4MQXD

Clc-ec1 fab complex cysless a399c-a432c mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter ClcA
publication title Conformational changes required for H(+)/Cl(-) exchange mediated by a CLC transporter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal transport, membrane protein
total genus 44
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mqxD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mqxD01
4JGMA 4ZQKB 4M5YH 3PWNA 4H0GA 4WW2C 5SWZD 5CD3B 1Y18A 3T0XA 3BKCL 4OV5A 3NIFE 3W0WA 3NZHL 4UAOB 3IKKA 3UJTL 4K07A 3HI6H 3K2UL 1G7PB 1FRGL 3MBEA 2AGJH 1BFTA 4Y5VB 2WBJD 4TN9A 3VFUA 4E0RA 2Z8WC 3QP3A 5JHLH 5FO7A 5C08B 3OXRA 4U6YB 4Y19D 5JNYA 1NANI 4M03A 2IQAA 4F2MB 1XH3B 3SDAA 4S1SL 5IM7A 5J13C 1Q1JH 2R2BA 5E4EB 4TPRH 1CI5A 5CEZE 2PYEE 4F37K 3D9AL 1KELH 1WLHA 4OCWH 4AM0A 3CFDB 2YA0A 3DMMC 4LMQI 1RFDL 2ZCHL 2DQIL 5HHOD 3WD5L 1XR9A 3MOAL 3AVEA 2UUDK 3S36H 2BZDA 1MIMH 3H7LA 4NOBA 4P5MB 4OZIE 4RX4A 1G84A 3PDOA 4TSAL 3VFTB 4R26L 3UJIL 2CRMA 4UOJA 5ICXA 3UTSE 1T22A 1UZ8B 1INDH 4NM4H 1X5KA 1XGUA 4HAGA 3GSVB 4PJ9B 4MJIA 4RIRB 5MEND 3E8UH 3QIUC 5DQJB 3VW3L 3TZVB 4Y4HD 2WK2A 3QXDA 3TP4A 1QSFA 3HI5H 1MAJA 2VB5A 4LLAA 3BJLA 2WIMA 5IEKA 4KRLB 1CYGA 1D9KA 3MV8E 4GRMB 1DBJH 5DK0A 2P44B 1LNUB 4HXAL 1XFPA 4XPFH 4JR9H 5IBUB 4JQXC 4KUZH 1CFVH 2WQ8A 4RAUA 2F54A 4LCWE 2IEPA 5EU7C 5GGVY 3MRDB 3P11L 3DXAB 5GSVA 4HIEB 3UC0H 1P69B 4H1LA 2IAND 2J7LA 5DSCB 3SY0B 3EHBD 1NCWL 4R90L 5CSGA 5DMIH 3BP4B 2FJFB 3H3BC 3B9KC 4PJHB 4XCYA 5SWSD 2R39A 4P3CH 2XNAB 1GZQA 5GSRB 4N90D 5I76A 3FQWB 2EE9A 1UM6L 1JHLH 3V6OA 3CLFH 3NCCB 1ZT1A 3UTTE 3A6BL 3VD7A 4LSTH 4RMTA 3EYFA 3VI4F 2J8UA 4LIQE 4M8VA 1HKFA 2VQ1A 4BJLA 2A0LC 3ALXA 1PSKL 4L3EE 3THMH 3P0YH 1JBJA 2NY1C 4C56B 4GAGL 4QOKA 4XNMA 2L0DA 2HTKC 3VFOB 5GGVH 4APQB 1X5HA 1A4KA 3BWUC 2DLGA 4X7DC 4XWGL 5GGTL 1JTPA 2J88H 4KJQD 1BJ1H 2I07A 5JXEA 4BSWA 5JOFA 4CADB 5IVOA 3NCMA 4KZEL 4J3OC 5GIRB 1T6WA 2RHEA 3O6FB 1BOGB 3EFFA 4YXLL 2F19H 4HIXH 1YDPB 1K4CA 4HH9A 3D39E 1QO3A 4QRRD 1F6FB 4OZHF 3LKOA 1CICA 4P2RA 2Q86B 4LEXL 3IXAB 4Z76A 2NZ9D 4NZUH 5E5RB 1FH5L 4N8PA 5IVXA 4LCYA 3F7VB 3QIBB 4MNGA 1BREA 1WZ1H 4XC3L 1QBBA 1IILE 4EDWH 3HHRB 1U8QA 3BP5B 1KN4L 2PXYD 2NY5C 4GSDH 2EIDA 4QHNB 4HF5L 1GGCL 5I6XB 2O61B 3JTSA 1GYAA 3PWLB 1JFQH 4P23C 3OMZA 5EZOL 2GY7B 5EUOF 5SWZB 4E9LA 5GRJL 3TBSB 5MP6H 4OIAA 2EECA 4WCYH 5FGRA 2Q7YB 3QCTH 5FECB 2ZOKB 3HZMB 4A6YH 1Y6MR 3EIFA 1I7UB 2ESVE 2XQBL 4D3CL 3L3KA 5FO9B 2WBJB 4BSVB 4MS8D 4DKEH 2C3WA 2R2EA 1NAMH 3LS4H 3P73B 4Y19B 3L3IB 4KZDH 3N1PC 5D2LB 4LPTA 1J12A 2KZWA 3ISWA 4NUJA 3FB7A 5AZEH 3WCYA 4DFHA 3LKSA 3OAZK 2B39A 1CXLA 1I1RA 1TQCC 3HB3C 2X4NA 1K8DA 2GJZB 3IJHA 4Y5XC 3TESA 3QI9D 4JPKH 3HE6D 1RK1A 3GSWA 5HGDB 3N50A 5HHOB 4HEME 3LKNA 2BSTB 4K9EC 4S1QL 4KXZH 5HHPB 1RULH 4TVPD 4QXGL 5HPMA 3MRPA 4GS7B 3EJZC 2EDNA 3F5WA 5JA8B 5GS0C 1LDPL 1S9WB 2CUMA 3NAAH 4K3DL 1T20B 2APBA 2VOTA 1DQML 5DJXA 3KS0J 2X40A 3BISA 1B4JH 1TFHA 4LVHC 3TVMC 3PL6D 5IHUH 4FABL 5MENB 4HV8B 2FX7L 4Y4HB 1JUFA 4OM1L 4JREC 4NJ9H 4QXTA 4JEGB 3LN4B 4XBEH 4X83A 3P9MA 4BH8A 2R4RH 4PLNC 2IG2L 3MNZB 1P9MA 4NQXB 1ZWIB 2AV1B 1LEIA 4TNVF 2ZUQB 2XTJE 4QHKJ 4WI4A 4ZFZA 2PR4H 3T0VA 4BUHA 5D7KD 1W0VB 2NLJA 4Y88A 2IANB 3MBED 2C26A 1AHWA 4XCCL 3U2SB 5SWSB 5GGSA 1OLLA 5CZXD 4OGYH 1ZLVK 4HT1L 4N68A 1NCCH 3TYFA 4XP5H 4GXVL 1NLDH 4I0PA 3R8QA 1KB9J 1ONQB 2Y07L 3TBWB 3O6ML 2VO5A 5I30L 1CDHA 1DQQB 4OZ4A 2QADD 3B6SA 4NRZB 2DQTL 5HVWA 5GJSL 3NIDF 5FUOH 3ZKSD 1IEBA 1CN4A 5C08E 4Y2OA 1SJHB 5D7IA 3C60A 1T83A 3C5JA 4PJ7A 4HS3A 3D48R 4RX4D 5DVOA 1AGDA 3H9SD 3ZDXE 4GRLA 2LU3A 3PV7A 1QFOA 4HUUB 1T0NA 1NPUA 1T7XA 1U6AH 3ZTNL 3KJ4B 4QRPB 2XZZA 4MJID 3V5DB 5ENWB 5BXFA 3CAFA 4UINH 1CF8L 2AXFA 1KENH 2H3NB 5HI3C 3B8SA 4K71B 1VCAA 4QRRB 1JPFA 4XGZA 4OF0A 4K7FB 4JHWL 1QFHA 3LN9A 4OD3H 5CIPH 3ZKXB 4OD2A 1D9KD 2VZTA 3OL2A 5C0JA 2SEBA 4F57L 5IK3B 2OCFD 5HBBA 4L8BB 1JYVA 1P4BH 1I3RA 3GJEA 5TE7L 1B0GA 1G9NC 2ZJSL 1XF5B 4PJIF 1FPTH 1JGEB 4L8CB 3U7WH 3A0OA 2VLJD 2PXYB 1LK2A 3S5LB 3GBMH 5I1KH 5HXMA 3TN0C 1HH9B 1SEBB 3Q6GL 2Q3ZA 5IW1A 3X3FH 5F9OL 1NEZG 3W2DH 5DFVC 2YPVL 1NUFA 1FFRA 2VISA 2FHFA 1FDLH 4HEPG 3A67H 3DXAE 4LCCC 3MFFA 3V5HB 4HCRL 2ZNXA 3RY4A 4MXVF 1KOAA 3MRKA 4HHAB 4RMVA 3V4VH 4IDJH 5IKCB 1U8IB 4MQ7B 3QHFL 1UB6A 2GAZA 4MQXD 4PJHE 4CDGC 4YFDB 2JE8A 3GNML 3O3EA 4QOKD 3WFDL 5A3IC 4NHCH 3F7QA 4IRJA 2BVQA 1I9EA 3QPXL 3ULSA 1WISA 2V5RA 5ITBH 4YC2B 2FJGB 3EW3B 4JHAL 4D8PA 4Q2ZB 5GGTA 2CDFA 4XAKD 1OP3K 3O8XD 3T4AB 5DVKA 4F3FA 1KCSH 5C7XL 1KJMB 3QI9B 5DJ8B 1JRHI 3HE6B 4NM8L 3ZZ1A 1MIEL 4U1MB 4JAMB 3QDJE 1HHGA 2OMBA 4C56E 2HVJA 3H3PH 1P84J 4XP4H 4XPBL 5C2BH 4YWGL 2R0WH 3V2AR 2DB8A 5BMFH 4GW5A 5EOQL 4OCSL 2GUOB 4UIMA 3WO4B 2R29H 1FLTX 1CICD 3MOBH 4P2RD 2CRYA 4FNLH 4FQLL 4FFYH 1KJVA 1RZIA 4PRIA 1DBKL 4C83A 5DK2B 2BOCA 2DLEA 2ZCKL 4WV1B 3PL6B 3C8DA 5CLWA 4U1JA 2EDOA 5F9WC 4NRYB 1I9JL 5FM8A 1OTUC 5DUMH 1X6NA 5GRVL 2ZSVB 4XP1L 1MRFH 3ULUL 2W0KA 3TBYA 1DEEB 2DKSA 4JM2F 4E5XA 4YK4B 3ME0A 4M5ZL 4N0CC 5T1LA 1UADC 1LP9A 3PWNB 1TIUA 4OV5B 2B2XH 3VJ6B 3N1FC 4YQXL 1M7IA 3CSYB 4UMGA 3FOLA 3DX8A 1TQBC 5J57B 5KS9F 1A2YB 4G8GA 1PD6A 1T0PB 4UV4H 3MBEB 3DROA 4X9BA 4S1DC 6FABH 4P59L 3AY4A 4E0RB 2GITA 5FO7B 4YAQA 3C2SA 3OXRB 1MCWW 1S7QB 5JNYB 2NW2A 1WTLA 2YPLA 4MNHA 3S97C 3RZCA 5SWZE 2IQAB 4QXWA 3SKMA 5BO1H 3SDAB 5E99L 2AJSH 1DVFD 1DN0B 2IBGA 1JL8A 4NKIH 2R2BB 3K8MA 3HR5B 2XQYK 4N5UA 1UCTA 2QADB 1LO2L 4AM0B 4XNXL 3WSQH 4U1NA 4GMSL 1J88A 3ZDYE 1N59B 4FQ2H 4Y19E 4GLRH 1XR9B 4B41A 5D2LE 1BOYA 4Z7UA 3QZWG 3HZKA 4KRNA 3SDXF 3ZKMC 1F6AA 1H5BA 3PWPD 3L9RA 3PDOB 1WBXB 5C07D 2XYCA 1PYWA 3SDYH 4GKSA 4LQFL 3H8NA 5ICXB 4PJGA 1T22B 3CX5K 3IVKB 1KBGL 4MJIB 3VCLA 1KULA 2Y6SD 3VXNA 5LG1A 4NBZB 3I2CL 5HHOE 4UNVA 4TUJB 4GBXC 5T1KA 3STBA 2N7AA 1G7LB 5KTEH 3QXDB 4XNZB 3VDAA 1HQRA 5IEKB 5ADPH 4FQHA 1D9KB 1SHMA 3BOVA 4IS6A 2ZUXA 3FN0H 4G6KL 5DK0B 1EPFA 4Y16A 3SOBL 2CUIA 1PG7H 4HJ0C 2G75B 1A7NH 3TYGH 5I8EA 1MFDH 4RAUB 1H3VA 3ZO0A 2JKXA 2XV6B 2DI9A 3Q2CA 5MENE 1MCDA 1IKFL 1XCTB 4JZJA 5CAYB 4H1LB 3G6AA 4M5YL 4D94A 2EYTB 5IB5A 4KVNH 4B5EA 5E1HB 1KJ2H 4XB7A 3AU1A 3VXPA 4XCYB 3F7RA 4GT7A 4HWEH 1GZQB 12E8H 5I76B 3HI6L 4L4JA 4YBLC 4XTRD 2XFXA 1REIA 4KI5D 5DUPH 4IIQC 1ZT1B 3GBLA 2F5AH 5TJWK 2AGJL 2WINA 1IJ9A 4I0PD 3EYFB 5JHLL 4HMEA 3NCYS 5IMKA 2J8UB 4OZFH 2DM3A 4FMFA 1L7IH 2IANE 2HT2D 2VQ1B 1FG2A 5GZOD 5ISZA 5D1XA 5SWSE 3D25A 5CP3H 1Q1JL 4KKLC 4QOKB 4GOSA 4N90E 4TPRL 2AVGA 3QJHA 3C60D 1KELL 5IP4A 1A4KB 4OCWL 1YPZA 1LGVA 1WBZB 2BHZA 5HYIA 2PW1A 3WNPA 2X09A 1TDQA 2I07B 3O8XB 5JOFB 3S36L 4LRNH 4GXUM 4LGSB 1MIML 3ETBF 1CFNA 1SJEA 5TE4H 5A2IH 1PX3A 4X7TB 3ZE2E 3UPRA 3PJSB 5I71C 1G6VK 3HUJB 4J23A 5D5MA 3MLUH 1XF3A 4HH9B 4IEFB 4P5KA 1A6VH 5F96H 1J8HA 1QO3B 3MNWA 1INDL 4NM4L 4EOWH 5MI0C 5DLMH 4AH2B 2N1KA 4XMPH 3VA6A 4KTEH 1CICB 4P2RB 3E8UL 1YN6A 4F7PA 4Z76B 2NY6C 2X1PA 3HI5L 2D31B 5IVXB 4LCYB 1JPGA 4QRPE 2GHWB 5HTSA 3TH3T 4L4VA 4GQ9H 1CLCA 1DBJL 3C9NB 4HIIA 5IGXH 2Z92A 4Q9CA 4JR9L 3V6OC 4QRRE 4KUZL 1CFVL 2FNBA 3BEWB 1M4KA 4PD4J 1SVCP 2R9HC 5EU6A 3UC0L 2F8VA 3BPOC 3O41A 4NO2A 2H8PA 4JFZH 5DMIL 2XQYG 2E7BA 3RVUD 3IKCA 1Z3GH 4HCRA 1V3JA 4P3CL 1SYVA 2IMNA 3KYNA 2YOCA 3OKOA 4RFEA 4WGWB 2P43B 3X13A 1T0MA 1S9VA 3VXSA 1JHLL 3CLFL 3ZT7A 4PTTA 4YHYC 3AM8C 4LSTL 4IRJD 4KWUA 5EZIH 1TJHH 3FB7B 3KG5A 3FAXA 1RJYA 1U0QA 3VXUA 1DVFB 1OB1A 5I1HH 3THML 2BHYA 3P0GB 3P0YL 4MD5B 3IDGA 3QNZA 1K8DB 4KRPD 2XRAH 4U1SA 1MLBA 3HCVA 5GGVL 3O45B 3LVEA 2IFFH 2ERJB 4K23H 1WFNA 1S78D 2AEWA 3LKNB 2UVEA 3MX0A 2J88L 2FATH 3TH4T 5HPMB 2DQFA 3K4ZA 3MRPB 5J6HA 3F5WB 5C9JA 3QQ4B 3FTGB 3PWPB 5C07B 1NGYA 1CFQA 2F19L 4HIXL 3IDIA 4QHKI 5DJXB 2AJUH 3MLXH 1RMFH 4PRID 3CFBA 4TTDC 3VWKC 4BQ6A 2YZ1A 4U0QB 4FQQA 5DDHB 2VDOH 3WFBH 5HDBE 4XHQA 4TVPE 4QXTB 1UVQA 1JHKH 4NZUL 3EJJX 1U8NA 5JR1H 2FHCA 3P9MB 4BH8B 3TIDA 1WZ1L 1UQSA 4JPWH 3TO2A 4EDWL 2A74A 3JZ7A 4U4BA 1R3JA 3PXJA 4GSDL 1LEIB 3SKOA 2L7UA 3GRWH 3N9GH 5I19H 1JFQL 1RU9H 4ZFZB 3FN9A 1PEZA 3E6HA 1Q94B 2NLJB 4OUUA 3QWRA 3VXMA 5MP6L 4PLOB 4IMKA 4I8DA 2EICA 1GOGA 4WCYL 4JRYD 5GGSB 5I1CH 1XGTA 4BQCA 3QCTL 2A83B 2YPLD 3TYFB 1T04A 4A6YL 5C9KA 4Y4KA 5TFSH 5EZJA 3FFCD 4ELKA 5FV1L 1G0XA 4I0PB 1BZ7A 4DKEL 3FZUC 3WLBA 1NAML 2WWMD 3LS4L 3ZT6A 5C0RH 3ARDA 4KZDL 5D7KE 3GJFA 4OZ4B 1QSEA 4OFVA 3B6SB 5AZEL 3GKWH 1IEBB 5FYLH 3RY5A 1OW0A 1FVCA 4Y5YC 3F65A 3C60B 5D7IB 4YDLB 2DL2A 3C5JB 2V5TA 5IHZA 4Z77A 1LO3H 4RBPK 1FFQA 3WNMA 3T2QA 4JPKL 1YMHA 5ESAA 2PW2A 1NGWA 5SX4I 4F9LC 1UJ3C 4UUJB 3V5KA 1RULL 1T0NB 3B9EA 3NAAL 2UVFA 2Q6WA 1YY9C 1VPOH 1ZOXA 3G6DH 5MERA 5T1KD 1WAAF 1U93A 4OQ1A 1VSCA 1A8JH 2AXFB 4POZD 5CGYD 1P9MC 4I18B 1B4JL 4XGZB 4H0HB 4P5TA 4OD2B 5IHUL 3ZDZE 3G9VA 3IDYC 4IRSC 1VEMA 4NJ9L 4GKOA 4WW2F 4XBEL 4PJ8A 4MJIE 4NT6A 1AHWC 1I3RB 1B0GB 2R4RL 4IRZH 1LD9A 2Y5EA 3BJ91 4X9HA 4B53A 3ZSSA 1QSFE 5JW4R 4JFQA 1GOFA 4CDHA 4F8TA 2PR4L 5E7BA 3QULA 1QKZH 2VISB 3GGWA 2X05A 1E28A 4V2BA 1SMAA 3SPVA 3MFFB 3IDJA 1RURH 4OGYL 1NCCL 1JCKA 4JDZA 4XP5L 3MRKB 2YR3A 2F8OA 1NLDL 1Q38A 2GAZB 1QZ1A 5LVEA 4I3GA 4EQ2A 4GRLC 4U7MA 4IRJB 3REVA 4I3RH 3OKMB 3I6KA 1E6OH 2HMID 4D8PB 5FUOL 5A2FA 5E24E 3EOBA 2J8UE 4KRPB 5JDSB 4F3FB 3PNWB 4IMLA 4WGVB 4P4KD 2AW2A 4N9GB 5HPOA 1J0KA 4EJ1C 1HCVA 4Z95H 2DKMA 3MLVH 1HHGB 2HVJB 5B38B 4AYFA 1KJ3H 4QOKE 1X5ZA 2P8MA 4QNPE 2Y9RT 3K46A 1IBGH 3AS1A 3KR3H 5FHBH 5JIPA 4G6FD 3U4AA 2Y25A 4O02H 5TH2B 2IAMD 3ARGC 4XAKE 2OMNA 4UINL 1KJVB 1RZIB 1KENL 2WWKT 4PRIB 2BSRA 4ZMAT 5F3BB 3P77B 3VGAB 1PZUB 1P1ZB 5TDOA 4L4VD 3HZYA 4OD3L 3T0WA 1NJ9A 1A9EA 3HUJE 3JWDH 3UTQB 1I1YA 1NBZB 2GEEA 4ZYKA 4CW1A 1IT9H 2F53A 1W2KT 3DX6A 4Z7VF 3TBYB 4E5XB 1P4BL 2X4OA 4JFFA 1T7ZA 4P2RE 1L9MA 1N0XH 5CZVH 1FPTL 4ZUUA 1LP9B 3ZHDA 3U7WL 3GI8H 3GSQA 5IVXE 3FOLB 3DX8B 1B0RB 3GBML 5I1KL 4OZGA 1I8KA 1H15B 3X3FL 5DTFA 3W2DL 4MLIA 5F7MC 1WFOA 2GITB 4JRYB 3QRGH 2FYYB 1KPUA 5MEOA 1FDLL 2C3GA 2NW2B 2VDPH 3A67L 2H45A 2YPLB 4MNHB 5L88H 3RZCB 3FB5A 1LO5A 3LKRA 3SKMB 1FZKA 3RVXC 3VXUD 3V4VL 4IDJL 3MBXH 4OT1H 5LXGH 1S5HA 4NHCL 3K2MC 5ITBL 4U1NB 5JW3H 5HYJD 1YMMA 5E8DH 3UYPA 3O81A 1GPOH 2FRGP 3NPZB 1V05A 2YPKA 1J0HA 2BXYA 2DQGH 4LAJH 3X12A 4PJCB 1KCSL 1KEMH 1U2CA 2W0LA 3HZKB 3VFVA 2NCMA 3FRPG 1H5BB 1KPRA 2V6HA 5ERWA 5DRZA 1IKNC 1MAMH 3L3HA 4KK8D 1PYWB 4XP4L 3WJLC 1KB9K 5C2BL 2R0WL 4PJGB 5ICZA 5BMFL 5BJTA 1QSVA 1TVDA 3CSPA 2ATPA 3VCLB 4WWKC 1S9YB 3BO8A 3VXNB 2P45B 2R29L 5T1KB 1HXYA 2UY7A 3MOBL 4FNLL 4TSCH 4XC1L 3MNVB 3ARQA 4FFYL 2EO1A 5EBWA 4WIQA 3ZKQD 3U4EA 3ULUD 5GS2H 3PWPE 2IF7A 4LLQA 4FQHB 5BZDA 2NYYC 4IS6B 4IHOA 4OKVA 5C07E 2FLRT 4GXUN 5DUML 2DIBA 3VRLF 4CU6A 3CFEA 1BVKA 2X4PA 3CC5A 2NY3D 3N1GC 2X44D 4PY8J 2Z93A 1Q9KA 3AY4C 3WUWG 1NLBH 3G6AB 3L7FB 4F9PA 4Z7WA 5IVZA 3QWRD 4FG6D 2DMKA 3VA2C 2B2XL 3TNNA 3VXPB 5F1OB 2GIYA 4HC1H 4NCC1 2NY2C 2GJ6A 4KDTC 4NC0B 3TO4A 4GMTH 2E7HA 3D87B 2XFXB 3CH8A 5HGHA 4UV4L 4Y4KD 3MQIA 3RX5A 2J12B 6FABL 1CD9B 1G7HA 1NAMA 5E9DA 2JCCA 1CLYL 3WDHA 1NFIB 4EZMA 1BWMA 2DJ4A 2ILLA 5BO1L 3IFNH 3U79A 1FG2B 2AJSL 3PUCA 3D2UA 4IOSD 5D1XB 3N1QC 3D25B 4NKIL 2NXZC 4KKBD 5EOCJ 4QF1A 3QJHB 4KI5E 5EOTA 1YPZB 5E70A 4YGAB 3KPNA 3WSQL 2Z35A 4YLQT 2PW1B 4D9LH 1R5WA 4FQ2L 3QIWA 4R0LC 5F71A 4U1IA 4P4KB 4V1DD 5EORH 4XPAH 4XVTH 3V6ZB 1SJEB 4BSJA 4JFXB 3UPRB 5F7NC 5DEGA 3G9AB 1TETH 1M05A 1NCBL 2A6KA 3MA7A 2B4CC 4G5ZH 4ZFGH 3SDYL 1PY4A 1B3JA 4Y16C 3EDJA 5D7IE 3MNWB 4PJ7E 4G6FB 4P5TD 1AGBA 3M07A 1MY7A 4ZOBA 4F7PB 5F7EH 4JZJC 3WHXB 5KTEL 1BMGA 3OSKA 5K33A 3I75B 4JGJA 3FONB 3LHPH 4KJWC 4L4VB 4N1EA 5ADPL 5IQ7H 3FN0L 2OI9B 4TVSa 1P84K 4U1KB 3MRRA 1PG7L 1F3JB 2VWEE 1L7TH 3TYGL 1SM3H 1MFDL 4K94C 3C6SB 4U1GC 4MD4A 3GMRA 3QYCA 2DQEH 2VDQH 1HSBB 1YEIH 3O41B 4NO2B 5FYKH 4KVNL 2H8PB 4O4YH 1KJ2L 3BGFB 4PB0H 4PRAB 3IKCB 1SYVB 2ADIA 3KYNB 3OKOB 4HWEL 4TNWF 12E8L 4XP9H 3X13B 1T0MB 1S9VB 4OGAD 3VXSB 1TJGH 5DUPL 3SE3A 2F5AL 3E2HC 5FGSA 4JFDA 3VD3A 2ICES 1T1WA 2UWEA 5AAMA 4U3HA 5DYOA 3D18B 1L7IL 3NFPA 1RJYB 1UH3A 3VXUB 3RTQA 5ALCH 4YO0A 1OB1B 4ZFFA 4XAWH 3IDGB 5EO0A 4LPVA 3QNZB 4G8EA 1IC4H 4U1SB 1MLBB 3HCVB 4BQBA 3UMTA 5HYJB 2W9EH 3SQOH 3F58H 5DJZB 4MZ3A 1AGFA 1CLOH 3BRGC 4XBGB 2DQFB 3EKCA 1HYSD 5J6HB 5KSBA 4LRNL 5C9JB 3DUUA 1S3KH 2R4SH 1MSPA 2L4OA 3SE8H 5TE4L 1NGYB 1CFQB 1HE7A 3OKDB 1QYGH 3IDIB 1T66D 3MLUL 3CFBB 1OAZH 5F96L 1A6VL 4EOWL 1HKLH 5CIPA 5DLML 3VI3F 4XMPL 1F90H 4KTEL 3ULVF 1UVQB 1U8NB 3QXTA 4O2FB 4FFWD 1GH7A 3L5JA 4BQ8A 6CGTA 2F53D 1RZJC 4NKMB 4EIZC 3TIDB 4N1HB 4JFFD 4GQ9L 4W70A 3GO1H 3S35X 4NP4H 3TO2B 3U30B 1ZTXH 2A74B 4S0TD 3BD5A 1OQOA 4PRIE 4R3SA 5IGXL 1R3JB 2NY3B 3SKOB 1N2RA 4PGBA 2D03L 2L7JA 2WIIA 5D4QA 4H88H 2W92A 5F88A 1V8HA 1HDMA 3E6HB 2H2SC 4BZYA 3JBG7 4QCIA 4J3SA 4LSSH 1CCZA 5DS8A 1CQYA 2EO9A 4JFZL 4JHBA 4XI5D 4LSRH 4OLZH 4CNIA 1Z3GL 3BD4A 4HAFA 3J8F7 4M62H 1LP9E 4Y4KB 4C59B 4ELKB 1BZ7B 3WLBB 2X4SA 4FQXC 3DRTB 5B22A 5MEPA 5EZIL 1X4YA 1TJHL 3TNMA 1YMMD 5FKPA 4JRYE 5I1HL 4HPOH 5CJOH 1FVCB 5CINH 1RUAH 2YPLE 2MMXA 2XRAL 3WS6C 4Z77B 1PKOA 4MQTB 3RVVC 1YMHB 1XF2A 4F58H 2BVOB 4RSVA 2IFFL 4R2GD 4K23L 1NGWB 1DQJB 2DBJA 2XICA 2XN9A 3ARBD 3V5KB 4V1DB 4JQVC 2FATL 3IRZA 1R5VA 4QEGA 2Q7NA 2Q6WB 1U3ZA 3FFDA 5MERB 4ISVA 4Y0GA 1U93B 4XMKH 1MJJA 4PJCE 2AJUL 2R1XA 3MLXL 1RMFL 4PGDA 1MREH 3LIZH 4PB9H 4A2MA 4P5TB 2YZ8A 5I9QB 4XH2A 5C8JA 2VDOL 3DOSA 3WFBL 4GKZA 1Z9MA 5J3HC 5IMLA 2PF6A 4PJGE 4RA0C 1JHKL 3GUTA 4NZTH 5JR1L 5E4IA 1MLCB 1F3DH 3MZGB 4NT6B 2VLMD 5BZWA 1LE9A 1DE4A 1FNGB 1LD9B 4JPWL 2EIZA 5GS3A 4R97C 4JFQB 2IC2A 3N9GL 4N5EC 3IJSA 2GJ6D 1P7HL 1HYSC 5I19L 4FQPA 3GSOB 3UPAA 1RU9L 3ZE0E 3ARDC 5KSUA 3T1WA 3G5XA 4KUCF 5E94A 3QULB 4F7MA 3PWUA 1FIEA 3IU4H 3GGWB 5E9DD 2PNDA 1E28B 5I1CL 3VFMA 1I7TB 3IDJB 2APWA 4MCYA 3HPJB 4JDZB 3H9HB 3P9LA 5TFSL 1M7DA 4DUWA 1DLHA 1UEMA 2X6MA 2W07A 3RHWK 2F9BT 2FEDC 1LILA 4PD4K 3REVB 5C0RL 5JO5A 5D1QA 3I6KB 3GKWL 1VFOA 5J6GB 2NQCA 1KB5H 4CGTA 5FYLL 3GMPB 1UH4A 5E5MB 1RIHH 4JKLA 1LO3L 2QSQA 4Q9QH 5F6IB 1BBDH 2K9UA 4L9LC 3O3UN 3DV4A 3TJHD 2IBBA 2JJSA 1YPZE 1A9BA 4PJ8C 3TV3H 1VPOL 3G6DL 5C0AD 4HX1B 2EC9T 4P2OC 2BSRB 4JN1H 3RHWF 4PJEF 5FK9A 5AD0A 4ZOAA 5TDOB 1ZVSA 3HZYB 3QAZB 1NJ9B 2AABH 1A9EB 1CGVA 5HGGS 1GJIA 4RZCA 4CUCA 4ZYKB 5KN5A 5DGRA 1C08A 1KCVH 2QQQA 5E6ID 4CW1B 2F53B 3DX6B 4MXWH 2X4OB 4JFFB 4WO4C 3GZKA 4HFWA 2A6DA 3HZVA 4HD9A 3RKDD 4ZUUB 4IRZL 3ARSA 4NWTL 4XVUC 5I75C 2O5YH 3BPLC 3KPOA 4L1HA 4OJFH 4L4VE 2LE9A 3WNLA 4N0RA 3E3QC 1WEJH 4LFHD 1TMCB 3GMOA 5D96B 3NIGF 1YEFH 1J1PH 3VXQB 1QKZL 4JFDD 2I5YH 4OZFA 5TE6H 3DURA 5MEOB 3IAQA 1WTGT 1DUZA 2Q1EA 1P7QA 1RURL 1LO5B 2OZ4H 2EXWD 4CN4A 1L4IA 4PJAB 1E4XI 1FNLA 5I74C 2AJZA 4O2CA 1JP5A 1YQVH 2FO1A 1S5HB 4NDMB 4RGMC 1PAMA 3VXSE 4I3RL 1CQKA 1MCRA 1YMMB 1E6OL 5IR1A 5ESQB 4PJFF 2VAAA 3X12B 1V7MH 1OL0A 2R15A 2GKIA 4OZHA 5JXAH 3OB8A 3VXUE 5ERWB 4Z95L 5DRZB 3L3HB 4Y4FD 4R2GB 3MLVL 4PY8I 4Z5RA 2NY5H 2EYRB 5ANMA 1KJ3L 3ARBB 1IBGL 5BJTB 4DN4H 3KR3L 1HCFX 5FHBL 3BO8B 5TGBA 2NNAB 4O02L 3BMVA 1HXYB 3UBXG 4WEBH 5EBWB 4RISH 3U4EB 2ORBH 4LLQB 5BZDB 4WWID 5EUOA 4IHOB 1E4KA 1YNTA 4OSUH 2RFXA 3JWDL 5D8JH 1R3LA 1BVKB 3CFEB 2X4PB 1LO4H 3FKUS 5L8LB 2Z93B 3HNVH 1IT9L 5FXCH 1QBMH 4TQEH 5EFIA 3Q6FA 1QHOA 4XWOD 4J3VA 4WHCA 1N0XL 5CZVL 1T7YA 3RL1A 4Z78A 1RUPH 3DVNB 4HS6A 3GI8L 4Z7WB 2N56A 3FCTA 5IVZB 3ULUE 3TNNB 4KDVA 1C7TA 2MHAA 3MLTB 4ZUVA 2GJ6B 2P5WD 3ARFD 4RRPA 4LVNB 3EYVA 3AGVA 5JIIA 4A6YB 1RUQH 3K81A 2IADA 2XOTA 2JJUA 3GHEH 1J11A 1VEOA 1G7HB 1NAMB 4K9EH 1ZGLA 1YECL 2ICWB 5E9DB 4DKFH 3QRGL 1L6ZA 2JCCB 4IJ3C 2C4XA 3IT8D 4P3DA 4MS8C 5FHAH 5GS0H 2VDPL 1A7OL 5L88L 1EEYA 4HJGA 4JY5H 5F7DA 2XXMB 3EO0A 4YFLI 3VE0B 1OP5H 3UPCA 1J5OH 4M7ZC 3TWCH 3AREA 4XT1C 1FL5A 3MBXL 2I9LA 1WICA 2VE6B 3KWWA 3MRCA 4OT1L 4QF1B 5H94B 5LXGL 5EOTB 1LE5A 5EWIH 1F4WH 4D9QD 2IWGA 4FXGA 3KPNB 2Z35B 4P46A 5E8DL 1GPOL 1BVZA 1ND0A 2DQGL 3DYPA 2VDRH 3OAYK 5CUSH 3QIWB 4Y8AA 3C5SB 3VXTA 1FFPA 4PS4H 5E6ZA 3VH8G 1A7PH 3I6LD 1KEML 2IALA 5EB9A 3L3OA 3QO1A 1M05B 1MAML 2A6KB 5J89A 3MA7B 3TFKD 4PJ5A 1FL6A 4OUOA 1X6LA 4I77H 1CDGA 4X7CC 1AGBB 3QUZC 3U46B 3MLRH 3K1DA 1FZOA 5C0AB 3WIFA 1LO0H 4KY1L 4TSCL 4V1DE 3FQRA 5MHSD 4HKZA 4F9PC 2V2TA 2FJHB 2P8PA 4WUUA 5HVGB 2MFNA 1P4LA 3CDFA 3CXDH 3MRRB 3T09A 4CMHB 3TO4C 3MUY1 4RAHA 3MJ6A 5E6IB 4AIXA 2X1XR 5DF0A 4MD4B 1BX2A 3GMRB 1UENA 3MRHA 2GSGA 1TVBA 1JMZA 1K3ZA 4NO0A 2CK2A 3RDTA 5ID0B 1AFVL 1FZMA 4ZPVA 4JG1H 4L3AA 4HC1L 2VUOA 2G5RA 2WZPD 4GMTL 3GSUA 1F3RB 1MJ8H 2DBLH 4J7RA 4POYA 4JFDB 4K7PH 3KPLA 1VESA 5M94B 3MREB 5I8CA 1KG0A 4F33B 2UWEB 2XZAH 3QIWC 5E2VH 2HTLC 3NFPB 3QQ3A 1S7TA 4FQCH 4P2CG 4FS0A 4HGWB 3IFNL 4YO0B 2UYLA 1ZHBB 3FB6B 5EO0B 4ZO9A 4UV7H 5DJAA 4ENEC 4YHPA 2EYSB 1WT5A 2MPAH 4D9LL 3S7GA 1AGFB 3E3QE 1U8LA 2WUCH 2EEAA 1AD9B 3HPLA 3K80A 3OHXB 4GG6B 5EORL 4ETYA 3CVIH 1G9NH 4XPAL 3DUUB 2ENSA 4XVTL 1II4E 4Y4FB 1FYTD 2BVPA 1TETL 2PN5A 4G5ZL 4ZFGL 2X4UB 2P5EA 3HI1A 1KIPA 5I73C 5KW9H 5T5NF 1QVOA 1GGTA 4PJIA 1LK3H 5DVMA 5CIPB 4LDLB 3DRQA 3HAEG 3BHBA 1AGCA 5F7EL 5JUEH 2X9WA 5KVEH 1JF1A 3LHPL 2HFGH 2WQRA 5J06A 5IQ7L 1UM5H 4LBEA 3RBSA 4ELMA 4NKQB 2YA1A 2VQTA 4LHUA 3BP6A 4R3SB 1FYHB 1L7TL 1U3HA 1G9EA 1SM3L 1N2RB 5C0BD 4U6XA 2DQEL 2VDQL 2BSSA 1CFTA 1HDMB 3O2WH 3OKEA 5BS0A 3NGBC 5F1SA 4QCIB 1A3QA 1YEIL 4HZAA 5FYKL 2VAJA 4O4YL 1FL3A 2F53E 3RTQC 4PB0L 3ARFB 3BGAA 4AENA 4JFFE 5I1JH 3HE7A 3Q5TA 2AKRA 4XP9L 3C6LC 1TJGL 2Q20A 2V7NA 3P4MA 2X4SB 3VWJA 3M45A 5MEPB 2DQJH 5DMYA 5L2KA 3TNMB 1RV6X 4MA1C 5ALCL 5FKPB 3PGFH 2VITA 4XAWL 4U2ZA 4LP5A 3S4SA 1DSFH 1GOHA 4PJAE 4U31A 2W9EL 4PRDA 3F58L 4OLVH 5K9QI 1MFCH 1CLOL 3GMMA 1R5VB 5KSAD 3B9VA 1S3KL 2R4SL 3NA9H 1YMME 1ZLUH 3FFDB 3SE8L 1DQLH 4ISVB 5TQ2H 2C1OA 1QYGL 5IB4A 4WEMB 3BXNA 4NYLB 4JM2A 1OAZL 7CGTA 1AR1D 1HKLL 1K5NA 4XH2B 2FWOA 2G9HA 5CLTA 5C8JB 1I4FA 3KYMB 5IV2A 1F90L 2H32H 4GKZB 5F70A 2HFFB 4PUBH 4KU1A 5FA3A 3GUTB 3KVQA 5KS9A 3NPSC 5T3XH 5BZWB 4OIBA 1I3GH 5SX5H 1N26A 5CSBA 4OFKA 3GO1L 5LWYH 1RPQA 4NP4L 3U0TA 5K9JH 1GSMA 5T5NG 3P4OA 5EIIA 4WRLA 1TVHA 1UM4H 2YWYA 4PGEA 4KMTH 3QJFB 3ALWA 4H88L 3CMGA 4YZFF 1JF6A 3QB7C 4WDIA 5KSUB 3IU3B 3G5XB 4HFUH 3F7YA 4LSSL 5E94B 2KPNA 5I66B 5ADOH 2VLME 1IGFH 3QQ9D 4KGLA 4G9DB 4LSRL 4OLZL 4MCYB 4M62L 4WI6A 4Z7WE 3P9LB 1TCMA 3G04A 1M7DB 2H1PH 2KQMA 1RZ8A 2B5IC 2GJ6E 2P7TB 3QDAA 3SDXA 3BWAA 2E8ZA 3DBXA 2BRQA 3MJ9H 2VDNH 5TDNA 1JI1A 4NQCD 5E9DE 4P46D 2JCCE 4HPOL 5CJOL 1MCNA 5LGKA 5CINL 1RUAL 3DUHA 4PRNA 4YFLF 2YD5A 2ZNWA 4UTBH 4LF3A 3U36A 4KV5E 4F58L 1NFDB 8FABA 3DV4B 3WJJA 4F15B 1OSZA 4X6FB 4Y1AA 1A9BB 5I18H 1MUJA 2MQ3A 5ESVA 4CL7A 1E4JA 5CZKA 1QFWI 3NCFB 1XGRA 1MREL 2VR5A 2AXGB 3EDDA 3LIZL 3GSNA 4PB9L 5AD0B 1JZ8A 5GHWH 2E3VA 2NY0C 1J05A 5FEBA 2B7DT 5KN5B 1C08B 3IS0X 4NZTL 4X4ZA 1F5WA 1W8NA 2D0FA 4MMXC 4P0DA 4HFWB 5C0AE 1A6PA 2A6DB 1FNHA 1NKOA 1QEWA 3HZVB 5B3JF 2E7LC 1JWUB 2OX5A 1AQKH 2VLRD 3ZLQC 3AMKA 2C3VA 1KJ2B 2YD4A 4NO0D 3LEXA 3KPOB 4HC1A 5C0BB 4FP8H 5IW6A 3R0NA 2GT9B 4H8WC 4ORZC 1MEXH 5GS1A 3A6OA 4PRPA 3M17A 2X10A 3GMOB 3RAJH 4MCZA 4Q6IC 5D1QC 4WI3A 3QEHA 5EU5B 3IU4L 4OZFB 3DURB 5DD3H 1JN6B 1MVUA 3QXAB 1WCBA 1ODAA 1DUZB 3OX8A 4YDKH 4JCLA 2YN3A 5FYLD 2AJZB 4O2CB 1GXEA 1GIGH 4GAYA 4YHLH 5IG7B 3HFMH 1CE1H 2WLZA 2W1NA 2JJSC 1V7NL 4LLYA 3SKNA 2W60B 4QRTA 5IR1B 4LPCA 4JFDE 1KB5L 3FO2B 1F4XH 2UWEE 3BQUA 3LPGA 3QO0A 4PJBF 1JWSA 4OZHB 1GL4B 4U33A 1XR8A 3R1GH 5C6TH 1RIHL 4B7LA 1NGQH 4Q9QL 3OR7A 4YBQC 1BBDL 4PJXB 5GZND 4Z5RB 3CUPA 3OJVC 4FXKA 4M3KB 4PBXA 5D93C 1TZGH 2VC2H 2D9CA 1LHZA 5TGBB 1VFMA 3TV3L 2A6IA 3BZ4A 5HY9A 3T3PE 5C70A 4OI7A 2X1QA 3QFJA 4GG6E 3PGCA 4JN1L 4TUOA 4O9HH 3KPRA 5EUOB 2AABL 5IOPA 1YNTB 3O3BA 4LGPB 5D7JC 4BK4A 2DYPA 1G7JA 2P47B 4LHUD 1R3LB 3B2UD 3MGTB 1U3HD 3P30H 2DI7A 1KCVL 4KK5D 4M93B 4DZ8A 3L3JA 4MXWL 1ORQA 1SEQH 5EFIB 1I8LA 3MGOB 5E0QA 1HQ4A 4NBXB 3BSZH 5DJYA 4HUNB 1Q0YH 3RL1B 5C3TA 4Z78B 5J0BA 2OBGA 4HS6B 2HYMA 1BFOA 2O5YL 2DL9A 2MHAB 4ZUVB 3EYVB 3HE7D 4ZXBA 3STZA 4LEOB 2IADB 1WEJL 1WK0A 2RCSH 1FZJA 1NMBH 4J4PA 4PP2B 3C8KB 1YEFL 1ZGLB 5B39G 1N6UA 1J1PL 2A9MH 4EI5D 4QTHA 4P3DB 2I5YL 5TE6L 2Y7QB 3CDYA 4E42B 3VWJD 4KQ4H 4HS8H 4TUKH 1EEYB 5EIVA 2OZ4L 5L2KD 1F4AA 4HJGB 3EO0B 4NJAH 5J7CC 1FFNA 3R0MA 3DIFB 1FL5B 4H26A 2I9LB 1J7VR 1YQVL 3KWWB 4ZFOL 2ZOLA 2ZUWA 4U6HA 3C09B 4FXGB 4JANA 2WUBH 4NQCB 5E7FA 5CILH 5C0NC 1UJTA 4P46B 4JGUA 1AJ7H 5CSZA 1ND0B 1GCFA 5CJ5A 1DANU 3NZ8A 3HNTH 2OM5A 1V7ML 1FFPB 4PY7A 2WP3T 3VXTB 3V6BR 4YR6A 5JXAL 2IALB 2R8SH 3QO1B 1VFUA 3QPQD 1FV1A 2NY5L 1E4KC 3MTRA 2YSSA 4MLSA 4D9QE 4JM2D 4HWZB 4DN4L 2OLDA 4PLKD 1FZOB 3I3BA 3T0BA 3WIFB 4WEBL 2QSTA 2XN9E 3KLHD 1PJ9A 3RP1A 4RISL 3I6LE 5I17A 4HKZB 1DCLA 2ORBL 3MCKA 2P8PB 4WUUB 5IW3A 3C08H 1P4LB 2M2DA 1ZV5A 3UZQA 3HMWH 4OSUL 2DLHA 5D8JL 4LCUA 5JOEA 1LO4L 3EOAA 1ZANH 4NQEA 1S9XB 2KH2B 3HNVL 5DZNA 1QBML 4TQEL 2BCKB 2GSGB 1TVBB 2VLRB 3MRHB 5DK3A 1RY7B 1K2DB 1RUPL 4NO0B 4P2YA 1FZMB 4JKMA 4CVZB 4ZPVB 3MLZH 3MO1A 1Z2KA 4KK6C 3AREC 1RUQL 3GSUB 5EU4B 3O0RH 4AMKH 1G1YA 3GHEL 2CLRA 4I2XA 5KAQF 5IEHA 4K9EL 1T1YA 4NSKB 1W0WA 3KPLB 4DKFL 3O3AA 5I8CB 1KG0B 3WFZA 5FHAL 5GS0L 5GGQH 3RX8A 5HHNA 3QQ3B 1X4ZA 5IFJA 1S7TB 1PX4A 3QHZH 1Q0XH 1P5VA 1YY8A 5LGHH 1J5OL 2CO7B 1YEHH 1Q8MA 3TWCL 3BKCH 4XXCA 3RVTD 4NQSA 5DJAB 5EWIL 1F4WL 1CG9B 4AEFA 1F11A 1YZZA 2WP3O 1WAAA 4YHPB 2Z91A 1JGUH 3WO3B 3MGAA 4M8QA 5JTWA 2VDRL 5CUSL 3HPLB 1T7WA 2CDEA 4PS4L 5HYFA 1A7PL 5K9OA 4EVNA 4M9PA 2BVPB 4WW2A 4QY8A 1JZ2A 2P5EB 2VN7A 1KIPB 1QVOB 4I77L 4IDLA 4PJIB 5GS2D 1A0QH 5DMGD 1RJCA 5SV3A 1WF5A 3MLRL 4XCEA 3DRQB 1OAXH 5IBLC 1NFDE 1AGEA 1LO0L 1AGCB 2VSCA 1TPXC 4WFHD 1JF1B 3WD5H 3RDTC 4AEHH 2XY2A 1IEAB 3CXDL 3Q5YA 3BP6B 1JF5A 4LHUB 1WZLA 4X0KB 1T5XB 1NAKH 2GK0A 1U3HB 4CKVX 5K9QG 2BRRL 5IBUG 2BSSB 1CFTB 3OKEB 1U8MA 2MKWA 3DMMA 4RNRB 3D85A 3SJVA 4R4BA 4PRPD 4ZOEA 2OR8A 1UXWB 2E6PA 2PO6D 5JLZB 1FL3B 5D1ZA 1RI8A 4JG1L 4PGCA 4CAGA 2AI0H 3HE7B 5KSVA 4KROD 5C3LD 4KK9C 3ZKND 1F4HA 4NZRH 5DHYA 5IB1A 3I85A 1MJ8L 2DBLL 2V7NB 5CJ8A 5KANI 5C0BE 3P4MB 4AEIH 4EI5B 4L9DA 4W6YB 4HXAH 1EEUA 4K7PL 1D5MA 2XZAL 3VWJB 3AAZB 3QIUA 4WJ5A 5E2VL 5L2KB 4FQCL 2BERA 4Q7DA 5EDXA 4U3CA 4NRXA 2HMIC 3BQUD 1MCEA 4R90H 3S4SB 5DRWA 1BPVA 4UV7L 4FHBD 5AZ2H 4Z6AT 3RY6C 1MHCA 2EXYC 5IUSA 2EDHA 3JVGC 3WUWA 1F42A 2MPAL 1I1FA 4AL8H 4JQXA 2VABA 4HK0A 1H3TA 4X5XA 2WUCL 1MELA 4ZTPH 3B2VH 3CVIL 1G9NL 3MLPA 2EDDA 1BFSA 3CFJA 1MHHA 5IB4B 2ZZUT 3BXNB 2XTLA 2IAMC 4JM2B 2YUXA 3B9KA 3KAAA 1WSST 2QR0A 3QFJD 4OF8A 4OZHE 5KW9L 5E2JA 1LK3L 1WWAX 1K5NB 3KPRD 2FWOB 3DLQR 2G9HB 4WHTA 5IBTH 5IV2B 1PVHA 1AE6H 4ETQA 4EUPH 5KS9B 5JUEL 1F45A 5KVEL 15C8H 1INQB 2JJTC 1YEDA 2J8OA 2HFGL 3LZFH 1UM5L 2DWEB 4LGRB 3L6FA 1Z0MA 5FYKD 1IAOA 5EIIB 1TVHB 5JORA 4R4ND 3MR9A 3KLDA 5EUOE 5FB8B 4OLYH 1IGTA 2JIXA 3O2WL 5LJYH 1JNJA 4QRQA 4WDIB 3CLEH 4J4PD 3F7YB 1KTKE 4MQSB 3V8CA 1HHIB 4WY7H 4N0FA 5I1JL 1XIWD 3V79C 3QEUA 3P2TA 3G04B 3DVGA 2W0FA 2XIDA 3MUHL 3SDXB 3BKMH 3BPNC 5ABDE 5JHDA 3IF1A 2CKBH 3HC4H 3RWGA 1K85A 1VA9A 1HSAA 1MFEH 4MB3A 5JMRA 2DQJL 4IBLT 4WHYG 3PGFL 2J5LC 4LNVA 1I7RA 3JV4A 5BOPA 1AD0A 2GQHA 4E41A 4PRNB 3TT3H 4L3ED 5HHMD 3KPTA 4LF3B 1NUNB 1DSFL 3U36B 5L8JB 1EBPA 2FH8A 1I8MA 3ILQD 4Z18A 2APXA 1B6UA 2W9DH 3IRPX 4OLVL 4I3SH 3QBTB 1ES0A 3WL9A 4EEEA 4P23A 4Y1AB 3STLA 1MUJB 3X3GH 1DQLL 5TQ2L 4OZGF 5ESVB 2VL5A 4K2UH 5H37H 3BZEA 1NGZA 1OD9A 4PP1D 1XGRB 2MTPA 2AEPH 3RA7H 4FQ1L 2QBWA 4YDIH 5FV2A 3VGGA 3DO7A 4PUBL 1MI5A 3QUYD 5FM5O 3L3GA 5T3XL 1ZLWH 1A6AA 1I3GL 3G5YA 3RNQA 4EN3D 3MYJA 4B0MM 4DEPB 2HH0H 1JYNA 3V6FA 5LWYL 2C3VB 5K9JL 3NFNA 3LEXB 1E27A 2D0GA 4XB8A 1UM4L 4WUUE 1WIOA 4KMTL 4WU5B 4RGND 3MFGB 5GS1B 4PRPB 3SDCA 4CN1A 4MCZB 4HFUL 2PO6B 2OQJB 3PHQB 3QEHB 5ADOL 1IGFL 2BNQA 1NKRA 3REWA 4YEEA 1MVUB 1WCBB 1EJOH 1JHTB 2VLRE 5FGCB 1K8IB 4FZ8L 3OAUH 4YJZL 2NR6C 2H1PL 2B4CH 3QG7H 3O9WC 1HWHB 1BQHA 4LPUA 1GHFH 1YEKH 3NIDE 3TVMA 1N3NA 3QUXD 4FZEH 4OM0H 3MJ9L 2VDNL 1EEZA 2FEEL 5J9PA 4MVBC 3D0VA 4QRTB 3SO3C 2HLFD 4IOFC 3BQUB 3EYUH 1DLFH 3QO0B 1KACB 1JWSB 1JZ6A 1XR8B 3SKJH 1XCQA 4UTBL 1U3JA 3ROLA 1EHXA 5FYLE 1CL7H 2I60H 3OR7B 1FORH 2ZSWA 3QHTC 4XVJH 3H0TA 3ET9F 4K94H 3ZL4H 1RHHB 4FXKB 3LQAC 4DKAA 4HDIA 2OSLB 3G6JB 2MWCA 2VZVA 5I18L 2A6IB 4G3YH 1NGXA 3BZ4B 5K59F 5HY9B 2CLZA 5GQBA 3KYKH 4BZ2H 5GJSH 3B5GA 3MRMB 3QH3A 3QFJB 3PGCB 1IGJA 4NNXA 3MMEA 3KPRB 1QP1A 5KBNC 3QXWA 4JCMA 5GHWL 4LAQL 4X4XB 4NFCA 5C09A 1OVZA 4ODWA 1WGOA 1G7JB 2P5EE 2YEZA 3T4YA 2KUTA 4HUWA 1D5IH 4PJIE 4D9RD 4KH2A 3KNBA 1ZHLA 3L3JB 1ORQB 1HQ4B 5CS7A 4G80B 4PRHA 3DMMD 1A21A 3D85D 3SJVD 1AQKL 4L3CA 2D7OA 3T2NH 1QR1A 1BFOB 5AUMB 3GMQA 3WLWC 5I15H 1K3IA 4RFNB 3JSSA 3TIEA 4FP8L 3I6GA 1K4DB 3S5LG 5I2IA 2FIKA 3STZB 1C16A 2H6PB 1CGSH 1MEXL 1P2CA 1EA9C 1FZJB 3H9YA 3DHMA 3QCUH 4LDOB 3RAJL 4OGAC 4QTHB 3T77A 4MXVE 5DD3L 1IL1A 1XIWB 5BS0E 4PV9A 1ZHKB 1DR9A 3BIKA 1UWXH 3QIUD 2E9IA 2C1PB 4YDKL 5FYKU 1QOKA 4MD0A 4H26B 1GIGL 4YHLL 4M43H 4JO3H 2ZOLB 1U8JA 3HFML 4U6HB 1CE1L 4XZUA 5GRWA 2BDNH 5GGUA 1BJ8A 3IB4A 4N0UA 4WENB 3RGHA 3C2AL 3VG9C 3OKKB 4ZS7H 4ORGB 5CSZB 5K9KA 3QCVH 1F4XL 3NZ8B 4NN6B 4PY7B 1NMAH 5B8CC 3QEGH 1RZJH 5HHMB 3R1GL 5C6TL 5L2KE 4QGTA 4UOW0 1FSKC 4NN7B 1M6OA 1NGQL 2YC1B 2XG4A 3IDMB 3HNSH 4S2SA 1ZSDA 1FV1B 5FF6A 1OAYH 2YSSB 1OT2A 3QHFH 4HUXA 2D0HA 3B9KD 3O11A 4Q0XH 3X11B 1TZGL 2VC2L 3KJ6H 1I8LC 5HI5C 1S8DA 5I17B 5DA4A 3MCKB 4LCCA 5TQ0H 1MCQA 4O9HL 2Z4QA 3U7YH 3N85L 5C7XH 3RWIA 2FECL 4OKDA 2A0LD 4ZXBC 3GMLA 1MHEA 2NY1D 2YN5A 3QUYB 4HLJA 4FFZH 3EOAB 1KIUA 3P30L 2HTKD 4YWGH 3L5IA 4EN3B 5CFHA 1SEQL 2IPUK 2ARJB 2Q76B 3BSZL 1Q0YL 1GGBH 4QYOB 1MFNA 3O6LH 5KS9E 2VNCA 2APFA 3B83A 4ZUWB 3TZVD 5J12B 4D0BA 4RGNB 5F9JB 4P2QA 5DD1H 2CQVA 3MRFB 4LVOC 2RCSL 1NMBL 5KSBF 5J11C 5F7UA 1IM3A 2CLRB 3MUZ1 1OCWH 2CR6A 4I2XB 1T1YB 1W0WB 2A9ML 1R3KA 5DJ0A 3W9EB 3SCMA 4ODHH 2ZPKH 2CIIB 1CVSC 4KQ4L 4HS8L 5IFJB 4TUKL 2HT3C 1KIQA 3DXAD 1YY8B 4NKOA 4NJAL 1BIHA 4DFIA 4AIZA 1JVKA 3VG0H 4NC1C 2C4FT 2DAVA 3PE9A 3QUXB 3V95A 4NQSB 5CMAA 5ETUA 4E41D 4GAJH 1F11B 4G7VH 2WUBL 2YUVA 1VHPA 3R06B 5CILL 5E2TH 1QUNA 1ZT7A 4CRPA 1AJ7L 1FBIH 3SDXE 4X9FA 4HWUA 4M8QB 1DQTA 5GPRA 5ILTH 3HNTL 2CDEB 5K9OB 4P23D 4WW2B 2ZUSA 3T8XA 4QY8B 4AK1A 2R8SL 4ZSOB 5KANG 4HWBH 1TZHA 3QDJD 5GRZA 1CD8A 4V2CB 3LH2H 3LSOA 4XCEB 1QLRA 3PWVB 3GJFH 3X14A 5E6YA 3BGMA 2IPTH 2E7CA 3HLAA 3AS0A 1JE6A 1NH6A 4Y1AE 1CZ8H 3S9DB 5FM4A 3MLWH 3C08L 4LLWA 1HILB 1VKXA 1G7QB 4ZS6C 2BNUA 3HMWL 5J13B 1A1OB 2GK0B 3HB3D 1ZANL 5EBMB 3EUUA 2XWBA 2EDEA 2VXSH 4K8RC 1U92A 4GO6B 1U8MB 1KC5H 1FE8H 3DMMB 3D85B 3SJVB 4R4BB 4DKDC 1P4IH 5D6DA 4WFHE 3DGGA 4LLMB 4H1LG 4WNQA 3MLZL 4YHMH 2BNQD 3B5TA 5A2LH 4HUKB 5BOZG 5KSVB 1U9KA 4LKCA 5GS0D 1VACB 3G08A 5DHYB 3OKNB 5IB1B 4AMKL 1H3UA 1UB5B 3B3IA 4ZPTA 1KCUH 1D5MB 1YUHA 3MJ9A 3TVMD 5GGQL 4OD1L 4PRPE 3QIUB 2BVYA 3OF6A 43C9A 1KB5B 3QHZL 1Q0XL 1HH6A 3MSPA 4AJ0A 4NRXB 5LGHL 1YEHL 2RB8A 4DWHA 1KF9B 5FGCE 5CP7A 1YC8A 1MHCB 1BJ1J 3BN9D 3MV9A 3WNOA 1I1FB 4LARH 4EI6B 4UB0H 1JGUL 4HK0B 3VGHA 4Z7QF 2BVUA 4PJEA 1DP0A 1YN7A 3ES6A 3MRQB 2VDMH 2AK4D 1EAPB 3TJHC 5JZ7C 3WKNA 1MHHB 3RUGB 2X89A 2EEDA 3LEVH 4Z7VB 3N06B 3B9KB 2QR0B 5C2UB 1A0QL 4WHTB 1WWBX 5KOMC 2IPUG 4IIQA 4HKBA 1OAXL 3QRFM 2VERN 1SY6A 2CDGA 4ETQB 4G8FA 2EH8H 3ZSTA 3OKLB 3BIAX 1YEDB 3G6JE 5D1ZC 4AEHL 1F6LL 5C0EB 3LEYH 1FNEA 2NY1B 3QFJE 1IAOB 5D9SB 3U0PB 1NAKL 3KPPA 3KPRE 3HS0B 3VH8A 1NMCC 1IGTB 4QRQB 1Y6KR 4NO5A 2H41A 4MNQA 4N0FB 5A16A 2HFEA 1Z6JT 2AI0L 5JW4M 3IDNA 3LPWA 3QEUB 5FYKE 2ICWJ 4PJFA 4NZRL 1FNAA 4F37F 3P40A 4AEIL 5HI3D 5IMOB 4ZFOB 4X9IA 5JHDB 3IF1B 2R0KH 3RWGB 3U6RA 1HSAB 1N7ML 3EGSB 1B2WH 4H20H 4L8DB 2MSPA 3LKPB 2ZUYA 1I7RB 3JV4B 1AD0B 4E41B 3MV7A 3L95A 3GKZA 5AZ2L 1EO5A 2HRPH 4OCMC 1TITA 2GTWA 4ODTH 1WWWX 1I8MB 4AL8L 1L0QA 2EZ0C 3CFKA 4FOMA 1QG3A 1ES0B 4HBQA 1OGAD 4P23B 3TN0D 4ZTPL 3STLB 3B2VL 1N5AB 2HJKB 4IOIA 1OTTC 1T03H 3EAKA 5DFVD 5HGBA 3BZEB 5EBGA 5MEQA 3EZ8A 2NW3B 3QDJB 5HHME 4NO3A 5IBTL 1BM3H 3Q48A 3DO7B 3AM8A 1AE6L 1SJVA 3L3GB 4X7FC 3BAEH 1I75A 5C0DB 5A3ID 15C8L 1JNHB 2RGSA 3MYJB 3LZFL 1MWAH 2EDQA 5FDWA 1QBLH 1JK8A 4QRPD 3NFNB 1TQCB 2E9BA 2I25N 1RHFA 4N1CA 4Y5XB 1NL0H 3FT3A 3HC0B 1NUGA 4OLYL 2DJSA 1EIBA 3CLEL 2BNQB 4WY7L 4UU9A 2H2PC 3ZTJH 1ED3B 2AS5M 1HXMA 4KJPC 2V2XB 1BQHB 3VWKA 4RGNE 1N6VA 4LVHB 3TVMB 3BKML 1N3NB 1EVTC 3RVWC 2CKBL 3HC4L 3Q0HA 4GRWF 1MFEL 1UXSA 3D0VB 5I1DA 4I2XE 4JREB 1ADQA 1RZKC 1UEYA 2GTZA 1KLUB 4MWFB 2HFTA 3UAJD 1XCQB 3TT3L 4N0CD 3ROLB 2ZSWB 5I8KH 3H0TB 5DUBA 3PABA 2W9DL 3FO9A 4I3SL 2AK4B 4HDIB 1WAAE 4R7DA 1KTRL 4DOHE 4KJYA 1QR4A 1NGXB 5DVNA 3X3GL 2CLZB 4S1DD 3RX7A 3VD5A 3QH3B 3MUGA 1OTSC 4K2UL 3O4OC 4QT5A 1IGJB 3GSXB 4LNRA 4NNXB 5JPNA 5T3XD 2X9XA 1TXKA 3MMEB 2YRLA 3K4AA 1D5XA 2AEPL 3RA7L 2AV7A 1EO7A 4KUCD 4ODWB 1X7QA 4YDIL 4ZSOE 2YEZB 3QISA 3SGEI 3T4YB 3SDCC 3DECA 3OXSA 3KNBB 1A1MA 1JPTH 1ZHLB 3QR2A 3UTPD 1QA9B 5F1NB 2XY1A 4NQVA 3FL7A 5BVJB 2HH0L 1EGJA 2QTEA 4L3CB 1QR1B 4G6JH 4I5BB 3GMQB 1JWMA 3TIEB 2HN7A 2QKIB 3LDBC 4U0RC 4Y5YA 2R2CA 2FIKB 2EIBA 3IFLH 3ECBB 3SDDA 5CBEA 1P2CB 1VGKA 2EKJA 1ZAGA 5IJVA 3KPMB 3T0EC 4D9RE 4F9LA 1UJ3A 3T77B 3IFPA 5DVLA 4WW1B 5IB2B 1IL1B 1AQDA 5BVPH 2IBZX 5CWSB 4C4KO 1EJOL 4J8RA 4PV9B 3SJVE 1UYWH 3R4DA 3OF6D 3OAUL 4GBXD 2B4CL 2A2QT 3DNKA 3QG7L 1S7WA 5EH1A 3Q1SH 1GHFL 1YEKL 4R7NB 1U8JB 1UGNA 4FZEL 1EUTA 4OM0L 4XZUB 3W0WD 5A2KH 3RWEA 4UILH 1AXSA 1U8PA 1D6EB 4HJ0D 4IRSA 2X4TB 4DGYH 5K9KB 4YUEH 4G43A 5FIEA 1PKQB 1DLFL 3EYUL 2OS7A 3SKJL 1OP9A 1D5BB 3WE6A 1OGTB 5C86A 1CL7L 3T04D 4LLUA 2I60L 4ZAKC 1CR9H 4S2SB 1FORL 1ZSDB 4XVJL 3UROR 2X89D 3HA0A 3SDAD 4K94L 1OGAB 4HUXB 2QQLH 3O3DB 3O11B 4OTXH 2FSEB 3H3KA 3ZL4L 3TN0B 5B38G 3HC3H 3WKMH 1NDMA 1A3RH 2WNGA 5A43C 3SQBA 4G3YL 2AJ3A 1S8DB 4JDVB 3KYKL 4BZ2L 1GGYA 2BVTA 1T6VN 5EU7E 1J18A 2X7LA 2Z8SA 4LCCB 5LKNA 3DWTA 4GAFB 3LQMA 4YIQA 3ESUF 3RUGE 3GMLB 4Z7VE 3WN5C 1KTLA 1MHEB 4GKNA 5F1IB 3ROOA 1D5IL 4KKLD 3TPUA 3DVIA 1E6JH 4M3JA 4OFPA 3EDKA 4L8SC 1PQZB 4LU5H 5DC4B 1YNLH 2DLTA 2V5SA 5IF0A 1A64A 2D7PA 2IFGA 1BF8A 3T2NL 2Z31C 5I15L 4MNQD 2HG5B 4D0BB 2OXHA 1RK0A 1QSFD 4ZO7A 3W82A 4ZUSA 1MPAH 1CGSL 4F8QA 4AT6A 1G1CA 3BDBA 3QCUL 4PREB 5L7XH 1IM3B 1RD6A 2ITDB 1B6DA 3GIVB 1R3KB 5TPWH 1MFBH 5E1AA 5DJ0B 5LAXB 2NXYC 3ZYIA 5JW5B 2HLAA 3IETA 2EEBA 1T2XA 2F54D 3ARGA 1KIQB 3ULVC 2NY6D 3M1BA 5DJDA 3RWFA 2OR9H 4AIZB 2YD2A 4PG9B 2FBOJ 5CMAB 4DCQA 4M43L 5ETUB 4JO3L 1AP2B 5F9WB 3MV7D 1WBYA 2BDNL 4LSDA 4S1RH 3OG6B 4ZS7L 3QCVL 4NUGH 5JHDE 4ELMF 1NMAL 2FL5A 3QEGL 1RZJL 2R9HD 4RMWA 5I16B 4L29B 3T8XB 3NCBB 5KSAC 3HNSL 3FQNB 1OAYL 4U05A 4E41E 1TQBB 3HN3A 3RL2B 1VFAA 4Q0XL 4MSWB 5IFHL 1MCWM 2H32B 3KJ6L 1QLRB 2VRAA 3FQUB 3X14B 1MCFA 3BGMB 3GSRA 2P8LB 5EUKA 4EUPA 4X6BA 5TQ0L 1KNOA 3VRLE 4I9WD 5JXED 3U7YL 3QNYA 4LLWB 3VMNA 2BNUB 4O00A 3D1MC 3PF2A 1XGQB 3EYQC 4FFZL 5BV7C 3CDCA 1AC0A 2GCYA 2XWBB 3AMLA 1OF2A 1U92B 1JI2A 4C55A 3SCMC 4Y8DC 1GGBL 3PP3K 25C8H 4UNTA 3DGGB 1ERNA 3NA4A 3O6LL 2DIAA 3OJDA 2LU4A 3IAGC 4MAUH 4XC1H 4HH8A 1DUYA 5GRVK 1H3XA 4LKCB 5HGAA 3WIIH 3G08B 4XHJC 5E8NA 1IKNA 1O7VA 1FGVH 5DD1L 3INUH 1ZLSH 2ITCA 3TCXA 3WJLA 3B3IB 4ZPTB 1OCWL 4TTDD 1KN2H 2OJEA 2DWDA 3VWKD 4AG4H 2CKBA 1FFOA 4WWKA 2JK5A 1CFSA 1D5ZB 4ODHL 2ZPKL 1PGRB 2VH5H 4GBXB 1DDHA 5AYQA 43C9B 3MV11 4RCAA 4YDVA 3D69A 1HH6B 2BNQE 1HHHA 3RWCA 1Y18B 3QUMH 5D2NA 3VG0L 4NN5C 3W0WB 4GAJL 4KFZC 2G2RA 4WI7A 2O5ZH 4G7VL 4LOUC 5E2TL 4W6XB 3L5HA 4KQ3H 1FBIL 4PJEB 3BH8A 4N8CH 5EC2A 1YN7B 3ES6B 4HW6A 2ESVA 5HDQH 5ILTL 3VFUB 3LRHA 5J1AA 1CLYH 4PBWD 1DFBH 1R0AH 1FO0A 3V8OA 2EDRA 3ULUF 5LGJA 1I9RH 5IM7B 5B39A 4HWBL 4KDTA 2QSVA 1QFWL 4BK5A 4H8WH 4YBLB 4KHTH 1PZ5A 4IIQB 3LH2L 4Z9KB 3VGFA 1BQUA 4HKBB 2CR3A 4ALAH 1ZK9A 2IPTL 5IESH 4N8VA 1J1OH 3FZUD 2CDGB 5D6DC 2AK4E 2ICWI 3BKYH 1CZ8L 5FDYA 1T1ZA 3O2VH 4MJ4A 3MLWL 2IH3A 2IH1A 5E8EA 3JV6A 3KPPB 3HG1A 1NCBH 4XNUH 4HIJA 2PYFA 2R1WA 3LRGA 2VXSL 1I1AC 4NNYA 4Z7OF 1XGUB 3TA3C 4JHZA 1KC5L 1FE8L 4R4FH 4RAVA 1P4IL 4NO5B 1JIBA 4HLZG 4MNQB 4R0LA 1BLNA 4YHML 4NPYA 2HJLA 5A16B 5GISH 1QSFB 3SGDH 5F44A 3IDNB 1YY9D 3LOWA 2UUDH 4PJFB 5I71B 1OOAA 3IXTA 1YEJH 4PJBA 1KCUL 1CE6A 5MI0B 5T5FH 2F54B 3U6RB 1AKJA 2VXQL 2XI9A 1X5FA 4W68A 3NN8A 2NY6B 5GSVB 4IRSD 1FG9C 1CGWA 5TF1H 3MV7B 3VDBA 5EN2A 2YUZA 2BOBA 2GTWB 3T65A 3FOMA 4JO1H 4I4WA 1NC4A 2X4RA 4LARL 1F58H 4JDTH 4UB0L 4ZQKA 1ORSA 3CFKB 1BBJA 2VDML 3BPOB 1RUKH 2DDQH 4IOIB 4D0CA 4Q58C 1OAKH 3NMEA 3CGTA 2DF3A 1BFVH 1G7PA 5MEQB 1XF1A 4P9HC 2XWJA 3LEVL 5FUZH 1MCBA 1PKQE 3VI3E 4FXLA 3ULVE 2KL6A 1UWGH 4NO3B 4MYWB 4XNMB 2G5BA 2R23A 5ICYA 4DGIH 4YHYB 5FUCC 1OGAE 4KKCC 1SBBA 2EH8L 2P48B 4GRLD 4JFEA 3B2UC 4BSWB 1NBVH 2C7UA 1X5XA 2RBLA 3TGXA 3WFEH 4ACPA 5FDWB 3QDGA 3LEYL 5JDJA 3TM6A 2YD8A 5C6PB 3EFFB 3EJYC 2EH7H 3U9PH 3NCJH 1K4CB 1NDGA 4DK6A 4D0DA 3LKOB 1HINH 4P57A 4W4OC 2DMBA 1OAUH 3JV0A 3MJ7A 4YNYA 5T1MA 3U7AA 1MJUH 1RZFH 1MH5A 4GRWH 3KLAA 5A2JH 1I85C 4P3WA 4PJ9A 2NMSA 4MNGB 4QWWD 3ARGD 1M71A 2FIRT 3LMJH 4WTZA 2FLBT 1KT2A 2WMPA 4KAQH 3ZHLA 4JKWA 4HGMA 1U8QB 3VWKB 4X6DF 4ZO8A 2R0KL 3F7PC 3JTSB 3DV6A 2D03H 3QDHA 4BYHA 3WIHH 1UXSB 5I1DB 1P7KA 1B2WL 4H20L 4GRMA 1A02N 4F7CA 1BIIA 1MCKA 1LNUA 3MODH 3ESVF 4HKJA 5CJQH 1HYRC 2HRPL 1QTYT 5HVHC 4ODTL 3KPSA 3PABB 3L3KB 4N0YH 3ARTA 3FO9B 2R2EB 3MACH 3QPQC 5M95B 4R7DB 2GY5A 1A6TA 1U8KA 3BP4A 2FJFA 2R0ZH 3OWEA 4KKAD 4PJHA 4KJYB 1T03L 2KDGA 3MJGX 3W9DA 4NUJB 3MUGB 4PLKC 3LKSB 3P4NA 4QT5B 3RGVC 4LNRB 4GG8A 1D5XB 3U0WH 2X4NB 3IJHB 2V7HA 4X7EC 2DLFL 1MCCA 1X7QB 3RVXD 1BM3L 2K1MA 2LTQC 4R6UA 5C0FA 1N64H 4M1CC 1RK1B 2A1WH 3GSWB 1F00I 2A9NH 3BAEL 4FQXA 1A1MB 1ULVA 4C56A 1AIFA 1MWAL 4APQA 3ARVA 3C5ZC 1QBLL 2FO4A 2N7BA 3CDGA 2DD8H 3QG6A 3SBWA 1IAIH 5T3XE 2HN7B 3OAZH 4Y5YB 4UBDC 4X5LA 5CJXC 5FO8A 3WS6A 1NL0L 2HT4C 2GI7A 5CBEB 5HDOA 4MJ6A 4U3XA 5KVGH 5GIRA 1UJ3B 1KTDA 3O6FA 1JUFB 4JQVA 3UTPE 1AQDB 3LV3A 2Q8BH 4J8RB 4WWKD 5GGRY 1SQ2N 3FHQA 1WQVT 5L8KB 9CGTA 5T1LD 1G7MA 1S7WB 3D3VA 2Q86A 2E5EA 1EBAA 2NY4C 4HQQH 5SWQA 2AERT 2NYYD 2BNRA 4KC3B 3F7VA 4JLRA 1AXSB 3QIBA 1U8PB 1IFHH 2V9RA 3IDYB 4G8GD 3W5NA 4IRSB 1P5UA 4WVRA 5DT1H 1PEWA 1AHWB 5ALBH 3BP5A 3BPCA 2XA3A 4QHNA 2Y5TA 4OLXH 3WE6B 4LLUB 5FFLA 3RZCD 4BFIA 5I8KL 4HWBA 1NANH 5SWZA 3W0WE 1CIUA 5CHNA 4X99A 4JM4H 3IJYA 2Q7YA 1T80A 3TF7C 2ZOKA 5FKAA 4G6AC 1BJMA 4Z0BH 4PJEE 5F8QC 5E56A 1I7UA 2X7LB 1GVIA 4OFYA 2CPCA 3CU7A 5FO9A 4BSVA 5DFTA 1YYMH 3CZJA 4PYGA 1KFAH 4YIQB 4PJ7B 1CGXA 5D2LA 3SDDC 4RDQG 1KTLB 4GKNB 4HS3B 1ZLVH 3ROOB 1AGDB 2D7TH 2NXZD 3HG1D 4GRLB 1F8TH 1JPTL 3GDBA 3OR6A 1QRKA 5BXFB 4NOFA 5E5UB 5EU3A 35C8H 4G6JL 3PXHA 2QL1A 4GLRI 5HHOA 2OXGA 4U2YA 1KYOJ 3NIGE 3IFLL 4ZUSB 1JPFB 1W8OA 1IZKA 2O5XH 4AT6B 4L9LA 4KROC 5C0JB 1EMTH 3OTTA 4Y16D 2SEBB 2PCPA 4RWYH 1IC5H 2HLAB 3IETB 5BVPL 2HRLA 1XZ0A 2FBJH 1U3YA 5BW7C 4RQQA 1UYWL 5F7HA 3GJEB 3ARGB 2F8XC 4P2OA 2XZCH 4MNQE 3RWFB 4NWTH 4ERSH 1LK2B 3KPQA 4JVWA 4YHOH 1ZGLM 3Q1SL 1EK3A 4DCQB 1JTTA 4KJWD 3EZJB 5FGBC 2BY1A 4JFYA 4PJFE 1WBYB 3LN4A 2HP4A 4UILL 1JZ5A 2Z8RA 3VRJA 5IW1B 3TPKA 1NC4D 7FABH 1NFKA 1NQBA 4DGYL 4YUEL 4NQXA 4NKDA 2F54E 1ZWIA 4WO4A 2FL5B 1ZE3C 1CLZH 3KLSA 1CR9L 3RIFK 4XNYH 1SBSH 1RZGA 1VENA 3MV7E 2IANA 3JWOC 4OTXL 2QQLL 1UB6B 5ISZD 5D1XD 1VFAB 2YK1H 3HC3L 4UQ3A 3WKML 3O3EB 1A3RL 2ZG3A 4EDXA 3ARWA 2BVQB 3V6OE 2BK8A 2BY2A 2CO6B 4FFVC 1IAIM 2Q3AA 3ULSB 4WU7A 3GSRB 3ZHKA 1H8SA 3WXWH 5EUKB 4EUPB 2CDFB 2EC8A 1JNLH 1CXHA 4U1HA 5L0QC 3QNYB 1A7QH 2R1YA 2PTUA 3QDGD 5HI4C 1FCCA 4NRZA 1IC7H 1P6FA 2ADGA 1E6JL 2GCYB 2MNUA 4L5FH 1OF2B 4XP6H 1PY9A 5J8OA 4LU5L 1JGDA 4GW5B 3S36X 1J8HD 1YNLL 1Z9LA 2AEIT 4UIMB 1CK0H 3OJDB 1MCLA 4I9WE 8CGTA 4C83B 5HGAB 2LFGA 1T3FA 4HK3J 1OP3H 2BOCB 1MPAL 4J1UA 2APVA 2MOVA 4GW1A 4U1JB 4CMMA 2ITCB 2GSIA 5L7XL 5ENWA 5HYQA 3FMGH 2DWDB 5TPWL 1MFBL 1BZ9A 2CKBB 1X3DA 4WWKB 2H3NA 4LVEA 2JK5B 1CFSB 3DI3B 4PR5A 4EXKA 4QRRA 1DDHB 4Y2DC 3U4BH 2DICA 4YDVB 3PP3H 4M4RA 5T1LB 5EU6D 3RWCB 1HHHB 2BFVH 4QHLA 3MXWH 4P49A 2OR9L 5DO2C 2H26A 2ZWLT 1U8HA 3TLRA 4X6CF 5IK3A 3T2PA 1M7IB 2G2RB 4MNGE 4L8BA 5FM5M 4G8GB 4MDIA 3ZMRA 4S1RL 5HYSA 5CKGA 1O5DT 3UEZA 3VXSD 3DROB 3RNKA 3GI9H 3BH8B 4NUGL 1J0YA 1A3LH 1G0YR 2PXYA 4YPGA 5AG9A 5B3NA 1YECH 4X80H 4YAQB 5J1AB 2H2SD 1A7OH 4LQ1A 5LGJB 1HH9A 1SEBA 4R9HA 2NY2B 4NZJA 4MA7H 2EDLA 1G0DA 5F3HA 3GB7A 1PZ5B 5E8PA 3RFZC 4N8VB 5IKCA 4FQXD 3O2DH 4FN0A 1NGPH 4Z7UB 1MWAA 3MLSH 4NQTA 1F6AB 4I48A 4ZUTA 2IH1B 3L9RB 5E8EB 3JV6B 2NXZB 3HG1B 3VXRA 3AB0C 1JZ7A 4GKSB 2PYFB 2R1WB 1BZQK 4NNYB 1VERA 3VFPA 3RVVD 3VGBA 4RAVB 3QI9A 25C8L 5BCAA 1IGMH 4JZNA 5CGMA 2VTFA 3OGCA 4R0LB 1BLNB 4JAMA 4KY1H 4MAUL 4NPYB 1Q9LA 5INDA 3WIIL 5D2NC 1HQRB 1WJ3A 3RZWA 1FGVL 1ZLSL 2EDJA 3GSNH 3INUL 5L2JA 3IXTB 4LFHG 2F5BH 4PJBB 4Y16B 4OF3A 3D3VD 1KN2L 4AG4L 3LQAH 5I8EB 3QUZA 1ZVHA 2EDBA 4YE4H 1G9MC 2BNRD 2VH5L 5DK2A 1EV2E 2LQRA 5J3HD 4JZJB 4K3EH 5IB5B 1AFVH 3DTXA 3QUML 3VXMD 4PFEA 3AU1B 4WFED 5EN2B 2BOBB 2ZSVA 1WC7A 4LKXA 4M7KH 1B9ZA 3QEQA 2O5ZL 3FOMB 5C71A 2ZG2A 1NC4B 2X4RB 4KQ3L 3BYTA 1ORSB 2AJXH 4U1GB 4N8CL 2WINB 2A73A 4GJTB 4N5ED 4R8WH 5HDQL 1INEH 1BBJB 2XXCB 1U8OA 4KTYA 4MZ2A 3VJ6A 3CSYA 1BVLA 4XXDA 1DFBL 2RIKA 5IMKB 3L1OH 1R0AL 4D0CB 3ARDD 4M7LH 1KCRH 1A2YA 1QSED 3UBXI 2X42A 5GRXG 2XWJB 1T2JA 3G5ZA 4UQ2A 1I9RL 4OFYD 5ISZB 4P48A 4H8WL 4KHTL 4X98A 2G5BB 2R23B 1S7QA 3VMPA 5ICYB 1UZ6F 4ALAL 3E2HB 1IARB 5GRUH 1M1SA 5IESL 1J1OL 2FEDD 4W81A 4W4NA 4RGOL 1DN0A 4JFEB 1WWCA 3BKYL 3CXHJ 2C7UB 3O2VL 3HR5A 3QDGB 2R0LH 4EQ3A 1CFNB 5I8OH 4XNUL 5D5MB 1N59A 5JPMA 1YJDC 1XF3B 4P5KB 1NDGB 3BZDA 1J8HB 4JRXA 1NSNH 4MXQC 4D0DB 1FHGA 4R4FL 4X4MA 5DQ9A 4P57B 1YN6B 3MJ7B 4YNYB 4M9OA 2XTJC 3H9SA 4X7SH 1WBXA 5T1MB 5GISL 3FHAA 1MH5B 1JPGB 3KLAB 4K3GA 2JELH 4PJ8D 5C0CA 1FNSH 3IVKA 1G7IA 3QUKA 5HHXH 1M71B 5I1AA 4P2OD 1YEJL 4HIIB 4MAYC 2QQNH 1KT2B 4TUJA 2Z92B 4KTDH 5T5FL 1G7LA 4M6OH 5C6WH 1C5CH 3DV6B 4PJDF 1NFDF 2DLIA 3PHSA 1P7KB 2X9YA 5EU6B 5DHVH 4UAOC 1XMWA 3FAWA 4F7CB 1NCTA 1BIIB 5CEXA 2G75A 5TF1L 4HKJB 4WO4D 4MB4A 2X1WL 5HYEA 2W0PA 4Y5VC 4RFEB 5FCSH 4JO1L 3KPSB 2CH8A 5DC0A 3W11C 1XCTA 4PLJC 4XVUD 3V0WH 1CTNA 1F58L 4JDTL 1CXKA 2VLJA 1W72H 4PTTB 2EYTA 2J6EH 3ZE1F 4M1GL 1A6TB 3VU2A 1U8KB 1RUKL 2DDQL 4UT9L 1OAKL 3EBAA 3W9DB 5E4EC 1BFVL 2EKSA 3P4NB 4Z0XA 5FUZL 3AS2A 4GG8B 4ODSH 1J8KA 1VDGA 2P24A 2AAVA 1F4YH 1UWGL 3MRBA 2V7HB 3C6LA 2FCBA 1F3DJ 2DTSA 1TENA 5LCVH 5C0FB 4DGIL 1JRHH 3WMSA 2AQ3A 4FQXB 5TDPA 1NBVL 2DN7A 4PYHA 2VYRE 1AIFB 1KPVA 3WFEL 3CDGB 2FO4B 3QG6B 1X5JA 1WBZA 1CXFA 4PJ9C 5D72H 4YZFE 5CD5C 2CUHA 5FO8B 2EH7L 1X5LA 3BUTA 3NCJL 3U9PL 3O8XA 1CIDA 2OP4H 3TZVC 4UIKH 2XWTA 1X4XA 4FQQB 4MJ6B 1HINL 1KTDB 4X7TA 3CSGA 1OAUL 3PJSA 3N0PB 5FA4A 4OLEA 1D6VH 4NIKB 1DBBH 3GK8H 3HUJA 3LV3B 1MJUL 1RZFL 4TOYH 2FDBP 1UQSB 4AH2A 3LMJL 1G7MB 3EFDH 3D3VB 4KAQL 3IAPA 5SWQB 1KXQE 3VD4A 4ONHA 3MRJA 4PJXF 3AXLA 2BNRB 2D31A 4JLRB 5ID1A 3WIHL 2IGFH 2Y23A 2X1OA 4OUUB 3C9NA 4LCIH 3VXMB 1HIMH 3MODL 4DAGH 3BPCB 4OB5H 2JJWA 2Y5TB 5CJQL 3CX2A 1XGTB 3BEWA 1T04B 2ZUUA 1JPST 1OARH 2VZ1A 4R97B 4BFIB 5D2NE 3MZTA 5EZJB 4N0YL 5CHNB 2QV2A 3MACL 4K8RH 4G8GE 4X99B 2XACC 3ARDB 3IJYB 4Z7NF 2R0ZL 3PHOA 3GJFB 1NBYA 5FKAB 1QSEB 3EYSH 3K0WA 3WXVH 4POUB 3B9DA 2EC9U 3JWNC 1DTUA 5DJCA 2ARJQ 4APQC 3OQ3B 1RUMH 4MB5A 3DARA 3QDMA 3SBWC 3U0WL 2AK1H 2E9WA 5ELIA 5IHZB 1IMHC 1U41A 1YC7A 3I3DA 1N64L 5ESAB 2COQA 3VXRD 2A1WL 2PW2B 3ARPA 3CIQA 4UT7H 1DVFA 5B3JE 2A9NL 5IWLA 1QLEH 4JO4H 3O6FC 4MD5A 4AZ8A 3OR6B 3TCLA 4HMCA 5EU3B 3TBTA 4NGHH 2DD8L 1URLA 1IAIL 1QPXA 3O45A 4GQPH 3QA3A 4TNVK 4Z7UE 3WEXA 1HN1A 2YD6A 2BY3A 3RWHA 2LVEA 4L9LB 3HG1E 3FTGA 3QQ4A 4RBPH 5KVGL 3PWPA 4I1NB 3QIBC 5C07A 2PCPB 1GC1C 1XZ0B 2Q8BL 1B4RA 3QUZD 4PJ8B 4OZFG 4RQQB 3DETD 5T3ZE 4P2OB 4UT6H 2FX8H 5DDHA 5I6XC 5L6YH 3BN3B 3QUMA 3KPQB 3LD8B 3QNXA 4HQQL 4JFYB 2FD6H 1L0YA 3QEQD 3VRJB 1IFHL 4JG0H 4PJBE 3TO4D 4F7EA 5DT1L 3LRSA 4DGVH 3BN9C 4NKDB 5KVMC 1HNFA 1IC1A 5ALBL 4WO4B 2D4FA 3T3MF 2E7LA 4OLXL 2WBJC 3D5OF 3SPVB 1KV3A 3MV01 1H3GA 5DQDH 4Q74A 5I75B 3BPLB 3H9ZA 1Q94A 1RZGB 3CMOH 3PGDA 2JTDA 1YA5A 3D2UD 4UQ3B 2W59A 4LK4A 1IE5A 1EXUA 4EDXB 3JV5A 4JM4L 2A83A 4Q6IA 1V7NH 4WU7B 4Z0BL 3L7EA 4GW4A 3WFHA 4HIHA 4GUPA 3EOBB 4U1HB 1YYML 3QIWD 1KFAL 4IMLB 1SMOA 2HTLD 2R1YB 5JOPE 1T21A 5I74B 3JUYA 3KHOA 2X41A 5CBAA 5ISZE 4GS7C 5B4MD 2D7TL 2ADGB 1QACA 2P8MB 4RGMB 1F8TL 4ENED 1JGDB 4HMDA 4JRXD 4JJ5A 3ARUA 35C8L 3V7AE 4ZO6A 4JFEE 5DURD 3TC9A 4QRUA 1NUDA 3VMOA 1T3FB 1UT9A 4Y4HC 4UUJA 1IM9A 3QDGE 4J1UB 5CCKH 4GW1B 4RRPG 3LD8C 4CMMB 5C0CD 2GSIB 2O5XL 2VXTH 2AXHA 3SGKA 5HYQB 5D5ME 1EMTL 4QO1A 5L9DH 5DD6A 1I1YB 3DVFA 2R2HA 1D7FA 1BZ9B 4RWYL 1J8HE 1IC5L 5EC1A 2XZQH 2FBJL 1S7XA 2DQHH 4PR5B 4HBCH 4I18A 3BUYA 3BEVA 1Q72H 2XZCL 2ZUQC 4QHLB 3GSQB 4MA8H 1PG7X 3S35H 3CVHH 4ERSL 1BEYH 2H26B 1U8HB 4YHOL 3RBGA 4RMQA 4OZGB 5HHQA 5D7JA 3EHBC 4MDIB 5HYSB 2MQCA 1I8KB 2CSPA 1IRAY 7FABL 3RNKB 3L5XH 5DTFB 1NCNA 4YPGB 3FQXA 3LY6A 3B43A 1KPUB 3CH1A 5EU6E 3H7BA 3FB5B 1CLZL 3SE9H 3LKRB 1FZKB 4JO2H 4XNYL 1SBSL 5LBSH 3RTQD 1X44A 3TT1H 3KS0H 5E2UH 2NZIA 4IM8A 3KHQA