4MQXD

Clc-ec1 fab complex cysless a399c-a432c mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport, membrane protein
molecule keywords H(+)/Cl(-) exchange transporter ClcA
publication title Conformational changes required for H(+)/Cl(-) exchange mediated by a CLC transporter.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mqxD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mqxD01
1T83A 2O61B 4NZJA 1JBJA 3TIDA 2YSSA 3C5ZB 4M03A 3GJEA 3HCVA 2Z8SA 1MFDL 5AZ2H 3RFZC 3V52L 3RY5A 4G6KH 3FN3A 4YNYA 2PTVA 32C2B 4DZBA 2VZ3A 1S7SA 1T2QH 2VDOL 1T3FA 1Q0XH 1RI8A 5BRZB 1KJ2H 4DVRH 2R1WB 1RMFH 3VI3E 1VERA 1LK3H 1T0NA 5DEZA 2IF7A 4ZYKA 4LSSH 1BM3H 2E6JA 3QG6B 3VXSA 1HHKA 4L8SB 1P6FA 4KHTH 4OD3H 2MCPH 3QEHA 1FNEB 1NH6A 2BHYA 2B1AL 4TQEH 2W0FA 3QUYA 3Q3GA 4N0YL 3BP4A 4XXDB 2QBWA 4CVWA 3RUGF 1J88A 1NC4A 5C08A 4IMKC 1INDH 4MJIA 2IPUG 3SKMB 1ED3B 4LSVL 1BZQK 3QCTL 3FRUA 4NO2B 4LLMA 1JP5A 4FHBD 3MJ9A 1BPVA 4M48L 2BVTA 5KSUB 5I8CB 3QXDB 2UUDK 2VRAA 3VFMA 4XVTL 5L0QB 4YGVB 4Z95L 4KV5E 2YUZA 1WFTA 2EDTA 4NWUH 5CEZD 3C8HA 4FXGA 4YHMH 4R97C 3V6OE 5E8DH 3ELAT 5HI3C 2HH0H 3S35H 5ADPL 1QFWI 2R2EA 1N59B 3CH1B 1D9KA 1OGAB 3NCMA 3ZKXC 1A7QL 1Q72H 3FOLB 3ZYJA 5C9KA 3KXFA 4FQ1H 4ODTH 5DJDA 1MIEH 5IMOA 4JN1H 4DGIL 2E9WA 1LNUA 2VXVH 1QFUL 4NN5C 2YMXH 5I16A 4ZMAT 3GBNL 4MXQC 4P5TC 5I1AA 1T5XA 1PSKL 1E28B 2WUBL 3QDGE 3IXAB 2G75B 5MENB 3MV8D 5FV2A 4WFED 4AZ8A 3VGDA 3A0OA 3D9AH 1ZS8A 4YDIH 2DAVA 4ETQA 4OCNC 1C5DB 3T08A 4WJ5A 2D7MA 1X44A 4F7PA 4PJAE 1UWXH 3WHE1 5DURB 3V4PH 1ZTXH 4GQPH 3RWJA 4MNQE 1NEUA 3QUML 3A6CH 2HTLC 5DK0B 1DQLL 3PGDB 3MTRA 5FGRA 1JK8A 1L7IL 2DQTH 3V5KB 6FABH 1YEIH 2Y7QB 5CIPB 3KJ4B 2EDYA 4UIKL 5ENWA 5J57B 3JWDC 4HHAB 4XPFH 2VR9A 3E6FB 4X9GA 4QRRD 3EGSB 4Y4KD 1G0DA 1I8IB 4PB0L 4TRPL 3WNKA 1AC6A 4QTIL 4I8DA 4HKZA 4NZUH 1LE5A 5AG8A 3LD8C 3MREB 4XCYB 4OZGA 5IVXF 3CUPB 3PWLB 4AMKH 3UEZA 5KVGH 2VL5B 4EQ3A 5KSVA 4WU7B 4JHBA 3QNZA 1R3KA 1F4AA 5K9JH 4JG1H 1NPUA 5BVJB 3QQ4A 3L3OB 2W1NA 4XMKH 3BX7C 3QFJA 2DQHL 3CZJA 2AERT 5D72H 1AXIB 1A2YB 3G04B 5J7CC 3PE9A 1P6AB 2HJFA 3WFDH 1BIIB 2OXHA 3P4LA 3KPRD 1RIUL 4F7TA 1HYSD 1DR9A 1OGAE 3LKRA 3REWB 2W91A 4OFVA 4OZIB 2VABA 2XKSA 4MD0B 5HHME 1BJMA 2XRAL 4HKXA 3WFHB 1F00I 2VDPH 3TESA 4KHXL 4R3SB 1JGEB 4JEGB 4P46A 5ESQB 5JUEH 3BEVB 4YZFE 1DBAL 1YQ2A 1T1XA 4JM2B 3RWIA 5I1JL 3GSVA 5MENE 1FPTH 1FZMB 2IQ9H 3I6GA 4JO1H 4NM8H 3PF2A 4O2CB 4ELMF 1A7OH 2PW1A 4YEEA 4KUCF 2XWBB 1DQMH 4GRWB 1A6PA 5JHDD 3ZSTA 3TA3A 1DEEA 4LLYB 1X5ZA 1GSMA 1IGYB 1JGUH 5L2JA 4LU5H 5I8KL 3G5YA 4NBZB 3GHEL 5HHNB 2I9LB 3RKDD 4FFWD 1RD6A 5IOPB 1FFNA 4GBXC 4Q9BA 3WCYA 4OIIH 1AQKL 5E2WL 3PHOB 5KVFH 5JORB 4OJFL 4PJXA 3UZVB 4HWZB 3B5TA 2A2QT 4NJAL 3UTTB 4ACPA 1OAQL 3SEPA 5D5MA 1BIHA 2A73A 3VW3H 2PYEB 1F4HA 3EOAB 3U9UB 3VXTA 3V0VB 3D5OF 4XNQA 3ZTNH 1F2QA 2ESVE 2I26N 3FO9B 3GK8H 3KNBA 2PXYC 3A67H 2YPLD 1XGRA 3TO4B 1G7PA 4ZS6C 1MLBA 5TDNB 4Q6IB 1P9MC 1UYWL 4KZEH 3MV9E 3QIUA 1RHHB 1R3LA 5TH2A 3WJJA 3WIFB 3NZHH 5MEPB 3B3IB 5DYOB 5D1ZD 3O0RH 2NY0B 2OJEB 3P0VH 2AJ3B 5I0DA 3HTLX 3JTSA 4JAMB 3VFSA 1UEMA 3O3EA 2Z31C 2C1PA 3HE7A 1NLBH 3ARFC 2NY3B 3NZ8B 3WUWA 1C1EH 3X11B 1RK1B 3X12B 4C4KO 4HIJA 4PLJC 3ULVD 3SE4C 5F7FA 4FQHB 8CGTA 7FABH 1OOAA 3K46A 1CE1L 1IM3A 3ZDYF 2ERJC 4LLDA 5JHLL 4NNXA 3MLRL 4FQCH 4OZIE 3QDJD 1BFVH 1J5OH 4JANA 1YDPA 2DICA 4OGAD 4LNRA 2R1YA 5DUMH 4LCUA 5EU7C 1CD1B 3MNZA 4NSKB 2NY2C 3R06A 1X7QA 3NIFE 1BBDH 4LEXL 1IEAA 3VRIA 1AIFB 4I2XB 5HY9A 3QWOB 4JZJA 2N4IA 3BP7A 4GRWE 4MJ4A 5IMMA 2Y4SA 4UBDC 1U42A 1O5DT 2RFXA 4YPJA 4J8RB 4Z7VA 3KYKH 4HC1L 2W65B 3O11B 4OKVB 3ZE0E 5LGJB 3TT3L 1IAIM 5DJ0A 4X4ME 4ZUTA 3BQUA 3P4NA 1IQDA 1EHNA 1SYVB 4G80B 5EIQA 3W81A 3DUSB 4JRYD 4P2OB 4MNGA 4X9IA 3LKSB 3L95B 1LVEA 4JQVA 1MIML 5DI8A 2PYEE 3HC3H 1RJZB 3RL1A 3K81A 2X1XR 3DGGB 3AB0C 1F58H 2AEWA 5D7SL 4FTVD 5T1LA 1N5AB 4JKKA 2BY2A 4QXTA 1KC5L 2I5YL 3SY0A 4PRPE 4F33B 1NUGA 1R24B 1CDGA 3RIAF 5EUKB 5F7EL 2D9QB 4HX1A 2DTML 5HDQH 3H3PH 1J1OH 4Y16D 4LF3B 3LS4L 5SWZD 1EO8L 3QH3A 4JHZA 4PTUB 1ADQL 2D7OA 2ZPKL 3LKOB 4JFEB 1UJ3C 1H8NA 2FBJH 3KYAA 4I1NB 4YBQC 1MWAL 3MRKA 4M6AA 4LKXA 4C59B 2CRYA 5GS0H 4DN3H 1LO4L 5F9JA 3TBYB 1RZJC 4URTB 3BXNA 1HSBB 1A1OB 3VFPA 3UBXG 1J0JA 1U58A 5DJ8A 4XWOD 2BNUA 4E5XB 3GMMA 3SDAC 1RZ8A 3VFGH 2DJUA 3NABL 4BZ1H 2ZUTA 3TM6A 4HPYL 1CDUA 1UT9A 4PRID 3SQBA 4UTAL 5F9AC 2KQNA 5FYLD 4PUBH 2YOCA 5T5NG 1NSNH 5EA0L 2LU7A 3RDTA 3QCUH 1KCSL 4XX1G 3PL6C 1MLCA 1U8QA 1HHJA 3Q1SL 1OTUD 4PG9A 3OG6B 5JXED 2Q6WA 4JPIA 1A7PH 2D31B 3UO1H 4N9GB 1F4XL 3RL2A 5HYFA 4UUJB 3QIWC 5HXMA 2LTQB 3T0ED 1E4JA 2MNUA 1UM4H 3RJQB 3H9YA 1QSFB 5DJ6A 3UBXB 1L7TL 5E2TH 3V8CA 5J3HC 3HG1B 4R26L 1DBKL 3IDJA 4ODUA 5SWSA 4POYA 1WGOA 4AJ0A 3U0WH 3AFLA 5E2UL 5F7YC 2HVKB 4IRJD 1QLEL 3BUYB 2FX9L 1MY7A 3L7FB 4XVUD 1LEIA 1BX2B 3MRNB 1XGQB 1SHMA 1I1AD 5EU3B 4FFVC 4JDZB 4QF1B 1MFEH 2CR3A 3IDYB 1CXEA 2EYSB 1JHTB 4HF5L 5CJXC 5FHBL 3PDDA 3CLEH 3QT2A 1RJYB 2FSEB 4PGBA 4M62L 4NQVB 2JELL 4XHJC 4QHLA 5B8CC 4N8VA 3O2WL 3QDMD 1N3NB 5KG9A 1DP0A 3GSNA 3PGCB 4MB5A 3HPJB 4JFEE 1EMTH 1QNZH 2OS7A 2WAHA 2N56A 1DDHA 1WJ3A 3MRRA 1DBJH 3OKOA 5GGVL 4U1GC 3FOMA 2XIDA 1U95A 2NYYC 5I66B 3S34L 2CLVB 3MNWB 4RMVA 1UJTA 2P8MB 3T4AA 5CMAA 2DBJA 2EIZB 3MLYL 4OFPA 1BGXH 3DVGA 4ZTPL 2IPUK 3QSKB 4ODHL 4RMSA 5DHXB 2X2YA 1FSKB 4QYOA 1HOCA 3VDBA 5CWSB 4HWBL 2AJZA 3W11D 1UCTA 5IB4A 4L9DA 4CMMB 1BAFL 3F6LA 5A2FA 1YY8B 1BJ1H 4O2EB 4N9OB 2VERN 4JREC 5IF0B 3MGTB 4KUZH 2R0ZH 5IJVB 4JKLA 1YN6B 4UIMB 4LVNB 5CS7A 4Q9RL 3CMOL 4LP5A 5I1IL 1OM3L 1XIWC 4U1JB 1P4LA 1GZQA 3IFPB 1LD9A 3ESVF 1FV1A 4ZPVB 1OAUL 3L9RA 1N4XL 3D0VB 4NO5B 4RNRB 3AM8A 1T22A 3T65A 1NMCC 4M7JL 4Y2DC 4Y5YB 1HINL 3KAAA 4LCCC 3T0DA 2JJVA 5JNYB 3WN5C 1CXFA 1NFDB 2CO7B 4XP6L 5KW9H 1MVUA 3IAQA 3MV8A 4N0FB 3W2DL 4L4TB 3BD4A 1IFHL 4H0GA 5DD6B 1FAIH 5D71H 4R4NC 4YBLC 2DQUH 1HH6A 3Q5TA 2BRRL 5LBSH 1S9VA 1KPUB 2VLRB 2UUDH 3AXLA 4HMCA 4FP8L 1UC6A 1CFTB 4KDTA 4U1MA 5KS9A 3HFML 2Q76A 1RUPH 5CAYB 2DL2A 1AH1A 4L29B 2C1OB 3UJJL 1K6QL 4QRRA 5I1CL 4Y4KA 3U0PB 3KLAA 3SO5A 1J0IA 1GHFH 15C8H 1FZOA 3QNXB 1F42A 2EXWD 4R4FL 4LIQE 3WL9A 5BO1H 1IAKB 1P84J 4FN0A 2IWGA 3MCLH 2UZYB 5T3XD 2K7PA 4YHPA 1FFPA 1XCTB 1Q9KB 3TT1L 1YZZA 1H3PH 3O3AB 3G08A 3UAJD 1IGCL 5IFJA 4LIQL 5DVOA 1R0AL 1V3JA 5HGAA 3CDYA 1IM9D 3L1OH 3SDCC 4WTXA 2AK1H 1TJHL 3TYGH 4JB9L 1HYRC 1BEYL 1CDIA 4XCEA 5L9DL 2GITA 1HZHL 1WWCA 1VGKA 5IGXH 3SGEI 5EUOF 5I18L 1S9XA 5HHXH 1KB5A 3KPRA 3B9KC 2A9ML 3ILQD 4YHIB 4WWKD 2C7UB 1CE6B 4YFLF 4GG8B 2DLGA 3OKEB 4WO4B 4OCWL 4OCYL 1OP9A 5KVEH 2PKDA 3NCYS 1EFQA 4HS8L 3EJZC 1QG3A 2WQ8A 2EC9T 5CZVH 3DUUA 3UYPA 3DXAD 1ZMYA 4LSUH 4DKFH 4J3OC 2CDFA 3HNTL 3MRHA 2NY6C 5JHDA 3FFCB 5F7KC 1U2CA 1G9MC 2B4CH 2H6PA 4TYUA 1C5CL 2FEEI 2JTDA 3S37H 3L3KA 3LAFA 4GAGL 4KKBC 2FHBA 1NGXB 3T8XB 4OLWH 2OK0L 3UJTH 2X70B 5HI5D 4WI3A 3EYVA 1PLGH 4NIKB 1HWHB 4NRXA 2YD4A 4V2BA 2I9TB 2B20A 1K8DA 4PFEA 1MQKH 4XNZB 5TE6H 1J1PL 1K8IB 3L3JA 4GT7A 4IIQA 2X4QB 5D1QD 2LE9A 2K9UA 3VH8G 4X0KB 3KLSA 4PJHA 3EYSL 1OAYH 1X5IA 4NCC2 2YPLA 3E8UH 1YN7B 4LGRB 4G6JH 3FRPG 3I6KA 1JWMB 5F71A 1MHEA 5MEOB 3U2SB 1GGBL 1WBZA 3F6IA 3FB5B 3ZL4H 2BHUA 5DMJB 1DQJB 5F7DA 3X13A 3QJFA 1B0GA 1I7ZA 3QXAA 4P2CG 1YYLL 5TE7H 3M17A 4YE4L 3DX6B 3TVMC 4O9HH 4YEFA 3IJYB 2OR7A 5CILL 3RGVD 5A16A 3P73A 4P4RB 1CIUA 3UTTD 1J8HA 2QADD 2FL5B 1BZ9A 3T3ME 4ZOCA 4XMLL 4DKDC 3LB6C 4W68A 1XR9A 5HYQA 1JHKL 3MUY1 4RWYH 5IM7B 2A77H 3MYJB 2EH7H 2BSTB 3O4LA 2FHCA 5D7IB 5HD8C 3JUYA 3VH8B 4J4PD 1QUNA 4QOKB 4OZHA 4H8WC 2JJSA 4ZDHA 3PQYB 4H0IA 4X5XB 2B2XH 3VWJC 3WHXB 1MHHB 3DARA 3LZFH 5CD3B 1PGRB 4AM0A 2J4WL 3QUYC 2EIDA 1H8OA 1ITBB 5DVKA 4GAJL 1P4BL 3I2CH 1IAMA 4XNYL 5GS2H 2CKBB 2QR0A 5DQDH 2O5XH 1BWWA 3RX8A 3FFCE 4GFTB 5DJYB 1I7RB 3OV6A 1Z9MA 4HD9A 4RAHA 1FIEA 3L3HB 4FQJH 3FB8A 1A6UL 1J10A 4XMPH 5KSBA 1X5KA 2ADFH 4QRQB 5IR1A 2GUOB 4U1NB 3VWKB 1NDMA 3DI2B 2DLHA 1KJVB 4KKCC 4G3YL 5K9OA 4NC0B 2IQAA 4JRYA 1N26A 5I1LA 4M61A 1U3HC 5BZWA 2A1WL 3C2AL 3E0GA 3SPVB 4JZNA 3W9DB 5A3ID 4LARL 3LN4B 4AK1A 2V7NB 3V52H 2R0KH 3EYQD 4FTVA 4P5MB 3UTPD 3HZYB 1G6RB 4PJ5D 3BGAA 5IBTL 1VHPA 4LHUG 5C0FB 3RRQA 1HH9A 1R3HA 4G8EA 4G9DB 4NBYB 2EYRA 1X5JA 2NX5E 4P23D 4S1SH 2E8YA 5DJXA 2FIKB 4K8RL 4KROD 4K3JL 4XWGH 4OV6F 1UVQB 1AO7B 4QCIA 1GH7A 5SWZA 4WI5A 4MX7B 5FYLH 3NIDF 3UTOA 3V8OA 4RRPG 3TBTB 3BYYA 4B41A 2NXZD 5EOQL 2UZIH 5FEBA 4XP9L 3RZCC 1HKLH 2OR8A 43CAB 3RWHB 5ABDE 5IIEB 3JTTB 4YUEL 5EO9B 5DRZB 4XPHL 4ZOEA 1AFVL 3ZZ1A 1K2DB 3BP6B 3V6FB 5IG7B 5FECB 3PQYE 2WZPD 5EZJB 4FQQA 3OR6A 4IM8A 2XQYK 3C09B 4LHUB 2WBKA 4PRIA 2H32B 3EJYD 2E7LA 1UM5L 2OTWB 3VFOB 5GQBA 2P48B 1KTLB 4NO0B 1B4RA 4N0CD 3QXWA 1MUJA 1U8LA 2VE6A 1U3ZA 3MLVH 3PGFH 3Q6GL 3QCVL 1KSRA 2APVA 1D3CA 4HIHB 3UX9B 5FM5M 5D7KE 2UVEA 1FFRA 2HWZL 4WENB 4OQTA 5JXEA 5E9DB 1XGYH 4Y5XB 5LQBH 2E8ZA 8FABB 2OCFD 3OZ9L 3BP5B 4DGIH 1ULVA 3BZFA 4FABL 2CKBL 4YDJB 1A8JH 3EO0A 2D0HA 3IDNB 3GBNH 5CP3A 4H1LG 1QBBA 3T0EA 2EDFA 4HMDA 1BVKA 4BZ2H 4MCYB 1XGUA 2WWMC 4J6RH 2DKSA 2M26A 4OGZA 5TF1H 3ULUH 3T1FA 4LPXA 1O7SA 4NQED 1I8LA 1JZ7A 1A14L 4L8BB 5CEYB 1B6UA 2VXSH 1BD2E 5I8EA 1U9KA 4D0CA 2GSIB 3QP3A 3PV7A 1B2WL 3WSQL 4IRJA 3QHFH 1T89A 4Y0GA 3MLSH 4P46C 5DR5H 2CR6A 1DQLH 2IG2L 3TJHC 1I1AA 2C3HA 4R8WH 1L7IH 3EBAA 1HQRB 3MRFA 1N5YL 2VZVA 1G6RL 1KT2B 3ARGB 4UIKH 1YEHH 3ARTA 4RA0C 2V5YA 4E42B 1NC2B 1MJ7L 2E3VA 3TA3C 3STZA 2X40A 3CVHA 4MQXC 4KI5F 5I74B 1E6JH 1QSFD 5GZNC 1AGDB 1ZHNB 4NC1E 4ODSH 1WTGT 4H1LB 2BSSB 3EO9H 1X4ZA 4WW2A 5GGUA 5TGBB 4Z7WE 4QHUB 3BHBA 3VI4E 3HRPA 2EDWA 4P3WA 4LKCB 3QAZB 3SKJL 4E9LA 12E8H 2PYFB 1N7MH 4TUOB 4HDIB 2B5IB 1D5ZB 4QHKI 2DQHH 4U4BA 3MRLB 3GJFK 1KIUA 2M1KA 1ZA3A 5EC2B 1F97A 1JF1B 3F5WA 1RJCA 1MAMH 3QNYA 2K1MA 2VZUA 5D4QA 5I6XC 2BOBA 4MLSA 3CPLA 3QG6A 5E9DE 4GLRH 5DZNA 3LVEA 1MI5D 1V5JA 4F7MA 5T1DH 2E7MA 3QO1B 3D3VB 3UYRH 5KANG 2K3TA 2ARJQ 1AE6L 3GSWB 1UKTA 4MDJB 3HE7C 3K2UH 4KRLB 3SDYL 2JJTA 4YAQB 5F3HA 1DBAH 5L8LB 1BECA 3R1GH 4LPTA 5EDXA 5KAQG 5I1JH 4D0BB 3DRTA 4NO2A 4ODVH 1CU4H 1IKNA 4KWUA 1U41A 3SE9H 1J1XH 3KPOA 5HVHB 2CLRA 4AT6B 2X7LA 5D93C 4MXWH 5TPWL 2I24N 4ETYA 4HG4J 5KSBF 3NPZB 1IC5L 1NLDL 1TZGH 1YEGL 3RWGA 2EEBA 5I8KH 4BH7A 1S7UB 4Q9QL 1UADC 2EEDA 2WINB 4IBLT 4X6DA 2G9HA 4FXKB 4LLVA 4DUVA 4PJ8C 1N59A 1D5XA 1IGJA 3EOTH 4R7NB 4JZJC 43C9B 4KC3B 1WWWX 4NFCA 3FOLA 3WV0A 4WI7A 5ISZD 4G7VH 3U9PL 4F7CB 2BY0A 1U2HA 2AEQH 3JUZA 5CIPH 3ZTJG 2DQIL 3OB0H 3REVB 4ZUVA 3LSOA 5GRJL 2ADGB 2Z0BA 1BFSA 2A0LC 1YY9C 4U1LB 4UU9A 5I15H 2ZUUA 2ARJA 1XF1A 4QXGH 1C5DA 3OKNB 5FYKU 1FNGB 2QQNL 5AD0B 3VJ6B 4F58H 4CGTA 1NCCL 2OTPA 5DK0A 2GK0A 1OTTC 3V2AR 1P4IH 4OFYD 2AJVL 1IM9A 2R23B 2AXHA 4R7DA 1FL5B 4PYGA 2A74A 4EI6A 3VFRB 5C2UB 3IJSA 4TSBL 1SJEA 4R97B 2VTFA 3O41B 5JHLH 4DW2H 3Q2CA 1DEDA 1QFHA 3OAZK 3TC9A 5ADOH 5DO2C 4R0LA 1JPGA 1KIQB 4N68A 4HH8A 4WWKA 1EK3A 1ZEAH 3MZGB 4XP1L 5LCVH 4RISH 3MBED 5K93A 3C6LC 2HTKD 4NN5B 4LLQB 4E41E 4L8DB 1FO0B 4PJBE 4P5TB 2DB8A 2VITB 4HJGB 3TBWA 4HS6A 4OTXH 2G2RA 3DXAA 4DWHA 1INQB 4XZUB 3RKPA 4HC1H 4X6CA 5HTSA 2EIBA 3QPXL 1XT5A 4XVSL 4K71C 4JFDE 5GJTL 4LCYA 4GRWH 4LPVA 5AAMA 4Z7OE 3OKLB 3HA0A 4PGEA 2FJGB 3ARZA 1RUQH 1KCKA 5TQ0L 2IBGA 1SEQL 3CFEA 1BQUA 1H0DA 1H3GA 3AAZB 3MRBA 1UQSB 4WO4D 1NMBH 4M4RA 1I1YB 4GKNB 4HGKC 1FJ1A 4LPCA 5ESAB 4U6XB 5GS0C 4WY7L 3F7PC 2DIJA 1JGLH 1NAMH 2BCKB 4GOSA 1U36A 5ESQA 3OXSB 5D1QA 2OZ4H 1QA9A 2VLME 3QISA 4DGVH 4Z7NE 4KV5F 3F58H 2GJ6D 3LD8B 1KC5H 4JLRA 2Z8VC 1BLNA 1IE5A 3CK0H 3CLFL 2A9NL 4LBEB 2P44B 1P69B 4M1CC 2DTMH 1OPGH 4YXHH 3BJ91 1IZJA 1TQCC 3OPZH 5EO1A 1LE9B 3SDDD 1D5IL 2DBLL 4OUUA 4ODXB 4KPHH 4IRSC 1JMZA 1K5NB 2BVUA 3ULUF 4HUVB 4LMQE 2X4OA 4MHHG 1NAMA 5HVWA 2ZOLB 3PHOA 5IEHA 4ZTOL 4KVNH 1P2CB 3RGVA 5C07B 2OZ4A 1Q9WB 3MRPB 3UTTA 1EH9A 1U0QA 2VDLH 2FX7L 1G7IA 3P9WB 4LLWB 1DJSA 4E0RA 1A3LL 5KVDH 5ICXB 4ZFFA 2IC2A 3KDMA 4HG4K 1S7TA 4NQCB 4UQ2B 4RAVA 1QR4A 3RWCB 3NABH 3MLXH 3U30B 4PBXA 4F3FA 4LHQB 2A83B 4J4PA 1A6AA 1S7RB 2ZJSL 4NWTL 4IS6A 4BQ8A 1TTGA 4NBXB 1E0OB 5DD0H 5KTEL 2LAGB 1PBYA 1H8SA 1OTSD 3WIHH 3U79A 5A40E 3DMMD 5EA0H 3GM0A 1MJJA 1IJ9A 1P1ZB 5DEFA 1KCSH 1ZGLA 4OFDA 1T6WA 1H15B 1RZGB 2BNQD 3D1MC 3CZFA 2JJUA 5JW4Q 3QYCA 1HNGA 5IFAH 4MQ7A 1AY1L 2Y36L 3VXME 2DQEL 1MFBL 2WBWB 2GAZB 4DUWA 5L2KD 4I0PD 4LQFL 1WC7B 1DBML 4LAQL 4OLVL 4K2UL 1LP9B 4MXVF 3IRPX 5F88A 5FKPB 1I8KA 1AQDB 3NAAL 4EI5B 3PWPD 3GB7B 3WO4C 2H9GA 5F70A 2YRPA 3L5XH 4Y5VA 1XGPB 1F4YL 3VRLE 5E2UH 2PXYB 2ZCKL 4WUUE 4FMFA 3QEUB 5FUZH 1KLGA 3LPWA 1QLRA 2BSED 3P11L 3JWDL 3WXWL 4PJ5A 2FEDC 1ZSDA 2E9IA 3KHOA 1NANH 1QBAA 3QO0B 4HF5H 5FHBH 1HXYA 5DJZB 4OKVA 2DWDB 1T7XA 4P23A 4V1DD 4H26B 2WIMA 5C0IA 4H20L 1NCBL 5EORH 1L9NA 3ARFB 1K3ZA 4K7PL 1NCTA 3B9EA 1M05A 4TVPE 4YZFF 1VKXB 5JPNB 3SGDI 4W81A 3WEXA 1KGCE 3QJHA 1CD8A 2RJMA 3FT3A 1SBBA 1FVDA 2AV1B 4RGOL 1A4KA 3WYRA 4NQCE 5J9PB 1KNOA 4D2NA 4TVPL 4WWID 5E6IC 5HSFA 2V2TB 4NRYB 1U3JA 3X3FL 4P57B 3WNPA 5IMKB 4ZFOL 3SOBL 5FYJU 4NQSA 5L7XH 4X80L 5EUKA 3ALWA 1MREL 5CGYD 4G5ZH 4Y4KC 5E00B 1PD6A 1I85A 2YN3A 3GHBL 5D9SB 1JN6B 1YYML 4JO4H 4L4VE 4ALAL 3NH7H 4EUPG 1CDBA 2GQHA 4Y4FB 3ZE2E 1MAKA 4PY8I 1AHWB 2H41A 4Q9RH 1Q9OB 4EN3B 3IDUA 4DEPB 4KXZH 5LJYH 3R8BB 3B6SA 4PJGE 5A2IH 3DX8A 2ICES 2Q7NA 2DKUA 5FDWB 1EHXA 4GXVL 1CR9H 3GSUB 4CJ0A 1MHPH 3O8XD 3WFEL 4M7JH 2QEJA 3WD5H 4MVBC 2YPKA 1LP9E 1HINH 3I85A 4IDJL 1QRNB 2YXMA 4LLAA 4UT9H 4XP6H 5JDJA 3K80A 4HAGA 1G9EA 1ZT7A 2IBZX 3CJJA 2BVPA 4JJ5A 4QXUL 2BVEA 3L3GB 3OBAA 4NZTH 3G6JA 4NO0D 4NQEA 3IRZA 1Y6KR 3M45A 1T21A 2NR6C 1T5WB 3NIGE 1E4XL 4AG4H 3S3SA 3DV6B 1JZ5A 5C0BE 1KENL 4OZIF 5DRWA 4EUPB 1K85A 3VXRD 4ZXBD 2VXUL 1HI6A 1S9YB 1Z2KA 4U0QB 1WEJL 3P4OB 5E56A 5CBEB 3LEXB 3OAYH 4OGXL 4MAUL 2F54B 5CP7B 1I1FB 5T3ZD 4JM2F 1CICD 5ANMB 3WS3B 1QZ1A 3KPPA 4U7SA 1OAZL 3NIFF 5EU4B 5DQJB 4RFNB 3KPLB 3P9MB 4U1IB 1GGIL 3FQUB 1OVZA 4GRWF 3QFDA 3TP4A 3HR5A 1ES0B 3T3PF 3VG9C 1FZJA 1FBIL 3VMNA 1MJ8H 5C8JB 2A6KB 2AW2A 2EKSB 2W9DL 3GRWA 4NKIL 1DQQB 5D7JB 4ZD3H 3ZE0F 1MF2L 3SDAB 5D2LB 5C7XH 3TT1H 1T20B 3D0LA 1DN0B 3FQRA 5EU7E 4P2QD 4IIQC 1IT9L 4EBQH 2Y07L 2YEZA 3ALPA 4I5BA 4YDLC 3TBSB 1TJHH 1KELH 1G9NH 3MSPA 5E08L 4IMLB 2FSEA 5L9DH 4K7PX 1V7NL 2B4CC 1FCGA 3H9HA 2E6PA 3CFKB 4D9LL 3GI9L 5E5RB 1QKZH 5F7HA 2ZSVB 4WFFE 1NMAH 3QZWG 5D1ZC 4XNXL 1MI5A 1T4KB 5IB2A 3F7RA 4U3CA 4UQ3A 2HRPL 3DJ9A 4LSTL 5CD5D 1QRNE 3TIEB 4JDTL 3FQWB 3NCFB 3ULVC 1PZ5A 1KLUA 4KKLD 5ACZA 3IFOA 2QTEA 2E27L 1D5BB 2FZ3A 4GS7C 3LKPB 1BZ7B 4NUGH 4Z7UB 1TNNA 4JFXB 1TJIL 3BD3A 1RZIA 3U7YH 1ONQA 4JY4B 4XPBL 4B0MM 3MJ8A 2F53D 2R8SH 1NBVL 2FR4B 4QRPD 5CEXB 4CADB 2GHWB 2I27N 2XWTB 5IF0A 3MGTA 5GXBB 3HE6D 2J8OA 4WCYL 1ZLUH 3RVVC 1WBXA 1JPFA 5TJWK 3VFWB 3JV5A 5FO9A 5I1HL 2CDGA 5I71B 2KPNA 1J1PH 5DD1L 4LRNH 4HJ0D 5B8CB 3QZWB 2F54E 3D0VA 4JFFB 4JGMA 1KUMA 5C0GB 4N0UB 3KR3L 5ANME 1ZT1A 2G60L 5ISZA 2R0LH 2V17H 5AWNL 5E5MB 1JNNL 3MR9B 4K7FA 4OV5B 1PKQE 4PJDE 1U6AL 5LXGH 1HHGB 1TFHA 3JVGC 3CC5B 3ROOB 3BPNC 3GJFA 1UKQA 3B43A 3HNSH 4TULL 2DQJL 3LKQA 3NA9H 1RZJL 3AU1B 5IESH 4HIIB 3ARYA 3IDXH 4UOW0 3EJJX 1LMKA 3MLTB 2X1WL 4OFYA 1N0XL 3BZDA 1Z9OA 1TIUA 5FK9B 5GZOD 5IFHL 1NCNA 3QWQB 1D5MA 5CLWA 5C71A 1JHKH 2VDQH 1VPOH 3WJLA 3MNVB 4G9FE 3LH2H 5EU6E 1IC7L 4OLXL 1CLZH 4Y16C 1JWUB 3QDGD 4FS0A 3IDIB 1HXMA 1G0XA 3MBEA 4JRWA 3QUXB 5I73C 1NMCB 5ECJE 4LCCB 2XG5A 2HVJA 1GCFA 3WN5B 1Q9KA 3DECA 3GKZA 4Z7UE 4YHNB 1HCFX 1ZANL 4U1SA 4MNQD 3CX5J 4JFPB 2CLZB 3DRQA 3FAWA 5DD5L 3QEQB 2ZWLT 4GQ9H 3DX9A 4WU5B 3U7AA 4XWOC 4AH2B 5DMIH 4LDEB 3S8WA 1CQKA 2AKRA 4PRDA 3MRJA 2VAAB 2EYTA 2YD2A 4NNYA 4GMTL 4UV7H 3WLBB 3CFBA 5HPMB 2E7LC 5ALCL 4JO2L 2UWEB 4WO4A 4JFFE 1RQ5A 4DCQA 2DLEA 3CSGA 2WIIB 4MA7L 3MV7D 3VGAC 1T03H 1YNLH 3G6JF 1OTUC 2KZ1B 3OAZH 4LARH 1ZLWH 4M8QA 3EZ8A 1HN1A 3ME0A 3RAJL 5FB8A 5DA0B 3LIZH 3JV6A 2GJ6A 5C3TA 4BELD 2E7BA 3VFTA 5M94B 3QIBB 4MSWA 1IRAY 4JE4B 4QHMA 5DHVH 2X44D 3KPTA 2HT3D 1JGVH 4KTYA 2DI7A 4W6WB 3SKOB 1YPZB 4K8RH 4L9LB 3M1BA 4LEOA 2FIRT 1ZK9A 1OAKL 3SDDA 4YGAB 1I8LC 4HCRA 5BZDA 1B0RA 3T2PA 1WT5C 4NT6B 5FKAB 3BH8A 4YX2H 1YMHA 5E4EB 4IRJC 5HHMD 3FB7B 4Q58C 3MJ6A 5I17A 1A7NL 1SJHB 4WUKH 1KCRH 4P4KD 3I75A 1DQDL 3B9KB 1G84A 35C8H 3NN8B 5I9QC 2NY5H 2MHAA 1FVEA 5DHVA 1JNHB 5T5NF 1AFVH 1QEWB 2Z4QA 3NA4A 5C0JA 1HK6A 1KPRB 3ULUC 3S3PA 1CL7I 1CGSH 4U6YA 1GGTA 2VDNH 3Q48A 3Q5YA 3RA7H 1F13A 5C2BH 2CUMA 5JOEA 1XR8A 3Q6GH 4TUKH 1CT8A 3DMMA 3D6GA 4U1HA 5DJAA 3O2DA 5DLMH 5FV1L 5GSRB 2BNQA 3C5ZC 3PWNB 5J06A 4WDIA 3H2WA 1U8JA 1F3JB 2QV2A 2VUYA 3LHPH 5FGBA 3F8UB 3HMWH 5KJRL 4Y4HB 4P9ML 5I0ZA 4QKXB 5EZOH 5BXFB 1XF2B 2CKBH 4HUXB 4XCCH 5ALBL 3KGRA 1YMMD 5L2KA 3W11C 1CGYA 4I0PA 3MMEA 5IM7A 1I3GH 2UWEE 1KN4H 3C5JB 4ONGL 1T0PB 5D7IA 4OCLC 1C7TA 4G43A 4LFHG 1XF5A 1F3DJ 1E27A 1V7MH 5F1IB 3PWPA 3OJDA 3EIFA 5B4MD 2ZUYA 5BVPL 3QQ9C 5JOPE 4ZPTA 3F7YA 5IW1B 1B2WH 3WSQH 3LOWA 1CFQB 1ZLVK 5E4IA 2VL4A 5E8EA 2JJTC 1Y18B 2I07B 4HUWB 2IG2H 5HDOA 1A0QL 5JPMA 4XB7A 4KDVA 3CSYB 1SY6L 4JPVH 1HCVA 3RPIB 1QFWL 5B38A 1N5YH 2K7QA 1YPZE 1RURL 1G6RH 4OD2B 4CVZB 2ZG2A 1IKNC 3KJ6L 5GGSA 4K9EH 1FIGH 3W5NA 4V1DA 4OM1L 1KN2L 2DYPD 1BVLA 3TIDB 2YSSB 3S36H 5L0QC 3FONA 3GJEB 3HCVB 3DNKA 4UOJA 3U4BL 4AEIH 3OKMA 4KGLA 4UTBL 2NTFA 3I02A 4EI5D 4YNYB 2GJJA 4DZBB 3KYOA 3WFBL 5IVXE 1NFDF 1FNFA 1YQVL 5HBBA 3CX5K 1LEKA 1S7SB 1T3FB 1JI1A 5K9KA 5JA8B 1JI2A 3ILPA 3LKNA 1U91A 1A6VL 1G7LA 4QRTA 2GT9A 4KMLB 1Z9SA 1T0NB 3MXVH 4ZYKB 1TVHA 1H3WM 1HHKB 1R5WA 5F7WC 1GOFA 5EOCJ 5C0DA 5DFWH 4HSQA 2FYYA 3QEHB 2AJYL 1G6VK 2MFNA 2W0FB 3QUYB 3Q3GB 3BP4B 1QVOA 5C0RL 3LQMA 1NC4B 5C08B 3S4SA 4M9OA 3RVUD 1WFOA 2H32H 4JR9H 4MJIB 4AEEA 4M7LH 3FRUB 3QI9B 4LLMB 5IWLA 3VDAA 4BQBA 4JQXC 4OZFA 2VQ1A 3TH2T 2QSVA 1RVFL 3SDYH 1FGNH 4X4XA 3VFMB 3QEGL 1G7HA 4MDIA 3O8XA 3OKYA 4KJPD 1RU9L 3KJ4C 1ZT4A 4FXGB 2WLZA 5JW3L 5LGHL 1K2DA 4PRPD 1OSPL 4GG6A 1RUMH 5F97E 2R2EB 2C4XA 5TPWH 4I0KA 4S1RH 2HKFL 1D9KB 3HNVH 3OAUL 5JIPA 4Y1AD 4NO0A 5L8JB 1CFBA 3KXFB 5DJDB 3T3MF 1QSED 4LSQL 3QRGH 4Y4FD 5KSAD 1GJIA 1LNUB 2X4RA 2ARWA 1S9WA 4EN3D 5I16B 3O4OC 4Z8FH 2Q8BL 1EGJA 4R2GD 5JIHA 2J88L 4YHOL 5I1AB 1T5XB 3VXRA 4ZXBA 2ED8A 3MFFB 4M43L 1ACZA 2XKUA 3FT2A 1ZS8B 2DQIH 4ETQB 4WJ5B 1CICA 1NDGB 4F7PB 1CGXA 4FNLL 2AI0H 4MCYA 1QLFA 3RWJB 5KZCB 2EDNA 5DDHA 3EYOA 4W4OA 3BE1H 5IT2H 1RULL 4QO1A 4L8CA 5DVLA 5HI5C 1JK8B 4YXKL 4H1LH 3MRMA 1IGML 2X9WA 1TZIA 2GSIA 4KQ3H 4XI5D 5ENWB 2ZNWA 1RHFA 3VXSE 4KTDL 1UG9A 5M95B 4P2QA 1TCMA 4HBCH 2AJVH 2P4AB 1MH5A 1LE5B 4HKZB 5GRVK 4EIZC 2EE3A 2FB4L 5LG1A 2P8PA 4OZGB 4JPKL 2MOVA 4CUCA 4I3SL 4H8WL 5C08E 2I60L 3IGAA 1OY3B 5KSVB 1AI1H 2H2SD 4XB8A 3QNZB 3STBA 1R3KB 5EBWA 4PYHA 4G6KL 4XP1H 1PG7X 1DFBH 3QQ4B 3QFJB 4R4BA 1Q0XL 5D7JD 4JY6B 5IK3A 5F1NA 3MRCA 4DVRL 1RMFL 2DQFA 4HH9A 5DWUL 2HJFB 1PY4A 1PAMA 1LK3L 3BDXA 1BM3L 4JFHE 3RNKA 4F7TB 2ZG1A 3LKRB 3IKCA 1VFBA 3NCCB 3RVWD 5A2LH 3X17A 4KHTL 2VABB 3TO4C 3KXFE 1XCQA 2F53A 2IH1B 4HKXB 4TQEL 2HA1A 4QRPA 1KLFA 4C56E 1X6LA 4P46B 1HE7A 1SEQH 1INDL 3HE6A 1T1XB 1RIVH 5D7IF 3RWIB 3WDIA 2JK5A 2XQBH 3GSVB 2QQLL 5T1KD 3I6GB 2GK2A 1DSFH 1LO3H 1FLRH 1PX4A 2PW1B 4WY7H 3GSWA 4ZUUB 3TA3B 4Y19E 2V5TA 5BJTA 1DEEB 3ARBD 1EUUA 5F7MC 3WUWG 4NWUL 1YEFH 5L2JB 4YHML 3G5YB 2J5LC 4MWFA 3CLFH 5E8DL 1FFNB 2HH0L 2R56H 1IVLA 4MMZC 1NCWH 4PJXB 1UZ8A 2R4SH 5D5MB 1IC1A 2A73B 4FQ1L 4ODTL 1HHHA 4F2MA 1MIEL 4JN1L 4X7FC 4Y5VC 3VXTB 1S7UA 4DK3A 2VXVL 4B5EA 5B39A 5DHYA 3IXTA 1XGRB 5FO7A 1VSCA 1G7PB 4OZGE 5FA4A 4KRPD 1MLBB 2BDNH 4WW1A 1FG2A 4QRSA 4IOSD 3EFDH 3QIUB 1R3LB 5TH2B 3V4VH 2UVFA 5I6XB 2D03H 3D9AL 1WCBA 1MCJA 5F6IB 4P9HH 4YDIL 1FC2D 2DJSA 5JW4M 4P23C 3V4PL 1ZTXL 3LV3A 3JTSB 3QFJE 4KROC 3VFSB 3A6CL 3O3EB 3QDGA 2C1PB 2SEBA 3HE7B 1RK0A 4ORGA 3QUMA 4HIJB 3T04D 4NKMA 3L5WA 2DQTL 1MFAH 3QRFM 3ZTJH 6FABL 1YEIL 3ZKMD 4TN9A 1IM3B 3DTXA 1ACYH 1GAFH 3ZYOA 1EZVY 4PJAA 4LLDB 3SJVD 4NNXB 4XPFL 3DHJA 1FO0H 2NXZC 4MNQA 4KJQC 2XPGA 5D93B 2E6QA 5C0ND 4ZFZB 4JANB 1EBAA 1YDPB 4NZUL 3FN9A 1WCQA 4M00A 1Q38A 2NW3A 4LNRB 4N5ED 2R1YB 4A2LA 1JRHH 4LCUB 1RJLA 5EZLB 5KVGL 4PG2A 3MNZB 4S0SD 5TDOA 3R06B 1X7QB 5GRWA 3QHTC 1XZ0A 1IEAB 3VRIB 3BZEB 5HY9B 3EJYC 4NM4L 5K9JL 4JZJB 3NAAH 3BW9B 1GPOH 3BP7B 3D2UD 4N0CC 5IMMB 4WI6A 3QUXD 1H3UA 2RFXB 4XMKL 1QBML 1I4FA 1C16A 4Z7VB 4LLQA 5D72L 3MV7A 3CGTA 4BSWA 3JWOH 1YJDH 1A22B 3EDFA 5GSVA 4YHZH 5DJ0B 2CGRH 4ZUTB 3BQUB 2AEIT 3P4NB 1IQDB 5SX4I 3I50L 3WFDL 2X9XA 4OCXH 4XBGA 1QSVA 5H94A 3QEQD 5LWYH 3WHE0 1QBLL 4PJXE 4MNGB 3BT2H 5CSBA 5DD3H 3X3GH 5D5ME 1KCVH 4ZUSA 3TYFA 5DI8B 3BKCH 5J8OA 2J7LA 3RL1B 1SEBA 2VDPL 1Z9LA 3K8LA 1ZHKA 1I9JH 3MUZ1 5AUMB 2R0WH 2Z93A 2LAAA 5EIIA 5T1LB 4RGND 4QXTB 3SY0B 1I1YA 3MROA 3SDXB 1FPTL 2IQ9L 4JO1L 4NM8L 1RZ7H 4PY7A 2JLLA 1U8IA 1DQML 3SBWA 1C5BH 2DQCH 1EAPA 4P4KA 4TVPH 4BKLA 2UV3A 3G6AA 5GGSY 5JZ7D 1C12A 2PR4H 3X3FH 4CDGC 4XCNA 4JDVA 3QH3B 2B7DT 4MGXA 1S78D 2VDML 4IOFD 4X80H 1MREH 2P42B 2JB5H 4OIIL 2VLKE 4EZMA 3MRKB 2IFFL 4LKXB 1MCOH 4X8XA 2BVYA 2EDQA 5F9JB 4ALAH 3VW3L 4PGJA 4ODXA 3HHRB 1SMAA 3BXNB 4TNWK 3GKWH 3ZTNL 3VFPB 3GK8L 1U58B 4N90E 5DJ8B 3A67L 5TDPA 1X5YA 2BNUB 3GMMB 2PO6D 2OYPA 1RZ8B 4TPRH 4LSRH 3OGOE 2AXGA 4I77H 3SCMD 4PRAA 3NZHL 2H45A 3IDYC 1JF5A 1YMMA 2YC1A 3O0RL 3P0VL 2YRLA 4LRIC 3RDTB 1MLCB 1U8QB 1HHJB 4PG9B 5IVOA 4FRWA 1NLBL 4HXAL 1C1EL 3MV9A 2Q6WB 4N8VG 1A6WH 4NFDA 3RL2B 1EX0A 3L5JA 2NY4B 4MNGE 2FECL 4RCAA 2EDEA 4FQCL 3V0AC 1GGCL 4ENED 3I6LD 4PP1D 1BFVL 4Y4HD 1G9NC 4UNVA 2VXUH 5DJ6B 3V7AE 3B4NA 1NEZA 1WEJH 4LSDA 1EEQA 3MUHL 5SWSB 5FYJE 3IDJB 4ODUB 5DUML 1YC8A 4ZO9A 4L3CA 1J87A 2DYPA 1S7XB 3RX7A 2L7JA 1BBDL 2C4FU 2GTWA 2XT1B 3MPCA 2DI9A 3UDWA 1F11A 3NCJL 4EI5A 1N6VA 1S8DA 1ZVYA 1LEIB 5JO5A 4HWEH 4LVNC 1KB9J 3KYKL 5FGSA 2H8PB 1PFCA 3MX0A 1MF2H 4PGBB 3Q6FA 4QHLB 2XXCB 4N8VB 3CFDA 5KG9B 2OR9H 4Z7OF 3TF7C 3GSNB 1IT9H 2PCPA 1DDHB 3MRRB 3OKOB 5E08H 2ZP0T 1FFOA 1UH2A 3FOMB 3HLAA 1U95B 3HC3L 5EUOE 4GKZA 1M7XA 4R6UA 4XC3H 3T4AB 4F7EA 3BESR 1YUHA 2FRGP 4EKXA 3CIQA 2XZAH 3O6FD 5ID0A 2YD1A 4OCMC 1AD9A 2GY5A 3JXAA 5KAQF 3P77A 4J12A 4QYOB 1HOCB 2AJZB 3C8KA 2GEEA 1CXHA 1RUAH 3IDMA 5FHAH 1ORSB 5IB4B 5HDQL 3H3PL 1J1OL 4JDTH 4J3TA 2VQUA 4JVWA 4NRYA 1EJOH 1DE4A 1WF5A 4LDLB 3CD4A 3I84A 3WJLC 4PRPA 3VD3A 1UFUA 4RX4D 2BC4A 5DMYA 2NX5D 1P4LB 1GZQB 2FBJL 1ADQA 1LD9B 1JRHI 1FV1B 4X6EA 3B9DA 3P4MA 3L9RB 4Y1AA 1PJ9A 5GS0L 4DN3L 5J4MA 5GGTH 1QSEA 3D39E 3MBEC 3BKJH 5MHSE 5KSAA 1T22B 4MJID 3H7LA 1CZ8L 3T65B 1KPVA 5J1AA 1AHWA 2HTKC 4KMTH 2BP3A 3QI9D 4X7TA 1AGBA 3MCG1 4CNIA 2ITDA 5SWSE 3TN0D 3SQOL 3VFGL 3M07A 4TUJA 5TF0A 5DC4B 4EUPH 4FQXD 2RQ8A 4GO6B 2RHEA 4PUBL 1JNNH 3TCLA 1HH6B 4M93C 1WWAX 3QCUL 1U6AH 1S9VB 4YIQA 2NNAA 1MAJA 4NQXA 3FKUS 1J0KA 3AXLB 3ZT7A 4B53A 1A7PL 4M7ZB 1ODAA 4U1MB 4WO4C 5KS9B 2DQJH 4J1UA 2F74A 2Q76B 1E4KC 3B9VA 3PABA 3HN3A 2DLTA 3BPCA 4XPAH 3RVTD 1UM4L 4QRRB 4Y4KB 3KLAB 4HQQH 4WHTA 4U3HA 5FYKD 2IPKA 2G5RA 4JHWL 4GSDH 1FZOB 2DN7A 5E2TL 3WL9B 1G1YA 1RUKH 3UJIH 1OD9A 2LV4A 1QPXA 3U0WL 3HZKA 5IV2A 4MA8H 4PJ9D 4OLXH 1FFPB 4YHPB 4NP4H 5KZCD 3QHZH 3G08B 1M7IA 3SDDC 2ENSA 2NZ9D 5HGAB 5DJCA 2AVGA 1MFEL 1JHLL 3A6OA 2P5ED 2CIIA 1DQQA 5D7JA 5I2IA 3OGCA 4XCEB 4XNZC 2HFEA 2N7AA 1BD2D 5D2LA 3FTGA 1DN0A 1VGKB 4HUUA 1KB5B 3KPRB 4PLKD 4XVJH 1IGTA 4UAOB 3GUTA 4GAYA 4RFEA 5IBUG 1DBJL 2HKHL 4GAFB 3DX7A 1N6QH 4PGCA 1KB9K 1EVUA 4N8CH 3FT4A 3QB7C 4NHUA 1LDPH 1BGXL 2FJFB 3DUUB 3S5LA 1F3DH 3MV8E 5T1KA 3KYNA 2CDFB 4WFEE 4MA7H 3ISWA 3MRHB 5JHDB 3BMWA 3TIEA 1Q1JH 1W0VA 2H6PB 4PV8A 4RBPK 3ARED 2NY5C 3ARBA 3L3KB 3SKNA 4DTGH 3FO1A 4H25A 1KTKE 4CRPA 4KUZL 2R0ZL 3EYVB 4NRXB 3U48A 4I0PC 3QR2A 5KS9E 1BREA 4UDTB 4JQIH 2L0DA 3UZEA 1DN2A 4UNTA 4OF0A 2MQ0A 5IBUB 4PREA 3V0WH 3MLWL 1DUZA 4QRRE 3NIDE 4PJHB 1TMCB 4YDLB 3D69A 1LP9F 4ZUWA 2YPLB 1VDGA 4AIXA 1IARB 3EDEA 3U7WH 2UYLA 1A7NH 3I6KB 1MHEB 2EXYD 1WBZB 1CN4A 1C7SA 4EXKA 1IGIL 2ZCLH 5F7DB 3X13B 1FAIL 3L3DA 1BOYA 1B0GB 1I7ZB 5GGQH 2DQUL 3BUTA 2Y6SC 3M17B 1KTRL 2FH8A 2XXMB 5LBSL 4U1KA 4O02H 4G6FB 1KFAH 1GRWA 3P73B 5A16B 3VXOA 3U1SL 4M9PA 1YEJH 1J8HB 2NMSA 1BZ9B 2CK0L 4JCLA 3GMLA 1JYNA 3O6KH 1RUPL 4GS7B 4HZLA 1VADA 1XR9B 5HYQB 4WEMB 3SJVA 5FCUL 4L1HA 3IF1A 1L0QA 3O4LB 5C0AD 3OJMB 1RPQA 2P49B 1GHFL 4I48A 4OZHB 4OZ4A 4K9EC 4WEBH 1CDHA 4ZDHB 5J12B 4QY8A 5I1GH 3OKKB 4R9HA 3PWJA 3MCLL 4AM0B 3U82B 4J3WA 4CAGA 2P7TA 4NNPH 4YC2C 1NUNB 5EG6C 3D2UA 5JHDE 4H5SA 1U8OA 2QR0B 3QUXA 1AGCB 2FJHB 3L1OL 1JIBA 2AK1L 3TYGL 4WRLA 1H5BA 1IAII 4PJCA 3FB8B 3NFPA 2P24A 5KSBB 3ES6A 1ETZA 5IR1B 2WWKO 5F6HJ 1NDMB 5IGXL 1CDCA 2N1KA 4G8FA 5HHXL 1A0QH 1NGQH 1LK2A 5K9OB 5LAXA 1G7QA 2IQAB 1QFWH 2EDLA 4JRYB 3BPNB 1DL7H 3KJ6H 5CKAA 5I1LB 4M61B 4FQPA 5BZWB 2FD6H 1FNSH 4FZ8H 5KVEL 4JZNB 4NN6B 4PJHE 4R96A 4K23H 3OX8A 4C57C 1LHZA 3H7BA 3U4BH 4DAGH 3MOQA 2HLAA 3SGKA 3T2NH 2YUWA 5EWIH 5CZVL 1ZVSA 4GJTB 4LSUL 5CSZA 4DKFL 4KJYA 1CDJA 5KN5A 1HH9B 1R3HB 4G8EB 2EYRB 2VOTA 1PG7H 4G8GD 5DJXB 2B4CL 1VFUA 4Q7DA 3S37L 4NJ9H 4OLWL 4QCIB 4U6VH 5SWZB 3UJTL 1PLGL 5I73B 3X14A 1CICC 1TVDA 3ULVE 1CBVH 1MQKL 1CFNA 5TE6L 4JFDD 3G5XB 4UZGA 5LGKA 2WNGA 2YS4A 1MCQA 1KXQE 5F7LB 3EO1A 3QDJE 4WI2A 1ZWIA 5ITFA 3ULVL 1OAYL 2D4FA 3E8UL 1UB6A 5I8OH 2PO6A 3KPSD 4G6JL 1DVFD 2X4PA 3NCBB 4FQQB 4MS8D 3OR6B 3QEGH 5IHLB 3SCMA 1CWVA 5FO8B 4PRIB 3ZL4L 1G9MH 5F3BA 2HJLA 1H3VA 5E6YA 5D2LF 3GFUA 1MUJB 1U8LB 1Q8MA 2VE6B 1JNHA 4PJFA 5TE7L 2ZSWA 3DO3A 5AYUH 4O9HL 1KPRA 3VGAB 4LGPB 5I74C 7CGTA 3BO8A 1KJMA 5EN2A 1U8PB 5KSBE 3VGFA 2FLRT 3UTSD 4JKWA 2VSCA 2EDDA 3UXFA 1ORQA 3GSRA 4JRYE 4RWYL 3T0EB 5CD5C 2A77L 2EH7L 3SKUD 4I3RH 1BVKB 5DSCA 1XGUB 2CIKA 4Y4HA 1K4DA 4M43H 5JR1H 2VH5H 4KKLC 2B5IC 4Z77A 3T1FB 3GIVA 5L6YH 5BMFH 5C0CB 2VAJA 4FTVE 4D0CB 5I8EB 1F6FB 2YK1H 2R69H 3MA9L 4IRJB 3RWDA 1IAOA 4PJEA 5E70A 2HN7A 3I2CL 5F1IA 4NFBA 3HE6C 1I1AB 3VGBA 4PJIA 5DQDL 2O5XL 5BW7C 4MXQD 3MRFB 2DRUA 3N1GC 3OHXA 4FQJL 3B2UD 3JWNC 4XMPL 4F9PA 5SWZE 4HJ0C 3HUJB 3STZB 5E2VH 3CVHB 4Z0BH 1PQZA 2DQDH 5EZIH 2EC9U 2X6MA 3TPUA 5BS0E 5M7QA 2FB4H 1PYWA 4WW2B 1S7QA 4H8WH 4I3SH 5GGUB 2AGJH 3FAXA 3BHBB 5J0BA 5TE4H 4O51A 1OQXA 2HTLD 3VXMD 2OLDA 5HVHC 4P3DA 2BMKA 2HG5A 4NOBA 2R0KL 4XCFH 3GIZH 3O6FA 4WGVB 3HI6H 5AYQA 4X9FA 4PRIE 5EPMA 4CW1A 3S37X 5JOFA 1ZA3B 4WTZA 5FYLE 2DKMA 3MJ9H 5DWUH 3ARQA 4S1SL 3F5WB 4WUUD 4OI8A 1IBGH 2ORBH 2F5AH 4WI4A 3QNYB 3FMGL 4XWGL 3GI8H 2GSGB 2BOBB 3CPLB 1T6VN 2P45B 5FYLL 4RX4A 4QHKJ 5GGRA 4F7MB 3DV4A 1VEPA 2NX5A 1MCSA 2FX8H 2WW8A 4OQTL 3RX5A 3T0EE 2UZIL 3V6ZA 5F3HB 1C08A 5FM5O 2X89D 2XWJA 4YJZL 1HKLL 3DRTB 2QQLH 3QI9A 5DQ9A 4CL7A 3U4EA 1HQ4A 3I9GH 2X1QA 4PRHD 3TN0A 5IJKA 2R29H 3KPOB 2CLRB 2B1HH 2X7LB 2P5WD 4FQXA 2EE6A 3VE0A 3CFCL 4ZQKA 2BSRA 4P9HC 5FYKH 2J12B 4L5FL 1AR1C 3T0BA 3D85D 3RWGB 3MLVL 4BH7B 3PGFL 4X6DB 4LHJB 3OR7A 1VENA 2G9HB 3F12A 1OP5H 4LLVB 3BIBX 4Z9KB 1WBYA 1D5XB 5A43C 1IGJB 2VXQH 3S7GA 1XGYL 5LQBL 4HZAA 3GSQB 1J11A 5IHUH 3QWRD 3QDME 5KOMC 4L4VD 3ULUE 3KHQA 3OQ3B 1YEKH 4YHLH 3MJ7A 4XPGH 2UWEF 2Z8RA 3V6BR 1U8MA 4ZUVB 4BZ2L 1NL0L 1T7YA 3LSOB 3ZT5A 3MFFA 4J6RL 5TF1L 3ULUL 1JPSH 3CVHL 4UU9B 3ESUF 2ARJB 1F90L 1MCFA 1KF9B 1MHCA 3SGJA 1NDGA 2VXSL 5HGBA 4PJ9A 2XICA 3QULA 3RTQD 3DBXA 3QHFL 2WUCH 3MLSL 5DR5L 5BRZE 5L88H 2GK0B 4YXLH 4PR5A 3MLUH 1IM9B 3PWUA 4R8WL 5DC9B 4R7DB 4EI6B 2A74B 4EOWH 2P5EA 1YPZF 3JWOC 4P2RD 3IJSB 1YJDC 3RHWF 1YEHL 2VN4A 1SJEB 1BD2A 1T1WB 4F57H 1J05A 3I3BA 4LPYA 4P4KC 3JV0A 4CN6A 3FZUC 4R0LB 1JPGB 1E6JL 4JM4H 4WWKB 4KY1H 4ODSL 3EO9L 4M3KB 4NQDB 4W6YB 1M6OA 4I18B 4XP4H 4RAUA 3O4OB 3CCHA 2HFFA 12E8L 4NM4H 4MXVE 3TBWB 4HS6B 1W2KT 3EOBA 1N7ML 2G2RB 3DXAB 1YEEH 3GO1L 5E5UB 1QBMH 4Z7WA 1E6OH 2IALA 4JY6A 4X6CB 5HDLA 4LCYB 5FCSH 2X09A 2C4FT 3I50H 3QQ3A 3EHBD 1MAML 3AREA 4PGEB 4BFGA 1AKJB 4BYHA 3RY6A 4AEFA 3KLDA 2VZTA 1QBLH 2NY2D 1MCCA 3DVNA 3CFEB 1XEDA 1AGFA 1H0DB 4M4PA 1VFMA 3MRBB 1NGWA 1LQSR 1SVCP 2XV6B 5T1DL 2IH1A 3PXJA 1FJ1B 1NFIA 3U30C 3UYRL 4BH8A 1WISA 2WK2A 1WK0A 4UBDD 4X83A 3K2UL 5D1QB 2Y5TA 1QA9B 1S7VA 2YXFA 3HC4H 3R1GL 4JLRB 5F9WB 4ODVL 1BLNB 4PJ7A 1CU4L 3AY4C 4X4ZA 4U6TA 4RQQA 1ZGLP 1AD0A 2HT2D 3SE9L 1J1XL 4KTEH 4ZUUA 2HFGH 4MXWL 5D1XD 3O3UN 5EO1B 1TZGL 3BKYH 4OUUB 1OARH 1BFOA 2EZ0C 2VDMH 2UY7A 4TNWF 2X4OB 1NAMB 2IADA 5IEHB 1L4IA 2V2WA 2OL3B 2IFFH 1XH3A 4IHOA 5ETUA 3RGVB 3EOTL 3UDWC 3BH9A 3RVXC 2R2BA 1XAUA 4EI5C 3GMPA 2QADB 1LEGA 5TQ2H 5IEKA 1G7IB 3TLRA 4E0RB 4G7VL 4ZFFB 2AEQL 3KDMB 1EO5A 1NFKA 1S7TB 4BQ9A 5B3JE 5DJ2A 4OUOA 3ROLB 1HIMH 4RAVB 4XAKD 4Z7QF 3IAPA 4F3FB 5C0AA 1A6AB 3P0YH 4IS6B 3KG5A 5I15L 3RBSA 2J8UA 4QXGL 4PGZA 1MJJB 2ADJA 5DEFB 2XN9D 1ZGLB 4KVCH 4UT6H 3R8QA 4F58L 3QDAA 3FCTA 4HFWA 4PP2A 2DM2A 4JZOB 4X6CE 4G6FD 4HXAH 3RVUC 1P4IL 3CZFB 4M1GH 1J8HD 1MVFA 1EUTA 4RZCA 5SV4A 4MQ7B 4OF3A 4NKDA 1WAAA 1OT2A 2J5LB 4DW2L 1B88A 1GGCH 3O4LD 5ADOL 1NKRA 4KJPC 4ZO6A 4ZFZA 4EVNA 2LVCA 1Z5LA 4D0DA 4GW1A 5F88B 1I8KB 1ZEAL 5BOPA 5HYJD 5LCVL 2MQ3A 2H9GB 4RISL 4MD4A 5EZLA 4Y5VB 1UKSA 1EO7A 4PBWD 4W70A 1O7VA 5D2NA 3BZEA 4M6OH 1KLGB 1QLRB 1UB5B 3NCJH 3BW9A 3QIWD 4OTXL 5FYJH 1AP2A 2VXTL 4Y4FC 5SX5K 4PJ5B 2ATKA 3T3PE 3FJTA 1G7JA 2V5RA 1AHWC 1ZSDB 1O0VA 5K59E 4Z76A 1UWEH 4EN3C 3A6BH 3RY4A 1HXYB 4QGTA 5DXWA 4DEPC 3CNKA 4R2GC 2AV7A 4P23B 4G8GA 1REIA 4PJBA 3KPMA 5C0IB 4HFUH 4KROB 4JFOA 1QTYT 5J6GA 1RUQL 4OIAA 3NGBB 1M05B 2C3XA 2ITCA 1MCLA 3EYFA 3UTTE 4L3ED 1NMBL 2E7HA 3QJHB 3WEXB 3FT3B 4XH2A 1FVDB 3NFNA 4HKBB 1HDMA 2XA8H 4JFDA 1A4KB 4YH6A 1JGLL 1NAML 3ZMRA 1PEZA 5AUMA 1KNOB 2NXZB 2OZ4L 1WUNT 4DGVL 2PNDA 2VZOA 3F58L 4J3XA 5MI0B 3ARWA 3SDXA 4XI5C 2R4RH 3CK0L 5J1TC 4G6AC 4NQSB 1GIGH 5FF6A 3KPSA 4JPWH 1VFAA 1U3YA 4OF6A 4D3CH 1DVFA 2A6JA 3PHQA 1OPGL 1OW0C 4YXHL 1SJVA 5IB5A 3OPZL 2AQ1A 3W9EA 5EOTA 2NYYD 2ZOKA 4KPHL 1VACA 3I3DA 4IOIA 4M1DL 5DUBA 2EDJA 4IMKA 2YA0A 4JN2A 4Y7MA 1Q0YH 4FFZL 4KVNL 4OZGF 4RFNC 3B6SB 3KYMA 3DX8B 1MCBA 2VDLL 5EBMA 2XNAA 1KXTB 3UTSA 1AGEB 3UTQA 1CZ8H 3SGEH 2F8VA 5KVDL 4P3CH 2YPKB 4DUXA 5D7JC 1FL3A 4PY8J 2GIYA 4K3GA 3SQOH 3MLXL 3VGHA 3I3EA 1EHAA 1ZT7B 4WHYG 4PLOB 2BVPB 2XQYG 4JJ5B 4U6HA 1GGUA 3TNNA 1VB9A 2HRLA 3P9LA 2VQTA 4I2XE 3RVWC 3G6JB 3HRZA 4NQEB 5DD0L 1XIWD 2KKQA 1VFOA 3WIHL 3UTPE 4PS4H 1T21B 4PJ5E 1R3JA 3G5VA 5BV7C 2DM4A 1IGFH 5IMLA 5DRWB 5HHPA 2NY1D 2X10A 1A7BA 1HI6B 2V7HB 2W0KA 1NCAH 1CVRA 5IFAL 1L0YA 1CGUA 2NW2A 1S5HA 4XPTH 3KPPB 5DVNA 2DLIA 2R1XA 5C86A 5C09D 4JHWH 4PPTA 2BK8A 2DLFH 3GSNH 2OSLA 4BUHA 3QFDB 3HR5B 1FZJB 2YHGA 5C0CD 3L5XL 3NTCH 3GBMH 1BQSA 3VXMA 4U2ZA 4TOYH 1S7XA 3IT8D 5FUZL 1I1CA 4K94C 2N7BA 3D0LB 3FQRB 3MRIA 3TH4T 4FMKA 2ZKHL 3DO7A 2OM5A 2YEZB 1JHLH 4ZO8A 4I5BB 4PJXF 1EFXD 2H8PA 1U8NA 3N0PB 5I71C 5D5MF 4YDKL 4KRPC 1PX3A 3H9HB 4WUUA 1A1NA 2XTLA 2XZZA 2FDBP 5EORL 3ARSA 3BPOB 1KG0A 2I25N 3VDCA 1XGTA 4KDWA 5CEZH 2HKHH 3BIKA 1MI5B 2GCYA 5IB2B 3FO2A 4AENA 1MRDH 4UQ3B 2E5EA 3P30L 4ZODA 4TSAL 1GZPA 4OF5A 2JJWA 2V6HA 4HPOH 1PZ5B 2X89A 1KLUB 3ZKMC 5ACZB 3IFOB 2FZ3B 5C0EA 2O5ZH 1RZIB 1ONQB 1V8HA 3G6JE 4NQEE 4PRHA 5ERWA 4ZFOA 5L7XL 3MJ8B 3E2HC 4G5ZL 5F8QC 1BJ8A 3O9WB 5C0NC 1ORSA 2P5WA 3F7QA 1WV7T 5IKCA 4JO4L 4N5EC 3WLWD 5T1MA 3NH7L 3D85A 2JCCA 3EW3B 1WBXB 1JPFB 3ORJA 5FO9B 3EJZD 2CDGB 5GS1B 4OFKA 3KS0J 2A38A 3QWRA 1BWMA 1CR9L 3BZ4A 1ZT1B 3MLWH 4L4VA 3QUXC 1I3VA 1MHPL 2NY6D 5ISZB 2EH8H 3WD5L 5INCA 3ZKND 1NGYA 1H5BC 3EDJA 5JTWA 3L3IB 5I1EL 1QSFE 3BSZH 4K7FB 2J6EA 9CGTA 2XZCH 3HG1E 1WVZA 4KKBD 4UT9L 1BBJA 4PJGA 4ZFGH 1GOGA 4Z7VF 5CBAA 2VZ1A 2D7TL 1IGIH 3W39A 4IJ3C 4GBXA 3GJFB 4NZTL 4M5ZL 5JIKA 2MCG1 5A2JH 3LKQB 1KYOJ 4AG4L 3RTQA 1X4XA 4KUCD 4XX1E 3U1SH 4NKQB 3E6HA 2CK0H 4RGNC 2HLFD 4U33A 4P2RA 5L8KB 1D5MB 4J3VA 1W72B 5C6TH 2R2HA 2JIXD 3C9NA 4N1HB 4OAWA 5FCUH 1MI5E 1NUDA 2B8OT 5C0BA 4NHCH 5JZ7C 3SDXF 3OKDA 1IQWH 3HC0A 1KB5H 4KFZC 1TCRA 3QIBC 3ZE1F 1HXMB 3TVMD 3MBEB 3LRSA 4K3DH 3BDYH 1MJ8L 4IOFC 2Z31A 4X6FB 5MEQA 1UEYA 4ZD3L 2HVJB 4OB5H 5C7XL 4L9LC 4CKVX 3LB6D 4U1SB 2J3SA 1ND0A 1ZE3C 3DRQB 4EBQL 4AIZA 4BFIA 3DX9B 3VFUB 4GMSL 1T0MA 1KELL 1G9NL 1NCDH 5HD8D 5E4EC 4K3HA 1EJ6A 2AKRB 4M93B 3BEWB 4PRDB 3MRJB 2EYTB 5F89A 3RIAK 3SCMC 1QKZL 4NNYB 2QHRH 3CFBB 5I75C 2Q20A 3VWJD 2UZXB 1NMAL 4NYLA 4MCZA 4UB0H 4DCQB 4NQDD 4X7DC 4OI7A 3ZDXF 2AJXH 5ISZE 3PNWB 5T33H 4M8QB 5IB3A 1KV3A 5E7FA 4R90H 3MGAA 5FB8B 5CSGA 2EO1A 2FJFA 3JV6B 1KEMH 2GJ6B 1NFDE 4TTGA 1R5VA 3VFTB 1Y6MR 2ZUWA 4MSWB 3BN9D 4OGYL 1S3KL 4NUGL 4QHMB 4UNUA 4L4TE 3U7YL 4KKCD 5D6DA 4XNMA 3N50A 4JRXB 4Y4HC 4JVUA 2R8SL 5D1XA 3TV3H 1U3HD 3M1BB 4LEOB 1AKJD 5HHQA 3SDDB 2VLRE 5BZDB 4OD1H 1B0RB 3IJHA 4P5KA 3HZMA 3BH8B 1YMHB 5DRXA 4UT7H 3MA7A 2W9EH 4UDTA 3JV4A 3VD4A 3WE6A 1LDSA 4RMQA 4LRNL 5I17B 2GI7A 1U92B 3I75B 2AJSH 2BNRD 2COQA 1MJUH 4ELKA 4LQ1A 2R0LL 3ULVH 3DWTA 2V17L 1OWRM 2MHAB 1FVEB 5DHVB 5JW4N 5E8NA 1LO5A 2Z4QB 3DETD 2NY7H 5C0JB 4X8JA 5LXGL 4KZDH 4U6YB 2QSQA 4P2YA 4KJWD 4DVBA 1D6VH 1CYGA 5E1HB 1UJ3A 2QSTA 3HNSL 2V2XA 1XR8B 1CT8B 3DMMB 2VIRA 4MAYD 3NA9L 4U1HB 1P7QD 1XF3A 3BDBA 5B38G 2XN9A 5DJAB 1T83C 2KQMA 5IESL 2BNQB 1WQVT 4WDIB 1PKQA 3IDXL 4PJDA 4HWUA 4PRBA 1U8JB 1T1ZA 3O6FC 1BHGA 4LASH 3U83A 4EDWH 5ICZA 3O2VH 1H3TA 5L2KB 2VDQL 1VPOL 2F19H 3MMEB 4I0PB 3R4DA 1AJ7H 3LH2L 2WANA 3LEVH 2ZCHH 1CLZL 1KYOK 4O5LH 5H35A 4G43B 3BFOA 1XF5B 1E27B 5GIRA 5HYJA 1I7UA 3PWPB 3OJDB 3VXPA 2HT4D 1J0YA 3PL6A 3QPQD 4LVOB 1UENA 3ZT6A 3PHSA 4P99A 3OKKA 4MNHA 4KK6D 5GISH 1JFQH 2DJ4A 4ZPTB 3F7YB 2ZNXA 4G9FA 2X4NA 4LOUD 1JWSA 5EO0A 1JMXA 3MA9H 4ZNEA 3BN3B 5E8EB 4MB3A 3QIWA 3IDGA 4D9RD 5JPMB 2FATH 3RNQA 1MOEA 1AGCA 2FJHA 4MJ6A 5J1SC 4GQ9L 4C83A 5B38B 1JNLH 3QI9C 3DIFA 3S4SG 2Z35A 5GGSB 4X9BA 1PEWA 5DMIL 2WWMD 4DGYH 3BOVA 4V1DB 5IJKC 4KKNA 5TFSH 1BVLB 3FONB 3EAKA 4FQXC 4OZFG 4UV7L 3OKMB 5DGRA 2NTFB 3I02B 4UINH 4NKOA 3KYOB 4L3EA 5F9OL 4HCRL 1LEKB 5K9KB 4HWNA 1T03L 3ILPB 1YNLL 3LKNB 1IL1A 1D9KC 1U91B 1FGVH 3TWCH 1G7LB 4QRTB 2GT9B 1ZHBA 5CJXA 2Q86A 5J13B 4FQIL 1TVHB 3LIZL 2XYCA 3PV6A 4WFHE 4BFBD 5GS3A 3MV11 1SYSA 2IAND 4HEPG 1JV5A 1R5WB 3G6DH 3RVTC 1QACA 5C0DB 3T09A 2FYYB 1OP3K 5KS9F 1JGVL 1A21A 5JDSA 3OB8A 5CUSH 3FMGH 4YC2B 4XP5H 1QVOB 1FAKT 2BNQE 3S4SB 4X4YA 3SGJC 3IU4H 4S10A 4YX2L 4JY5H 1HHIA 1HSAA 4PJ9C 1RSFA 2OJZH 4OZFB 3C60D 2VQ1B 1JTOA 3FQTA 1G7MA 3G5XA 4I9WD 3O3BA 4OQTH 5L2KE 4WUKL 4JKMA 4X4XB 1KCRL 4HLZG 2NZ9C 2MKWA 1G7HB 4MDIB 3O8XB 5IBLC 1N8ZA 4XGZA 4UV4H 5D7IE 2RB8A 3OXRA 5EC1A 35C8L 4BK5A 1ZT4B 2NY5L 4QOKE 2PF6A 3MUGA 3RP1A 3PWPE 3BPLB 4KI1A 2ATPA 1BVZA 5CP3H 5JQ6H 4GG6B 4A2MA 4NUJA 5HHOD 1CGSL 1TQBB 3RUGA 3UPRA 5FO8A 3CFCH 2C3VA 2VDNL 3C2SA 4L5FH 1XIWA 3RA7L 4NN7C 1DBBL 3T0AA 5C2BL 4TUKL 4I0CC 2X4RB 1S9WB 2NTSP 3HR6A 5DLML 2Y06H 5JLZA 2VLKD 3LHPL 1U8PA 3VXRB 3HMWL 3LQZA 2H2PD 4ZXBB 4RFOL 4V1DE 3DURA 4K3EL 3MOBH 3MOAH 1BJ1J 5EZOL 1NBQA 3FT2B 2CDEA 4XCCL 2WMPA 1FYTD 4QHNA 5BQ7A 1CICB 1I3GL 1KN4L 5MP6L 4KAQH 1NL0H 1QLFB 2NXYD 4YHKH 3AREC 5DDHB 5C09A 2MJWA 3FO0H 3EYOB 3RY6C 3T0VA 5IQ9A 3CVHH 1V7ML 4L8CB 1ZV5A 2AXFB 5C0CA 4XAWH 3TBVA 1F90H 2F5BH 2ICWJ 2YA1A 3MRMB 2GTZA 1TZIB 4ZSOA 2X41A 2BOCA 4LLUA 4P2QB 4TNVK 1MH5B 4JPVL 3PWVA 4KK5C 1JZ8A 2P8PB 4ZAKD 2J2ZA 1RFDH 1EFXA 1SY6A 4HAFA 4M8VA 4V2CB 2IBBA 4K9EL 1EAJA 1AO7E 1FIGL 5HGHA 1CTOA 2AK4B 3IGAB 1CK0H 3HUJA 1D6EA 1DANT 4PJHF 2EXYC 4CU6A 3S36L 3K7UA 5FOBA 5EBWB 2CUIA 4LCWD 1YECH 3F7VA 4AEIL 2D0FA 4GXUM 3O81A 4MYWB 3QA3A 1JPTH 3V4UL 3MCKA 3GMOA 4QRUA 4R4BB 5IK3B 5F1NB 3MRCB 3VG0H 1EZVX 4F37K 2DQFB 4HH9B 4RMWA 1MEXL 5EBLA 1T80A 2DM3A 3MXVL 3GO1H 1MRFH 3RNKB 4FZEH 3ZHLA 4HIEA 4S1DD 5IVXA 3IKCB 3VRJA 1VFBB 4PV9B 1Y6NR 3ULVF 1XCQB 2F53B 3P2TA 5B39G 1I1RA 1KBGL 4QRPB 3QIUC 5H37G 1TITA 1IC4L 3WJJC 3C6LD 3CSBA 4FQLH 2GSGA 1JL8A 3HE6B 4KH2A 5F6IC 4JR9L 1RZKC 2RCSH 3VXRE 3CU1A 4M7LL 1N2RA 2JK5B 4BJLA 4U7MA 1BOGA 4OZHF 4X5LA 4ERSL 4X98A 2VDKH 1EGJL 1FGNL 5T3ZE 5BJTB 2RAMA 4MQTB 2C26A 5I19L 4MWFB 1OQOA 4QXWA 2IJ0C 3BGFC 3BMVA 3QQNA 5T3ZL 1RUML 1TENA 3O9WD 2VKXA 4S1RL 1A9BA 3HNVL 1UZ8B 5MERA 1K9TA 1WZMA 4KRMB 4KGJA 3HAEA 1HHHB 4P2QE 4POUB 3QRGL 5H2BB 4F2MB 5ITBH 4DN4H 5GS0D 1IZKA 5B39B 2NLJA 4ELMA 1A6TA 2GFBA 5DHYB 4NOFA 3IXTB 4OBRA 4Z8FL 5D2NC 5FO7B 5T3XH 4WHCA 5FA4B 1PW3A 5GPRA 1UA6H 3GSQA 4WW1B 3H9SD 1FG2B 4QRSB 1YC7A 3LRHA 3H6JA 5FUCC 3D39D 1AR2A 1WCBB 2JIXA 3BQUC 1MCWW 4H88H 5B3NA 1B0WA 2AI0L 3SGDH 1KULA 4HLJA 3LV3B 5HDBF 3GNMH 3QDGB 2SEBB 4IRSD 1CG9A 5IT2L 3BE1L 1RK0B 3PXHA 4ORGB 3QUMB 4RA3A 3TVMA 4NKMB 3L5WB 1VCAA 2OI9B 5J11B 1P7HL 4JQVC 2WBJD 2RR3A 4KQ3L 3DTXB 3N9GL 2EC8A 3NACL 3MRDA 3B5GA 4PJAB 4XNUH 3TZVD 1QR1A 4MJ5A 4HBCL 4MNQB 2EE2A 2XPGB 5DFVD 4BUGA 3RGHA 1CTNA 2F53E 2F58L 5ID1A 4QRPE 1BF8A 2NW3B 3S36X 1RJLB 3T77A 1T1WA 1HWGB 5TDOB 2O5YH 1DVFC 2AEPH 4MS8C 1AI1L 4HGWB 5SWQA 1XZ0B 3ECBA 3D3VE 4NQTA 5ILTL 3VWJA 4ZOAA 3K74B 4POZD 1B4JH 4QNPE 1DFBL 3IETA 1DTUA 5DEGA 2W92A 4NQDA 1I4FB 1C16B 4I18A 3MV7B 1JE6A 4BSWB 3MBXH 3R0NA 1T66D 4XTRD 5GSVB 2OQJA 1KJ2A 5CJQL 4J23A 5HYSA 4CMHC 2OP4H 5F21B 2LQRA 2VXTH 4XBGB 5H94B 3CU7A 3MLZH 4TTDD 1QHOA 3IFNH 2CSPA 2YA2A 5HHVH 4ZUSB 1LO2H 3TYFB 1SEBB 1A7RL 1U3HA 4JFYA 1AKJA 1JUFA 1QO3A 1ZHKB 1B3JA 1N64H 2E9BA 2Z93B 5EIIB 1VESA 1RIVL 3QBTB 3QUKA 2XQBL 3MROB 3RDTC 1DSFL 2PW2A 4PY7B 1LO3L 1FLRL 5HHMB 1U8IB 4YWGH 2Z92B 5D70L 5AG9A 2FEDD 4C56A 1KTDB 2OL3H 1EAPB 4P4KB 5AZEH 4BKLB 3G6AB 1UCBL 2LFGA 2EDHA 1U8HA 2IPTH 2BNRA 2R15A 4Z6AT 4G7YL 1C12B 5JMOC 1OSZA 4XCNB 3B2UC 4JDVB 1YEFL 2NY4C 2NCMA 5AAWA 2D0GA 1A1MA 2R56L 1MCHA 1OWWA 4JRXD 3GM8A 1NCWL 5JW5A 4Y19A 4ISVA 1U93A 1A6ZA 4MD5A 5FIEA 2R4SL 2BVOA 1UM6H 2FO4A 3HUJF 3H42H 1AXTH 4I4WA 4MAYA 4M1DH 1P7QA 3G9VA 1NEZG 2E9JA 2ED7A 5TDPB 4FFZH 2OL3A 5E6ID 4Z5RA 4WW2F 3RZCA 3N1PC 3F65A 2BDNL 5DA4A 1DLHA 3QXVA 4O4YH 3EFDL 4RWHA 1DLFH 1MCPH 2AXGB 2BZDA 4PRAB 2B0SL 3V4VL 2H1PH 2LVEA 2D03L 2XTJD 2Y25A 1YMMB 3VXNB 2YC1B 4P9HL 2ESVB 3ROLA 4YK4C 2XY2A 5FUOH 4PTTA 3RWFA 3LQAH 3P0GB 4O58L 4U05A 2PUQT 3K4AA 4NPYA 3MV7E 3MV9B 5HGDA 1V05A 3HMXH 1SM3L 3HKFA 5C70A 1MFAL 1FORL 3GSOA 5FAAA 1GOHA 1ACYL 1GAFL 4ZNCD 3GMNA 5IHZA 2XOTA 3TEUA 4JZOA 2Y5EA 1FO0L 4MVBD 4LP4A 4X9HA 3O6ML 5JXAH 2FGWH 3KS0H 5SV3A 3THMH 1NEZB 1X9QA 1G1CA 2X4SA 1J0HA 4WHDA 1JRHL 4FQ2H 3D87B 4L3CB 2DYPB 3INUH 1T1YB 2H26A 1QQDA 5EB9A 4PLNC 1KJ3L 2GTWB 4NRZA 1LWRA 3HMXA 1L6ZA 1F11B 5ESVA 2NR6D 1S8DB 1GPOL 5JO5B 2VDRH 2XKNA 4GKSA 4S1QH 2OTUA 1S5IH 1HEZA 3RWEA 3DSFH 2APFA 4WV1A 1W0WA 3Q6FB 3JWOL 3BVNA 5IB1A 1YJDL 4HXBL 4YHZL 2CGRL 1UB5A 3CFDB 3CX2A 5E8PA 4JHAH 2XFXA 2ZKHH 4X6DF 3HI5H 4XXCA 3AM8C 1I8MA 2KUTA 4OCXL 4NDMA 2PCPB 5LWYL 3VA2C 2IANA 3BT2L 1FFOB 4NQUA 3X3GL 5DD3L 4YDKH 1KCVL 3MFGB 5D7LD 1LO0H 25C8H 3HLAB 3BKCL 4GKZB 3QXUA 2DD8H 5E99H 1Z3GH 4F7EB 5EFIA 1I9JL 2W0PA 3PIQA 1YUHB 2R0WL 5C07E 1Y0LB 1ZVHA 5CJ5A 5HJ3A 5ID0B 1AD9B 2QQKH 1A9EA 3CDFA 5DK2A 3P77B 3RTQC 1RZ7L 3HZVA 1AC0A 1UGNA 3C60A 3P30H 4HKBA 2BERA 4TSAH 1YMME 3C8KB 3IDMB 1C5BL 2DQCL 2PTTB 3EFFA 3NFSH 5IROA 4KI5D 4M7ZC 4Y8AA 4KDTC 2PR4L 1DE4B 4X6BA 3W0WD 3AS0A 2FWOA 1UACH 3VXUD 4PRPB 1CFSA 2CMRH 2BC4B 4LSPH 2JB5L 5HHOA 4QTHA 4X6EB 3P4MB 1NGPH 4Y1AB 1MCOL 1MWAB 1QSEB 3FQNA 4F15B 5KSAB 1KEGH 3NCEB 3JSSA 3GKWL 1KPVB 5J1AB 4W4NA 4GRLD 2DQGH 2X05A 4X7TB 1AGBB 3NBNA 1OP3H 4R2GB 3WXVH 4CNIB 5B3JF 3BAEL 2ITDB 4OF7A 2VLKA 4MA1C 2J1KA 3VFNA 4TPRL 1EEZA 4LSRL 4TUJB 1MCNA 1AGEA 3SE8H 4I77L 3AUVA 4M7KH 5I30H 2VLJD 5C6PB 3DOSA 5I1EH 5F7NC 3TCLB 1FYTA 1SBSH 3GBLA 2YR3A 3O3DB 2FLBT 5LKNA 3EHBC 4YIQB 2NNAB 1QFOA 2CH8A 4NQXB 4U31A 1RAMA 4X6CF 4KQ4H 2D7TH 3RVVD 4UAOC 1HYSC 3T2OA 5AEAA 3SHSA 2X4UA 1A6WL 4M5ZH 5D6CB 4PJ8A 2IGFH 4J1UB 2F74B 4M6NL 3QUZD 3PABB 4PRNA 3GRWH 3BPCB 1I9EA 4WHYH 5K9QI 2BFVH 3P3YA 1QFPA 2DIBA 4WHTB 2IPKB 2ADIA 1I3RA 2W07A 2OXGA 2V7HA 4ZAKA 2HT2C 1OLLA 5D6DC 4A6YH 3S5LG 3HZKB 1T7ZA 3EOYG 5IV2B 3J8F7 5D1XC 1LGVA 2JB6A 1FE8H 3KPNA 4LCWA 2X4TB 1M7IB 4HWEL 2VC2H 5DJCB 5BOZG 5IQ7H 3RKDC 5K59F 4FFWC 5GS2D 2LU3A 2CIIB 2IAMD 5I2IB 3OGCB 1YEDA 1MPAH 2HFEB 2AAVA 4Q0XL 3FTGB 4PGDA 3ALXA 4HUUB 2OR9L 2RGSA 2X42A 3VCLA 5LVEA 2V9QA 1IGTB 4GMSH 4GAYB 3GUTB 1CL7H 4RFEB 4A6YA 4Y1AE 1QSEE 3DX7B 4DFHA 2AK4D 4PGCB 5BV7B 1I7TA 4XC3L 2EIEA 4P0DA 3C6LA 2G5BA 3FT4B 3IVKA 2VWEC 2YD3A 1FRGH 4NHUB 3WS6A 1N0LA 1FP5A 2YKLH 4WGWB 2XZAL 5BS0D 3S5LB 2CRIA 5T1KB 3KYNB 2HFTA 5CJ8A 1FH5H 2VKWA 3MRGA 4UI2A 3HI1A 5EUOA 5I1DA 2KDGA 4OLEA 3BYTA 1RUAL 1IEBB 1W0VB 5FHAL 4PV8B 3CDGB 3PJSB 3ARBB 3SKNB 1EJOL 3C6SB 3FO1B 4OGYH 4H25B 1S3KH 4NO3A 4D9QE 2GY7B 1R3IH 1GC1C 5E1AA 3TJEH 5HGGS 3O9WA 4TSCH 4OM0L 4RGMB 1EA9C 3STLA 1IAIL 1KIPA 4OGAC 4XBPA 4NZRH 2JJSC 4PREB 5GGTL 2HJKA 3BKJL 5J12C 1DUZB 3BWAA 4J3SA 4HK3J 3GJFH 5I76A 4KMTL 3D69B 4ZUWB 1FZKA 1F2XK 2BVQA 3NOIA 1NBYA 1TLKA 3RI5K 5GS1A 4KRPB 2UYLB 4BA8A 3H9SA 2WP3O 4HKJA 1I9IH 1CLOH 2DWEA 3D39A 3L3DB 3MGOA 3L3IA 4D8PA 4GKOA 4QT5A 1W72H 3L7EA 4KK9D 3ARDD 4ONHA 3QDHA 4U1KB 2FNBA 4IRSA 3LEYL 3VD7A 3VXOB 3SE3A 3LCYA 3KLHD 3DROA 3BGMA 5D2LE 3S96A 4YDVA 2F8XC 3C5SA 3GMLB 2Q3AA 1TTFA 2WBJA 4ODWB 4HZLB 1HNFA 1VADB 1XF4A 4NN6C 5DUPH 3TZVA 3SJVB 4XPAL 3IF1B 2YBRA 3CVIL 3E2HB 2W0LA 4HQQL 5HVFB