4NOFA

Crystal structure of the second ig domain from mouse polymeric immunoglobulin receptor [psi-nysgrc-006220]
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
111
structure length
111
Chain Sequence
b'GGLPSDTHVYTKDIGRNVTIECPFKRENAPSKKSLCKKTNQSCELVIDSTEKVNPSYIGRAKLFMKGTDLTVFYVNISHLTHNDAGLYICQAGEGPSADKKNVDLQVLAPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymeric immunoglobulin receptor
publication title Crystal structure of the second Ig domain from mouse Polymeric Immunoglobulin receptor
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 28
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nofA00
5KN5A 3EFDH 3FT4B 5MHSD 3IVKA 4XNQB 1XCTB 2O5ZH 1OLLA 4CU6A 5BCAA 4HKJA 3VFSB 4LLVA 1T0NA 2NY4D 3HG1D 4NFDA 3NZ8B 4X8JB 1C1EH 5KW9H 5FM8A 5GS0C 4LQFH 3QYCA 1U8IB 2A83B 4AH2B 2ZCKH 1BVLA 1E6JL 4ZFGH 1PKQA 2IGFH 3IDYB 4WIQA 1DEEA 3QRFM 1F13A 4C56A 1IGMH 3HPJA 4KKCC 5D72L 3QUYC 5DRWB 5BV7L 4P9HH 4W4OA 1CICC 5E6ZA 1D5IH 3VXMD 1Z6JT 1OW0A 3DUSA 4K3DL 4F57L 3ZTJG 4G80A 5SX4I 3BP4A 3T8XB 2YEZA 4PV8B 2DBJA 4DKFL 2Q7NA 3QUXA 2R1YA 3FFDA 5A40E 1KN4L 1CXFA 3SDDD 2J8UA 3P9MB 3QNZA 2EYTB 1MREH 5D5MF 3M1BA 2MJWA 4K3EH 1CR9L 4P9ML 3DARA 4NHUA 5I76B 2O5ZL 1QBMH 5AYQA 3QNYA 2PXYB 1UA6L 2AJYL 2DQFA 2CSPA 4XMLH 1C1EL 1FYTB 4JDZA 4LQFL 2XKUA 3DGGA 4OI9A 4ODBD 1VFMA 4LMQE 4U1SA 5I74C 4TNVK 1P84J 4ZFGL 2F53B 1P4LB 2IGFL 1S7SA 2IAMD 5MEQA 3QPQC 4ZFFB 4JFDD 5IBUB 1IGML 4MJIE 4P5TC 1YNKL 1NCBH 3BP5B 2MPAH 5F7UA 1D5IL 4UUJB 5IHUL 4MCZB 2F19H 1EERB 3L95A 2GAZA 4G6JH 1S5IH 4O51B 1XGQA 3TIEA 4BFIB 1HILA 4G8EB 1PBYA 4OLYL 1OGAA 5E6IA 4P5MB 5FM4A 5CAYB 4PJCA 5DFVC 2EDJA 3RX7A 4KROD 1X5ZA 2FZ3A 2IPTH 5FB8B 1QHPA 2BNQD 5B38A 2DMCA 1OTSD 1CXLA 5CHNA 5HHOE 3D87B 4FTVD 2OXHA 5F1SA 1QLEH 2P8MA 5DMKA 1CD8A 5EO9B 3T0XA 5DJ8A 2KZ1B 4XMLL 3U36A 3PDOB 3WIFB 4WNQA 4LEXL 1AR2A 2OJEA 5DJXA 1U3HB 2BDNL 1T3FA 2XQBH 3V5KA 3EFFA 4XNZC 2BNRA 2FJFB 2YD7A 3QA3A 2ESVE 2YK1H 5KSVB 3VA6A 4P2QD 1R3KA 4GS7B 2OCFD 5A2IH 1TZHA 2GK0B 2CJUL 3O3UN 1J05B 2BX5A 3QIWB 1U95B 1A4KA 2Y06H 3LN9A 4ZOCA 1NCBL 4C58B 5CUSL 5IB2B 4G6FB 3MBEC 1TCMA 2DDQH 5GIRB 4OD1H 4G6JL 5JPNB 4IRSA 3I3BA 3BP6B 5ERWA 4YZFF 4NT6B 3O4LA 3T4YA 2EE2A 4NRZA 1LEGB 4QNPF 4MAYC 2QKIB 3S3PA 3FRUB 3JV0A 3RUGF 1MIEH 2EDWA 2AXGB 1MFDL 1JMXA 1W72H 4U1NB 4NNPH 1GGYA 1KJMB 1NAKL 3BMWA 4LPYA 1REIA 5L8KB 1XGTB 4EI5B 1ZHBA 4JY4A 1DANT 1NANI 1ZEAH 2EIDA 1MIMH 3OJDB 1NC4D 2BSTB 3KLHC 1RMFH 4Z7VB 2AKRB 2OM5A 4P59H 2ZUUA 2YSSB 5DEGA 5L9DH 3WNKA 5A3ID 2XQBL 1A6UH 1EJ6A 4K55A 3TNMB 3PIQB 4CJ1A 3TO2B 4FXKB 3VGGA 2Z91A 5E9DE 4TTGA 3M8OH 3HI5L 5EA0L 4ZAKD 4X9HA 4XNUH 4X6CE 4XBPB 2EO1A 5CFHA 2R15A 2DDQL 4XVJH 2HJFB 4OD1L 3KPNA 3D1MC 4XCCL 3WJLC 4DKDC 5J12C 3Q48A 4ONHA 4O5LH 3TGXA 3S98A 4RRPA 4MLSA 2VZOA 4YUEL 1XR8B 4YDIL 1WBYA 1H3PH 2F54E 3MLSH 1YEJH 4JRYB 2AGJL 1MIEL 3RZCC 4LCWD 1C12A 1W72L 4Y4FD 1O0VA 4NNPL 1HYRC 2XOTA 1WEJL 2B2XH 4J3XA 4HKJB 3GSXB 4NM4H 5MP6H 4LLVB 1AHWA 3RAJH 1ZEAL 1MIML 4NQDE 3U2SA 2VDOH 1RULH 4M62L 1RMFL 4JPKH 4P59L 2I27N 4OV5B 4UQ2B 2QQLH 4PRHA 3VI3E 5ITFB 1SJHA 5ID0B 1BVKA 5I16A 2X05A 4YHZH 4JM2D 1IKNA 2VO5A 1IFHH 3SE3C 1X5AA 3WS6A 5D7JC 1DQJB 4QT5A 1KELH 5B8CB 2E6PA 3M8OL 4X6DF 3HPJB 1X4YA 5TF1H 3MRIB 5GGRB 3BMVA 1FVCA 1T22B 1NGPH 4KAQH 1K8DA 4KQ3H 4GXVH 3QHTC 4TVPD 3S5LG 1U8KA 5FHBL 2GK2A 3U0PA 2YEZB 3QG7H 3MC0A 3WV0A 1NMCC 3QI9B 3QEGH 3U9UA 1MCWM 4Z7QE 3NN8B 5CZVH 2DKMA 1FGNL 4HQQH 3MLSL 3UEZA 1RZJH 2J88H 1F2QA 3NMEA 4X6FA 3Q6FA 2IH3B 4IM8A 4KY1L 1NL0L 4HK0A 5DJDB 5MP6L 3QDMA 1INDL 1LK3H 4LSTH 4OKVB 2VDOL 3NFSL 3GMOB 3DXAB 4JPKL 5E5MB 5JHDD 4HKXA 1YEGH 1FFNA 1Y6NR 1NGWA 4C4KT 1QZ1A 1W0VB 3BWAB 4FABH 3TZVD 5MEQB 3GZKA 4Z95H 3FT3A 5TF1L 2WZPD 4GQPH 3MPCA 3BPNC 1PG7X 2H45A 3U7YH 4X5XB 1IEBA 5DUBA 3FFCE 4KQ3L 4GXVL 4PJ5A 4G8GB 2D0HA 2PR4H 4QHKI 2M26A 3RTQD 4WWKB 3EYFB 3QEGL 4PJHF 4Y16D 5E6IB 2DN7A 2PO6B 3LD8B 4KJPC 5CZVL 1UJTA 4P2OC 4D9RE 4APQB 5B38B 1EUUA 1BJ1J 2BXZA 5HPMA 2VLKE 3K46A 1AIFA 3JV6A 5CHNB 3RU8H 3LN4A 4TVPH 3OF6A 2VERN 3I2CL 4NWUH 2RB8A 4LSTL 5DJ8B 1U91A 1KJ2H 2P4AB 2UZIL 4JY5L 2OSLB 4LL9A 4HFUL 4JRXE 1T3FB 1YEGL 3PQYA 3VXPA 4N8VG 1QBLL 3GI9L 5IVOA 4RMTA 3EOBB 4FABL 3BJ91 2UWEF 3O8XD 4ZOEA 1OAYH 1ONQA 2X44D 4UILL 2MKWA 4MXQD 3U1SL 2R4SH 5IFHH 1A4KB 1YQ2A 4J23A 1ZT7B 4LASH 3WFEH 3O6FB 2PYFA 3LKPB 3P4OB 1QFOA 3PJSA 1OWRM 4HCRL 2X4TB 2X40A 4X7TB 2IG2H 3RWGA 4LLMB 4OBSA 4OD3L 4HAFA 4FFWC 1IE5A 3MOBL 1MWAB 1MHHA 4HWUA 3ZDZE 1I7RA 4TQEH 5TQ2L 4CVZB 1I8IA 1D5ZB 5DMGC 3HR5A 4TVPL 1DQDL 1O7SA 4X6EA 1UZ6E 3VFPA 4NFBA 4NWUL 3S96B 5B4MC 4AZ8A 1MCLA 1NUDA 3PWNB 2YUVA 4B50A 1U8PB 1G7MB 4E41A 4G8FB 4L3EA 5HYSA 4N5ED 1FH5H 3NGBB 1OAYL 1VEPA 3IDIA 5C70A 4XP6H 1PDKA 3DURA 3NCFB 2NY2C 4LASL 3MNZA 3DMMA 5T1KD 5M95B 1G9ML 1F45A 2NZ9D 1I9JL 5JW3L 4X9FA 1XF4A 2IG2L 1WBZA 2YBRB 3MRCA 1WBYB 4AL8L 1A6PA 2K7QA 5DS8B 4RWYH 5MENE 3ZKXB 5JXED 1QTYT 3DYOA 4OCNC 2CXGA 3LQZB 1NGZA 5FKAB 3ROOA 5DQ9B 3MO1A 1DVFC 1UVQA 2EDTA 1I1RA 4H20L 4XH2B 5FIEA 2DMBA 2HRPH 2X4UA 4QOKD 4MGXA 4J3SA 2B39A 4OM1L 2XZQH 4MZ2A 1MQ8A 2P7TA 3F62A 3QDJE 2HFEA 4IRJC 2ICES 5E8OB 3SKMA 1CDJA 4QT5B 4RGNB 2Y7QA 4FZ8L 4IDLA 4KTDH 1F02I 1T83A 3B3IB 4HLZH 3T09A 2NY5H 5DMIH 1XF5A 4AG4H 3UTQA 1FVCB 4M7KH 1CGXA 4FMKA 1MFAH 1DUYB 1K8DB 1ZWIA 4LRNH 4P5KA 4YAQB 4N90E 1E27B 3KYAA 2VQ1A 4JVUA 3CLEH 5JLZA 1JCKA 4GXUM 1U9KA 5IB1A 1X4XA 4OFVA 4POZD 2PKDA 4RFNB 3SOBH 4XP9L 4YHLL 5LCVH 5CEZH 3TESA 4LSSL 3QCVH 2Q87A 4QYOA 4GRLB 4P2RE 4NSKA 3PWJB 5I19L 1D6VH 2W59A 3QDMB 4LCYA 5F21B 3CK0L 4X7CC 1DLFH 6FABL 2HRPL 1RU9H 1DCLA 2VXUH 4EI6A 2XXMB 1KSRA 4RAUA 1MI5A 1NGWB 5FO8A 5D5ME 2Q6WB 1OSZA 2AQ2A 3HC3H 1S9KC 2AV7A 3VWKB 1H0DA 1U42A 2DI7A 2HFGL 3VG0H 2FL5A 2FX8H 1BPVA 4GW1B 5DQJB 4RISH 1VKXB 5TH2B 4DW2L 5DUBB 5BVPH 4M7KL 3OKOB 3TCXA 3GO1L 3UTTD 5CBAB 2OTWA 4MVBD 3IU3A 2CDFB 2IADB 1P1ZB 1JVKA 1U3JA 4YNYA 4YHNA 3STLB 5DJAB 1NJ9A 3VGHA 4Z77B 2GUOA 4UQ3A 3RBGA 4PIRF 4NO3A 5CGYD 5LCVL 3NPZB 3VFOA 5HDOA 3QCVL 1EVTC 3RWFA 4UNVA 1AIFB 1U8QB 3LN4B 2I9LB 5D93C 1INEH 3EYSH 1HHIA 4PGDA 4GFTB 5F44A 2ZOKB 3MYZA 4RNRA 2AEPL 1DLFL 1U91B 4CW1A 1M6OA 5CJOH 3RL1A 3IGAA 2VXUL 3OKMB 3SDCA 5DK2B 2P1YA 1ZT1B 3UBXB 1FZJA 2YD9A 2FDBP 4PLJC 1TVBA 1IT9L 3HC3L 5TDOB 4HK3N 1ONQB 4ZUVA 3OB0H 5GS2D 3S88H 1G7HB 4U6YA 2HT3C 5IROA 4M7JH 4Q2ZB 1KEGH 5BVPL 4HFWA 4Y8AA 3ARGA 1QSFA 5T5NG 1VESA 1T66D 2CKNA 1HH9A 1T2QH 2JCCA 1AGBA 3MRNA 4KRPD 3QIUD 1JNLL 3LKQA 3MLXH 3SCMC 4U1IB 1IGJB 5ELIA 1LD9A 3BPLB 1F4HA 4JN2A 3ET9F 3MRFB 2EKSB 4L8SA 4NRYA 4UAOB 3CFDB 3EYSL 3BRDA 1MJ8H 4YZFE 3MROA 5IBUG 3JVGC 5D7IB 3U7AA 4P9HC 4QNPE 4LSRH 5CJOL 3GJFB 1HHHA 4JEGB 5KS9A 2PTUA 3RUGE 4N9GB 2Q8BL 5HYSB 1IARB 1JF5A 4ETQB 4UINH 2FYYA 3DVNB 2ZG2A 5GRVK 3W2DL 5K59F 5KJRH 5GZND 5DZOA 1XZ0A 3RWIB 4YPGB 3DMMB 4QRRE 5C09B 5HY9A 3BPNB 3AU1B 1XF3A 4EXKA 4GAYA 4QXUL 1ZLWH 1T2QL 2DQIL 1WBZB 5TDPA 3MRCB 5D71H 3VXNA 1R3LA 1QFHA 1BD2D 1QFUL 3MLXL 4OZFG 5E95B 5GS2H 2DICA 1B2WH 2UUDK 3HR6A 5J7CC 1XIWC 2OK0L 1NGZB 2CGRH 3UTSE 3KR3H 3MJ9L 3I9GH 4NQEE 3BPOB 5E8NA 5HGDB 4GG6A 4J1UA 4NZTH 3E1F1 1QEWB 3DO7B 2VKXA 2X4UB 3QAZB 4LSRL 1J8HA 2OQJA 5HI3D 1UB5B 3T1FA 2P7TB 3QNXA 1MCKA 2IH1A 5I18H 1YPZA 3T0DA 2WINB 4PTUA 1VFOA 2AXFA 4N1HB 1K4CA 5J6GA 4WTWA 3SKMB 3T0VA 1OP3K 3JXAA 4CMMA 1D7FA 5KJRL 2E27L 3G6JF 3JWNC 1A1MB 3G04B 1XF5B 2AJUL 3UTQB 4PJDF 1CD1A 1ZWIB 2L4OA 1X5HA 3BEWA 1NFIA 1JTOA 4A6YH 5FA4B 4EIZC 1R5WB 4ZO8A 4MD4A 3WMSA 4RSVA 1AO7B 1KCVL 5IB1B 5D71L 3ULUC 3KPOA 2K7PA 1KYOK 4M00A 3T2PA 4X6DE 3W11D 5BZWA 4PREB 5TE7H 1B2WL 1LMKA 1WIUA 3QFJA 1FFPB 3FB7A 3WSQL 4Q74A 4PJAB 1YJDH 4WFEE 4HUXA 2CGRL 2ZUQB 3KR3L 5EB9A 4G9FE 3GHBH 3RVXD 1K2DB 1LNUA 4LCYB 3H6JA 5IJVB 3QXVA 4OSUH 3HMWH 4HX1A 3BT2H 2APFA 4UDTB 4ZXBB 4KVNH 5I18L 1ZVSA 1VFAB 1OSZB 4XAKE 1MY7A 3BKYH 2C1PA 2OZ4H 2ATKB 3S36H 2R9HC 1FFRA 4OGYH 4Y0GA 4G7VH 3VMOA 1E4KA 1GZQB 2XQYG 2EDRA 4NJAH 5C6PB 4W70A 3ROLA 1A3LH 1OM3L 3RNKA 1A9BB 4OCWH 2OTWB 3MLVH 2L0DA 1YN7A 4YHNB 2W65A 3LMJL 1JTTA 1NJ9B 5GGSB 5JW5B 4LBEA 2VLRE 4IEFB 4RGMB 4KROC 5FCUL 3DYPA 3MLYH 3RGHA 2H32H 4NN6C 3RWFB 1BOGB 1OTSC 2MQCA 4NUGL 4ZNEA 2VZ1A 4Q9QH 3GHBL 4OKDA 4CW1B 3WFCH 1M6OB 1KYOJ 4NFCA 4PJHE 2DQGL 3SKNA 3IGAB 4OSUL 1RZKL 3BT2L 3AS1A 4F7TB 4WUUE 2FEEL 1FZJB 4MA3A 4JO2H 2XWJB 4YLQT 1T21A 3FOMB 2BHYA 2NXZB 3BKYL 5H8DA 1EFXD 1ITCA 4ZUVB 4EDWL 2J8UF 2LV4A 2BRRL 1CZ8H 2ZUYA 5I73C 3IJYB 2X5PA 2CR6A 3FOLA 1U58B 3P2TA 4I2XE 3HB3D 3MLVL 4PY8I 2IANB 3WEXA 1KULA 3KYNB 1FZOB 4YDKH 4ZUSA 3PL6D 4PJ7B 5J1AA 2JCCB 3C9NB 1AGBB 4ZYKA 4W6WB 4K8RD 5GISH 3MRPA 2P42B 3ARBA 5IKCB 3HI1A 4WCYH 5KANI 1I7UA 1LD9B 2H9GB 3UBXI 2AJZA 3MV8E 5KOMC 1ZGLP 5C0CA 4FXGA 1WAAA 1S7WB 4LU5H 4B5EA 4Q9QL 5INCB 4QCIB 3PHOA 2XZZA 5GGTH 3BD5A 1D5BA 1RZGB 1QQDA 4M7LT 3E0GA 2XZAL 2N4IA 5CJXA 3ULVE 4F3FB 5A3IC 3WN5A 4TYUA 3RQ3A 3EIFA 1BQLH 1AI1L 3MBXH 2Q86B 4YO0B 3BISA 4I3GA 1WCBA 4PJCF 1U92B 2Y36L 12E8H 1AP2B 4BZ1H 3TLRA 3VGAC 1AGFA 1D5MB 4ZAKC 1CZ8L 1L4IA 1RZJC 1KTLA 4DZBB 3D9AH 2CKBH 4HWEH 5B38G 4PRIB 3UJTH 3QUZA 1JGLH 1LK2A 4BSJA 1P2CB 5EIQA 2APBA 3FN3A 4V2BA 2GCYA 4JE4B 2HN7A 4PYGA 3QDGE 4WCYL 5FYKU 1W2KT 4JREC 3N1MC 5DJZB 4XNMA 4X80H 5A2JH 3QXAB 2VSCA 4Y4FC 2P8LB 1TNMA 5C2UB 1LO4H 3BIBX 1N6VA 4PS4L 5ICZB 3CVIH 4KMTH 3F65A 1VACB 3QWRA 5L6YH 2H2SC 4K8RH 1DBJL 2BVOB 3GEWB 3GHEL 3MV11 5BV7B 5ALCL 3T1FB 3MLZH 1BM3H 1BQLL 4Y2OA 4JM2C 2ADIA 2HVKA 5J6GB 3TCLA 4Z7NF 1WIPA 3LKSA 3ZKQD 4TNWK 4BZ1L 4OI8A 4CMMB 4M1DH 2OL3H 4Y4HB 4IMKA 2QR0B 5D1XD 1S7TA 3D9AL 2CKBL 3BKCL 2ZNXA 1HK6A 2VH5H 3BZFA 4F9PC 3IU4L 2VR9A 1J0JA 1JGLL 4KXZI 5EZJB 1Z0NA 5DI8A 4QTHB 4WHTB 4W6XB 1LE5B 3ARDD 4IRZH 1RIHH 3O4OB 5ADOH 5GRYA 2XPGA 5C0AA 5E6YA 1MAJA 3BEVA 4U6TA 2JLLA 2ZP0T 4QXTA 1E28B 4PP1D 2DLHA 1LNUB 4ONOA 3CVIL 4KMTL 4NRXB 1KC5L 4JFOB 3O3AA 3G5YB 5L6YL 1IAMA 1PD6A 5H2BA 3C6LA 4HX1B 4N0UA 1BX2B 4KZEL 2FLRT 4FG6D 1RZ8B 2W92A 5I1HL 3MLZL 5HBBA 4LFHD 2GY7B 1NBYA 3TZVC 4JFXB 1OSPH 1UJ3A 4BFEA 5IMLA 4RRPG 2OL3L 4YK4B 4JM4H 4U1KA 3U46B 3ROLB 4IHOB 3RNKB 3BPCA 3NCMA 2GSGB 1JGUH 4GW5B 5MI0C 2VH5L 2OTUB 3RTQC 1F00I 1YN7B 4U1LA 4GSDH 4V1DB 1Y18A 1IAIL 2YXFA 3D69A 4HMEA 2YC1A 5ADOL 3SKJL 1KENH 1D5XA 3BO8A 3BD4A 3FT2A 4F58L 4HC1A 4JFPA 5E8PA 5LJYH 5FYKL 1NBVH 1F3JA 4Z7UB 3IT8D 1TITA 4K3JL 5EOCH 5K9JH 2ZUVA 5I30H 2NY4B 1PVHA 1SM3H 1ZHKB 4ZPVA 3E6FA 1WFOA 3U0TB 5IFAH 5IOPA 4HHAA 1A14L 5EOQH 1KPUA 4OCSL 2GFBA 2XA8H 3O8XC 1OSPL 3FL7A 3QULB 2QL1A 4MXQC 4P57B 1I1AB 4HZLB 4YE4H 4D9LL 1IC1A 4LVEA 4OZGE 3RGVC 1QSEA 3W39A 2OX5A 1DANU 3VXMB 3UDWC 3THMH 4GSDL 1FSKC 4HKBB 1HN1A 2FJHA 4H25A 1E0OB 4LSUH 5I2IB 2AABH 1KENL 1QVOA 1I7UB 2GJ6E 3HNVL 4JCMA 4XP1L 3CXHK 3TYGH 3SDDB 5C0CB 3R06A 3HMXH 1NBVL 2D7MA 3V6OC 4Z18A 5FDWA 2DI9A 3W5MA 3PHOB 3ECBA 2NY5C 1EO8H 4PRPA 5K9JL 5I30L 5DYOA 4N8PA 4ZFOA 4U6HA 3QT2A 4N0RA 5KSUA 2C9AA 5F93C 1T4KA 4PP2B 5AZEH 1S7QB 3RVUD 4N5EC 5DTFA 5I17A 4M5YL 3MLTA 3RPKA 2IAMB 1IAOB 4LLYB 4PJ9A 3EDFA 3F7VA 4QRPD 5SWZA 3D18B 4MNGA 3QQ3A 5BRZE 7FABH 4Y2DA 2UVFA 2CK0H 2AVGA 4F2MA 1W72B 3D2UD 1LK2B 3IDJB 2NZ9C 2D4FA 4NQSB 2J7LA 4F7PB 2PTVA 4NWTH 3VXUE 1FP5A 2EYRA 4LSUL 1OTUD 2AABL 5K59E 2HN7B 2DWDB 1N6UA 2VQTA 5D1QB 3ESUF 5KANG 1G7JB 1B0GA 5CZKA 4XRCB 1PGRB 2F54D 3FB5A 5E24E 3HMXL 2BNQB 3VRIA 3BVNA 2A6KB 5JPMA 4U49A 1KXTB 5GSRA 1PQZA 2WBJB 3QCTL 2XTJE 4F37F 3CXHJ 4JO4H 3QEHB 3KPRA 4DAGH 4U1GC 5AZEL 2NXYB 4NCC1 2XKSA 4ODVH 1S7TB 2C3GA 2VDNH 1G1YA 3TPUA 7FABL 2AJXH 2CK0L 4XC1H 5FUCE 1AKJA 1EO7A 2AK4A 5D7SH 3H3PH 4JB9L 4LHQB 4POZC 2V5RA 1QP1A 4F80A 4S1DD 5C0AB 3G6JE 4RCAA 1Z5LB 4PJDE 2ZCLH 3FMGH 4HJGA 1JWSA 3V4PL 3VW3H 4U33A 1MVUA 3ALWA 4OZHA 5HYSG 4DFHA 4JHBA 5IT2L 2E7BA 1I7ZA 3BIAX 3GBNL 5C86A 3FN9A 5D7LD 3KYKL 4Z6AT 1ITBB 1T5XB 1V5JA 4UMGA 3W9EB 4OLWH 4JO4L 4OM0H 4P4KD 4DAGL 3QXDB 5TDNB 1QD0A 4HH9A 3BQUA 5I1KH 2B1HL 5ID1A 4CDGC 2J5LB 2F58L 5IV2B 4JN1L 3BPCB 3VFTB 5DEZA 4OFYD 2AJXL 3DBXB 5K9QI 2FATH 4MVBC 2DQHL 2RBLA 3S97C 5I1DB 3REWA 3EBAA 5L2KA 2I9TA 4NZUH 5DEFA 4NO0B 1CU4H 1YECL 1OP5H 1BIHA 4X7FC 5FO7A 3D69B 4XPBH 4NKMB 5E94B 1QLRA 1UACL 2D3VA 1D5XB 5CGYC 5JOPE 3CC5A 4XNXH 2RAMA 1U0QA 4X83A 1I4FB 4W4NA 3VW3L 1I3GH 4JREB 4D9RD 1R24A 4BSWB 3KPQB 1T1XA 4QGYA 2VLKD 1I7TB 2MCPL 2GTZB 2APTA 1UM5L 2H1PL 5ACZB 1J88A 1PKQE 3O9WB 4OLWL 3E6FB 4OM0L 4JZJB 2HKFL 2HG5A 2QQNH 3HLAB 4D0DA 3C09C 3CGTA 3P0YH 2GFBB 4NC1E 5ANMA 4C56E 2CLZA 3RPIB 1NUGA 5T1LD 4FQQA 2XKNB 3QFDA 1J1OH 1T89A 3TF7C 3W39B 4X7SL 5IQ9A 1IM9D 3GSRA 4O2FB 2V5TA 1GC1L 1QBBA 3QQNA 3LY6A 2AV1A 5IW6B 5D96B 1JK8B 5CCKH 3RVVD 4KRPC 2HWZL 3TH4T 2J8UE 1JN6B 2FH6A 1QVOB 4IMLA 1PFCA 4X5WA 2J6EH 1GGIH 2CDEA 3OZ9L 5HI4C 2DQCL 1I3GL 5JZ7C 1SBBA 5FDWB 2VDQL 3J7HA 1WC7B 3QUYA 5EOTA 4AEEA 2ZPKL 3TNNB 1CICA 5ICYA 3LIZH 4GAFB 4F7CA 1H3XA 4XX1G 2OTPA 3KAAA 5JHDB 3IDMB 5CIPB 5E70A 1T4KB 2X7LB 3V4VH 5DA4A 2XIDA 1I1FA 5HGHB 4G42B 1FV1A 2JB6A 4FQ1L 1JMZA 3TZVB 1GH7A 4PJ9B 1IMHC 5GZNC 4P2CG 1I85A 4KUCF 3QQ3B 2P47B 3BIKB 4MNGB 4OTXH 4ACPA 4TPRL 1FRGH 1MFBH 1FL6A 1YJDC 3DX7B 3QUMH 4Q9RH 5LXGH 4F2MB 5IGXL 5JQHC 2OR8A 1VB9A 3AC0A 5LAXA 5IMKA 1OGAE 4HT1L 32C2A 1FLRH 4PJCE 2EYRB 5CCKL 3R8BB 3ARFC 1CXEA 3KPMB 3PDGA 3UYPA 4Y16B 1U8NA 3DVIA 4HUUB 5MEND 4I5BA 2ZWLT 4RFEB 3FB5B 2UV3A 1MCDA 1B0RB 2JIXA 1T1YA 2VLJB 2W1NA 1HHJB 4KI5D 5E00B 4P5TA 1MJJA 4WW2C 1JZ3A 3OL2A 3ZYOA 3LIZL 1VPOH 5HI3C 3V0VB 1CGVA 1AXTH 1U3YA 2BNRE 4WUKH 5HYJB 2JCCF 1O5DT 3V4VL 1IAKA 3MV9D 3SGKC 2CLRB 1AGEA 4NBXB 5KVEL 3H9SE 3QCUL 2NW3A 5BXFA 3PP4H 4NJ9H 4XB8A 4OTXL 4JPVH 1FRGL 1MFBL 4GJTB 5BO1H 3QUML 3SDAA 5CP7A 3L3OB 3O4LE 3TJHC 3U9PL 4XNYH 4ZSOE 1EHLH 3EHBD 3OR7A 2BVPA 1FLRL 4Z7NE 1CDHA 1Z9MA 5KS9F 5E8DH 1WFTA 2A73A 2D31A 1YMMA 2W9LA 1YDPA 1F58H 3HFMH 3T65B 1G6RH 1N5AA 1MVUB 4G6AD 1HHKB 1A7QL 1GGBH 1I7ZB 5EU6D 3RVXC 4P2RD 2NY7H 3MBEA 3MUY1 5C08B 1FIGH 1VPOL 1AXTL 3CFJB 4MS8C 1DBBH 1MFCH 3P11H 4POUB 1LO3H 3K74B 4EZMA 4MAYA 4WO4C 3T77A 2ITCB 1Q0YH 2E7HA 2LE9A 3PP4L 2M8XA 4NJ9L 5J57B 3LKOB 4I1NB 3FO9A 4QWWC 1L0YA 2LU4A 2V2TA 1WGOA 4GG6F 4X98B 1EGJA 5DA0B 4LLUB 1EHLL 15C8H 5DSCB 5DEFB 3PWUB 1MCWW 1ED3A 1BGXL 4JJHA 5D2NA 1IL1A 1U8LA 1YPZF 1H15A 4MQ7A 3UZEA 2GIYA 2BVQA 1FC2D 3CC5B 2VDML 1F58L 3HFML 4ELMB 2M1KA 1R24B 4ZMAT 5SWSB 5CP3H 3RWJA 2B20A 5I1AA 1PZ5B 3NCCB 4F7MA 2O93L 2BOBA 1F11A 4MJ6B 3O6LH 3V8CA 3VXOA 1DL7L 1MLBB 2HTLD 4L4VA 5JR1H 1Q8MA 5JA8B 4KVCL 4PRHE 3MCKB 5J11C 3GUTB 4WHDA 3MJGX 4D0DB 1IGCL 3WJLA 2ZOLB 4TOYH 4OBRA 5EORH 4JFZL 2NX5A 1UKQA 2D7NA 3VXRD 1ZE3C 2HH0H 1Q0YL 3UTOA 2FR4A 4PJIE 3RZCA 3CXDL 3LEXB 4I18C 3GSRB 3REVA 3HB3C 2XQYK 1CBVH 1UM6H 4LF3A 2AV1B 3WHE1 3W9DB 3OAUH 3ARQA 1JGEB 15C8L 5F97E 4X4XA 4K8RC 3PV6A 1BJ8A 4NN7B 3H0TA 3PDDA 1UXWB 2QADD 3FZUD 2F5AH 4DQOL 3TVMD 4C54A 3TBWA 3ARZA 3SE3A 4ZS7H 2CUIA 5D7JA 1IQWL 3S36X 4FQLL 2K9UA 3I6GA 4PJBA 2AI0L 3BSZH 5EOTB 2IPUK 1J0YA 5C0JA 4GRWB 5JR1L 5ICYB 1JP5A 1TQBC 1Q9KA 4PGJA 2E9IA 4FN0A 1ZLSL 4TOYL 4M4PA 5EOCJ 1UCTA 3HZMB 1ND0A 3EGSB 4GMSH 3O3EA 5H94A 3C5JA 3MQIA 4NKOA 3SE8H 4MLIA 2DYPB 5DJYB 4PJ5E 3PHQA 3PGDB 1HIML 3VWJB 1CBVL 3UTTB 3G08A 3OAUL 5D2LE 2PYEA 1PX4A 3M17B 5I8EB 4QY8B 4YR6B 3VXSD 3OKYA 3T3MF 2UVEA 2MQ0A 1JHKH 4I5BB 4OLEA 5F3BB 1LGVA 1BZ9A 2WAHA 4N0CD 2VL5A 4ZS7L 3IXTB 3C8HA 1Q9OA 3HRPA 4RQQB 4RFOH 4M5ZH 2DF3A 4R2GD 1MJJB 3GSOA 4MA1C 4NQED 3FQWA 4QEGA 5FM5O 1MRCH 3FHAA 3PQYE 3H3BC 3SQOL 3VCLA 2AERT 1UKTA 4K7FA 3DX6A 4WV1B 5GJTL 1D9KD 5BXFB 4P2OA 2VZVA 5E8EB 3E8UL 4CN1A 1KG0A 3GSVA 1J10A 1DDHB 4R97C 1AR1D 1KIQB 1WAAF 2VDRH 4XCNA 3SDAB 1TCRA 25C8H 5IHZB 4WTZA 2AEQH 3MRHB 4X4YB 2COQA 4HUVA 3KPLA 5DHVH 1CWVA 3H3KA 1CXKA 3MV7D 4O58H 3QIUB 1YDPB 3VG9C 5EU4B 1TTGA 4HIEB 3IDUA 4PP1C 4Y4KD 4L3CA 1U8MA 3BZ4A 3FQUA 4GKOA 1ZK9A 3CFEA 5B21A 4DK6A 5L8JB 4FG6C 5F70A 3MRRB 4E41E 4L3EE 1KCUH 4MXVF 1JYVA 3C5ZD 2X4QA 5T3ZD 1FG9C 1KXVC 3GMRB 3MLUH 1QFWM 1WSST 4LDLB 3WHE0 1NBZA 4PJ8D 1XGUA 4LKXB 1FVEB 1QNZH 4X99A 4IS6A 3FO9B 2ICEA 4NQXB 3TA3B 4CMHB 1X5FA 3FB8A 1F4YH 5I1GH 4YHKL 4HKZA 25C8L 5GGVH 1H3GA 2VXVH 3R0NA 4CADA 1G7LB 3GIVA 2AEQL 1XMWA 4WU5B 2HLFC 3ZE2F 1NGYA 2EIZB 1FE8L 4PRDA 3X3FL 1ED3B 5BS0D 4HS8H 3WUZA 5E2UH 1U8LB 4BZ2H 2G5BB 3EYUH 4PJGB 4UBDD 3QZWA 1FORH 1E4WL 4FQXB 4G5ZL 2VISB 3NPSB 4LNRA 1KPVA 3AM8C 1HXYA 5ETUA 3VXOB 4QHMA 3IS1X 2VAAA 1FNLA 3MJ7A 4DZ8A 2Q3AA 3HC0A 3MA7A 2XWTB 2BXYA 3HPLB 5I8KL 8FABA 1I9IH 1UXSA 4OIIH 4N5UA 2ZSVA 3QDAA 1J1PL 1PX3A 1JF6A 4BUGA 2Z4QB 3F7YA 3JWDH 4U0RB 4MHHI 2EE6A 1XAUA 5ESVA 4ZO9A 5F89B 2XFXB 1NFDE 1ZLUK 1F4YL 5DT1H 4H5SA 5GGVL 2WBWB 2VXVL 1DVFA 2L7UA 5T3ZH 5DRNA 1CFQA 2A0LD 2X4OB 4FNLL 5E2UL 2AP2A 5DD0H 3L7EA 4IRJA 5C0EA 1RK1A 5FOBB 1R3HB 2C4XA 1W0WA 1J0IA 3ZZ1A 3WO4C 1CIUA 1A7OH 2NY3B 5FV2A 5C0JB 1QO3B 4FFZH 4S0TD 1W0YT 1P9MC 2CIKB 2YUWA 2HRLA 1MI5E 4TRPH 5EU7C 4HXBH 1F42A 4I13B 4OUOA 5FYLE 1I9IL 3A0OA 1KACB 2BZDA 5C6TL 4OIIL 2B4CH 2CLVA 3RVUC 1XF2A 3HZKA 4XBEL 1BF8A 4KJYB 5SX4H 4D0BA 3JWDL 3KYMB 4XX1E 2QLVB 4F33B 1G7PB 5CEXA 4P46D 1UB6A 1JZ6A 2VDLH 2C3WA 1CTNA 4DCQB 1CGUA 4LPXA 4WFGE 4K3GA 2DBLL 3PWVA 2H3NB 2ATPA 2PYEB 5IG7B 3BGAA 5HHPB 1F90H 1KN2L 1OTUC 1DQTA 3U4EB 5CLWA 3FO1A 4Z0BH 1V7NH 3FCTA 2VSDA 3RL2A 1I1YA 3MFFB 1FQ9C 3QDGD 3LKNA 2PW2A 3D0LA 4Z5RB 2VL5B 3KNBA 3P0VH 4OT1H 1E4JA 2ARWA 4JGMA 2DIJA 4JCLA 1AXSA 1A7OL 3UTZA 2XACC 4KI1A 3RWEA 3T0ED 5KSBE 4FFZL 4HWBH 4P3CL 1YUHB 2V7HA 4M3JA 4HXBL 5E1AB 1M1SA 1QRNB 4D0CB 3CDFA 4NO5B 2B4CL 5HHMD 3INUL 1DQLL 3I3DA 3STZB 1S9XB 2D7TH 2BY1A 4UNUA 3QIBD 1JPFA 3QEQD 1QSFE 3WFHB 4XCNB 3GBMH 1P4BH 1TCRB 3GSWA 4ZTPH 2VDLL 1FNSL 4OCLC 5HJ3A 4PB9H 1PSKH 3QSKB 3KJ4B 3PL6B 5ISZA 1MFNA 3OAYK 5IB5B 3HNSH 2HFFA 4S1DC 2DS4A 1NGXA 2W9DH 4L4TA 4M7LL 1V7NL 2Y1VA 5JORA 3CVHH 3PGFH 4YDVA 4KKNA 2VDPL 4OT1L 2NY0D 5GSVA 3GSQA 2XICA 3ESVF 3BZ4B 4UOJA 3GSNA 1NEZB 4UOW1 1SYSB 2W07A 3CFEB 3SPVB 5KS9E 2R56H 1RSFA 4PJEA 5IUSA 3O0RH 1XGPA 1EAPA 3V6FB 4WGWB 2PW1A 4P4KC 1MCOL 2X4QB 4M1GH 2I25N 3MXVL 4D8PA 3RWHB 1HHGB 1N0XH 2GY5A 4MXWH 2D7TL 1M7IA 3SCMA 4F37K 4QF1B 4HS6B 5KVGH 1SY6A 2R23B 4M3KB 3E3QE 4U05A 4L9DA 1MUJB 2R2HA 4DGYH 3GBML 4H8WL 2XN9B 3UO1H 3U7WH 3MRKA 2BVEA 4RBPK 1VERA 1NGYB 3JVGA 4PB9L 1PSKL 3EOYG 4XWGH 5D6DC 5EBMB 4XP4H 4D9QD 3TC9A 3HNSL 1TPXB 4HK3J 1NANH 5CBEA 3CVHL 1YY8B 3QZWB 4RMRA 4GG6E 2CD0A 4LNRB 1KPVB 4HD9A 3FAWA 1HXYB 4HJJH 1OQXA 1VGEH 1J8HE 1CGTA 2VWEE 2ICWB 2ERJB 1HINH 1YPZE 3O0RL 3MA7B 1IBGL 1N3NA 1RK0B 4I9WE 4U1HA 5CINH 4BH7A 1UXSB 5HI5C 4LAJH 1DE4B 2DQJL 2ZJSH 1AQDA 1N0XL 4XGZA 3B6SA 4TSAH 3SKOA 2EDHA 3F7YB 4F15C 4BH8B 5GRUL 5A43C 5KVGL 1XIWA 1DBMH 4OZHF 5D1XB 2FEEI 1OAXL 2EDDA 1TQCC 4WU7A 5CJ8A 3UO1L 4LCUA 2AXHA 3HG1A 4GKSA 2KQNA 3RVVC 4XWGL 4H1LH 3QFJE 5F7LB 3MA9H 3L7EB 4X9BA 3ARDB 1SMAA 5E08L 1W0WB 4QHUB 4UB0H 1MAKA 3T2NH 4HJJL 4JO1L 2PCPA 1LP9A 2A9MH 3HCVA 1A9EA 1SJEA 1YN6B 1FYTD 3K1DA 5EUOF 4P0DA 3ZE1F 1ES0B 3CDYA 1U93B 1C5CH 2F53D 2ADFH 5EBWB 4UT9H 1XF2B 2BSRB 1JFQH 5E5UB 1CFNA 3DV4B 4OCYH 4TSAL 5CD5D 3QJHB 3MRJB 5I6XB 1DBML 5HDBF 1WF5A 1UB6B 5DFWH 2WUCH 5DJ2A 4MJIB 5I1LB 5BRZD 3OB8A 3EJYC 5FDYA 3OHXA 3BXNB 4MDJB 4NGHH 2ATPB 3DV6A 4KPHH 5C2BH 4PD4J 5E7FA 3KWWB 3FQRA 1I1YB 4UOW0 3IDXH 2G9HA 3SE9H 4ZNEE 3D0LB 5DJ6A 1TETL 3MREB 5EN2B 4JFDA 3V8OA 1OWWA 4JDVA 4KI5C 3PHSA 1M7XA 5FYJE 3KLAB 1LO2L 1KXQE 2V7HB 3GRWH 5HHOB 1ZHLA 2CO7B 1MCPH 3T3ME 5DQDH 3LDBB 1U3HD 4QKXB 1CFVH 4UT9L 4JRXA 1FGVH 4OCYL 4OQTH 3U83A 1YNTA 4Y7MA 4PJFA 2ESVB 1U8JB 3QIWD 4LARL 3UAJD 2DM2A 5F7HA 1RV6X 3GSUB 1FO0H 5MEOB 4FTVA 3VMNA 1EZVY 2ZKHL 1IC5H 2V17L 3EHBC 3LKRB 4OZIA 4K7PH 1EHAA 1P7QA 4EBQH 3TN0D 3U30C 1NGXB 2Y72A 2DLGA 1WAAE 3I6KA 2DJUA 4G6AC 2NZIA 3V5DB 4OLZH 4P2QA 5I9QB 3WFBH 4Y19E 5GGVY 4YEEA 4CU8A 5KG9B 4EI5D 4EQ2A 4Y89A 3DSFL 1A2YB 4EVNA 1S7RB 3BH8A 1MCPL 1XGPB 1EAPB 5C3LD 4WI4A 1CFVL 3BHBA 2Z92A 1FJ1B 2JTDA 3DLQR 1OAUL 3D39E 4ENEC 2VLME 2R0LL 3D25A 1WV7T 3OPZL 4Y5XB 3NFNA 1AJ7H 1JZ5A 3DHJA 5E9DB 1S78D 4OZFH 1FO0L 5C0DB 3JBG7 1P53A 4KK8D 4MNHB 3O41A 4MXVE 4K9EC 4X6CB 1G9NC 3UC0H 3D2UB 1IC7H 5ECJE 2GITA 2EH7H 1NC4A 5J89A 1X5LA 4EBQL 4KTEH 1LE9B 3O6KH 3QG6B 5CBEB 4GBXC 1ZGLA 4JRYD 1NCUA 3I50H 5CD3B 4TSCH 3WKML 1MLCA 1T7VA 4OLZL 2F54B 3WFBL 5ADPH 3ZE2E 3ZHLA 4EJ1C 3LS4H 2X2YA 4ZAKA 4MCYA 4CGTA 1IAII 3HAEA 4M8QA 1JPGA 2GW5A 4HMCA 3GDBA 4NQDB 2MSPA 3Q3GA 1DUZB 3AS0A 3LH2H 1SJXA 1KCSH 3MJ8B 1AQDB 3ARYA 3B6SB 3QDJA 4OD2A 2RGSA 1EO5A 1KV3A 2IBGA 4C56D 4ZUTB 3IXAA 1AJ7L 4LCWA 2X41A 4JQXC 1HDMB 4Y4FA 1F6AB 4Q6YA 3U48A 1IC4L 5EU5A 4LCUB 4EQ3A 4LCIL 5F96H 3L3HB 3S35L 2XZCH 1IKFH 2DIBA 3QI9D 4AEIH 1UWEH 4Z76B 4Z8FH 3O6KL 2YA2A 2ICWI 2GSIA 2QADC 3FZUC 1G9EA 1SVCP 2R29L 3RY5A 2B0SL 3TVMC 3OKDB 2AS5M 2ADGA 4TSCL 2DOCA 4LVHB 5ADPL 1CT8A 3LS4L 3WXWL 4N0UE 4AT6B 4UU9A 1N7ML 2R0WL 3DXAD 4M93C 3B9KA 1RZIA 4F9PA 1JPTH 3NH7H 5HVHC 1Y0LA 3LH2L 5IMMB 4P4KB 1KCSL 1KJ2A 4C83A 1G0YR 3P4LA 4LLWB 5C0BE 4B7LA 3T2QA 1H3WM 5FO9A 4JFEA 4QHNB 2XXCB 3BW9A 4H26A 4KUZL 4IIQC 5IVZA 5EUKA 1KIUA 2ZNWA 4IDJH 3IFPB 4PV9A 1CDYA 2HJKB 2OJZL 2GJJA 5C9JA 3RWCB 4ZO6A 5K9OB 4JFYA 5F96L 5C92A 1T04B 3FFCB 5A16B 1IKFL 4AEIL 4WWKD 5E6ID 2PO6D 4DGVL 5E2VH 1ORSB 3K7UA 3UTPD 4APQD 4NKDA 4N0CC 4ONGH 1JRHH 5GQBA 2JB5L 4FQJH 3OAZH 2W0PA 5JDSB 5T1MA 2F74A 4GMTH 4LMQI 2FO4A 5JO5B 4WFFE 3VFVA 3HUJA 5DGQA 4TNVF 1BQSA 2VLKB 4CN6A 1BMGA 1ZHLB 5F6HI 1EVUA 2DRUA 3MXWH 1DLHA 1JPTL 3QUMB 1MJUH 3NH7L 1ZKAA 2BNRD 3QH3B 2ENSA 1LILA 3EO1A 4JRXB 4XAWH 3GK8L 3LB6C 4LVOC 3VFGH 4LIQE 1QSEE 4PPTA 3QQ4A 1GPOL 2UZYB 2R2EA 2EDYA 3KPSA 3VFUB 3O6FD 4R4ND 3AREB 4PJBF 3ZL4H 1IM9B 3ILQD 1EDQA 2J4WH 4IRSD 2X89D 4G43A 2OMBA 1KLGB 4NC2B 3IJHA 5I1CL 3DPBA 4Q6IA 5E2VL 4AMKL 4NZRH 4XCFH 5EO1A 4PG9A 3MYJA 3O8XA 2D03H 1JRHL 4PGCA 3K8KA 4U6XA 3MGAA 4ERSH 3CX5K 4Y4KC 5I66A 3RGVA 2BNUB 4FQHA 4GMTL 4PRPE 3JWDC 2Q8AH 1SHMA 1I8MA 2A77H 1CQYA 2CR3A 4HZAA 3C5ZC 3UDWA 3HZVB 2Z92B 1HQRB 1FPTH 3Q1SH 1G7QA 3NVQA 4Z78A 5SWZE 3VRJA 4M48L 4PJ8C 5TGBA 3V6OA 1O7VA 3O41B 3WLBA 4DFIA 4WDIB 3MLPA 5I8OH 4QRRA 2C7UB 3V0WH 3CSYA 1TENA 2VOTA 3CDGB 4OCMC 3UMTA 5AZ2H 3L3KB 4UBDC 4NZRL 2I5YH 3TT3H 5ESAB 2B5IB 2B4CC 3JUYA 3WIHH 3MJ6A 1LEKB 2D03L 5MENB 2P45B 3EOAA 5EZLA 2YA0A 2ZUSA 2Q8AL 4MCYB 1OARL 2Z8RA 4J6RL 4KK5D 4RA0C 5T1KA 2A77L 1ZANH 1JPGB 2EDQA 3KPRE 5HHQA 5I75C 4WTZG 1U3ZA 2BVTA 3VDAA 4LRIA 1FPTL 2VLLA 3VDBA 3CX5J 2HFTA 3QDJB 3MRGA 4RGND 4ZDHA 4OF3A 4WW1A 1NCAH 1YEHH 1SVZA 3CMOH 2NY1B 2AK4E 4Q58C 3P30H 4ZFZA 3A6BH 3NCYS 1M05A 1DEDA 2VNCA 2XG5A 2A0LC 4LNVA 5GS1B 4QOKA 1Q94A 3VFNA 4O2CB 1EZVX 1M71B 1NEZG 3V0WL 3BAEH 1HEZA 3WE6B 1QUNA 2DD8L 4I4WB 4XHJD 4YIQA 3QWOA 5AZ2L 5FF6B 1D3CA 1T1WA 4OZHE 3L3JA 4R3SA 4S11A 3TT3L 3OXSA 1J1XH 5GZOD 2YRPA 4R0LC 4U6VL 4M6AA 3MRLA 2X4NB 4L9LB 3QDMD 3GI8H 3TO4C 1MH5A 4P2RB 5CJBA 5AUMA 2LAGB 4ONFH 3B9KB 4JJ5A 1RZIB 4GAGH 2X42A 1EEZA 4HGMA 1KCLA 2WM0A 3HNTH 5FFLA 1F4XH 3VWKD 5IR1B 1Q9WA 1IGTA 2AJVL 5D5MB 4OCXL 1FL5B 1NCAL 1YEHL 3QDHA 2D2OA 4PV9B 3CMOL 3F5WB 4P46C 5EUOE 3QZWG 3ZE1E 5L2KE 1LO0H 4JDTH 4M6OH 4AJ0A 3LZFL 5HGBB 1QKZL 3TFKC 3BAEL 4JY6B 2BFVH 2QHRH 4U1MB 4JHAH 2E6QA 5HDBE 1JNHA 5I0DA 5DRXB 2VLRA 3T4AA 4BA8A 1PG7H 1G7IB 3BYTA 3NTCH 4M7ZB 3OF6D 2F74B 1Z0MA 1HXMB 3C2AL 3T0EC 1KLUA 1CD9B 1KTRL 2EKJA 1WWCA 3FQXA 2CMRL 1CFTB 4K7PY 3DI2B 5J3HD 2OBGA 1C7TA 1A7NH 2QEJA 5ANME 1S5HA 3I85A 4HDIA 2APWA 4I0PA 4ZUUA 5F1IA 3FTGB 3VDCA 4L8CB 3WXVH 3QIBC 1P7HL 1Z9OA 4EN3A 5FV1L 2OI9C 3CUPA 4DVBB 5D4QA 3LV3B 5HYIA 3WDJA 1EBAA 2F9BT 4WFHE 3NBNA 4HV8A 3GKZA 3K81A 4JDTL 3IDNB 1JE6A 2P5EA 4M6OL 1UWXH 2WWKO 3QO0A 5C0IB 2NQCA 2VITB 3O3BB 4DTGH 1T20B 3IJHB 4I2XA 4ZQKA 3GFUA 2BFVL 1HOCA 2QHRL 4JHAL 1IZKA 2MHAA 3QEUB 4Q6IB 5LWYH 2A6IB 5IP4A 4QRSA 5GGUB 4Y5YA 4PG9B 4XPTH 4PGCB 4Q0XH 2NY0C 1RJLB 3T3PF 3KPPA 2Q7YB 4FQHB 4DN4L 3DTXB 3EYOA 3MV8A 3IJSB 5LGKA 1BLNA 1JV5A 1FFQA 1UYWH 3AS2A 1IZJA 4HIJA 1MHPH 5F8QC 4I77H 3G5ZB 3KYOB 4E41D 4L3ED 1G7QB 3ZE0F 4C55A 3BKMH 5TF0A 4I48B 2E3VA 4JFFA 3RUGB 4KC3B 1CE6B 3HS0B 3V7AG 3VXQA 1MCHA 3WS3A 2VZSA 4ALAH 3DMMD 3UCRA 3E2HB 5TGBB 5C09D 4H0IA 2LFGA 3WBDA 2HJLB 3WLBB 1B90A 4YHPA 4QHKJ 3VA2C 4QRRB 1FAIH 3QUKB 3P73A 3B5TA 1RUPH 3MACL 1KEMH 3CNKA 4WRLA 2FWOB 5DC4B 1Y6KR 5LWYL 35C8L 4OFPA 5SX5K 4A6YA 1I75A 4UV7L 1DQMH 1K8IA 1LDSA 4XCYB 2R0ZH 3NABH 5EZLB 3KLDA 3X13B 5JOFA 4R2GB 3UTSB 1XCQB 1X6NA 5MEPB 1UYWL 1N4XH 4NQEB 2FBOJ 2Z31A 4QTIL 1JI2A 4I77L 4MQXD 4HGWA 4HIIB 3DJ9A 3IDYC 4LLDA 3RDTB 4OGXH 3ARFA 1CL7L 2IFFH 2JJWA 4UT6H 4ZDHB 3DSNA 3ARTA 4WW1B 1D9KB 1H8SA 4L1HA 3JTTA 1ZA3B 2OZ4A 3G6AB 3GJFH 3H9ZA 1G0DA 4DOHE 3P0GB 4RAVA 3UYOD 2I60H 4WW2A 1FAIL 1RUPL 1RFDL 1KEML 2VTFA 4PJEF 4KGLA 1YMME 3N9GL 1AO7D 4YIQB 1CLOH 2D7PA 5IF0A 3SGKA 4X6DB 4DUVA 1SYVB 2G2RB 5HHNA 5I0ZA 2FSEA 2AJSH 3VGFA 1LEIB 2PXYC 4MAUH 3MRMA 2H32A 3I75A 3U6RA 4R6UA 4QRUA 4G9FB 4B7IA 1QR1B 4NM8L 3VXTA 2QBWA 4PG2C 2XTLA 1T7XA 1FCGA 3GMNB 5IBLD 3IKCB 5GGRY 1A0QL 4OGXL 1UQSB 4FQIL 3RRQA 4UT6L 3GNMH 4KXZH 5CD5C 4TUJB 4Y88A 4PJ8B 5F9WB 5AD0A 1VFBA 3S4SA 4ZD3H 2X4SA 8CGTA 4ZTOL 1D6EB 1KIPA 4MD5A 4AM0A 5D2NE 1WCQA 5IIEB 4NKIL 3VJ6B 1I3VA 4ODHH 1A1NB 2O61B 3IF1A 2HAZA 5C0NC 3CSPA 3Q5YA 4E0RA 2WK2A 3GMQA 3L6FA 4UV4H 3VI3F 1FN4A 2VLRB 3T4AB 1FVDB 4WO4A 3J8F7 4XPAL 4R4FH 1R3IH 1S7VB 4L4VE 5DVOA 1I8LC 3OWEA 2LABA 4C59B 3SDCD 1U3HC 3QHFH 5DUPL 2NX5E 1YQVH 4PJHB 1S5HB 5GGTA 2N56A 4I0PB 5F1IB 1ZGLM 4FQ2H 2VAJA 4WUUB 1HI6A 1NKOA 4GS7C 1TJHH 3VFMB 4K94L 2GKIA 4WI7A 3CUPB 3QIWC 1X5KA 2R1XB 5EDXA 3UAJC 4YGVA 3PG2A 3PABA 1C16A 1QSFD 4OZGA 4ZD3L 1M7DB 1LP9F 3LQAC 1MEXH 2IAND 4DUWA 5FKPA 3RWDA 3L9RB 5BVJA 4I2XB 3AXLA 1AGDA 1CDGA 3CFBA 4AQOA 2VIRA 1L7IH 4YWGH 2MHAB 2O26U 1DJSA 3GBLA 2LVEA 2KL6A 3U0WH 4NQCA 1FNEB 4Y5YB 5JIKA 3RY6C 3ULUF 1JZ2A 1EFXA 4PJBE 3D0VB 1QA9B 2GJ6A 4JPIB 5AAMA 3VFWB 3MV8B 4EI5C 5JHLH 4KKLD 1BLNB 4TTDD 1JV5B 1VGKB 4I18A 1T1ZB 1OB1A 1PEWA 1KIRB 3TPKA 1QSZA 4S0SD 4M6NH 3O2DA 3FQTA 5DD6A 3QHFL 2XT1B 5T3XD 3MGOA 1YQVL 3P3YA 4NOBA 5IJKC 3DHMA 4NCC2 1JUFB 1NCWL 3A6CL 4JAMB 1FDLH 1S78C 2B1AH 4K23H 3RIFF 3CVHB 4XMKH 1ZLVH 4KK8C 4PRID 5BOPA 1S7UA 3G5VB 2KKQA 2NNAA 4MZ3A 4JFQB 5FYLL 2GJZA 3BGMA 1EX0A 4DEPB 5C8JB 1DBAH 3H7BA 4WENB 1K3IA 3ISWA 4MWFA 3P9LB 4IOFC 3QDGB 3MLRH 3HTLX 1I8KB 4ZS6D 4PJFF 3KDMA 3CFIC 4YDLB 4AEFA 5JHLL 1J12A 1X7QA 5JOFB 1HZHH 4LKCB 2VXTH 2IQAA 1AFVH 1J7VR 2Z31B 3KHOA 2ADJA 4OZIF 4HH8A 5KVDH 4RX4D 4K7PX 4YBLB 2XWBA 3MNWA 1NCDL 5B8CC 3TWCH 2CXKA 3DVGA 4Y4HD 1P4IL 1QBAA 1FFOB 1V7MH 3S34H 5BMFH 3W81A 2DTSA 2OI9B 4XMKL 2F15A 2Y5TB 1II4E 4P99A 5T3XH 4MDIA 1H5BB 3ILPA 3OV6A 4U2ZA 3QI9C 5TE6H 4CVXA 1KGCE 1HSAB 4X6BB 1DBAL 1OAZL 3ZSSA 2JELH 1UH2A 3GMLA 1PKOA 3CFCH 5J6HB 3QFJD 2HT2D 3KG5A 4J2XA 2Y23A 3C87A 3ES6A 3MLRL 1AGCA 3WNLA 5D70L 1A6VH 5KSAA 3D85B 1TZIA 2NLJB 3MRMB 3I75B 5D6CA 3LN5B 3SDXA 1B4JH 2VXTL 4QRUB 3MOAL 4XXCC 5B3JF 4R7DB 4S1RL 3VD3A 4FFVD 5DJ0A 3S35X 3UPRB 1E6JH 2AXJA 1ORQA 3X11A 3TWCL 5B39A 3SJVA 4X9IA 3BZEB 5DRZB 4E42B 1ODAA 5BV7H 2X4SB 1KB5A 4FS0A 6CGTA 1LVEA 3DUUA 4L29A 3HE7B 5CSZA 2H8PA 1F3DH 4K3DH 4R96A 5IEHB 3GGWA 3C60A 5TE6L 2WWMD 4V1DD 4WWKC 3OXRA 5E6IC 2QSTA 3FO0L 2DQEH 2PO6C 3HAEG 3LD8C 1F97A 2YD3A 2H26A 5DUMH 1U2CA 3SQBA 1KN4H 4APQC 5JNYB 3UJJL 2EDBA 3RZWA 1MCFA 1P84K 1A6VL 5EBLA 2PUQT 1CR9H 4P9MH 4GO6B 1BP3B 1B4JL 3FN0L 1UA6H 2AJYH 3HE6A 1OF2B 2D7QA 5C07A 5L2JB 1VDGA 4U1JB 3RNQB 1BHGA 1HI6B 1NAMA 2X1QA 1I1AD 4R4BB 4C4KO 1J5OL 4LVNB 4JM2F 5FYJU 3B2UD 5LQBH 4R8WL 1RZFL 3M45A 3P4MA 4FOMA 2K1MA 3FB6B 3O6FC 4R4NC 1S9VA 1HSBA 4FZEH 4OZGB 1YNKH 2JK5B 4J7RA 3AM8A 5E0QA 1EFQA 1N0LA 1UCBH 5IHUH 3DRTA 1A6AA 2CK2A 5FKPB 4X0KA 3QQ9C 3AXLB 1AGDB 2BMKB 4FQPA 4YHYB 43CAB 4EDXB 2DQEL 1OP9A 2WIIB 4N0FA 5EFIB 5C9KA 5DUML 1JGDB 2N7AA 1BIIB 4OLYH 1RD6A 5HGAB 5C0CD 2GJ6B 1KJVA 1YEIH 5HYQA 2HYMA 1S9YB 4XTRC 5DJCA 5DDHA 3X14A 4LHUA 3EYQD 1V05A 1EXUB 5DR5L 4KJQC 1FO0B 1WQVT 4LEXH 3VD5A 5FK9B 2BDNH 5J9PA 1QLFB 3NOIA 5EC1B 3UYRH 3MUGA 3T3PE 4S1QL 4NPYA 3NGBC 3K0WA 2ZCHH 5JMRA 1IM3A 1JYXA 5LQBL 5F8RC 2CJUH 5ENWA 4FZEL 1B3JA 3ZKMD 1PZUB 3RI5K 1FCCA 4U3XA 5CUSH 3HUJF 1UCBL 2P24A 2NNAB 2Z8SA 5BRZB 3ZE0E 5EWIH 3V7AE 1P9MA 5F9OL 5CEYA 1OL0A 3KS0J 3H7BB 3FO2B 5ICXB 3DRQB 2YD1A 3VXUB 3ZKXC 5D1QD 3CPLB 1A4JB 5HXMA 5IMOA 4XXDB 1MCEA 3P40A 3KDMB 1MFDH 4JKPL 4EUPA 1YEIL 4OF0A 4YQXL 4QRPA 3EDEA 1NAKH 1XH3A 4KK5C 3QWRD 2WBJD 3NCEB 4AIXA 2IQAB 3SY0A 1X5GA 2ITDB 5IWLC 1N8ZB 4OZFB 4LCCB 4Y8DC 2XTJB 1KLFA 2X4RA 3UYRL 2XWBB 2W60A 5H35B 2NXYD 4RGNC 5DMJB 5DURD 1T7YA 1HE7A 2ZCHL 3TBSA 4LSVL 3AB0B 3HI5H 3H9SA 5EA0H 3FQNA 4K2UL 1Q9LB 4NNYA 5FYJL 1KJ3L 4PY8J 5SWQB 1BAFH 2YPKB 4RGOL 4PGBA 5ISZE 2EEBA 5FGRA 4LHJB 1GZPA 4E5XA 5EWIL 5BQ7A 5F6IB 1Q0XH 3AAZA 4XCCH 1LO5A 4L4TE 2N1KA 3UP1A 1OGTA 4ZSOA 3OKNB 4RFNC 4XHJC 3L5WB 4YUEH 1K4DB 5C0AD 3TN0B 4YDIH 4N68A 1HNFA 2BY0A 1EK3A 4GRLC 3VU2A 3ES6B 4JQIL 5GZOC 2AGJH 3G6JB 4KH2A 3WUWA 4PJDB 4FXLA 4GW4A 2EE3A 1WEJH 4PJEE 3BE1H 5KBNC 4Y5VB 1DTUA 3FONA 2A6JA 1WT5C 4HMDA 4M62H 4TNWF 4M61B 1ETZA 4NUJB 1A47A 1UH3A 5FHAL 4G8IA 4ODTH 3VWKC 2X6MA 3X11B 3FAXA 3I02A 4UTBL 1A1OA 5B39B 1A21A 1TZGH 2R2BB 1VA9A 5ALBH 5DXWA 1KB5B 1BAFL 2C5DC 2H8PB 4P3DA 2H6PA 4P4RB 4YHMH 5J13B 5D7LA 5FHBH 3VRLF 3C60B 1Q0XL 4NO0D 4HUWA 1SEQH 1HKFA 1FGNH 4DGIL 3LSOA 4YFEA 3B9EA 2EDOA 3DX8B 5IEKA 5KN5B 4MNQA 1J86A 3GM8A 4JZNA 3IVKB 1F6LL 4QRQA 1IQDA 4BKLA 1YA5A 2J6EA 4KY1H 3LAFA 1NL0H 1X6LA 3BE1L 2MWCA 4PTTA 4HEPG 1INDH 1T0NB 4WFFD 1B6UA 3HE6B 1YEKL 1CLYH 4LEOA 5J3HC 3NFSH 3O9WD 3QJFA 1C5DA 3C8KA 2A74A 1EEYA 1BVLB 4ODTL 5D6DA 1ACZA 1PKQB 1R3JA 1NAMB 2Q1EA 4YX2H 1DEEB 3SO5A 4S10A 5MHSE 4NN5C 1QSED 4C56B 2NTFA 3D48R 1XGYH 1SEBA 1TZGL 1MPAL 1S9VB 1JBJA 1HSBB 5ALBL 4RZCA 3W0WA 5GGSY 5JDJA 4NO2A 3HG1E 3BH9A 4PJIA 1MRDL 4HUKB 3DUSB 4YHML 4X0KB 4G80B 4NNXA 4OUUA 1P69B 3BP4B 1A5FH 5TPWH 1INQA 3QUXB 2R1YB 5FGSA 3FFDB 1SEQL 3PGCA 2YS4A 3R1GH 5FA3A 3BPLC 5TFSL 1AD9A 3O3DA 1ZA6A 5M94B 2DTML 2J8UB 3QNZB 4NDMA 5T1LA 1LP9E 4GQ9H 3M1BB 4UAOC 4R26L 4NHUB 5LGJA 3UZVB 3QNYB 1ZVHA 3I2CH 5DDHB 3X14B 2DQFB 1MCNA 3MRDA 1CLYL 4JDZB 3PNWA 3DX9A 2UZIH 4JY5H 3DGGB 1BJMA 1DFBL 4HFUH 3ULUE 3ZTNL 4U1SB 4O02H 1V3LA 5J9PB 4HC1H 1QBLH 3GI9H 3WHXA 4PGEA 4XI5D 1X5YA 1S7SB 4YX2L 4N1EA 4XC3H 4PBWD 1CLCA 4LP4A 4PJ9D 4KK6D 1CI5A 4UILH 5SWZD 3V5HA 3EOTL 3DMMC 1XGYL 3U1SH 5ENWB 2V9QA 5CWSA 1F4WH 1MQKH 1S8DA 5E7BA 4X7DC 2P24B 3L95B 2GAZB 5L88H 2BCKA 1A5FL 1XGQB 3TIEB 2CDGA 2Q76A 2MTPA 4HCRH 5TPWL 3WFZA 5CEYB 1HILB 2EDLA 2FJGA 4PR5A 2VDKH 1OGAB 5D2LA 3R1GL 4LAQL 4OD3H 4PJCB 4JZOA 4JFDE 3MOBH 3GJEA 2FZ3B 4GQ9L 4M8VA 1CDCA 4JHZA 5TQ2H 4WI8A 3BPOC 2VLJD 5BJTA 2AAVA 4YXKL 1DQDH 1G6RA 3F7RA 2P8MB 3QAZC 5DMKB 2V9TA 1T0MA 3U36B 5C0GA 2O5YH 1HKLH 4WNQB 3TJEL 3JWOH 5HYJD 2OJEB 5DJXB 1B0WA 1KCRL 4O02L 4HC1L 3V5KB 3QRGL 3EFFB 4DVRH 2W60B 2BNRB 4K71B 3QA3B 3UROR 1R5IA 2NTSP 4PJFE 1JF1A 4XC3L 5F9DC 3TBSB 1GCFA 1A64A 5FXCH 3BKJL 1EIBA 1R3KB 4FFYH 3H9SB 4Y1AA 2A1WL 1TZHB 5DHYA 2WP3O 2EECA 4FTVE 1F4WL 1MQKL 4U3CA 1AKJD 2AK4D 4OZIE 5CIPH 1GZPB 2H2PC 4IRSB 5L88L 1NMBL 5BQ7B 1IJ9A 1G9MH 5ERWB 1BF2A 5JW3H 1I9JH 1NCCH 3O4LB 4K07A 3T4YB 4NRZB 2FHBA 4ZSOB 2D0FA 4ELKA 2ORBL 2VDKL 1FLTX 3KGRA 4AL8H 5EPMA 3HZYA 4YHIA 4LIQL 2ARJA 3ULVF 4P2QE 3MV9A 3IFNH 5DK0A 2ZUQC 3WUWB 3UPAA 4GAJL 3BJLA 1ZHBB 2IQ9L 4JY4B 4H20H 5CP3A 5C08D 2IEPA 2O5YL 1HKLL 4ZXBC 1ETZB 3JWOL 5DEGB 4DKAA 1QFWL 4OM1H 4G8IB 4DVRL 2VZUA 4JVPA 3BQUD 4MSWA 5F7KC 1FL3A 3PP3H 2Z91B 3SGDI 4F8QA 4FZ8H 4YC2B 4FFYL 5JOEA 5B3JE 4ZFOL 5KTEL 4OAWA 4X9GA 2V2XA 5EU6A 1MY5A 1CGSL 5A1AA 1GVIA 2HVJA 3KPNB 4GRMA 1NCCL 4ONHB 5F1NA 4RGMC 1FAKT 3P4NA 4JLRA 4XP9H 1XFPA 4ODUA 4YHLH 3IFNL 1HWHB 3RVTD 2CRZA 3EDJA 2WBKA 5SWSD 4LSSH 2YPVL 1MAML 3RA7L 1C12B 4QRQB 1IQDB 3RKPA 1WVZA 5I19H 5AYUL 2VN7A 1AHWB 5INDA 4LEOB 1CVSC 3CK0H 5EC2A 6FABH 3U2SB 3QJFB 4FP8H 4WW2F 5DFTA 3D6GA 2UYLA 3NIGF 4PRHB 1SJHB 1BVKB 5I16B 2NXZC 3BDXA 4U7KA 4LCWE 2C26A 2HFGH 4GBXA 3L3GA 1SEBB 4LP5A 4DW2H 1R5VA 4RZCB 1FZKA 4PJIB 3GO1H 1B4RA 3EO0A 1NFDA 2AJ3A 1U8KB 4NNXB 2IBBA 3U0PB 5GS0D 1RY7B 1BBJA 4XPGL 2VJXA 3U9UB 2LU3A 4PUBH 1ZA6B 1F3DJ 3VXRA 1WITA 2ZSWA 5EZOL 1JWUA 2Z8VC 1HH6A 2WIMA 4X6FB 3L5XL 1BQHA 1NUNB 3Q6FB 4KKLC 4TTDC 5F7EL 4HK0B 1KPRA 4JQXA 1CICD 3CD4A 4GUPA 2AEPH 3EJZD 3S4SG 3NIFF 4FP8L 3PWLA 4HKXB 4WGVB 1JRHI 3MV01 1AD0A 1FFNB 3WHXB 4MJ5A 5IK3A 3OMZA 3NAAH 4JFEE 1IT9H 4NBYB 1L0QA 3IAGC 2BSSA 2VXQL 3TVMA 4ORZC 3FT3B 2DYPD 5CWSB 1FNAA 3I84A 3K3QA 1T6VN 3VWJD 3H9HA 1IEBB 3MR9A 4PJ5B 3V2AR 2BCKB 2IMNA 2CDGB 2Q76B 3RVWD 1MF2L 1LWRA 2FJGB 3SBWC 5D2LB 1BBDL 1JNLH 2EH8H 4PUBL 1YC8A 4YPJA 1MNUL 3BWUC 3NFPA 3CH1A 5DHVA 3V4UH 5J1SC 5L7XH 4JANA 3RFZC 3QPQD 3L1OH 5D1ZA 1OD7A 3HUJE 5HPMB 5BJTB 4BUHA 3JV6B 3DWTA 2FBJH 1WBXA 1OHQA 4OZGF 3DROA 5GS0H 1A6WH 2YPLA 4QXWA 5BV7C 5C0GB 4PRNA 5KSBA 4XPFH 2C3HA 1KUMA 2BHZA 3PQYB 4HIHA 1ZT4A 3VXPB 4I3RH 1YY9D 2Q8BH 3NAAL 1IGIH 3VXSA 4CBPA 1JF1B 4Y4HC 3KPSE 4D2NA 5CJ5A 3W2DH 3ZLQC 5DHYB 1YYLL 2MNUA 4EIGB 4GRWH 3O2WH 4NN5B 3SDAD 1CFSA 2UZXB 2PYFB 2W38A 2OR9L 2G60H 3PJSB 3LPFA 5JW4N 5DVKA 4V2CB 4QXUH 3RIFK 4PB0L 1GOGA 1YMHA 3RWGB 2DQIH 2JJSC 3O4OC 3BP7A 2EH8L 4NCDA 1WZMA 2NW2A 1QFUH 5IVXF 3V4UL 1MHHB 5L7XL 3L1OL 1I7RB 2OK0H 1I8IB 3OGCA 2FBJL 1A6ZA 4PGZA 4BSVA 3HR5B 3MJ9H 4X6EB 3VFPB 2QSCL 5GS0L 1A6WL 3MBED 3HN3A 3IETA 4XPFL 2XNAA 2WANA 3C5SA 5F3HA 4UIKL 4I3RL 2HKHH 2CPCA 4E41B 3MV7A 1IGIL 1X9QA 4L3EB 5EZIL 3CFKA 2IBZY 4MAYD 2IC2A 1E4KC 4YK4C 4NC0B 4XT1C 5DHXB 3V6OE 3IDIB 3OR6A 3TA3D 2E27H 1FYHB 3DURB 3O2WL 1RVFH 2AJUH 3MNZB 3L7FA 3SHSA 1RUAH 2G60L 1EA9C 3TBYA 4GRMB 2WWMC 3MCLL 1C08A 5F9JA 1XF4B 2OLDA 4HBCL 2LU7A 1KCVH 3C5ZA 4XHQA 5SV4A 4JRWA 4HWZA 3WSQH 4FQXD 1GAFH 5CEZE 5C71A 3ROOB 1B6DA 3MO1B 3VRLE 1UVQB 1P7KA 2NY4C 5EC2B 4XVTH 3Q5OA 1F4AA 3D3VA 4KWUA 2UYLB 4KK9D 1BWWA 2X1PA 4ZUWA 3GB7A 2HKHL 2HFEB 5BS0A 1TXKA 2GTWA 5IESH 4AIZA 1I1AC 4CVUA 3B2UC 4U3HA 2Y7QB 3MCG1 1K5NA 3RZCD 5L8LB 4DWHA 1EEQA 1RVFL 3F58H 4KU1A 1OM3H 1FZKB 4GH7B 1RUAL 2WUBL 4QOKE 3SDXF 1NFDB 4P5KB 5D9SA 1N5YL 1XGRA 2VQ1B 5M7QA 4OLUL 3LMJH 5JLZB 5ACMA 4ODXA 3SDDC 5FCUH 2SEBA 3ORJA 5D7JD 1GAFL 4QYOB 1EGJH 1BQHB 1JNNL 4NSKB 4NUGH 1PEZA 2NY3D 5F7DA 3OQ3B 5B39G 5LVEA 2BVUA 1RJYA 4GUPB 3MLWL 3EYQC 4G3YH 4XVTL 1RUML 2DQGH 1RZKH 4EI6B 3PWLB 3U4AA 1VEMA 4HWBA 4RAUB 1MI5B 4WJ5A 5FO8B 4HPOH 2AV7B 5IESL 1BZ7A 2BSSB 2IAMC 1H0DB 5I71B 2FL5B 4EDWH 2RFXA 1TJIH 2BRRH 3X12A 2NY6B 3CCHA 3F58L 4R0LA 3ZKMC 3TO4A 3IU3B 2PYED 4YNYB 4F7EA 1KFAL 1QYGL 4ZPTA 2I07A 1QRKA 43C9A 4NQTA 5D1QC 1MCQA 2GUOB 4UQ3B 4Z7OF 4KDVA 5FECA 2BC4A 4NO3B 1B88A 1I3RA 1E6OH 5D1ZB 3VFOB 3IKKA 4JFHD 1EGJL 2IPUG 1AXIB 1BQUA 2V5MA 3O45A 4KQ4H 2WBJC 1HHIB 4PGDB 3DROB 4ETYA 4RNRB 3OX8A 3JV4A 2WV3A 4G3YL 2Z93A 4PRNB 5KSBB 2OYPA 3RL1B 5T33L 4NQVA 2XZAH 3SDCB 1QRND 4RMSA 4HIHB 1ZT4B 4HPOL 1PYWA 1AI1H 1TVBB 2NXYC 3V0AC 3K1KC 1N59A 4P2OD 2Y36H 5A2LH 4MMZC 1TJIL 4U6YB 3ZT7A 2P5EE 4HFWB 4RMQA 3ARGB 1QSFB 2VXSL 3RX5A 1PJ9A 3S9DB 1AY1L 1CL7I 1W8NA 1HH9B 1G84A 1FC1A 1YMHB 3MRNB 3BP7B 4LHUG 1KGCD 3DUHA 3GMMA 3LKQB 4D3CL 1ZS8A 4N0YH 1T80A 1R0AH 4P3WA 4JN2B 1E6OL 5DVLA 4L8SB 2HLAA 4NRYB 1TLKA 3QIBA 2C1OA 3QEQA 4BSVB 3KXFA 4KQ4L 4PS4H 4PJXF 1P5UA 3MROB 4Z7WA 4HPYH 4G9DA 4Y19A 4NZJA 1DBJH 3QPXL 5HD8D 4YXLL 3GHEH 1HHHB 5ALCH 5KS9B 3UJIL 4JFFE 1KBGL 1GL4B 4HEME 3PE9A 2FYYB 2J5LC 2P5WA 4AY0A 5J8OA 1FG2A 1XZ0B 3NA9L 3D39A 4P49A 2XN9D 5HY9B 1JIBA 3BKCH 5FYKD 1WWWX 4ODWA 4EUPG 1XF3B 5KZCB 3IU4H 4GAYB 4JKLA 5F9JB 5KVFL 4XWOD 5TDPB 3VXNB 3PWPA 1R3LB 3CAFA 4N0YL 1R0AL 3AGVA 2F5BL 1NEUA 5CJQL 4H1LA 4XB7A 2I24N 2R1WA 4M43H 5E8NB 4GG6B 2NY2D 2GI7A 1P7KB 4J1UB 2YRZA 3JTSA 1TVDA 1KC5H 4HPYL 2XY2A 1JZ8A 3O9WC 1J8HB 2OQJB 4WTXA 1RQ5A 4JZJC 2FD6L 2J12B 4KZEH 1ROWA 3PUCA 3QNXB 5I1HH 2IH1B 1BD2E 1YPZB 3TV3H 4JQVC 4PTUB 3MUZ1 2AXFB 1K4CB 4H0HB 2DM3A 3RHWF 5JW4M 3DIFA 3V95A 5GRJL 3FT4A 4U7SA 4XNQA 1XCTA 3AS3A 1CD1B 3WUWG 3ETBF 5D96C 3VFSA 3BEWB 3NIGE 1NFIB 4X8JA 1U8IA 4MD4B 2A83A 4AH2A 1IAIH 3KPOB 2FIRT 3SKJH 3HHRB 1HYSD 5BZWB 4KGJA 4P23A 3LRSA 3QFJB 3FB7B 3ARWA 4F58H 2EE9A 4HUXB 5EULV 5FYKH 4M43L 3WDHA 4MA7H 5DRWA 4R90H 5JA9A 2Y9RT 4K3JH 3VD4A 4PV8A 3IYLW 1CLZL 1ZVSB 3TV3L 1G9MC 3GRWA 1A14H 4OCSH 4PJ9C 2C1PB 3BYYA 3P9MA 4D9LH 2EYTA 5K93A 5IHBA 4L4JA 2IBZX 3ELAT 3GIZL 5C0BA 4OQTA 5I76A 1A22B 3NIFE 4O9HH 4MJID 3BOVA 2PXYA 3OG6B 1FYTA 5JTWA 4F7EB 2W65B 4LBEB 1DN2A 4PG2A 4Y16C 1NCNA 2F53A 1P4LA 3HNVH 1YZZA 4XP1H 1A8JH 3RKDD 4ZFFA 4MA7L 4R90L 2WWKT 3BP5A 2V5YA 3ALPA 3S8WA 5HHOD 2Z93B 2G5RA 4MCZA 4PJIF 3SKNB 4O51A 3H42H 1K6QL 4MA3B 4HJ0D 2EO9A 4G8EA 4P5MA 3OB0K 1T21B 3OBAA 4M5YH 2EDNA 3SGJA 2ESVD 4KV5F 4XPHH 1ERNA 1NH6A 3FOLB 4O9HL 1ZSDA 5LGHL 3H9YA 2DQUH 3WEXB 1I8LA 5EO9A 4ZUSB 1BEYH 1AE6H 3PDOA 1IGFH 3WIFA 5J1AB 4ZYKB 5C3TA 4NQCE 1U3HA 3MRPB 3ARBB 3DVFA 1ZS8B 3CU1A 4PLJD 3HI1B 5IQ7L 2FJFA 5BW7C 5KSVA 2AJZB 3UXFA 2Z8WC 1LDPL 4FXGB 4HXAH 3O2VL 2GK0A 2HT3D 1J05A 1U95A 2RJMA 2GT9A 5IB2A 4Y19B 5GIRA 3QCTH 5JPNA 1D5BB 2EIEA 1QQDB 2FGWL 3BP6A 3H42L 4NT6A 3WN5B 5IVXE 3NZHH 1LEGA 1N2RA 3KJ6L 1WCBB 5D2LF 2FX7L 2CO6B 2QKIA 3FRUA 1AGFB 4XPHL 4I3SH 2AXGA 4FA8A 5E9DD 3D39B 1KTLB 3CX2A 1KJMA 1N26A 1XGTA 1ZMYA 1ZLWK 4ODWB 4EI5A 2DQUL 3QUZB 3OJDA 1BEYL 1AE6L 2KPNA 1IGFL 1NLDL 3ZHDA 4Z7VA 2YSSA 2NMSA 4BZYA 4JB9H 2LAAA 5HPOA 2GCYB 3TNMA 5IJKA 3PIQA 3TO2A 5JXEC 4XNMB 4FXKA 2EEDA 4G6KH 3V4PH 2BOCA 4HXAL 1PY4A 2X1WL 5IT2H 5DD3H 3JTSB 2P44B 1OAQL 3GBNH 3T0BA 4KI5F 2HJFA 5EIIA 5CS7A 3KYKH 4W6YB 4NQDD 9CGTA 5IVNA 3NZHL 1CYGA 1XR8A 2ADIB 2DLEA 2HVKB 3TCLB 3LKSB 5DURB 2B1HH 1T89C 3GSNH 4JRYA 1XIWD 4YXHH 2F58H 2R4RH 4I3SL 3CLFL 4HGKC 4JN1H 5HDQH 4WEUD 3GSXA 5DGRA 2DQHH 3BZFB 5DI8B 4OV5A 4NN7C 1X4ZA 1YECH 4UQ2A 1MFEL 3AMLA 5DC9B 3SO3C 5ITFA 1QOKA 2X9XA 5ID0A 1SY6H 2XPGB 1UACH 4P23B 3LRSB 3BEVB 1DQJA 4G6KL 5B8CA 1TTUA 4QXTB 3SDXE 2P43B 1RJCA 3MRIA 5GGRA 4Z9KB 5JXAH 5DD3L 2MCPH 3NA4A 1T22A 1OT2A 3O3AB 3EJZC 3IAPA 1DN0A 3MFGB 5H2BB 1UM5H 2H1PH 3C6LB 2YKLH 4KTYA 4N0UB 3TH3T 3C08L 2HKFH 3QI9A 2AW2A 3ULUD 3SJVE 1NBYB 3U82B 3NN8A 4GT7A 2EEAA 1UJ3B 5IMLB 1I85C 4OFIA 3GSNL 1MCSA 4YXHL 2R4RL 4U1KB 3AROA 3EFDL 5C0BB 4NYLA 5HDQL 4X7SH 3VWJC 2IH3A 1MCJA 5DJDA 4CN4A 1GC1H 4OKVA 5KW9L 1VSCA 5EUOA 3FFCD 3GMOA 3RVWC 3DXAA 4U1LB 4XXCA 5E5MA 1Y18B 2ZCKL 2HWZH 3UZQA 2WLYA 2YC1B 1EEUA 1SY6L 1W0VA 3BWAA 1DSFH 3BO8B 3FT2B 2D9CA 3OZ9H 2R9HD 4JFPB 2DQCH 5E8PB 1F3JB 2ILLA 3ZT6A 2VDQH 1NMAH 2YD8A 5JXAL 4P9HL 2YHGA 5F9AC 4X5XA 3DECA 2MFNA 5C07E 2ZPKH 4G8GA 1WISA 2YKLL 1NFDF 4ZPVB 3BN9D 5T1DH 4Z7OE 3SGEI 5IOPB 1YY9C 4WV1C 4WWKA 3EYFA 3Q5TA 4HHAB 4JRXD 1UZ8A 4OFDA 2PO6A 1KPUB 5BZDA 1KOAA 1MREL 4APQA 4FQ1H 3BGFB 1EBPA 1MOEA 1QSEB 2GHWB 4K3EL 3SDAC 4TPRH 3ARED 1OCWH 3OSKA 2HA1A 1QBML 1ZSDB 5L0QB 2XG4A 5IGXH 1BQHG 1T66C 1P7QD 1NC2A 3ULUH 2OSLA 3JV5A 4HT1H 3V7MA 2FJHB 4H25B 5FGCE 2APXA 4BYHA 3QIUC 3NACH 1DSFL 3EOBA 3A67H 2YD4A 2A6DA 2DB8A 1H3VA 4NHCH 1DR9A 3R06B 5D8JH 2ENYA 2GT9B 1NMAL 1ZT7A 2MPAL 3ECBB 1C5BH 3O6FA 3P9WB 3WIHA 3LKPA 2F19L 4PRPB 3P4OA 4IJ3B 5DYOB 1S5IL 2X89A 3OKEA 2JE8A 4ZFOB 4MB3A 5T1DL 1HCFX 2X4TA 4X7TA 4U6HB 4M1CD 5KSUB 1N2RB 4LLMA 4J3OC 5DTFB 5KVEH 5I17B 3MLTB 3HI6H 1MWAA 3UPCA 2IPTL 3QCUH 4PJXE 3QB7C 3N1QC 5T5FH 3F7VB 5ESQA 3TA3C 4GXUN 5SWZB 4CMHC 4CVZA 1OCWL 1D5ZA 1URLA 4Y2DB 1QLEL 4O4YH 3U9PH 5EU7E 5ILTH 4N1CA 3S96A 5D2NC 5TJWK 3ULUL 5KSBF 3PWNA 4B0MM 1BOYA 1RZKC 1U8PA 3ZSTA 3NACL 1G7MA 2LTQB 1K85A 4G8FA 3A67L 2YK1L 1B0GB 3WD5H 2JF1A 4QRPE 4FQXC 4NHCL 4RAHA 1U36A 2BOCB 1Y6MR 3NPSC 4RIRA 5D8JL 1FZMA 3VRIB 3BVNB 1V3JA 2Y06L 1A7QH 5JPMB 5GSRB 1C5BL 1PQZB 4WI2A 2EDKA 5EIIB 3L5HA 2YD2A 2V2WA 4KK9C 1TNNA 3KPRB 3ZKND 2YBRA 2CRMA 3QDJD 4U0QB 5DS8A 1WWAX 3HI6L 4U0RC 1FNFA 2KUTA 4O00A 1B9ZA 5T5FL 2JJTC 2UUDH 2PN5A 3LQZA 2NY1D 5FKAA 1ZV5A 2EXYD 4QGTA 3TPUB 5DQ9A 1MSPA 2X4PA 1AKJB 2AK4B 4O4YL 4XH2A 2H2SD 5ILTL 4IBLT 5IWLA 5L9DL 4YFDB 4N90D 1BGXH 1NPUA 1A6UL 1CGYA 3WIIH 5C7XH 5E8OA 3W11C 3WD5L 2VDMH 1IRAY 1MRFH 1ADQA 1I1CA 4HJGB 1JWSB 4OZHB 3B3IA 2CRYA 2NY3C 5GRVL 3EYVA 1OP3H 4XNUL 3T04D 1IILE 3VFRA 2A38A 4XVJL 1DUYA 1DN0B 3GMPA 3B9KD 4A2LA 1DL7H 4BM7A 4YAQA 4KVCH 3P77A 1E27A 4O5LL 1FIEA 4FQCH 4WI5A 1IGCH 2X9YA 4HH9B 4JFZH 2VYRE 1H3PL 3BQUB 4JFED 5ID1B 1HWGB 1YEJL 3K4AA 2VQUA 1K9TA 3HAEH 4GRLA 4NYLB 3CXDH 3PWJA 5HVFB 2B2XL 1IVLA 5D7LE 4NM4L 5ACLA 3RAJL 1WTLA 1L0XA 3REWB 5EUOB 1RULL 1AC6A 5L2KB 2I9TB 1WT5A 2QQLL 5FO7B 2X1OA 3S37H 1QLRB 5C7XL 2Q6WA 3WIIL 4YHZL 1IFHL 3VWKA 3X3GH 4EEEA 2M2DA 4MNQE 1MRFL 2OS7A 4DQOH 1KELL 4GW1A 5DQJA 1VKXA 5TH2A 1IQWH 3K4ZA 4FQLH 3G9AB 1T1XB 3EDDA 1RIUH 5FGBC 2AI0H 4KAQL 1NGPL 5F1KC 3OKOA 5CBAA 2ZG3A 2CDFA 2IADA 5E2WH 1A3QA 1P1ZA 3QG7L 5EG6C 4FQCL 2YXMA 3STLA 2HG5B 5DJAA 4M9OA 1UZ8B 4Z77A 1ZLSH 5DD5H 3ULSA 5BZDB 5ANMB 2CLZB 4HQQL 5AWNH 5K33A 2DWEA 3ZTJH 4FQQB 1RZJL 2J88L 3W0WE 3QFDB 3KPSD 1U8QA 5IQ9B 2I9LA 1HIMH 2ZOKA 1LK3L 3KJ4C 3PL6C 1NC2B 3L5JA 3OKMA 2ICWJ 5DK2A 1ZT1A 3UBXA 3S37L 4OJFH 4KV5E 4IMLB 3SO3B 5TDOA 4YFLI 3X3GL 2A6DB 4X5WB 1NGQH 2E9WA 2CDEB 3O6MH 4DUXA 1G7HA 4XVUD 4Z95L 3RGVD 4EOWH 5KVMC 4Q2ZA 1RIUL 3U7YL 5F7MC 3QUYB 1CICB 2PR4L 3OKEB 5HD8C 5E2WL 3RIAF 2Y5EA 4F7CB 3SQOH 1KTKE 5IW1A 5DD5L 2ID5A 1I1FB 5AWNL 2MKLC 4U1IA 1IGJA 1FV1B 2JB6B 5JIPA 5GJTH 1CS6A 5ESQB 3MRFA 1BVZA 2EKSA 3E8UH 2CIIA 3RU8L