4J6RH

Crystal structure of broadly and potently neutralizing antibody vrc23 in complex with hiv-1 gp120
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
222
structure length
222
Chain Sequence
EVQFVQSGAEVKKPGASVRVSCEASGYSFTDYVLQWIRQAPGQRPEWMGWIKPERGAVSYAPQFQGRLTLTRDLYTETAYMHFKNLRSDDTAIYYCARGVRRDASWWLQFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
publication title Delineating antibody recognition in polyclonal sera from patterns of HIV-1 isolate neutralization.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 37
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2013-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4j6rH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4j6rH01
3VXTB 4BSWA 3KYKL 5C08D 4NQDA 3MRKA 3EOTL 2MMXA 3IU4H 5GGVL 2OJEB 1BWMA 2GSIB 2X44D 1M05A 2F74B 2P45B 4MCZA 3QJHB 4ONGL 1FPTH 2GYSA 3ALWA 2AK4B 3BN9C 3DURB 4PJ9C 1K8IA 3LY6A 4JY5H 5C6TL 3PWJA 3QULA 1XGTA 3QIUC 3G5VB 4OFVA 1MWAH 1BZ7B 4ZUSA 4MA1B 4X6DE 2OTPA 5IB3A 2VQ1A 3R06A 4EN3C 4N9GB 5BQ7A 4LSVL 5D7KE 1IAOB 1YA5A 1BLNA 4L8BB 1J12A 4MMZC 2DYPB 1MCIA 4RAHA 3RAJL 1AY1L 2BOBA 3PL6D 5C9JA 2MCPH 1IGCH 4RISL 3QNYA 1XR8A 4G8GB 4PP1C 3HFML 3RQ3A 1CXHA 1N0LA 4YQXH 3SDAD 2XWJA 2L7JA 4ZFOL 3PDDA 4S1SL 3D39D 4O4YL 5KJRH 3M1BA 3SDDA 1VADB 4H8WL 4H26A 2EH7L 3PL6B 3T4AB 4AJ0A 1T7XA 5K9OB 2JF1A 4L1DA 4XP6H 4ZFZA 1RQ5A 1EAJA 5K33A 1S9YA 1Z5LA 1LD9A 5F1OB 3D39B 1DEDA 2PCPA 3KJ4C 1CQKA 4ZTOH 4WEBH 4Z9KB 3LRGA 2AKRB 3L3DB 2Y7QA 3PQYB 4DKEL 3HC3H 5C0BB 5JW4N 1PJ9A 2VLJE 4NC1C 4ISVB 3WJLA 4ONHA 5CSBA 3SE4A 4OCNC 2DM2A 1A6AB 5J11C 1MRDL 4YO0B 3CVIL 4Z7UE 3IJYB 5IQ7L 3HMXH 3HR5B 2PTTA 1QFUH 5I8CA 5CFHA 1KB5A 3FT2A 1B6UA 1UH2A 3LPGA 3BH8B 5DJAB 4I4WB 4NGHH 3VXQA 3V52H 5HHXH 3WXWH 4MA8H 3VXNA 4P5TC 4E42A 2ZP0T 3SKMA 3RL2B 3U30B 1WC7A 2MPAH 3CCHB 3MR9A 4JQXC 4NC1E 1J88A 3KYNA 2EDOA 4JM2A 4ZUWA 4MA3A 4U1GC 3C2AL 1XIWB 3OJVC 3LQZA 5KOMC 3VA2C 1D5IH 2YPVL 3SOBL 1NDGA 1AO7E 5IMLB 3QHFL 4HGKC 3MRMA 6FABH 4XCCH 1LEIA 4XX1E 1L6XA 4RMTA 3NFSH 3I6LD 4ERSL 5H35B 2MFNA 2B39A 5LBSH 5HVWA 3X3GL 2Z91A 1FVEA 3SQBA 4U2YA 3S88L 2AJXL 2GSGB 5H2BB 4J3XA 4C59B 1GGIL 4I3RH 4WUUB 5DJXB 2PF6A 5DD5H 1MFAL 5CINH 1WZLA 4DN3L 4NCC1 3F8UB 1CGYA 4Y7MA 4WW2A 5CHNA 4GAYA 4XB7A 3F58H 1JJUA 5MEOA 2P8LB 3CC5B 4JG1H 5JHDD 1P6FA 1MVUB 4GAGH 5B38B 5EU3B 2J4WL 4XC3L 2FLBT 3T0BA 5HGDB 3IAQA 1AXTH 1ZVSA 2B4CH 2J3SA 2E7BA 1P7KB 1UYWL 3QUYC 2QBWA 2R0ZH 3DMMB 4NO0A 4CGTA 4P5MB 4W6WB 3VG9C 4X0KB 1A14L 2A1WL 1M71A 4N0UA 4S11A 5DHVB 3MJ9H 3Q6GH 3QDJD 4APQA 4FZEL 3K8KA 5HDQH 5EUOE 4J3UA 5FAAA 4JVPA 3OB0H 4PJXA 4MGXA 2X4OA 4R0LC 3U48A 4L9DA 4IEFB 2ATKA 1AHWB 2H41A 3LKOA 4XNUL 5DVNA 5F97E 1S7XB 3QEGH 2PO6A 4ZYKA 3QAZC 1XR9B 2VN4A 4PTTA 3GSVB 3OKLA 1FNSH 5J3HC 1E4WH 2QSTA 3UROR 2W0PA 5FGBC 3QPXH 4HPYH 2X1OA 1V3KA 2WQ8A 3MLRH 3VMPA 3LKNB 4LPXA 3L9RB 2VWEC 2YD2A 3ULUC 4JO3L 5E2JA 2CR6A 4CNIA 4LSTL 4U49A 3QXVA 1DQQB 4X9IA 3A6CH 4OV6F 3BKMH 1WEJH 1OTSD 3LV3A 3ECBA 1EJ6A 1JHLL 5DDHB 4XWGH 1TQBC 4WTZG 4HIJB 4XRCA 1J0HA 2HTKC 3GIVB 2BVUA 1CE6B 3O6FB 4NRXA 5CLTA 5I66A 4GO6B 25C8H 1T5WA 5IJVB 1JF1B 3PV7A 3V0VB 4Y16A 1FC1A 2ZUYA 3DUUB 4HWEH 1G7HB 2VWEE 4PV8B 5FUOL 1FVDA 1IQWL 4L8SA 2HLFC 3O6ML 3P9MA 4LDLB 1S9XB 4G3YH 2UUDH 3S6CA 3IDMA 5JOPD 2QSVA 3A6BL 4MNQA 1I7ZB 3GBMH 4QHKI 3PWUA 4HH8A 2EIEA 3FFDA 1QKZL 5HGGS 3ZE1F 4FQCL 4Z7WE 5JLZA 3MRJB 1VPOH 5IHUL 4I2XE 1U93B 4Y88A 2VUOA 1S7VA 3I84A 4PLOB 1NMAL 4GS7B 3QBTB 3VXMB 3WFCL 4HCRL 3CAFA 2QHRH 3DX6A 4XMLH 1DQML 1RJYA 2F9BT 5F6IB 2F19L 2H2PC 5IFJA 2OTWB 2JJUA 1WCBA 2BNQB 1AKJD 4RMWA 2DWDA 4KDVA 5INCA 1RUPL 4Q6IA 3BEVA 1OSPL 1QBLH 3F5WA 3QDGD 5FYJH 1OGAE 3WO4C 1MCRA 4U1JB 1T6VN 2XWBB 4MDIA 3QO1B 2YC1A 1H15B 4FOMA 1HNFA 4XPTL 4JJ5B 2HP4A 2YXFA 3IDGA 1QVOB 5DS8B 4ZD3L 5IR1B 2NX5B 3QEQA 1N59B 1PX3A 4F8TA 1G7IB 1KNOA 2J6EL 3SKUD 3S37L 4YWGL 3VI3F 4LRNL 1NSNH 3BZEA 1QSEE 2C3GA 4GG6F 3FT4B 4XH2B 2V6HA 3QDGB 4DUWA 2XN9A 4BUHA 4ODHH 2WNGA 5IMKB 4JFEB 3O9WD 4F9PA 2ZCLL 4LLVB 4NHUB 4PJEB 1EUUA 5TGBA 2XFXA 1QFPA 4NRZB 3KPMB 3QG7H 4WUKH 4FQQB 5ICXA 3PQYE 1OB1B 4DKDC 1NCDH 2VQTA 3TCLB 5D2NA 4TTGA 3O9WB 2ZCKH 3VFGL 4OAWB 4OGAD 5EOCH 2Z31C 4JRYE 1F58H 1E27B 4JKKA 4PJ5E 3S37X 1UCTA 4WEMB 2BNRA 4LAQH 1BJ1J 5D6CB 4K7FB 3TFKC 3WFBL 4GSDH 1PX4A 1VFBB 3ARDC 3PDGA 4WEUD 2AXHA 1AC6A 1G1YA 2VXVL 1R5VA 5D1QB 5K93A 2QHLA 1D9KD 1RIUH 5CEYA 4YBLB 1PEZA 4MJIB 4LLUB 5E6IB 3RNKB 4M62H 3QUZD 3PGCB 4XPAL 4PRHB 2IH1A 2O5YL 4U1NA 2ARWA 3B3IB 2R4RL 3WEXB 1KC5H 3SKOA 1QO3B 2I26N 1M7IA 3F12A 4Z0BH 5T1MB 1QPPA 5FA3B 3DGGB 3GMNB 1E4KC 1N26A 4HG4K 3TZVA 5BRZA 3FB7B 3F65A 3EGSA 4M93B 4KJYA 5I1AB 2CD0A 3QCTH 2AXFA 1NFIA 3CNKA 4JFHE 3D85A 3O4LA 3QRGH 2FECI 5TE4H 2ADIB 3MBEC 3D0LB 2GJ6E 3TPKA 3ILPA 2P24B 5F44A 4WUUE 1RVFH 3SE8H 3STZB 1H5BB 1CGXA 4UOW0 1SJVA 3MREB 1JRHI 4JCLA 1T1YA 2DQCH 4DZ8A 4FNLH 3NFPA 1FZJB 2VRAA 2EC9T 3CK0H 5FKAA 3PP3H 3GSOA 1OQXA 4ENEC 3MFFA 1C12A 4IDJH 3G5XA 1EGJH 4LLQA 4RRPA 1W0WB 3RBGA 4FQ2H 2YZ1A 4U6XA 4M48L 4MWFA 3T0WA 4HUVB 3QUXB 2EEAA 3W0WE 5JR1H 1Q1JH 1IC5H 4A6YH 4KRPD 1Q9LA 3UX9B 3VRLE 2HFGL 2QQKL 3ULVC 4XNXL 3EO1A 3KPRE 3AM8A 1FORL 3P2TA 4F37K 3EOBB 4KUZH 2Z8WC 4JN2B 1QG3A 1IAKB 5J7CC 1QLRB 1YDPB 5GS2H 2EE6A 1NCCL 5I15H 4L4TE 5L2JB 5DK0A 1FCCA 4QRTB 1OHQA 1J1XL 2XT1B 5SWQA 1WAAE 3RGVB 2F54A 3V7MA 5CILL 1M7DA 3KPQA 5HY9B 3ET9F 2OZ4H 4HLZG 1CK0H 3EYVA 3OB0K 5HHOA 4WU5A 4MQ7A 1V3LA 4Z7QE 1KCSL 1MVFA 2VLKD 1QPXA 3ULVE 4EIZC 2PN5A 1K8DA 3ULUH 3DX8A 1QR1B 3BO8B 1INDL 1M7XA 2GFBB 1CI5A 3F7YA 4C56B 1MEXL 3AREC 1U8QB 3ZL4L 4W4OA 1YQ2A 2C3HA 3RU8H 2CRIA 3GUTB 2CPCA 1AQDA 4ZSOE 5FO9A 4DAGL 4OD2A 1R6VA 1DEEB 1RJZB 3QQ9C 5DHYB 4HQQL 4JPVH 5I6XB 1UJTA 2ICCA 3I3EA 4NOFA 2A74B 4MCYA 5C0ND 3OZ9L 3VFMA 2ZPKH 5C2BH 1HILB 1MHEA 2P5ED 3D6GA 4OLWL 5GS1B 4AT6A 4OSUL 2AVGA 3Q6FB 1XCQA 4K8RD 1R3IH 3PNWA 4K71B 2APVA 5T1KA 4QGTA 5SX4I 3C5ZC 3VRJB 2Y07L 3AS1A 2B1AH 2XWTA 4U3XA 3QNXB 4BH7B 1AD9A 2K7QA 4BA8A 4PG9A 1AP2A 4WO4C 4UT7H 1JZ7A 5J1AB 3K81A 1QA9B 4JPKL 4QRRA 5EO0B 1ZOXA 2HH0L 3SCMB 5JW4M 1HK6A 3IDNA 3WUWB 5FKPA 1UB5A 2Q7NA 4M7KH 3FB8A 3MC0A 4P2OB 4YLQT 2GJZB 5DLML 5FDYA 1OTUC 3W11C 3KPPB 5DJZA 5ANMA 3VXSA 2UUDK 4S1RL 5I71C 2CLRA 5JXEA 5TJWK 4MAYC 4UT9L 1MIEH 3O6KH 1ZS8A 1S5HA 4MS8C 1MCLA 1YY8B 2ZSVA 5GZNC 1IGML 2OX5A 2RFXA 5DUBA 5JIKA 3VXME 1IQDA 4HUWB 1IAIL 4CVXB 4PLKD 3P4LA 1Q38A 3QZWG 2X4UB 1OSZB 1A7QL 5F9OH 5IMOA 5HYQB 4XPHL 1NAMA 5H94A 1ES0A 4P3CL 3GHBL 3QO0B 3MMEA 3HLAB 2YD3A 3BUYA 1KCRL 1II4E 1ORSA 4QNPE 5DURB 1TVBB 3O0RL 4S0SD 1E6OH 1SM3H 3U36A 3BZ4B 4NQCE 3UAJC 2A77H 2B2XL 1ZANL 1YEJH 4OB5H 5MEQA 3D3VA 4F7MA 1W2KT 4PG2A 43CAA 3AS2A 3BEWA 4NFCA 4Y5XC 4PGDA 4KROB 1CICD 1YEHH 3S35L 4LGPB 3MRRA 4ZFFB 5F88A 5JPMB 4TQEH 3WHXB 2YD9A 3B9EA 2XTJD 4JFEE 4K55A 4R26L 4PJ8D 2F58L 1CICB 4PJEE 1DFBL 2OK0L 5KSBB 4G42A 3EDFA 4KPHL 4JQIL 3HE6D 3PGDB 5D93C 1Q9KA 3QT2A 3CZFB 3STLB 3BISA 3E8UL 3KPSB 2XTJB 1R3HB 2A83B 3BPNB 1QSFD 2YS4A 4QRSB 5E7FA 3MACL 4YGVA 4KI5C 4GXUN 4HDIB 4CUCA 1E6JH 2VZVA 1A1MA 4FQHB 4FQXC 5D7JD 5BZDA 4IS6B 2I60L 5HJ3A 3X3FH 3BN3B 4EIGB 2MQCA 1QSFB 1UCBL 3L3HA 1OP5H 5D7LB 1WTLA 4U1KA 4YHKH 1T6WA 3GB7B 5CIPH 1I9RL 3WSQL 1JGDB 5T5FH 3OKOB 1IGFL 1CDUA 4MJIE 5AWNL 2ENSA 4J1UB 5DJ8B 5D7JB 3WLWC 3HCVB 2JIXB 3LB6D 3WFEL 1B4JH 4C54A 3QIBA 3BDYH 3CSPA 1CU4L 3VH8G 3IFPB 1BVKB 4PRHE 4KI5E 4X6CE 2QTEA 3ARBC 2KQNA 3NFNB 4E5XA 2AJUL 3TT1H 1A6TA 4HMEA 5IESH 4ZUUA 3L5WA 2DICA 3ES6A 2X70B 2ADFL 1CBVH 2QQLL 4UT6H 1YYML 4X6FB 5DD3H 3U79A 5I30L 3OR6A 2RQ8A 5TPWH 2IQ9L 4YDJB 1I4FB 1UWGL 3KYMA 3E6HB 3INUH 2D0GA 2NY0C 4G8FB 3QP3A 4CN1A 4OV5B 1YUHA 5KAQG 2Q7YB 4NQDD 2BDNH 5JPNB 1SJEB 2FJHA 3LQAH 3P4MB 5KTEL 1ZA6B 1U8JA 3RTQA 3EIFA 2WBJC 3SDDD 3JTTA 2W9EL 1IC1A 1Q0XL 3FAXA 3RGVC 2YK1L 2GIYA 4HD9A 1RZKC 3NA9H 4BSWB 2AEPL 1JE6A 3JWDH 3MRKB 3U0TA 4KK9C 2W0KA 4NKOA 3TVMA 1UKQA 2OL3A 3BMVA 3HPJA 3DYOA 4RA0C 1M05B 4TVPD 3PP3K 3BESR 4JY6B 5E8EA 1K8IB 2EO1A 3OR7A 1KTRL 1MI5E 4Y5VA 3PWJB 5L7XH 5C6WH 1XGTB 1FFPA 2VL5B 4IIQB 4FFZL 2VQ1B 4HXBH 4J8RA 4ALAH 4AEHH 1BLNB 5FYLL 1HWHB 1QLEL 4D9QE 1B4RA 1XR8B 3UEZA 3L5XL 3U2SA 2NXZC 4HIHA 5C07A 2DBLL 2YD8A 3M1BB 1P5UA 1RUML 3IDYB 4H26B 5C0AA 3Q1SL 5J9PB 1E28A 2FATH 4LBEA 4Y89A 1U3HA 4LPCA 5DC9B 4C56E 1OAKH 2X5PA 4KK5C 1S9YB 5IUSA 5J1TC 1Z5LB 1LD9B 5DMGC 4DGVL 2Y7QB 5LKNA 4WI6A 4OZIE 2G60H 4MXQD 2H6PA 3V6ZB 3T2PA 4ONHB 4CMHC 4HIIA 3UTSE 1WITA 4LLMA 2UZIL 3G04A 3IFLH 3TA3C 1OOAA 5JORB 2HFFA 2FIRT 3H9ZA 1NBYA 3D0VA 5I8CB 1T03H 3FT2B 4JM2D 1EERB 4KDTA 3GSXA 4G8EB 1ADQA 3VXQB 4BZ2H 2GCYA 1NMBH 4E42B 1PD6A 1UJ3C 4FXLA 3RIAF 3T04D 3SKMB 2EH8L 5FM4A 2GT9A 1WC7B 3GK8L 3MR9B 2JCCA 4XGZB 4R7DB 2R1XB 3KYNB 4JM2B 4ZUWB 4NWTH 3L3IA 4MA3B 5J89A 1KN4L 2LE9A 1HHJA 3LQZB 5B39A 2I5YH 5L0QB 3GMOB 3IJHA 5CJOL 1JFQL 4HAFA 3JSSA 3U83A 3MRMB 1ZEAL 1LEIB 1A6UL 4IRZL 1X5KA 4PJBB 2X10A 5HDBE 3TIDB 3MRIA 3MV9A 4CAGA 1YQVH 4U33A 4M1DL 4XCYA 1CLYL 1FVEB 2Z91B 5AZEH 3H8NA 5ADPL 3CDYA 4H88H 4WDIA 1YEGH 3THML 3RVVD 4HBCH 1HCFX 3VD9A 3EJYC 4RFOL 2E7HA 4TUKH 5DJ2A 2NYYC 2JJVA 3C5SA 1J0YA 4WW2B 5CHNB 5MEOB 1WFTA 3SE9L 3MRPB 5E70A 1I9EA 4PJFE 3UBXA 1HHHA 1E4XL 1A7RH 2NY1D 5FGSA 3C2SA 1ZVSB 2CK0H 2X4NA 5DJYA 5IW6A 3VFTB 2CIKA 3NGBB 4HAGA 1BWWA 1YMHA 4NO0B 2FBJH 4QGYA 3RFZC 1BF8A 1I1AC 2PO6D 1M71B 1MQ8A 4AH2B 4N0UB 4JHZA 4XMKL 1MCSA 2NY2B 2PXYB 3KPSE 4APQB 1A1OA 4RGNC 3MLYH 1OARH 1OAUH 3MRNB 1FDLH 4M7JL 4K94C 3BQUA 4PJXB 1D5ZB 5AZ2L 2CR3A 1RIVH 2ATKB 3U7WL 1S3KH 3LKOB 4DW2H 4XP1L 2PO6B 1KPVB 4OT1L 3BZFA 2LU3A 1WJ3A 4PTTB 3OKLB 3VI4F 1UM4L 3X11A 2EECA 2IAMC 4D0CA 5KSUA 4X9GA 3WV0A 1TFHA 3IFNL 5IB2A 3PWNA 3L7EA 4FTVD 4G6JL 4ZUTA 4D8PA 5TDOA 3DUSB 4NUJA 3SN6N 3IDXH 3C6LA 5B8CC 4CNIB 2CRMA 4U0RC 4RGNE 1ZTXH 1OP5K 3H6JA 5J12B 4PGEA 4IOFC 1LO0H 2V5YA 4Y16D 3CIQA 3LV3B 1FNAA 4ZAKC 2YA1A 5DR5H 7CGTA 4XRCB 4HPOL 4J7RA 4G6FD 1SJXA 2LAGB 4NRXB 4LF3B 1I9JL 5I66B 3ZKNC 1MFEL 3S36X 2F8OA 3WYRA 3LOWA 1D5XA 1T5WB 4Y4KC 1C5DA 1EEQA 4MNQD 5GS0L 3KGRA 3DYMA 4DWHA 1WWWX 1KIPB 4OLVH 3UTTA 1FVDB 4L8SB 4QRUB 4H0GA 2EE9A 3P9MB 5E56A 1W8OA 2P5WE 3IDMB 4X4ME 3WS3B 1VA9A 2DTML 3LKRA 3MRBA 3PWUB 4KAQL 5ETUB 4LDOB 3FFDB 1FNFA 2WWKO 3HA0A 1BIIA 2R8SL 2WIMA 4OZ4A 1Q9WA 2Q8BL 2YEZA 2A9NH 2JK5B 4NPYA 2I9TA 4QRQA 1OAZL 5KSAB 2CUHA 1F00I 4LHJB 1S7VB 4F7CA 2CMRL 4EDWH 4LKCA 4LNVA 5D1XA 1FIGL 3KWWB 3SO3C 2UY6A 3DX6B 4G43A 4WI5A 1N5YH 1RJYB 3MA9L 4K3JL 2FR4B 3VFOA 1YMMA 2Z92A 4LHUA 1AQKH 1WCBB 2AJSH 2XA3A 4G7YH 5DA0B 3MV01 1N6QL 3QEQD 2Y4SA 1WWCA 1OCWH 4M7LT 4DQOL 1D5BA 1RFDL 1H3GA 1HYSC 3PE9A 3LH2L 1ZT4B 4Q6IB 5E03A 2OSLA 2VIRA 3TV3L 3BZDA 3F5WB 3BP4A 1T66C 4MDIB 2YC1B 2H3NB 3QFJE 3IDGB 3QEQB 3JWOH 1B0GA 1KNOB 4JFZH 5ALCH 1GIGH 3SO5A 3BH9A 3VWKD 3V7AG 3BZEB 5E1AB 1U91A 4P46A 2XN9B 4XPFH 5I1IL 1LE9A 4ORGA 2EE2A 1BX2B 1GZQA 1I8LA 1VKXA 2FYYA 1YEFL 5BOPA 1G9NC 2ZUWA 3FFCE 1V05A 4PJDF 2F53A 5TGBB 3GMPA 1NUDA 2DQUH 4NZDA 5TDNA 2BNRD 2ZCHL 2R2HA 3NTCH 4UQ3B 5ICXB 1ZHBA 4K3HA 4EUPB 1C8PA 5I74B 3X12A 3EKCA 4YHYC 5D2NB 1IEAA 1KTKE 1OLLA 2XPGA 3QXUA 3UDWA 1NLDL 4IMLA 3ZT5A 1GZPB 1EO7A 4U2ZA 4GMTL 2NPLX 4LPWA 2BNRB 1OD7A 3IXAA 4YHZH 1CYGA 2W38A 5T33H 1OM3H 5LGHL 5C0CD 4JY4A 4FXKA 1QLFA 3L95B 4UV4L 2XKUA 5EWIH 5C0RH 3B6SA 3KR3L 2DQJH 1R5VB 4MB5A 1BECA 1EBPA 2DD8H 4FZ8H 3FN0H 5CEYB 3Q0HA 5FB8A 3AS0A 2J8UF 2XG4A 3EAKA 4YX2H 5HXMA 1XF2A 4GXUM 1FLRH 4P2YA 2FX7L 5GIRA 1OPGH 4C58B 4PLJC 1XT5A 4OLZH 4KQ3L 4U1NB 5BRZD 4N8VB 5GQBA 1K85A 4QWWD 4PS4L 4L5FH 3UPRB 2ESVA 4L3EE 3L1OL 1NBVL 2EC8A 1M7IB 1KCUL 3D85D 3O4LD 2HLAA 5DUPH 3EYSH 5BV7H 5JNYA 1SVCP 3TZVB 1KB9K 4AIOA 2WP3T 3LEVH 5BRZB 2CJUH 4KK6D 1LEKA 4PJBE 3WIHA 3EGSB 4KJYB 2AXFB 4NQSB 3ARWA 3DI2B 4R7NA 4V1DA 1UEYA 3EJZC 3H7BA 5BXFA 4D9LL 4IRSA 1BVZA 2VDLH 1H8NA 1KUMA 4P99A 3N1PC 4Q9RH 4UU9A 1SMOA 1D6EA 1QACA 2PW1B 4YHLH 2V2XA 1XAUA 4DZ8B 3UYRH 3QI9A 3NFPB 1VESA 1U6AL 4S1DC 4OZFG 4X80H 1HSAA 5FKAB 1WLHA 3GSOB 3WXVH 5KG9A 3MO1A 4XNYH 1O5DT 3ARSA 5DRNA 3G5XB 4LLQB 1OT1A 5CBEA 4FG6D 3DIFA 3ARYA 4U6XB 2GK2A 4XTRD 1X4ZA 2DMBA 4MWFB 4H1LA 1YECL 4UTBL 2CXKA 1Q9LB 3I2CL 3OPZH 4X4XB 5F1SA 2BRQA 3EO1B 2P1YA 4MNGB 1BEYL 1QBMH 3M8OH 4N0UE 4GKZA 5D96C 3E3QE 1K5NA 1ADQL 1ORQA 3LHPH 3K2UH 1KYOK 1LMKA 1MUJA 2FH6A 3OQ3B 4PJXE 1EMTH 3QEHA 5SWQB 2F54B 1QFHA 3VGFA 1DP0A 1ZSDA 5DJDA 3HNVH 3I3DA 4ZO7A 1CXLA 1MCJA 3KPQB 1A3QA 2QQNL 3VG0L 3EYVB 5HHOB 4I0CC 3CU1A 5FYKL 4WU5B 4MQ7B 1IGIH 4PBWD 2NY4D 5I1CL 4HWBA 3GSNH 4BFBD 4YNYA 5L6YH 2YRLA 5BVPL 2HJFA 5T3ZD 2CKNA 1EV2E 3P73A 3DYPA 1P7HL 1K8DB 5DC4B 3DX8B 1MCCA 9CGTA 1I85A 1BQSA 3F7YB 5SV4A 1T0PB 2CSPA 4ZO6A 4POZD 4LCYB 5FO9B 1PZUB 4OD2B 4P23C 1P5VA 5C2UB 2H32A 3AFLA 3FN9A 4LVHB 1BOYA 3VFMB 2EDFA 1MHEB 3P30H 2ZSWA 2ADJB 4HKJA 1DUZA 3C5JA 5E4EC 1J1OL 1XCQB 4Z7VF 4EI5A 2VISA 3MV11 2AEWA 2VDRH 4QRRD 1G1CA 3PNWB 5IFAH 4JKPH 3VJ6A 4PRDA 5MI0C 1CFTA 4H20L 5T1KB 2BZDA 1CLOL 1JMXA 4N1CA 4POUB 5GJTL 5LGJA 2AK1L 4FABH 1AD9B 1LO4L 4PG9B 2PYEA 5JXED 3V4VH 4TUOA 2VH5L 3HUJA 1CXKA 3CH8A 4GG6B 5HGAB 4POYA 3FB8B 5IBUG 2O93L 1GOHA 5GGQL 5DJZB 3VXSB 1MFNA 2BFVH 2CLRB 1FL3A 5E2VH 1S5HB 4U1HA 3O2DA 2ZSVB 2OI9C 3O8XD 1T1XA 2ARJQ 4PJDA 1IQDB 1S5IL 2PKDA 4U3HA 4P2QA 1VENA 1WBZB 1ONQA 4PJGF 3L5IA 5E6ZA 1FBIH 1NAMB 1VGKA 2DLIA 3FOLA 5H94B 1ES0B 3MMEB 4W6XB 4W70A 1V7NH 2R0KL 2XA8H 3RUGF 3D3VD 2AJZA 4OM1H 4LIQL 3BMWA 5DK3A 4ZMAT 1ORSB 4KTEH 3V5HA 2Q1EA 2QSCH 5HD8D 5HI3C 4PREB 5IM7B 1BVLA 3ARUA 4GKSA 4M1CC 2V5TA 4Q9QL 3NACL 2KDGA 3VW3L 4HXAL 3ARFD 3D3VB 3EYUH 43CAB 1A7NL 1QFWI 1WBYA 3TO2A 3PHSA 3ROLA 4PGDB 5D1ZC 1MAJA 1N4XH 1I8IA 1EFXA 3ARZA 3RY4A 4F57L 2OM5A 3NCYS 3I50L 4RAVA 4Y2DC 4AK1A 4IJ3C 3WFHA 3RVXD 2OMBA 4O58H 2VDPH 5D72L 4AY0A 2FWOB 2XZCL 4G42B 1T20B 2ZWLT 4KZEL 1EUTA 3U9PL 4U6YA 4K7PH 1NAKH 4KJPD 1VGEH 1Q9OB 4NJAH 4EQ3A 5DT1L 4JRXE 2IANB 3GHEL 3HRZA 5EOCJ 4Y4HA 5F21B 4HS3B 4YGVB 2HMID 2R4SH 3MOAH 1XGYL 5CEZD 4YDVA 4Z95L 2FB4H 4AL8H 3QQNA 3K2MC 3FO9A 4QLRA 2APTA 4NOBA 3SDAC 4CU7A 5CBAB 2YKLH 3TN0A 3SKNA 4WGVB 4FFVD 3T2NL 5BZDB 3QIBD 5HJ3B 3S9DB 1JWMB 3X13A 4LRIA 5DD1L 2VLRA 1TIUA 3DV6B 2V7NA 5MENA 4U1KB 1DVFA 3MLXL 1OAYL 3SGKA 1UGNA 4NYLA 4TSBH 1Q0YH 2XY1A 3G9AB 1FFOA 5FYLE 4N5EC 3REWB 2HVJB 4I0PA 3KDMA 3QIBB 3LRHA 4P4KC 2DI8A 3RWEA 4MLIA 4WV1C 3BHBA 3U9UA 5C09A 2IBBA 4NFDA 4WFFD 2VITA 4ZUUB 3L5WB 3ES6B 1S9WB 4F37F 5DJ0A 5IWLC 5ESVA 1VEPA 2C26A 5DTFA 3H2WA 1S78D 4R8WH 3OR6B 5D7IF 1PSKH 3EOYG 3B9KA 4YDIL 4QOKE 4ELMF 3RTQD 2IPTH 2VQUA 3KYMB 3MLUL 5EZJA 4KHXH 4NIKB 3V6OC 2Q8AL 2P43B 1YUHB 2B5IC 3TBVA 4LCCC 1YNKH 3TVMD 2FX8H 1QFOA 3TWCH 4X7SH 1FGVH 4ZTPH 3EZ8A 4L8CA 3JTTB 2W65A 4KV5F 1HH6A 2R15A 1TVDA 2PTUA 1I3GH 4TPRH 5AAMA 1G6RL 2F5BL 3P0GB 5TFSL 3ARRA 4NKOB 4FA8A 2OL3B 1X5LA 3S5LG 1XGUA 4OZGA 3HB3D 5E8EB 1RMFH 3V6OE 4Z7VA 3OR7B 4CN6A 4MNGE 3VD4A 5DRZB 1WZKA 1DN2A 1FN4B 1FFPB 1WFUA 1J05A 15C8H 5FO7A 3KPNA 1MHPL 4J8RB 1FRGL 2NY5L 3MNZA 5C07D 1CF8L 5EZIL 1GGTA 4LEOA 4LVOB 1HYRC 4ODUA 5C0AD 2F54E 1MCWW 1U0QA 1TJHH 1RU9H 1U3HD 1ZHLA 3V5DB 1NFDA 3ZE1E 4MJ4A 4HIHB 1PG7X 3NCCB 4PGCA 2XG5A 3T0EC 5L88H 2VDOL 4NZRL 2WZPD 3LD8C 5C0AB 3A67H 4MXVF 4DEPB 1E28B 4M03A 1U3HB 4YGAB 3N9GH 1BQHA 3FB6B 3L3KB 3WIHL 4ZPVA 1J86A 2XRAH 1NANI 1F90H 2OP4H 1LDSA 1W72H 5BO1L 3WBDA 3H3PH 3NZHL 1T89C 4ZOAA 4U1SB 1UVQA 1KV3A 5TQ0L 2NXYB 3BYTA 1ZHNA 4YPJA 3GJEA 4LLMB 3T0EE 4IMKC 3G04B 3C60C 4XCFH 5E8DH 4L9LC 1T80A 1PFCA 4B7IA 1PYWA 1NBYB 2UVEA 3D0VB 4NO2A 5JMRA 3MLTA 1A47A 1G7PA 3GSXB 4G80A 4JN1L 2CKBH 1BBDL 1L7TH 4GG6E 2B1HL 1S7RB 2GCYB 3A6OA 2JB6A 1HXMA 1I1YA 4HS6B 3VXSE 2WUCH 1OTSC 2GT9B 2JCCB 3PWLA 4K3DL 3TH3T 3L3IB 3WNNA 1A21A 3PXHA 2AJYH 5HGHA 3MV9D 3HG1E 2HTLD 1HHJB 4TULL 3V95A 4EBQL 1S7TA 5B39B 1BGXL 5GS2D 5GS0C 4Z8FH 5KVFH 5EU6B 3IJHB 2ADGA 4I48A 2VDNL 1Q72L 2X4RA 4ZOEA 5E4IA 3IT8D 3UJJL 5I1JH 1BD2A 4HWBL 2AXGA 3DV4A 2ED9A 2MKLC 1UACL 1RULH 4GAJL 4NP4H 3TIEA 4Q2ZB 1YZZA 4PJCE 3QPQD 1GGCH 2MJWA 5DEFA 5KZCD 1FP5A 4YE4H 5DJ2B 3AB0C 4M1GH 2E3VA 2ZOKB 4M4PA 2CGRL 2V9RA 4R3SB 1YNTA 1HHHB 4NNXA 3GBNH 3PP4L 3TBWA 5DVMA 4KMQA 3QIWB 2X4NB 5TE6H 2BVYA 3BQUD 4P2RD 1TETH 1NDMB 2CIKB 1NGQL 1JHKL 1KENH 3MOBH 3QG6A 4L8DA 1YMHB 1XGRA 5DJ6A 1RD6A 3QA3B 1R24A 5T5NG 2IBZX 2BOCA 1PKQA 1TMCB 2VXQH 4F3FA 1U8IA 2IANE 1A1OB 5IVZA 1T4KA 4ELMA 4UIKL 3NZ8A 3O3DA 5DGQA 4N90E 4RGOH 5IFHH 1FO0H 1KXTB 1FV1A 3EFFB 3BSZL 4KKLD 4NN7B 3HHRB 5EORH 5C70A 2ICEB 3C6LD 2AAVA 3MV7A 1K2DB 1JP5A 2VXSL 1UZ8B 4QHLA 4D0CB 3OJDA 1MFBH 1JF5A 4EJ1C 4MXWL 3BD3A 1Z2KA 2ICES 3PWNB 3L7EB 2DJSA 4D8PB 5TDOB 4NUJB 1KJ2L 5DF0A 5FECB 4CU8A 3ZKMD 3VXRA 1MCFA 4PGEB 2WMPA 4D9RD 3D48R 4U05A 5GHWL 2OJZH 4DJMA 1BQLL 3TPUA 3UTTD 1WT5A 2JB5H 3WNPA 4MX7A 4OGAC 3IVKB 2DQDL 1GHFL 6CGTA 1MAMH 2VSCA 3IFOA 1D5XB 5HYJE 1MJUH 2JJWA 1C5DB 3TP4A 2P48B 4LSUH 4UI2A 3ROOA 1DBAH 1HIML 1EEZA 2NY3D 1AJ7H 3UTTB 3GMQA 5HSFA 3E1F1 4XP4H 5BMFH 5M94B 2HRPH 1D9KC 1S7QA 1NCAL 3ZMRA 2R2EA 1BOGA 2ZKHL 1PAMA 3SDXF 1RZ7H 3T77A 3LKRB 4AMKL 3QUZC 4YFDB 1N0XL 4WTZA 1CT8A 1BIIB 4MB3A 3AROA 4R90L 4OZ4B 3ARGD 1Q9WB 2YEZB 4ZXBA 4NPYB 4YUEL 2I9TB 4X6DA 1YMMD 3NN8B 4LHUD 5H8DA 5E95B 4HGMA 5B38G 3AU1A 1EVTC 3MRQA 5CUSH 4LKCB 5CKGA 1G7LA 4GRWB 5EPMA 5D1XB 3VCLB 1AGCA 3ULUF 4G6AD 1XFPA 1L0YA 4MLSA 4LMQE 5CZXD 3VA6A 2YSSA 3VFOB 1YMMB 2Z92B 4KRMB 5IHLB 1MY5A 4EZMA 5J06A 1C5CL 1FFNA 1JPTL 4L3AA 3RVTD 3ZE2F 3LKQB 1D5BB 3K8LA 4AQOA 4OI7A 2CXGA 1WBXA 3QIUA 4KVCL 5HI4D 1HHGA 3LIZL 1RK1B 1A7PL 1ZGLP 2OSLB 4LSQL 2VIRB 3RWGA 4HWZB 3BP4B 4P46D 4EN3A 1OWRM 4Z5RB 4ODVH 1R5IA 3CLFL 5D7SL 1MNUL 2NNAA 3SDCD 2FD6L 4LARL 4WTWA 1B0GB 2HJLA 5HVFB 3D1MC 4PB0L 2D31A 3BH9B 5DHVH 1NCTA 2F53D 4UINH 5C0DA 5DXWA 3OKMA 1HN1A 1J5OL 1A6VL 1U91B 2W59A 2M8XA 2ORBH 2VAJA 2K7PA 4MYWB 4KRPC 3SBWA 4PB9L 1N5AB 4M7LH 5E99H 5GJSL 5GGTL 4Z7UA 3DGCR 5EC2A 5J56B 2F5AL 3GMPB 1CXIA 2R2HB 4NM4L 1KTLA 1A6WL 3GNML 2IGFH 1ZHBB 4NKMA 1WWBX 2Z35A 2C7UB 4OUUA 3B8SA 4TSAL 3X12B 5EUKA 4HBQA 1G6RB 1IEAB 1NL0H 4WY7L 2CH8A 4UV7H 3RWJA 2XPGB 4E41B 1J0IA 2NY7H 4R9HA 3EHBD 5ESAA 1CD0A 1BF2A 4N5UA 3GI8H 3HZVA 3BP7A 4PYGA 3IXAB 1LHZA 1F02I 4I1NB 4XC1H 1QLFB 1YEKL 3QWOA 2NLJA 5LQBH 5FO8A 1PDKA 2IADA 3B6SB 4HFUH 4LASH 4BQ6A 2ESVD 3MJ7A 5H37H 4OI9A 2D9CA 1XF2B 1MH5A 5L8KB 1FPTL 5GIRB 4P5TA 4XPGH 4L4VB 5AYUH 1HHKB 3UCRA 2UY7A 5ID0A 1HKFA 5FYKE 2ESVB 4JQXA 3EDDA 4K8RC 2BC4A 4Z78B 1CCZA 4RDQF 1PBYA 3P9LA 3K3QA 2HLAB 5EU6E 4V1DD 3RL1A 1JV5B 2PR4L 3HZKA 4IRSD 1T5XA 1IL1A 4FN0A 3L6FA 3NIGF 2MCPL 4EI6A 1BMGA 3CDGA 4O2EA 5E2WH 4YQXL 3QI9D 3PG2A 3T0DA 2D7OA 1F45A 4R7NB 3H7BB 4NJ9H 5BXFB 5KJRL 2AABL 5E94B 4MMXC 4OIAA 5DD6A 1JCKA 3RI5K 4HHAA 4XVTL 2P5EE 1D6EB 1RZFL 2V2XB 4ZS7H 4XP6L 4D3CL 5IF0B 1NGZB 3DVGA 1ZXQA 5CCKH 4LU5H 5CJQL 2EZ0D 5F72S 5KG9B 5EUOA 3D5OF 1WWAX 4ZTOL 5DRNB 1RZGA 5CBEB 4OM0L 2AW2A 3QDAA 1QUNA 2R69H 3P11H 1QHPA 3FB5A 4BZ1H 2VKWA 1CTNA 4H1LB 1KYOJ 3HMWH 2D7QA 2W92A 2Y06L 5EULV 1B88A 1ND0A 4P3DB 4R6UA 1FSKC 3V5KA 4FQJL 2V17H 4GKZB 3SGDI 5JQ6L 3T08A 3HMXL 2XQBL 3G6AA 1MUJB 1U8KB 3VDCA 3CZJA 5TF0A 3W39A 1HEZA 5K59F 1IAII 3V52L 5HHXL 3OKEA 3NH7H 1AGDB 1ZSDB 4MA8L 5DJDB 4AENA 5EB9A 4NCC2 4LAJH 1BJ8A 4QHNA 1RIHH 1KT2A 3B4NA 2W0LA 1L7IH 3ULSA 4UIMA 2V2WB 2MPAL 3JZ7A 4YNYB 2IPUG 3I9GH 2HJFB 2E7LC 3P73B 4PJ8C 3KYKH 4KK8C 4I9WD 2E6QA 5FGBA 3DX7B 3DXAE 3L3JA 4GRLA 1A9EA 5I1IH 3HE6C 4OGZA 5MHSE 1I8KA 5I1HH 3GJFA 4KHTL 4UAOB 3CFJA 5C6TH 5IW3A 2PYFA 4XCCL 1IKFL 5IBLD 1DUZB 5B4MD 2PYED 3C5JB 3MXVL 4EI5B 2VISB 5KAQF 1K3IA 1JGVL 3FOMA 4PRDB 4I3RL 1CFTB 3RAJH 1MRFH 3ULVF 4I2XA 4RIRA 3HFMH 5DD5L 1EEUA 3B5TA 4WFEE 3ISWA 3VXTA 1H3XA 4S1SH 3F58L 4O4YH 4JG1L 1IZKA 4PRAA 2F74A 1CDHA 3GKZA 3QJHA 4H8WH 2EDNA 3LB6C 1UKSA 4MSWB 1AXTL 4HIXL 3G5VA 3MLWH 1BZ7A 1OTTC 1N6VA 4KVNH 2VNCA 2ICWJ 4U1HB 4HF5H 1AC0A 4KKNA 3VGDA 3WFDL 4PJDB 2WSKA 3MJ9L 3QUMA 5HHPA 1KEGL 1OGAA 4DKEH 1OW0C 4YXLL 5HDQL 4P2QB 1ONQB 1VGKB 3FOLB 4F7PB 3QEGL 2AJZB 5ECJE 2YN3A 2QR0A 1QSEA 3CVIH 1FNSL 5IQ7H 5K9OA 1NEZB 4M5ZH 2OR8A 1BVLB 4GKSB 3LKPB 2UWEF 3IDUA 1KGCE 3SDDC 1BP3B 3WNKA 1WBYB 4DZBA 5L8JB 3PQYA 4ONOA 1I8IB 1UM6L 1EFXB 1CL7I 3CSBA 1WEJL 5FK9A 4X7EC 4OQTA 3X14A 4JRYA 4RAVB 3C2AH 5EU4A 4Y4HD 3WFHB 4PJ5A 3SOBH 5C9KA 1G6VK 1XH3A 4WWKD 3HR5A 3QHFH 5E9DA 3BH8A 3WKMH 4A2MA 3CMOL 1KPRA 1XGPB 3X3GH 5DK2A 2BNUA 4FMKA 5DUMH 2BRRL 2VLRD 4Y4HB 4G5ZL 4E41E 3S88H 5IGXL 2F8VA 4U1LB 1DVFD 4YDVB 2VR9A 1GGIH 3ARPA 3BGFC 3GBML 1NANH 3D9AL 4FFWD 1MFAH 2Z31A 3TN0B 4I0PD 1F4WL 4DN3H 4TVPE 5FUZL 3X13B 3ZLQC 3DSFL 2VLRB 1VPOL 1T21A 2EEDA 1P84K 1AIFA 4HJ0D 2V7NB 5MENB 1DVFB 5F1KC 3DO3A 3ARDA 3WO3B 5F7HA 2J4WH 5IMLA 4NYLB 2HRLA 1U8HA 1FFOB 4I0PB 2QHRL 3KDMB 5IQ9B 3UC0L 3SHSA 4L4VE 2IG2H 3BPLC 5DHXB 1A14H 3BHBB 4N8PA 4OD3L 2A1WH 5C09B 2GJ6A 4MXQC 4PV9A 4WUUA 2VITB 3VGAC 4FZEH 4PP2B 2VLLA 2OXGA 5DJ0B 3ZYIA 1AFVH 5DTFB 5B21A 3VGEA 1TNNA 4P3WA 1QBLL 5FYJL 2EYRA 3QISA 1GYAA 3B9KB 3E6FA 2VC2H 1OP3H 1MVUA 3R8QA 5L8LB 1JNJA 5EU3A 5GRWA 4X9FA 3BRGC 2C4FT 3VI4E 5HGDA 2VE6B 3ARQA 1NSNL 3TBVB 3W0WA 3NPSB 4XHJD 4JDTH 5F8QC 3MBEA 2IWGA 3DMMA 3KPRA 4P5MA 3K4ZA 4K3GA 4X0KA 1PLGL 2W65B 1LILA 3ESUF 1HH6B 4WRLA 1DBBL 2X9WA 4TNVK 2FGWH 2DQTL 1CDBA 2RIKA 2IH3A 4AM0A 2JJSC 3QG7L 3QXDA 4L4TA 2P8PB 2DLFH 1JHLH 1WAAA 3BKCL 1XGUB 1X5FA 1XR9A 2R29H 2ZCKL 4OZGB 4R97B 5EOCL 3Q5OA 4Z7VB 3FKUS 2W1NA 1FAIL 3NCJL 5MEPA 4LAQL 1H3WM 4GSDL 4XP9L 3N1GC 3RVVC 3JVGC 3O6MH 2Z4QB 3MNZB 4UBDD 4WI8A 3PF2A 4ODUB 5GZOD 4ZSOA 1FE8L 3A6BH 3EJJX 1QKZH 4GFTB 2DQIL 4FQCH 5DDHA 2HYMA 1I9IL 5FUCC 2NY1C 1CE6A 3O6FA 4PGCB 3H42H 1KCLA 1F8TH 3V6BR 5DEGB 5LJYH 5BOZG 1NMAH 1MCDA 4DKFL 3WFCH 5GGSB 4DUVA 2D0HA 3BRDA 3DUUA 1BQHB 1DBKH 1G7HA 2AV7A 4ZPVB 1DQMH 5GISL 3CFEA 2ZUVA 2F19H 4PJGB 3U82B 3FQNA 1DSFH 2OBGA 3RUGB 2YPLE 1I7ZA 3QCTL 5TE4L 1H3UA 4TNWK 3ZZ1A 1E4XI 5F96H 5FUCE 2DQGL 1RVFL 3MV8B 1OSPH 3GJEB 1U93A 4XPTH 2AEQL 4ZD3H 1INEL 1PYWB 3DECA 4I5BA 4NO2B 3C5ZA 3MLTB 4HUMB 5KSVB 2OXHA 2FEDC 4LSRL 4LRNH 2ITDA 4G80B 3TNNA 4EKXA 3IDIA 2OR9H 1EGJL 4WO4A 3C08L 3IYLW 3T0XA 4FQ2L 4UDUB 5JTWA 2JB6B 1HXMB 3PGFH 1GOFA 4LEXH 5JR1L 1Q1JL 4Y16C 4X9HA 4NC2B 2ZCLH 5M95B 2R0WH 4K9EC 1F4XL 4PJDE 5HGHB 2X4PA 5CP3A 4KUZL 4RFNB 2CK2A 4NQCA 1X6LA 4YXKL 2VR5A 1RURH 4P2QE 5ALBH 4DTGH 2ADGB 4JJ5A 1NCUA 5I15L 5IR1A 1QVOA 2YN5A 4Z7NF 3PABA 3BGAA 12E8H 1KIUA 4FQLH 1BD2B 4XWOD 5T1LA 2Z0BA 2AXGB 5A43C 2OZ4L 3WFBH 1CK0L 4Y1AA 2LFGA 3TIEB 4FFYL 3QWRD 5DRWA 2CLVB 2WBKA 3BIKA 3S7GA 1EO5A 4JFEA 2VXVH 1DANT 5DEFB 1HDMA 4E0RB 4PJEA 3ULUL 1PKOA 5F7YC 2A38A 1GRWA 4JZJB 4JREB 4X6BB 4JAMA 5D8JL 2DWEB 3IU3A 2X4QA 4FQQA 4OFYA 2J8UE 3ESVF 1I7RA 3TCLA 4XPAH 1YNTB 2O5YH 4Y5XA 4OCSH 4ESKA 4NNXB 3FRUB 2VLME 1GCFA 1C16A 1E27A 5C2BL 3AVEA 2DLEA 1NMCB 5HDBF 4EOWH 5J4MA 5T3XD 1MHHA 1YJDC 5IV2B 1PGRB 4K7FA 5FCUL 1EH9A 1R3IL 1TTFA 3OSKA 4XVUD 3QG6B 3V79C 1XGRB 3ME0A 2DIBA 1QRNE 2D4FA 5CKAA 1R24B 2NY6C 1PKQB 3V0WH 4XNZB 3T1WA 1U8IB 5IVZB 4JB9H 4LSSL 4ELMB 3NZ8B 4UT7L 4MJIA 4LSPL 4AIXA 3TYGL 3EYQD 2XNAA 4GXVH 4PJFF 4X6CA 3B3IA 3MV7B 4M7KL 4QTHB 3VWKC 1FZOA 2DQFA 4ZFOA 1MLBA 1QO3A 4XI5D 3X17A 1GAFL 3L3GB 3QUML 4FQXA 4N8CH 4QXTB 5HHMB 1RY7B 1G0DA 4U4BA 5T1MA 4S1QL 3O6KL 3BPOB 2Q20A 3D25A 4M48H 5E08L 1A4KB 3FB7A 1ZWIA 2N1KA 4O51B 3HI5L 3VXRB 4PY7B 5GRVK 2HFGH 2QQKH 2ADIA 1FORH 5C09E 1KB5H 1YY9D 2P24A 3RNQA 3TPUB 3UPAA 3STZA 4MX7B 1FH5L 3MREA 3ARBA 4LP4A 5DMIH 1HINH 1K6QL 3IFOB 5K9JH 2QLVB 3WHE0 1E6OL 1JZ3A 5ITFB 3ZYZA 2CRZA 5IB1A 3SGJA 1J1XH 1MJ8L 5J57B 4PFEA 3O45A 4OI8A 3LRSB 3ROOB 2O5ZH 1YEJL 5JA8B 3RY6C 1EEZB 5CILH 4KJWD 4D94A 3ARVA 3GMQB 4GQ9H 5EIVA 1KACB 4MHHG 4OQTL 4TSCL 2EDXA 1CD1A 4KTYA 1YEHL 1EJOL 4D0BA 5IVXF 4HUVA 2R2EB 1BOGB 5D7KD 3VMOA 1OP3K 3SY0A 4UTAH 1MI5A 2VZUA 3RWHA 1T0NA 1MEXH 4ZXBB 3NVQA 4JO4H 4DAGH 1IAKA 2EDQA 1A7OL 5IHBA 2R39A 1RZ8A 4YFEA 4HQQH 3OMZA 3WNOA 3AU1B 3T2QA 5L2JA 4QRTA 4R4FL 3CX5J 3RGVA 3W2DL 1AGCB 3DX9A 2X6MA 3QIUD 5HI5D 4AYFA 3EUUA 4JR9L 2ICWA 5DGRA 3BE1H 4KK6C 1N3NA 3SGEH 2YSSB 4EN3D 1E6JL 4LMQI 3BAEH 4NQXA 2MKWA 4PJ9B 4YBQD 4WENB 3T0VA 4KWUA 1MJJB 2RBLA 2M26A 1UXWA 4PP1D 2BXYA 3X3FL 4QCIA 2X41A 2EIZA 3P0YH 1HHGB 5KW9H 2OYPA 3RWGB 2VLJD 3UTPE 2XICA 4EN3B 2HH0H 1ACYL 1DEEA 1H9VA 2NNAB 3OKDB 2X7LB 4QRPB 3VFPA 4RMQA 2A74A 2HJLB 1G0YR 1B4JL 2YMXH 1G7QB 3AM8C 4HC1A 1HILA 3BDYL 1RUQL 4OZIA 1X5JA 3VU2A 2DKUA 3OKMB 1IGMH 4XAWL 3TT3H 1K4DA 1IJ9A 1IAIH 3ZTNL 5IESL 3UTSA 5DEZA 1RZJH 4JO1L 2BXZA 3OXRA 3S4SG 4XPHH 1CBVL 4J6RH 4ZNCD 3QNXA 1Z0MA 4UT6L 4Z7UB 5EC2B 2ERJC 3I85A 4PJGE 2Z8VC 4J3OC 2YD7A 4L3CA 4NKMB 3F7PC 5KVGL 1BJMA 2Z35B 5EO0A 3RUGE 3CXHK 4EEEA 1YYLH 2PNDA 3KJ4B 5EUKB 2XZZA 1J11A 3WUWA 5J0BA 3INUL 3RWJB 3O0RH 3SDYL 2GJZA 2R56H 1J8HA 3MV8E 2P8MB 5ESAB 5JMOC 3BJLA 1AO7D 3IETA 2BDNL 3HZVB 3BP7B 1ZANH 1SMAA 4IRJC 1Y6NR 1YY8A 2NY4C 3NABH 4F80A 3QWOB 1T2QH 3F62A 4O02H 5J11B 3ZSSA 1U41A 4P5TD 4U6VH 3MZTA 1KLGA 2IFFL 2IADB 3VE0B 2JELL 3FMGH 3TA3A 4KGLA 3NCMA 1JL8A 1N8ZA 2C5DC 3MJ7B 3NA9L 1CXEA 35C8L 4POZC 1NCBL 1V3MA 1MH5B 3LN9A 1JGLL 1J10A 3WD5H 5F6HJ 4P5TB 3ULVL 1IFHH 1DFBH 1UJ3A 2E9WA 5D71L 3FQRA 5ID0B 3V4PH 4KPHH 3MRGA 5L7XL 2DTSA 1OQOA 1U3YA 4GBXC 2BC4B 2XY2A 4P0DA 3P9LB 1FYTE 1VEMA 3K0WA 3RL1B 4HXBL 4U1GB 2YD4A 4G6MH 3HZKB 4ALAL 4AEHL 4GAFB 1T5XB 3VXUA 1IL1B 2UZYB 3OKYA 3L6FB 2VO5A 4EI6B 3CDGB 1BD2E 2DI7A 4O2EB 4PJFA 4ZFFA 1HNGA 2DQEL 5HPMA 5IP4A 3QDME 2I60H 2YUXA 1R3KB 2B4CC 4EVNB 4R2GD 5DD6B 1LK3H 4HHAB 2YWZA 4PD4K 1I9RH 3WSQH 5E5MA 2FATL 3C09C 1RZIA 2EDJA 5AWNH 1IZJA 1OAKL 5CJXC 5E7BA 3WFEH 1GXEA 3GIZL 3CZFA 3O8XC 2EYTA 1MFCH 3VWJD 3G6JF 5EN2A 4W4NA 4QRSA 5EUOB 1RZGB 2DN7A 3RWIA 4HCRA 4U7MA 3ZDYF 1MAKA 2G60L 4M9PA 2QADD 2O5XL 2IF7A 4IS6A 1ND0B 3V5KB 3MRDA 1XCTB 2IQ9H 5D7IE 2F15A 3QUYB 3ZKSD 3LAFA 1UWGH 4ELME 3VG9B 1T03L 1I1AA 3OKOA 4OZFA 3W39B 2JIXA 2R1YA 4Z76A 1HEZB 1IBGL 3ARFC 4BZ2L 2BY1A 3GO1H 2APFA 4AENB 2DS4A 2BSRA 3MV7E 3N1QC 4R0LB 1NMBL 3NFNA 4GRLD 4QHNB 2J6EA 1Y18A 2W9EH 5HVHC 4EUPH 3QAZB 3CFKA 4KV5E 2X1XR 3S3SA 2ZUXA 1Q0XH 5HTSA 2FHCA 2YK1H 2IAMA 1UXSA 4P57A 3RVXC 5KANI 5I18H 2I5YL 3MNVA 1X5AA 3L3JB 1A9EB 4G6KL 2KUTA 1IKNA 2KL6A 2YD5A 2HTKD 4HH9A 4KJPC 5B8CA 5HYSG 4LLWA 2PYFB 4G8FA 4OFPA 5D9SA 2I25N 4OV5A 2P5WA 2HJKA 1QYGH 4X4MA 1ZHKB 5DMJB 1YQVL 2Q7YA 1HZHH 5AZEL 4FFZH 3OG4B 1RHHA 1ZA6A 4ZAKA 1TQBB 1YEGL 3FOMB 4HWNA 5FYLH 4HBCL 4FFVC 1QLEH 5EU5B 4I3SH 4PLNC 1JI1A 4I2XB 4RIRB 4TUKL 4C4KT 2KQMA 4Y4KA 4NQEB 1FNGB 3AUVA 1XF4A 3L5JA 5DMKA 2BCKA 3P9WB 1MCBA 3KYOA 5E2UH 2YBRA 2P42B 3FQTA 4PRAB 1WTGT 4JY6A 1A1NA 2DYPD 2DIJA 3VXPA 1OGAD 4OLEA 2W9DL 4G8GD 4KRNA 2CK0L 4TRPL 4MXVE 2VL5A 4EQ2A 4IIQA 3QWQB 4MD5B 3P0VH 1SEBA 2P46B 3AGVA 1WISA 2FBJL 5CZKA 1WF5A 1BFTA 4DGVH 4RRPG 1CFVL 1QSED 3QUMB 1CVSC 5AUMB 1OGAB 5HHPB 1IILE 2R2CA 2VYRE 1S78C 1SYSA 3QFJA 4XP5H 1RIVL 2HT2C 5EDXA 1S3KL 3RIFF 3S34L 3RTQC 4DW2L 1OP9A 4CMMB 2UZIH 2QR0B 5BS0B 3B9AA 1QSEB 3WIIH 2RCSH 3PQYD 2MWCA 5IT2H 1NC2B 1HOCB 5J9PA 5C0BD 5LCVH 1CDGA 3MTRA 3DTXA 2EXWC 3TVMC 4BSVB 2DMCA 3NAAL 2N56A 2A6IB 3FFCA 3LEYL 2BHZA 1G9EA 4QRPE 4PJ5D 2K3TA 1I1FA 4DZBB 5FYJE 4Y5VC 1WK0A 1KIRA 3JV5A 3F6LA 3WO4B 1ZTXL 4NZTH 2X89A 1MCPH 3V6ZA 3R0NA 2QL1A 1OAXL 5FK9B 3X14B 4LFHD 4JRYB 1G84A 1JMZA 3BT2H 5DR5L 2DKMA 3HB3C 5DO2C 5EU4B 4P9HC 4PJ5B 5E6YA 1ZAGA 2KH2B 5JORA 1F6AB 1JFQH 3QHZH 3PWVA 1XH3B 5I17A 3GM8A 5E9DB 1ZEAH 4RX4A 4G8EA 3T1FB 3BKJL 1JN6B 1WFNA 4OIIH 2XXMB 2ZNWA 1KPRB 4C55A 5C86A 1XIWD 5BJTA 5DK2B 2BNUB 1WIPA 5C7XL 4CVWA 1SY6A 5ADPH 3TFKD 4XGZA 4RWYH 2C1OA 2WWMD 4R7DA 2R1XA 2Z31B 2G5BA 1YPZF 3O4OC 5TE7H 4YHPB 1A64A 1UENA 2V2TA 4NBZB 5F8RC 4L3EA 5T3ZH 2XQYK 2A9NL 3OAUL 5I16A 1T21B 1Y0LA 4JFHD 3GMOA 2ZUUA 1AIFB 2Q76A 3SE9H 1RZKL 3ARDB 4I18C 4WUUD 1U8HB 4NFBA 4YH6A 3CVHA 1MF2L 2WM0A 4PJBA 4MJ6A 3TIDA 3UO1H 2ZZUT 4PY8J 2FHBA 1OAQL 1N5YL 1V8HA 1YEIH 3W82A 1RUAL 1S7SA 3PHOA 2VMFA 1KJVA 4G7YL 2GJ6B 4JHWL 5FHBH 4PV9B 1OCWL 3EZJB 4M7JH 5ISZE 1NKRA 2VLLB 1AI1H 3W0WD 1U9KA 3U7WH 2EYRB 3BVNB 4HC1L 4GRMB 3DMMD 5FHAL 3E6FB 2FCBA 3MRPA 3KPRD 4S2SB 3S36H 4OT1H 5AAWA 1U3JA 1NGWA 2EE3A 4JFZL 5ALCL 2GKIA 1GIGL 1YEDB 4LCIL 1I3RA 4LCWB 1JF6A 3VH8B 4WI3A 3ZKXC 1A6PA 3VFTA 3W0WB 1JGUL 4L4TD 3MRFB 4XPFL 3MBEB 2FEEL 1NAMH 4ENED 3KPRB 1DLHB 4GT7A 1FYHB 1EXUB 3HE7C 4AH2A 3QUKB 4XPBH 3ZO0A 4Y19B 2PXYA 3KXFA 2IH3B 3MRNA 2DQUL 5T5NF 4AM0B 5I73C 1D5ZA 3QXDB 5SWZB 3NTCL 4L4TB 1T7YA 5T1DL 3UJTL 3W9DB 4HPOH 5F9JA 5CP7A 1I9JH 1KPVA 1MFEH 2B0SH 5E0QA 4PRPB 3GSUA 3CFBB 2AJ3A 4NN5C 1P4IL 5E2TL 4ZO8A 5MEPB 1OM3L 3QPQC 1AGBB 2YRPA 4JKMA 4QHUA 4XAKE 5KN5A 4YDKH 1GGYA 5KVEL 3DUSA 4RWHA 3O6FD 3Q2CA 3O3BB 2VDKH 4UQ2A 1CDJA 5FA4A 5ITBH 4ZSOB 4X99A 3SDXE 5I76A 1MPAH 3UJIL 1IGTB 3DRTA 5L9DL 4NQTA 1FLRL 3WDHA 2Q8BH 1OY3B 1OPGL 3RX7A 3UTQB 4F58L 3BFOA 4OLZL 2YPKA 1RHFA 1TJIL 4LF3A 4XXCA 1J0JA 2CMRH 3BQUC 3QQ9D 2DBJA 1X5YA 4TYUA 1FIGH 1KIPA 5DUPL 3AXLA 4KUCD 2AV7B 3ULUE 2DJ4A 1R5WA 4KGJA 3CFEB 4K3JH 4M3KB 4QRUA 2RAMA 2FX9H 3LEVL 3AREB 1D6VH 2XV6B 2CJUL 1QQDA 3FQNB 4JFOB 3QDHA 4OCWL 5F89A 3WS3A 5IG7B 3VXMD 5CEZH 2J8HA 4N9OB 3ZE2E 1RFDH 5ETUA 1JTPA 4KKLC 4XCEB 3CH1A 2A2QT 3B2UC 1DUYB 3C6LC 4LKXB 2JK5A 5TH2A 4JO2L 4CRPA 2H2SC 4Q9RL 5KSAA 5DFVD 4NQEE 2BNQD 4P2RE 4YHLL 1W0YT 1I75A 2EYSB 4I5BB 3PWPE 3C5ZB 5F7DA 4E9LA 3KWWA 5EA0L 2ITDB 3WXVL 1OTUD 4I0KA 4XNYL 3TNNB 1PY4A 2GAZB 3IDIB 1A7BA 4WO4B 2FR4A 4XVJH 4NQCD 4MS8D 3TO4C 4HW6A 3GMLB 1DCLA 4MDJA 2NX5D 4RQQB 2WUBL 2H1PH 4NKIH 3U46B 5FXCH 1ZT4A 2X4PB 3M8OL 5I71B 5JUEL 2APWA 5IW1B 4K3EH 4N0YH 4MAYB 4NQCB 2R23B 3LHPL 3K2UL 2H3NA 4K94L 4JFED 1EMTL 1NLDH 3PABB 2NY3C 2WLZA 1FCGA 3HNVL 4RFEB 4DN4L 5BS0E 5T1LB 3P4NB 5E1AA 5C1MB 4UV4H 3UAJD 4Y1AB 2VABA 2IALB 1IGIL 5DRWB 2LQRA 4NDMA 3BIKB 4G7VH 3VGHA 3FO2A 1BX2A 3SKJH 3GSNL 4ONFH 1MIML 2OL3H 1HDMB 4HJJL 4O2FA 3ARGC 3K46A 5HDLA 2G2RB 4JAMB 3ZSTA 3MLPA 1WVZA 2X4QB 3IU3B 4UQ3A 5E1HB 1AXIB 4EUPA 3OGCA 2DM3A 2GITA 3DHJA 2FX7H 4JRXA 1CGSL 1I7RB 1T2XA 4HFWA 4Y5XB 5D1ZA 2ZG1A 4TTDD 1NCWH 4PS4H 1JZ8A 5D1QD 5FV2A 4G6AC 1JPGA 1GZPA 1C16B 1NBVH 4P9HH 5CZXC 5F7EH 4MJID 1MHHB 5E6ID 1CVRA 3CFCL 2VDRL 2NW2B 3L95A 4Y2DA 3K74B 5IKCB 4YEEA 3RVTC 5IFAL 4PJCF 4X7CC 4JKPL 2ATPA 4N0FA 5E9DE 3ILQD 4KI5D 4PRHD 3MCKB 2BVEA 3NIGE 3LZFH 5HI4C 4PJ7F 3BWAB 2HKFH 3KYAA 1SJHA 4FABL 1QRKA 5D93B 3VXOA 4ZODA 2ITCA 2VZ1A 1KELL 3P3YA 4FQXD 1SVZA 4P46C 3V4VL 2CDGA 3U1SL 4LVNC 4D9LH 3STBA 3SDCC 1Z3GL 2XNAB 5IROC 5E8PB 2B8OT 4N8VA 4X6CB 1UA6H 1FZOB 3UPRA 2DQFB 4G9FB 4ZFOB 1MLBB 1JNNL 1B2WL 1U6AH 2BFVL 4QF1A 4FQXB 5DWUH 5E2VL 1SHMA 4KC3B 3V2AR 4ETQA 3BYYA 5D4QA 3TEUA 1U8LB 3UDWC 4TNVF 2GJJA 3D25B 3ARBD 1ZWIB 1MCOH 4UTBH 4QOKA 3QCVH 3QH3A 3I2CH 1FBIL 4NQSA 1P9MC 4QHMA 3U4EA 5EC1B 1BEYH 2XA8L 4YK4C 4BH8A 3RNQB 3HAEA 4NUGL 2DJUA 4KTEL 4P4KA 1ADQH 2GQHA 1BJ1H 3ARBB 3OAYH 4U3CA 3LQAC 2PW1A 2MSPA 3QUXD 4GKOA 4L4JA 5IB1B 1RI8A 3O45B 5I19L 5K59E 1MI5D 2OQJA 5IWLA 3EYUL 3TBYA 2QQNH 3VG0H 3GGWB 4WI9A 3JWDC 1CD1B 1N4XL 1CD9B 4LCWE 3IXTA 1Q94A 2OR7A 4D0BB 5I1CH 3SY0B 2G9HA 3V6OA 4X4XA 2NY0B 4MNGA 3RGVD 1MI5B 1YN6A 2B7DT 4D9QD 3IJSA 3RWHB 1TVHA 1T0NB 2GEEA 5A2LH 4O58L 1G9NL 4LCCA 4Y19E 4KK9D 1O7SA 5C3LD 1IT9H 1XF5B 4LLAA 1RZ8B 1J87A 2WBJB 4JGUA 5FOBB 3UBXG 5SWZE 1SY6L 2VDML 3U4BH 4NJAL 4HWUA 1ZLSL 1A9BA 1IC4H 1KCVH 2CO7B 2VXTH 3DX9B 4IRSC 3ZHDA 1J1OH 2ICWB 1T0MA 4MQXC 4C56D 4PRPE 3MOAL 1UEMA 1N3NB 2FB4L 1L0QA 1R0AL 3QI9C 4H20H 3JWNC 4NQXB 5HHVL 4TNWF 2YKLL 3CFIC 2E5EA 2R0LL 2AK1H 1UXWB 4X7FC 1LO4H 4QCIB 2VJXA 2EIZB 4FQIH 3CVHL 3L7FB 1I7TA 2VH5H 4X83A 2V5MA 4OCYH 4LCYA 3R1GH 4RGMC 1FFQA 4WFHE 3MPCA 1UWEL 4Y5YC 4O9HH 2EZ0C 3VFPB 4KKCD 3KLDA 5GGQH 4DGIH 4PGJA 4XBPA 4HS8H 4JLRB 4ZNEE 4OZIB 1JWUB 2ADJA 2HT4C 4QT5A 5JO5A 1H3VA 1LO3H 4GLRI 1FZKA 5JHDA 3B2VH 2NXZB 1EO8H 1S5IH 1K4DB 3CXHJ 3SCMD 3UTSB 3T0EA 4YAQA 2Y36H 3OXRB 4LHQB 4P2OD 3MSPA 4R8WL 1TNMA 4QO1A 1PSKL 3VFVB 4RMSA 3MLZH 2R0KH 2VR4A 4L3CB 4MAUH 2EEBA 4LIQH 2DAVA 2IPTL 2I24N 3QCUH 4KHXL 4GG6A 5HGAA 1CTOA 1T89A 3GSWA 3S97C 1J8HB 2VOTA 1P7QA 1F4YH 3IETB 2UWEE 3NACH 4R96A 3E2HC 2D7PA 4ZO9A 5LXGH 2FX8L 4CMHB 4X7SL 1FGVL 1A7NH 4ZTPL 3HG1A 1KLGB 2RB8A 4U0QB 3D2UA 3C60A 5DURD 3TA3B 4TUJB 1I3GL 4TPRL 1N8ZB 1X5GA 3MA7A 1MOEA 1C7SA 1WBZA 4F57H 4O5LH 2OS7A 2MHAB 3UYOD 4WGWB 1F3DJ 3W81A 5JW4R 1EBAA 5ADOH 1CWVA 1KBGH 1RMFL 4KROD 5IEKB 2Y6SD 1UJ3B 4RDQG 2DOCA 3FQRB 5IBLC 5B3NA 4PREA 5C8JB 3F7VA 3N06B 3MRGB 5IM7A 3CMGA 4PJCA 3DETD 2P4AB 4XVSH 5DT1H 1YC8A 5CD5D 1JZ4A 4YBHA 4HGWA 1D5MB 3HZYA 2LU7A 3WS6A 3VXUB 4WHYG 4Z95H 1VFOA 5IEHA 4I9WE 3QQ3A 3FQUB 4LHUG 3KLAA 3N0PB 4BUGA 5DD0H 1A0QL 1RU9L 5I1LA 5AG8A 4R4ND 4PJFB 5IVNA 1FNHA 4Y1AE 3KAAA 3S8WA 5HPMB 3IRPX 1J7VR 3FAWA 1N7MH 3KPSD 5F7WC 4GRWH 5L88L 5I1EL 5AYQA 1OAYH 2A6KA 2FWOA 4EDXA 3A67L 3H9HA 1T20A 2X4TA 5E5MB 4WHYH 1RZIB 1JYWA 3N9GL 1Q9OA 2EYTB 2XRAL 2IANA 2OP4L 1W72L 3EO9H 5EN2B 1GC1H 4HS3A 2VTFA 5D7LD 3W5MA 3RWIB 3MYJA 3H3PL 3S35X 4I77L 5CBAA 1S8DA 2RGSA 2JIXD 5HVGB 4RGND 1JWMA 5D5MF 4X4YA 3MRDB 4I3GA 2AERT 3DV6A 4XCFL 3LEXB 5E8DL 4WI2A 3N1FC 4B53A 3MLUH 3O11A 3QR2A 4W81A 1AKJA 2APBA 1I1AB 5BW7C 2ARJA 4OZFB 3REWA 2HVJA 4ELKB 4Z76B 1QD0A 2R1YB 4Z7OF 4RGNB 2CKBL 1L7TL 2BSRB 4OLXH 2HKHH 1O7VA 2EC9U 4G9FE 5D2LF 1Y18B 1T1WA 2BHUA 5I8OH 3CFKB 4UMGA 1S9WA 3KPLA 4CJ0A 2AJYL 2P5WD 2IAMB 1UXSB 4P57B 1A3RL 5D70L 2MCG1 5HYJA 2F5BH 4FMFA 3BOVA 3GSNB 4KJQD 1CL7L 1PG7H 1P4BH 3MNVB 5JA9A 1Z9LA 4GQPH 4L1HA 4WWKC 3GMRA 4ZAKD 5KVFL 1U36A 1HE7A 5EOTA 2WQRA 4HH9B 5B8CB 4ZUVB 5EBLA 1DBML 2IPKB 4LLWB 4U0RB 5D9SB 3MQIA 1WZMA 4LRIC 4Y4KD 2P5WB 4JFDE 2HJKB 4JHAL 1OVZA 2FO1A 4OD1L 2ZOLA 1RHHB 4NP4L 2Q3ZA 1MHPH 4ZAKB 2NY5H 1GGCL 5KOVC 1CF8H 5EZIH 3NMEA 1WZ1H 3LDBC 5JIIA 4PBVC 4YE4L 2G5RA 2APXA 4Y4KB 3PIQA 4KQ4L 2GY7B 3OAYK 4M1GL 1XF4B 4PJIF 3QSKB 1F2XK 5DMKB 2BCKB 4HJ0C 3KYOB 4UUJA 2YBRB 4LPTA 2FJFA 3FQTB 3BKYH 1DZBA 2VDOH 4NZRH 5A2FA 1A1NB 3VXPB 5EG6C 2IBZY 1CN4A 5F3HA 1TLKA 1BBJB 3B5GA 4KKAD 4ODTH 4KKBD 5DRZA 1FN4A 5TE6L 4Q0XH 2D03L 2DKSA 5KSBF 3WIHH 3MOBL 1SEBB 1EAPA 4M6AA 5BO1H 1EHAA 4X98B 1EHXA 5F9WC 2DLHA 3TBSB 1V7MH 3BIAX 3NZHH 5JZ7C 2HN7B 2ILLA 4Y4FC 4M7ZC 3V5DA 1SYSB 3QFJB 1AH1A 4CN4A 4RGOL 5IFHL 3JWOC 1FO0L 5TQ0H 1LO2H 1BIHA 3FFCD 3GZKA 3SO3B 4F9LC 1EZVX 5EORL 4JPWL 5IBUB 1DQLL 1T66D 2AJVL 5A3IC 1MREL 3DTXB 3FB6A 4JN1H 3L3KA 4H1LH 4PJHF 5LWYL 3FFCB 3P40A 4H0IA 2B1HH 1I1FB 4Y2OA 1U8NA 3BP5A 2DM7A 5CGMA 1AE6H 1KIRB 4FP8L 4U1SA 4QYOA 4K3DH 1SQ2N 3AAZA 2OJZL 5E5RB 4NHCH 4EBQH 1BGXH 4KY1H 3W9EA 1G7MA 1CIDA 3UJJH 1CLCA 4JQVC 3PWVB 1J1PL 1MJUL 4BFIA 5I17B 4F15C 4Z7NE 5I9QC 1K4CA 2J5LC 1TENA 3U0WH 4XB8A 4HWBH 1LVEA 4L3ED 4XP4L 5BJTB 3NCYP 1UACH 3PV6A 1S7RA 4GAJH 2HRPL 1TITA 3V7AE 3V6FB 1F13A 3HI1A 1J8HE 1DL7L 4HS6A 2FBOJ 4YHYB 2DDQH 1RZ7L 2C1OB 1MHCA 4MQSB 4DFHA 1GPOH 2G5BB 2VXUH 2DMKA 5JOFA 2H32H 2V2TB 3AMKA 4L3EB 5I16B 1Y0LB 2NR6D 2CGRH 2FRGP 2Q76B 4LOUD 5EU6A 4OCRL 3WN5C 3G6JB 5BV7C 5CUSL 3EOAA 3WCYA 2JE8A 2FJGA 2ZG3A 3CVHB 4PYHA 4MJ6B 4WCYH 2X05A 3T8XB 4ZDHA 1JHKH 4U1MB 1U2CA 1S7SB 5EH1A 3PHOB 4Q2ZA 1JNLH 2A0LC 1KJVB 5D5MA 1L9NA 1HKLL 2GY5A 5SWSE 2P5EA 2HT3D 4YDLC 4UIKH 3DO7B 3BIBX 1MSPA 4Q58C 3VXUE 2ZOKA 1WFOA 1GGBL 1NGPH 3TJHD 4NO0D 4ODVL 5IJKC 4R3SA 4B50A 1H3PL 5GS3A 4N0RA 3O2DH 5I1KL 1NGWB 2NY2D 1NLBH 2JTDA 2PXYD 4APQD 1I3RB 3QIWA 1DQTA 4UINL 4TOYH 1N64L 4MXWH 1KSRA 2EDKA 4S1DD 1NDMA 4NNYA 1SBBA 2ORBL 2J8OA 4M6NH 4JFXA 1QEWA 1L0XA 4HKBA 4HUUB 3QA3A 1UWXH 5J13C 5E99L 1LK2A 2GW5A 3HPLA 3KXFB 3CUPA 4WFGE 1MFDH 4YXHH 1MCWM 3EFFA 1LP9E 4KFZC 5GRUH 3MXWH 2ICEA 5F9JB 1EEYA 5CP7B 1JZ5A 2P7TB 4UV7L 1K2DA 3GSUB 1UZ8A 2NY7L 1IARB 2AJ3B 4MZ2A 3RKPA 2W60A 5GSVA 1HIMH 4QHUB 1UQSA 5KN5B 4YC2C 4NKQB 5HHQB 1T7WA 1SBSL 3BDBA 4PJIA 2XZQL 1G7JA 5D96B 5FECA 4UQ2B 3DXAA 3RIAK 3N1MC 1MJ7L 1UG9A 2ZKHH 5FA4B 5IVXE 4X99B 5I76B 2UV3A 1N0XH 3K7UA 3KLHC 3DRTB 5F1NA 1T1ZA 3S5LB 5F9AC 2OMNA 4JM2F 4WJ5B 4YUEH 3IVKA 2YPKB 5AYUL 3DI3B 4L29A 1G0XA 3TESA 4YHIA 1IGJB 4WWID 3P4OA 4XVUC 5E8NA 2E7LA 1VFUA 3AXLB 4PJ8A 1R5WB 1T7ZA 3RVWD 3WDIA 3MODL 3TBTB 5KSAD 1QQDB 2EDTA 3HE6A 1C5CH 1JPTH 5F89B 3HC4L 4P23B 4ZS6C 5GSRA 5JQHC 2RHEA 2WAHA 1S7WB 4YHML 3CH1B 4KVCH 1MCQA 3GEWB 3O2VH 4NJ9L 5EOQL 4OCXH 1X6NA 4Q97A 5TH2B 5E4EB 1WIUA 4OBSA 2ENYA 3SQOH 3NN8A 4PJHA 5D7SH 1MNUH 4WW2F 4ZS7L 5MI0B 2FD6H 4JFFE 3CLEL 1TZGL 1ZA3B 4W6YB 5CCKL 4LU5L 2H45A 3VCLA 3MRHA 5F7DB 2N7BA 1JRHH 1TZHB 4HMDA 3V4UL 3O41B 3PJSA 4Z18A 4GW5A 5JXAL 4BZ1L 4PB9H 4PBXA 3HMWL 2CKBB 4MDJB 3FZUD 1NUFA 3LKQA 5FV1L 5GJSH 5GRYA 1YY9C 2F5AH 3MJ6A 3GBLA 1RK1A 2BVQA 2J88L 4JZNA 4NM8L 1A6WH 4NRYA 3GNMH 4KZDL 4HWZA 2E7MA 2XN9D 3NIDF 4TSAH 4FQ1H 3RDTC 3VD7A 2BVPA 4Z5RA 2OI9B 3MFGB 5I75C 4WY7H 1N6UA 1NEUA 3CPLB 4RAUA 1OW0A 2QKIA 3NH7L 3SE3C 1JK8B 3OGOE 3HNSH 1RIHL 3K4AA 2VABB 4JRXD 1YPZB 4MVBD 1L7IL 4NDMB 3FO2B 4M61A 4X7TB 3QNZA 1N5AA 5D1ZD 2VL4A 4O2FB 4HK3J 2G75A 2KKQA 5CGYD 5DZNA 2X4SB 3A0OA 3QEUA 1UT9A 3OGCB 2GITB 2C7UA 4M43L 4Y2DD 4JRXB 5I1HL 1G6RA 1TCRA 4GJTB 4HFWB 3KJ6H 5D1ZB 4E41A 3CD4A 5HI5C 1JPGB 1R3JA 4XBEH 4LQ1A 5C08B 2H26B 3T3MF 1KLFA 4PRBA 3SJVE 1BQHG 5FYLD 2PR4H 1B0RA 3FO0L 4Y2DB 4YBQC 4IJ3B 4M6MH 4NKDA 2ATPB 4N0FB 1MRFL 3RWDB 3MROA 4RMVA 4GLRH 3OHXA 1SJHB 1BM3H 3VXOB 2ITCB 2YHGA 5SX4H 2VN7A 2CDGB 2AABH 3IB4A 4KMTL 3SBWC 3TZVD 1AR2A 2CUMA 4HG4J 4XVTH 4L4VA 1HHKA 4OCLC 1RZFH 1FFRA 2AI0H 1FO0B 4WTXA 4XBGA 3LN5A 4QOKD 4D3CH 1DR9A 3SDAB 3MLWL 4Z78A 2ZUQC 4QF1B 4JVWA 1H8OA 4N5ED 4KVNL 4WNQA 5CJQH 1JV5A 1F5WA 1F6LL 3G6JE 4DCQB 4HF5L 4OZHF 2NZ9D 4ETQB 4UB0L 4OM0H 4P4KD 3BW9A 3WUZA 3ZDYE 1VFAA 4QOKB 1PZ5B 2FZ3A 2Y06H 3QH3B 4M8VA 5I0ZA 4QHMB 3U4EB 1BAFH 3V8OA 2A6DB 4PGZA 4K2UH 4BH8B 3IS1X 2XYCA 4FQJH 5E94A 3HAEB 3G5ZB 1MRCH 4P4KB 3M07A 5JQ6H 3N85L 3TF7C 4YFLF 4XNMB 4WV1B 2XQBH 1TPXC 3RPIA 2LABA 4M5ZL 1C5BH 3R4DA 5IF0A 2K9UA 1NGZA 5DQDH 3ZDXF 1CE1H 3DVNA 3QFDA 32C2A 1XGQA 2OQJB 4URTB 2MOVA 4NZUH 3TBYB 3S3PA 4ACPA 3RY5A 1OLZA 5DYOB 3U6RA 1JNHA 1RJLA 3IXTB 1Q94B 1LNUB 2G9HB 4PRIE 1MLCA 4OBRA 4P3DA 1YN6B 2F54D 3IJSB 2B5IB 1TVHB 3FCTA 2BVOA 4X9BA 5JHLH 4LCCB 5HHOD 2D7NA 3KXFE 3C8KA 1JYVA 2NQCA 1U8KA 4KHTH 4MZ3A 1IKFH 3WKML 1CFNB 4OKDA 5IHZB 1A9BB 1AGDA 1UWXK 2JJSA 5DUML 3MXVH 1T0MB 2BJML 3ZYOA 3HI6H 1T83A 5ELIA 1JGVH 2XXCB 4P5KA 2GK0B 5JDSA 4PGBB 2V2WA 4XCNB 1NGXB 4LQFH 3T4YB 2EICA 3KG5A 4JDVA 4R2GC 1WICA 3LKSB 3DX7A 1I7TB 1C08A 1CZ8H 5GRVL 3JV6B 3JVGA 1AR1D 4JFYB 3S96A 5T1KD 2LTQC 4M00A 3T0ED 3VWJC 1GL4B 5GGUA 4HIXH 4K23H 5GGRA 3TH2T 5ACZA 1A4JA 4XBPB 3I75A 7FABH 3MNWA 4QT5B 2YPLA 4GKNB 5JO5B 3WLBA 2IG2L 5L2KE 1FZKB 5JHDB 3M17B 3RZCC 3UYPA 3WFDH 5T3XH 4K8RL 3UTOA 3UP1A 2QADC 3T0EB 4YAQB 1KEGH 4YXLH 3LD8B 4M3JA 4K7PY 3VXSD 1P7QD 1AFVL 4GW1B 2VC2L 3LMJH 4FXGB 3AS3A 4NN6C 5C0IA 5AG9A 1TQCC 2EKJA 4P59H 1M6OA 5LAXA 4RZCA 3HG1D 3QDJB 4J4PC 3D2UD 3C60D 4MSWA 2IQAA 2AEIT 2QV2A 3GSWB 4JJHA 1P7QB 4AEIL 4JDTL 4GRLC 4R96B 2C3VA 4WHTA 3LS5L 4OF8A 3IAPA 3MGTA 4HKZB 5DSCB 1IMHC 3S4SA 3B9DA 5C71A 3HG1B 1UM6H 3D2UB 4U6HA 3C60B 5F7LB 2FGWL 2VAAB 4L9LB 4NBYB 4DGYL 5ERWA 3MA7B 3F6IA 4UILH 5ILTH 3IGAB 1KJ2A 4Q6YA 2DLFL 4CDGC 2M1KA 4F7PA 4FTVA 1NGYA 3EFDL 3RVUC 4IM8A 3CFDA 3EBAA 2R29L 3PXJA 3I6GA 5IOPB 4LLDB 5GS0D 3OWEA 2YZ8A 1NEZA 4XMPH 5FIEA 3F7VB 4PJCB 4JFQA 2CDFA 3LKPA 4UDTA 4J23A 3CMOH 5I1DA 1HCVA 2HWZL 1G9MC 5MERB 4PJ7B 2PW2A 4HGWB 1KN2L 2BRRH 3HZYB 4G5ZH 1QNZH 5IGXH 4M6OH 2J8UA 1F2QA 5IEHB 3QQ3B 4LGSB 3KLAB 1RAMA 3D9AH 5I1LB 4MA1C 1F4WH 4LNRA 1P69B 2VDQH 1YPZE 4HUNB 5FUZH 2IAND 3DSFH 3H9SE 3H42L 1F8TL 4N90D 2A6KB 4EDXB 3H9HB 2Q6WA 3NIFF 2X4TB 4OZHA 5D6DC 1QRNA 3OL2A 4YZFF 3ZKQD 1CDYA 3DWTA 1DBKL 3OKKB 4D2NA 2AK4E 3AB0B 3EYFA 1XGPA 3UC0H 4ODWA 3GKWL 3PL6C 2LVCA 4U1LA 4OD3H 3WJJA 3MYJB 5C08E 1DSFL 4J3WA 1YEEL 3G08A 1S8DB 4YR6A 1S9KC 5F96L 5ID1A 3QXAA 1VHPA 5MP6H 5GPRA 4X4YB 1JWSA 5KVDH 4G8GE 4OFIA 5ENWA 1FVCA 1TDQA 3CSYA 3O11B 1AKJB 5F7UA 1U8OA 2ARJB 2J7LA 3FRPG 4GMSL 5IQ9A 2OR9L 5HYJD 1C1EL 1TJGH 4HLJA 1LGVA 3PGFL 4BFGA 3EDEA 4XNQB 3OXSB 1S7UA 4LEXL 4TVSa 3RPKA 4XZUA 1T1WB 1PLGH 2H8PA 1DBBH 3D39E 3HNTH 4JEGB 3OX8B 2DQTH 1ZK9A 3VWKA 2HG5A 2R0WL 4PP2A 3K1DA 4Q74A 3KPLB 3C9NA 3JV4B 5HYJB 3GRWA 1ZKAA 5C0BE 2X2YA 3VFWB 1RURL 4X6EB 3BKCH 3GMRB 4XX1G 5ALBL 3U30C 4DTGL 4HT1H 5GGTA 3Q3GA 3V8CA 5EOTB 1BFSA 4PUBL 5EBLB 1FGNL 5E5UB 12E8L 1FAIH 2VE6A 4FQLL 1HH9B 4HJGA 1RK0A 1XIWC 3NCJH 3DHMA 4X4ZA 2AGJH 3O2WL 2WK2A 1JIBA 2ZOLB 4XP9H 2KZ1B 3FONA 2WWMC 4YPGB 5C0FA 3FT3A 5CWSA 3RKDD 4UOW1 5DZLA 1XZ0B 5AD0A 4CW1A 1CLZH 1ULVA 1FE8H 5GRJL 3PIQB 4ODSH 3NCFB 5J8OA 5C0CA 4CVUA 2P8PA 2R9HD 4YIQA 4BFEA 2DQIH 1B9ZA 1M1SA 4UUJB 3RY6A 1I9IH 2FJFB 5HYSA 1PQZA 1EA9C 4NNPH 1OT2A 4OCSL 1D9KB 3MCLL 4TVPL 5F3HB 4DKFH 3REVA 4EOWL 1ROWA 1U42A 5EZLB 1MQKH 3QUZB 1ETZB 4JVUA 3U0PB 1EAPB 5GISH 1OF2B 4JE4B 2Z4QA 1VERA 1MWAA 1BZQK 4GOSA 3V0WL 4NWUL 3KVQA 4JB9L 1JYNA 5TQ2L 4OFDA 3DMMC 2XZAH 2ICWI 1KFAL 2A9MH 2C1PA 2DQGH 5K9KA 1CFQA 4GXVL 3HS0A 2AEQH 2WWKT 3I6LE 1QR4A 5DEGA 1NC4A 1INEH 5GGSA 2NTSP 4ZFGL 4N8CL 2UZXB 1AHWC 4LSRH 5E8OB 2NXYD 4OJFH 3D87B 2Y72A 3C08H 4PJGA 1U8NB 3BP5B 1SEQL 2E9JA 1JPSL 1U92B 3RUGA 1A3LL 4HULB 4QYOB 5CAYB 4X5LA 5EFIA 3AAZB 3L5HA 3TNMB 5JHDE 4AG4L 5CSZA 5C0GA 1F4XH 1HQRA 1KB5L 2JJTC 3VDBA 4NO5A 1U95B 4XHQA 3MV8A 2DLGA 2OTUA 4LCUB 4YXKH 5ICZB 2Y5TB 5DMIL 3W9EB 1HINL 1G7MB 5K9JL 4OLUL 4KRPB