4J6RH

Crystal structure of broadly and potently neutralizing antibody vrc23 in complex with hiv-1 gp120
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
222
structure length
222
Chain Sequence
b'EVQFVQSGAEVKKPGASVRVSCEASGYSFTDYVLQWIRQAPGQRPEWMGWIKPERGAVSYAPQFQGRLTLTRDLYTETAYMHFKNLRSDDTAIYYCARGVRRDASWWLQFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Delineating antibody recognition in polyclonal sera from patterns of HIV-1 isolate neutralization.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 37
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2013-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4j6rH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4j6rH01
1AHWC 2KZ1B 2D7NA 5D1QA 1NH6A 3MRHA 4Z6AT 2GSGB 4LLMA 4G3YL 1AO7A 1MJ8H 4H0GA 4X9GA 2OX5A 2BDNH 3V6OA 5KSUA 1L9MA 4N9GB 1TVBB 3KPLB 4I0PA 2KQNA 2PYED 3EW3B 4X9HA 2UUDK 4X5XB 3KPQB 2R0KL 3HAEG 5KW9H 3VRJA 4F37F 4MVBD 3U36B 1MFDH 1HNGA 3HS0B 3QUYD 1GVIA 3UPRB 2FR4A 2EDYA 4P5MA 4L5FL 2J7LA 1ZLSL 1SJVA 2IPTL 3V4UL 3CXHJ 1CE6B 4GSDH 2HN7B 5IR1B 3U7AA 5FM4A 3WUWB 3QEGH 2C4FT 5FO8B 4X5WB 1WICA 4L4VE 1VFUA 5A43C 5TE6L 5A2IH 1X5KA 4FQXA 3R06A 4FQPA 3KS0H 4ZDHA 5TGBB 4I3RH 4XRCB 3D0LB 2Q7YA 4HAFA 4A6YB 1PW3A 3SDDB 2UV3A 3P73B 1FV1B 3GHEH 4HC1L 3OR7B 2DTML 3TJEH 1UM4H 3L5XH 4IRZH 1HXMA 4LGRB 1DL7H 4UQ2B 1D9KC 3BKYH 1U8NA 4TNVK 1EFXB 2H6PB 2QQNH 3RVUC 1MEXH 4X0KA 2VABA 2YPLA 1JGLH 4TTDC 1KJ3H 3FO2A 3QI9A 2PETA 4NNYA 2DDQL 2G75B 4XPFL 4YFEA 3WS3A 3VE0B 4ZOEA 3O2WL 3BX7C 3QO0B 4GKSB 5HVWA 1HHKA 5IW1A 1YPZB 2ZG1A 3HLAA 3MLXH 2VUYA 4WO4D 3U7WH 5BCAA 4ZS7L 1R3HB 5J13C 1DE4A 2I07B 5FAAA 4OLVH 3VRLF 3DURB 3MO1A 2HJKB 4Q9QL 4Z76A 5E9DE 5IFJA 3TA3A 2Z31D 3MUGB 5SV3A 2CDEA 4U1NA 2R1WB 4YPGA 4M43L 3SCMA 4OF3A 5M95B 4M62L 1BX2A 1X5JA 2W38A 2IAMB 2C3VB 1XCQB 4XPTH 3OGCB 4ZFZA 3TN0B 4BQ9A 4OD3H 4XP4H 3LH2H 1N7MH 4HKBB 1KEGL 4O4YH 2EKSB 3MV7E 3NA9L 1MFAL 1BD2A 3TT1H 3PL6B 4POUB 4JE4B 3SE8H 4CJ1A 2F54B 4LASH 4BZ1H 2JIXD 4OZGB 4Z8FH 3FQWA 3QEQE 2JK5B 3OZ9L 3FONA 4MJ6A 1A4JA 1TZGL 5BJTA 1QQDA 5I1EH 5F7DA 1IAOB 1OPGL 4KK6C 2YPVH 3FO1B 3V4PH 1KCUH 4WHTA 1CVSC 4FZEL 5IW3A 2DLGA 1UKTA 1BWMA 5SWSD 1L0QA 3PDGA 3HC4L 4LSUL 3FL7A 4IRSA 2OR9L 4ZPVA 1NAML 3QEHA 4FFYH 1MCPL 2VLKE 1YYML 3VD9A 1OVZA 1YEHL 5C6PB 4OFYA 5LAXA 3UJIL 3LKPA 3IJSA 2VH5H 1LMKA 2XN9B 4RZCB 4M6MH 4RRPA 4HV8A 2OR7A 2NPLX 4HWEL 4RAUB 2DI7A 3SDDC 1ZT4A 1OAUH 1G7PB 43CAB 1YN6B 4YC2B 3FQTB 2NW3A 4WFEE 1J12A 4GUPA 4JGUA 3KPOB 4YEFA 1R3LB 4I5BB 4B50A 1QLEL 2A6IA 4HT1L 4M93C 4PGDA 1T89C 1FNEA 3L3IB 3MRFB 2KUTA 3D5OF 5DJ0A 1NGXB 4XBPA 4YDIH 4P4KD 3KYOA 1IEAB 2VO5A 5BOPA 5GGRB 1QO3B 1GOGA 1I1FB 5C0GB 5IF0A 5BMFH 1FPTH 4NZRH 4XC1H 5CEZH 3BGAA 3K80A 2AXGA 4ONGH 4ELMA 4R4ND 1OGAB 3ZMRA 1R5IB 4FFVC 4DVBA 4XP5L 3G6JF 3HA0A 4DJMA 1AGDB 1TETH 4QRRE 3GI9H 1SHMA 4L3EA 2CLVB 4HK3J 3UMTA 5BOZG 4KI5F 4R8WL 5D7JA 5T1DL 3NN8B 4RFNC 1KLUA 3RZWA 1DFBH 1WZ1L 5F7WC 2FSEB 4NRYA 1W72H 3TO4D 5JHDB 5AG9A 4UINH 4R90L 4N0CC 5I1JL 2AV1B 3ZSSA 2VXVL 2IAMC 2BP3A 5IK3B 4JO1L 4G8IB 4Y5XA 1IBGH 4XPAH 1T83A 4JFED 3TN0C 1N8ZB 5DK2B 5FO9A 4D0CA 5K93A 2VE6A 3FKUS 3T0VA 5DD1L 3V6BR 3W39B 2LAGB 2A1WL 3PL6C 4JQXC 1NUFA 3TYGL 1EBAA 1QG3A 3S98A 4NM8H 1WQVT 3RAJL 2RHEA 5EUKB 3WL9A 3OKMA 2E5EA 4KMTL 2VDRH 1I8LC 4XCFH 4XNUL 3TVMB 1KYOJ 2QHLA 4H1LH 1TTFA 4WW2B 3KYKH 4XWOC 3BZ4B 4OLZH 3WXVL 5T1MA 4Y16B 4WFFD 1MCOL 2R4SL 3QJFB 5E2VH 4LPYA 4Y4HC 5ITFA 3V5HA 4LSVH 1EXUB 4Z5RB 2X09A 1FVDA 2BOCA 1QSVA 4OI7A 4E41E 1UEYA 3QJHA 1XF1A 4XMLH 4P2QD 4PR5A 2D0HA 3MODL 1JWMB 2WBJA 1RSFA 1X7QA 2HT3D 1J8HB 1WEJH 3QCTL 1OT2A 1GPOH 2PKDA 3ARQA 3RY5A 1XR8A 2EDKA 4HBCL 4XAKD 1GC1C 4M8QB 1UQSA 4HX1B 3MJ7A 2Y7QB 1AR1C 3QIUD 4KJPD 4OFPA 3MRGA 1FAIL 5CINL 4G6JL 2ICWJ 3NABL 4C58B 4F15B 4HHAB 3HI1A 3N50A 3MCKB 2IQ9H 3DROB 4XMKH 3L95B 1IGTA 5SV4A 3CCHB 4LLUA 1K4CB 3IDJA 1FIEA 4XPHL 2ITCA 5CCKH 3W2DL 2R1YB 43C9A 3BUYA 3NAAL 4UUJA 1FVEB 1UVQB 1KB9K 3L3OA 3NZHH 3L7EA 2ESVD 3ZTJG 5JW4N 4IMLA 2VDLL 5D6CA 5ADOH 1LDPH 1R3JB 3MROA 4XP6H 1I8MA 1W2KT 5T3XL 4IMKA 1JWUB 3L9RA 4X7EC 3C5SB 2WWMD 1BIIB 5D93B 4GW1B 5C0EA 3S34H 1WWBX 3C60A 1T2QH 3F12A 1AKJA 3P40A 2IBZY 1X5FA 3VXUB 3G5VB 3EFDL 3C5JB 1ZT7A 5CAYB 1C5BL 3UROR 4Y2DA 4JPWL 3S5LB 5HY9A 5FV1L 4ONHB 4Z7WF 1I85A 4M02A 4C4KT 3DO7A 5E8OA 1A1MA 1UZ8A 4WY7L 3H3PL 1JGEB 5HYJE 1CFVL 3UAJC 2R9HC 4BFBD 1AC6A 3EO0A 1I1CA 2NY3D 3LN4A 2WQRA 1KLGB 2ADFH 1EAPB 5GGRY 4DKFL 4MA1B 3TVMC 4IHOA 1HINL 4FZ8H 2ADGB 3LMJL 3O6FA 4WW2C 3EZ8A 5CZKA 1M71A 5T3ZL 5JXEC 4TULH 4X80H 2OTWA 2AJXL 4Z95L 1S7TB 5CEYB 3FMGL 3NACL 4GKZB 1NKOA 1TQCB 3GSNB 2GT9B 1UJTA 1UM6L 1YEEL 5CIPB 5HDQL 4HIIB 1V3KA 2R2HA 4BM7A 1SY6H 1KN2H 3IFOB 2GQHA 4MLSA 3TZVD 2R69L 1PAMA 5DRNA 3MV9A 4XCYA 3OPZH 3QUMB 1FL6A 2F8XC 3PWJB 2UVEA 3DHJA 5IG7B 3QUXC 1N3NA 4NHUB 5E8NB 3CK0H 1NFIB 1RUQL 3FFCD 1AGFA 1G6RB 4UTAH 3Q5OA 3MJ9H 4WHYG 5KAQG 3KPRB 4HF5L 1N5AA 4QOKA 1Z3GL 4U6YB 4YFLF 4KUCF 5FYLD 3U79A 5EBGA 5IJKA 4YQXL 1QBBA 4HXAH 5E03A 5T3XE 3NZ8B 1Y6MR 4OJFL 3T1FA 3VXRB 4F3FA 2F15A 4PBVC 2MHAA 1H9VA 3GKZA 5D7IA 5ACLA 3E1F1 4PB9L 1ULVA 1U42A 3P0VL 2YEZB 3MV8E 4NQCB 1P7QD 5D93C 4OLYH 2UWEB 4ZO7A 1I3GH 5ICYB 1JGVH 1EPFA 3SOBL 1KGCD 1DBBL 3ZL4H 5C0NC 3TBWA 4K9EC 3PF2A 3X13B 1PVHA 1BVLA 1BZ9B 2X4UB 1I8IA 4LCWD 4M7KL 4GJTB 3ULSA 2Z91A 4Q6IA 1Z5LA 5EA0H 3SKMB 1LK2B 3UX9B 1I7RB 4FTVD 1CGSH 3LKSA 3MFFA 4J8RB 4KKCC 2MNUA 3OL2A 3HAEB 2ICEB 3V5DA 5F9JB 1DBKH 4NKOB 1CXIA 5EUOF 4MD5B 2DWEA 5TE7H 1M1SA 1X4ZA 2HFGL 5B22A 1DJSA 4LVNB 4DVRH 1JZ8A 2Z35B 3O6LH 2BOBA 1PY4A 5F96L 2APTA 1Q9OA 1QLRA 3FQNB 5EOCH 1SVZA 5T3ZE 3P9MB 4DGYL 3QFDB 1OAYH 3DX8A 4ZUUA 3FFDB 3ARDB 1DP0A 1P53A 4OCXH 4XI5C 4JPKH 4LLWA 3HRPA 1JPTH 1CIDA 3KWWA 4UQ3A 2MWCA 1EX0A 2QR0B 3VXNB 4NRXB 1W72A 1ADQH 5ECJE 5CZVL 3V95A 5DVNA 5HVFB 2HTKD 5CHNB 3CU1A 4DKEL 3RZCB 1RZKL 2YUWA 1QKZH 1ZOXA 5F88B 3KR3L 3FRUB 5FYJU 1MCEA 3SDXB 2MJWA 2CUHA 2OJZH 3JV6B 3NIGF 4W6XB 3V0WH 5HGAB 1J87A 3KJ6H 5C6TH 3CX5K 3GMRA 3PHOB 1AD9B 3DMMB 3ETBF 3QWOA 5E1AA 3X11B 5KSBB 4MNQD 3RVWD 1MJUH 2ZOKA 4R7NB 3ARPA 3P30H 4J3UA 4Z7QE 4P2YA 4YHLL 4H1LA 2PTVA 2OK0L 5CD3A 4LRNH 3D48R 3EJZD 4YEEA 2X1OA 5FGCB 8FABA 5HYFA 3O2DL 1LGVA 3CDCA 4HUMB 12E8H 5JW4R 2PO6B 3HG1D 5E2JA 4ZAKD 3FT2A 2VN4A 5DEZA 3S37L 2P5WA 3TFKC 5IKCB 2HLFC 1LNUB 4EUPH 4RGNB 4ZFFB 1FLRL 2NY0D 5E2WH 3WFDL 3BIKB 3Q3GB 2RQ8A 4WCYL 3M45A 5CS7A 5D7SH 5IHLB 4K3JL 1FGVH 4L4TA 1G9EA 3HUJA 4TUKH 1ND0B 2HTLD 4X98B 2VLRB 5LKNA 2ENYA 4XTRC 2K7PA 2WP3T 4NOBA 1ORSA 3P2TA 3QHTC 1IC5L 1TNMA 1BQUA 4LPCA 5I16A 1DLHB 1X5IA 4I0PD 2C1PB 3W82A 1S3KL 2H3NA 4F2MA 3H9SD 2EE3A 5J1AB 3IFNH 1J0JA 4LVNC 4IRJA 3SO3B 1SYVA 1DQML 2DQFA 1IE5A 2FIKA 1RZGA 2JELH 1GC1L 2F5AL 1GZQA 4KZDH 3AUVA 4LKCB 3NOIA 1OTSD 2DQIH 1VKXB 5MEQA 3U6RB 2YWYA 3ARDC 4QY8A 4LFHD 3P0YH 1AGEA 3U0WH 3BP6A 4JQIH 2ZP0T 4PGZA 1HQRA 1M7IB 2XTLA 4K8RD 5DJXA 3VDCA 1C16A 5FUZL 1NGZB 1SYSB 3G5XB 1NJ9A 4FQXD 3GMOB 2BVOA 4WU7A 4RWYH 4M00A 3NFSH 2IANE 2IALB 3LHPL 3STLB 3FB7B 5DT1L 4GH7B 2G5BA 5CUSH 4LF3A 1U58A 4XZUB 4GAGL 1UA6L 1ZA3B 4KHTH 3FQXB 2E27H 4PJ7E 2FO4A 4OUUB 1Z0NA 5EH1A 3PJSA 3HNTH 3E6HB 4Y4FC 1RMFL 4HIEA 4OKVA 5EO9A 2YD2A 1AQDA 4UT9L 5E00B 3L5IA 2OLDA 4QXGL 1YYLL 2FEEI 3ZDXE 2GK0A 5K9KB 4NSKB 2GITB 2YPLD 1UYWH 5C71A 2ADIA 3DV6A 4NCC1 1MI5E 3HRZB 5CMAB 3GSRA 4D2NA 1QBLH 3T65B 1CD1A 4HXBH 3DNKA 3CFJA 5J9PA 1U0QA 4X99B 2ORBL 1T4KB 4IIQC 1YMMD 2PO6C 3ULUH 1FIGL 1I7TB 4JN2A 3QQ9D 4QO1A 1YQVL 4E42B 4YR6B 3RNQB 1PKQB 5CBEA 1TXKA 4RGNC 5KVFH 4BSVB 2SEBA 2XWBA 5HYIA 5SWZB 1B6UA 4Y1AA 4M5YL 2DQUL 3GIZH 1IGCL 1WSST 4IJ3B 4OZIB 1FNGA 3ROLA 5FGRA 1J7VR 4NKMA 3FOMB 4KRLB 2Q3ZA 1SY6A 1F90H 5D2LB 4E5XA 3PWPB 2G60L 4TSBH 2VLME 1GXEA 2CMRL 5C0AA 4QHKJ 1IM9B 3BI9X 5FECB 3QCVL 2K7QA 4PLKD 1PLGL 2XN9E 2GJ6A 1WBYA 4WTZA 5HVGB 2C3HA 1BD2D 1Q94A 2BSTA 3BHBB 1CU4L 3IDNB 4NO0A 3STBA 3VXOB 3WNMA 3O3BA 1B0RA 2IPKA 3MJ9A 3SO3C 4G8GB 4V1DB 4UT7H 2CK2A 4RA3A 4OZ4B 5EO1B 3OXRB 2FX7H 2MCPL 2EZ0D 4ZODA 2HH0L 2DI9A 5AZ2L 4X7SH 3RKPA 4OQTA 3SJVA 4LCCA 3UO1L 4M7LT 3FZUC 5BRZA 4K3DL 4C56A 1E27A 4HCRL 1HK6A 3LKOB 5GS2D 4EOWH 4IRSD 3X12A 3G5YA 1CR9H 4QRUB 3B43A 5MENA 5DA4A 3TBVB 3HZKB 1DBAH 2IGFL 4J2XA 1OGAE 4MAUH 1ZT1A 3REVB 1IQDA 3SDAD 4TUOB 2DQHH 4NQSB 2EYTA 2P5EE 5I71B 2R8SL 4RX4A 5TQ2H 3RDTA 1QRNA 2MTPA 3BRDA 2HVKA 1A0QH 1PZ5A 4FHBD 2P8LA 3OB0H 3QQ3B 3Q6GH 3LSOA 3QIWB 4X6BB 1KPUB 2LE9A 4M61A 2APWA 3U82B 3VFRA 1VACA 4XP9H 1KG0A 4P23C 1WIUA 2FLBT 5CILL 3P4OB 4PJBA 4BZ2H 4GXVL 4W81A 3MLZL 3MA9H 3DRTA 1EEUA 4J4PD 4O58H 2HAZA 1ONQB 3QZWG 1XT5A 5ESAB 4JDVA 2VSCA 1WZMA 2GCYA 2FYYB 4G6AD 1A7PH 3OKOA 4AEHL 4CU6A 2Z0BA 5EBLB 1CDHA 3H9HA 4JGMA 3C8DA 3ULVC 3GMNA 2B2XH 2VAAA 4JQVC 5D7JD 5E08L 1KJ2H 1ADQA 5HBBA 5JDJA 4IJ3C 4R97C 3CFDA 2Y07L 2YD4A 3MRQB 1EHAA 4HAGA 4N0FB 1MF2H 5ALBL 5JIKA 2BVUA 1XF3A 3WLWC 2H9GA 4LKXA 2VC2L 4FQLL 1RFDL 2OM5A 2XA8L 4F7MB 5IEHA 2F19L 1BZQK 2V2XA 1OGTA 3I6GA 1NCDH 4HQQL 4S1RL 3PABA 3HE7A 3MREB 4RAHA 3VGGA 2FHBA 4PLNC 1U9KA 5J4MA 3GSNL 2NNAB 2X89A 5DVLA 4JG1L 4OZFH 4ZNEA 2VN7A 1CE1H 1ZK9A 3CGTA 1DVFB 4XXCA 5GGVL 4F58L 1Q9KB 5ISZB 1S7XA 5TDNA 3CVIH 5GRVK 2VLJB 4LMQE 4P3CL 3F7QA 3TBSA 4O5LL 3AREB 4PS4H 1G7LB 2BC4B 1XGRA 5KSVB 4TSCL 3HB3C 5DR5L 3V7MA 4HK3N 5CSZA 1REIA 1PSKL 2HKHH 3MTRA 1G6RL 2A73A 1A7OL 4KVNL 3BP4B 4G8EA 5DFVC 3VXMB 4L8DA 1DQQA 3T0WA 1TJIL 4M7LL 4O2CA 3DX9A 4AJ0A 2JJSA 3FN3A 2OYPA 2FJFA 3FT4A 3I75B 2Y36L 5GS1B 1CTNA 1IGIL 1L9NA 2WBJD 5I71C 5EUOB 1F3DH 1UXWA 4LARH 3CFBA 5DMGD 2B0SH 5C7XH 5DMKA 5EZIH 1YUHA 3ZO0A 2GAZA 3BGFB 1Q9WA 3LKQB 4G3YH 4D9LL 5D7LA 5CFHA 5FUCC 4G8FA 4PBWD 5C07B 3QDHA 3QIWC 4HG4J 2NYYC 3H0TA 4LVOC 4YK4B 2CDGB 3CPLA 5EWIL 1ZHBB 3RPIB 3QQ4B 3KXFE 1G84A 3BQUD 5DJZB 1JYXA 4YNYB 5HGHA 5C0CE 4CN4A 5CZXC 2WSKA 5EU4A 2R0KH 3F62A 3L5JA 5B3JF 3CFKB 1IC7L 3OHXB 1K4DB 4MCZA 1I1RA 2RIKA 3CX2A 3WE6A 4X6FA 4Q9BA 4L5FH 3D39B 1ZLSH 2IPTH 3V4UH 5C09E 2K3TA 5B38A 2W65B 1HYSC 4HK0B 5FIEA 2DL2A 4PRHA 1LO5B 3U9UA 2YS4A 5E6YA 5I76B 5TE6H 2J2ZA 5MEOA 1NFDF 4KGLA 5EZJB 2FJHB 1MQKL 3HZYA 2F8OA 1WZLA 1A2YA 4LLQA 2NY2D 1QSEB 4Y2DD 4UDUA 4BH7B 3PQYA 2Q3AA 5FKAA 4K23L 3VMNA 4HC1H 5T1LA 2EDJA 4X6DB 2DTMH 1LEGA 4HH9A 4MJIE 1NGWA 1S7SB 5SX5H 4N9OB 4IOIB 3JZ7A 5IFAL 1YY9D 1T7XA 4U1SB 3V0VB 3MUJA 1WCBB 8CGTA 4PJ5D 3U46A 1NFKA 5B21A 3AREC 5IMMB 2AJ3B 3UYRL 3O6FD 3W9DB 5EN2B 5E94B 4OFVA 2YN3A 4NYLB 5E6IB 4QRPD 2DDQH 4WWKC 2QLVB 3JWDC 4ERSL 1U8IA 2A6DB 4OV6F 4XPFH 3BZEA 3O2WH 1MCBA 3QFJB 3VXQB 5L2KB 3BZDA 1JGDA 2FHCA 4ZS7H 1VDGA 5DQJA 3PV6B 3DX6B 3OB0K 5GS1C 4HJ0D 4GO6B 4Q9QH 1CD0A 3T0BA 4AQOA 1CGXA 4PJFA 3BD4A 3T09A 4BH8B 3PWVB 3CNKA 4M43H 4M62H 3QT2A 4LVHC 3BGFC 3MV9D 2MQ3A 3MV11 5C0JB 4KRPB 1U3YA 3W0WD 5EBMA 3M17A 2X1XR 4QHLB 4YK4C 4I0KA 1NDGB 3KPSD 1UM5L 1QNZL 4RMUA 5C0FA 1HZHL 3BOVA 3SKNA 5JZ7C 1KEGH 1T1ZA 3NA9H 1MFAH 4PJHA 4HWZA 2DBJA 2VZ1A 1PYWA 4CMHB 3I50L 1ACZA 2OZ4L 4QOKD 2UY6A 3OZ9H 2FX9L 2W0FA 2VISA 4NP4L 2BJML 1TZGH 3MLWL 2XY2A 3KLDA 1EUUA 4QXTA 4NC1C 3IAPA 4LSPL 4UILL 1OPGH 2A83A 3DHMA 4GAFB 4U33A 2G5RA 3VRLE 4FZEH 4P2OA 5JHLL 3LRSA 4GKNA 2F53A 1S7WB 3HC4H 4LSUH 1U91B 2YD3A 2OR9H 1NAMH 4ZFGH 5CJ5A 4JFFE 2Y5TA 1MCPH 3DXAA 4Y4KD 1YYMH 3H3BC 5HHQB 3WNLA 1YEHH 3OJDA 1JJUA 3IRZA 3BDBA 3UJIH 3V6ZB 4LCYB 3F7YA 5I8CB 2BHUA 4WV1A 3VFPA 3GSQA 4HWEH 5F1OB 5ID0A 4OM0L 3BDXA 1CFNB 1KTDB 3OKDA 4PB0L 3OBAA 3WNPA 1V5JA 5E8PB 3NMEA 4PJAB 4QTHA 5IB1A 1BLNA 1QLEH 3DECA 4HT1H 5C92A 5HD8C 5DK3A 2GSIB 1JUFB 5C3LD 2NY4D 4M1GL 2M1KA 4PGBA 5CEZD 3U30B 2XYCA 3WJJC 3WYRA 1KB9J 4AT6A 5E6IC 2FH8A 5KZCD 2DBLL 5L6YL 5C0DA 1GGIL 1JN6B 1IEBB 4GG6B 1DBJH 1NBZA 2I9LB 1TVHA 4XP5H 3ZT7A 3NH7L 5F97E 5HHOB 5D8JL 1T1WA 5I1GL 3GK8L 3R0MA 3EFFA 5BXFA 1F6AB 1G9ML 3RGVA 4R8WH 2H2PC 5T1DH 4J1UA 4JRXB 4ONFL 5FK9B 1WZ1H 4L4VA 4CNIA 5DRZB 2VXTL 3I6KB 4OZHF 1J88A 2ZCLL 1EIBA 4R90H 5I1JH 4PGEA 1JZ5A 1NAKL 2VXVH 2LVCA 3DWTA 4NQUA 4JO1H 4K7PL 2ZG2A 4KRPC 4OZFA 1RZ8B 1OAZL 5JO5B 5JMRA 3HUJF 1UXSB 5DD1H 1K8IB 4K7FA 5GZOD 3S96B 1BQSA 2A1WH 4HJJH 1JE6A 2ZUWA 3P4MB 4JFDD 3LEVL 4CMHC 3PGCA 3CFEA 5K9JL 3TYGH 3OG6B 2NY1B 4GBXA 3IDMA 3RAJH 1A3RL 5TJWK 2X4NA 5DC0A 5EORL 4JY4B 5J56B 1E28A 1P4IL 5DJ8A 4KMTH 3D69B 5F89A 3TH3T 2AV7A 3IJHB 1D5IH 4XNUH 2XTJE 1PX3A 2IMMA 2LAAA 4KI5E 5DSCA 3VFNB 5J6GB 3S4SG 3WXVH 2YRPA 4QHNA 3VU2A 4K7PX 5C8JB 3DTXA 4LHQB 3FOLA 2B4CC 1MCOH 2R4SH 5AD0B 3JUZA 4L4TD 3TESA 1KTLB 4HKXA 2C26A 5HHVH 1IAMA 4LVEA 1U8KA 3MRRB 3L3DB 2VDML 4FQJL 5DUML 4D8PA 3QXDA 3QXUA 1SEBB 2V7NA 3MODH 2C3WA 5E9DA 4RMWA 3QCTH 1KJMA 4HBCH 2HVJA 4HZLB 3EHBD 1EJ6A 4ZXBA 5A16B 1MHCA 2VWEC 1B2WL 4QHMB 3IDIB 1CT8A 3STZA 5CINH 1FAIH 4BK4A 2EH8L 4G6JH 1T0MA 3AFLA 3DYOA 3NABH 1TCRA 2CKBB 4IRJD 2NW2B 1PDKA 3VG9B 4WU5A 2E9IA 4QCIB 4OAWB 4DEPB 2KBGA 3MV7A 1VFAB 4MD0A 4ODVL 1Q9LB 4R4FL 4HS3B 1JPGB 4XPHH 3W2DH 1HHGA 4Z0XA 2KQMA 3NAAH 1W0VA 3QEQA 5BW7A 4N0UE 3MLRL 2ZSVA 5IEKA 1HKFA 5F3HB 5I1AA 2VDLH 3MRDA 5GGSY 4GW4A 5GSRB 3T77A 4KKAC 3QAZB 4J3TA 5IM7B 3EYFB 3V5KA 5C08B 5T3XH 4OFIA 4MAYA 3DUUA 3DETC 3UYPA 4JVUA 2Q8AL 4AL8L 1Q1JL 3JWNC 5ESVB 2VLKA 5ILTL 5FGSA 3DSFL 3EJYC 1WFNA 4OZIE 1ITCA 3RWGB 3G04A 3EFDH 3ARGA 4RSVA 3RWIA 4X8JB 4HC1A 3CIQA 1EEZA 1C5BH 2EEDA 5E5MB 5AYUL 3VWKB 5FGBC 5T5NF 4JPWH 1J8KA 3HPLA 5D2NB 2NZIA 4YXLL 2EYRB 2IADB 4GRWF 4R96B 3QZWB 1F3JA 4L9LA 4L8SA 4WY7H 4Y19B 1OB1A 4DAGL 1XF2B 5SX4H 1S8DB 3H3PH 4OV5A 1F4YL 2NY1C 1C5DA 1CFVH 3BPCA 2BZDA 1OLZA 1K5NB 4OCWL 1RIVL 5F1IA 5LG1A 3PHQB 4V1DE 4DKFH 1EFXD 3WDJA 3VFMB 5MEPA 1HINH 3LMJH 2EXYD 5M94B 3RWCB 5T3ZH 4TSAL 4Y1AD 5L9DL 2XFXA 5IBLC 1ZGLP 2AJXH 4KJYB 3B9DA 1HH6B 9CGTA 4Z95H 1I9JL 3FMGH 5J3HC 1ZWIB 3GZKA 4QRRA 3BAEL 3PGFL 4DWHA 5L8JB 3JWDL 1RZFL 3O4LB 1UM6H 4OF5A 1JHTB 1NL0L 1YEEH 5F9AC 5HDQH 3NFNB 3BJ91 2ADJA 4KDVA 3QDJE 3QDGB 4Z7WE 1MCKA 2ICCA 3L3JB 2Z9TA 1CG9A 2GJ6D 4RFEB 4URTB 3WSQL 3LOWA 5IROA 2CQVA 4AEFA 2R69H 1XIWB 3AU1A 2P8PB 4NO0D 4DGVL 4AIOA 1NCCL 5IVOA 3WCYA 4LHUD 2APFA 4XBGB 3VG9C 5JLZA 2XWJB 3RUGB 4RQQB 3O3UN 2ZCKL 1S9WB 4JRYE 4DEPC 1FQ9C 1M6OA 1RUQH 1QEWA 2P8MA 1MRFL 2NR6D 3EYVB 1S7VA 4ELKB 2X4TA 2R29L 4G9FE 2OP4L 2XZCL 4HF5H 4JFOB 1U2HA 5BRZD 1MUJB 1Z3GH 1SBBA 1E0OB 3G9VA 1R5WA 4YQXH 4JY5L 1ES0A 2BCKA 4KROC 5MEND 3E6FA 4OJFH 4AZ8A 4PJ8D 5DI8A 1N59B 1U2CA 3VCLA 3QAZC 3OXSA 1NAMA 1UWEL 1B6DA 2P46B 3WBDA 4PB9H 3V8OA 3P0VH 3DIFB 3VXSE 4YHPA 4R26L 1RJYA 3PGDA 3ARUA 2GTZB 3V6FB 1CFTB 3SOBH 3QNZB 5DDHA 4HPYL 3O6KL 1DBBH 3TCLA 2NTSP 1BJ1J 5E8EA 1FFOB 1P5VA 4PIRF 4W4OC 4M7KH 4E41A 5I6XC 1OTTC 1HDMA 2IJ0C 3VWKC 2R0ZL 3RL1A 4BJLA 5D2NC 2ZNWA 4NQEA 3TF7C 2Y06L 3MUY1 2WMPA 5TFSL 5J8OA 4IBLT 3N1MC 1R3KA 2FDBP 1YC7A 2PYEB 1ZHLA 3L7FA 1FVCA 2GJZB 3VI3E 1DQJA 3HR6A 3GSXB 4UU9A 1DUYA 1KULA 4M8VA 3IVKA 2XZZA 5F96H 4EI5A 1FFPA 4DGYH 3QUYB 4Q7DA 1BP3B 5GHWL 4EI6B 1KIRA 1CK0L 1R3IL 1CL7L 1QSFE 1SJXA 1UC6A 4L8CB 4NIKB 3HE6C 4KXZH 4OCMC 4PRIB 1A1NA 1FRGL 2EIZA 4QRQA 5I30L 5CZVH 2W9LA 3CVHL 5IV2B 4XCNA 4W70A 3WJLA 3RWJA 1V3JA 4RDQF 2IWGA 5HYSG 4DKEH 5I1IL 5IVXF 1GGUA 1RZKH 3SDYL 1R5VB 4H5SA 3I02A 5EUOE 4KH2A 1JYVA 1XIWC 1YMHA 3KR3H 2N4IA 5D72L 5F1NB 3GJFB 2YN5A 3O3AA 5EC1A 3N0PB 1SQ2N 2D7PA 1NQBA 1G7JB 4JZNA 3ARSA 4PD4K 4Y5YB 1CIUA 4MNHB 5GRUL 2J4WL 3CSYA 4I1NB 5HYJA 4YBQC 5I75B 2C7UA 4NO3B 4HUVB 1LP9B 4JG0L 4YHLH 3LV3B 4TPRL 2OK0H 5AAWA 1CLCA 1CFSB 2A6KA 3G9AB 3SE9L 3LN9A 1U3HC 4HUUA 5MHSD 3O2DH 4E9LA 4JHWL 1Z6JT 2Q20A 4NUJB 3S37H 3QNXB 4JFYB 4WO4B 3ROOA 4KKLD 2BHZA 1FLRH 3UC0L 4WGWB 3WFDH 2EC9U 3MC0A 4WCYH 4Y16D 4U1MB 1ETZA 4QKXB 1YJDC 4MXQD 4K3JH 1VHPA 2VXQL 3BEWB 2Z31B 3AS2A 4HFWA 1VPOL 2KH2B 3IFPA 5D7LD 1OP9A 5K59F 1UH4A 1MCDA 4G6ML 1IC5H 4FNLL 1NDMB 2APVA 5EIQA 1S3KH 1I3VA 2D03L 4X6DE 1QVOA 4GLRI 2HFEA 5DO2D 3HC3L 3B8YA 1DQMH 2NXZD 3MSPA 1A6ZA 2JIXB 1TZHB 1RUAL 3MMEA 1GC1H 4MVBC 5DHVH 4Z78A 1HI6A 2F5AH 5JR1L 2WM0A 3UEZA 2MKLC 2XICA 3JTTA 2CKNA 2R2BB 3RJDA 5DF0A 2A9ML 3VA2C 4F9LC 1HXYA 5JA9A 5IQ7L 4G6KL 2YSSB 3MRNB 1CFQA 3PP4L 4F7EB 4FFZL 5FUZH 5SWSB 1V8HA 4OIBA 3ULUF 3WHE1 3G08B 5FO7B 4LFHG 1DBML 3LHPH 1ZTXL 2X4SB 5DT1H 3HZVA 1KIPA 3MV8A 3TNNA 1KT2B 3GBNL 4NN5B 4WDIB 4GAGH 1UA6H 4P5KB 1I7ZB 1G7IA 2F58L 1E4JA 2EICA 5CWSB 3C8KA 5JOPD 1J9CT 2IQAB 5CKAA 4Z7NF 1TZIA 4KKBD 1RMFH 1WISA 3QHFL 4UT9H 1FAKT 1MHHA 3BDYL 2ZOLA 1RZJC 4QXGH 1YYLH 4Y5YC 3U0TA 2ZUUA 3L1OL 3BP5A 1B88A 4WW1B 3LKRA 3VGFA 4KJQD 4P4KB 1A8JH 3O3DA 1YEFL 1GGBL 4XHQA 2OR8A 2OI9B 2QSQA 4WI8A 4KPHL 3RNKB 3RVVD 1MWAB 2BMKA 2ORBH 1MH5B 1U8QA 2RFXA 3UTSD 4LBEB 4MYWB 1FIGH 2BRRL 1HHIB 2OQJA 3RQ3A 1YQVH 1C7SA 3UTQB 5DURB 3MUZ1 1AR2A 4WO4C 3MNVA 4MQ7A 4F57L 3EJJX 2PTTA 1AP2A 2X4OA 4M5YH 2DQUH 1T20B 4OM1L 2VJXA 2PYFA 2Z31C 3TO4B 3L5HA 4NKDB 2C3XA 3FB8B 4JZOB 2G60H 1VFBB 3QNYB 1IKNA 2CMRH 2XQYK 1D5MA 3ISWA 4H26B 3HR5B 4HWBL 4WNQA 4YHZL 3WHXA 4DN3L 3FQRA 4ZFOB 4LDOB 3EIFA 4JFEB 1Q0XL 3QCVH 1PLGH 2IBGA 1GJIA 2APXA 5DC9B 1JRHL 1VEOA 4Y5VB 4L29A 5BQ7A 1KNOB 1CU4H 3BO8A 2DIJA 3VFVB 4QGYA 3D0VB 2VWEE 5F7EL 4HEME 2WIMA 4S2SB 1CD9B 1CXLA 3D85B 4U1IB 1OLLA 2JJTC 1ZVSA 2MCPH 3L5WB 3TNMB 2HH0H 1NBYA 3S4SB 5IUSA 1C8PA 3UO1H 2CKBL 1FN4A 4K3DH 4P2OD 15C8L 4HCRH 3SBWC 5FXCH 4PG2C 2EDEA 2V2WB 1AFVL 1T22B 2RJMA 2F53D 2VZVA 1TVDA 2JJWA 4N5ED 3MPCA 4YLQT 1IVLA 2R0WL 1D7FA 3DXAD 2G2RA 2VZTA 2IGFH 3P77B 1U8OA 2DQJL 4YO0A 5JOEA 5HHOE 3SKOA 1NSNL 5GGSA 4POYA 1HSBB 2W0PA 1EGJL 1EDQA 4NQCD 1FCGA 2R8SH 4P2QB 3FO9A 4P9HC 2WLYA 2W9DL 1K2DA 1J10A 2DOCA 4M9OA 2Y1VA 2J8HA 1FH5L 2C1OA 3QIUB 2XIDA 3QH3B 2XACC 1MVFA 4WVRA 4Y2OA 2Z4QA 4RMQA 1BVKA 3RY6C 5TGBA 4KMLB 4ZSOE 2BX5A 3ES6B 5EU7C 3JBG7 1HH9A 4P4KC 5FYJL 4NCC2 4GXVH 3MLZH 4E0RA 1T5XB 3D87B 3OR7A 3I9GL 3SGDH 2OI9C 3U2SA 1ZVHA 1ZSDB 4UQ2A 2BY0A 4YAQB 1M05A 4W4NA 3UTTD 1OCWL 5TF0A 5BS0E 2DM2A 1EO7A 2KL6A 4AEHH 2ESVB 4BQCA 4R4NC 4J23A 2Z92B 1FSKB 4CJ0A 2OBGA 2R4RL 4YHNA 3K46A 5B39A 4U4BA 4P4RA 1EERB 3PHSA 4ZYKB 4YXHL 1O5DT 2BY3A 2YC1B 5E08H 3ILPB 4L4VD 2Y07H 5EO0A 4N68A 5ALBH 2IANA 2NLJB 3TO4C 4U3XA 3G6AA 25C8L 3MA7A 2VC2H 4NT6A 5D1XA 1G9NC 4FQLH 3MRMA 3O45B 1U8PB 3UTZA 2XA8H 1DQTA 2I07A 4PJ7A 2F19H 2GJJA 5DQ9B 4LOUD 4HQQH 4S1RH 3DURA 5DGQA 3HZMA 5F72S 3RZCD 1T0NA 1IC1A 4Y5VC 3EOBA 3GSNH 3AXLB 4HKZB 3S35L 4PTUA 3GSWA 2V5MA 1F42A 1ZLWH 5E5UB 4BFIB 4KZEL 5GGVH 4GBXD 4F58H 2QBWA 1K3ZA 4G42A 4IRZL 2BFVL 3N9GL 3VMPA 2C3VA 1XCQA 2NY3B 4P3CH 1MI5A 3AY4A 3DMMD 2Z8SA 4O5LH 3L3HB 4ETQB 2MFNA 3O2DA 4TSCH 1KB5L 5DR5H 5F6HI 1DTUA 2PW1B 4ZUVA 4KKNA 4NQDE 4LNRA 5FDWB 1V3LA 1PSKH 3TCXA 1S7QB 4EZMA 2ZSWA 5F3BB 1G6RH 2GIYA 4NDMA 5BZDA 2JK5A 2CXKA 4KVNH 2KPNA 4G9DB 1CXKA 1TJIH 4M7LH 1I8LA 1WV7T 3FO1A 3TC9A 4LRIA 2Y36H 5DFWH 1IGIH 2UYLA 2JCCF 3O9WB 2HT3C 3JSSA 4ZXBD 5C0IB 3F6LA 4Y4HA 3QXVA 5DJAB 4JFZL 4D9LH 3TZVB 2VLRD 3QIUC 4KJPC 1WZKA 3VXTB 3WIHL 3EYUH 5FYJE 4FQHB 3TIDA 4WFHE 3H7BB 1YJDL 5EWIH 2DJSA 2QQQA 1QHPA 3MV7D 4RZCA 4G7VL 4U1LB 1E6JL 4O00A 43CAA 3FFCB 1UH2A 4Z7UF 2BNQD 4XP4L 4PJ9D 5DHVA 2AXFB 3HNSL 3CZJA 1T04B 3LD8C 2E6QA 1R3LA 1VESA 3EYQD 1IC7H 3UBXG 3HAEH 1JNHB 1I75A 3MRFA 1I3UA 5IMOA 4AK1A 5EU6E 3M07A 1T3FB 1FSKC 3CLFL 3SY0B 5IJVA 1N2RA 5IVXB 1OL0A 4MAYD 2ENSA 3VH8G 2QL1A 2WWMC 1P7QB 2XPGB 1ORQA 1NEZA 2VLKD 1RJLA 3CXHK 1OGAA 1R5IA 4P46A 3ARGD 1MQKH 2VMFA 2EYSA 3C6LA 2WIIB 4LCWB 2P5EA 4I8DA 4GS7B 5J57B 4U1JA 3RTQA 4K23H 2IFFL 4FTVB 5ACZA 1U93A 4WFED 3RBGA 1YEDB 4DZ8A 3RI5K 1MAML 4KI1A 1OAUL 3KLAA 4YZFF 2AV1A 5HGBB 5B3JE 4KU1A 4LLAA 5IFAH 5IK3A 4PJGF 4J6RL 1W0WA 4UI2A 1BWWA 3WIIL 4R7DA 4JY6B 1TDQA 2NY3C 4LSQL 3ARXA 5DK2A 1MAJA 2AABL 3JVGC 3UYRH 2JJVA 3C5ZC 3S36L 5L0QB 2BXZA 3I3EA 5SWQB 1RIHL 4ERSH 4AEEA 3SPVA 2DWDA 2E8ZA 1D3CA 1NFDE 3RWFB 4MD4B 3T4AB 1WC7B 3FQUA 4QRRD 5HYSB 1T2JA 2B20A 4OLEA 3TVMA 2NY7L 4D9RE 1J5OL 4P9ML 1NUGA 4FXGA 5EZLB 1FZJB 4ISVA 1YEGL 5IOPA 4QHUA 5JXEA 1FG2B 4N5UA 5ICXA 2X7LA 3QJFA 2BY2A 4XNQA 4XNMB 3AGVA 1JF5A 2OSLB 1EXUA 4TQEH 1JYNA 4NQXB 3TZVC 1SBSL 1Y18A 4HMEA 3IF1A 4I3GA 5K9OA 1UM5H 1XF4B 5CKGA 5T1KB 1IM9D 4OB5L 4P99A 1HZHH 1H0DB 3REWB 4YHIB 3T0EE 4MNQB 1B4RA 1RIUL 4BZYA 1E4KA 3I50H 5ABDE 3CFIC 1QR1A 4OF0A 2OZ4H 4CDHA 1OAQL 4AMKL 2DQEL 1MFEL 2FX9H 1H8NA 5DTFB 4APQA 1FL3A 3DROA 3QUXA 4HCRA 4XHJD 4NP4H 4Z9KB 3MLWH 3BVNA 5CBAB 3DVGB 3HG1B 4LSPH 4OCRL 4UILH 1J05B 3FT3A 1ZLVK 4HIJB 2VERN 4JJ5B 5JHLH 4AIZB 1H3TA 2NY0B 1QFPA 2J88L 5JW3L 5INCA 3TBTB 3IU3B 1I8KB 3TPUB 4OBRA 1FE8L 2H1PL 5DUBA 1ZLWK 3ARZA 4LLMB 3ET9F 4NQED 1INDL 2AQ3A 3B9VA 1UZ6F 1SM3L 1YC8A 2H8PB 4X9IA 5KSUB 4YPJA 4JVWA 4OM0H 1WEJL 3FCTA 2VQUA 4I0PB 4MHHI 4PB0H 4PY8J 3BEVB 2HT2D 3LQMA 3H9SB 2HKFL 3OR6A 3HCVA 4ODUA 4PG9A 3VRJB 2Q76A 4QWWD 1I1YA 4M1GH 4EI5D 2VL5A 3KXFA 1J0YA 5C0CA 3TH4T 2FR4B 3ZE0E 4P5MB 5HGDA 3U48A 5DVKA 1JGEA 2DBLH 1LD9A 5L6YH 1GGIH 1ZHKA 2EE9A 4F7CA 5GS0D 1UENA 5HYQA 2AQ1A 4NC0B 4JAMA 1GSMA 2WWKO 2R2EA 4ALAL 1KLGA 3AM8A 2E3VA 1RZ7L 3NH7H 5E7FA 4JFPA 4XCEA 4FQXB 3R06B 4U6VL 5D8JH 5C09A 2FGWL 3GK8H 2V5YA 2YR3A 3IJYB 1G9MH 1LDPL 4UV4L 5F8QC 2XRAL 4ONFH 4C54A 3MLPA 2HTKC 2VXTH 2CGRL 2NX5E 1NLBL 4NZJA 3QWRA 2ZCLH 2Q7YB 1OY3B 3ECBA 3S3JA 4U0RB 4MS8D 4ORZC 4PRAA 2WANA 4K7PH 3ESUF 4JO4L 4O9HL 1A9BA 3GSNA 2X42A 3NCBB 1OAZH 1C1EL 1U92A 5H94A 1UH3A 1U8NB 3MCLL 3RKDD 4N1EA 4X0KB 4MJIA 2YPLB 1G9NL 3RVWC 2P47B 3T04D 2QEJA 2RB8A 3LEVH 5K9JH 3GIVA 3FO2B 4NNYB 1A3RH 1PJ9A 1DVFD 2ZUQB 4ZFOL 1JWSA 4NO5B 4UOJA 3A0OA 5IG7A 1UCTA 1HWHB 5KS9F 1P4IH 1WJ3A 3WS3B 3EJZC 1TJHL 2Q7NA 1HHKB 1YMMB 2CUIA 3Q2CA 5F7KC 4ZAKC 4A2MA 1Q72L 3HLAB 1ZLUH 3MACL 3M1BB 5JOFA 3PG2A 2WBKA 5F9WC 2RAMA 1DE4B 3F7VA 3BN9D 4Q9RL 1LE5A 2NY0C 1KYOK 4OZHE 4BSJA 1G7QA 4Z76B 5IFJB 5J1SC 2CDEB 3NZ8A 2X70B 4YPGB 1KBGL 4JB9L 2Q6WA 1BX2B 2HTLC 4FQJH 5DUMH 2APBA 2XG5A 4OD1H 1CLYL 3F58L 4NOFA 4X9FA 2GYSA 4X6CF 3BPLB 1WT5A 3V6OC 4L9DA 4ZFZB 2DKSA 5ICYA 4G6FD 4J3XA 4PJEF 5T33H 1B2WH 2QQKL 3MRBA 4FA8A 1X5ZA 4RMVA 1JZ7A 1BD2B 2EH8H 4GRLA 1U36A 5I9QB 2FRGP 4I48A 4I77L 4O2EA 6CGTA 1LK2A 1CDIA 3FQWB 3ZYZA 1MCFA 5ANMB 5ID1A 4MJ6B 4ODVH 3HAEA 2ICEA 2FO1A 5BJTB 4R4FH 1IL1B 1WBZA 1OTSC 5F7DB 5EU7E 1I4FA 1QYGL 4LLYB 5B3NA 4PJIF 4WHTB 2OJEA 3MLRH 1EO5A 5CJXA 5T3XD 1FP5A 4K8RC 4W6YB 4IRSB 3RWEA 3FQNA 4ZPVB 3ZTJH 4FQXC 3QEHB 3OX8B 3P9MA 1SMOA 2VDKL 2CRZA 5DJDA 3FFDA 5LAXB 3SDAB 3PXHA 3MCG1 3IJSB 1OM3L 5ENWA 3PE9A 1J1OL 2Q8AH 1T1XA 2FB4L 4HV8B 3LIZL 4JFFA 4AL8H 1DN0A 1Q1JH 5ILTH 5I66A 3DSFH 4U0RC 1XGPA 5GGUA 4GUPB 3SQBA 2DD8L 3FTGB 4RBPH 5AYUH 5LVEA 1JF1A 2A6IB 4XVTL 1FNEB 4YXLH 1AI1L 5CHNA 2XKSA 2DLIA 4XBPB 4DAGH 2GFBA 1NCNA 3KYOB 1MIML 4CVUA 1RK0A 1F4YH 1AC0A 3DYMA 3FJTA 5GISL 2BNRD 4Y4FA 2ZUQC 5IF0B 5I73B 4OCWH 1RIVH 4WEUD 2ATKB 4O2FA 3PHOA 4HKJA 2AXGB 2O5ZL 4DVBB 4RISL 4S10A 1FFRA 4HGMA 3QQ9C 2ICWA 4EIZC 4L3EB 1OAYL 4TSAH 1KN4L 5L9DH 1BBJA 5D7JB 1BFOA 4C59B 1KLUB 1I9JH 5I0ZA 4IIQA 4LPTA 4NRYB 4XBEL 3BAEH 3PGFH 2VTFA 4PJDB 5IB5A 3JWDH 5C6WH 1RZFH 4ZD3L 1NL0H 1GL4B 2J3SA 5DC4B 4Y5XB 4Z7UB 3BPLC 3T0DA 1V05A 4GRWE 1SVCP 3BIKA 5F8RC 3WSQH 5FO9B 3IAQA 4D0CB 2VE6B 1JFQL 4PLKC 1IT9L 4ODTL 4DGVH 1NCCH 5I9QC 5LXGL 3IGAA 2ZCKH 4WTZG 2EDTA 3C6SA 3WL9B 2OZ4A 3OKMB 3TT3L 3HFML 2LFGA 4NN6C 1MRFH 4ZTOL 3D3VE 1MCSA 2EZ0C 4EQ2A 2F5BL 2R29H 4LHUG 2OP4H 2XZCH 3X3FL 1ZV5A 4WHYH 3BP7A 2GKIA 4FQIL 5T1MB 3IDUA 4JY5H 4JFQA 3VMOA 5FA3A 3TGXA 4IRSC 3VGHA 5ITFB 1QSZA 4PJXB 3V5HB 4LKCA 4PRNA 4PRPE 5IHUL 1UWEH 1FVDB 2BOCB 4Y7MA 1DEEA 4ZTPL 4YDLB 3SDAC 1OTUD 4R26H 2I9TA 3QJHB 5CGMA 2H2SD 4PR5B 2DKUA 2WBJB 1X7QB 1XR8B 3O6KH 4HPYH 1FZMA 3U4BL 1G0YR 1SYSA 3G5XA 4ZS6D 1UQSB 1YZZA 3MJ7B 2YXMA 4EN3A 1FNLA 3B5HA 2IALA 4OCYL 5TQ0L 1VERA 2R0ZH 2LABA 3LEYL 1F58L 3HI1B 4YX2L 4PP2A 1YPZF 3QP3A 3BMVA 3MNZA 2AK1L 2Y06H 1IGTB 3FAXA 3UBXB 1ZLUK 1HQ4A 1F02I 3E6HA 2ITCB 5D5MB 3LN5A 2AEWA 4J4PC 3PIQA 3BUYB 5I73C 4UUJB 2CRMA 3L3OB 2Z8RA 4L3CA 5CLTA 2VXSL 2BSSA 3MLVL 3L7EB 1MCCA 4G6AC 4IMLB 4YFDB 1G0XA 3OMZA 4P23A 5D6CB 3MLTB 3RY4A 3NCJL 3MROB 4JKKA 4M7JL 4N0UA 1CK0H 1R3IH 1EZVY 3K1DA 5KJRL 1CL7H 5TDOA 5D7JC 1N6UA 2B8OT 3C60B 2IAND 1A6TA 1FRGH 3F12B 1AKJB 2MQ0A 5I30H 3QRGL 5D1XD 3GMMA 4YR6A 4OZGF 3CVHH 5DVOA 1PY9A 2NY2B 4UDTA 4Y5XC 2UZXB 4LAQL 4HUXA 1T83C 4Y2DB 1KTKE 5I1IH 5HY9B 3SDYH 1EVUA 4OZIA 3SE3A 5E8OB 1A1MB 1UZ8B 4PFEA 5D72H 4TNWK 3VWJD 1N5YL 1QOKA 3EO0B 3LN4B 5GRUH 5D1ZA 2J4WH 3B83A 1RJZA 2AKRA 1H8SA 1EHNA 1LWRA 3ALWA 1CICA 2VQTA 4KV5F 4IHOB 4JG0H 2HT4D 3O6FB 1UKQA 2OTUA 2EDDA 4XX1G 1M71B 4V1DA 3SE9H 2OTWB 4JHZA 3ABZA 4JHWH 4G43B 5EO1A 3TYFA 4Q74A 2YD8A 3ULUL 4WUUE 5LBSL 4YDLC 3UC0H 4RBPK 1JNNL 3BZFA 5IVXE 4P2RD 2WBJC 4GMSH 5EBWA 5HI5D 2VUOA 5AG8A 3LPGA 2VXQH 5DMGC 4JANA 2VLMD 1VPOH 3TBVA 2N7AA 3DV4A 5DRNB 3MV9B 4NNPL 4XCYB 3REVA 3QDJA 4Z7WA 3GM8A 1FL6B 2PF6A 4G6MH 4TUOA 1NC4A 1MJJA 5TF1L 1I1AA 3MOQA 4FNLH 1PGRB 3W0WB 4NQSA 1N3NB 3KPSB 3K4ZA 5HHME 1AGFB 1T7ZA 3MRLB 4FFWD 1FNAA 6FABL 2D03H 3BQUC 3VDBA 3P0GB 3HC3H 2HFTA 4JRYA 3RL2B 1N5AB 3CFCL 3MLUL 5D7KD 4QOKB 1P1ZA 4I0CC 1RUAH 3BKML 1ZS8A 5JR1H 2F74A 4F3FB 3T1FB 4G9FA 3UJTL 3VJ6A 2A9MH 4Y0GA 2MHAB 5D7IB 5IQ7H 1PG7X 4IMKC 5DEGA 4G6KH 1ONQA 5ESAA 3PP4H 3K8MA 1RUPL 4LK4A 3MNWA 4P46D 1ZTXH 5B38G 3TBWB 3T1WA 4HIHA 3VXSA 3C6LD 1BVLB 4Y4KB 5K59E 1I8IB 2P5ED 2AK4E 1F4AA 3ULSB 2NY2C 2Z91B 5C08D 2F58H 1Z5LB 4K8RL 5FV2A 3RTQD 4Y2DC 4UBDD 2ILLA 3LKSB 3MFFB 1YECL 3VFTA 3SQOL 5J89A 1A3QA 4WW2F 3V5DB 4FS0A 2XXMB 5KS9B 2CD0A 3V8CA 2DWEB 3QHFH 3BDYH 1A0QL 3BRGC 5I2IA 4JDTL 1X5AA 3L1OH 1YY9C 3QYCA 5CSBA 1KJVB 1HE7A 1LVEA 2XKNB 2NY4B 3WLBA 2BOBB 1Q9OB 1YEIL 1QLRB 3F8UB 4U1KA 4IOFD 1YEFH 1GGBH 2IF7A 2NNAA 3O6FC 2AJYL 4ZUUB 1M7DA 3BESR 4KPHH 1CFBA 2DQCL 4WFGD 1X6LA 5KZCB 5DXWA 4HLZH 3ULUE 3OJMB 1D5XA 2VR9A 4GQPH 2BRRH 3KWWB 4UQ3B 1KCRL 1Q38A 3AREA 1G7LA 5JPMA 2WAHA 3HMXL 1W72B 4F57H 1FZOA 3HG1E 1QSFA 1CLOL 2R1XA 4WWKA 4OM1H 4LLDA 1MFNA 2EC9T 5EOQL 4HJ0C 1KJ2L 1RURL 1N26A 3BP4A 2NTFB 2YD5A 1CF8H 1VGKA 3U83A 2IBBA 1KCKA 1MJ7L 3I75A 1WCQA 4HWBH 4YHZH 4DN3H 1T21A 4JREB 5GS1A 4PV9A 2VDQL 3GMRB 1Q0XH 5EUOA 2PNDA 3QWOB 5E1AB 1FJ1A 1JRHH 4CGTA 3AS1A 5FKPB 2ZOKB 4JFDB 4NFBA 2AJSL 5F7EH 4JM4L 5EIIA 5CD3B 4APQD 3H9SE 1BF2A 5LQBL 5IJKC 8FABB 5C9JA 1ZHBA 2O5YL 3MFGB 3NGBC 3RPIA 3QQ4A 3FT2B 2EEBA 2P5WB 2CKBH 5JORB 4KTEL 5DJZA 4PS4L 4YNYA 3V0AC 1CXFA 15C8H 1AFVH 1F2XK 1FNSL 1PQZA 2R0WH 3OHXA 2BRQA 1A7QL 1RU9L 2I27N 4L4TB 1L0YA 2DQJH 4Y4KC 1MHEA 1NSNH 1EGJH 5DZOA 2ICES 3N1FC 4U2YA 1UB6B 4NBZB 3NCEB 5AAMA 5I16B 2W9DH 1S9XA 2YA2A 3ZDYF 1NMCB 1BHGA 4HUWA 2XWTA 2H3NB 5EZJA 2FJHA 4F2MB 1FH5H 2XT1B 1YY8A 3ZTNL 1XGUA 4IRJB 1SYVB 3BPNB 3KGRA 2DQFB 3KXFD 2NY4C 5ITBL 3FHQA 5K9QG 5C0CD 5FYJH 1GZQB 4X6DA 1A02N 3I9GH 3W5NA 5IWLC 2XZAL 5MEQB 5I8EA 4QY8B 4NZUL 1AGEB 2COQA 4K71C 4IOIA 4PRDB 5I1LA 1HQRB 1OCWH 4NQVA 5DJXB 5JDSA 1DSFL 1JHKL 2ARJQ 5A2KH 1NJ9B 2CLZA 2BVOB 4X9BA 2R4RH 5C09D 4LHJB 1YMME 5HHPB 4YXHH 2G5BB 5E94A 1A22B 4LF3B 2X4RB 4NYLA 1NC2D 1U58B 2D7TL 2YK1L 4I18A 3ZLQC 3CVHA 3L6FA 3QWRD 2YUVA 2FO4B 4I3SL 2MPAL 4PRID 25C8H 1VEMA 3DGGB 2OTPA 2H41A 4NNXB 4HIEB 2B1AL 2Y25A 3ORJA 4OKVB 5EO9B 4C83A 1AQDB 3RIAK 4V2BA 4KVCL 4N8PA 5HDOA 5CJOL 1A21A 2GK0B 4MJID 4Y8AA 4BH8A 3DV6B 3S35H 3RVTD 2ED8A 3GSRB 3BJLA 3MJ8A 5DWUL 4KZEH 4F7PA 4F9PC 2UWEF 1CD1B 3PWNA 2BFVH 1CYGA 1D5BA 4TOYL 3N9GH 2RCSL 1V7NL 3U0PA 1CZ8L 3DVNA 1X4YA 4JN2B 3GSVA 5ANME 1KB5H 3QEUB 3NCMA 4ZUTA 2SEBB 2XWBB 2L7UA 4ZPTA 1C08A 4TVPD 1E4WL 2CSPA 4Y1AB 2Y72A 1EJOL 5ETUA 4XB7A 2OL3B 5C0BE 1FNGB 3ROLB 2DRUA 4NKMB 4H25A 1URLA 3R4DA 2WUBL 4E5XB 3C9NA 3DO3A 1S9VA 4Z7OE 2ZWLT 4JHAL 4MNGB 2EDXA 5F7YC 3GO1L 5DUPL 2ZUVA 3JXAA 3EHBC 2GJ6B 1WBYB 3GGWA 2Q86A 4JFZH 4HSQA 1Q94B 4GRLD 3WN5B 1XGTA 4NO0B 2DM3A 3WIHH 3O3BB 1MFBH 1B0RB 2IPKB 3V6ZA 4IRJC 1NBQA 4LCYA 1BOGA 1IAIL 1QFWM 1YJDH 4LHUB 5DHXB 3BPNC 1L6XA 3ZKMD 1K3IA 3LQAC 4G7VH 1IZKA 4MCYA 1E6JH 3INUL 3WIFB 1QFWI 3B9AA 4HG4K 3HNSH 3L3GA 4LCCB 1GCFA 4ODSL 5BRZB 3SDCA 4C56B 1E27B 1F00I 5INDA 2QQLH 1D6EA 5EG6C 3FN0L 3X12B 4OLUL 3SDXF 3CLFH 3C2AL 5MENB 4PJ8B 1ZT1B 1IQDB 1A4KA 2JCCE 3T3MF 3EZJB 5KSBF 2EYTB 2E8YA 4JFFD 3MOBL 1IGML 3BN3B 3RDTB 1CLZL 3NPSB 4M1DL 4LLVA 1JP5A 4N8CL 2HVKB 3CZFA 5HHOA 4ZFGL 2PCPA 1PZ5B 4O51B 3MYZA 3D9AL 3QDME 4PJDE 4Z7VB 3W9EA 2A38A 2IFFH 4M61B 3CD4A 3RPKA 3A6CL 3VFRB 1VACB 3GMPA 4Z7UE 5DJ6A 2BY1A 3EYOB 1KG0B 3T4YA 1F8TL 1MAMH 2J12B 3IDXL 4K3EL 4PJBB 5B8CB 4DW2H 1T7YA 2DIAA 2A6JA 4DN4L 4J6RH 3WIIH 4ZSOA 4JDVB 4LSQH 3U7YL 2D7OA 1JVKA 2GCYB 2AABH 4P48A 3S36H 5EPMA 3KPMA 3H9HB 2EXYC 4MLIA 3GMNB 3UPAA 1RIHH 4WJ5A 2VAAB 3MJGX 5BS0A 1BZ7A 4YGVB 1GGCL 1IJ9A 3CFDB 3KAAA 3V7AE 3IYLW 3IJHA 3MRJA 2NY7H 5IBTL 1DBJL 1XF3B 1J5OH 5DURD 4P9MH 2H9GB 4LKXB 3MXVL 3OAUL 4Y88A 4PJXE 3VFNA 2A9NL 1YEGH 4MZ2A 5IEHB 2V2XB 3IXAA 1OGTB 5C8JA 2DS4A 3I6GB 4HWBA 3PABB 4P49A 1AIFB 3OKNB 3LPFA 1U41A 3EDFA 1JBJA 3UDWC 4YZFE 3WN5C 1EEYA 1SBSH 2GEEA 4PJGE 5CJ8A 3L3DA 2CIKA 1DCLA 1SEBA 1I7UA 5TDNB 5JQ6L 4OB5H 1X5YA 2AXHA 4NKIL 3PDOA 4NRZA 2F8VA 3TBSB 3VFWA 1F4HA 3KNBA 1MLBA 2NR6C 4EIGB 5B4MD 2VR4A 1RIUH 4LCCC 4HJJL 1AXSA 1AXTH 1OAQH 3DPBA 4AMKH 2DQEH 2CKBA 5CSZB 1MFEH 3D85D 5D5ME 3OKKB 1JV5A 5H35A 2XTJD 1WIOA 3UPCA 2A73B 1VFAA 3DSNA 4G8EB 2I5YL 4KI5D 4L8DB 4OCRH 4PJ8C 1DQQB 4O2CB 1D5IL 4NQDA 3TBYA 2FJFB 3PWUA 3FT4B 4LP5A 4D0BB 1XF5A 2J88H 1AD0B 4OUOA 5JW3H 1CVRA 1KPVA 4K07A 3FRPG 1VB9A 4WEBL 4G5ZL 5D6DA 1EGJA 1UXWB 3CFBB 4P57A 3NPSC 5DMKB 3K7UA 1YUHB 1FE8H 4EN3D 2H1PH 2H45A 2IH1A 1A6PA 5HHVL 5D7LB 3WD5L 5IM7A 4PYGA 1R6VA 3TO2B 1INDH 3H0TB 1PD6A 1SM3H 3CPLB 1C5CL 5BVJA 5GRZA 3T2QA 3ULVF 3LEXB 5B8CC 1JZ2A 4ODWA 4W4OA 4YC2C 2HKFH 5LCVL 3MGAA 4OZIF 4GXUN 1GAFL 5E5MA 1KV3A 1T80A 2NXZB 4MCZB 5D2LF 4R96A 3WE6B 5DD3L 2H26B 5HHXL 4F33A 1XGYL 4WHCA 4U6HA 4PJ5E 5JXAL 2QSCL 1KC5L 5E1HB 5B38B 3NIDF 5EU6A 4ALAH 4PRHB 3H3KA 3U9UB 1RZ7H 4QRPE 1IGJA 4I9WD 2FCBA 4B41A 4U6VH 5MEOB 2FGWH 3VFUA 5GIRB 3HZYB 2B1HL 1A2YB 1A6WL 4LLQB 4UV4H 4PV8A 2XRAH 4R9HA 1UZ6E 4UDUB 4M6OL 3P4NA 4DOHE 4TUJA 2CGRH 3U4EB 1NLBH 5FKAB 2WLZA 4LEOB 3HE6A 4QF1B 4MJ5B 1WIPA 4UNUA 2W07A 3AMKA 1LEGB 4HH9B 4JO4H 3BGMA 4JN1L 4O9HH 1NUNB 1NGWB 4XXCC 1C1EH 1JHTA 5DRWA 4HGKC 3MCLH 3EKCA 1FYTE 5D1ZD 4AEIL 4DCQB 5LGHL 3U46B 5DVMA 4OGAD 2QADD 1CICD 4RFEA 3W0WE 1G9NH 5DEFB 1EEQA 3KPSE 3QG7L 4JO2L 1XIWA 4M7ZB 1B4JL 4YDKL 1KB5A 2DJ4A 1BFVL 3EO1A 1U8IB 1BJ1H 3K3QA 3BZEB 1TJHH 1OQOA 4QYOA 1JNLL 1Q0YL 3UTSB 1JL8A 2O61B 1Q72H 3OKEA 4TNWF 3EYVA 3MACH 1YEKL 2DYPA 4NM4L 1JGDB 2JJSC 4JRWA 4YHKL 4AM0A 3GJEA 4Q9RH 4KKLC 5DQJB 5JIHA 1T1YA 3U4AA 1NFDA 5K9QI 2LV4A 1U8MA 3G5ZB 1HIML 3ARTA 3VI4F 4Y16C 1U3HA 4W6WB 2FWOA 3P11L 4MXQC 3Q1SL 4PBXA 2Z8WC 4J3OC 1KBGH 4JB9H 1ED3A 3TPKA 3CLEL 3QDJD 1CLYH 3EGSA 1RAMA 3F58H 3ZT5A 1NC4D 5IVZA 2OXHA 5EIVA 1I1AD 2YHGA 3M17B 4UV7L 1P4BL 3WIHA 1TTUA 1BQHG 3O9WD 3V6FA 5C0FB 1TENA 1CFTA 3SKNB 1T1ZB 2QQKH 3GJFK 5EULV 4PJHB 4GRWH 2KKQA 2P49B 4HWZB 3WHE0 1PYWB 1MLCB 2J6EL 5DRXA 4JRYD 1RD6A 1EVTC 5J6HA 5HI3D 5DO2C 5KS9E 4I77H 4LSTL 4F15C 1IAKA 2NXZC 2W0FB 1U8JB 3T0EA 1YN7A 4G9FD 5CEXA 1QTYT 3VGDA 4QXTB 2AJUL 2LVEA 3H7LA 3X3GL 2A83B 4FQCL 1QYGH 1TNNA 2EE6A 4P2OB 3LQAL 3LRSB 4GKNB 1LILA 3H6JA 2F9BT 2F53B 3IU4L 1NLDL 3RWDB 3MRCA 3VI3F 4GAYA 4M4PA 4CMMA 3DXAB 2VDKH 4Y89A 3S8WA 3KLSA 3QULB 1PFCA 4EI6A 4F9LA 4X6CE 3F7YB 1OM3H 1AGCA 5I0DA 3P4LA 1J1OH 4WV1B 2FB4H 3LIZH 3GSQB 4PJEE 3QR2A 1E4XL 2YPKA 4AENB 4GOSA 4UIMA 5ID0B 5EC2B 1FFNB 1CS6A 3OKDB 2YKLL 2DD8H 4KKBC 1UCBL 4QTHB 5FYKD 4XVTH 5IV2A 3C09B 1AI1H 2IC2A 3CMOL 3OKYA 1R24B 2JE8A 3LDBB 1MNUL 3RIFK 4D9QE 1R0AL 4PGBB 5DHYA 4MDIA 1MIMH 1NMAL 4KJQC 3QUKA 5IGXL 2IPUG 4NO2A 4AT6B 4PJIE 5GISH 2E9BA 1RK1A 1PG7W 3RVVC 4KFZC 5C0DB 5EDXA 5I17A 4JFDE 4D94A 4Y5YA 3UTTB 3WV0A 4MNHA 1F2QA 4A6YL 2O5ZH 1MHPL 4RISH 1S7UA 1TVHB 4I4WA 5E99L 2AP2A 4MA1C 3T0AA 3WEXB 4ORGA 1T1WB 4NO3A 5KAQF 4HUVA 4H0IA 5BXFB 1QSFD 2ZUTA 1KN4H 3LV3A 4J1UB 1CFSA 1Y0LA 1G0DA 4L4VB 4CNIB 4XBEH 3DX7A 3SGJC 1HN1A 4G80A 4NUJA 5MERA 5DMIL 1WBXA 3BT2L 4ZD3H 5FF6A 4QNPE 1TQCC 4U31A 2NX5A 4OZFB 1QLFA 2OL3L 5ESQA 1U6AL 1JFQH 1FC2D 1IT9H 1PKOA 4ODTH 1CGTA 3KYMB 4K7FB 2Z31A 3ARFA 3SKJL 5I1HL 2M2DA 3PGCB 3CFEB 3Q6FA 5F93C 5LXGH 1ODAA 4GBXB 3IDMB 4RFOL 4JM2D 1G7HA 4JPVL 1BVZA 3TT3H 2VKWA 2W60A 3HFMH 5T1KD 3B5GA 4ZTOH 5F89B 2F5BH 3GRWL 3X3FH 3KYNA 5DSCB 4FQIH 4ZQKB 4FXKA 4P2OC 2X9WA 4WHDA 4QHNB 3F7RA 3T2PA 4X6DF 4MQXD 3OF6A 3FOLB 2EDFA 4N5EC 2JIXA 2EDBA 1WWAX 4OQTL 2AI0L 5IHUH 1JF6A 4ZTPH 1U8KB 3A67L 4MZ3A 2D7QA 4D8PB 4PPTA 4OZHA 4PG2A 5E9DB 1QUNA 5GPRA 4WV1C 1KJMB 3MRNA 2WUCL 3FB6A 3U4BH 4HULB 2FD6L 4UTBL 5J12B 2H32H 3G08A 4ZXBB 2ZPKL 3KHQA 2J5LB 5FOBB 4UOW0 4JCLA 5I15L 4OCYH 3STZB 5TQ0H 4R0LA 1T0MB 5D1QD 1TCRB 1TLKA 3LEYH 1F58H 1AO7D 2Y4SA 4YX2H 3C09C 3MRKB 4P5KA 3WMSA 1P9MC 2VZ3A 4YIQA 2AK1H 4WUKL 2DMKA 1HYRC 3LDBC 3MV7B 2XA3A 5CWSA 4MD0B 2D31A 2BNQB 4PJ9B 1HHGB 4Z0XB 1TITA 4HS8L 3SE4C 1QFUL 1W0VB 2HMID 2VXSH 3BWAA 3MLVH 2DAVA 4Q9CA 4LSSL 3RY6A 5I1AB 4R3SA 4WW1A 3MRDB 4GW4B 3NCJH 1FZKA 5DZNA 4M7JH 5CP7A 4LPXA 5KJRH 2HG5A 1A5FL 4NN7B 4MAYB 1F13A 2X40A 4FQQA 4POZD 5CGYD 3DUUB 2W9EL 1MCHA 2QKIA 4OIIH 5B39G 2VLKB 1HHIA 3QRGH 3QPQD 1UB5A 1NCUA 3G04B 3RWIB 3ARGB 5E7BA 2X9YA 5I8OH 1EEZB 1EHLL 1QFWL 1GYAA 1YPZE 1S78D 3MLSL 4LAQH 5AUMA 3IS0X 4B53A 2IBZX 4PRBB 3MR9A 3HPLB 4LOUC 3GHBL 2WBWB 4MNGE 4U0QB 1EV2E 4L8SB 1F3JB 4L9LB 3RWHB 3RZCC 1X9QA 3SGEH 3TO4A 1N5YH 4OV5B 3ILQD 2P24A 1C5DB 4KK9D 4GBXC 3BPCB 2EDOA 2CO6B 4XNXL 5DJ2A 4LCIL 1XH3A 5F1IB 1LEKA 3AMLA 3DMMC 1CDUA 5A3ID 1BFSA 4Y5VA 5MEPB 3QI9D 4M6AA 4KK5D 3RIAF 2FEDD 4AIXA 2Y6SC 1IQWL 2XFXB 4FQ2L 2J8UF 2OCFD 4KTDL 1A6AA 2F54E 3L5WA 4UZGA 2NY5C 4PJAF 4QRRB 2HFFA 4OZGE 4GW5A 5LBSH 1ZA6B 5CD5D 5FB8A 3QA3A 2VSDA 3IKCB 1JNNH 4KAQL 2ADJB 1T22A 1L7TL 2QSTA 3B9KA 5HI4D 1CG9B 5D4QA 5J12C 4YE4L 3TA3D 4ZXBC 4HS6A 2J5LC 1AGBA 3DOSA 3AU1B 2P4AB 3SCMD 4NNPH 3P77A 2VL4A 4GG6F 5TF1H 3TIEA 5JMOC 3I2CL 1M6OB 4Z7VE 4KV5E 2P8MB 3THML 1S7VB 4JPIB 6FABH 2X4TB 4PJ9C 5HPMB 3WNOA 3RX7A 3SDCD 3QIUA 3FB5A 3CFCH 3MLUH 5BW7C 3EYQC 3D3VA 1KPRA 3BKMH 5DK0A 1TPXB 1N0XL 1G7MB 1ES0B 2BCKB 3BIAX 3E6FB 3UJTH 5HHNA 3CDFA 4MB3A 3VCLB 4DQOL 3RA7L 1KENL 1JTTA 3HTLX 5A2FA 2X4QA 3FHAA 4NN7C 4MAYC 4YHPB 4S1DD 5D70H 1RJYB 5DD6B 5L2JA 1RUPH 2CJUL 4PRPA 4UNTA 5DDHB 2K9UA 3TCLB 2NQCA 4XH2B 3VXPB 5JW4Q 5E8EB 1FGNL 3ARGC 1HDMB 1NEZG 2YA1A 4K8RH 4BSWA 4OFYD 3RL1B 3CDGA 5EU3A 3ARBA 2D9CA 1RZIA 1YECH 4NQEB 5E2UL 3SQOH 1TJGL 4L8SC 4L9LC 3S3SA 3MBEA 1ZHNA 2CRYA 3FAWA 2JB6A 1R3KB 1XEDA 3L7FB 1JPFA 5JHDE 1VFMA 1BGXL 2VIRB 4JDTH 4MDJA 1DUYB 1TCMA 5DQ9A 3IVKB 2YWZA 3ARWA 4EI5B 1YEIH 1FFPB 1TTGA 4K94C 2YZ1A 2NY6D 4K9EL 4XX1E 1VGEL 2AJYH 4MJ4A 5J0BA 4PGCA 1A64A 1KIRB 2J1KA 4BFIA 2DQCH 1NCWL 4RGOL 1C12A 3HC0A 3JWOC 1KCRH 1CDCA 4KUZL 1A1NB 4ETQA 4QRQB 5JIPA 1GIGL 5MHSE 3C5ZA 3B2UD 3HMXH 4YBLB 3MOAL 2G9HB 1CLOH 4L3ED 1CD8A 4OCLC 5FDWA 5EOQH 3RWJB 4QXWA 4M3KB 1RURH 5E95B 2KZWA 3UTPE 2CXGA 5IROC 3IDGA 4ZUWB 1OWWA 5D9SA 3GMLA 1MJ7H 5EC1B 2GUOB 4O02L 2ARJA 2VDQH 4PREA 2AEQL 1YEJL 2CK0L 5IHZA 3OTTA 5C0IA 4CVWA 2C7UB 1J8HE 2R39A 2AJSH 4JM4H 4X7TA 3TZVA 5HDBE 5EU5B 2MKWA 3JV4A 1FLTX 2A6KB 5LQBH 5TH2A 4HUUB 1TPXC 2O5YH 5IBUG 1OSPH 4XHJC 3KDMA 3PXJA 1HSAA 3DBXA 5IVNA 4KTEH 4NQDD 3OAYH 2AXFA 4P3DA 1T04A 3ROOB 3QUML 1P6FA 5CSGA 3QG6A 1FNSH 2EDQA 4UIKL 3EDDA 4S0SD 1ZEAL 5IIEB 4EUPA 1SMAA 5CP3H 1ETZB 5SX4I 4DZBB 1A7QH 1RU9H 4WUUA 1T3FA 2HYMA 1BQHB 4HFWB 3VD5A 2H32A 5IVXA 3K81A 4ODXA 1MRDH 2BNUA 1U8LA 1DQLL 3ZE2F 3O2VL 2XPGA 2IH3A 5AYQA 4RGMB 4G6FB 1NGYA 3QXWA 1WK0A 4F7TA 5ICZA 5FYJD 4OLXL 5F7LB 3ZTNH 2HT2C 1QVOB 3C08L 2HFEB 3EDEA 3SO5A 1BEYL 3PNWA 3QXTA 3F5WA 3VXUE 3EYUL 5ITBH 1A1OA 3DRQA 4EI5C 4Z78B 1HI6B 4CBPA 3JTTB 4FG6D 4WTWA 1AJ7L 1UACL 2XZAH 1LO2L 4G7YL 4NZUH 2P42B 1HXYB 3S88L 4PLJD 5GS0C 5EU6D 1MQ8A 1CFQB 1DSFH 1JHKH 4IS6B 1FYHB 1VSCA 1U3ZA 2AAVA 3LZFL 4XXDA 4Q2ZB 2R15A 4U3CA 3RUGF 3UTSE 4YBLC 1KIPB 3MV8B 1LEIA 4U1HA 3TNNB 2R23A 3B9EA 5BZWB 5C70A 2D7TH 1KXQE 2YK1H 5IB4B 1AXIB 1G7IB 2C3GA 3DVFA 3QXAA 2AJZA 4KDTA 3ZDYE 4I3SH 3R8QA 2MPAH 3C60D 1T5WA 3RWFA 3B2VL 5EFIB 1AKJD 1IFHL 3C8KB 2AK4A 4MS8C 2E7LA 2B1AH 5IB2A 1JTPA 1A6UL 1INQA 2D2OA 1MHHB 32C2B 5EZLA 1VEPA 4X5LA 4KVCH 5CJOH 3U0TB 3K2MC 2PW2B 4X4XA 4TYUA 3BP5B 3X14A 3RKDC 3MGOB 5KSAA 3QUZA 3O3DB 1YNTA 5DWUH 5DJYA 4IDJL 1OF2A 4TOYH 2BNRB 1DVFC 1L6ZA 2BMKB 2HP4A 2RCSH 1V7NH 1CZ8H 1U8QB 4CUCA 4KMQA 3D2UA 3OQ3B 4ZOBA 3IETA 2AW2A 2OQJB 3QHZL 2A74B 2DYPD 2Y5EA 1MREL 2YUZA 4D0DB 2X9XA 3MNVB 4MQ7B 2UZYB 2PTTB 3BN9C 2VDOL 1E4WH 1AP2B 5FM8A 1EJOH 3KPRE 4X6EA 4D9RD 5MI0B 4L8BA 4JFXA 1W8NA 5TDPA 2VZOA 3DVGA 1F11A 3HG1A 1SEQL 4ZAKA 2WUBH 1J05A 4JJ5A 1D5MB 4JHAH 5J13B 4OF8A 3VXRE 4X7FC 4WNQB 1BF8A 4MWFA 2CIIB 3FQRB 3GO1H 2VITA 5DUPH 3AAZA 5CJQL 1VADA 2NY5L 3HNVL 4V2CB 5BV7B 4RGMC 3CC5A 4NQCE 1QPPA 4L29B 5BQ7B 4NKQB 2UWEE 3BFOA 1CWVA 3BO8B 3QQNA 4MB4A 4HGWB 4TQEL 5IQ9A 1IAIH 4KXZI 1Z9MA 5DMJB 1DDHA 3T0ED 3INUH 1QHOA 1QRKA 1ZVSB 2H8PA 3MRIA 1NBYB 2FL5A 1L4IA 2PN5A 1JGUH 5LWYL 4ODSH 1HOCB 3BEVA 1P7KB 1FN4B 1KCLA 3H9SA 4AH2B 3MLYL 4OLWL 5GGTL 1I3RA 3EOYG 4NZTL 3FN0H 4WEMB 2I60L 4OLUH 1BREA 2YD1A 4OQ1A 3C2AH 3N1QC 1P2CA 1J0HA 1RI8A 5H8DA 1F6LL 3UTTE 2G2RB 1OARL 1U8OB 4YO0B 4PJCF 1KLFA 1N64L 4RMSA 1OWRM 3SKOB 5GGSB 2NZ9D 3ZE0F 3MOBH 2FX8L 4K3HA 1IGMH 5DD5L 3FO9B 4UNVA 1CLZH 1LP9F 4M1DH 5GJTL 1K2DB 4YUEL 3OKLA 4N8CH 2W0KA 5K33A 3BW9B 1B90A 4HZAA 2CLRA 3IJYA 2C1OB 3D9AH 4DGIL 5J7CC 1LO3L 2Z4QB 3A6CH 4PP1D 1BVKB 1KIQA 4CN6A 1F8TH 4K3EH 3IDXH 1HH9B 4RMRA 3KLHD 3CJJA 2FATL 5ERWA 4E0RB 3OAYK 2J8UB 4QLRA 3U2SB 4DN4H 3BXNA 5DYOA 1MY7A 4OD2B 1M05B 4M93B 4TVSa 3U7YH 3SDXE 4KRNA 2MQCA 1LE9A 1G1CA 4EVNB 3VFOA 1TMCB 4YHNB 1KEML 5B39B 4P4RB 3T3ME 1BBDL 5KSBE 3HMXA 4LDEB 4NO5A 1GGCH 3GNML 2E7BA 3RIFF 4MSWA 2DLFL 4K94L 3CXDL 5MI0C 5EO0B 3WO4B 5DS8A 3G6DL 1LQSR 3ZSTA 2IANB 1YMMA 3BWUC 5IBTH 1KJ2A 4NWUL 5EB9A 4PTTA 3G6AB 4NT6B 3MA7B 3MXVH 3OAUH 5D1XB 5FGCE 3M1BA 3VW3L 3MRMB 4LQ1A 5I1CL 1IKNC 2A9NH 2ERJB 3UTZB 2NX5D 4UB0L 4PJ7B 5AZEL 3HI6L 3JWOL 4BFEA 1GGTA 1E6OL 4RFNB 4RGNE 2HLAB 3HZMB 5BV7C 1T0NB 3ARFD 3EOBB 4PTUB 2X70A 3GSWB 4EBQL 3ULVL 3VWJB 4YHML 5TPWL 4U2ZA 3D18A 3NVQA 4G42B 5FYKU 1DQDL 5JQ6H 2CDFB 2VLRE 4NKIH 1MI5B 4JKWA 3BH9A 1RPQA 4K2UH 4QGTA 4DUXA 4W68A 1S9KC 4KK8D 5L7XL 3PWLA 3OB8A 2BNQE 4ZUVB 2JF1A 2HA1A 4LNRB 4RAVA 4NPYA 2ZSWB 3OF6D 1J1XL 4NDMB 5BZDB 2V6HA 5ANMA 2I5YH 4ZOCA 3H2WA 4OCSL 5EOTB 4ESKA 5CP3A 2P5WD 4J3VA 2YD7A 1IL1A 3D25A 1I9IL 3ARYA 3UZQA 3RP1A 4LLYA 2EXWD 1OTUC 4MA3B 5IW6A 2UYLB 4WEBH 5C0BA 3ZZ1A 4G5ZH 2H2SC 4CVXA 4P2RB 4XGZA 4GAJL 1KCSL 1S5IL 4Y4HB 4ZS6C 2V5SA 3OX8A 1NANH 3WD5H 3ZKND 2FEEL 3K4DA 3SDAA 2HJFB 3TIDB 4OD1L 3VD7A 3SN6N 2ZG3A 1C5CH 1KF9B 2BVQA 4XNYL 4JFHE 1BQLL 2P48B 3GMQA 4GG8A 4FQ1L 1J0ZA 3K1KC 3IXTB 4XPBL 5DHVB 2VAJA 5T33L 4AG4L 2FBJL 5LCVH 2DQGL 3FTGA 1GAFH 4C4KO 3RJQB 4ETYA 5DD3H 5IMOB 2FLRT 5HHXH 1XGYH 5H37G 2IMNA 4OCNC 5JXAH 5IJVB 1N2RB 2QSCH 1KC5H 3I6LE 3U30C 2VOTA 4PGJA 4IDLA 4J4PA 1J1PL 1CCZA 2ATKA 3T0XA 1ORQB 3WO4C 1NEZB 4MXWL 1RJLB 4P46B 1IMHC 3KPPB 1RZKC 5D1XC 2JCCA 2EYSB 2B1HH 3C6LB 1A6WH 3O81A 3MBXL 2ERJC 3QO1A 1DLFL 3EYSL 5GS0L 2P5EB 5GXBB 3ZHDA 5IB3A 4M6OH 4U1JB 1JIBA 1PKQE 3RTQB 3ULVE 5ADPL 5ACZB 1U93B 4NUGL 4LMQI 3RX5A 4DZ8B 3KHOA 3MZTA 5SWZE 3F65A 2PXYA 1M7XA 4AYFA 3KLAB 2WW8A 4JN1H 3QDMA 4PJDA 3VWJC 5GQBA 1U8HA 4J3SA 1EUTA 3HN3A 4Z7UA 1P4LA 1W0WB 4AEIH 4R7DB 5D2LE 1S7RA 5LGHH 3PWPE 1ZVYA 1U95A 3AVEA 4CW1A 3AY4C 5GRWA 2L7JA 1GZPA 4JO2H 3QG7H 1B4JH 2HT4C 4YDKH 3NIDE 1BFVH 4OGYL 3SPVB 2DWDB 4U6XA 1JNLH 1Q0YH 4BELD 3GUTB 2V2TB 3FQUB 3GSUA 4G8GE 4RIRA 1YEKH 3RHWK 4NM4H 5LJYH 1H3WM 2P7TB 1XR9A 3ALPA 4YHKH 4P5TA 4FXGB 1WAAF 1A14L 4S1SL 4LRIC 4ISVB 3O8XA 1ITBB 4XWGL 4QHUB 5IOPB 1HIMH 5F44A 3V9FA 3B9KD 2VR5A 2N56A 5HI5C 3P11H 5ICXB 3SGDI 3Q1SH 2EO1A 2X7LB 4R4BA 4XNQB 4ODHH 4PJXA 1N6QL 3CLEH 2FZ3A 1Y18B 3HKFA 3IF1B 3HMWL 1MVUA 5C0AD 2BVTA 3BH8A 5K9OB 4UV7H 1P4BH 5J1TC 1MRCL 2A77L 1S9YA 2GI7A 3CUPA 4FFWC 4NQEE 4PJGA 5IBUB 1RUKL 2J6EH 4DFHA 4JDZA 1QR1B 4LSTH 1T03L 3D3VD 1B0GB 1DR9A 1FL3B 4APQB 2IG2L 3QUXB 3T8XB 1V7ML 3HPJA 1FG9C 2DMCA 5FUCE 5HPOA 2FHFA 2PTUA 1NGQL 3BVNB 2AJUH 3UBXA 3X3GH 3EAKA 4GRMA 4HDIA 3FT3B 4FQCH 3SJVD 2X05A 3BQUA 1B3JA 5D5MA 3VGAB 3LQAH 4YHYB 4C56D 3LB6D 4S11A 4Z0BL 3VI4E 2BXYA 3IU4H 1NLDH 4MQTB 4Q0XL 5I8KL 3MYJA 5INCB 4KC3B 2BERA 3P9LA 4PRPD 2X1QA 5AEAA 4P46C 1H15A 3VH8A 2BSRA 1YNKL 1YDPA 3MLTA 5FDYA 3C6LC 5DUBB 2YUXA 3BIBX 2CPCA 4M5ZL 3ARBD 4JZJA 1WUNT 3RTQC 1J86A 4YDVA 4UBDC 1E4XH 3IS1X 4RX4D 3K2UL 1CGWA 3MBED 1S5HA 2GTWB 3RDTD 3IB4A 1QRND 3FCTB 4HLJA 4BQ6A 3R8BB 2YKLH 4N8VA 1UCBH 5FCSH 2L4OA 3U9PL 3OR6B 3HCVB 4ODUB 3PP3H 4PG9B 3VA6A 3PUCA 2Q76B 3CMOH 1I1YB 1R0AH 2VL5B 1MNUH 3KXFB 1NMAH 3GSOA 5C0CB 5IGXH 4IOFC 4QRTA 4L3AA 5C9KA 5HGDB 2VLLB 3AB0B 4IEFB 1LD9B 4DUVA 1ZHKB 4F7CB 1IM3A 3O11B 5HYQB 2XXCB 4JAMB 3W81A 2R2EB 2BK8A 4A6YH 1MHPH 35C8L 5E99H 5ISZE 1HILA 1A9EB 2NXYD 4JFPB 4PJ5A 1NCAL 4XCEB 3C5ZD 5EZOL 5C09B 4XVUD 3N1GC 4U7SA 2VLJE 1NC2B 4QRPA 5KG9A 4XP1L 1IRAY 1FHGA 1KELL 4G43A 3ECBB 4HH8A 4IM8A 1GRWA 4HJGB 4N1CA 4WI6A 1SJEB 3BT2H 4PRAB 5DMIH 4NZDA 5E70A 4YHOL 3VXME 1A9BB 3WS6A 3LQZB 2OL3H 1U92B 3FN9A 2R2CA 5H94B 2I25N 4NHCL 1U6AH 4HEPG 1DANU 2ATPB 1EHXA 3NFPB 4XT1C 3HE7D 4RA0C </