4J6RH

Crystal structure of broadly and potently neutralizing antibody vrc23 in complex with hiv-1 gp120
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
222
structure length
222
Chain Sequence
EVQFVQSGAEVKKPGASVRVSCEASGYSFTDYVLQWIRQAPGQRPEWMGWIKPERGAVSYAPQFQGRLTLTRDLYTETAYMHFKNLRSDDTAIYYCARGVRRDASWWLQFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Delineating antibody recognition in polyclonal sera from patterns of HIV-1 isolate neutralization.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
total genus 37
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2013-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4j6rH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4j6rH01
5ESVA 1FC2D 5TQ0L 4OZFG 1ZLWH 2CKBL 3TA3B 3GFUA 1BJ1H 1M7DA 3UAJD 5CGYC 5DR5H 1IQWL 2YD6A 4RFNB 2NQCA 5MEQB 2X70A 4HS8L 4GXVL 5EOTB 3T0DA 1FZJA 1CFSA 5BZDA 1TZIA 3BPNB 4L29B 3SCMD 2EXYC 1S7XA 2DQIH 2PTTB 5FUOH 3MGAA 4YNYB 1GHFL 3LMJH 4F37K 4O4YH 3SE9H 3KLAA 2BFVH 1EEZB 3EZJB 4XMPH 1PZ5A 4HJ0D 1KYOK 3Q3GA 5IFAH 5I8EB 3MLYL 1X3DA 5D93C 3WUZA 1DLFL 2BOCB 2VUOA 5ICZA 5EOQH 3X11B 1SYVB 3CFKA 4LQFH 1IC1A 2G75A 4ZO9A 1ZEAH 2DF3A 3DX8A 3GSNL 4GMTL 5HHME 5C0AD 5EOCH 4YWGH 2BRRH 1WAAF 4JHAL 3SDCD 5DXWA 2HLAA 5DD5L 5BZWA 1J0IA 3DV6A 1TXKA 4ZUSA 1MJ7L 5I1HL 3KYOA 1S7QB 2G2RB 5IW1B 2V5TA 2X89D 3QXVA 2E8ZA 2P7TA 3HG1D 3B2UD 4XAKD 3QIUD 2K9UA 5I19H 2EDJA 4C59B 2FSEB 3MOAH 2EYSA 4ZFOB 2WZPD 4LRNL 2ZPKH 4O2FB 4P2RE 4ZAKD 1MY5A 1R3LA 1DVFC 3ZKXB 1OLLA 3P73A 1NCAH 1F3DH 1YUHB 3EO1B 1WF5A 3ARXA 1ZLSH 2XACC 4O58L 4L3EA 4ODUA 1TFHA 2VZ3A 1J8HD 2IAMB 4R2GC 2FH8A 1T66C 4UAOB 1UFUA 1Z9MA 3SGKC 4HGMA 5C86A 1XZ0B 1HXYA 2VC2H 4JFHD 1F58L 4NO2A 2RIKA 3CC5A 5E94B 4MNGE 2J8HA 1MFBL 1MRDL 3OKOB 1LO4L 2VLKB 1V7NL 4HMDA 2EXWD 3RVWC 2BOCA 3LQAC 4F9LA 4NQCE 5JZ7D 3MXVL 1FE8H 3ZDXF 3CSYA 3S8WA 4P46C 5FCUL 1WCBA 1CR9H 3U82B 4KK6C 3WIIH 3VRLE 1D6VL 4QKXB 4XCEA 2OK0H 4K7PY 4JQXA 3QZWG 5DUPL 1KENH 4NRXA 5AG8A 1MCFA 4J3XA 5IMLA 2DM4A 3U4EA 1ZHBA 5DVMA 5L2KB 1JHLH 2D7QA 2FSEA 5IK3A 5SWZD 4R90H 4GUPB 5FKPB 1EEZA 3RBGA 3M1BB 1MRFH 1IEAA 3DROB 2YWZA 4FQHB 5D9SB 5L88L 4GKNA 1FLRH 4TPRL 2QJDA 3EYVA 4OLEA 2E7LC 1EV2E 2EH7L 1TVHB 4L4VA 1KJ2A 1TJGH 3DXAB 4PD4K 5F21B 5KVMC 4D2NA 3L5JA 1RSFA 4ZNEA 2YBRA 5BV7B 4Y4FC 1N64L 1AXSB 3VFWA 3OJMB 1OD9A 3MLTA 4K3DH 3ZSTA 1T21A 3CXHK 4C58B 1FCGA 3X3GH 4CMMB 1O7VA 3PG2A 4HLJA 1IGJA 1HQ4A 2VDLL 1A4KB 1NLDH 5C07D 1I3RA 4QHUB 2DWEB 4OF3A 4C4KT 1I8KB 3O3DA 4R4NC 5GRUH 5CAYB 3T3PF 2HKHH 4ZO8A 3QDJD 4ZYKB 3WD5H 2J8UB 3B5HA 4LVNB 5BVPL 2OI9B 4ZFOA 3ROOB 3TIDA 3QZWB 2NY3B 4X6DA 4J6RL 5C0IB 5T1LD 5A2KH 3GJFB 3WLBA 2C1OB 3BGMA 5EOQL 5SWZA 5GS0H 2R4SL 4LMQE 4R26H 3S4SA 3DXAE 4ZODA 5DSCB 5F97E 3VI4E 4K8RL 4JFDA 3ZL4H 1AO7E 1P84K 5KVFL 4X8JA 1ZS8A 3FRUB 2QQNH 3WCYA 2FO4A 3SCMB 3T4AA 3BRGC 2VC2L 4JRYD 1JK8B 3BKJL 1GHFH 3LMJL 1LE5A 2UV3A 1GGBH 4PJ5A 3U4AA 5HYFA 5DYOB 2ORBH 4UV7H 5DWUL 3N85L 2GYSA 5B3NA 1PG7L 5C0GA 3O2DL 1MSPA 2NW2A 4FXKB 4EQ3A 3RP1A 3TVMD 3VJ6A 4LRNH 1RIHL 1BQHA 4Y16B 3CCHA 4FFWC 2NZIA 3X14A 4IRSD 3RGVB 4BH7A 1I4FA 1KIPB 1Q9LA 2MKLC 3V0WH 4PGJA 5HXMA 1A3QA 1E28B 1WBYA 2F54E 5FGCE 5JMRA 4EEEA 3VD5A 2FJFA 3OKMB 2GK0A 3G5XA 5F7UA 1S5IH 4LCCC 2JB5L 1NUGA 3SKOA 4U1SA 4JFFA 1OAUL 4ZXBC 5E6YA 2GFBA 4LU5H 1NCDH 2ZG2A 2D9QB 3HI5L 5FHAL 5GS2D 1MCOL 1BBDL 5GZND 5DRNA 1R3LB 1CFNA 1A6WH 2PXYA 4AQ1B 3VGAB 3VH8A 1I1AC 5DJ6B 1H3TA 5BQ7B 3TC9A 2CK0L 4OBSA 4LCIH 3C6SA 2BNRE 4JRXE 2H6PB 4O4YL 2CH8A 3LQAL 1MWAA 3KPSB 1G7LB 3QNXB 2FX7L 4P2YA 5FUOL 4N0YL 1RJCA 1SJEA 5D7SH 2W9EH 3S96B 3TBVA 5DRZA 3DURB 3AS1A 4Y5XA 1IL1B 2VLJA 2DKMA 4KI1A 3QT2A 1RZIB 1A6VH 3EYUH 3GI9L 3TZVC 4J3VA 5GS1B 2VDPH 2R1YA 1RHFA 4QXWA 4KFZC 4HX1A 1YEEL 4NHUA 1OSZB 3OAUL 4QXUL 4W4OC 4N5ED 1M05B 5IBLC 2ARJA 1NMCC 3HMXH 4ENEC 2X1XR 5AZ2L 3NVQA 3T8XA 5FDYA 3VRIB 2VB5A 3KS0H 3SE8H 1I8MA 4NM8H 3CFCL 3UJIL 3I9GH 3FRUA 4XP4H 5KZCB 3P11H 2GJZA 1A6PA 2VKWA 5HI3C 4P2QD 5L2KA 3BDBA 3HPLA 1T04A 5H35A 3VXTA 5DVKA 5EUOE 2APTA 2RFXA 4MXVE 3MRPA 4MA3A 5JHLL 4QCIA 4N0CC 1LP9E 2NY7L 4CN4A 4GRLB 3HG1E 1OY3B 4I1NB 1T03H 4G43B 2W9LA 1V3MA 3DXAA 4ODHH 1SY6H 1F90L 1BX2A 3T2NH 3LHPL 4I0CC 5I0ZA 2R0ZL 3CCHB 1S7WB 1KCUH 2X4UA 4RGNE 5E8DL 4DN4H 4U7MA 4RMVA 2AXFB 1INQA 3WNNA 3CMOL 3L5WA 1D5IH 2MQCA 4J4PA 1T20B 4N68A 2R2BA 2EKSA 2CKBA 2WBKA 4JO3L 4PJAB 3GIVB 2P5ED 3NA9L 1UKSA 3CK0H 4JANA 5M94B 2LQRA 2OMNA 3ULUE 1Q94B 3KYNA 3JV6B 2QKIA 4PRIA 4I4WB 1Q0XH 3VGHA 1T83C 1XR9B 2BVUA 3QH3A 4WFGE 3DVNA 2Q8AL 2HA1A 3BZ4A 1EERB 3H42H 2QADC 3L3IB 1G6RB 1H15B 1AXIB 3CFBB 1U58B 1L7TH 1UXWA 2V17L 3O9WC 5FGCB 3MUHL 3KPQA 3PIQA 4GRLC 3IRZA 5SWZB 5E94A 2DKUA 3KPPB 5C0RL 3MYJB 3BDYH 3LDBB 1TNNA 1R3JA 3MACH 4JREB 2NXYB 1L9NA 4EDWL 1KEMH 3BRDA 3CSBA 1BWMA 1FL5B 3SQOH 3JBG7 1I7RA 4QXUH 3ARBD 4DCQB 1UGNA 5D7JD 4BK5A 1UJTA 4WI4A 1MQKL 3MO1A 5SWQA 1DQTA 1FNHA 1Z5LB 4AENB 2XTJE 1T4KA 4UT7H 3RNQB 4X8XA 4Y1AB 2VO5A 4XPTL 2DWDA 3VU2A 4HJGB 5EU6D 4L8SB 3LEYH 3QUYA 4XCYA 2CIIA 3SKNB 4GKNB 1XR8B 1A21A 3C60A 2HMID 1DJSA 1Q9OB 5K9OA 4XCNA 1JPTL 4WI5A 2Z92A 4G3YH 4AEHH 3VXMD 3L3JA 1MCOH 2ADGA 5HD8D 3MRJA 1IGYB 5JHDD 4GW5B 1IAIL 4Z0XA 2R23B 1WK0A 3FFCE 3MRPB 3VWKB 1HHIA 1ZK9A 4TSCH 1MNUH 1KYOJ 4F9PA 4M5YL 4RAVA 3PL6A 2DQUH 1BJ1J 1GZPA 1G9EA 4ZFOL 4JFPA 4XBEH 2A6IA 1ED3B 3PWUA 4N5EC 4JY5L 2KH2B 5EH1A 1BGXL 1HZHH 2UVEA 4FQ2L 1K5NB 1BBJB 2LVCA 4R8WH 4LLMA 1NH6A 5CKGA 4M03A 2HFFB 3ZDYE 3SOBL 5B38B 5KVEH 4HIIB 1A6AB 3VD7A 4KVNH 4X6CA 2OP4H 4YHLH 2C3GA 4OZGA 5ENWA 7FABH 3O2DH 3O4LE 4M48L 5HVHB 1OGTA 1U3JA 2E27H 2EIDA 5L0QC 5DWUH 4JDTL 3QFJA 4MNQE 3KLHD 4C56E 4PJ8D 2VZTA 3C2AH 3IJYB 3L3IA 3HZVA 4LRIC 4OKVB 3V4UH 3KLAB 2QTEA 2F5BL 3KPOA 2IANB 2NX5D 4BZ2H 4DVBB 3INUH 4MSWB 5EZJB 2JJTA 1U8PB 1FVDB 4K8RH 1V7ML 5FM4A 2Q7YB 1NPUA 1PLGH 4BZ2L 5FYKE 4PRHD 4GMSL 2ADFL 4HWBA 1MFDH 1HHIB 2F54D 4KKNA 5I1KL 4RRPA 4CVZA 5E5MB 3DUHA 2A83A 1EO5A 2X4SA 1J86A 2YK1H 3MXWH 4NC0B 1N4XH 5HGHB 1I85A 5A3ID 4XB8A 3IFPA 1CWVA 5BW7A 1J5OH 1UG9A 3GDBA 2HFGH 4M48H 3ARDC 4P99A 2YN5A 1DQLL 2P24B 3BP6B 2EH8L 3W9DA 2OP4L 4LAQL 1T2JA 3PE9A 5DHVB 3TCLB 4L3EE 2OSLA 3B43A 4RWYL 4KROD 4R4FH 1G0YR 1G0DA 4OB5H 5ID1B 4JZNB 4GG8A 1Q9WA 4QLRA 3F65A 5T1KD 1C12B 2WBJD 1GL4B 5LVEA 1HHJA 2EDDA 4FQ2H 2R2BB 1RK0A 5HI4D 3OG6B 1QSFD 1UQSA 5IVXE 3QDME 4YGAB 1TZGH 1A1NB 3B9KB 5DDHB 1NFDF 2VERN 4NJAH 3ZMRA 3CSGA 1TJGL 3OR7B 1P84J 4XWGH 2EH7H 3BQUD 4AK1A 2BNUA 5FGBA 5IVNA 2JJVA 1FFPA 3EJYC 1QR4A 4HHAB 4XC3L 1ZT4B 1EAJA 1D5MA 2F58H 1EMTH 2CLRA 1OCWL 4KY1L 3QQNA 5I76A 4PY8I 2MWCA 4NN5B 4NOFA 3QWOB 4PRDB 3G6AB 3LEYL 4EI6B 2DBJA 4D0BA 3I75B 3MV8D 5IBUG 3PXJA 4WGVB 4CVZB 5KN5B 4XPTH 1BHGA 4IIQB 3ULVE 5J11B 3H9SE 1AHWC 1BMGA 5J6GB 1CXHA 3BPCA 1H5BC 2OL3L 3W39A 3V52H 1FL5A 4KRNA 3SN6N 4NKDA 3SKMA 5CD5D 4OZGB 5JR1L 4HF5H 4PFEA 4OLZH 1RY7B 7CGTA 1TETH 4WO4A 2XTJB 1MQKH 2D7OA 4MDJA 5D5MF 1ZA3A 2X09A 4G8GB 3T3MF 3GM8A 5FF6B 3EFFA 4WJ5A 4ZNEE 4XPAL 4RAUA 3STLA 3WN5B 4M8QA 3TA3C 3WDJA 3ARFA 4MJID 2DQDH 4P23C 3DBXA 2OXHA 2FX8H 3JV4B 3V8CA 1CFBA 1RK1B 2ESVE 5E03A 2WLZA 4M1CC 4PGCA 4XXCC 5FUCE 4ACPA 5SX4H 4LARH 1ND0B 4PJHA 3ARVA 4GFTB 1P7QB 3IB4A 3RDTB 1E4XH 1UWEL 2LU4A 4NC1C 1MWAH 2BNQA 1HSAB 1LDPL 4YDJB 1A3RH 3QEHA 4A6YH 3P2TA 3D39A 3CGTA 2LAAA 2P48B 4JN2B 5EC1B 1Q0XL 4JDZA 1A47A 4LLWA 4J8RB 1RUPH 3L3HB 4L1DA 2OSLB 3PABA 3MV7A 5IHZA 5KSVB 1T89A 2DM3A 4OLXH 3IDXH 4OCSH 4ONFH 5IKCB 2NYYD 4HBCH 4Y5VC 4Z7UF 1HEZA 3RPIA 1D5IL 1T5WB 1FAIH 1K6QH 3HRZA 4KK9C 3BW9B 4FOMA 3PP4L 2WBJA 3KDMA 5FEBA 5T1KA 3GSNH 2UY6A 4Q6IB 1MLCA 4E9LA 5KOVC 4FTVA 3HUJE 2NW3A 1PEZA 1T80A 1KB9K 4FQJH 2AK4A 3S4SB 1IMHC 1DLFH 1T03L 3UX9B 5C9KA 4HIEB 4NO3A 5FECA 3BQUC 2C4XA 2PO6C 5E4EB 3OXRB 4KK5D 3FQNA 1BFVL 4NQDB 3VGGA 4ODTH 2BSTA 3QHFL 2BFVL 3BN3B 5ETUB 1R3JB 4NT6B 3C8HA 3JWOC 5CP3H 2NCMA 2YXMA 4XP1H 3GZKA 1YQVL 1G1YA 4K2UL 3BP7B 3D48R 4FNLL 1UVQA 3G6AA 1BOGB 3QNZA 3DLQR 4TQEL 3VA6A 3S7GA 1G7IA 3QIUC 3B2UC 5C0BE 4HS8H 1VPOH 1OGAD 2FX9L 1LMKA 3EYSL 1IQWH 1UCTA 4D0CB 4NQSB 4X9GA 1IAOB 2ZCKH 2CRYA 5AAWA 4M43H 4PJEA 4I77H 3FOLA 4PJ8A 3IU4L 3FFCD 2OBGA 1CLYL 3RWEA 2VQ1A 1MHCB 3O4LA 1INEL 1AIFB 2NY5H 3C8DA 3HG1B 3OHXA 3WN5A 1U36A 1MHEB 4E41B 3U0WL 3EDDA 1IGMH 3CVIH 1AGCA 4OFYA 3QQ4B 5ID1A 5DD1H 4UTAL 3A67H 2KPNA 5BV7H 3WNPA 4NNXA 5DEFB 2B0SL 4RMTA 2BSTB 1SY6A 4KQ4L 1XF2B 1ZANH 4XMLL 3T1FB 4Y8AA 4YJZL 3QNXA 4NN7B 1NL0H 1UZ8B 4XTRD 3WS6C 35C8L 5K9QG 2VR4A 2VLRA 4NNYA 2F5AL 2AV1A 5IF0A 2R39A 1D5MB 1J87A 4G6FB 3VXMA 4NC1E 4HPOL 4RX4D 2F19H 1MPAH 4N9OB 4OLUH 5EOTA 5IB5A 3X3FL 1XMWA 2MPAL 1FNGB 1MHHA 1Y6MR 4OZ4B 4LSTL 1WV7T 3O0RL 4I0KA 1DEDA 2DS4A 2C5DC 5DJ2A 5DO2C 1JMXA 5KSBB 2PCPA 3VE0A 4JN1H 4HH9B 1B0RB 2AK4B 2X9XA 4QO1A 1JTTA 1RVFL 4Q74A 5E4IA 5F7MC 3WIHH 3IDNA 5F89B 2ZG3A 4FMFA 1ITCA 1I1FB 4DQOH 3ZSSA 3O2WL 3NOIA 5GGRY 2PYFB 2AEPH 1CGWA 1YNTB 5T3ZD 3UZQA 5ICXA 2NY3C 3GSXA 4F33B 1BQUA 4X6DF 2Y9RT 5D1ZB 4U0RB 4XX1E 1N59A 5SWSA 3ZL4L 3CFDA 4F7EA 5KVFH 1OAQL 1H8NA 2WUBH 1DEEA 4U3HA 4YE4H 1EFXA 3B2VL 1G9NH 3GMMB 2CXGA 2R4SH 1MOEA 2NPLX 4YHKL 1CICC 4GAJH 5GGQH 3TIEA 2VQTA 1IEAB 5D9SA 3RL2B 3WJJC 3RDTD 3BIKA 3WNKA 3GUTA 4PJ5E 3T0WA 4QWWC 4LSRL 5C0DB 4NZRH 3F7QA 4M6AA 5D7JC 1I8IA 3ARBC 5IW6A 1IQDB 4HKXB 3WJLA 3S35H 4J8RA 1YYLH 2IBZY 4XNYL 4LASL 1G7QB 2VZUA 2AJZB 3CFEA 3HNVL 1NLDL 1ZLWK 1GYAA 4HFUH 4ODUB 2NY2B 5T33L 4HD9A 4J4PD 4DVRL 4JFEA 3JWDH 4HUWB 1MUJB 3QAZC 2WP3O 1U8MA 4TSAH 5T5NF 1DSFH 4LSVL 5GISL 2JK5A 3TT3L 3Q48A 4LGRB 4RGNC 4F57L 2VLKA 4Z7UB 1BJ8A 1NMAL 3S3PA 5KTEL 4K23H 1I9IH 5CSZA 5I8EA 3V7AG 2VDOH 1T1XA 5L88H 1IZKA 2YD8A 2GJ6E 2I5YH 4NRZA 5K59E 3N1FC 1FIEA 4HEPG 1IE5A 3VXOA 3DX7B 5EBLA 1PKOA 1PJ9A 3RZCB 4OM1H 4LGSB 4TUJA 3V4PH 1RU9H 3SKMB 4V1DA 4ODXA 5B3JF 2ZZUT 5IHUH 1T4KB 1IILE 3LCYA 2VN4A 4OCRH 3SDDD 4Y2DA 4K7PH 1FO0B 3VCLB 3O3BB 4NFDA 3BMWA 3TH4T 4Z7NE 3FT3A 1MCHA 4NN7C 4YHIB 2HT3C 4CMHB 1UM4H 2WSKA 3CU7A 3ZT5A 4MCZA 4S10A 3LN5B 4G6JL 2GK2A 2NW2B 2VDRH 3VXQB 3FRPG 3KYMB 2UZYB 3T2OA 3V7MA 2ZUYA 1ITBB 5D5MB 4RSVA 1IAKA 1QHOA 4WENB 2DQEH 1U3ZA 1DE4B 2KZ1B 5E8NB 1EBPA 2ADIB 2SEBB 3ZDZE 4MA7H 1S5HA 2O5ZH 4QHUA 1JWUA 4PB0H 4WV1B 2DDQH 3MTRA 4KKLD 2FBJL 1N26A 2H45A 5JW5B 1A9EB 5MEOA 4TVPH 2CRZA 2PR4L 4N90E 3VWJC 1A6AA 1MCWM 4KUCD 4QGTA 1XGPB 3RY6C 4M4PA 4XH2A 5I1CH 4WNQA 5C08E 1ZGLA 4UMGA 3IU3A 4XBPB 4G80A 3S37X 3UYRL 1K85A 3TWCL 2O5YH 1LHZA 1KJ2H 4MNQB 4NOBA 2YZ1A 2H2PD 1QNZL 2AJVL 5DJ2B 3VFVB 5EZJA 1EZVX 3GMNA 1RJZB 5I8OL 1A7NL 1HIML 3IKCA 2DMBA 3HNTH 3AREB 5GS1A 2B4CC 5TGBB 2R9HC 4O2EA 4WTZA 2A6DA 1A6TB 3C5ZB 4L8BA 2JCCA 2ZJSL 4LSPL 4ELME 4ZUVB 4AYFA 3MCLH 3L5IA 3RA7H 1N8ZB 4A6YA 4ALAL 1WZ1L 1I9JL 1RZ8B 2PXYD 5TQ2H 3CX5K 3MCG1 4PJ5D 5H37G 3IDGB 2QQKH 4P57A 5GJTL 3HR5A 2VXQL 5FK9A 2BVYA 4F7CB 3AREC 4LLYA 2DTML 5I8CB 2UYLA 4EUPH 4JFFD 3UPCA 5CBAA 3HMWH 3T0AA 1J8HB 1HXMB 1I8KA 4IJ3B 1OAZH 4QRRB 5CCKH 3FFDB 3SKJL 2OI9C 3OKKB 4RWHA 5TE6H 4WDIA 4EI5D 2DM2A 3BKYH 4GBXB 4NDMB 3FMGL 4YDVA 1KB9J 4PJXA 5DJZB 5EU6B 3QIBC 3NCFB 3TJHD 2V7HA 5CJOH 5JNYB 2VYRE 3VXRD 3UTSA 3GMLB 4RFOL 4X9FA 2GY7B 1M7DB 1UB5B 4ZYKA 5DMIL 1A64A 2EDHA 1W72H 1KPUB 3PQYB 4PJ9C 3VFGH 1MVUB 1X5AA 2GY5A 3DECA 2I60L 3T0EA 2DTMH 4LLUB 3OX8A 1GZQB 5EBMB 4GW1B 4PREA 3K81A 1CGYA 4U49A 4WU5B 3EOBA 3I50L 3I2CL 2E9WA 5FYKL 4BJLA 1J1OL 1KTLB 4X5XB 3VXPA 2VZ1A 2BNQE 1MCDA 1ZVSB 1QBAA 2UUDK 1Y0LB 3KPQB 3G6JE 5CKAA 2XZQL 4N1EA 3X14B 4JM4H 3JV5A 4XI5D 5GGVH 1Q9LB 1JRHI 3B9EA 1ZLUH 4GQ9L 3M07A 3QWRD 1UM4L 4RISH 3C5ZD 5FKPA 2Q87A 4Q97A 4LOUC 5JOPE 4JFXB 3FQTA 2FJGB 3DUSA 3OZ9L 4KV5F 3RIAK 4RAVB 1ACYL 3D0VB 4Z7VB 5ICXB 3BKCH 3BPLB 1FQ9C 4Z0BH 5FO7A 3WEXA 1KOAA 4NKIH 5IWLA 5DS8A 5LQBL 1OTSC 3HUJB 4JO4H 5ILTH 5J6HB 1LO0L 1QUNA 3O6KH 3UTSD 2NXYD 2QR0A 3DHJA 4OM1L 3ZTNH 1ZHNA 1UEMA 2E7BA 3D39B 2NY0D 3NABL 4QGYA 1XGUB 1F5WA 4P9HH 2FBJH 4UT9H 3HC3L 4PGEB 1E27A 4FQIL 4ZPTA 2O5ZL 1JP5A 5TE7H 5D6CB 3MOQA 1ZHLB 4P2QB 3UPRA 2G9HB 4JJ5A 1RZIA 3QG7L 3JWDL 4NZTH 2ARJQ 5C0JB 4MDIA 4X99B 2R0WL 3W2DL 4G7YH 1RZGB 4W81A 4LEOB 2P5EB 1NC4D 5HDQL 4ONHB 5EORL 5FYLD 5HY9A 2V9TA 1YQ2A 3OTTA 4GO6B 2H2PC 5DSCA 4Z7QE 4G6JH 2F8VA 2X4TA 1IKFL 3S3JA 3ZDXE 3FO1A 4JFXA 5BCAA 3KPPA 2ENYA 3C09B 3VGBA 3BUYA 4CRPA 5C0AA 5ADPH 5JUEH 4ZO6A 3HA0A 5IHBA 1JNNH 1NUFA 1J11A 3FB8B 1FG2A 4P59H 1BOGA 1PBYA 3WLWC 1ONQA 2I07A 2XKNA 3LV3B 3TEUA 5IHUL 1XF5B 1A14L 4CU8A 2GI7A 1A7RL 5F1IB 5J3HC 3C5JA 3IS1X 5J1AA 1I1AA 3FTGA 5HGBA 4N0UB 4MNGB 1CDCA 3F62A 4JCLA 4NWUH 4OAWA 3VGDA 5J1SC 1V5JA 2OTWA 4ZAKA 3ULSB 2IFFH 5HHMB 1FVCB 2R56L 5EU4A 4ETYA 2ADJB 3N06B 5BOPA 3C60B 1B4RA 1EGJH 3SKOB 4YR6B 1RVFH 4C56D 2NLJB 4OLVL 5INDA 3GRWL 4LDLB 3RNKA 3O0RH 2VAAA 2IANE 4QY8A 2VTFA 1KPRB 2X9YA 3K4ZA 1CFNB 1UWGH 4LASH 1S9YB 3LS4H 1VFBB 5D72H 1N7MH 5MHSE 1RZKL 2EXYD 4QHLB 4OUOA 3P77A 3ULUH 2NY4C 1JTPA 2R1WA 2XV6B 3OPZH 2ZKHH 1ROWA 5CZVH 4PJGB 5E0QA 2R69H 3CH1B 4N8CH 4X7SH 3KS0J 3GJFA 5IESH 2HG5B 3NCCB 1DBML 3FL7A 5IGXL 4U1HB 2J2ZA 3DYOA 3QUXA 5KAQF 4P23B 5D6CA 1N7ML 3EAKA 4M7JH 1A8JH 4LLVA 4G5ZH 3SGJA 4X6CB 1RIVH 2G60H 4H88H 1MAML 2WUBL 3KNBA 3PIQB 1ZS8B 4MXQC 1RV6X 4L9LA 2IALA 2OJZL 3E0GA 4JR9H 3TPKA 1S8DA 2EDLA 2X4PB 3VXSD 4ZS6C 1IGML 2D2OA 2VISA 2FD6L 4V1DD 5KJRL 3MRKA 2P47B 3SJVE 2D7PA 3T2PA 2HT2C 1I3GL 2P45B 3CAFA 4M62L 3K74B 2ICEB 2DLEA 1YMHA 2DIJA 2AERT 3RIAF 1ZTXL 1W0VA 3MLPA 3RVTC 5DRXB 4D9QD 3U6RA 5LGJB 4YHOL 1EFQA 2QHRL 4IMLA 4CU6A 4H0IA 3EHBD 5GGTA 4Y4HB 1EX0A 2WIIB 5HTSA 3WXWL 1MJ8H 5KANI 5EC1A 4ZFZA 1IAIM 3EYSH 4JFEE 3RHWK 3LQMA 4WI8A 2HLFC 4WU7B 3QEGL 3AXLB 4K3EL 4P2RA 3RX8A 1S7VA 2AP2A 4NN5C 5HYSA 3IDJA 4TNWK 4OT1H 4E0RA 1NCBH 1JGUH 1W72B 1Q1JH 4HAFA 3PP3K 5HGDA 3V5KA 5EIIA 4XPHL 1SBBA 4MNHA 1YYML 2EKSB 3MREA 2BDNL 4WW2B 4JPKL 5E2UH 5FA3A 3ARPA 5ESAB 2JIXB 1BFVH 1BD2D 4X6CF 3TBYB 5C3LD 1CE6A 4S1DD 5A43C 5T1LB 3TT1L 2AJZA 1IGCH 1E6JH 1JRHL 4RAHA 4D8PA 1ZTXH 1EXUB 5ENWB 5F7DB 4QTHB 5BV7L 4RGOH 4XZUB 1KUMA 32C2A 4EVNB 3LAFA 3UPRB 2W38A 3IJHA 4MQ7A 3UTSB 4WGWB 1CGXA 5I2IA 4S2SA 5SWSD 2NY5L 2C1PB 5DTFA 1QSEE 3O8XB 3RZWA 4LHQB 1G7IB 3IU4H 2G60L 1AY1H 4MGXA 4MJ4A 3H8NA 3N9GL 5EU5B 1RJYA 3WS3B 2ATKB 3QUKB 3RWJB 1T2QL 1ZHKB 1JWSB 5IGXH 4GKZA 3F8UB 5IP4A 1N5YL 2WV3A 3BZFB 3VXPB 3ABZA 4XTRC 5ITFB 3FQXA 5EWIH 1OHQA 3WSQL 1XIWB 4NQDA 4RFEA 4H0GA 2HH0L 1UXSB 3O6FB 4KQ3H 3KPMA 1YQVH 1BJMA 2W0KA 1S7RB 4PR5A 3OKDA 1B6UA 5F7LB 4DWHA 3LQZA 4ZSOE 4GRWE 4ZQKB 1RFDH 2IH3B 4FZ8H 3REVB 3QYCA 2EE3A 3NCEB 2VLRD 1H3UA 3TP4A 1CXIA 1K2DB 3U4BH 2Z9TA 3S35X 1MJUL 3D0VA 5LGJA 3U6RB 2H8PB 4YHYC 2J7LA 3QIWB 4YDIH 4OI8A 3NAAH 3GEWB 2AS5M 1SQ2N 1CFVL 1PSKL 1CLCA 3HCVA 3T77B 4XVSL 1UM6H 4H8WL 2R0KL 4CNIA 3CX2A 3BI9X 4IOIB 1C1EL 3JWNC 4P2CG 1GGIH 2AVGA 5JLZA 2DQTL 1QD0A 2BY2A 3C5SA 5C0AE 3ZYIA 3VFRA 1ED3A 4GG8B 4OLXL 5IFHH 1IBGL 5IOPB 4Z77A 2M8XA 1CG9A 1OCWH 1AO7A 2F58L 4HIJB 3D3VA 4JM2B 1IGIL 2FJFB 2Y36L 1N2RB 4XC3H 3MREB 4Q0XH 1F6FB 4AQOA 4L8CB 1T5XA 4NWTL 3PHQA 2J6EH 5DMIH 1GPOH 4JPIB 4W70A 3I3EA 3ZTJG 3I75A 4XXDB 4RFOH 3QEUA 3I6LE 3IAGC 1PDKA 1WTLA 1KSRA 4WUKH 5AZEL 4LFHD 4NCC2 1HHKB 2UWEB 4ZD3L 3QPQD 1QSZA 1SJVA 3GMRB 1Y18B 2B2XH 4Z7WE 2HP4A 4LPCA 4GXUN 1XEDA 1FGNH 1PX4A 4OB5L 4XPAH 5ICZB 2DYPB 3G5YB 4QF1B 5EZLB 3BVNA 4BUHA 4S1QH 1QFHA 2Q7YA 3W39B 3ZE0E 5HHXL 3QI9B 4PJXE 4RIRB 3TJEH 2D03H 2OL3B 1CFTB 1XCTA 5GPRA 3WFHB 3O41B 5HPMB 1VB9A 3MBXH 4CVUA 5L7XL 1N8ZA 4RMSA 1M7IB 1ZA3B 4Z95L 4LPTA 2GIYA 3H9HA 3HC3H 5TQ2L 5CIPH 2A74B 1MJJA 3MCLL 3MCKA 3NABH 5HGBB 2Z31C 2O61A 1BF8A 2YD1A 1EUUA 3EYQC 4RFNC 2KZWA 3ZLQC 3O6KL 4GQPH 2QL1A 1RK1A 1A4JB 1JPFB 1ZT7B 2ADJA 1X6LA 4MB5A 1JPGB 4HQQL 4QRSA 4FQHA 2A77L 5FHBL 5FOBB 4HG4J 3OZ9H 1T5WA 4U0RC 4WW2A 5J9PB 3D39E 1H5BA 2QSQA 1A7QL 5KS9A 3VXTB 1ZGLM 2DJ4A 2JIXA 2RFXB 1KIQB 4U3XA 3MUGA 5ERWB 1Y18A 3U1SL 5AEAA 1RULL 3P0VH 4HKJB 4KI5C 1WICA 5F70A 5MEPB 5KVDL 4PGDA 3U48A 4KK9D 4F7PA 1TVBA 1ZE3C 1QBBA 5F7DA 3HZMB 2DB8A 3QQ9C 3FN3A 3RZCA 5DI8B 4R7NA 4RDQG 2X7LA 1FSKC 4ZFFB 1CQYA 4MJIA 2R0LL 4FZEH 2JELL 1P7HL 2WWMD 4JY5H 4P23A 3OB0K 3UBXB 3FCTB 1V3LA 4R7DA 3QQ9D 1KCVL 4X5LA 1VFMA 3K46A 2EKJA 2BVOB 4F58L 3O6LH 4JPVH 5I9QC 3FQNB 3VFGL 5A1AA 1VADA 4WO4D 5GGRA 2FH6A 2IANA 2NX5B 1T1YB 4MCZB 4PD4J 4MD0A 1KELH 3TFKC 4TVPD 4R0LC 3DVGA 4BSJA 5GJSL 1XGRA 1X5ZA 3U1SH 3U2SA 4U1JB 4F7TA 2V9QA 1GC1C 4LCCB 5DJ0B 4NZJA 1ADQL 2VQ1B 1J0KA 5EZIH 5DRXA 1T89C 2KKQA 2HFEA 4JFOB 2JKXA 4R96A 4TOYL 4YX2L 2AV7A 4POUB 5KSAA 3DYPA 5B4MC 1FZKA 1HWGB 4AIXA 2Z31D 1NDMA 4ODWA 2BNQB 3V8OA 1BD2E 5DQ9A 4M6OH 3ZT6A 4DFIA 3BDXA 5DI8A 3C09C 4I5BB 4LHUG 3SOBH 2EZ0D 3NZ8A 2DQFA 3SQOL 1QSFA 3MRLB 3TNNA 4NKOB 1KTDA 1QA9B 3MV7B 1NCUA 3QDMB 4KKCC 3QUMB 4D94A 1DUZA 2VLRB 4OZIA 1T7VA 5HBBA 2CD0A 3G5VB 1FFNA 5GXBB 3AS3A 3CFEB 1NANI 5HHXH 2DQJL 5AUMB 4S1QL 4Q9BA 5T33H 3PGCA 1Y6NR 4X0KA 3MRMA 4P2RD 2OMBA 3D2UB 5DEZA 5CP3A 2VLJE 3KWWB 4ZS6D 1VFUA 3P0YL 5IQ7L 5AD0B 3CK0L 3RIFK 4LCCA 5FYJL 3WSQH 4BA8A 2AV1B 4ZS7H 5EWIL 2GJJA 2A6KA 4WUKL 1KJMA 4PJBB 1O0VA 2X4OA 4NFBA 5KOMC 3TBSA 3WN5C 3PV6A 1S9WA 5IVZB 4S1SL 4G8IA 3IS0X 1GPOL 3KXFE 4QF1A 3GSXB 1UADC 3ARBB 1X5IA 3RHWF 1F90H 2EYRA 3KYKH 5SWSB 3MA7A 5FAAA 1G9NL 1SEBB 1LD9A 3QHZL 4UNVA 2VIRB 2EE6A 4RA3A 4TUOB 4U7SA 3VFVA 2GITB 3I02B 2DQEL 2YC1A 4M8QB 5L8LB 4OD2B 1C1EH 3WO4B 1FSKB 1MCPH 3ULSA 2DQHL 3N1PC 3DUUA 3MACL 4WEBL 3D9AL 3RI5F 4NM8L 1JZ2A 2A6DB 3PWPD 3QI9C 4L3EB 2UZXB 3EUUA 3MGOA 1AGEB 4X5WA 2HT2D 2EDFA 2FDBP 2LV4A 3NAAL 4NO5B 3GHEH 1RZFH 1GGTA 3GJFK 1LO5A 1U93A 2IEPA 3QCVL 4EIGB 4W4OA 2A73A 3DPBA 4KVCH 1IAKB 3G6JA 3C87A 4HZLB 5EO1A 5J12B 5H2BB 4I3RL 3PL6D 3FB5B 3DJ9A 3KG5A 3ZTJH 5F88A 4MAYC 4OI7A 4NPYB 5EOCJ 4KKBD 2OJEB 5IB2B 2F5AH 3O6FC 2FNBA 3CZFA 3NACH 4ZG1A 1FNEA 4N0YH 5D7SL 4MA8L 5MEPA 3BW9A 5IEKB 4PGDB 4FXGA 4FQLH 1QRNB 3O3UN 5TH2A 1YNKL 4HX1B 3WLWD 4JANB 4J3SA 4HUXB 2F53B 4EN3A 3MLUL 4YIQB 5CBEA 5TDOB 3F7VB 4DTGL 1I1CA 4UUJB 5IM7B 1A6ZA 4HWEL 5DFVC 3VDCA 2VRAA 4NUJA 5MENE 4LSVH 1S8DB 2BJML 4PRAA 1M71B 1CICA 3M1BA 5IMKA 4I2XB 1EPFA 3QULA 4GRLD 5FDWA 3MOBH 2IF7A 1NFIB 2VSDA 5JDJA 5JPNA 4ORGB 5E9DD 5FO9A 3TH2T 4JR9L 5SWSE 2W07A 3O81A 5D2NA 4LLQB 1IC5L 2NMSA 3G08B 3HNVH 2JE8A 1BZ9A 3V5DA 5JO5A 1MHPH 4HIXL 3TBTA 3LN5A 3WJLC 3TT1H 1T0MB 4PG9B 1XCTB 3BYYA 3WFHA 1TQBB 4HGKC 1UB6A 1DQMH 5CLTA 3S5LA 5K9KB 2WWKT 1PKQB 4PJEF 1F00I 3I3DA 3OKLA 4CKVX 4RGMB 3B83A 3GSOB 2FX9H 4H5SB 2BHUA 2P5WD 4CU7A 3EYUL 3GI9H 4GAJL 3DIFA 3HE7B 4L4VE 1DFBL 4PYHA 4F7CA 5I8CA 3CLEH 4U6XA 4X6FA 4YPGB 4YE4L 2O5XL 3GUTB 2AK1H 5C0CD 1P4LB 4I48A 3RJQB 4PJ7B 1AHWB 4D9RE 2VLRE 3PUCA 4OFKA 5CINH 3HAEB 1PQZA 3QJHA 4DN3L 4OZGF 5GRJL 1R24B 4FQJL 1JGLL 2XNAA 4GKOA 4JQXC 5GS0L 2AGJL 1U8JA 2FB4H 3WIHL 4I2XA 1MELA 3VWKA 3X12A 1MF2H 4JFEB 3T65B 1S7QA 4ZOEA 3KYAA 1FAIL 4KMLB 2P7TB 5DHVH 1P4BL 1G7MB 4DW2L 1S5IL 5ESVB 1ONQB 2Z91A 3DETC 4P5KB 2MPAH 4Z8FH 1CDIA 2E3VA 5GRUL 2CUMA 4DCQA 1MPAL 4FP8H 4KC3B 3Q6GL 4LLMB 4HGWB 3JXAA 5C0CB 2FEEI 4FXKA 4BFBD 1KC5H 1FNGA 1MHHB 4OSUL 2X5PA 5L2JA 5TGBA 2JB6B 1F11B 4L3AA 4N0UA 3ARTA 1A6TA 1Z5LA 3C5ZA 4L8BB 4OAWB 5GZOC 1HEZB 2H9GA 1QQDA 2XI9A 4HWBL 4F9PC 1AC0A 4H5SA 3C6LD 2R69L 4UT6H 4LHUA 4PJIF 5E00B 1UWEH 1TENA 2EO9A 1IM9B 5KW9H 1ZGLP 2QHLA 5DEGB 4FFZH 3PHOB 4PBVC 2ZUUA 1AH1A 3MRRA 1U91A 2O93L 1U3HD 3U7YH 4EOWH 5D72L 1TPXC 4MD4A 5ALCL 4PRAB 1P4LA 4IJ3C 1WT5A 2D31A 3ES6A 1BAFL 3H7BB 4F3FB 2OQJA 3MRDB 4N8PA 4PJGE 1F4WL 2D7MA 4F2MB 3U0TA 2G75B 1NDGA 3QDGE 3KPNB 3T0ED 4XNUL 4JFOA 5C0FA 4G6KH 5FYKU 4JDVB 1T0PB 4ZXBD 2LAGB 2GQHA 3C5JB 5IBLD 4OLZL 3L6FB 1D6VH 5TE7L 5DJZA 5HPOA 2I27N 4ZUUA 2IH1A 4DGIL 1RZJH 4M61A 4U3CA 5J06A 3UBXI 2PN5A 2AXJA 2UY7A 2QADB 3P0GB 1MCJA 4M43L 1DE4A 3SGDI 1NGWA 4BSWA 1FE8L 5CJBA 2OTPA 2RB8A 1KNOA 4WRLA 5C6WH 3JV6A 4PJEB 5T1DL 3AU1B 4X6FB 3NCJL 5LXGL 3A6OA 3CFIC 1V7NH 1EMTL 1BOYA 4G8EB 2XWTB 1A9EA 2OR8A 5LQBH 3ZKQD 3LRHA 4U2ZA 4CW1B 1DBAH 2PW2B 4JRXB 4U2YA 1FNEB 3BKCL 5C0BB 1PVHA 5JA9A 1I75A 1UXWB 1N64H 4Z6AT 4DAGH 5BW7C 1IEBA 4DEPC 1UQSB 3TJHC 5F6IC 1QYGL 4EN3B 4O58H 2OZ4H 2AJSH 2FJHB 4RISL 2FYYA 4X0KB 1G9ML 5JIPA 1U8OA 3MR9A 3B5GA 3G9VA 2UUDH 3M45A 3R06A 1GIGL 3EBAA 3NCYP 5CJQL 4WFGD 3MRDA 1FV1A 1R5VA 3MLZH 1JHLL 4G7YL 3MFGB 2P5WE 5E5MA 2VDNL 3MC0A 4OGXL 1ZLUK 2BZDA 4UOW1 2A1WL 4PJDA 2ED9A 3QG7H 4Y4KB 4G8IB 4EZMA 4HBCL 5IT2L 4L29A 5DD5H 4K71C 1JHKH 4HT1H 1NFDB 2PXYC 2H9GB 4JFDD 4HZAA 3S34L 4JE4B 2VIRA 4UT9L 4OZ4A 2C3WA 1KT2A 4D9RD 1LDPH 1P7KA 3DUSB 4QT5A 3WFCL 2VZOA 3AFLA 3MMEA 4Y4KC 3HR6A 3H0TA 4X9BA 1JNJA 1XR9A 3R1GL 1FL3A 2X41A 1VKXB 5I1AB 3QDJA 3GB7B 5E8PA 3R4DA 5BRZB 3UC0L 4QRRD 3BEWA 4G7VH 3MV9A 2PYFA 3KPNA 5FB8B 2YRZA 4AY0A 3QUML 3L5HA 5TE6L 4XI5C 3KGRA 4LNVA 3UCRA 5DJDB 4HLZH 1NAMB 3KPLB 1NBVL 4W6XB 1E27B 3PNWB 3MV7E 1NKRA 3CDGB 3VXME 3WS3A 4KZDL 2PTUA 4PS4L 1FV1B 1R5VB 4JHWL 3SE4C 4PRDA 4HXBH 4ZXBB 3SDCB 3RX7A 5I16B 1IRAY 5I1HH 2ED7A 1OAKL 5TDPB 1CYGA 5E8OB 1J1OH 2YOCA 1J1PH 1U3HA 5ABDE 2R15A 3W11C 1T7XA 3D69B 5MERB 2PXYB 3GRWA 5C0CA 1ORSA 3NPSC 4MZ3A 2YXFA 3S36L 4Y2DD 4JFDB 4BH8A 3TNMB 3CD4A 1T1YA 1BZ7B 1QTYT 5J13C 1QNZH 4O5LL 1QOKA 4H0HB 2L7UA 2BSRB 2CIIB 3FKUS 4WI9A 3SKNA 1D6EB 5C0AB 4J4PC 3PGFL 5I30L 4FABH 5IFAL 3OF6D 4YHPA 3TH3T 3HE6B 5DYOA 1T66D 1ZKAA 4XVJH 5B39B 3HCVB 5D2NB 4ERSL 5IMMA 4Z0XB 1LILA 2V2WB 1YC7A 1OAKH 1CBVL 1NMBL 4WY7H 5FGRA 2YD5A 1R3IH 3WUWA 5DZOA 4WW1B 4P0DA 5KSAB 5CP7A 1BQHB 1EHNA 3GSRB 1NGZB 2R29L 1GVIA 3LEVH 5IJKA 4JDVA 5GGSY 3QPXL 2X4RB 3G5ZB 4RGNB 4GRLA 3THML 1JNHA 4IRZH 2Y06H 2A0LC 5CEXA 3AVEA 4LP5A 1BVZA 4MA7L 4YO0A 5C0BD 3DX9A 1KT2B 1KJ3L 3IETB 5GJTH 2GJZB 3L3GB 4NHCL 1JF1B 2BMKA 3SDCC 1Z3GL 3IFLL 4GBXA 1G7PB 4HMCA 5CS7A 1N0LA 2BERA 4LMQI 1CK0L 4ZUTA 4XP6L 2X9WA 4BZYA 2WBWB 5I1AA 3QIUA 1KGCD 1D3CA 3HG1A 3QO0B 1KN4L 4LBEB 4KROB 2OR9L 4X99A 1T7ZA 4E41A 5KS9F 2D4DA 1AKJA 3HZVB 5E08L 4FG6D 2L7JA 5I9QB 3MJ9H 5IFJA 4HHAA 4NJ9H 5D5MA 5EZLA 3SBWC 4FTVE 4NIKB 4DVBA 2OS7A 3CH1A 3S34H 1QBML 1IKNC 3OX8B 4U1HA 1Q38A 2IBZX 3OXSB 1DN0A 4WFFD 3C9NB 4D0BB 4P5KA 3MRQA 3C60C 4LDEB 4KAQL 1CF8H 3T1FA 4XCCH 1OB1A 1J88A 3T09A 3EOAB 4LKXB 1F3RB 3ULVC 1U6AL 4XT1C 4ZSOA 3L95A 4HPYL 1P5UA 2A83B 3SDDB 1CICD 4YFLF 3W0WD 2VDKH 3QXAA 3MLZL 3QISA 2QQLH 4PV8A 1U3HB 4XP5L 2Z8RA 3QQ3B 1FIGH 2WIMA 3K4DA 4NQXA 3RBSA 4LHUB 4MJ2A 3W9DB 3QIWC 5J56B 4PB0L 1FP5A 1EEYB 3D18A 3LPFA 2R2EB 15C8H 4KMQA 1HYSD 3WS6A 1RUQL 3ZKND 4PR5B 4YDKH 1MNUL 2VKXA 3JVGC 4X83A 3P11L 4JKLA 4Q2ZB 4HCRL 4PGCB 5ACZB 1X5FA 1VACB 3QEQE 3SE8L 5FUCC 5H35B 3TO2B 2BXYA 4MA3B 2RGSA 1YYLL 1FZMB 3H9HB 4LLDA 4PLJC 1JN6A 5HYJA 4Z7WB 4TSBH 3G04A 3VD9A 4Y16A 4CN1A 4AENA 5E8PB 3RVVC 1G1CA 1QO3B 5H37H 2YKLH 5DVLA 3L3HA 4M00A 1EFXB 1DN0B 5FYJU 2OLDA 5DJDA 2C1PA 1K4DB 5D1ZD 4HWUA 3RPIB 5IF0B 3NFSH 1WLHA 3QSKB 3SO3C 1OAQH 2X4QB 3OKNB 2DJUA 3RWFB 1N3NB 1N2RA 1M4KA 3FZUC 4OZFB 4PJCF 3V4PL 3OV6A 3BEVA 3QDGB 2GTZA 3O4LD 5LJYH 2HFFA 1G6VK 1PX3A 3VXRE 4YK4C 4IBLT 5EO0B 4EDWH 3QEUB 5IM7A 3CU1A 2DD8L 3NTCL 3TCXA 1SJXA 5DD0H 4RBPK 1NMAH 2WINA 4XX1G 5C0RH 2A6JB 2R8SH 3KPTA 3U7YL 2C3HA 1FJ1B 4EOWL 1SYVA 3BRFA 4U6YA 5IVOA 5C7XH 2BCKA 4OFPA 2CR6A 4MQXC 4UT6L 4JN1L 4ORGA 2D3VA 1CXEA 3H42L 4XPGL 2GJ6B 2YEZB 4LNRB 4NRYB 3ECBA 4OGAD 4HFUL 4WUUD 1EH9A 4OSUH 5CEZD 3MLSH 1KACB 4G42A 2DLFL 1LK3L 2AJYH 2EDKA 4K9EH 4AEFA 3OGOE 1BVLA 3SGKA 5TPWH 1FBIH 3MQIA 4GT7A 3PWJB 2WUCL 1WBXA 3QCTH 1RIHH 4PRBA 2YSSB 4GW4B 1HHHB 1CDUA 3CMOH 3MV11 4FQXB 4Y89A 1KTRL 1E28A 3MJ7A 4OIAA 5AWNL 3WXVL 2AK4D 1NC2D 1ZANL 1PG7H 5IBTL 2R0ZH 3IDJB 5EU7E 5D7IA 4E5XA 2BVEA 1S78C 5GRJH 3MYZA 1QBMH 1QRND 2NY7H 3U0PB 5F96H 5K9OB 1OGAE 3HLAA 1A4JA 1G0XA 3EOTH 4G6FD 4UU9B 5EUOF 2YPLE 4Q6IC 1W0YT 5AG9A 2BHYA 3MV7D 1JF1A 2FATH 5HHOA 1NMCB 4QNPE 5ALBL 2MHAB 4R97C 3QXUA 3L3DA 1DDHB 2C7UB 3P4MB 3BP6A 3BE1L 5TF1H 5DHVA 1Z3GH 3IFLH 1TTFA 3QO1B 3WL9B 1ZHNB 1DLHA 1KJ3H 5E1AB 4WI6A 1GAFH 3ECBB 3DURA 4Y5XB 2JIXD 2MQ3A 2P5EE 4UOJA 3QEQA 3LSOA 3LKOB 3F58H 4NRXB 5ID0A 5CIPB 3L7FA 4V1DB 4Y4FA 4BQCA 1BREA 2CMRH 1JF5A 2NNAB 3SDYL 3CUPB 2E7MA 4R9HA 3EDEA 4HK0B 1NMBH 3BGAA 4YBQD 3FO9B 4BH8B 2B1AH 1KJ2B 3F12B 2WINB 4Y2OA 1BZ7A 2WQRA 5F89A 4ODTL 1HHGA 1YY8A 5FUZH 3FAXA 4P23D 2XKSA 4DKEH 2OZ4A 4P9ML 2ERJB 1QFWI 2AKRB 1MRFL 1PFCA 1YN7B 4M7ZC 1FN4A 4LU5L 3PWNB 1XFPA 1FH5L 4RMUA 1CU4H 2A9MH 2VUYA 3HPLB 4R90L 3SY0A 1O7SA 4I0PD 4JFHE 2ED8A 2W59A 4QRQA 1KPVB 1YDPA 1HKLH 2AABL 4Z7VE 3GMMA 4Q2ZA 5JQ6H 2UWEE 1NAKL 1SBSH 3DV6B 2OK0L 4C4KO 4A6YB 1RUPL 3BQUA 5JW4N 3VI3F 5HYJB 5FYLH 1A2YA 1CTOA 3DV4A 5J1AB 3QFDB 2EIZB 4PJCB 4YFEA 3ESUF 1WWAX 3PWLA 3LN9A 4JVUA 5JIKA 1A3RL 4HULB 2ZCKL 4LSSH 1U95A 4YFDB 1ORQB 2F74A 4HIJA 1BECA 4HC1H 4PIRF 1RZFL 3O4OB 5DLML 4KJYB 1H3PL 3OKKA 2XYCA 3GK8H 4HBQA 1ZGLB 2ORBL 4F8TA 4HZLA 3RWIB 4XP1L 2PO6D 43CAA 1JGDB 4ZFGL 2BVOA 9CGTA 4FQXC 1ZVYA 3EJJX 4RMWA 4URTB 5EDXA 1TVDA 2Z31B 3OB0H 4YGVA 3UZEA 5HI4C 3V4VL 4RZCB 4AMKL 4HC1L 2CLVB 3DMMC 2IGFH 1KCSL 1FYTE 1RJYB 2NTFB 1QLRB 3WL9A 2ZPKL 1B88A 3O3EB 3VFTB 1TDQA 4U1JA 4M6ML 4H25A 2FIKB 3EOAA 4LKXA 4ZUVA 2I26N 3N0PB 3WFBH 1K6QL 3ARDD 2XTJD 3GSUB 1FL6A 3NFPB 4K94H 3MGTA 2NX5A 4OZHE 1ETZB 3UTQA 4ZS7L 3U30C 3V5HB 3MA7B 2A1WH 5IT2H 4KY1H 1XF1A 2XY1A 4PJ9A 1CU4L 2A9ML 1C08A 4MJ6B 1OF2B 1EZVY 3QWQB 4K3DL 3RZCC 4Y5XC 3MBEB 1BEYL 3D3VD 3C6LB 5ISZE 4DKEL 1T0MA 1M7XA 4AMKH 5TJWK 5KAQG 2ZOLB 12E8H 4LCWD 2YMXH 4PRHE 5B8CC 1OW0A 2DLHA 4PJBE 2HMIC 3EZ8A 4Z76A 5FA4A 3O3AA 4AL8L 1C5BH 5CZXC 4HK3J 4RMRA 5I6XC 1NUNB 3GK8L 5EPMB 2NY5C 3C6LC 1P6AB 2W60B 4GXVH 5FFLA 4WU7A 2QR0B 3NCJH 5GZOD 5D8JL 3HZMA 1HH6A 3V6FA 4JAMA 4NHUB 4X98B 5JHDA 4K3JH 2CKBH 5D1QD 5SV3A 4E42B 5F9JB 1U8LA 4H1LG 4ZO7A 4PGEA 5F3BB 1XGPA 3QZWA 1EDQA 5CFHA 5MEQA 3DO3A 4LSDA 4R7DB 3VRLF 2NY0B 3NH7L 4R3SA 2OR7A 1AP2B 2A38A 3VCLA 4U6VL 3F7RA 1JPSH 5E56A 1RZKC 3PJSA 5DJ8A 4XNQB 5IUSA 1YEGH 2VXTH 3CUPA 3B9VA 4KZEL 1MREL 3TM6A 1JYWA 4QYOB 3D1MC 2XXCB 3ZKXC 5ALCH 2AAVA 1S7TB 4OZHB 4XWGL 3U2SB 4OIIL 5JIIA 1XH3B 2Q86A 3ARBA 4KK8C 1F11A 1ZLSL 2D4FA 4YHNA 2YUWA 1U41A 4GKSB 1CDJA 2H32A 3OAZH 1R5IB 4H26A 1YY9C 2W92A 5GHWL 3V6OE 3VXRB 5BJTB 4BSVB 4PJDF 3B9AA 5HGHA 5I0DA 4K07A 1HN1A 1FBIL 2VNCA 4HS3A 1PD6A 5I15L 2HTKD 2ZSWB 5F1IA 1HINL 3F58L 3ZZ1A 3VGAC 2EH8H 1AE6H 4JAMB 3AM8C 1YY9D 4I5BA 3VXSA 5H94A 2OJEA 1MH5A 3FQUA 1U8LB 5ANMA 5CWSA 3HNSL 2XIDA 1H3GA 3H9ZA 3MLRL 4PRID 3WHE0 1G9NC 4QOKE 1ZEAL 3FAWA 5T5FL 5L9DL 1PYWA 4QHNA 2IG2L 2QSTA 3T0XA 4WNQB 1ZOXA 2XRAL 5C0EB 4DUVA 2DICA 3F7PC 4U1NA 5GGUA 1I3RB 3NTCH 2DD8H 2BXZA 3MLYH 2CJUL 1R24A 1NSNH 3ETBF 5TF0A 1X4ZA 4OLYL 4YHZH 1HXYB 4ETQB 4XWOD 2F9BT 1AD0A 4CVXB 3WFDL 2AK1L 1U8HB 3QJFA 1LEKA 4EDXA 1GZQA 3OXSA 2VDMH 2MFNA 4IOFC 2CDEB 1B0GA 1JHTB 4IDJH 5DA4A 1CD9B 2GJ6D 4YHNB 3MBXL 2ICCA 3GI8H 1CS6A 3SDXE 4HKXA 2H32B 5K9JL 2Y5TA 4NZUL 1J8HE 4Y1AA 5F3BA 4C56A 2DIAA 4NO0B 4Y4FB 4ODSL 2APXA 4PJIB 2WUCH 5EN2A 4JPWL 5IMKB 1K3IA 2CO6B 2NY6B 1JK8A 4I9WD 1KEML 4CN6A 1BQHG 2FL5A 1W0WB 4PJ5B 4O9HL 2DLFH 3L1OH 2HJLB 1FL3B 3N1QC 3VFNB 2ADGB 1S9VB 3MRRB 2ILLA 3UROR 2YPVL 1F6AA 2XFXA 3NN8B 3EFFB 3QUXD 4WHTB 4ELMB 4WJ5B 3NZHH 1BZ9B 3MRKB 1JNLL 1RAMA 5C0GB 4NSKA 3QUXC 1OARH 3KPSE 1F45A 2EE9A 4KJWC 2J6EL 2Q8AH 1KCKA 4RCAA 1YNLL 1IGIH 1G6RL 3HZKA 2V9RA 1JPTH 4P3WA 2OL3A 4KHTH 4U1MB 4DGYH 4JO3H 4HS3B 3TYFB 1FO0A 5LG1A 4CVXA 2IH1B 1A4KA 1EK3A 2DL2A 2WM0A 2KQMA 1JCKA 4YBLC 4Z76B 4U1SB 2DWEA 4XVSH 3VFMA 1CF8L 4OF0A 4UQ3A 4KDVA 1KNOB 4POZC 1MAKA 2XG5A 3T2NL 3QRGL 4WI3A 3QJHB 2NZ9D 2X70B 3F7YA 3KYMA 3PDOB 1DQQB 4KDWA 5AUMA 2YKLL 2BC4B 1F3DJ 4DJMA 4QRSB 1I85C 3DO7A 3OJDA 5D1XB 4XBGA 2HRPL 3EO9L 2H6PA 1G6RA 1H15A 3AMLA 5F7EL 5IIEB 5GZNC 1TIUA 5E8NA 4MHHI 4P5TD 1E6OL 5C1MB 4B53A 4XP6H 2E5EA 4FS0A 3GHBL 4D0DB 3I6GB 4GSDL 3AB0C 3D25B 1NGXA 2HRPH 3EO9H 2XPGB 1B0GB 1JHTA 4XCEB 1I7RB 2GSIB 5TE4H 3OF6A 4PJAE 4S1RL 4U6TA 1RUAH 4J7RA 3S37H 1OAXL 1N5AA 3M17A 4QXGL 4OD1H 2VAJA 1NC4A 4PJIA 4S1SH 2VDKL 3BZFA 4QRPE 1Q9WB 1O5DT 3O2DA 2FGWH 2G5BB 2YUZA 5B38G 2B4CH 3DIFB 4JG0H 1YEKL 3A6BH 4L4VB 1FNLA 3IDGA 4NKMA 5CMAA 4HC1A 4XCCL 4PJFB 6FABL 5FYJH 4KTDH 1MI5E 5DF0A 4LBEA 3JTSB 1SHMA 4XCYB 1VFOA 4DKFL 5I73B 3PGFH 3OB8A 5IJVB 1KIRB 5I18H 1YPZA 3VG9C 1YUHA 1AHWA 4F80A 5H94B 2BVTA 3QXWA 3FFDA 3NIFF 3OWEA 4MAUL 1W8NA 1U3YA 4LL9A 1NBYA 1PQZB 3FOMB 4P57B 1KXTB 4YBQC 4YFLI 5GIRA 5C07A 4PLOB 3I9GL 2NY2D 1HSBA 3RGVD 1NDMB 4W6WB 2W60A 3GMPA 1K5NA 1BBJA 1G7MA 4NQUA 4QRRA 4JPWH 4OF8A 3RU8L 3ARFC 2WWMC 4Q9CA 4YIQA 3BXNB 5TDOA 4KK6D 3FN0L 3NIDE 4UTBH 3SQBA 3QWRA 5DK0B 3VXUE 1T0NA 3ZE1E 3MBED 4YZFF 3HRPA 4EI5A 3QB7C 3BH8A 3MRCB 5CJ8A 4UV7L 5I1JL 3RVWD 3QULB 5FDWB 5F1OB 3IU3B 4XBPA 2EXWC 2W9EL 3VMNA 4XBGB 1PZUB 4G7VL 3BFOA 3PXHA 2ZUSA 3F12A 3CFJA 1QPXA 3V0VB 2CO7B 2CK0H 1J05B 3EGSA 2YS4A 4LVEA 1ND0A 4PJHB 2EDRA 2BSED 1BQSA 4Y5VA 3CIQA 3DWTA 2J5LB 3NFNA 3BPNC 4J3TA 2XZZA 4KRPD 3MO1B 4OF7A 5EU6E 4OBRA 5SWQB 4O5LH 4UDUA 5GS0C 1XGQB 3QDJB 3RTQB 2DKSA 5IESL 3O6LL 2HJKB 3VXRA 5BJTA 2GUOA 4YK4B 2BNRB 5BVPH 1CFTA 4G43A 1QFOA 1P7KB 3UEZA 1HQ4B 2XTJC 4IRSC 1LO2L 1JYNA 1HINH 2Q6WB 4BZ1L 4G9FE 3TVMC 4A2MA 1RMFH 2ZUVA 4YO0B 4M7ZB 2HG5A 3DX9B 1QSFE 1MCBA 2Y1VA 3BWAB 4Q6YA 2GFBB 4X4XB 3ZDYF 2ZUWA 3AU1A 1XGUA 3VXNB 3VXQA 5GS3A 2N56A 2WP3T 4HKBA 4YXKL 1RULH 4KTYA 4OF6A 4MQXD 3JSSA 3DVNB 4JKPL 2UVFA 4M1GH 1ZHLA 1LO5B 1U93B 3PDOA 1J0ZA 5FHBH 3RUGB 5I71C 4R2GD 1ADQA 4S2SB 1I1YA 2W0FB 1F42A 3MRHB 1DR9A 3VMOA 4OGYH 4FQPA 3MYJA 3RY4A 3ARZA 2BSRA 3DVFA 3D5OF 5LXGH 3QCUL 5D7IF 5ICYA 3OJ2C 4NPYA 1DQJA 1YPZF 2Y72A 1T1XB 4D0CA 4Y4HA 3E8UH 2WAHA 2WIIA 1OP5H 4JLRA 4ZFFA 3WIIL 1K8IB 4PJIE 3OL2A 5E00A 3QP3A 2CLZB 4Z95H 5ADPL 4DGIH 1X5YA 3QXAB 3I3BA 4K3JL 3AUVA 4XAWL 3UTQB 3WD5L 3O2VH 5JW4Q 4NQXB 4D9LL 2LU3A 2XKNB 3GSNA 4LCUA 1EO8H 5DFTA 4MD5B 2CQVA 5INCB 4ZQKA 3QDJE 1NLBL 4KKAD 3CFJB 3BSZL 4PJGF 3ALPA 4WHTA 2DIBA 2J8OA 2BK8A 3SE4A 4MNGA 1NLBH 3DTXB 1GOGA 4LGPB 2EDXA 1I8LA 4KUZL 1EO8L 5F6HJ 4NKMB 4ZD3H 2YUVA 1VEOA 5A2IH 1JUFB 5HVHC 2A9NL 1UCBH 5IQ9B 3ZKNC 1D5BA 3GMOB 4X4MA 4JM2C 1QYGH 1NCCL 1UA6H 5ACLA 4NQDE 3QXDB 1C5DB 1CLOH 4PUBH 2VH5L 3ZHKA 1CXLA 1B4JH 1Z0NA 1NGWB 1FLRL 3SCMC 3D85B 2VLKD 2K7PA 3S5LB 1BZQK 1FRGL 4MCYA 2Z93B 4DKDC 3QEHB 2NX5E 2VLME 3EDJA 3RX5A 2VXSL 3H3KA 4JEGB 5KSUA 3Q6GH 1WIUA 1MJ7H 2QKIB 5F72S 3UAJC 3ALXA 3QDHA 3ORJA 4Z8FL 2PYED 4JQIH 5IFHL 1MIEH 1UZ6F 5E7BA 4HJJH 1SEQL 4KJQC 4BK4A 3VG0H 2BRRL 2EYSB 1GGIL 1B90A 4ZSOB 3ULVF 3UTTE 5BOZG 2DQCL 2OTUB 5KSAC 4OUUB 3KHOA 5BS0E 1CFVH 2RQ8A 4M7KH 4JGJA 3AAZB 4EKXA 4KRMB 3G5VA 3BD3A 2X10A 2IAMA 4MD5A 2Z8SA 4WHDA 4AJ0A 4RQQA 4XNUH 2VXUH 1A0QH 4XPFL 4OJFH 4PRNA 3RTQD 4BM7A 5F1KC 4GUPA 1FG9C 3FO1B 4JFZL 1F58H 3Q2CA 3MLVL 1ZT1B 1D6EA 3OKEA 3LY6A 4ZFGH 2NR6D 2DQIL 4BZ1H 3B4NA 4GBXC 1VFAB 5D2NE 4MYWB 4NKDB 5FYKH 3FO0L 1I7UA 4QWWD 1J05A 3O45B 5DLMH 4GKSA 4KJQD 3S3SA 3LD8B 3RDTC 1CT8B 1FGVL 2C3VA 4JFED 3LN4B 2RBLA 4QRPB 1XGTB 2A0LD 3S9DB 4NBYB 1J0YA 1YMMD 3UTTA 2H3NB 2DWDB 5BXFB 3DOSA 3UTPE 5C9JA 5GRZA 4B7LA 3BH9A 4OCYH 1UT9A 3VGEA 1AY1L 3M8OL 1I1RA 2XN9E 1KLUB 5EUOB 1IKNA 1JZ7A 3GMQA 3GB7A 4U1LA 3KR3H 1P9MC 4OD2A 1AIFA 5E70A 5M95B 3RTQC 4X6EA 3L5XL 3MV9E 1AGFA 4ZUTB 2ZWLT 4MNHB 1AJ7H 1RK0B 1KIQA 4IMKA 3BGMB 3WEXB 3BWAA 1RIUL 1EVUA 4ONGH 3RNKB 4ELKB 1C5CL 1XAUA 1JGLH 5HHOB 3BT2H 3HUJF 4J12A 1IGCL 1EFXD 3FOMA 3BJ91 4NNXB 4G8GE 4WFED 4Y2DC 3CVHH 5IFJB 2FLBT 2A73B 4N0UE 5D7LA 4KDTC 1TNMA 4UTBL 3UTSE 5FUZL 2IBGA 4H25B 2D0HA 3LZFL 1FJ1A 2BDNH 1EJ6A 4UBDC 3W11D 3RU8H 2X4UB 2QQKL 2ITCA 1LEKB 3QJFB 4EDXB 5T3ZH 4LFHG 1CD0A 3TV3L 3SDYH 4RBPH 1EA9C 3H7LA 4I0PB 3PWVB 4RIRA 3OGCB 3MRHA 1QPPA 2FCBA 3MRQB 4LSPH 4X9IA 1DFBH 1CI5A 1EAPB 2G9HA 1Q72H 2VJXA 3RJDA 2NY4D 4O2CA 4FXGB 4C56B 4GG6F 4KI5F 4I3RH 5TH2B 3V6OA 4Y16C 2WLYA 4KVCL 2R2CA 4GAYA 1DQML 4KV5E 4Z7QF 4IM8A 3U46B 1Y6KR 1D5XA 1X7QA 3D0LA 4YHOH 4LHJB 5ADOL 3KPRA 3R8QA 5HHPA 1CDGA 1EEYA 5ACMA 1S9VA 1H8OA 2DBLH 4L8SA 2JJWA 4UB0H 4AEIH 5IHLB 4LIQH 1NQBA 3UYOD 1YEKH 4TNVF 5FM5O 4CBPA 1OGAA 2X44D 3NBNA 4Y5VB 5I8KL 2P43B 2AKRA 3R06B 2MKWA 5JIHA 5J9PA 1UM5L 1AGDB 1WBXB 3K1DA 4TVPL 4FQ1L 4DEPB 1S3KL 4PJHF 5GRYA 4QXGH 1WTGT 4HWZB 3FQWA 2GUOB 2X4RA 3G5ZA 2XZAL 3HC4L 3IT8D 4MJ5A 1DEEB 4HIHB 3KYKL 2YPLD 5DQJB 1CIDA 3C6SB 4RFEB 2B1HH 1X5KA 4OKDA 1DBMH 3KPMB 4U6HA 3QXDA 2D0GA 2YA1A 3BO8B 2IADB 1G7JA 4HV8A 3OPZL 2G5RA 3QFDA 3QCTL 3NIGE 5IB1A 1CDYA 1IC7L 3EDKA 5LGHH 1QLEH 2HWZH 3BOVA 3R0MA 5KS9E 2NR6C 5DC0A 5KSUB 5H8DA 2XWJA 3JUZA 5B39G 4M3JA 4KJYA 3ARGD 2FZ3B 4JFQB 3HAEH 2V2TA 1Q0YL 4MXVF 1I3UA 1HNFA 1H9VA 4DOHB 2D7TH 4KK5C 1FFPB 3T77A 4OLVH 2VXVH 2ZCLH 4WI7A 1NC2B 3DRQA 4WIQA 4Q9QL 1AXTH 3D87B 2Z31A 3GHEL 4UV4L 5JPNB 5E2JA 5KSAD 4JRYE 2R56H 4NNYB 2X4NA 1IM3A 1CG9B 3LSOB 1U8PA 3QEQB 4H1LA 3HC0A 3BYTA 2DQHH 1HH9B 1JE6A 1ZSDA 1TQCC 4HUMB 4NQED 3TBWA 1G9MC 4NP4H 4NRZB 4RNRB 3BIBX 2E8YA 4APQB 2NNAA 4HWZA 4WCYH 3OKEB 3WIFB 5IBUB 3EO0B 3QIBA 1DL7H 5C09E 2NY6D 4M6NH 4XB7A 5C6TL 3V6ZB 4UNUA 5ITFA 3TT3H 1QACA 4P59L 1DSFL 3FTGB 1CGSL 1N6UA 5DHYA 4KRPC 1XGTA 3HB3D 4N1HB 3GSQA 2ICWA 4P46B 3MUJA 5HHQA 3EYFA 2FIRT 1PYWB 3TNMA 1M1SA 5ACZA 3KPRB 4M1CD 1AQDA 1M6OB 2APVA 1OF2A 1U2CA 4HLZG 4L5FL 3P40A 2YD3A 5E8EB 1J12A 1I7ZB 5HVGB 3BUTA 3U9PL 5E99H 3L1OL 4IMLB 2CRMA 4XRCB 4X7CC 1NGPL 1YJDH 2EDQA 1QLEL 2HWZL 3ARRA 3MV8A 2CSPA 5EORH 2KDGA 4J3OC 4YXLL 1AGDA 1H3WM 1WZLA 2BNQD 3OR7A 1QFPA 3RPKA 2DQJH 3AXLA 4P2RB 1SMOA 2ICES 4YDKL 5FOBA 1KCVH 1CGSH 5CP7B 1WEJH 2SEBA 4JZJC 2HYMA 1R3HA 4R0LA 4JREC 1QEWB 3HC4H 3V5KB 5GS2H 1ZSDB 1U8QB 4JKKA 2CLVA 1WFUA 3SHSA 5D7LB 1JPFA 3WFDH 1SVCP 1MCEA 5FGSA 1S3KH 1F8TL 2QV2A 3VFPA 1CIUA 2QQLL 5E2VH 1UM5H 2C1OA 4LLAA 2HT4D 4PV9B 5K59F 2VL4A 4RRPG 1TMCB 1NSNL 4RGMC 2EYRB 2CIKA 5IWLC 3DARA 1LP9A 1TZHB 3PGDB 1LE9A 1EXUA 1L0XA 3P0VL 4IDLA 4HUNB 3NFPA 4X4ME 2FZ3A 2VMFA 4JFQA 4Z0BL 5K33A 3RGHA 1AP2A 4YX2H 5L9DH 1U8IB 3WBDA 2ICWB 1IEBB 1U8HA 4RMQA 4Q9QH 4MLSA 4BFGA 5JTWA 1ADQH 2D7TL 1YEJH 2ICEA 4AIOA 1DBKL 1FORH 4Y4KD 1IGTB 1BF2A 5J89A 4NQEA 2FECL 3BIAX 4F2MA 1AE6L 1QKZH 2F19L 5C3TA 4QRUB 4L3CB 1KN4H 3MV8B 3FJTA 4UIMA 1QFWM 4NO0A 2I9TA 3TZVB 4U1MA 5I15H 4N8VB 4S0TD 1IC7H 4PRHA 2EDOA 1N59B 4ZFZB 4JHBA 4PGBB 1YDPB 1P4IH 2BNRA 1MFAL 3GNML 2PTTA 3Q5OA 3DVIA 4NHCH 2ZSVB 4WWID 3I50H 4HDIB 4JFPB 1GC1H 3P9MA 5EC2B 3JUYA 2O61B 3JWOH 5HYJE 4TNWF 5HJ3B 1A5FL 3BHBA 1N6QL 2R29H 1MREH 4PJCA 4KZEH 5KSVA 3T0BA 2OXGA 4LAJH 2AJUH 4U0QB 3A67L 5T5NG 2ZG1A 5L8JB 5I8KH 4JHZA 1MQ8A 2YA0A 3DX6B 3RVXC 4OF5A 5DJAA 5EPMA 4XVJL 1BLNB 3OKOA 3BEWB 1A7QH 1MVFA 2EIEA 3FT2A 5FB8A 1U42A 2K3TA 3KLHC 1U8OB 3MR9B 4I77L 3RUGE 4HXAH 4LSQL 4HQQH 3SDAC 3MBEC 2Q76A 3SKJH 2VLJB 1WBZB 1XGYL 1QO3A 4CMHC 2VZVA 1IVLA 2ITCB 4U31A 2ZCHH 3FONB 4X80H 4OZIF 2D9CA 3E6HA 4TUKH 1X5JA 3TBTB 2F54B 2MOVA 3TBVB 1A7OH 5C09A 1UVQB 3PHQB 5A40E 4PRHB 1I1AB 4XNZB 5JORB 5BV7C 4A2LA 1BQLL 3TV3H 2X4QA 3RWFA 4GRWF 1SJHB 5B8CA 4H8WH 1EO7A 4YBLB 3FQXB 1MCRA 1S9WB 3QUYD 4GS7B 3QHFH 1QFWH 4AT6A 4AH2B 1NBZB 4PS4H 1X7QB 3OAZK 2M1KA 1ORSB 4DZ8B 2LU7A 3WO3B 3VW3L 3RIFF 4YHML 3WIHA 4FHBD 3Q1SL 1BEYH 3BT2L 1D9KC 5ITBL 3RQ3A 4AM0B 1CE1L 4JZNA 4IS6B 2AQ1A 3SDAB 4BQBA 4NT6A 4NSKB 1AXSA 3L5XH 3PQYE 3HE6A 3UC0H 5I66A 4Z7VA 5SWZE 3GMOA 3RKPA 3R1GH 4L9LC 2D7NA 5D7LD 1B2WH 2V2XA 5D70H 4K94L 4P3DB 3ALWA 4PGBA 3K4AA 4NQCA 5IB4B 5BRZE 1BX2B 3VXSE 2V5YA 2PR4H 1ZHBB 4OCYL 4M4RA 4Y5YC 1XF2A 2ADIA 5C0DA 1AGBA 3IGAB 5KG9B 2EIBA 4HS6B 3G6JB 1QSFB 4ZOAA 3IAQA 2ZP0T 3GIZH 5GGVY 1SVZA 4PRIB 5E1HB 4HT1L 1FZJB 1OM3L 1RQ5A 1JHKL 3DI2B 4ZPVA 1YEFL 1BD2A 5JHDB 1UCBL 4XWOC 2PYEB 4IIQC 1MFEL 2W1NA 1PAMA 1UM6L 1BPVA 1RZGA 3ILQD 1YEHL 4AT6B 4ETQA 3AAZA 5IJKC 2P5EA 1F4YL 4D3CH 3K8MA 4HCRA 2VABB 1JGVL 1LP9B 1TZHA 2CR3A 4M93C 1BFSA 1KG0B 3D2UA 3F7VA 2AXGB 4FFVC 5FYLE 1E4KA 3WKNA 4PRPA 2N7BA 2YD7A 2AJSL 3AM8A 4IS6A 1RZ7L 4R4BA 3EOBB 4HF5L 2Y5TB 1RFDL 1MLBB 4FZ8L 4XAKE 3DXAD 2NTSP 2BP3A 2OL3H 1CGVA 1C8PA 5D2LB 3MGTB 1Q1JL 3BJLA 5E1AA 3HN3A 3WUWB 5JPMB 3CMGA 3O45A 1TJIL 3QWOA 1BM3L 1L0YA 3O41A 3X13A 3CFDB 4F7EB 5JQ6L 1W0WA 3GJFH 4TUKL 3VDBA 3JWDC 3V2AR 1ZMYA 3O6FD 3H9SA 2VOTA 3IF1B 1YC8A 4XP9H 4LSQH 4HS6A 5B4MD 1HILB 3LIZH 1V05A 1OTUC 1B4JL 4XCNB 5LWYH 2HKFH 3LS5H 4JZJB 2CDFA 2GW5A 1H3XA 2YZ8A 4G8GA 4ZAKB 4NJAL 3MRNA 1LK2B 5EU4B 2XOTA 3H3BC 2B39A 4LKCB 4TSAL 5HI3D 5F9OL 1VGKB 3P9WB 4NBZB 3HRZB 3EJZC 4JFDE 2HJKA 4WFHE 3ZE2E 2IMMA 1F4WH 4FRWA 4PJXB 1JI1A 3I6KB 2R4RH 1NANH 3NGBC 1I4FB 1KIPA 3CNKA 1QBLH 5GGTH 3TN0B 1AC6A 3S35L 4PG2C 1A5FH 4H1LH 1E4WH 5ECJE 1EEUA 2L4OA 1URLA 3U7WH 4FFZL 3GMPB 4JPKH 5E2UL 5KW9L 3JVGA 4KRPB 4N8CL 4X7SL 5DC4B 1FDLL 1IGFL 1MFAH 1P4IL 3GNMH 1OPGH 2ATPB 1BIIB 5TF1L 3VFPB 3P73B 2Q20A 3BE1H 1HI6A 1JGUL 3NGBB 4QHMB 1UH4A 5F7WC 4PV8B 3LS4L 1UWGL 5ALBH 3S5LG 2F8XC 4PP1C 3OMZA 3WDHA 3LQZB 2FATL 3DMMD 1UENA 4OGYL 5F93C 1FORL 3REVA 1I1AD 1Q9KB 1HYRC 3KJ6L 3FFCB 1P4BH 2ZUTA 5E2WL 4DW2H 3D0LB 1WC7A 2VISB 3D25A 5F96L 3ET9F 3IKCB 3OKYA 5C07E 3TLRA 4UILH 3RKDD 1HDMB 2EC9U 4M1GL 3MLXL 1DQDL 4L4JA 4AH2A 4JDTH 5A2FA 2UZIL 2VLJD 5D7LE 2IFFL 4OCNC 3TYGH 2P49B 1T22B 3CJJA 5DC9B 4YHLL 4LVNC 4MNQD 1N5AB 3M17B 4C57C 3GSRA 2OJZH 3OJVC 3FQWB 1F02I 5C08B 4OLUL 2V7NA 1LK3H 1RMFL 5MENB 3MRGA 3V95A 4UIKH 4LCUB 5C0FB 3QDAA 3K8KA 3MRIB 3RL1B 4JRYA 1GCFA 1HXMA 1ETZA 2GITA 3P4OA 2HN7A 1Q94A 3IRPX 3ROOA 1FCCA 3TIDB 5DD6B 1HHHA 4EUPB 2D31B 1DBBH 2AXHA 1XF3A 1P5VA 3RVUC 4XMLH 1CXFA 4I0PC 1AGBB 3IGAA 1R3KB 3CFBA 4PTTA 4LKCA 5I18L 1CE6B 1HHJB 3LPGA 4G3YL 1MHPL 3FQRB 3LD8C 4HIXH 4IHOB 5T1LA 2WW8A 2BC4A 4DKFH 4XH2B 2X6MA 2HJFA 3MLTB 4GG6A 1WZMA 3A6BL 3DI3B 5AAMA 5EG6C 4Y8DC 3TFKD 2FGWL 3U0WH 3S36X 4YQXL 3MOBL 4NZTL 1IARB 4PJ7F 2BNUB 2W0FA 4QHKJ 5J4MA 2A2QT 4KKCD 4MHHG 4UT7L 4YHPB 2Z4QA 3HE7C 1NGYB 1KB5B 4PREB 2QLVB 4P2OB 1OAXH 3BWUC 1CT8A 1S5HB 1KBGH 4I2XE 1ZV5A 1FO0L 3N1MC 4QOKB 2MNUA 2LVEA 4XGZB 2M26A 4WW2C 2PW1B 3VFSB 2KQNA 4J1UA 3ZTNL 3MRFB 3RNQA 1S7XB 1QFUL 4N8VG 4HUUB 2Q7NA 4GW4A 3VH8G 4U1GB 5JDSA 1BM3H 4LK4A 2W9DH 3X13B 1YMHB 5HGAA 1CL7H 3TIEB 1AR1C 4RAUB 3STLB 3C08L 3UTZB 4DK3A 2V17H 1CVRA 3MV8E 3MUY1 2XKUA 1OVZA 4X6DE 3DUUB 3ISWA 3ARWA 4P2OD 3RAJH 5HYQA 5EBWB 3G08A 5JO5B 4ISVA 3QCVH 4X6CE 1Z9OA 3IDYC 3HZKB 4OV5B 5DJ6A 5E2TL 2R1XB 4D3CL 1QR1B 4C55A 5CSGA 1UJ3C 4M5ZH 2PF6A 1S7VB 4UDTA 5C9JB 2C4FU 3NA9H 5IROA 2FEEL 2OM5A 2AQ3A 3AY4C 4Z78B 3UBXG 3S97C 1HNGA 4JDZB 4HPYH 1K3ZA 5DRZB 3JTTA 1JWMA 5E8DH 4DN4L 4P2OA 2JJSC 4MA1C 3LKSB 3LHPH 4HAGA 5EA0L 2CKNA 2I60H 4PRPE 1N3NA 3RL2A 4P46D 4S1RH 2P46B 4ZTOH 5I1IL 3MNWA 3B9KD 1IFHH 3PABB 3BP4B 5IHZB 1J8HA 4A6YL 3IDMB 4GW5A 5K93A 3I85A 3QUXB 2DMCA 8FABB 5E24E 1QP1A 1KFAL 5CJXC 1HE7A 5E08H 1I9RL 5EU3B 3Q0HA 4NO3B 5D70L 3EJYD 5T3XH 1LO0H 1Z0MA 4QHNB 3NZHL 3IXTA 4GH7B 5DTFB 3D18B 3LH2H 5CEZL 1XT5A 4TRPL 1DUYA 1UJ3B 3CDGA 1WAAE 4JQVA 5AZ2H 1G7LA 1NBQA 4PBWD 5F7EH 5DJXA 1U8MB 5HYQB 4G9DB 1ZHKA 3SDCA 5F71A 1F4AA 4YHMH 2I07B 3LV3A 3UO1L 2HVJA 1J10A 4M02A 3QPXH 3RVUD 1R5WB 2VDPL 3LEVL 5DQ9B 2BY1A 5FO7B 5JR1H 3B6SB 3B8SA 4HFWB 1UXSA 3V52L 3LKRB 4FQXA 1NUDA 2APFA 4U1IB 4HUUA 5IEHB 3TPUA 1E4XI 1Z9LA 4V2BA 4YHZL 3I2CH 4PLKD 5J1TC 3DMMA 4M6OL 3DTXA 1FC1A 4WFHD 1NGZA 3DGCR 1MIML 2VLKE 5I30H 4YR6A 5F7NC 1Z9SA 1MHEA 1PY9A 1X4YA 1IT9H 5D7KE 2D0FA 3BZ4B 3KJ4B 4ELMA 3RVTD 4PP2A 4Y4HC 1OP5K 5E95B 5T5FH 4JJ5B 1AJ7L 3OHXB 5E6ID 4KXZH 3QDMD 2LFGA 4JFFB 1JL8A 4Y0GA 3S36H 3QPQC 4IOSD 5IMOA 3HNSH 3SKUD 3PQYD 3KWWA 1S9YA 2DQGL 1IGJB 2ICWI 3B9DA 4ELKA 1BLNA 3KR3L 1UYWH 5IOPA 4Y1AE 4MNQA 4HEME 2GKIA 3TBSB 5F7YC 4OI9A 4BSWB 5IVZA 3VRJB 4R4FL 1JMZA 1FNSH 5D1ZC 2YR3A 2COQA 4KZDH 5GHWH 5CGYD 3L3OA 4NZUH 1FGVH 4EI5B 3BISA 2HFGL 3MNWB 2HTLC 5IB5B 4KMTL 5HHVH 4CW1A 4Q7DA 1JZ5A 4LCYB 1UC6A 1OW0C 5FYJD 3DSFH 1IAII 1XF5A 3V5HA 2VDML 3RVVD 1AKJB 2R1YB 1V8HA 1P69B 2DM7A 5I1KH 4ALAH 3SDDA 2FO4B 3SCMA 3QUZB 1E0OB 3EGSB 4FMKA 3X17A 2X42A 2H2SC 2NXZC 3IXTB 1WC7B 4OQTH 3Q3GB 4MA1B 4S11A 4HG4K 3H9SD 3O6FA 4OJFL 4L1HA 3E6FA 1QKZL 3INUL 1NEZG 4X7TA 2X4TB 2XRAH 3SY0B 2VITA 3FRPA 3IXAA 1P7QA 4Z7OE 3BN9C 2AEQL 4S1DC 5J11C 2DQCH 1S78D 5HDBE 3VXUB 5F3HA 3CVHA 1ULVA 4U1KA 1NDGB 4K7PL 3MPCA 5TFSL 1BWWA 3TWCH 3KVQA 5K9QI 5I1LB 2A74A 4P4KC 4HJJL 1RD6A 4TVSa 3BPOC 4JQIL 4PRPD 2DTSA 3MRGB 2BX5A 4CNIB 2IAMC 4R2GB 5HI5C 1SYSB 3GMQB 4LDOB 1VFBA 3ZE0F 5J3HD 2XA3A 5E2VL 4ZOBA 1DANU 2DMKA 3LEXB 1C5BL 4O2FA 2HLFD 3H2WA 3X3GL 3G6DL 3NZ8B 5FK9B 2ZUQB 1JJUA 4HV8B 1EHAA 4OGAC 5KTEH 1CLOL 4PUBL 4XNMA 2YMXL 4JRWA 4ODBD 2Y6SD 4PTTB 2DQUL 1CQKA 4ZTPL 1YMMB 4J23A 3FO2B 4BELD 1KIRA 3RDTA 2J8UE 3QH3B 3QA3B 4G6MH 1TVBB 3H3PH 1QSVA 2X4PA 2GT9A 2FJHA 4QY8B 1JPSL 1VESA 3OSKA 5EIVA 1QEWA 2VL5B 2QADD 3ARDB 3PWVA 3DHMA 1HK6A 3NH7H 3O2VL 3QUKA 1X5GA 3RWJA 3VRJA 3VG9B 4MXWH 5B38A 5C0CE 1PKQA 4CGTA 4WUUE 1KLGB 1MVUA 1KPVA 3TBWB 5FCUH 5I17B 4Q6IA 4KRLB 1J9CT 3I6LD 4Q0XL 1RUMH 5HDOA 1U8NB 3IJSB 1KCSH 4M6NL 1MI5A 3TCLA 2PO6B 2YD2A 5LBSH 3BZDA 1CFSB 5BZDB 2NXYC 4BFIA 1GGCH 5CEZE 2P8LA 1A3LH 4JO1L 3DROA 5C8JB 4JM2D 1BAFH 1K2DA 1DCLA 2VDOL 2R0KH 1I9IL 5D1QA 1LEGA 4WTXA 4PJFE 1LK2A 5EU7C 5GISH 3UDWC 3U30B 5L0QB 4WEUD 5KSBF 3C5ZC 4NQCD 3ILPB 1A7BA 2W65A 4YXKH 5CEYA 1LGVA 4N5UA 1KCLA 4MWFB 3VFRB 3QIWD 3X3FH 4EIZC 1YA5A 3E6HB 1VGEL 4KQ3L 3ZO0A 4F7PB 3BKMH 2NTFA 3DNKA 4E5XB 5FYJE 1SBSL 3O3EA 3VFTA 4NZRL 3REWB 2BHZA 4JHAH 1QQDB 1G7PA 2BVQA 4K8RC 5C71A 2XWBB