4FQ1L

Crystal structure of pgt121 fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
207
structure length
207
Chain Sequence
SDISVAPGETARISCGEKSLGSRAVQWYQHRAGQAPSLIIYNNQDRPSGIPERFSGSPDSPFGTTATLTITSVEAGDEADYYCHIWDSRVPTKWVFGGGTTLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab heavy chain
publication title Complex-type N-glycan recognition by potent broadly neutralizing HIV antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2012-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fq1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fq1L01
2ARJQ 1F58H 4R3SB 5C0AD 4JRXB 5DEGB 3TYGL 3IU3A 4ETQB 4FFZH 4IRZH 5BJTB 2KUTA 4HKJB 4ONFL 2PTUA 1HXMA 3BOVA 5IIEB 4RFEB 4LKCA 1OLZA 3R8QA 2H9GB 4TQEH 2DBJA 4J3OC 5LWYH 2NW3B 3I6LE 3N9GL 4DZ8B 1A6PA 1VKXB 2OQJB 1VEPA 4FP8H 4WUUE 1CIUA 4APQC 3SGDI 3OKEB 3TC9A 1ORSB 2VKWA 4XPHH 1XF1A 2OJZL 4YQXL 3OG4B 1UQSB 5FYJH 1C5CH 4PJ8C 5IV2A 4HS3A 5EZJA 4FFVD 3V4PH 2BNUA 5BVPL 1EMTL 5DT1H 2XZAH 3OAYH 4MSWB 25C8L 1QSFD 3IAPA 2APFA 1JZ6A 3FT2B 4O2EA 3F62A 3BPNB 3EO9L 4O9HL 4FQ1L 1J8HA 1PGRB 3GNMH 4AY0A 2YA2A 5SWQB 1Q9KA 3GBLA 4L29A 5KJRL 3DVNB 2NY7H 1F4AA 3IDIB 4DFIA 1I3VA 1I7ZB 5DHXB 5AYUH 2ZSWB 5EC1A 1NCWL 2DQIL 4R4NC 1JGEA 2NLJB 1V3KA 3SOBH 3FT3B 5JMRA 2V7NA 5I1AA 1LP9A 3DXAD 3O0RL 5T1LA 4LBEA 4CDHA 2DQCL 5E94B 3VFGH 1G9EA 4XVUD 2FD6L 2ADJB 3RNKB 1WC7B 3CDGB 4JR9H 2VB5A 4O4YH 1BD2D 3I3DA 4KUZH 2WAHA 5J6HA 2VN4A 1XCTB 3QA3A 1B88A 1KF9B 4H5SB 3SJVA 2VLRA 2DIAA 2F74A 1HSAA 2AXGA 1DLHB 1YY8B 4OGZA 4YHYC 2VDKH 3V7AE 1NJ9A 3OKKB 1N7MH 5BS0D 1TLKA 3FQTB 5AUMA 1H5BB 3Q5OA 4P4RA 5H8DA 2F15A 4ZTPH 1VFBA 3JWDH 3O2VH 3W11D 1HKFA 3O3EB 4QRRE 3HE6A 4FFYH 1UFUA 4X5XB 3KLAB 2UWEA 4OIAA 3GSXA 2UV3A 3BP5A 3X3GH 3T3PE 2PW2A 3DXAE 3PL6A 5ANME 1B4JH 1FZJB 2FX7L 2NXYC 3NCBB 4Y4KA 4NJAH 4OCWL 4YXKL 1T22B 1F4WH 5CHNB 1DQDH 2HTLC 2VZSA 2DDQH 1IQDA 4PJ9A 4NQED 3TESA 3EYFB 4HCRH 1S8DA 3MRPB 4LVNC 4B53A 4PUBH 4KXZH 4G8GA 2KH2B 4RWYH 2Y6SD 3UJTH 3KYKH 2R1WB 5SX4I 4HIEA 4Y5XC 3CSYB 3NH7H 5D70H 5EOCH 5DJZB 3PDOB 4FQCH 2A1WH 3L6FA 4UQ2A 4KI5C 3RGVA 2XG4A 2OTUB 2YPVL 5C0JA 1U8QB 3MFGB 4YK4B 4JRXE 3WUWA 4UOJA 5ITFB 4YHNB 1TJHL 3DSNA 3E3QC 4YDIH 4MQXC 3RNQA 5C0CB 5JW4N 3BZFB 4XVTH 3REVB 1V05A 4YDKH 2K7PA 5BZWB 1S7SA 1LVEA 4PTTA 4HF5L 2P5WB 1OT2A 3MRKB 5T1MB 5IJVA 4Z0BH 3VWJC 4NNXB 2NY4C 1OGTA 2DS4A 1MQKL 4KJQD 2NNAB 5DK3A 4JFED 5I15H 2HYMA 5HY9A 4KAQH 5GS1C 2P7TB 3O9WC 1A9BB 3IDGB 4FQPA 1CBVH 1HOCA 4LSVH 3C8KB 1PSKL 5ICXB 1HIML 1R3JA 4ZS6C 1KPUB 1P7QA 1N6QL 5CIPA 5EO9A 1TENA 5C9JB 4HEPG 4LPYA 4HFWA 4WW1B 3NA9H 5ACLA 2E7LA 4NUJA 2JB6A 5C3TA 2H6PA 1MHPL 1YA5A 2APBA 3CIQA 2AXFB 4KMTL 2HKHH 4XT1C 3FFDA 2MHAA 3E2HC 5D2LB 4JPKH 5I6XB 4HUKB 3SKOA 3T77A 1RJLA 5CJXC 2GHWB 1JNNL 1Y18B 2XIDA 5MEPB 3RIAF 5FF6B 5HHPA 2AEPH 5IGXL 5K9OB 1UKSA 1OAQH 2O5ZH 2YR3A 4YXLL 5C08B 5KVEL 5SV3A 2ZCLL 5D96B 1QFUH 3MMEB 4JLRB 1S9YB 2Q8AL 1OGAD 4PB9H 3FO2A 4PS4H 4OD1L 1RUKL 1KYOK 3WIIL 5I76B 3IB4A 4K7PL 4RGND 4OF8A 2XICA 1OTSC 2AEQH 3R4DA 4U1LB 1JGLH 5IB3A 1KEGH 3K3QA 4DVRL 3FB7B 2E9BA 2X1QA 3HAEG 4LP4A 1BGXH 4LCWD 4R97C 4MA8H 4YHOL 4MD0B 2IANA 4WNQA 5GIRA 3WIFB 5C0CD 1ETZA 3C5JB 2V2WA 5KVGH 2YD1A 3ARFA 4PJDF 3WO4C 5HTSA 3HB3C 4A6YB 4OZGF 1LO5A 3FOLB 3MRNB 1E0OB 3F7YA 5FUZH 4NN5B 3RVVD 2N4IA 4PRPA 3C87A 1A1MB 4TNVF 1GCFA 4P5MB 1U93B 4NN7C 3BN3B 3LB6C 4Z7VA 1AY1L 4H0HB 4HPOL 3B2UC 5HDQH 5I17B 2MFNA 4WHYG 2P24B 15C8L 5D2NA 3LEXB 2NY3C 3SO5A 3ULVE 1VDGA 4UZGA 1AO7D 3L3KB 5KANG 4PY8J 1I9JL 2B5IC 3FB5A 4LLDA 4X98A 2FR4A 5BRZB 2DI7A 3T0XA 5CSGA 3OKMB 5D1XA 4FXGA 4YEFA 5DFWH 3MLUL 2VTFA 3LV3B 2J2ZA 3MJ7A 4H20H 5HHQB 3QNXA 1JTOA 5GGVL 5DD5H 1AD0B 1C16A 4X6DB 3MLZH 5BCAA 3CZFB 4L3ED 5C0CE 4M5YL 3UP1A 5EO0B 3U4EA 4AEIL 2OR9H 4Y4FA 2G9HB 4BZ2H 2EDJA 3VI4E 2P5WE 5IROA 2COQA 1GZQA 1WCQA 4X7EC 1NC4B 5LQBH 4JPWH 3MBEC 1OWWA 3LHPL 1JWMB 1IC7H 5DVKA 5M95B 3WYRA 3ZHDA 4XPTL 4ZUVB 4EN3A 1B0GB 1UCBH 3VXRB 3WJLC 4POZC 1RUML 5EG6C 1P84K 4M93B 5BV7B 4LVHC 1IBGH 3MCKA 2R0ZH 2EH7H 5CWSB 1A1NB 5F1IA 3UTTD 2GW5A 5DQDL 3FO9B 3OHXA 1BQHG 4HHAB 1S7QA 4ZFGL 1TCRA 1C12A 2EEDA 5JHDB 1TPXC 1BFSA 3RPIA 4FQQB 1Z9OA 3N1MC 4PV8A 2DYPA 3EOAB 2H32B 3DURA 2C3WA 2LVCA 3MOQA 4JN2B 4U1IA 1KCSL 1S7XA 3E8UH 3P2TA 5KVFH 2X4SB 3IKCA 4NN6B 5DJ8A 1UEMA 1H3PL 1HH6A 1DL7L 1KV3A 1UXSB 5D2LE 1A6ZA 3D0VA 1C1EL 4MDIB 1MCWM 4YNYA 4AZ8A 3HZMA 5IVOA 4LU5L 2B4CC 1LDPL 2EDLA 4TSBH 4F57H 1KGCE 3WL9A 5IT2H 3BJ91 3P0YL 5C08E 3MUGA 1XCQA 4LRNL 4MWFB 4Q74A 5FM5O 5IKCA 1CICC 2CKNA 1MFEL 3GMNA 1BQUA 2DQTH 2OZ4A 5IQ7L 1G7QB 1K4DA 2YZ1A 1QA9A 1MLBA 3GJFB 4WI2A 3ELAT 1LEKA 5EIIB 2BOBA 2Q7YB 3L3IB 3FN9A 3GZKA 3OV6A 4JG1H 2EDEA 5EU4B 4CVXB 4FABH 4Z7NE 1U6AH 2WWKO 3D6GA 5FM4A 1RVFL 1CDJA 2D4DA 2XZCH 3QUXD 3LEYL 4HAFA 4PP1D 4ENED 4APQB 5GSRA 5EOQH 2EZ0D 4EEEA 1IAOB 1J7VR 4EI6A 2CLRA 3B83A 1K3ZA 3UO1H 3PUCA 4GW1B 4PJ8B 3HNVH 1T1YA 2GUOA 1N64L 4YZFF 1ZEAL 4HUWB 4YWGL 3NMEA 5C0ND 3ARYA 2YRZA 1AGFB 3IJYB 1QNZH 4HIHB 3GMQA 4WTZG 4HIIA 1N0LA 2FJGB 1QO3B 4L8CB 2X09A 2YSSA 3VCLA 1AE6H 1EXUB 4AEEA 4TYUA 3D39D 5CEZD 4UNUA 1ZHLB 3A0OA 3MA7B 4U6XA 3SGJC 4LHQB 3KPLB 5IBTL 4C54A 5BRZE 2AJYL 5FV2A 3S3PA 3O6FD 5J3HC 4OGYL 5E8EA 3BKMH 1F4XH 5T5FL 4MDJA 4X6DE 3QDJD 4EOWH 1GGCH 1KLUA 4ODWB 4UU9B 5LCVL 2Q6WB 2VL5A 1QR1B 4MJ5B 5ISZB 5D7LD 1KCLA 4LHUA 4YHYB 2HRPH 1RZIB 4PRDB 5MP6L 1WIPA 4JQVA 2AJ3B 3INUH 2EICA 4WO4D 1SEQL 3TBWA 1RK0A 4LLUB 4NT6A 2JJSA 3MNWA 2R4RL 3WNOA 1CDCA 1EJ6A 4OM0L 3VXRE 3ZE0E 3U79A 2XG5A 4MNQD 2W60B 4JZOB 4TSAL 5CJOH 2XY1A 1VFAB 4NZUH 4PB0L 5DR5L 4H26A 2WBKA 3WEXB 4G80B 1TNNA 4U1MA 4F7EB 1WBZB 3EYSH 1E4KA 2DL2A 3MRDA 2GSIA 5JHDE 3VXUA 1NBZB 2X42A 2AV1B 2DM7A 3ILPB 1TVHA 1A7NH 5H35B 2XWTB 2GEEA 1WJ3A 1F3RB 4J3XA 3C8HA 5D93B 2BDNH 5GGRB 3TN0A 1J0ZA 1CFQA 3RA7H 5CILH 1KTLA 1Y6MR 5I1HL 4RNRB 4LVNB 1E4XL 1A3LH 5FYJD 5T33L 1MAJA 5IBUG 3LMJL 4MA1B 3LAFA 2EDOA 3FTGA 3GEWB 1YPZF 1NSNL 3P9LB 4Y5XB 4PJ5A 2XXCB 3MJ6A 5IHBA 1M7DB 3MV7D 1N59B 2G5BA 3Q1SL 2D4FA 1EHXA 2XTLA 3NPSC 4K7FA 3FQNB 2AJVH 5DUBA 2VE6A 4R7DA 4C57C 4LPTA 5IB1A 4B7LA 3BP6A 2FEDD 1BBJB 3DLQR 3VD7A 5KZCD 5JO5A 1A6WH 3BEVA 4U6YA 4G6ML 1FCGA 4ZS7H 3C2AH 1YYLH 4K3JH 3AUVA 3MNZA 4RDQF 3U2SB 4GRWF 3RTQA 5DA0B 3EKCA 3LPWA 5FGBA 2Y5TA 4XNXL 3VWJB 2NY4B 3GSNH 2R2HA 1KJ3L 2IAMC 3TBSB 2BVTA 2ZOLA 2ILLA 3ISWA 5L6YL 2XKNA 4BM7A 2BHUA 3AY4A 4RAHA 3AXLB 5ICZA 5E7BA 5TQ0L 3O9WB 1PY4A 3IU4H 4AT6B 1NGXB 3MRJA 1QBMH 5E9DD 3VRLF 2Y36H 4G9FB 3WKNA 1A5FH 1CGYA 1XR9A 3FONA 2HTKD 4I1NB 3HPLA 3KNBA 3IJHB 4LLWA 1U95B 3P73B 3WIHH 2FSEA 1MH5B 4HG4J 5GRYA 2CR3A 1W72A 4YC2B 4PLJD 4N68A 3LKRB 2IH1B 1XH3B 1I4FB 3CVHA 2R1XA 1NAMB 1RHHB 1DLFL 3V0WH 4WW2A 1OT1A 1I9IH 4JFFD 5EUOB 3O2WH 1HYRC 1K3IA 1AXSB 4ODTL 4YDVA 3VXMA 3FFCD 5E6ID 3CFBA 4H8WC 4FS0A 4YXHH 2J8UF 5B22A 3WDHA 2XXMB 1S9XA 4R4BA 3VA6A 1MCRA 3E2HB 2FJHB 3VFOA 5BZDA 4G8EB 3GI9L 2D3VA 2R2EA 3SKUD 4K2UL 5AZ2L 2X40A 4XMLL 4DAGH 5IG7A 4ODSH 4G7YH 3TBVA 1RJYA 5GZOC 1FNGB 2XYCA 3G08B 3OX8A 1EHLL 2BXZA 4GRMA 5DHVB 5ISZE 4MXVF 1K85A 3ARBA 3BD5A 1I3RB 2PO6D 1NMBH 3L9RB 1KJ2H 3IFPA 1O7SA 5K9KB 2GT9B 6FABL 3T1WA 4ZFOB 1GPOH 3I6KB 1FLRH 4WENB 3NCEB 3MRLA 1ODAA 3A6BL 4KKBD 2DQJL 3BGAA 5CMAB 1G7HA 5IOPB 3FMGL 3LD8C 5TJWK 3HZYA 3UXFA 4F33B 4OLZL 3QUYA 3QEGH 4L4VD 3PHQA 2ITDA 4XI5D 1KB5L 1R3HA 1JVKA 4KJWD 4NPYA 4OM1H 3U7WH 2DQUL 5E8PB 1WIUA 3BH9A 4KROC 2FRGP 4PJDB 3EOYG 3IJSA 4K3EL 4Y4HC 3I75B 3GMPA 5DYOA 1BWWA 4XCFH 4FZEH 5AWNL 1NFDB 4J3UA 5KVDH 1JGDA 5ALCH 1EFQA 4C4KT 2WBJC 4N8PA 4NM8H 3L95B 4NQUA 1EHAA 2HKFH 3TWCH 2BNQA 4NN7B 1RJZA 3QEHB 1YEEH 1GAFH 3HC0A 2HWZL 3G5ZA 1DBKH 3KLHD 4OZHA 1JUFA 2RGSA 4P5TC 2NY3B 1X5JA 3P4MA 3DO3A 4S1RL 2XRAL 1AGBA 2B5IB 5SWSD 3BT2L 5I1IL 4JDVA 1HHHB 3C5ZA 4KI5E 5M94B 4OKDA 3QDGB 3RI5K 2R8SH 1RFDH 1FNEB 5F9AC 4CADA 1ZLVK 4Z7UA 3E3QE 4OKVA 3G6AB 4X9IA 1YEIH 2GJ6B 4PLKD 2P43B 3NCYP 3D87B 1H0DB 1ZSDB 1G0YR 3HI1B 3OAUL 4LVEA 2ADFL 1BFVL 5C2UB 5F6HJ 3I9GL 3MBEB 3VMPA 3WHE1 5HGDA 4WHTB 4KTDL 1ZS8B 3KJ4C 2XWBB 1GXEA 4MS8C 3SDAC 1KPVB 3MODH 2XZQL 3H9HB 1T03H 3R0NA 4JPIA 5DUPH 5GISH 1QKZH 4K7PX 4LVHB 1EGJL 2ADIB 3MCLL 3UBXA 4G9FE 3S35L 1DVFD 2XOTA 2PYFA 1J0HA 1RMFH 5ADPH 1OAKL 1B2WH 4P49A 4D2NA 1ORQB 2ED7A 4YDLC 1TPXB 3AS0A 4PTUA 4CN1A 1K8DB 5C0RL 4E41A 1MPAL 5M7QA 2CLZB 5I16A 4HK0A 4E0RB 2MQ0A 3JTSA 1NDMB 5EUOE 4LHUG 5KSAA 3VWKC 1VADB 3VE0A 4YHLH 1MFDL 4ZQKA 5TDOA 1DN0B 2AGJL 1KENH 4KMQA 2QHRL 3UYPA 1OB1A 1RV6X 4WHYH 3RJQB 2BHZA 3BPLC 4WU7B 2NZ9C 4DVBA 4KGLA 1IM9B 2PW1B 4HKXA 1QOKA 5KN5B 1RURL 1KCUL 2VLJA 4IOIB 1R3KA 1U8HA 2YPLD 3RHWF 5I30L 4QXGH 3OXSB 4OCYH 3FQWA 1CE6A 2D31B 1D6VL 1N4XH 2FBOJ 4KI1A 2P45B 1G9MH 4PJCA 1HNFA 4Y16A 2I07B 3JV4B 5JZ7C 2H2PD 4XNQA 5TQ2L 5EZIL 4XXCA 3BQUD 4OF7A 1IC4H 1FPTH 4YIQA 3NABH 4M1CD 5C07B 5D7KD 5A3IC 2Y7QA 4H0GA 4ZNEE 4RAVB 5I9QB 4PJDE 1L7IH 3DARA 3DVGA 4I2XA 2X6MA 1NFDE 4O58H 3PWPB 3D3VA 1T7ZA 5DDHB 2NTSP 2A73A 5D7SL 1JN6A 2YMXH 5L8KB 5IEKA 2X70A 1BVLA 1KCRL 5KSVA 2EE2A 3MV9D 2VXUH 2EH8H 4NJ9L 4I77H 5GRJH 3CFCH 2SEBB 3BKYL 1AQKL 3HZVA 5I1KH 2RR3A 3W82A 1BFOA 4WFHE 3SKJL 3TVMC 4CMMB 3QDGE 3VFSB 1E6OH 1S7WB 4P2RD 4RSVA 3UZVB 4EXPX 3NACH 2X4TA 2AVGA 4X9FA 2GJ6E 4PRHA 3ECBA 1YEHL 2BRQA 1BJ1H 1Q9OA 2P46B 2CRZA 5DJCB 3IVKA 5C6PB 4ONGH 4OFVA 3HC4H 3PHSA 4LSSH 1XF3B 1ZGLB 5I19L 3LRSB 2W9LA 3EFDL 3BYYA 5F89B 3CU1A 3WHXB 1QYGL 3BP7B 2LVEA 1MRCL 3EOBA 1FIGL 2V17L 3SO3C 2YC1B 1WCBA 1S5HB 1IM9D 5F7EH 1NLDH 3FHAA 3H3PH 1QLRB 4FQ2H 2X4NA 5F93C 1ZVHA 3C60C 4Q7DA 4S10A 4JCMA 4K8RH 4YR6B 4Z78A 2W9DH 3D85B 1WFTA 1X44A 4H25B 2ZPKH 3DOSA 2HVKB 3ULUH 4BH8A 3OL2A 3QJFA 1A64A 3MTRA 3UMTA 4JQXA 2ORBH 4UIMB 3H8NA 5JLZB 1PY9A 4WWKD 4YBLB 3B9KA 2QHLA 4ORGA 4XP1L 4I3SL 35C8L 2A0LC 4PLNC 3KDMB 2X1OA 2VUOA 3BH8B 1OP3K 3G04A 5J9PB 3G5YA 5EZLA 4HS6B 1DR9A 1YPZB 3QCUL 2BERA 2BNRB 3KYMB 1PKOA 2CGRH 4X7TB 1TZHB 2A74A 2XV6B 1I8KB 1MCLA 3N85H 5D1QA 4O00A 3MRQA 4LLYB 3WJJC 2B1HH 3GO1H 3JVGA 2YHGA 2ESVB 1KN4L 1SMAA 1VPOL 1F8TL 3BUYA 1HI6A 4UB0L 4ERSL 3ULVL 4NNPH 5FIEA 4QCIB 1WF5A 2A83B 3QI9D 5DJXB 2K7QA 2WQ8A 3BE1L 5F7DB 4BSVA 1CL7L 1RZGA 2F54A 3W9EB 3FKUS 4M48L 5IVZB 5C07E 3T0AA 1A4KB 5HI4D 4PV9A 1HILA 5CIPH 3VXQB 1FL5B 3T08A 4N1CA 1FFNA 5J89A 3LS4L 1M6OB 4MZ3A 1HQRA 4TRPH 4ZOBA 5DMYA 4YBQC 5FKAB 3PWPE 1MFCH 2V5TA 2FJFA 4NO2A 4YZFE 3BISA 1HEZB 1NL0L 1S7TB 2BOCA 1IC5H 3E0GA 4GQ9H 1IAIH 1DDHB 4LEXL 3GSWB 2E6QA 4NKDA 5MEQB 1QBLL 4PJBB 5HHMD 5C0EA 5F97E 1S5IL 4FTVB 3PGDA 4MJ6A 1ZWIB 2J8UB 3EYUL 4YPGB 5FOBA 4U6VH 5KG9B 4QT5A 4RRPA 1M05B 1MJJB 1UB6A 1R5IB 2C4FU 1T7YA 3SDCA 5CD5D 4KVCH 5AZEH 1K2DA 2IQ9H 1I3UA 1MAML 2DJ4A 3MOBH 1IFHH 3DUUA 3KPPA 1ZA3A 4ZNCD 5C0DB 2DQHH 1IKFH 3PWLA 3PWNA 4QF1B 4LRIA 3C08H 3VDCA 5TF1H 3H42L 2YUWA 3DMMA 3Q6FA 2FATL 3DROA 1Q9LB 4L3CB 1CG9B 3CUPB 4ZDHB 5C0IA 3U0TB 2C3XA 3T2NL 5E99L 2I9TB 1JBJA 3RDTD 3VXPA 1SJXA 1Q0YH 5DD0L 5EBWB 5JW5A 2ZKHH 5DRWA 3ROLA 2OXHA 3LD8B 4KRMB 4WJ5B 1I85C 2ESVD 3GIZL 4LOUC 4HUVB 1N2RB 5AD0B 1GHFL 3LOWA 1MFAH 4NQCB 5I73C 4KDWA 4C56D 4KROB 1RZKC 4DGYL 5L88H 4Z95H 4WV1A 2D7NA 4Y4HB 5J13C 1A6TA 4H88L 3GDBA 4U1HA 1UH4A 3SY0A 3G6JF 3L5JA 4BQ6A 3RU8H 3WNKA 4PJ7F 2Z4QA 3EDJA 1QRNA 1QSED 3F58L 3ZTNL 4F7PB 4M9OA 4MHHI 4MB5A 4UINL 5JW4R 5FA3B 2H26A 2Z8VC 3NZ8B 5MEND 1A1OB 1JMXA 1L7TH 4POYA 1AHWB 3ZDXF 5JXEC 4N5UA 5IMLA 4P5TB 1YPZE 4LAQL 1OF2A 5T1KA 4L8BB 2BNRE 1WSST 4A6YL 3VH8A 3GJEB 4M7KH 5J12C 4DN4H 2YBRB 1ZGLP 3HZKB 3TBYB 3TYFA 5DSCB 5FECA 1EEYA 2ESVE 3KXFA 3GBNL 1E4WL 4FQHB 1B6UA 3GM0A 4CVZB 2IJ0C 2PCPA 2NY0C 4M4RA 2AJZA 3BN9D 1JGVL 5KSUB 3GMRB 5FYLH 1PZUB 4XNMA 1VFUA 1H15B 1TZIB 5HD8D 4Y2DD 4ZYKA 3LRGA 1FVEB 4P23A 4LCIH 4P3CH 2KDGA 4JKMA 5B8CA 3WS3B 5BXFB 2P5ED 2JB5L 5IFAL 4KDVA 3C6SA 3SKNB 5IHLB 5HHOA 1FZOB 1QFWI 2QQNL 1UYWH 5DD1H 3KJ4B 3NCJL 3U83A 2VR5A 5EUKA 1VESA 3SDAB 4IHOB 1NBYA 1SBSL 4DUWA 4I0CC 4WUKL 1CLCA 1FN4A 4C58B 5IEHA 1A14H 4PJFA 4WEBH 1MI5A 3QIUD 3KAAA 3EHBC 1DUYA 1KCVH 4I5BA 4JM2A 5GZND 4A2LA 4JFHD 2HFGL 5FYKE 4YDLB 3UPRA 5F88A 1W0WA 3GMLA 4NO3B 3ULSB 1MF2H 1CQYA 4AIZB 4X5WB 1BM3H 1HHJB 4PJBE 4TUOB 4M3JA 3SE3A 4FTVE 1AGDB 4LLMA 4G6FD 3GI8H 4HJGA 4GAYB 4QTIL 4GS7B 4QGYA 1IGML 2QR0A 5CEZL 3FB6B 3VWKB 2J8UE 4GLRI 1G7JB 1CT8B 3RFZC 2FO4B 2L0DA 1IAMA 5E4EC 5FA4B 4HK3J 3LQZA 5DMKA 3B9VA 2OZ4H 1OSZB 2YK1H 4NRXB 3BPLB 2UUDK 4Y5YC 2PTTB 5I1EL 1LD9B 4NQSA 1YZZA 4OQTA 1N6UA 4K55A 4P2YA 3ARSA 4OF6A 3LRHA 1Q72L 2BY3A 5HHVL 3V6FA 1Z9SA 2MOVA 1TMCB 2VQTA 4OD2B 1KT2A 4OV6F 4HGWB 1U8OB 5CJ5A 2JCCB 1AXTH 3QHTC 3HE7A 4GRLA 4LK4A 1GC1L 3MJ8B 5ECJE 4ALAH 4NQCE 1IAKA 4K71C 5IHUL 1G7PB 3VXSD 1MFNA 3U1SL 4J3WA 4N8CH 4HC1L 4NO0D 3GFUA 1Y6KR 2L7UA 4G5ZH 1JF1A 3NCFB 1MUJA 2O61B 1FE8L 1U8JB 3PGCA 3S35X 1KG0A 2EKSB 3O6MH 3Q5YA 3MREB 1SJEB 7CGTA 1J05B 1CLOL 1NCBL 4IEFB 4XH2A 4JO2L 1A02N 4NOBA 4NFDA 3D1MC 1NMAH 4RWHA 4JB9H 2FH8A 2JK5B 5E2TH 3HLAA 4GAFB 4NM4L 4JN1L 3AREA 5GPRA 4HG4K 4ZPVB 1JZ5A 4HDIA 5CP3A 3TVMB 3WFCL 2IBGA 1H3UA 5D71H 2A6IB 4OCXH 1OW0C 2HJKB 2IBBA 1NC2B 2CIIB 3QEUB 1T66C 1I1AD 4FQXA 1RIHH 5AG9A 3IDNA 5EBMB 2DMKA 4IRSA 4EI5A 4JFDA 2V7HA 1FZKA 2Z31A 1ACYH 5C2BH 1SY6L 4K9EH 4YFDB 1JWSB 1LE9B 2DQEL 3PJSB 5D1ZA 3LKQB 4NOFA 4U6HB 4X99B 4P57A 5D4QA 3L3OA 4Y7MA 4R2GC 2LQRA 3BAEH 5ILTL 3FRPA 4XPBH 3B6SA 4PGEA 1T21A 1U8MA 4KQ4L 3SO3B 3L3GB 3FL7A 4MA3A 2UYLB 5E2VL 3U9UA 1DQJB 3C60B 2FEEL 3RZCC 3IFLL 2G75B 3R8BB 1HSBA 4L4TB 1MJ8L 5FO7B 3TV3H 2FZ3A 3P0VL 3KR3L 2YD8A 1EPFA 1P7KB 3RZWA 3LQAH 4XCNA 3TA3A 5DEFB 3JWOC 2BVPB 3T0EB 2AK4A 3QXAB 3GBMH 3SE4C 1A7PL 3OKYA 3Q48A 5DD6B 5DTFA 3RX8A 3PHOB 3CXHJ 5EBLB 1HCVA 2I5YH 1IL1A 4JFZL 4M1GH 5CJQH 5HVFB 1F3DH 2FL5B 1T1WB 5F70A 1HN1A 1LQSR 4MXQC 1DQLH 3CMOL 4U1KA 5T1LD 2W65A 5EIVA 2DLEA 4M62L 3P30L 4U1SA 2F53B 5EU6A 1T0NA 5IBLC 1D5BB 2YN3A 1QTYT 1XGUB 2BZDA 2VLRD 4IRJD 1I7RA 2MPAH 5GJTH 2QSCH 4XP5H 2IALB 5DJYA 3W9DB 4JO4H 4XP4L 4UT9L 1NCCH 4DQOH 2JCCE 1KB5A 2A77H 3QUKB 4MA7L 3HCVB 2M2DA 4D3CL 4N90E 1DQQB 3NN8A 5F9JB 4JHAL 3DRQB 5B39B 2EE3A 2X2YA 3F8UB 4RGMC 1W72H 4Z5RB 3RVXD 2HG5B 3VH8G 4YHIB 3K8KA 2VXVH 3ARPA 3CVHH 3QIWC 2HH0H 3HE6D 4XCCH 1U3HA 3ALXA 5GJSH 2CLVA 4N0CD 4CN6A 2AK1L 4BQBA 4W70A 4F7CB 3SE8H 4J8RB 4XVJL 4JDZA 4JFQB 4LL9A 3NAAH 1JNHB 3RQ3A 3X11A 2DM2A 4IOFC 4HKZA 1ZT7B 5I1DB 3MA9H 3S88L 4P48A 4K8RD 5DZLA 4KWUA 2AQ1A 4S1SL 5J11C 3UJJH 4G8GD 4U31A 1F13A 4ZAKA 3VFMB 4K3HA 4Y2OA 1UA6H 5I8CB 1YN7A 3T0ED 3GUTA 1I8IB 4BZ1L 3IAGC 1X3DA 3RGVD 1NAML 4YGAB 1ERNA 3GIVB 5FAAA 4KHXH 2N1KA 1PLGL 4NBXB 5J1SC 3QQNA 1RZ7L 5K33A 3STZA 4L8SC 4M7LL 5IUSA 1A3RL 2VAAA 2BY2A 1I3GL 4PJIF 3UAJD 1CGSL 4JO3L 4NHCH 1EGJA 4S0TD 1FIEA 4G43B 2DWEB 3D0LA 4P5KA 3W2DL 4N0YH 4S0SD 1GH7A 4TULH 2JIXB 2DN7A 3CZJA 4I0PC 4L4TE 3UJIH 3R06A 4UAOC 4BSWA 3GHEL 2EXWD 4XP9H 4Z0XA 2FBJL 1EH9A 2FX9L 3RL1B 3G6JB 5E5MB 3T0EE 5HHNA 4PR5A 5DI8A 3RKDD 1AKJB 4PJ7B 3VGDA 1NGQL 4QRRA 1N5AB 3D18A 2WK2A 4XNYL 2HMID 1ZVSA 1JZ3A 2EXYD 1VEOA 3DXAA 1UENA 2XTJD 4G9DA 3ILQD 3OMZA 1KLGB 4PRBB 2WWMC 5HPOA 1MCWW 2XA8L 4ONFH 4OLYL 4J2XA 3RWCB 4KDTA 1BQLL 1DE4A 4O51A 5I1GL 4P4KC 2WQRA 3Q5TA 4QRQA 3K4DA 1QEWB 3O4LB 5J12B 1EBAA 3BDBA 1SHMA 3L3HB 3N9GH 1ZLVH 3MUJA 1FNSL 2VL4A 5J1AA 4ISVA 5I8EA 5KSBF 1YJDC 4OT1L 5H94A 1OPGL 2F53E 1MCCA 4KKLD 3RAJL 4RMQA 4WHCA 2AQ3A 1X5IA 5ACZA 2OJZH 4YQXH 5JIHA 2NY0B 5BS0A 3MX0A 4X6BA 1CTNA 3SDYL 2DICA 4WTXA 5B38A 4MAYC 3MYZA 4R3SA 5IB2A 3BVNB 2A6KB 5FB8B 5BVPH 1EMTH 2GTWA 2HLAB 5DEGA 5IQ9A 4ZUUA 5BVJB 4L8DB 2NYYD 1JWUB 2RCSL 1FRGL 3FO1B 3EO9H 4O9HH 4FQ1H 1I7TA 5IIEA 5E70A 4RFEA 4X8JA 4OI9A 5KJRH 5L0QC 3QUZD 2NW3A 1NCWH 2DQIH 4KKNA 4DZ8A 3DRTA 1P7HL 1TQCC 2OQJA 3O0RH 2OTWA 2IH3B 5CGTA 1BLNB 4YHML 4W4OC 2FD6H 2QBWA 1ORSA 1V5JA 3J8F7 4P9HL 3ARFD 3WFZA 3KYNB 4NP4L 1UQSA 5E8NB 4UUJA 5FUOL 1DTUA 2FDBP 4N8VB 1GGYA 4X6EB 5IK3B 3TO4D 2NXZD 3OGOE 1R3IL 3GRWL 4P2OC 4MSWA 2GYSA 4HWNA 1S3KL 3L7FB 5FHBH 4HH9A 2HT4D 5E4EB 1FCCA 3P77A 5IW1B 2ICWI 1CD9B 1NGYB 1MHEB 2VDQL 1AKJD 3DVNA 4BFEA 4Y19B 3IDIA 4J23A 1E6JL 2ZSWA 3ZKQD 1VEMA 2NLJA 2BMKA 3L7EA 4LCCC 2VABB 3RVUC 3KPNA 4TSCL 5E94A 4HBCL 4LSRL 5TE4L 3F6IA 1WC7A 4Z7OF 3CDGA 2IMMA 1F5WA 4XBEL 3STBA 1ZLWH 1RI8A 4OCWH 4YXKH 4P2QB 4Y4FD 1PAMA 4RFOH 3O41A 4N0UB 3VU2A 1PFCA 2CUMA 1YY8A 2Q3AA 3BDYL 1DEEB 2HRLA 3BFOA 3LN4B 4TUJB 3CSBA 5LXGL 3NBNA 4M61B 3OKKA 5FYLD 2DIBA 3VXOB 4XPFL 4FMFA 3SGKC 4K71B 3VFRB 5GGSB 3WDJA 1WVZA 1UACH 1RD6A 4NGHL 1MFBL 3G6JE 2CIKA 3M07A 5FYJU 4PJ7E 5I1LA 2I60H 2YPVH 4X5XA 3U4BL 4LQ1A 3KVQA 3RIFK 3K81A 3BO8B 2W0PA 5E2WL 1ES0B 1LEIB 3EUUA 4UV4L 1TJHH 2E27L 1FZJA 1T5WB 3QJHB 2DRUA 2J6EL 2DYPD 3KPTA 5CHNA 2HFTA 3O6LL 3UYOD 1EIBA 3IFNH 2ERJC 4FXKB 3V6OC 2MWCA 2AEIT 1YMMD 1EVUA 5A16B 4HF5H 3O4LE 1NGPL 3TBTB 4ZO7A 3ARGC 3DYMA 3EYOB 4NNYB 2H2SC 1MQKH 3IRPX 1OGAA 3UZEA 1WISA 5IWLC 2R1WA 4JG0L 3SDDC 1IT9L 3B5TA 2IPTL 4U1GC 4F15B 4FZ8H 5FOJA 3VFUA 2WWKT 4BUHA 5CKAA 3ZDZF 4WCYL 1PSKH 1U8QA 3C9NB 4JAMA 4OGAD 3S5LA 5ITFA 4LCWA 4QRSB 4YHNA 5DQJB 1N6QH 3MV8B 1CXKA 4XB8A 1OCWL 1CFSB 5F1NB 5C0CA 4R2GB 4RCAA 1FLTX 2CDFA 5JORB 2AERT 4KU1A 2QKIA 3C09C 3CFKA 3OPZH 1CGWA 1UWXH 3PXHA 4KMTH 3QZWB 3RZCB 2JJWA 1ZHKB 1RPQA 1PVHA 4YGVB 1JNNH 3WLWC 5IB4B 5C0BD 4D9RE 2P7TA 5EU5B 4G6KL 4RDQG 3EZJB 3IDGA 2OS7A 1AO7A 5IGXH 1WQVT 2R9HD 5K59E 4OZIB 1OP3H 1U36A 3C8KA 3K2UL 2W0KA 4YXLH 5CAYB 2MCG1 5KVEH 1C8PA 1HHKA 2ZCLH 5KANI 4JFPB 5ICXA 1IE5A 4LFHD 2Q8AH 4OD1H 1V3MA 1RUKH 1OTUD 4K7PH 2JKXA 4JJ5B 2Y07L 4L3EA 4Y19E 4YH6A 4FG6D 4YO0A 1SM3L 4OLUL 2AXFA 1QG3A 2Y72A 4HZAA 4GUPA 4DVRH 4Q9QL 4XHJC 3MACL 4YHOH 1MHHB 4ODVL 4F37F 4KH2A 3ZE2E 1NCNA 1IRAY 1U58A 5I0DA 3BHBA 4O5LL 1JK8B 4XCYB 3F5WB 1YY9C 2AJXL 2Y23A 3DX6A 2I25N 4P2QE 2DQFB 3P4NB 5K9OA 5DRNA 2BC4B 1XIWC 4N0UE 4PJEF 4LPXA 4QY8A 1HQ4B 4U4BA 5DURD 2HT3D 4RISL 1FV1B 5ESVB 5ENWA 4LVOC 5SWZB 3U82B 3UTTA 4JLRA 1S9YA 4Q9BA 3TT1H 5T5NG 5HVHB 4TTDC 4HPOH 3MNVB 15C8H 5L7XL 3OJDB 3IDXL 5I76A 1T89C 4G6AC 4RGMB 4K3GA 1I9JH 1P4BL 4CJ0A 3FB7A 3RWFB 5KS9F 3QEQB 4MD0A 4AH2B 3MLUH 1CFNB 4JQIL 3WIFA 3VXUD 3C5JA 5GGVH 3SCMC 1ZHNB 1BZQK 3FOLA 4M5YH 5B38G 4AEIH 3TN0D 1LNUB 3TNMB 4P5MA 1U93A 3EGSA 1BOGA 2VISB 5D5ME 5L9DL 1EFXD 3LHPH 5J11B 5I17A 5FDWB 4ZMAT 1I8LC 3MRRB 4QHNB 3L3KA 1RUMH 1A4JA 2C7UB 1J1XL 5DQDH 3NCCB 5DFVD 3OKMA 2EDYA 4H8WL 4ZFGH 1AGEA 3LV3A 3WXWH 3QUXA 3QULB 2IFGA 3MV8E 4L8SB 4X6DA 2HN7B 3K2MC 4PRNB 4ZUSA 3U4AA 2RQ8A 4WEUD 3RTQD 3TZVB 2WSKA 5J56B 4KKCC 5EO1B 3BP4B 1MRFL 1GVIA 1G7MA 4NQXA 1H3PH 1XMWA 3QDAA 1DL7H 5KOMC 3BXNB 3EAKA 3OKNB 4OZ4B 4OLWL 2DJSA 1CXHA 1PKQA 1FL3B 4I0PB 2DI9A 4XXDB 4ZUVA 1G9MC 4UAOB 5IFJB 1B0GA 2QQLL 2Z92B 5CGYC 4DKAA 3VXRA 2NY6B 4EDXA 1JPST 2IF7A 4UDUA 3BZ4B 3ARDC 4CN4A 4LU5H 1RUAH 5IF0A 1LDPH 5CWSA 1A1NA 2KZWA 4OZIE 5I18L 3FO9A 3D39A 5DQ9A 3ZDYE 3VXNB 4NCC2 2Q76B 3P0YH 2J12B 2ZUSA 3P11L 3MO1B 3N1QC 4M1DL 1QBAA 2VJXA 3O6FA 1MFEH 2VZVA 5D6CB 2GK2A 4FQQA 1U3ZA 1SEBB 3TO2B 1RIUL 1BVZA 3EOAA 3IGAB 1YC7A 3LQMA 5DS8A 3BI9X 4P4KB 4JN2A 3S3JA 2AJSL 3KPMB 3DUHA 1TQBC 2GTZB 1UXSA 1KOAA 2GKIA 5KSBB 1LP9F 1RVFH 3S4SB 3LEYH 1FFQA 4EBQL 1KIRA 1BBDL 4MDIA 4WO4A 3W0WD 4HFUL 4YHZL 1HHIB 3VD5A 1MCJA 4MNQA 3JWNC 4MAYB 2WLYA 1N64H 4OUOA 5SWZE 2HVJB 4YWGH 4DUXA 4X9HA 3TFKC 3N1PC 1OLLA 1WEJL 2HJLA 4I4WB 1TDQA 3C5SB 3MGOB 1NCUA 2H8PB 3QCTL 3PV6A 5LGJB 5CZXD 2VIRB 3SN6N 4HC1A 4OSUL 3GJFA 1JPTL 4V1DB 5EIIA 3L3IA 5DRXA 7FABL 5JDSB 3W5NA 5IBTH 2Q8BL 2AJYH 1TQCB 1QPXA 4D8PA 4XX1G 2UWEF 2YEZB 4APQA 4J7RA 2VH5L 3QEQE 4XBPB 5ESQA 3PP4L 3PL6C 4OGYH 1IAOA 3MLVL 5T5FH 1T3FB 2D7QA 2DAVA 2OXGA 3OAYK 4Y4KC 4UNVA 3LZFL 5CJBA 1HNGA 4GW1A 2AJUL 5LCVH 4PJ9C 3JUZA 2BNQD 3TJEL 5ESAB 4DN3L 4HUWA 4P2OB 1FG2A 1Q0XL 4HKBB 3S5LG 4Y1AD 2AQ2A 5CZVH 4OQTH 2NTFB 3VRIA 2DM4A 5MP6H 2UUDH 5D7JD 1U8NB 4JFOB 4Q58C 2NY6D 1SEQH 3ULUC 4ZPTA 1LMKA 1DQTA 2FJGA 2R69H 3ULUF 4L8CA 2R4RH 1MELA 1OP5H 4DCQB 1HCFX 1YQ2A 1EXUA 1FFOB 2QSVA 1ZHLA 4TSAH 3MA7A 4NZRH 1WZMA 4X6FA 1SY6A 4ZUWB 3U6RA 5DHYA 2XN9B 3LSOB 3CXHK 4LCCB 5DR5H 3QSKB 2EDBA 1CGXA 3C8DA 4HIXL 4HUUA 3B43A 5F7KC 5IMMB 4ODWA 3UAJC 5CP7B 1JPFB 1EA9C 1QR1A 5ISZA 5E9DA 2HFFA 4WFEE 3QFJB 1QLFA 1RZIA 3AS3A 1U8PB 4KRPD 1BFTA 2AJ3A 1E4XH 4YX2L 3QWOA 3GMOB 5T33H 1MJ7L 5MEOA 3LMJH 4XTRC 1J5OH 3V0AC 3AAZA 1MNUL 4PJXA 1IM3A 3DIFA 1J0YA 3AM8A 2VITB 2W60A 4JZOA 4M5ZL 4JZNB 2X89A 3GSUA 5I1CL 3Q1SH 4NKMB 3B9DA 3VG9B 1LO0H 3GSNB 5E6IA 3UEZA 3IXAA 4QWWD 4F7EA 3H9YA 1WBZA 3GGWB 3ZTJG 2RB8A 1NBZA 4Z7QE 3ILPA 4BK4A 5FO9B 4GKSA 2XWTA 4CMHC 2E7LC 3FRUB 4QHMB 5KSAD 3ZHKA 2ERJB 4Q6IC 4G8IB 1UVQB 5GGRA 1GRWA 1D9KC 4W6YB 4S1DC 3T65A 3ARGB 1NEUA 1VB9A 4XNXH 1VGKA 4MCZA 4RNRA 5KSBE 1KJ3H 1RU9L 4D0DB 3ESUF 2PYED 2APVA 3SDDB 5F3BA 2ICES 3DUSB 4U1GB 2NMSA 1E28B 5TQ0H 1M7DA 2F8VA 1N59A 2H3NB 1GGBL 5E5UB 2VLJD 4HWZB 1VGEL 2VN7A 3KWWA 3FQNA 4LCYA 5LVEA 4L4VA 4PPTA 4JKPL 4Q2ZB 4X9GA 4QOKD 1WLHA 4PJHB 4E5XB 1WBYB 5HYFA 5DO2D 5LAXB 1DLFH 1XGQB 1FYTB 3DGGA 4V1DE 2XN9D 3U2SA 5JPNB 3O11B 1FO0B 4WGVB 3V0VA 3C09B 4ODTH 3F7VA 4MNGB 5EU3A 1J9CT 4R96A 3O2DL 32C2B 2ICWB 3SPVA 1E27B 1S7RA 3TBSA 1EZVX 1OY3B 3GI9H 4NRZB 5T3XE 4K2UH 4XMLH 4MJIB 4OTXL 4PRID 2FYYB 2RAMA 3P0GB 4AT6A 3O8XD 1NGXA 4KK9C 4G9FA 1P1ZB 2X4RB 3JXAA 1PJ9A 4HJ0D 2YUZA 1JHLL 2VDNL 2IPKB 1U95A 2GY7B 4Z7VF 1MH5A 2C26A 5IR1B 1GZPB 5D2NC 4FRWA 6FABH 2NY1D 1UJTA 1A47A 1BJ1J 1XH3A 1I4FA 1UWEL 1WZLA 3A6BH 3SGEI 1KNOB 2DQJH 3M45A 1RHHA 2Z91B 3H6JA 4OGXL 1QQDB 1T5XB 1T6VN 2ED8A 5F71A 5EUOA 5D9SA 3FMGH 1AXSA 3NZHL 1ADQL 2NR6D 4OLZH 2OSLB 1AH1A 2XN9E 2VLLB 5D1XC 4DKFH 1KB5H 2FJHA 2ATKB 4G8EA 4Z7OE 4YHKL 4XGZB 1T1XA 5AAWA 4K3EH 2BRRL 3VMOA 4PG9B 1FNGA 4KQ3L 5AWNH 4TVPH 4Y4FC 4GXUM 1XIWB 5CINL 5DHVA 5JPMB 5IROC 3QFDB 4HXBL 2BSTB 3L9RA 4LVOB 3QFJE 3SE9L 2C1OB 2HWZH 2GT9A 3P9WB 1LE5A 4XWOC 1UT9A 4EN3C 3BIKB 3I6KA 1T04B 4JREB 2IBZX 1A7QL 2D9CA 1MJUL 3CCHB 3WE6B 2R29L 4S1RH 5EPMB 1MIEL 4I9WD 5I1IH 1A7RH 1FFRA 3BT2H 4HV8B 5I71B 5IW6B 1MCEA 1PG7W 4PJGA 4BYHA 1QFHA 1OTTC 5TDPA 1HYSD 1AP2B 1CGUA 3OQ3B 4TNWF 3T4AB 5E8PA 3BMVA 4F7MB 5AYQA 3MROA 3I75A 3IETB 2K3TA 3SCMB 1NFDA 4P9MH 4NYLA 5E95B 2VC2L 3V6OE 3ZKMC 3L95A 3OAUH 1D5ZB 2ADFH 4OLVH 1BFVH 2B1AL 3QEHA 4ACPA 3CSPA 3HAEB 2FECI 3I9GH 4AL8L 2YPLA 2QSQA 2GITA 3PABB 5L8JB 4KTDH 4CU6A 3CDCA 2WANA 5K9JL 2Z8SA 2IBZY 1UC6A 5T3ZD 2XZQH 2RJMA 2HJFB 1I8MB 2NPLX 3GKZA 3MRGB 5D1QD 1AI1L 1EGJH 2VOTA 1HHHA 1CD0A 3MCLH 1ZGLM 3DI3B 4PRAB 2YD4A 1U9KA 3S35H 3ZDZE 2D7PA 2QSTA 5JR1H 5I8OL 2AXJA 1DCLA 4YDJB 1IARB 2ZUTA 1T6WA 2WINB 3ZL4L 2EDDA 3QWQB 1OAKH 2VKXA 3CPLB 2VXTL 4PJHE 2NY2C 1TTFA 2FHFA 2BVOB 3G6AA 5C0RH 1MPAH 5BQ7B 1H0DA 5JW3L 1M1SA 1FYTE 1KBGL 5E56A 4MNGE 4P59L 1OAUL 2AGJH 2QHRH 4WHTA 1RJCA 1UCTA 3HI6L 3MV9A 2X05A 1KPVA 4MJIE 3H9HA 3ARDB 2QQKL 5IV2B 3GRWA 5EZJB 1RURH 2WUBL 2BNUB 3SBWA 1KCUH 4AEHL 1FGVL 5I30H 2OBGA 1FJ1A 1ORQA 3I3BA 4QRUB 1D6VH 1J8HB 5C0FB 1K4CB 5EIQA 4PBVC 1Q9KB 1RZKL 3T1FB 2CLZA 4NWUL 1KYOJ 2B0SL 3CX5J 2AI0L 5EC1B 3TJHC 5TQ2H 5EZIH 1JGEB 1JIBA 1UJ3B 2AV7A 3RY4A 1KB9J 1VADA 1BQHB 4XAWL 1D5IL 3EJZD 3S96B 3E6HB 4JFXA 1FAKT 4WU7A 4DFHA 1JI1A 2A38A 3UZQA 1IM9A 3SJVB 2PW1A 4HS8L 1HSAB 5C86A 3QQ9D 4ETYA 5D7SH 5DT1L 4Z77B 4LP5A 1MLCA 4PJAB 3PXJA 4JQVC 1J88A 1KCRH 4NQDD 3OGCB 4M8VA 2D31A 1NJ9B 2JJSC 4YAQB 4NJ9H 3B2VL 1NUGA 1YEDB 4P4RB 2P48B 2I07A 1TVBA 2NX5D 3ROOB 4X6CA 1CN4A 3BKYH 1AQKH 3ZKNC 4H1LA 1NBVH 5HDBF 4WWKA 2BY1A 4RA3A 3SKJH 3GSXB 5C07A 4YE4L 1E4KC 1NEZG 3RWIA 4OD3L 2PW2B 5K93A 2J6EA 3PL6B 4O4YL 4BQCA 4OBRA 4KUZL 4Y4KB 3Q6GL 4NFBA 3OF6D 3PWPA 1YEHH 3RVWC 4F9PC 5F7LB 2CMRL 4PJ9B 4ZXBB 5DDHA 3V6ZB 5B3NA 2V5RA 5I19H 1CCZA 3EFDH 8CGTA 2CKBB 1PZ5B 3ZYJA 2HA1A 1G0XA 1AC6A 1QYGH 2WMPA 1MRCH 3LQAC 5T1KD 3V52L 1FIGH 2EDQA 2V17H 4CU7A 3KPRD 2SEBA 5ETUB 4F7TB 4J6RL 4MQ7A 3O2VL 3L6FB 3QI9A 4UQ2B 1P84J 3EO1B 4HQQL 2KZ1B 4MB3A 4HWBL 3KXFD 1BVKB 3X3GL 1S7WA 4HX1B 3GM8A 2FIKB 3BSZH 4JRYD 5D7IB 3RNQB 1ZLSL 3OJ2C 4KJPD 3H7BB 3HNTL 4KV5F 4JEGB 5DJDA 1S7SB 4PTTB 1TXKA 3LRSA 1XGTB 1GGIL 1YEKH 4XP1H 3WHXA 4MYWB 35C8H 2E9IA 4FFWC 2C3VB 4ODHL 2BK8A 3KYKL 1KPRB 4GBXB 2CK2A 3AY4C 3QCUH 2A6DB 4IMKC 5INCA 5J1TC 4ZO9A 5EOCL 4RX4A 1I1FB 1QLRA 2VLKB 5CBAA 3CFEB 5F7WC 1HOCB 3K8MA 3MLRL 2EYSA 2V9QA 5C8JB 4ZODA 3EO0A 1KN4H 1KIPB 3QCVL 2YRPA 4GJTB 1P7QB 1VPOH 3D85A 1F8TH 4ERSH 4H25A 4YDIL 3ULVH 5EO9B 1N8ZA 2D0GA 4LAJH 4WW2C 2EYRA 4CMHB 4I13B 4WW2F 3IFOB 4NUJB 2JB6B 2VDOL 4Q6IB 1F11A 5FEBA 5E08L 3BE1H 1D9KB 1VCAA 2VZOA 3H9SD 1CL7H 3FFDB 1DBAL 1TIUA 2CK0L 1DQML 1CXEA 3BH8A 5DVNA 2W0FA 3SKOB 5J9PA 1RJLB 4HS6A 1C08B 4MMZC 3PP3H 1B90A 1BX2B 3KYMA 5IJKA 3LS4H 3RDTA 1TZHA 1DBMH 4I18C 1H3XA 1OAZH 3DX7B 3SJVE 3QO1B 3ARBC 2ESVA 1JF5A 1QFWL 4PJAE 4CNIA 4GG8A 1CFBA 5DZOA 1KTRL 3NIDF 4XB7A 5IBUB 1L0XA 1IGTB 1QBLH 5IVXA 4B41A 1S5IH 4N0FA 5DJ0A 5IB3B 3HR5B 3QUYC 5F7DA 2VUYA 2HKHL 3QPQD 3W9EA 1A7OH 3EYUH 1FNHA 4X80L 5IVZA 1BIIB 4JPKL 1AR1D 3UTQA 1ETZB 3JV5A 2X7LB 2OL3L 3MUY1 4Q97A 3L5XL 1LO5B 3FCTB 4OUUB 2W91A 4PRPB 3H42H 3WIHA 1HEZA 2FATH 4Z7VB 2DI8A 4GBXD 1LK2A 4Z7WB 5EWIL 3T2NH 1EAJA 3GSWA 4U2YA 1CGVA 5D2NB 5E99H 4OZHF 4N5ED 3ULUE 3ZTJH 5MEQA 3T0BA 4PJBA 5DD0H 5F6IC 2J3SA 3JWOL 3FB5B 1T1ZB 4LLDB 1ZWIA 3ARED 3HA0A 3C5ZC 3P3YA 1CIDA 3GIZH 1FSKC 4YPGA 3JBG7 5KG9A 1MJJA 1GHFH 5D1XB 5DVOA 3MLTA 5MI0C 2ARWA 4KK5D 4WFFD 5F7MC 8FABB 3QNXB 4JFYA 4Z7UF 5D7IE 4DGYH 3RI5F 4IRSD 1XT5A 1Z6JT 3K7UA 4JFDD 4H88H 5C0DA 1UH3A 2Z31D 4QF1A 4PGZA 3F58H 1RZJL 3VXTB 3T3MF 1BJMA 4UINH 1Q9LA 3QIUA 4L3CA 1CG9A 4ZDHA 3U0TA 2B39A 3HUJA 2I9TA 2NQCA 4EN3B 2BCKA 1TETL 3NIFE 1BPVA 4LAQH 1X7QB 3MZTA 4UTAH 4A6YH 2VLKE 1YQVL 3D9AL 2ZUQC 3OHXB 4LCUA 5J0BA 1SVCP 4DUVA 4XAKE 1S7QB 4EVNB 4F9LA 3GBNH 1E4WH 4H20L 1F3DJ 1TCRB 4PGCA 1LO3H 2VDLL 1F6AA 3TA3D 3HHRB 4YLQT 3CH1B 4Y4HA 1JGVH 1P4IL 3V5HB 4ZOCA 4EDWH 1UZ6F 2EO1A 4U1IB 2YWYA 1S78C 3QBTB 4F7PA 3BEWB 5DJ8B 3VFNB 5LQBL 2VQ1B 1HH6B 5IFAH 5HHXL 3ARWA 1INQB 1SYSB 1A1OA 1AHWA 2RHEA 3V4VL 2QQNH 3D0VB 2X9WA 1VERA 3L3DA 3IS0X 3KJ6L 1V7NL 4YNYB 2V2TA 4PJEA 4KK8C 5F7YC 1SBSH 3GJEA 3MLXL 3OB8A 3REWB 2YBRA 1D6EB 4WUKH 2E7CA 3WL9B 4H1LG 3TBYA 5DSCA 1WAAE 3LKOA 3MUGB 3O45A 3TP4A 3OWEA 4NZJA 4PGDB 2HFGH 4CVZA 1VSCA 2NY2B 5KSUA 1QA9B 1MLBB 4Y16C 3VXSA 1TZIA 4PJCF 3UTZA 1CI5A 4KK6C 4HWUA 4TPRL 2BOBB 4NO0A 3WS3A 4XXCC 3WCYA 5BXFA 4QTIH 1IGMH 5CEZH 3MLSL 1IKNA 1DBJL 1NCDL 2HLFC 1CTOA 1FZOA 1CVSC 5AG8A 1LEGB 2PXYD 1M71B 4IHOA 1T2XA 1TZGL 3OKLA 3I6LD 4EI6B 2CLRB 3P4OA 2I9LB 2H32H 1BEYH 4GQPH 1T1YB 5I1EH 4WUUD 5EZOL 5IT2L 4PRPE 2GUOB 3EJJX 3JUYA 2QADC 1INEL 1FAIH 4PY8I 1EO8L 2V9RA 2YD5A 1IGJA 4Z7VE 3AMKA 2MTPA 4Z7WE 5HHVH 3GMQB 5D2NE 1TVDA 2YSSB 5HYJB 1I1AA 1XF4B 4TUOA 3HMWL 4HD9A 3VCLB 2EYTA 1AGDA 1X6LA 3O3AA 4FABL 4GG6A 3ZMRA 1U6AL 4ZUTA 1G7JA 4ZAKD 1EEZA 2FO4A 3EFFB 2XZCL 1S7UB 1BMGA 3QH3B 5FA4A 1GC1H 4JDTL 3LS5L 3OBAA 1RULL 1ZT1A 5IHUH 1J8KA 3PQYB 3RVTC 1OSZA 3OJVC 4ZG1A 3U1SH 1G7IB 1EJOL 4HULB 4HC1H 3GJFH 2PTTA 4WI7A 3GSVA 3BRGC 3M1BA 1LD9A 2VL5B 1FE8H 3DX8A 3H9ZA 4X4MA 2H41A 4P46D 1PBYA 3CU7A 1YJDL 1C5BL 1CLOH 1NCBH 4OD2A 1NGWB 2DQDL 3HG1B 5B4MC 4JO2H 5IMKA 5IW3A 1OD9A 4HGWA 3RWEB 5BOPA 3QRFM 1CF8L 3U46A 2JCCA 1X4YA 3VFVB 1CZ8H 4NM4H 4PD4K 3KG5A 4H26B 3MJ8A 4U1MB 1F4YL 4X83A 1RUQL 3MRDB 1A0QL 4EIGB 1G7PA 2F58L 4EOWL 1GGCL 4QRRD 3EDDA 4JQXC 2QQQA 4HT1H 4LSQL 2N7BA 4CBPA 1T7WA 5E5RB 1U8JA 1CFQB 1SY6H 4AM0A 3B9KC 3JV6B 4MAUL 4ZTOL 3HPJB 2DQEH 4OF0A 2EKSA 3INUL 1J05A 5T3XL 5ABDE 5ILTH 1G9NH 4WU5B 2UZIL 4MX7A 4ZO8A 4C55A 3X12A 2EIBA 3IF1B 4IRJA 2JK5A 3EOTL 5E2VH 5D1QC 4KKAC 5JHLL 3JVGC 4ZPVA 3IFLH 2R15A 2CUIA 3KPSB 1MCPL 1MJ8H 5DUBB 2VE6B 1A2YB 2A6JA 2HJKA 5DMGC 1NC2A 1MQ8A 3QEUA 3P0VH 3KR3H 2J88L 4CGTA 3ARQA 5JO5B 4HUXA 5F1OB 3MRIA 5HI5C 2P8PA 4IIQC 3ZYIA 3MNZB 4JRXD 2YS4A 3RA7L 2FB4L 4XPGH 1A7PH 1LE9A 1HE7A 3LKQA 2Y5TB 4U6HA 1OSPL 3STLA 5EC2A 4X99A 3QDMB 2MNUA 3QXWA 5F9WC 2OCFD 3DX9B 4JFZH 5E2UL 1PYWA 2VXSL 5ICZB 3DSFL 1NKRA 2XNAB 4URTB 2UYLA 3WKML 2JF1A 3C60A 3CMOH 5HYSG 3FONB 4ZFZA 1YNTB 4M62H 3P30H 2ATPB 4U1NB 1AD9B 4LLWB 2FSEB 5F7HA 2Y06L 2NY5H 1BAFL 1P7KA 4X7CC 5DEFA 3T0EA 1MCDA 4UI2A 2PR4L 2R1XB 5HYJE 5B3JE 1YYLL 4GW5B 4R8WH 4UT9H 1R5VA 4WFGE 3VXMB 3CFBB 5DD6A 3L1OL 3SGDH 4JZJA 5GS0C 1S9XB 1KC5L 2W07A 3GSNL 1T4KA 4R4BB 1T2QL 3O3DA 4MA7H 4D3CH 5GRUL 4D94A 1Q94A 1RHFA 3MJ9A 5BZDB 5E7FA 4JHAH 2R2EB 3LN9A 3SDCC 3V95A 4YJZL 3PQYE 2R0WL 3DYOA 3HFMH 5IG7B 2FL5A 1VHPA 1T1WA 1QBML 4I18B 4LRIC 4GRMB 1T0MA 3DMMC 1FYHB 1U8KB 3ARBB 4PGJA 1FBIH 2AK1H 3KPQA 2F53A 5FO8A 4NSKB 1D5BA 1XGUA 3MRLB 2VDML 3BD4A 3HG1E 4UT7H 2IALA 1SVZA 3W9DA 5CEXA 3HZYB 3S88H 3TCLA 4YFEA 3B3IB 5FV1L 1CFVH 3W39A 3QUKA 5C6TL 3PHQB 2ITDB 4LSDA 2CRIA 2Z93A 3RBSA 4I3GA 1WTLA 3A6CL 5IHZB 3MCG1 4EQ3A 2VSDA 4M9PA 5GRXG 4LEOA 3I6GA 4Z5RA 5D8JL 4WV1C 2DJUA 4BZ1H 4DKDC 2L7JA 2VLME 1UKQA 3FQUB 2YRLA 1FO0L 1ZLUH 2F5BL 1JF6A 5TH2B 4J4PD 3QIBB 3HC0B 5DF0A 4J8RA 1RZ7H 4M7LH 5D6DA 1EBPA 1JUFB 1FLRL 1FQ9C 1A3RH 4HWEL 5CCKL 1Z2KA 1I3GH 5HI3D 1CGSH 4JO3H 3MLWL 1R0AL 3E6FA 3FT4B 2RIKA 5F6IB 4R6UA 3QNZB 1BECA 4JDVB 5T3ZL 3QEGL 1AXIB 3C5ZB 1ND0A 5DHVH 4AEFA 2AS5M 1FSKB 3ULVD 5I8KL 3WN5C 3KPSE 1FH5L 5LGHL 1BZ9A 2Y1VA 2DTSA 1YUHA 3GHEH 4Z7UB 5DWUL 3CX5K 2FX9H 5CS7A 1SJHB 4KJPC 1KB9K 3I02B 4P23C 3GIVA 3U0PB 5B8CC 3QUZA 2HKFL 1IC1A 2R1YA 3U36A 4XNYH 2O93L 4BFIB 3EYVA 3D2UB 2VERN 3SDXB 4KZDH 2XA8H 3FAXA 4OLYH 1KFAL 3QDME 4HGKC 3NGBC 5I1GH 1NAKH 2P5WD 2DWEA 4G43A 4Y0GA 4OI7A 2BJMH 12E8L 1OOAA 1I85A 3TO4A 1WZKA 4M7JH 4PJFF 1FNSH 1HHGB 2JIXA 4JM2C 2PYFB 4OT1H 3RAJH 1OPGH 4JM2F 1RFDL 4UBDC 3DVFA 1EX0A 4GXUN 4PTUB 4AK1A 3RL1A 2BP3A 3QHFH 3SDYH 5E5MA 4E41B 1X5GA 1AKJA 3KLDA 3WFDL 5I16B 1OVZA 4HK0B 1QFWM 1CK0L 3OKOA 3VXME 2EE9A 5E03A 5TDOB 4ZQKB 2WZPD 2RCSH 1FRGH 2VXQL 1KIQA 2VZ1A 3RWCA 1OB1B 5JXEA 1YYML 3PWUB 3MODL 2E8YA 1QKZL 3HS0B 1WFNA 3L3HA 4LLAA 3C6LC 3BZDA 2QTEA 3DTXB 1JZ2A 1U8HB 1FP5A 3LPGA 4YHMH 2R2BA 2VR4A 3FN0L 5GS2D 4P9HH 4M6ML 4NP4H 2ZOKA 1HDMB 1KGCD 2E6JA 1EAPA 2HT2C 1QHOA 2YKLL 3WDIA 1M7IB 2V5MA 3L5WA 2B7DT 5FUOH 4CRPA 5C08D 4TNWK 2WBWB 2VMFA 4XNQB 1R3IH 1LHZA 3GRWH 3V8OA 4IMLB 3HE7C 5BVJA 1S3KH 4GRLC 4JCLA 1FVCB 1JWUA 3FO1A 5CUSH 3MV11 4XC3L 1YNKL 1RK1B 2Y7QB 2ZUWA 2VDQH 3V5DB 3RUGA 4X7DC 1IVLA 3MLPA 5JOPE 5JA9A 1E6JH 2OLDA 3D3VB 3B8SA 1YMMA 4QRPB 3KYOA 1RZ8B 3D2UD 4WHDA 4TSCH 2ZCKL 2QADB 4HBCH 4LSRH 5TE4H 5IEKB 2YD7A 3UTOA 3FZUC 2YD3A 3KYNA 3ZKXC 5INDA 3FAWA 5E8NA 3L3JA 1MVUA 3DHMA 1G6RA 3MRHB 3RWGA 4QTHB 4OAWB 2DD8H 1ONQA 3BWAA 4HWBA 4XWGH 3JV0A 3BDYH 3HZVB 1H3TA 3VFPA 1IC4L 5LXGH 1YDPB 4X9BA 2H1PL 2OM5A 3X13B 5C6WH 1NGYA 4XPFH 3WFHA 1MHEA 2D7TL 1FGNL 3QPXL 4FQXC 4Z7UE 4NIKB 1L7IL 4Y19A 5F6HI 4NGHH 3F65A 5BRZD 4EI5C 3T04D 1JTTA 3DI2B 3ECBB 5HGGS 5CD3B 2FO1A 4JJHA 4QNPF 3U4BH 1ZE3C 4H1LH 5D1ZC 2FIRT 5E2WH 4UV4H 2E27H 1JL8A 3SDXE 2J6EH 1S9WB 4P2QA 5C0BA 4N0UA 1W0VA 1CLZH 4MVBC 43CAA 1NC4D 1QR4A 5IMOA 1NGPH 3WO3B 3FB8A 3WUWG 1F90L 3OKDA 3VJ6B 1CLYL 1JHKL 4KRLB 3VXRD 4AQ1B 1RUPL 2PTVA 4JG0H 5GGSA 3FHQA 3LKNB 4BH8B 3QJFB 1A6VL 5BMFL 2WIMA 3ARTA 4E41E 1D5XB 1UZ6E 1KJVA 4WCYH 1K5NB 4KUCF 3BO8A 1CGTA 4MB4A 4ORGB 5JHDD 1ES0A 4ZD3L 3QNYA 3BPCA 1INDL 1OCWH 3G04B 3VRJA 1T5WA 4OB5L 3M8OL 4FXLA 4CJ1A 4NKQB 4NO5A 1UXWB 4Q9RL 2RFXB 3OZ9L 4M6AA 1WUNT 4ODUA 2WM0A 4LDOB 5E4IA 5A16A 3TBTA 3DETD 5D5MA 3EYOA 4XMPH 2E6PA 3MRQB 3GK8L 3OG6B 4LSUL 4Y8DC 2CKBL 4EQ2A 1A22B 3RL2B 3HNSL 1HI6B 2EIZA 2F8OA 3ULUL 4G6KH 4F8QA 4O2FA 4RMTA 5JXAL 3NIGF 3QQ4A 4IIQB 4X4YB 3K2UH 2OTPA 3GKWH 2EDHA 4OCRL 2G60L 5DQJA 2F9BT 3MV8A 5CEYB 1CFSA 3K4ZA 5ID0A 2OL3A 3CH8A 2NXYB 5F9WB 1DN2A 1LO4L 5JORA 5HJ3A 3IDMB 1HQRB 4UQ3A 5EA0L 1S9KC 4MD4B 3CK0L 1SM3H 1U3HC 4OLUH 3QZWA 3F12B 3D3VE 5ERWB 4Q9QH 2BVEA 4QRPE 3OR6B 4APQD 3MACH 4ODVH 5AAMA 2AKRA 1EFXA 4YGVA 3WFBL 5IB4A 4PJ8D 5EU5A 4PYHA 1U8IA 4MCYA 3S98A 4OZIA 4MJ6B 3PGDB 1U92B 4DEPC 4JGUA 3U30C 4RISH 4J1UB 2JLLA 5EBGA 4JFPA 4N9GB 1EHNA 2J1KA 4Y89A 4QT5B 1PG7L 1UB6B 3QUMB 5GGTL 3AU1A 5L7XH 2Q7NA 4PGBB 1KELL 2X4QB 3IDXH 1JYVA 4XPAL 3SDCB 3K8LA 3T8XA 5ADOH 2XQYK 3KPPB 3H0TB 4R4ND 2CUHA 1P4BH 1MFCL 3ZE1F 3DMMB 3Q6FB 1IEHA 1MHHA 3DROB 4JQIH 4M02A 1TJGL 2H45A 5E1AA 1FVDB 4QYOB 1NFKA 5HXMA 5GS1B 3VXPB 3VMNA 5ISZD 4W4NA 2BC4A 4GFTB 1MOEA 4IM8A 3ROLB 4FFVC 1HK6A 1FV1A 2P42B 5ESVA 1X5LA 2DOCA 3N06B 4Z18A 5L9DH 2HFEA 4RZCB 5JOFA 4A2MA 4GAJL 2IQ9L 5I2IA 3B9AA 4PREA 2X89D 3PWVB 1A6TB 1R3LB 2YZ8A 4U1HB 3SY0B 1CFTA 3ET9F 2Z4QB 3DV4B 1QRNB 5ALBL 1FFPB 3ESVF 4AH2A 4XVUC 4MXWL 2NXYD 5T5NF 4KDTC 2HTLD 1ZHNA 5IMLB 4GMSL 3W0WA 3MRFB 3F7QA 3VH8B 1LNUA 3TNMA 1MRFH 4K94L 2VRAA 3TYFB 3WMSA 4DW2L 5FECB 5FDWA 4OLWH 1V7ML 1MFAL 1EEYB 3WN5B 5FK9A 3MRRA 4H0IA 4QHNA 1A9EA 3ZHLA 2C7UA 2DKUA 1NKOA 1ROWA 3A6OA 4KI5D 4R4FL 2IADA 1IEAB 3SQOL 3WLBB 4L3AA 4P23B 3W11C 5I18H 4BZYA 1ZTXL 5B8CB 5CLWA 4S1QL 1K8IA 1NMCC 4R97B 2VYRE 3HKFA 3P11H 4M1DH 3QULA 5HHOB 4MQXD 3U9PL 2HN7A 1JPSL 3UPAA 4PRNA 4OZGB 3WO4B 3NGBB 4N1HB 4M43L 1F2XK 1Z5LA 1NBYB 3TZVA 4M7KL 5FGRA 5L2KB 1F3JA 3VWJD 2NY4D 5IEHB 4PJFB 1MI5B 2YA0A 1N5YL 1Z0MA 3BXNA 3OKNA 4IJ3C 4Y1AA 4JM2B 1J0JA 1FL3A 3PWJA 4EBQH 5IFJA 2Z92A 1BBDH 5D7JA 1NCAL 2Y6SC 3O9WD 1DFBL 3UPRB 4HFUH 3BZ4A 4YHZH 4HPYH 3GMLB 4G9FD 4YBHA 1F42A 1T20B 1CDYA 2EO9A 3TIDA 4LLMB 3VXNA 2D7MA 1Z9MA 2Q76A 4HJGB 4ZS6D 1X5ZA 1AGCA 3LEVL 2ZZUT 4K3DH 1HKLL 3MO1A 4M4PA 3NFNA 1OAXL 5HGAB 1V3JA 4JY6A 1TCMA 4NQVB 1SEBA 3QCTH 3LQZB 3PE9A 2CDGB 3DBXA 1Q8MA 4AMKL 4OSUH 5DMKB 3IGAA 4NHUB 1JPTH 4IS6A 1NANI 4P4KA 3LY6A 3VI3F 3QHZL 7FABH 2GTZA 1RIVL 2HP4A 4NQSB 2Q8BH 3C6LB 3S4SA 4OCLC 4LFHG 1F4HA 4KJQC 4HW6A 3PP4H 1BIHA 3MLVH 3PNWB 1HHIA 4LGRB 3LZFH 3H2WA 1TNMA 1KT2B 3QB7C 3B5GA 4JGJA 5TGBB 1EDQA 4DN3H 2HVJA 1Q0XH 3HE7B 1JRHI 1F2QA 3HMXL 4GRLB 2DM3A 3ES6B 3C5SA 2ZJSL 1IAKB 1XGYL 2VIRA 3S8WA 1OTSD 3MYJB 4V1DA 3NFSL 2FWOB 5DK0A 3IDUA 3VFTB 2Q87A 1JF1B 4K23H 1MUJB 3MLYL 1QRNE 4G7VL 2O5YL 2G2RA 4XBPA 1KG0B 4MD5A 3ZKXB 3HB3D 3RIFF 4XH2B 2PYEA 5EH1A 1UZ8A 4K7PY 3GSQA 4I8DA 2IG2L 5A2FA 4KJYB 3T2OA 3LB6D 3MRCA 5F7UA 3B2UD 4HDIB 3B9EA 4JFOA 2NY3D 1CICB 4YX2H 3ULVF 1FNAA 1MJ7H 4XMKH 4QOKA 1MNUH 4PYGA 2CDEB 4Z76B 4FQXB 4IOSD 1FFOA 1XFPA 5T1DL 1I1YB 1NUDA 4RGNC 4M5ZH 3IDNB 2BSSB 4G5ZL 3MFFA 4EI5B 4WFHD 2P8MA 4ZUWA 5I1CH 1BF8A 2V7HB 2JJUA 3QDGD 1ZLWK 2XN9A 3LSOA 1LDSA 4LCCA 4YK4C 4KGJA 3FO0H 1H8SA 3ZSTA 3HRZA 5D1ZB 4F3FB 2V2XA 1HINL 4P57B 5HHOE 3L3OB 2GJ6D 2APWA 3B6SB 3MBXL 1T21B 3IXTB 4OZGE 4PRIA 2LE9A 4L9LC 5L8LB 4MA3B 3O8XA 1OM3L 3MV01 4XC1H 1Q1JL 4XP6L 3RVVC 5L2KE 3MBED 3T2QA 3U9UB 5ITBL 4PJFE 1U8PA 1UWGH 5H2BA 1RU9H 1LO2L 3GMOA 5GXBB 2O5XH 4POZD 3WSQL 3SGKA 4JANB 5IM7A 1RIHL 5GGVY 1PX3A 4JZNA 3WFEH 1TJIL 3WXVL 3V8CA 1GGBH 1UB5B 2WIIB 4LARL 1KTDA 2FECL 2XQYG 2X4OB 5JNYB 5DTFB 4JKPH 4KTYA 5EOTA 4LMQI 1DP0A 4FN0A 3L5IA 5FO9A 3LVEA 3ARVA 4GKZB 3V6OA 5GHWL 5I6XC 4OBSA 4FQLL 5LJYH 5EU6B 4FNLL 4AIOA 2A9NL 5IWLA 4UDTB 2B20A 5HGHB 3SDDA 2MMXA 4OTXH 5F72S 3IRZA 1E28A 2ICCA 1O5DT 1G0DA 2H3NA 1W0YT 5DJ2A 5DJYB 1XF2A 2YWZA 1MWAB 1KEML 5D96C 1KULA 2MQ3A 5C0GA 1KB5B 1JHLH 2VDNH 1CICD 4Q2ZA 4W6XB 4JPVL 1UWXK 4PJHA 3NN8B 3RJDA 4E5XA 4GT7A 2ZG2A 4D9QD 3MGTB 5EN2A 5CJQL 4OGXH 2C1PB 5JPNA 3O11A 1FO0A 3LCYA 3NZHH 1U3HB 4Z7NF 1ADQH 2CLVB 5C07D 1CR9L 2ICWA 5ICYB 3G6DL 4YHKH 4HGMA 3MJ9H 5A2LH 4GW4B 2FYYA 2BRRH 3PWPD 3X11B 4KQ3H 4HKZB 1CDIA 1P1ZA 1NCCL 5CINH 5GGUA 2X4RA 4DEPB 4DQOL 3U30B 4HXBH 4TTGA 3NPSB 3SE9H 5C0AB 1GZPA 2ZSVA 1T2JA 2M8XA 1A7QH 5E8DH 4YHPA 1MJUH 2Z91A 1QQDA 5JQ6L 5DJ6B 1T5XA 4D9QE 3BIBX 1ED3B 1MIEH 4GRWB 1XGPA 3CC5A 5E00A 5E6ZA 5J3HD 1FDLH 3QQ3A 1EUTA 1J18A 1T80A 2ATKA 3VDBA 2IAMB 3QUXC 4M3KB 5F9DC 3QR2A 4PP1C 4ENEC 3TPKA 1MAKA 2R56L 2VAAB 2EZ0C 4X6DF 3Q3GA 5HPMB 5FM5M 4PG9A 4Y5VA 4M8QA 1YECH 4P5KB 1QP1A 4NKOA 1SMOA 2EKJA 1XR8B 2B1AH 2QL1A 4IDJL 4GKNA 4R7NB 4AL8H 5C0NC 4NCC1 1QSFB 3NFPB 5IESL 4BSWB 3LH2L 3TM6A 4CDGC 4RX4D 4Z0XB 5K9JH 5CBEB 3GMMA 2VSCA 4FHBD 5HHNB 4PR5B 5DI8B 2Z35A 1I1CA 2E7BA 1MRDH 4BK5A 4RGOL 2P47B 4KHXL 3S4SG 1MHCB 2Y25A 3TGXA 4GXVL 3D85D 1Z9LA 3O6FC 3ZL4H 4X8XA 1WFOA 1XF5A 2UZYB 4F7MA 2VXTH 4MNHA 1IEBB 1PD6A 2D2OA 3GSOB 1UM4L 1BD2B 1NFIB 3UBXG 5JW3H 4R90L 2M1KA 1D5ZA 1XAUA 1KBGH 4BA8A 5F44A 1MY5A 4P59H 1OAUH 1WZ1L 4ISVB 2FLBT 4M6NL 1R5WB 5TPWL 2DWDA 5EU6E 3EJYD 5DJAB 5KTEL 2BNRD 4NQDA 3HI6H 4WO4C 5MHSE 5ACZB 1PG7X 5BS0B 4X6BB 4OZFA 2QQKH 3MRGA 3WUZA 5B38B 5IB2B 2NX5A 2WUBH 1U41A 2GTWB 4YDJA 4AEHH 1FGVH 5IQ9B 4ZUUB 1GC1C 2WINA 1NMCB 2XFXA 5A2IH 3CPLA 1SYVB 2W0LA 2X9YA 1VACA 1I7TB 4KXZI 2BVOA 4XNUL 2E7HA 3MRBA 4LLQB 1RZKH 4X8JB 5BQ7A 4TVPE 4NWUH 1XGRA 2B0SH 3BDXA 2AI0H 3OF6A 2WBJB 3DRTB 2V5SA 4NQEB 4UIKL 4FQJL 2IAMD 2PUQT 2OTWB 1OHQA 2DL9A 1U0QA 2X5PA 1YEJL 4IJ3B 4XAWH 1X5FA 1D5IH 5A2KH 1NDGA 4UUJB 3ARDA 3KPRA 4WI4A 5DRZB 3FQXB 4HS8H 2P1YA 1IAIM 4U2ZA 4LPUA 2Q1EA 2OK0L 5FYKD 2ED9A 3WV0A 4S11A 4HH9B 5C0AE 4QRUA 4D0BB 3P77B 5C0FA 2DMBA 4JO1L 1K4CA 3B2VH 2FEDC 4FTVD 2XKSA 4ELKB 4JRYA 3T1FA 4ELMA 1JE6A 2WUCL 4L1DA 2F19H 4NWTL 1UJ3A 3D25A 4GRWE 2FGWL 2DIJA 2BMKB 3QXUA 3ZE1E 3L7EB 1L6XA 1K6QH 3KPNB 3BWUC 1BQHA 5JDJA 4OV5A 2P8LB 1A6AB 4YE4H 4D0CB 1G9NC 2CD0A 3S96A 1ZANL 2VDRL 1FL6B 3E6HA 4OD3H 3U7YL 4JFEB 1JYNA 5GZOD 5HDLA 3TPUA 4OIIL 3BKJH 3Q6GH 3O41B 3BKCL 3VRLE 2CMRH 1IQWL 3JTTB 4FOMA 4O2CB 4Z77A 2JJTC 1P5UA 5E6YA 2HTKC 4PJAA 5BO1L 4BQ8A 5FHBL 5C09B 3OGCA 3S3SA 1Q9WA 4HJJL 4YAQA 1QSFE 2XKUA 3QO0B 3V52H 4HSQA 1YEDA 3JWDC 4QEGA 4PLJC 4PJXF 2OYPA 1JGUL 3AM8C 3MXWH 4WDIA 4J6RH 1JZ7A 5BV7L 1G6RH 3ROOA 2CIKB 2DQGL 1ULVA 4HQQH 5I1LB 1T83C 4GMTL 1W8OA 4HWBH 5E6IC 4NQCD 3H9SA 4HIJB 2C9AA 4KROD 4DTGL 1FC2D 4BKLB 3WS6A 3OB0H 4Y4HD 1ZLSH 3CVIL 4RFOL 3HNTH 3WHE0 4FQIL 5D93C 1BD2E 2WBJD 4ZXBA 3V6ZA 1J0KA 1MREH 4MXVE 1OP5K 4RMWA 2CKBA 1GGIH 1PZ5A 2PO6C 2BXYA 2NY5C 4QO1A 3BIAX 1D5MB 1T0PB 4ODHH 2WV3A 2YN5A 1OGAB 4MA1C 2DLHA 4P5TD 4WVRA 4MJ2A 4NKIH 5ETUA 4F7TA 1DZBA 1UACL 3NTCL 5BS0E 4KKBC 4RGNB 4U3HA 4RMVA 3VFUB 4JKWA 3EO1A 2I60L 4KI5F 3MLRH 1WBXA 3MXVL 5DFTA 3P9MA 4JAMB 3S5LB 1BVKA 4LCWB 4XI5C 3QCVH 4HX1A 4OFYA 4KJWC 2FIKA 4GO6B 5D7IA 4HXAL 4WTZA 4X7FC 4LIQE 3H7BA 1NUNB 3IFNL 1P4LA 4O02L 2CDFB 4U1JB 4L9LB 1RQ5A 2QKIB 3CFKB 2VDOH 2P44B 5E08H 4P3WA 1XGTA 4OJFL 1DBAH 4NQEE 2CK0H 3CFJB 3CJJA 2QJDA 5C92A 1DQMH 2C3VA 1FZMB 1KPRA 1GOGA 1JTPA 4GBXA 4MS8D 3SDAD 3KLHC 4BUGA 1GGUA 2X1PA 3UTPD 1AQDA 4ONHA 2A6DA 2DLTA 4FZ8L 1A6UL 1I1FA 2VLKA 2ARJA 5F3HA 3SKMA 3CFEA 1AO7B 2R4SH 1YN6A 3X14B 1P6AB 4NRYA 1CD1A 1HHKB 5C09D 5C8JA 1IZKA 1WICA 1BF2A 1KIPA 1QFWH 3O3BB 4JRWA 5GGTA 1CE1L 2LABA 4YC2C 3VGHA 4PY7B 4L3EB 3IFOA 4RIRA 4PLKC 2J5LC 3OPZL 4Q6IA 4YO0B 2DLFL 5EUOF 3VWKD 1D9KA 3VI3E 4GUPB 1MCOL 2BFVL 4X80H 4Q0XL 5IB5B 1Y0LA 1GIGL 1C08A 1U58B 2XT1B 3BHBB 4JFEE 3NOIA 1BX2A 2OL3H 2NZ9D 2GSGB 3L5XH 4DZBA 2E7MA 3DX6B 4ZSOB 3UTPE 5DRNB 3DX7A 3V5KA 4QY8B 1MCHA 1AIFA 2VZUA 1NPUA 3F7RA 3QO1A 4GLRH 1WAAA 3JSSA 5ENWB 4L5FL 2GK0B 1DVFC 2DMCA 4RRPG 3RWHB 3UTTB 2W92A 2VDPL 4XHQA 5C09E 5DK2A 5EWIH 5TE6L 1IGTA 5IFHH 3B4NA 5JZ7D 5LKNA 4NDMA 3JWOH 4R0LC 3HR5A 2M26A 2DBLL 4N90D 4UOW0 1QVOA 4PJGF 1YEGL 1BIIA 3BUTA 4B7IA 5DC0A 3IYLW 5A3ID 4EUPA 2FX8L 2X7LA 5L2JB 4OCNC 2X4UB 3DYPA 3MJGX 4OZFG 3OTTA 1NFDF 4RMSA 3TIEB 4LLVA 3FCTA 4OUUA 2ITCA 2R23A 1H8OA 5CZKA 4CL7A 1RZJH 1DUZB 3EGSB 1BOGB 3TT1L 1J11A 5EB9A 4Z7WA 5JOEA 4XX1E 2VAJA 1I7UB 1OGAE 3PDDA 2EEBA 4HZLA 1QHPA 4ODXB 3UYRL 2EDNA 1TETH 4F2MB 4XRCA 1A4JB 1T1ZA 1YQVH 4RGNE 2B2XL 3D9AH 4RQQA 3PV7A 1U91B 2H2PC 3ZO0A 3TVMD 3BQUC 1AGEB 1AFVL 1NC2D 5GS0L 4M1CC 4LCWE 8FABA 3QUXB 3UDWA 2VDLH 3QUML 3K80A 3HN3A 1P4IH 5J06A 4ZUSB 4XCEB 2PXYA 4RAUA 5F9OL 3VG0L 3X17A 1BOYA 2MCPL 3VXTA 4KVNL 4JY5L 3QXDA 1G7MB 4NQXB 4WUUA 1X5KA 3RY5A 4PG2C 5HHXH 4P9HC 1PKQB 4ORZC 2A9MH 4L4JA 2BSRB 3V4VH 4P3DB 3KJ6H 4DOHB 1V7NH 4EDXB 4UDUB 1X7QA 3MR9B 1L6ZA 1MCNA 3MLXH 5IF0B 3C60D 2YD2A 4GAGL 1AO7E 1LK3H 3D39B 3SBWC 5DQ9B 4L4TD 3WXWL 4EVNA 3O6FB 3G5XB 1KJMA 3CH1A 4NQTA 3AGVA 2GJZB 4HBQA 5J6GB 3V5HA 4WTWA 4JY4A 5E0QA 5DS8B 4L3EE 3QDJB 4TPRH 1U42A 3BEWA 3VFNA 2VQ1A 2A0LD 1MEXH 3MLSH 1INQA 5D7LB 3WD5L 1DBJH 1NCDH 1SYSA 1KCKA 1RZFL 3OSKA 4QRTB 4P46A 1KIRB 3NCYS 4WO4B 1RUAL 1TZGH 4F58L 3REWA 1D6EA 1PDKA 4ZSOE 4QHUA 4MNQB 5EZOH 2XWJB 2F53D 3HMXA 2ZNWA 4OCSH 2YPKB 1INEH 3UTTE 3M17B 1EO8H 4I48B 4PGDA 2HJLB 3S34L 5I73B 4ZFOL 3PV6B 2JE8A 1NBQA 5C9KA 5J13B 3U0WH 1ZA6A 3HMWH 3CDFA 2KQMA 1L0QA 5DRXB 4X6CF 4DKEL 2JELL 4PP2B 3G9AB 4WWKC 1AJ7L 1NGZB 3TYGH 2A2QT 4D8PB 5FHAL 1NCTA 2HAZA 5ANMA 5ESQB 4JDTH 5A43C 3ZT6A 3LS5H 1RULH 5CSZA 1LEGA 5I9QC 1M71A 1XZ0A 4LASL 5CSBA 1EJOH 4YBQD 2I9LA 1JFQL 1S7VB 3PIQA 3MV7B 3VFWA 4G8FA 1FG2B 3QXVA 4YFLI 3VRIB 4BH7A 3MRMA 2GAZB 4DGIL 1YJDH 1ITCA 1C5BH 2OJEA 1QLEL 4ZPTB 4PBXA 1CXFA 3OJMB 2V6HA 2DQDH 5HYJA 5DUML 1XF4A 5KZCB 2IQAA 1WWAX 3QI9C 6CGTA 3G5VB 3WNNA 1CF8H 2R0LL 4X6FB 3U6RB 4JRXA 5DHYB 2NW2B 3QG7L 3EFFA 25C8H 4ETQA 1S7UA 3QH3A 5BJTA 4HKJA 3RWJB 1F4YH 3GSRB 1RUQH 1DANU 1A0QH 3PQYA 4HUUB 3UCRA 5HI4C 2F58H 1G7IA 2H9GA 2GQHA 5FCUL 3CLFL 1J12A 2E9WA 4LSQH 5C7XL 2BVQB 1L4IA 5E9DB 1VKXA 2HFFB 4MAUH 1QLFB 4ZTOH 4J3VA 4OQTL 2DQCH 5CZVL 2EIDA 4B0MM 3OKEA 4LMQE 1OARL 1MCFA 3QWOB 1PKQE 5T3XH