5I1HH

Crystal structure of human germline antibody ighv3-53/igkv3-20
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
211
Chain Sequence
EVQLVETGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords FAB LIGHT CHAIN
total genus 41
structure length 211
sequence length 218
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1hH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1hH01
1S8DB 2DJSA 5ESAA 3HE6C 1CE1H 4LLYB 2R1YA 2CGRL 2VDKL 3ULVD 3ARTA 1IZKA 5E6ID 5EPMA 5E2UH 4A6YH 4ZO6A 1Q0YH 4RFEB 3L3KB 1CR9L 3MRLA 3MLZL 2DAVA 3GI9L 1FAIH 2HRPL 5DUPH 4HJGA 2V9QA 2QADB 1G6RH 1BX2B 4PB0H 5EH1A 3VWJD 3O3EB 4JFDD 5FO7A 3WKML 3NFSH 1RHHB 5D1XC 5E00B 3KYNA 4XCEB 3VXTA 5JPNA 5HHMB 3HUJF 1UACH 3WSQL 3GHEL 4JE4B 5E00A 1CIDA 4RMSA 3DMMD 3U2SB 4OIIH 4YEFA 2HTKC 5GISH 1F8TH 3NCJL 4K8RH 4X4XB 4F80A 3GSQA 2P4AB 3WN5A 4PGEA 3VG9C 1NCCL 4Z7VE 1HH6A 1EMTH 3STLB 3D25A 2JCCE 2GUOA 1ZLWH 2AKRA 5CILH 4XBEL 1RZGB 3CFJA 3P40A 4YFDB 1BQHA 1U8KB 5F70A 2WP3T 4GG6E 1CVSC 4HIJA 2AKRB 2N56A 3BP6B 3RDTB 5BRZE 3P9MA 1NCTA 5I75B 4QRRB 1D5ZB 1FL6B 5EA0L 5ESVA 3FL7A 2DMCA 1CD9B 1JNJA 5GZOD 3MRHA 1X6NA 4M93C 4HIJB 4LIQL 4LDOB 1HDMA 2IH3B 1LEIA 1F90L 2ZUQC 4FTVE 3VI3F 1JGVH 4GXVH 5CMAA 1TPXB 2GJZB 1FLRH 2ZJSH 5D7IA 5I73C 2GJ6A 5EO9B 4K8RC 1TVBA 2CJUL 4YHOH 3VXUE 8FABB 4JRYD 2Y7QB 4G7VH 2ZSVB 4X8JA 4YPGB 3TA3A 2HP4A 3VFWB 1YYLH 4G9FD 5D2LF 1HI6A 4DKFL 2FR4A 3IETB 5BRZB 4D0DA 4TVPD 1XF2B 4XBPB 2X1OA 2E3VA 4I13B 4X8JB 5D1QD 5EU7C 5C08A 1A7NH 4PYGA 4NNYA 1T66D 1NCCH 4PPTA 1U9KA 1CGXA 3QULA 4EQ3A 1S7XB 3RI5F 4N8VG 3OGCA 3N9GH 3L7FA 3S34L 5BV7C 4LNRA 1AGCA 1WFUA 5BS0A 2I9LA 1KJVA 3VRLE 1NGQH 1WGOA 3U9PL 3UDWC 4JAMA 3KPMA 3UTTA 4JM2C 2NY2D 4QNPF 3AS0A 1IBGH 4U1KA 4KDTC 4D2NA 3LQZA 2NY4D 1QACA 1JTPA 2VAJA 3Q3GA 5HSFA 5HHME 2FO4A 1QBMH 3L6FA 3VXRE 2DYPD 2IH1A 2Y5TA 5F21B 3H9SD 4HS8H 5ISZE 4PJ9C 1KIQB 4S0SD 1MVFA 1OGTB 2Y72A 1D5IH 3GJFH 1J18A 1V8HA 1BF8A 3IDYC 3PABB 1MHHA 3PV7A 3RVTD 4LVNC 1XGTB 5CJBA 2F54E 4IDJH 3QDJB 1KN2L 3D0LB 1H3TA 1MCSA 1QFHA 3QEQE 1RURL 4G6ML 2VE6A 3L3OB 4U3CA 5IJKA 1KB9J 4CMMB 1XGPB 2X4QB 1J5OL 4LLUA 4FS0A 4MJ5A 3GMRB 5DA0B 4XPGL 2FGWL 2ESVE 4JFFE 4JFHE 1CL7L 4OZHB 5EUKA 3MBEC 4LRIC 5DD5H 6FABL 4UIMA 3SDDD 1ZA6B 1ORSA 1RFDL 1QSFB 3KWWB 2RFXA 4ZUVB 4HK3N 2X1WL 3SQOL 2ADIB 2Z92A 3V8OA 5C2BL 3TJHC 2DI8A 4FZEH 5GGSB 4X9FA 4R0LB 3TO2A 4TPRL 4JDVA 3ROOA 3MLVL 3UBXG 2OSLA 3C60A 5SWQB 5TH2B 35C8H 4P4KC 5EU4A 2VXUH 5IEKB 3B9KC 2XN9D 4L8SC 5J4MA 3KYMA 4IRSD 5TF0A 1WEJH 3H2WA 4LKCB 4MDIA 5IM7A 3T0WA 2ADJB 2VXVH 5FYKD 3EJZD 1N26A 4XP4H 3U79A 5CCKL 4RMTA 4G3YH 4QNPE 4PLOB 2FH8A 4JFPA 12E8L 1I7TA 4UU9B 3RNKB 4UILL 4G43A 3T77B 3TBTB 2BNRD 2A2QT 2FX7L 2GYSA 4HK3J 1S7WA 5J9PB 1LEKA 3GK8L 3B5HA 4G6FD 4H25B 5HHOD 3TBSB 5KBNC 1TFHA 2K9UA 4PRNB 4H26A 3VXSE 4JFEA 3QZWA 5DD1L 2FL5B 3D25B 2P5EA 4ODXA 2OCFD 1NDMA 1JL8A 5DD3L 4XC1H 4YHZH 4TVPE 3QUYA 1QO3B 1G7PB 4RAHA 4M6OL 3CFIC 4ODXB 5DT1H 1QSFD 3QUYD 4U4BA 2YUWA 3TPUA 1JV5A 2XKNA 1V3KA 2J5LB 3U82B 5ITBL 1U36A 5ADOL 4U1JB 1BZ7B 3MUY1 1O7SA 5FKPA 2Q7YB 1OAZH 1P4IH 4HAFA 4JJ5A 3T0EE 4OQ1A 3UYOD 5CSGA 5DK3A 1I7ZA 2R9HC 4LPTA 5DEGA 5SWSE 4PJ8C 1TMCB 4ODWB 1P7QA 1B9ZA 3VGGA 1VCAA 1N4XH 3MXWL 4BFEA 3GHBH 1T4KA 2VLKD 4ZAKC 1KEML 2G9HA 1EMTL 3I6LD 4ZO8A 4R90H 4DGVL 1J8HB 4N5ED 4QO1A 2YD5A 2J1KA 4GMSL 3GFUA 4MXWL 5I8CB 2HVKB 1FVDA 2CGRH 2VDKH 4FABL 4M5ZH 4LDLB 4XXDB 1H3XA 4NFCA 5E6IB 5F7UA 3WSQH 2DLIA 5C3TA 1FVDB 1RHHA 3V0VA 3EAKA 3C6SA 2J88L 1CXHA 5E94A 2DI9A 4M1CC 2IPTH 2A83A 2MPAH 2OMNA 4ZS6C 2Z35B 2GKIA 1UGNA 2VLRA 4L29A 4M7LT 4QTIL 1S7TA 3SGJC 5DFTA 2P46B 1HCFX 1S9VB 4PJCF 3C5ZC 1FLRL 3MRFA 5I8KH 2R8SL 3MJ9H 2Z35A 4MQSB 3GSQB 1A64A 1I4FA 1Y6NR 2EDDA 4OFVA 2PYED 1RK0A 3QG6A 3FRPA 5D6DA 3ZDXF 2VKWA 3TT1L 3RVWC 2VAAA 2X4UA 4JZNB 2EICA 4MXQD 1PLGL 1X5GA 1VFOA 3LPWA 3C5ZB 1WBXA 5JLZB 1KCSL 1A7NL 1CXLA 3B9VA 5ID0A 4NC2B 3WIIL 1W72B 3O2VL 4YC2C 5FXCH 3GSXB 2CK0H 5DMKA 1D5MA 5CKGA 3VRIA 4Q6IA 5A3ID 2ZSWB 4P59L 4WWKD 1ND0A 1IGIH 1R5IA 2R4SH 4DVRL 1J88A 1DUYB 3QFJE 4MLSA 1HYSC 2A6JA 4HFWB 3U0PB 5C0BB 1IGML 1M4KA 2GJZA 3VGFA 4Z7QF 3BW9A 4XAKD 5CGTA 4P46B 3DRQB 1LHZA 2ZSVA 4YE4L 4Y19D 3OX8A 3QUXC 2WBJB 2YN5A 3ZYOA 2Z31B 5FECA 4BQBA 1JGEB 4OM1L 2OM5A 1KYOK 3BT2H 4NDMB 1T0NA 4BZ1H 4PRIB 5E5MA 3MRDB 1QSVA 1WVZA 2QV2A 4PJHA 4RISH 1W0VA 3QXAA 3C60B 3NFPA 4OZFB 4OCWL 1B0GA 1K3IA 5HYQA 5F9WB 1MCCA 2R29L 1JF1A 3L5WA 5A2LH 3QZWG 1RIUL 4L4VD 5EOQL 3GSRB 3R4DA 4J3WA 2QQKH 3C8DA 2NLJA 1KCUH 3JWOH 2Z31C 5L2KE 1JF1B 3WHE1 4LLVA 2A6DB 1NUNB 1FV1B 1QYGL 3RWIB 4LPYA 4Z77A 5EZOL 5D2LE 2H2PC 1NFDA 3GMLA 5EZJB 3CXHJ 3D39B 1P2CB 2R69L 4S2SA 1DBAH 1F3JB 3G5ZA 4IMKC 3BVNB 4Z76B 1EAJA 5D71H 1A6WH 1IKFL 5FA3B 5GJTL 3GMLB 1NGZB 1XGTA 1EUTA 3VI3E 1U8PA 1I1YA 1AQDA 1JNNH 2F5BL 2GITA 4G42B 1QFPA 3ARGC 2RCSL 3VXSA 3P77B 1U95A 4RIRA 5D1QC 4DTGL 2DLGA 3QEHB 2ZCKH 3FT2B 2OR9H 1JV5B 4U2ZA 5IB5B 3FFCE 1O0VA 3MOAL 3P4OB 5F9JB 1MFDL 4HZLB 1MSPA 4K8RD 4WRLA 4MJIA 3DV4A 5HHOE 3VXMB 5TDOB 3HPJB 3QWQB 5KSBE 4Y1AB 2VXSL 4URTB 4JCLA 5I16B 4KJPC 5T33H 1FYTD 3H9HB 1IM3B 3VXNA 3F7PC 2XZAH 2P43B 5DTFB 2ZUTA 1JGUH 1L6ZA 2OSLB 2B7DT 5AEAA 1OM3H 4HG4K 3IDMB 2EDYA 4DKEH 4ESKA 1WC7A 5GS1A 1HSAA 1ORQA 4W68A 3GZKA 5LCVL 3L5JA 5T5NG 4ERSL 4JKPH 1IAOB 4WGVB 3O3BB 5C0EA 1BJMA 4IIQC 4G7VL 2HT3C 5C09A 5IHUL 3ZKSD 4XBGB 4X6EA 5E94B 1RZFL 1U3HB 4DQOH 2C26A 2XZQH 4E41E 3FQWA 4RMWA 3ZYJA 4O5LL 2RAMA 4JFED 2FWOA 3JV6B 5DO2D 3SJVE 1U41A 1G7QB 5DMGC 3HE6D 2AK4B 3BJLA 3H42L 3DBXA 4JFEB 4ZG1A 1S9KC 3QG6B 1DLFL 5SX5K 4DVBA 1BOGB 1U3HC 3DVNA 5HI3C 2VN4A 2VXTL 1UXWA 1WBYA 3GMMB 1KCRH 3WJLC 4AIZA 1XR8A 1RUKH 3ALWA 2G2RA 3VMPA 3MODL 2XWBA 2NQCA 1HH6B 1CE6A 3OF6A 1U8LB 1PFCA 4DGYL 3WIHL 2MCPH 4CRPA 1OGAD 4Y8DC 3NAAL 4CMHC 5DRNA 2HA1A 3L5HA 1T04A 2ZSWA 4JRXB 4LHJB 4X6FA 1FFOB 1NUGA 3DOSA 4X6CA 2I25N 5F71A 4R26L 2P7TA 1ULVA 2DS4A 3CSGA 4HS8L 1AFVL 4OZ4B 1F6AA 4Z7WE 4XMKH 3EJYC 3TIDA 1U8NA 2UY6A 4LHUD 1QBLH 3ME0A 3ZKND 4ZMAT 4PJ5B 1NUDA 4O9HL 1QQDA 3KXFA 4AENB 4LSRH 2H3NA 3TO4A 5EC1A 1FBIL 4NBXB 5E8NA 1KG0A 5HYJA 5JW4Q 1T5XA 2ZG1A 5FECB 3FCTB 1OTTC 1QQDB 4LPVA 5F9OH 3HC0B 2VDOH 5IROC 5D6CB 3NIGF 1R0AH 3V5HB 1WCBA 1OQXA 5IQ9B 1TZHB 2XPGA 1S7XA 4KQ3L 4FQLH 5GRUH 1IM9D 4ZXBD 3CH1B 1KIPA 3CAFA 3O45A 1P6FA 5DJAA 3LY6A 2RB8A 2MSPA 4CL7A 1MJ7H 1Q9WA 2AK4E 3T09A 4PGCB 3OPZH 4YDVA 5F9AC 2X7LA 2C7UA 1KCRL 4R4FH 1FV1A 3B5TA 4YDVB 1N5YL 1IILE 1FDLL 1UT9A 3QO0A 4UT7L 4OTXH 2BNQE 3KPPB 4UNVA 3OSKA 3ARVA 5D72L 1CFVL 4QTHB 5M7QA 3QUXA 3VFSB 1CE1L 1MHEA 4PJIF 3QUXD 3RVUD 5TQ0L 4QTHA 1R5IB 4NKOA 1S7QB 3VFNA 4YHYB 4B41A 3MV8E 1U8MA 1A4JA 2GSGA 4LVHB 5KSUA 4JM2D 3CSYB 3LQAL 3WO3B 3BDYH 3BIKB 4HDIB 3KPNB 5HI4D 5K9KB 3ULUD 2I26N 2P44B 3TT3L 4KQ4L 1FJ1B 4MA3B 3NACH 1BD2A 5JHDE 1N6VA 4ELMA 1C7TA 3GK8H 1JYWA 3TP4A 1JZ3A 1FH5L 3EUUA 2Q6WB 5DI8B 5FDWA 2PW2A 1OVZA 2WBJA 1SVCP 1FPTH 1IAMA 3MRGA 4Z0BH 2F58L 3JTSB 5IBTL 4ZYKA 1A1MA 3JZ7A 5EO1B 1I1AA 5EZIL 1AY1L 4G9FA 1RUAL 4HPYH 32C2B 4LF3A 2VUYA 2GJ6D 3RGVD 2ZUWA 2D03L 3PJSA 3T65B 4JDVB 3ROOB 3O0RL 4FQXD 4HJ0C 1G1CA 3RP1A 2UZYB 2NY2B 2NPLX 5EUOE 3WUWB 3CCHB 5EU4B 4M9OA 1OOAA 2C1OB 5BV7L 3INUH 4G6MH 3FT3B 3V0WH 4XP1H 4L8BB 2XRAL 1RIVL 3A67H 4GG8B 3ZTJH 4GBXC 1G7HA 2VXSH 1H9VA 1NGWA 4MB4A 4MCZB 2GAZA 2ICEB 4EIGB 2I24N 3UCRA 4BH7B 4TRPL 5E4EC 5C0IB 4IRJB 1PYWA 3DRTB 1NMCB 3OAYH 2UUDH 3SY0B 1NJ9A 2PO6A 4I3SL 3F62A 4G42A 4L4TA 2AEIT 1A14H 1PG7L 3KPRB 1GCFA 1Q72L 2XOTA 4FG6C 5SV3A 3PGFL 4WHYG 4L4TD 1J0JA 4XCYB 4Q6YA 2DBLL 4OUOA 4LGRB 3SCMD 1JVKA 1EEZA 4G8EB 2YEZA 3FQRB 4FQ2H 4NJAH 1A1OA 1CG9A 2OP4H 2DICA 1RULL 2O5XH 5CZVL 5TJWK 4LLDB 3WXWH 4JFEE 1AO7E 1P4LB 1T7ZA 3DROB 1KJ3L 2D9CA 3I9GL 3M45A 2GTZB 4LLWA 4B53A 3BIBX 1DFBL 2AK4D 3NABL 2B20A 1FZJA 3MACH 4F8TA 1G7LB 2AABH 4J1UB 5C9JA 1E6OL 4FXKA 3RWCB 2CDGB 4FA8A 3WJLA 5JQ6H 4XVUD 4UOW1 1YNTA 2QSCH 3JSSA 3FAXA 4FZ8H 3T1FB 5C9JB 3GKZA 5KVGH 1R0AL 3RWCA 4WUKH 2DQHH 4HIIB 5JNYB 2X4TB 1ADQA 2D3VA 4OV6F 4WO4D 1MI5A 3S4SG 3MLUL 1NCAL 3NCFB 4JZOA 4DOHE 1RJYB 5DRZB 2X4SA 3FOMA 3RQ3A 2QADD 4DEPB 4YIQA 4P5TB 3S37X 1JRHL 5K33A 3K2MC 1CLCA 4PGCA 3VDCA 4LAQH 4U6HB 5HHOB 3SE4C 4DQOL 1LQSR 1CGVA 5T1LA 4HMCA 1QSZA 1EFXB 3TVMA 3R06A 3QFDB 1KIUA 4QHNB 5HGHB 1JUFA 1U3JA 5HHOA 2IAND 4ELME 1JGDA 1OTUC 4QXWA 3E8UH 5I30L 4X6DB 3ZKMD 3D9AL 5F89A 3VGEA 4LEOB 4EDXA 4CADA 5ADPL 2B1AL 5IGXL 1JRHH 3MLXH 3DX6B 4QXUL 4KHXL 1AO7B 2V5SA 4I18C 4P59H 3VFPB 1NAKL 2KDGA 1SY6L 3M8OL 1MHPL 4J12A 3HAEG 1SYVB 2JJSA 4BZ2L 4P9HL 5LGJB 4FFYH 5IKCA 3SE3C 5EU5A 3MJ8B 4RFOH 5KSVB 4WJ5A 3EYFB 2VABB 1Q0XH 3TIDB 1LO3H 5I66B 4Y4HB 4JKMA 3NN8A 1DDHA 2BDNH 2D7TL 1G9EA 3MMEB 4ZPVA 3MC0A 3ARYA 2EXWC 4F7EA 5EN2A 1MRFH 1OD7A 3HNTL 3KHQA 5CINL 3DX8B 3HG1E 4P46A 1T5XB 2Y23A 5M94B 3DRQA 3MMEA 5CBEB 5I1AB 4XTRD 3I84A 4QHMA 2PTTB 3SDAA 2HLAA 2HWZH 5FGRA 1RZ7H 1IAIM 4WU7A 4PJIB 1QLEL 4LF3B 5KSAB 3I6GB 2HKFL 3RGVC 1GSMA 3LMJL 2P24B 5D7SH 4KTDL 2MKWA 5DD0H 2GSIA 5EU6E 4DFIA 5E8EA 3OG6B 3GM8A 1CFTB 1RJLA 2NY6C 3NCBB 5GRZA 3SDXA 3UPAA 1EX0A 3GSNH 1UQSB 3I6GA 4HS6B 2J8UB 4KVCL 5DA4A 3MR9A 5C0AA 2YSSB 3A0OA 3PWUA 5F88B 1G6VK 3U46A 2XRAH 4BZ2H 1IM9B 2W0PA 2DWEA 4GFTB 3FONB 1E4WL 1IQDB 5HGGS 3NFSL 4JFHD 1ZHKA 4NKMB 1A02N 4X98B 4F7TB 3IF1B 5HI4C 3SJVD 1A6WL 1IM9A 1AO7D 5D7IF 3BKCL 1NGWB 1XZ0B 2NYYD 1EHNA 3KLDA 3NTCL 4M6NH 5E2UL 3VJ6B 2FBJL 3DXAE 3RWFB 3CVHB 1FG2A 1FVCA 4XVSL 1QKZL 3MCKA 5E7FA 3VJ6A 4LMQI 3WFHA 4GH7B 1WT5A 4XMPL 5ERWA 3THMH 3C9NA 3CVHA 4G6JH 4HDIA 4CKVX 3BH8A 4NOFA 5DD1H 1P4IL 1S7VB 2W60A 1EEZB 4K23H 4N8PA 1MRFL 1CG9B 2VYRE 4L9DA 3KPLA 4KQ4H 1QSFE 1ZHNB 4P49A 5IB5A 4X4YB 1G6RB 3JWNC 4HLZH 1T0PB 3U4EA 2WNGA 4ODUB 1CZ8L 2V7NB 3EOTL 1U2HA 1C5BH 2PCPA 1KEGH 1UYWH 2F53D 4IMKA 1G7LA 3SOBH 5KZCD 1MUJB 1S9WB 1IAKA 3MRKA 1Y18A 2DQIH 2XV6B 2Y4SA 3F12A 4WGWB 1C5CH 1A7PH 3H9HA 2AABL 2AK1L 1TVHA 1GGYA 2FBJH 2EO9A 2Z91B 2Y6SC 4JKPL 2HH0L 3RVWD 1XF4B 4P23C 4YWGL 2X4TA 1BZ9B 2XZZA 1C08B 2ITCA 1RZGA 2RJMA 3CFJB 3FQUB 4UILH 2OZ4A 4NQUA 3JWDH 4JQIH 2G5BA 4NSKA 2EDQA 3O6FB 4YC2B 5FF6B 1JYXA 2R56H 1R5VA 1EXUB 3K8KA 5AZ2L 4F57H 1DBKL 5D8JL 4WFFD 3GSNA 3IFNH 4WI4A 1RZFH 1PEWA 3VA6A 5CEZL 5GGVH 5D1QA 2FJGB 5C09B 3TWCH 5ALBL 1OL0A 5I9QC 4CAGA 2BNRE 3LEVL 1PG7H 2EH8L 2XTJB 2PO6D 1KV3A 1LO2L 3P2TA 5T1LB 5IEHA 1OSPL 3FB5B 5BS0D 2J2ZA 2A73B 5D7IB 3BYYA 5I8KL 2R8SH 4PV8B 3OJMB 4XX1G 1MHCA 4YH6A 4N9GB 4XI5C 4ODVL 3GRWA 5E99H 3FB5A 4RGOL 5LBSL 4TTGA 1CDYA 4JG1L 4Y1AD 3S5LA 1MLBA 5DUMH 3MNVA 4X5XB 2VISB 43CAB 2JJWA 5FM8A 5CP7B 1JNHB 3P11L 2EDEA 2AXHA 4GQ9H 2HFFB 1U0QA 3P73A 1XCQB 1S7RA 4FXKB 3NA9L 5HI3D 4HAGA 1IJ9A 3GMOB 5C6TH 2BNRB 2AV1A 3SE8L 3QRGL 1IBGL 5MENE 4M00A 4LSRL 1DANU 3WNOA 5ECJE 4DCQB 5BJTB 1KC5H 2ZUXA 4M62H 4HV8B 3QUZC 4HCRL 1HEZB 1ED3A 2HN7A 3OXSB 4GRWE 1D3CA 4U3XA 3F65A 4W6XB 3TBVB 3LZFL 4JZOB 4U1IB 5BJTA 4NO5B 4PRAA 1IAII 4BKLB 1CFSB 2LTQB 5E8EB 2PXYC 5GXBB 5HGAA 4P23D 5A16A 5IFJB 4I18A 1ZXQA 4UBDD 1FC2D 4PRDB 3QXDA 1CTNA 2X4NB 2MCPL 1YEFL 4KUCF 2XPGB 5HGAB 2NNAB 2Q86A 1KN4H 1HSBB 5LGKA 5E24E 3GMRA 1MCOH 3M1BB 5C0NC 5J8OA 1KCSH 2XWJB 3AY4C 2FYYB 5TF1L 1AFVH 1JGDB 4KMTH 4G80A 3UZVB 3MV01 3BOVA 3N1PC 1B6UA 1F2QA 2XTJD 4BUGA 1NC2A 3Q1SH 2CLVA 5MEPA 3EFDH 3VFPA 4YXKH 2JK5B 1CQYA 5B8CB 3EOYG 3BDXA 3RWDA 1MCKA 4O2FB 3BKML 5GGSA 3P3YA 5IMOB 2MOVA 2DM7A 1BQLH 3X3FH 4HCRH 4XH2A 3TJHD 3H9SB 3RY6C 1T20B 3QDMD 2Y06H 5HGDA 3H8NA 3PP4H 5I1EH 4N0RA 1QNZL 1NBQA 3CC5B 3ZL4H 2H2PD 2HRPH 5DUPL 5TE4H 2NX5A 3TESA 3DO3A 3F58H 4MLIA 2JJVA 4POYA 3WNNA 5IFHH 3IU3B 1MWAH 5FKAA 1D9KB 1WAAE 2BY2A 3QXWA 1JGUL 2YWYA 3QJHA 5HJ3B 3TN0C 7CGTA 3FZUC 1R3KA 4CU8A 2BJML 1CQKA 5I6XC 4LOUD 5L6YL 4IHOA 2NY7L 5DJ6A 5DJ8A 2DBLH 4PJ5E 3WEXA 4CN6A 5D2LB 4ALAH 1W0YT 5I1LA 3O6MH 4ORGA 1EZVX 1LO0L 1U6AL 2XZCL 2ZOLB 4GRLA 4RGMC 4ERSH 4LRNL 1DQJA 4E0RB 1XEDA 4GUPA 5MENA 3D2UB 3IDJB 1FFNB 4H26B 4LCIL 4AK1A 1AD0B 2XXMB 4P2RA 3VXRD 3G5VA 4S1DD 1UJTA 3DUHA 4KKBD 1IGJB 3RBGA 4M3JA 3QHZH 3D2UA 3DGCR 3ZDZF 1M05B 3QDAA 2G5BB 4NSKB 3D2UD 4AT6A 1KBGH 2H2SD 3E6HB 1X4ZA 4XP1L 4AYFA 3LEYL 4NNXA 4QRTA 2CDEA 4KK5D 4AIOA 3HR5A 1F4WH 1W72L 1I8MA 1CT8B 4OGAD 3MODH 5E9DB 5FKPB 4M48H 5JDJA 4OZFG 8CGTA 1A3QA 5T3ZL 4NNXB 4XP6L 2FJFB 4CW1A 3S37H 3SJVB 3BP5A 1NLBH 2Q7NA 4M3KB 4RGNB 1BPVA 4MCZA 1I7ZB 3O8XC 4RWHA 1KXQE 3LV3A 3X14B 3OJVC 1B2WH 4WV1B 5K9OB 4KKLC 4JPIA 2XY2A 3SJVA 4NJ9L 4XTRC 4NN5B 3TF7C 4LSTL 5ESAB 3MGOB 4NKQB 3HUJB 3E2HC 3KPRA 4HKZA 1XT5A 5KG9B 5I8CA 4OLYH 1EEUA 1KOAA 2OQJB 4JR9L 5IHUH 2ADFL 4JO3L 3GSWB 4PRBB 1GOHA 4HCRA 4QOKB 2VISA 43CAA 1MJJB 5CP7A 4JPVL 3B2UC 1BEYL 2VLJA 3DVGB 4P3CL 3STZB 4IJ3B 1I7UA 2GK0A 5B39B 3ET9F 2DQDL 3ULVF 3KLSA 3DROA 4LCUA 4Q0XL 3O6FC 3U36B 2MKLC 1T0MA 5DHVA 1CFQB 4Y4FC 1N64H 3SO3C 5L88L 3THML 3PGCB 3GMPB 5K9JL 4G6FB 1SJHA 2VDML 3OJ2C 1DBKH 2WWKO 5J3HD 4OKDA 3ISWA 3DYOA 3GI8L 3D0VA 4NRYB 1I9IL 2BSTA 1IC7L 3BPCA 5F7NC 3P9LA 3PQYB 1CK0H 4JY5L 4NO5A 1J1OL 4PRAB 4BKLA 4PJDE 1T89C 1BFOB 3MLRH 4LCCB 1WWWX 5I1DA 3E3QE 3SN6N 4BFBD 3K2UL 3W9DB 3F7YB 3VFVB 4QRSB 3T1WA 2IEPA 4I48B 4HK0B 4KJPD 2ZJSL 3AS1A 2NNAA 4XBEH 2Q76A 5F93C 3O4OC 5IVXF 4JPWL 5DR5H 5F7FA 1T22A 3VXPA 4PBVC 5GHWH 2VZ3A 4YXLL 5FA4A 4PJEA 4JPKL 3BI9X 1GRWA 1CDCA 2Q76B 2I60L 3VXPB 1MFAH 1WWBX 3BP4A 4G80B 3D3VD 3GSNL 3N85L 3ZE2F 4J6RH 1CLYL 5GRJH 4ZD3H 2VDOL 1DN2A 3E1F1 3BDYL 5E9DE 2JJSC 4JR9H 1IGCH 3PWJB 5ABDE 1CFBA 2CIKB 2O5ZH 4M6AA 4K3EH 4F2MB 1BFVH 3IETA 5BRZA 4U05A 1ZGLA 1T2JA 3T8XB 3MRDA 3H9SA 3QCUL 4ONFH 1H8NA 5F6HJ 4OGYL 3FOLA 5INDB 4OLZL 3OGCB 2NX5B 2KZWA 5J1AA 5A2KH 3CFBA 1MCEA 3T3PE 5IHBA 3RUGE 5BZDB 1X5JA 4GAYA 2Q8BH 2DKSA 4PJAE 1NPUA 1XGRA 1LK3H 4ZUSA 1MFEL 3DX9A 1INEH 3OMZA 3VFTB 1FNGB 3U7WL 5DJ2B 1LO0H 3TZVB 5HHXH 2XNAA 4PG9A 3CNKA 2W0KA 3WEXB 2DJUA 3RUGB 5I1HH 4L1DA 1TVDA 4XRCB 4ETYA 1VERA 1ZVYA 5EOCL 4ZD3L 4DAGH 1E27B 1A0QH 5I30H 2PYFA 4PRDA 4JFDE 2B5IB 2RR3A 3TN0D 3H42H 3N50A 5DJDA 1VFBB 1FHGA 2GITB 4YXLH 1N4XL 3BESR 4AG4H 3WS3B 1HIMH 1H5BA 4CUCA 3MSPA 4U0RB 2XWJA 1XGPA 3U6RA 2BHUA 4G6AC 4LLUB 4ZQKB 1DZBA 1AQKH 1IGFL 1NAMB 5ACZA 1LWRA 2C1PB 2SEBA 4KJYA 4MWFA 4XP9H 4ONHB 3BD4A 3ULUL 5HHVL 2ICWI 3HPLB 3U7YH 4MJIB 3U30C 3EGSA 4U1NB 2O93L 1PKQB 4HJJH 3ILPB 4R26H 1U42A 4EOWL 3QT2A 4KPHL 1U92A 2HG5B 4XH2B 3L3HB 4LDEB 1K5NB 3MBED 4YBQC 5HTSA 4YHLL 2N4IA 4G8GD 4LLYA 2J7LA 4ZAKD 2FEDC 3HLAA 3QCVH 4R0LA 5J6GB 1CD1B 5GS1C 1C1EL 1FPTL 1FN4A 1KN4L 1X5YA 3GGWA 3RKDC 5T3XE 5ERWB 3K80A 4POUB 5I15L 4ODHL 5GRYA 4K94L 1NGXB 3UTSA 1S7UB 2NY5C 4L9LA 5HHNB 2ORBL 1QG3A 3GJEA 1NEZG 4UAOC 1AR1D 4Q9CA 3B9KB 4XVTL 2AJZB 1YC7A 3ARGA 4KJWD 1AQKL 1IGFH 1AJ7H 1N8ZA 3DSFH 4MQ7B 5JW4M 3H9YA 5E2VH 1IGTB 3CVIL 4G8FB 3O3EA 5MENB 1FFNA 4E5XA 3JBG7 4WTZA 3UBXA 3LS5L 4N8CH 4PUBL 4XPFL 4EDWH 3SKMB 1HHGB 5T5NF 1ZT1A 1K6QH 4XNQB 2W92A 4GQPH 1FC1A 1IFHH 1IL1A 5J57B 1NEUA 2VDMH 5C9KA 1F11B 4YNYB 4ODSH 2O5YH 4UT9H 3G5YA 3O6FD 1TJGL 2QSCL 1MOEA 3MRIA 4OGXL 4QKXB 5AG8A 2GFBB 4HH9A 2XT1B 1T04B 2B4CC 2YXFA 3IU4H 1UWEH 4MAYD 3VU2A 2DRUA 1YA5A 2OR7A 1U8JA 3WXVL 5KAQG 5L2KA 1FQ9C 1WIPA 1U8KA 3N9GL 5KJRH 5IW3A 4WI9A 3L7EB 1GOFA 5I71C 2JTDA 3B2UD 4X7FC 1IC5L 5EO9A 3D6GA 3HAEB 1V05A 1BM3L 4EN3C 4FQXC 3H7LA 4HJ0D 1JMZA 3BP4B 1HOCB 4R9HA 4HD9A 3BFOA 2HWZL 2R0LH 1NBVL 4ODWA 4OI7A 3BT2L 2V2TA 5IV2B 4JRXE 4XBPA 1YMMA 3LKOB 3B9DA 2FX8H 1X3DA 4CU6A 4DEPC 4J7RA 4F2MA 5HDOA 3K4AA 3AAZA 3G6JE 4JN1L 1M6OB 2WQRA 4Q7DA 1I7UB 2GK0B 5B39A 1KB5A 5IB2B 1VACB 1ZVSA 1J05A 5INDA 4IRSB 4KDWA 1U3YA 3TLRA 2HT4D 3B8SA 4DW2H 4F15C 2H1PL 3U36A 2E6JA 4D3CH 3C8HA 2W59A 1RZJH 5BZDA 4WW2F 3M8OH 2A83B 2ICES 5KVDL 4K9EC 3V0AC 3PGCA 3BZ4B 1BBJB 2R1XB 1AY1H 2EDFA 2B1AH 1HN1A 3QEUA 4QRUB 4KKCD 3WLWD 4N5EC 4OZHE 1NLDH 4KKBC 3EO1A 2BFVH 1TITA 2IGFH 3QIBD 5MERB 4JREB 4LP5A 2Y9RT 3EHBD 1SEBB 1AKJB 1J1XH 3O0RH 1ONQA 2ZCLL 4NFBA 4LSUH 4EBQH 1I85C 3F6LA 4Y5YB 4IOIB 1EGJL 3LS4H 4LPXA 1I9EA 2NXYD 1BREA 3SPVB 1LP9A 1MVUA 1WWCA 2CSPA 3FB7A 1FORH 4F7PB 4UIMB 1GC1C 1KENL 4MWFB 5DJYB 4HUKB 4C56A 1LP9B 5SWSA 2V6HA 1A47A 5J06A 5IMMB 1ZEAL 4NPYA 4MJ5B 1MQKL 4YXHL 2F74A 4N5UA 2Z8RA 5JXEC 5TFSL 1DBMH 1JWUB 1AD9A 2OTUA 3JV5A 3L3HA 5DFVD 2Z9TA 1NFIA 4I2XE 3SDXF 2W0LA 1OD9A 2ICCA 3QISA 4PG2A 1CFNB 4EVNB 4GSDH 1KFAL 1LDPH 3RZCA 4NBZB 5BZWA 1HQRB 2DYPA 2G75A 3TNMA 1CFNA 3TO2B 1B0GB 1V3MA 2BRQA 4OGYH 4HMDA 3L5WB 3G6JB 3BGMA 4U6VH 3X12B 4OLZH 3TV3H 2DQGL 1I1FB 4KTDH 5GZND 2XQYK 3F5WB 4NP4H 1X6LA 4ELMF 3QJHB 1QBML 3CLEL 5FGBA 2EE3A 4NZUL 4XPHH 2DOCA 4I0PD 4KVNL 3U7WH 1P7HL 2VWEC 5DJ8B 1U93B 1IGTA 4G8FA 4ZOEA 5E8PB 1OAXH 2JLLA 3D39A 3GRWL 5ILTL 4Y5XA 4ORGB 1V7NL 4B0MM 5DJXB 4E41A 1ZOXA 2CRIA 3QHZL 4ENEC 2EE2A 1N7ML 2F8OA 1OAQH 3L1OH 1JHLH 5DXWA 3WHXA 4C58B 3GSVA 4PLKC 5FB8A 4FQQA 1C5DA 4NUGL 3FQNB 4YHIA 1FBIH 2AQ1A 5FOBA 4UTAH 3MRIB 5IHZB 2H6PA 1K8DA 1BBDL 1LK2A 1PY9A 1KCKA 4X7SH 4ONHA 3SDXE 1NC4B 3FQNA 1H3GA 4Z6AT 2EC8A 1FGVL 3C2SA 3KVQA 4Y0GA 2XN9B 1AE6L 2J4WH 2PR4L 4OCSH 4QRTB 3V4UH 1TZGL 1JIBA 5DMYA 2BOBA 3CFCL 3LIZH 4C4KO 3RJDA 1J1OH 2APFA 3RVVD 4RGNC 4NZRH 4GRMB 2EH8H 1WIUA 4LPCA 5SWZB 5I16A 2AJVH 2X2YA 1YEHL 1JTTA 2BOBB 2GTWA 4LIQH 2CDGA 4NO3B 3RZCC 2MHAB 4LVOC 4TPRH 2V9RA 5ICZB 3BKYL 3QDMA 5E8OA 4NQVB 2D4DA 3MGOA 1Y6MR 4R7DA 4WFGD 3AREB 1CLOL 3NIDE 3VWJB 1QZ1A 1E4XL 4DW2L 5GGQL 1DUZB 2VXQL 3X17A 1R6VA 1IAOA 2CUMA 1J05B 4L4VB 5JXAL 4HXAL 2ATPB 2EH7H 4WW2C 5IVZB 2VMFA 2BNUA 5F7DA 3OKNB 1X9QA 4RFEA 1A6PA 3VCLB 3LVEA 2YD8A 3VFUB 1HQ4B 3LN4A 2UYLB 3GIVA 1G7MA 4KK9C 2X1PA 1AGBA 2VAAB 2R0LL 3H0TB 1IL1B 3HE7B 3V5DA 1HILA 4M7LL 2EIZA 2VXQH 4MJIE 5C0BD 4NWTH 4UTBH 5CUSH 1FIGH 4NN5C 3MRCB 3PP3K 2ZOKB 3KXFD 3RVVC 3L3GA 2RQ8A 2N1KA 5FYJE 4U0QB 5IBLC 5C86A 1RK0B 4AM0B 2YD6A 1MFBH 4K7PL 1AGFA 2JF1A 5F44A 1EA9C 3FO1A 3VXRA 3C6LA 3MFFA 1FL3A 2GIYA 3L3GB 4PTUB 5KOMC 4OQTH 1NAMH 3RWJA 4Y5YA 2ERJB 3MJ8A 3STLA 3DXAB 4F9PA 2VLLB 4WHTB 4ZOBA 4KAQH 4RAVA 5KW9L 1I9JL 4GMTL 3VFRA 5CMAB 4A2LA 1QSEE 3KPSD 5HY9B 5BS0E 1K9TA 1U8IA 5F3HB 3NVQA 4X5WA 2VOTA 2ERJC 1GZQB 3SDYH 2L7JA 2Y7QA 3O3DB 4G6KL 4NPYB 4UDTB 3RU8L 3MV7D 1JGEA 5FYLD 1HWGB 3SDAB 4LRNH 5BQ7A 3GO1H 5EC1B 4KK6D 4GAGL 3Q5TA 1XAUA 4XNMA 2PYEB 5EBWB 2F54D 2IANB 3PWJA 1M6OA 4N0UA 3RWEA 3UTQA 1JNNL 3HC0A 1QBBA 2YK1L 2H32B 3OB8A 1TVBB 1IKFH 5GJTH 3RVXC 1BQUA 4NCC2 2A9NH 4QHUA 5EUOB 1N5AA 5KN5A 3UTQB 3KLAA 3X11B 4S0TD 1EBAA 3WKNA 3WLBB 4WI8A 2IANE 5I1CL 1PZUB 1FFPA 4QHUB 4HBCL 1EUUA 4KWUA 2FJHB 1ZSDB 2P8LA 3LQZB 4NZUH 4QRPB 4XPHL 4LK4A 4LGSB 4TVPH 5L8KB 3QPQC 1BD2D 4YFLF 1FP5A 2X7LB 3W11D 1WITA 4LNRB 3UAJC 5BS0B 3TZVA 3OZ9H 5I1IL 5EO0A 3B83A 4ZS7L 3RTQB 1PEZA 3NPZB 4OF5A 3P0VL 3KPTA 2NY6D 4U1HA 3QDJD 1N6UA 4NRZB 4Z77B 4BQCA 1UM5L 1ZLUH 1DQDL 1WFOA 3LEXA 1TJHH 4X7DC 2EKSA 2X41A 1VGKB 3GSVB 4HT1H 3O6ML 4S2SB 3LD8C 3W0WD 1IQWL 2WM0A 4MDJB 4WDIA 5IIEB 4Y5XC 1MVUB 2Z4QB 2WSKA 4EBQL 1CGYA 2H8PA 1RU9L 2EXYD 3QIBA 4EIZC 3T2QA 3QA3A 4X6BA 4ELMB 3R0MA 1X5LA 4MNHA 3DV4B 3VXMA 1WLHA 4NZRL 1IZJA 1ORSB 5DI8A 1E28A 4JHAH 3D3VA 2NW3B 5D72H 1SVZA 5ITFB 4NRXB 1IAIL 2XKUA 1ADQL 3V4UL 2NXYB 1T1ZB 4M4RA 1I1AB 5IJVA 3VRJB 4Z8FL 4PJCA 3UBXI 1K4DA 3MRKB 1A9BB 2FEEI 2YRPA 5ACMA 1XGUA 4XAWL 1LDSA 3RBSA 2AJ3A 3CFKA 1T1ZA 2JIXD 1F00I 2J88H 4JFFD 4BK4A 1CU4H 4DOHB 2F54B 1BD2E 1ORQB 3SBWC 4UTAL 1QKZH 2E9JA 1Q8MA 4R7DB 3DI3B 1S9YB 3AREA 4XNUL 3MXVL 1K4CB 4FXGB 4Z5RB 5D1XB 3O4LE 4BM7A 4NO0D 5HYSG 1YZZA 5FF6A 3PXHA 3BE1H 1GGTA 3S34H 2P5EE 2FNBA 3GRWH 5CSZB 3WN5C 2QADC 4J23A 4XP6H 1AE6H 2J4WL 3FQWB 4OCSL 2CLRB 4Z5RA 3RZCD 3D39D 1CDUA 4TTDC 2BNUB 2HT2C 2NXYC 5FCSH 5EULV 5CJOH 2XKSA 1YEFH 1NMCC 1F45A 3J8F7 2WBWB 3FHAA 3NCEB 1S7WB 5J9PA 1S3KH 3GBLA 3ZMRA 1EGJA 3FJTA 2EYRA 1U3HA 4OZFH 2P5WD 2X9YA 3H0TA 2YUXA 4O02H 2G2RB 2UV3A 4Q9RH 3GIZH 2O61B 5FGSA 1KPRA 1U3HD 5EB9A 3VG9B 1KCVH 4M7LH 4C57C 5IR1A 4OFYA 4X4XA 3IU4L 3WN5B 1DVFB 1AIFA 4DVBB 1TJIL 1RZ8A 3V2AR 4JRXA 4X6FB 5I74C 2V2XA 5TE6H 3OXRA 4LARL 4P2RE 1PGRB 5FYLL 2EXYC 4KZDH 4WCYH 1KB5L 3N1QC 3OWEA 4MHHI 1NDMB 1P84K 5D1ZA 4GW5A 3VFOA 3EYUL 5CZXD 1MH5A 2F19H 4J8RB 4PGBB 5IB3A 4FTVB 4K7PX 4HUMB 1DJSA 1FLTX 2H3NB 4Y5YC 2MMXA 3KXFE 4PS4H 1FRGL 1YYLL 2IBZY 3QCUH 4ELKB 3GBNL 4J1UA 5E08H 3LQMA 4LCCC 5J6HB 1XGYH 3VD3A 4TOYH 4LPWA 4GJTB 2FBOJ 3HN3A 4JZJC 5BQ7B 1DE4A 2EE6A 2W07A 2NY0B 4FG6D 4NGHH 3T2NH 4ELKA 1VENA 1IGCL 3QQ3B 1S78C 2ZP0T 5DHVH 5F1NB 3VGDA 5I0ZA 5MHSD 4M61B 4NZTL 5BO1L 5E8NB 4NC1E 5HYJB 5EFIB 1ODAA 4FQ1H 3ULVL 1TDQA 4H1LB 1CICB 4BJLA 4EN3D 3VWKC 3NACL 3OQ3B 4JVUA 1OWRM 4X6CF 1ZTXL 4DVRH 3MROB 3HZMA 5C3LD 2UUDK 2I9TA 3GI8H 1QD0A 1QRKA 2UYLA 2FGZA 3V5HA 3AY4A 1KLUB 3ZYZA 1S9VA 2BJMH 5SX4H 1OGAA 4U6YB 2VDNL 2R0WL 1EJOH 4TUOB 4CU7A 2UY7A 5TDPB 5TE7L 1OAYL 3S8WA 1FSKB 1NC2B 3LHPH 4PB9H 1UB5B 2IALA 4TULH 4YQXH 2WANA 2VLKA 1GOGA 4MA7L 4M7ZC 2ZNXA 4KV5E 3V4VL 4ZTOH 4CADB 1HH9B 4WUUA 1F58L 3RWJB 3IGAB 3CUPA 2FECI 3IXAA 4M8VA 5D2NA 2EKSB 5EUOF 4WUUD 1EVTC 3DXAA 1HH9A 4WHTA 4HFWA 4JFYB 4KFZC 3QUMB 1WBXB 3GI9H 5L2KD 2YZ8A 4OBRA 1FNAA 5CP3H 3BQUC 4KRPB 4NIKB 5I66A 5LXGH 5AZEL 4ZYKB 1JYNA 4UDTA 5GGTH 1MIML 1OCWH 5I1HL 3BIKA 3PHOA 5GSRA 1DBAL 5FHAH 1OTUD 4Q9BA 4WY7H 4ZSOE 5FK9B 1EAPB 2EDXA 3LS5H 4L8SA 4PUBH 3PHOB 2NY6B 3FFCA 1OB1A 2OXHA 2RFXB 1XIWC 4QRPD 3WYRA 3MCLL 3QXTA 1K4DB 2LU4A 3MRGB 1SJEB 3JTSA 3KG5A 2WV3A 4JHWL 2ADGB 4L8SB 5E2JA 4S1SL 4HIXH 5EBLB 4CN1A 1ZANH 2OXGA 5AAWA 1MIMH 1OCWL 3BE1L 3ARDC 1F58H 1IKNC 4OF8A 4RCAA 5FV2A 2BDNL 2WWMC 3QWOA 1E0OB 3MRMA 1JGLH 1YEEL 3FO0H 3TFKD 1KB9K 3P4NB 4GKOA 4GXUM 3KPRD 3PXJA 2CDEB 3KYMB 3LHPL 4PB9L 4YGAB 1QPXA 3GKWL 3VDAA 2F8XC 4YDIL 1A22B 2L7UA 4I77H 2OS7A 2D4FA 4CBPA 1XCTA 1TJGH 4F8QA 3SKOB 5L9DL 3MBEB 2A6KB 2EYRB 1HHJB 2NCMA 3H6JA 5IBLD 3GSUB 1MPAL 3V6FB 3QAZB 2XTJE 4YUEL 2HKHL 5F6HI 5FYJD 4K55A 4M9PA 3S3SA 3SEPA 2NX5E 3B3IB 2E6QA 1AI1H 2BSED 3BQUA 3QHFH 1NGYA 5DRWB 4TTDD 1A8JH 1AGEA 2X1QA 3X3GH 3AB0C 2V5RA 5D1ZC 4PJ7E 4XMLH 3G5ZB 4YR6B 3T0EC 3QA3B 1EJ6A 4PRBA 2P5EB 4ORZC 1ES0B 1SYSB 4ONOA 2WAHA 1GGIL 3IJSA 1HHHB 3FT2A 3ZHDA 3FQXB 3D3VB 1F4AA 2WW8A 4XCYA 3SDDB 5L7XH 3QP3A 4K3JL 5E56A 3FO0L 1RIHL 1FIEA 1VFAA 4IRJC 2BK8A 5LG1A 1YQVH 1G6RA 3U4EB 4PGBA 5IB3B 3IJHA 3DO7B 4U6XA 3PIQA 2CKBH 3MNWA 4Q9QL 3CX5J 1G9MH 1P4LA 4J3VA 4LAQL 5CD3A 1RQ5A 4UZGA 4PP2A 1MCOL 4GKZA 3IJHB 3EFFA 3I3EA 2R56L 3UMTA 5J11B 2ITDB 5ESQA 4KHXH 4NQDB 3MUZ1 5T33L 2E8YA 3HPJA 1OGAE 4GKNA 4M02A 2APWA 4Y1AA 1P9MC 5D1XA 5EDXA 2AS5M 1RJYA 1HXYA 3VH8B 1X7QA 4WU5A 2BVPA 1RZIB 5B4MC 5EFIA 3FQUA 4M6ML 5C6WH 3BUYB 4PJGF 3W9DA 4KZDL 4Y16C 4X6EB 2Y07H 4YHML 1N6QH 3EYQC 4GAFB 3MV8D 5M95B 3I75B 5KTEL 1KLUA 4CDGC 1BX2A 3OTTA 4KY1L 4JO4L 1HIML 1PKQE 2KL6A 5DEZA 5GGVY 4BSVB 4W70A 3GIVB 4LSDA 4LVOB 3UYRH 3V4VH 3O9WD 1KPVA 4K7PY 1HILB 1N6QL 1R3IH 3AROA 5H2BB 5IVOA 1A0QL 1A7BA 5GS0C 5C0AE 4QOKE 2FEDD 4RNRA 3LPFA 4Y2DA 3OXRB 3QPQD 2P5WA 4N68A 1AP2B 1MF2L 2F5BH 3LCYA 3OB0K 4Y2DD 1VEMA 2DQFA 1RPQA 4N1CA 2J8UE 4JFYA 5B38B 3RAJL 1CVRA 3JV0A 1ND0B 4G6KH 4FRWA 4V1DE 5JXAH 4U1SA 4I5BA 4W81A 2OBGA 4KXZH 3RRQA 4HQQH 2GT9B 1WISA 3BWAA 3CK0H 3MBXH 4RGNE 2OZ4L 1UEMA 5EU5B 1I85A 3UO1H 5B21A 2QKIB 1YMME 1KNOA 3MRHB 3IKCB 5DJ2A 2OL3B 5K59F 1NC2D 1E4WH 2CXGA 4M6OH 4AL8H 4PJAB 5F1NA 2EIEA 4P9HH 3IKCA 2X42A 1OB1B 3OX8B 4MMXC 1RUPL 5IB4B 1U8NB 1SJEA 3LRGA 3UDWA 2Z31A 4X99B 5E03A 1RHFA 3TO4C 1KACB 1WV7T 4FFWC 1UM6H 4ZFGL 3KPQA 5A43C 3WO4C 4PRIA 1KIPB 5E5MB 5GRWA 5TF1H 1I8LA 1K6QL 5JOEA 1FH5H 4L3AA 1J11A 5CLWA 4NNYB 3UPRB 4F9PC 4PR5A 2Y1VA 4XB7A 1MCJA 1NLDL 3MRPB 5AG9A 5B3JF 3OZ9L 1JPGB 3O9WB 2NR6C 2ZCLH 1PJ9A 1OSZB 1ZT7B 1UB5A 4X6DE 3ULVC 1F4XH 5GIRA 5JOFB 4NUGH 3RWFA 1BZQK 4XP5L 2YXMA 4OIIL 4WUUB 1AXSA 2DQDH 4OZHF 4OM0H 3BGFB 2BMKA 4Y8AA 1UXSB 2AXJA 1DLHA 2DMKA 2LU3A 2Y5TB 3IVKB 3FFDB 3BZEA 2VNCA 3CSPA 3DIFB 3CSYA 5L88H 4Y4HD 3OG4B 4OD2A 4MDJA 4RSVA 4LSSL 1WBZA 3T4YB 5DQDL 1VPOH 1J7VR 5JA8B 3IFOA 4KK8C 1A6VH 3KPOB 1ZHNA 3BRGC 3QIBB 4X4YA 3ZT7A 5DJCB 3IDGA 1MCQA 1L0XA 2BVTA 3DX7B 4ZFOB 3K0WA 1Z6JT 2GSGB 5D96B 1KLFA 3TT3H 5I0DA 4X4MA 4OLVH 4U3HA 1R3KB 2RHEA 2FB4H 1ZANL 1T03H 1YNKL 4R2GB 4FOMA 1JHTA 1FJ1A 2R2BB 1Y18B 3OGOE 1XF3B 1JFQL 3KPSB 4Z7UF 4MNQB 4RFNC 5FO8B 1LILA 2A6IB 3A6BL 3MNWB 1F4YL 4WFHD 3KAAA 1D5BB 3UBXB 4LIQE 3T04D 4RGOH 4KRNA 1UKSA 3PJSB 2EC9T 3G6AA 1KGCE 5J3HC 4PLJC 3H3BC 5AD0B 5IESH 1MCWW 4WWKB 3BEVB 4IIQB 1U91A 4H1LH 2Z0BA 2F54A 5CD5D 3G5YB 3RL2B 4NO0B 3BMVA 3MCG1 4ETQA 4HEME 5AZEH 1UH4A 1WF5A 4GRWF 5ANMB 4CJ0A 1KJ2B 4WHYH 3ZTJG 5ILTH 1ZMYA 2R9HD 2BSRB 4FQJL 1U8JB 5HYIA 3WFZA 4JO4H 3O3BA 4YHZL 5BW7C 5JMRA 2AJUL 4WENB 5JUEL 4QWWD 1KBGL 1HHJA 1SY6A 3L7EA 4UAOB 3KNBA 1DANT 3QEQD 1I1AD 3GSNB 1OTSD 4BFIA 1R5WB 3FT3A 3HI5L 1VADA 4FFZH 1ADQH 4HIHA 4JQXC 5F7KC 5FUCC 4PD4J 1G7HB 1ZTXH 3WDIA 5IV2A 3K4ZA 1YY8B 5KS9A 2O61A 3CDCA 4UB0H 2WINB 3R1GH 3U7AA 5GZNC 1MNUL 1TTFA 5I2IB 2VDQL 4OCYH 1A2YA 3LRHA 2P5WB 5AYQA 2D7NA 3DRTA 1LEGB 2CUHA 1NJ9B 4NYLA 1RZJC 1U8LA 4DK3A 2NMSA 3RHWK 2PNDA 1CF8H 3QI9C 2W65A 1ZGLP 2QQNL 3W39B 1YDPA 2VERN 3CFEB 3SCMB 5DVOA 1LEGA 4IMLB 3LKPB 2ICWA 1G7PA 1DEDA 2CH8A 3GBNH 1EIBA 5E08L 2EE9A 4OZGA 2YEZB 4G8EA 3MLVH 4NQDD 3H3KA 4LQ1A 4BQ8A 2IAMD 2ICWB 4NQDA 1YN7B 4MS8D 4KI5D 4X4ME 5C09E 4Q0XH 2VXVL 3PGDB 1WFNA 3O6LH 2QR0A 1M1SA 4JFFA 5DMIH 2PN5A 1TJHL 2EDHA 4AMKL 4HBCH 3BUYA 4JHBA 3TEUA 2OI9C 1CGTA 2IGFL 4ZSOA 3RU8H 3SKUD 2FX7H 4M61A 3JUZA 4NOBA 3TBYB 1OY3B 3ARBA 3Q2CA 1JZ2A 1PQZB 4JFXB 5LWYL 2HVKA 3NFNB 1HSBA 5E4IA 1CFSA 4LHUB 2OYPA 5DYOA 1PQZA 4JFXA 1G9NH 3STBA 4UNUA 3NFNA 1I8IB 3TBWA 4GW4A 1JPGA 3O9WA 4PTTB 2HJLA 1YJDC 2WUCL 5IT2H 3TA3C 4Z7OE 3S5LG 5HPMB 3VE0A 3O6KH 4FQCL 3IT8D 5LWYH 4JQVC 5T5FL 4U49A 3BUTA 3WCYA 1NFIB 4L8CA 4QXTB 2NY3C 1KULA 1T1WB 3F8UB 4XVJH 2WBJC 3QFDA 2NW2B 1RJZA 1Z9SA 4X7EC 4JRXD 1VA9A 1WZ1H 1NMBH 1LK3L 2JK5A 5B8CA 4K3HA 3PWPB 3DIFA 2X9WA 1KF9B 4V2BA 5ID0B 4KVCH 4JANB 5CKAA 4N0CD 3O2WL 3CU7A 4GRWB 4QRRD 5FHAL 1KNOB 5I76A 3KPNA 5K9KA 4YDLB 3BKCH 1EO8H 3CH8A 4JFDB 1Z9OA 2FIKB 4UV4H 4X9IA 5GGTL 4M48L 1QFUH 4DTGH 3WFCH 5F9WC 3QRFM 2ZZUT 1FCCA 2Q1EA 2BVQA 2VABA 3NIFE 1UWEL 2IAMC 4L5FH 4TQEL 2O5ZL 2Y06L 1GGUA 5IBUG 1D9KA 2X4PA 4WTWA 4JLRA 1KCUL 1RVFL 5EU3A 5I8EB 4C4KT 1LD9B 1NMAL 5AZ2H 2GW5A 1QRND 5DJ0A 5E1HB 1MQKH 1OP5K 3S88L 1A6TA 5JDSA 4U7KA 2O5YL 4JY6A 2EDJA 2P8PA 4LSQH 4HKBB 1YQVL 1T5WB 4MQXC 5DD0L 1CGUA 3FB6A 4KHTL 4H88H 4HFUH 4HGKC 4L3EE 5GGQH 3U83A 3GBMH 5IHZA 3HR5B 3KR3H 4PJIE 1K8IB 2ADFH 4JO3H 3VXUB 5E2TL 5IVNA 3GKWH 3CMOL 3SQBA 4Z8FH 4YX2L 3MOBH 1HZHH 1XZ0A 3SOBL 5D8JH 4FQJH 4HT1L 3BH9B 3EFDL 4WI6A 4A6YA 4GXVL 4I2XA 4AEIL 2FD6H 4OAWB 5A40E 5B4MD 2YUVA 3IS1X 2HTKD 4BSWB 5GS0D 3V7AE 1DLHB 4EI5D 5K9OA 2GTWB 4NO3A 5GRXG 5HHVH 4F7CA 3X13B 3F6IA 3O8XD 3B8YA 1BP3B 2A74B 1K2DA 5F1OB 2DD8H 2DDQH 5IESL 1BGXH 5JQ6L 3O8XA 1GGIH 4M43L 5E8DL 5H35B 5FA3A 4HUXB 1B4JL 1F4WL 2W60B 1ZWIB 2OMBA 5ANME 4ZFZA 4TUJA 3IKKA 3DETD 3IJYB 2A9MH 3O8XB 4APQC 5H35A 4JKKA 4ZFOA 4KQ3H 1A9EA 2A38A 3L3KA 4IRZL 3GUTB 2BVOB 4JDTL 3HZYA 4HJJL 5JW3L 1OF2A 1HYSD 2VLRD 3OKOB 4I77L 4WI3A 2X6MA 1I3GL 2CK0L 3TC9A 4ZO7A 1YN7A 5C2UB 1MIEH 4LU5H 4NNPH 5LBSH 3BEVA 4IIQA 2JB5H 3UJJH 3RIFK 4K3EL 2XG4A 4Z0XA 2Z91A 4OF0A 1ZT1B 5E99L 5HYSA 3DMMC 3MLUH 5LJYH 3H3PL 3EOBA 5C7XH 4CVXB 4YHPA 3KJ4B 3UROR 3N1GC 3QH3B 3B6SA 1IAKB 3F7YA 2VJXA 3F12B 4Z7UA 4HK0A 2ZNWA 3GNMH 1YEKL 4OLWL 1Z5LA 1LVEA 4HS3B 5GS1B 3CXHK 5TE7H 1NDGB 5JA9A 4K2UH 1FORL 2A0LD 4UDUB 1F3DH 1NCUA 2VLLA 3DECA 4QOKD 3NIFF 5GGRA 3TBWB 2VL5B 1UWXH 1PDKA 3UTOA 4MAYC 4D9RD 1U8IB 5F3HA 4YJZL 3OJDB 1GC1H 3DVIA 1UH3A 2I5YL 3GM0A 4P2QD 1LEIB 2PTVA 1XH3A 1T1YB 2PXYB 3H9ZA 5I1GL 2WZPD 3WDJA 4M7KL 4RZCB 1G7QA 3K81A 3N1MC 4MD0A 3T4AA 1KPVB 4PRHE 1T7VA 4Y4HC 2QJDA 1IT9L 3L95A 4AIXA 2P49B 3E6FA 1W0WB 3L3DB 4JPWH 5DR5L 4PJXB 4WW2B 2CK2A 2VTFA 3T4AB 4RBPH 5DVKA 1UWGH 3HMWL 3DLQR 1FSKC 3MREB 4N9GA 3PWPA 5C0RL 5IBTH 3GEWB 3KLAB 4YXHH 2W0FA 4OLUL 2JJTA 1KB5B 1X5IA 4JGUA 4C83B 3N85H 4DN4L 5IB2A 2ESVD 2IAMA 4LFHG 4NN7B 5HHQA 1A6ZB 4PRIE 3BEWA 2FSEB 5IWLC 3ZSSA 2BFVL 4X6CB 3S4SB 4DZBB 5KSAC 2ZUQB 5I1KL 3BN3B 4OZ4A 1GZPA 5L9DH 2W9DL 4HSQA 4GAYB 4NCDA 1BQSA 2DQJH 1E27A 4YXKL 1QFWL 5D7JA 5FUCE 3I85A 3TO4B 2IH1B 2AV1B 5CFHA 4KHTH 3VD4A 4UT7H 1KCLA 4PJIA 4B7IA 2NZ9D 4I0PB 4F9LA 1D9KC 3WS3A 4O02L 2FB4L 1G7JB 1EEYA 1M7IA 4G8IB 5D93C 2DL9A 4MXVF 2OP4L 1MAML 3MR9B 2B39A 2VC2H 3K8MA 2MNUA 3Q6FB 3HS0B 3QYCA 2V9TA 2XZAL 3HI1A 3IS0X 3PQYE 3VE0B 1G9NL 3EYSL 5C0ND 2X4NA 4XVJL 4D9QE 1E4KA 3C5JA 4KV5F 3NABH 5CHNB 4H5SA 2MQ0A 4L8DB 4P2CG 1MCRA 2SEBB 2NW2A 1DEEA 5ID1B 2O5XL 1IFHL 2J6EL 1OWWA 5CZVH 5JHLL 1FVEB 3WFDH 1CN4A 1Q9OA 3LSOB 5E5UB 3QSKB 3QUXB 1OAKH 1FNEB 4PRPE 4HEPG 5D96C 2IFFL 3RZCB 1N2RA 4NJ9H 5ICYB 1QHPA 4OD3H 2X70B 3IU3A 1N0LA 3LKRA 1C12B 4PBXA 4GQ9L 5JZ7C 3TH3T 3BJ91 3IFOB 1B6DA 4JQIL 5F7LB 5IB1B 1EFQA 3O6KL 4NQDE 5ENWB 4MXVE 5IM7B 1XGQA 1A3LH 5L7XL 3HMXA 3UTSB 2YPLD 3WL9B 3O3UN 5HHNA 1J0IA 1W8OA 4NHCH 3C60C 3G9VA 1JZ7A 5DUBB 3IDIB 3SKMA 2BNQA 3CVHH 1RUQH 1H15A 4YGVB 5E8PA 1G7IA 4NGHL 1E6JH 5DZNA 3K8LA 1S9WA 2XQBL 3KYNB 2X89D 4XCEA 4JDZB 4Z7WA 3VXTB 4IHOB 5HYSB 5JPMB 4H25A 2X4OA 4AH2B 2DKUA 2BY1A 1P1ZA 1HXMB 1EH9A 4PRHD 4AEIH 3VXUA 1CU4L 1M7DA 4OF3A 2X05A 3KPRE 4PIRF 4O58H 2AVGA 3QNYB 4P4RB 1WQVT 2DQTL 2LAAA 1D7FA 4L3EB 4PGDB 5FYLH 4OAWA 4POZC 2WIIA 3QHFL 3QQ4B 3RWGA 2GFBA 4HH9B 1F6LL 1FYTA 4FTVA 4P5TD 2DM3A 1UJ3A 1H3WM 1NBZB 3BZDA 1A6UL 3NH7H 5D7IE 2BERA 3TNNA 3ULSB 4BH7A 3RNQA 1P7QB 4DJMA 5CEXA 3MUGB 5EWIH 1CF8L 5IQ7L 2PO6B 3MLTA 4P46D 3ZDYF 4L3CA 5TDNA 4V1DA 4EI5A 4HIEB 3MLXL 4BFGA 8FABA 2BXZA 3EO0B 1QR1A 3ILQC 4PV9B 5C09D 5HD8C 4X5XA 5CAYB 1HI6B 3STZA 2FR4B 1FO0H 1TJIH 1CDIA 4R8WL 3UTZB 5BW7A 3C6LD 4Z95H 3VW3L 1AHWB 3HI6H 1PSKL 2DL2A 2J5LC 3H9SE 5T3ZD 2CIIB 1GIGL 1FZOA 5GGUB 4O2EA 3DJ9A 5EOCH 2R1XA 5BVPH 1P84J 4NT6A 1ZVSB 1CS6A 4WTXA 5F6IB 3VFUA 4BYHA 3QCTH 1XR9A 1GZPB 4KKAD 4NKDB 2HRLA 1BJ1J 4RMQA 35C8L 3PQYA 2V17L 1CTOA 3BZ4A 4JFFB 2ESVB 1YN6A 2PETA 4OI8A 2PF6A 2AJSL 3WBDA 2VITA 4Y4FB 1FL3B 1TQCC 3QI9B 1A6VL 1NCWH 2IJ0C 3V9FA 3VRIB 3CXDL 7FABL 1ACYL 4RDQG 2V7HA 3V0WL 4MS8C 2X4SB 1V7ML 2C4FU 3ULUC 3B2VL 1MAMH 3MYJB 1D5ZA 1FL6A 4O4YL 5L0QC 1ZHBA 3EZJB 4LKXA 1T03L 1DQML 1RD6A 4FFVC 3VFVA 4PTTA 3V6OA 4RZCA 1IQWH 5IWLA 5I17A 4NWTL 5CUSL 2CRYA 2FYYA 1T22B 2X4QA 5JOPE 3FFCB 5MI0C 1IEBA 4P3DB 1UKQA 1UM6L 4ZFGH 3EW3B 1Q9KB 3DTXB 4ALAL 2KZ1B 4K07A 3QQ9D 4U0RC 3OHXA 3RIFF 4OQTL 1ZA6A 2R2CA 3KWWA 1CDGA 4MAUH 4HGWA 2W0FB 4DN3L 4YX2H 1GYAA 5MP6L 3DTXA 4XVTH 1AD9B 2OTUB 4XHJC 4YZFE 3MO1A 3MV9B 1WEJL 1NFKA 3JWDL 3QCVL 2LTQC 3TYGL 3DURA 2OJEB 3SDCA 4Y16D 3NFPB 3VFMA 3T0VA 4JN2B 3O9WC 1A7OH 4JKLA 4N8CL 1VSCA 5IW6A 3BPNC 3EYFA 4P2OC 1EERB 4O5LH 3LEVH 4Y4KC 4KRPC 3H7BB 3U7YL 2P42B 2IPKB 3KPMB 3TH4T 4RAUA 1M71A 4ODTL 4LLVB 1IMHC 1G0DA 2BVQB 4OLYL 5IOPB 1CI5A 5EO0B 4RFNB 3JV4A 3BISA 5CBEA 4F57L 1OTTD 1ITBB 1M71B 1S5IH 3A6OA 4QY8A 4MJ4A 2BRRL 4LLMA 4WHCA 2UWEE 4HHAB 2XNAB 4PG9B 4G8IA 3FT4B 1KGCD 4IM8A 4JM2A 3BQUB 4GUPB 3LEXB 3TBTA 3E0GA 1KJ3H 3ZDZE 2H6PB 3CX2A 3T0AA 5I15H 1T2QL 5TGBA 4LSVH 5DF0A 4FHBD 4OKVB 1DQMH 1UQSA 1NBYA 4KVNH 4HS6A 1MWAB 2C1PA 2OR8A 5D1XD 1UB6B 2NTSP 3IDXH 4JEGB 2JCCB 2YSSA 2FL5A 3C2AL 4H5SB 4OGAC 1MY5A 2CDFB 3SGEI 4NHCL 5SWZA 4O2CB 1H5BB 1IQDA 4HKXA 3PWLB 2Y6SD 5ID1A 1LO5B 1YJDL 1CT8A 4U6XB 5GS3A 3F7RA 3HFMH 3KS0J 2Z93A 4XP9L 5IFAH 4BSWA 3J7HA 4PJFE 4O2CA 4DGVH 4CW1B 3BP5B 3V7MA 4QCIB 4U1JA 3O41A 4MHHG 4NQVA 4X7SL 1BFSA 5CILL 3R0NA 3MCKB 1ZT4B 4GBXD 4FFWD 1OAKL 4P5TC 4U6VL 3QFJA 4L9LB 3MRRA 1CCZA 3HE7D 4ZFZB 2AW2A 3QEGL 2CMRH 4GBXA 3TIEB 1PSKH 4EUPA 2OQJA 5SWQA 4NM4H 3ROLB 4K7PH 4M6MH 3MOAH 3REVA 3WFBL 3EYVA 4Q9RL 2E5EA 2YS4A 4MQ7A 5F6IC 3MJ7A 4X83A 3B9EA 4DGIH 5JPNB 5KJRL 1AGBB 3QDGB 1QNZH 3OKLB 2YRLA 2JB5L 4JM4L 2HT3D 4NT6B 5EIQA 5A3IC 1K3ZA 5EZLB 2QQNH 1MIEL 3ZE0E 4JPKH 4HJGB 4JFPB 5DS8A 1CDJA 4WVRA 3B9KA 3QDME 1JCKA 5IK3A 3V4PL 4OZIB 4KTYA 1CLYH 3LN4B 1KPRB 5GRJL 1OSPH 1ZA3A 3I6LE 4K3DH 5FUOL 1AGFB 1WAAF 3S9DB 1RMFL 3ALPA 1M7DB 5J11C 1OARH 1QRNA 4EKXA 4M03A 5I19H 2N7AA 5FYKU 2P1YA 3B6SB 1RUMH 5FM4A 4Z7UB 5E1AB 2ZOKA 4PGDA 3E2HB 2E27H 3RDTA 1BZ9A 4RAVB 2BCKA 4PGEB 5E9DD 5CGMA 3I2CL 3N0PB 1MAKA 2JB6A 2V7HB 4IS6B 4LP4A 3HAEA 4Q6IB 5FV1L 4JRYE 1R3LA 4OLEA 1F6AB 3QNXB 2QKIA 3EJJX 2AXGB 5L2KB 2A6JB 3SO3B 4JZJB 3PNWB 3SDAD 2MTPA 4XNMB 3UTTE 4MGXA 5F96L 4PJAA 5IJKC 4B7LA 4KMTL 4KGJA 4AENA 1EHAA 3EYQD 1MI5D 4UV7L 2ARJQ 1VB9A 2JJTC 1Z9LA 1F6FB 3O3DA 1CZ8H 3EOTH 1KC5L 5D6DC 2BP3A 2YKLL 4JRYB 2GK2A 3X11A 1A3RL 1MCPL 3MRJB 4IRSA 5SX4I 3HZKA 2CPCA 3MREA 2OX5A 3KYKH 5KANI 3L7FB 1CXEA 4OD1L 3EYUH 3SE4A 4NDMA 1BJ1H 1TZHA 1JZ6A 1JWMB 3GMQB 3MOBL 3O2WH 2HFFA 2HMID 1AC0A 2HFGH 3WLBA 4QRUA 4OF7A 4XWGH 5JIHA 4O00A 4JFQA 5HYQB 3HB3C 3RX8A 1J12A 4J4PD 1FNGA 3I50L 2FO1A 3UXFA 4QRPA 4K7FA 2AERT 4HWUA 5JR1L 4P3CH 1QSEB 1OW0C 4J4PA 2BSSB 1RUML 1AKJA 1NANI 1U2CA 1BECA 2FIRT 4OUUB 1P4BH 1YEDA 4GMSH 5F7YC 4LBEB 2HVJA 4GG6A 1W72A 4I9WE 1MJ7L 3RTQC 2EYSA 3EYSH 4I18B 4F7MA 5DK0A 1ZHBB 3REWB 3FQTB 1EJOL 3MNZB 1F13A 5IIEA 4GO6B 4JG1H 4NQSB 4YDJB 1MHHB 4N1EA 4R4NC 2EYSB 3ZHKA 2VDLL 5DSCA 2CKNA 5IMMA 4F3FB 1FAIL 3QIWB 2ATKA 3QAZC 5IJVB 4KTEL 2DM4A 3IFPA 4YWGH 2VE6B 3L3OA 3UEZA 1JHTB 2R2BA 2MFNA 4YDJA 4DKDC 1KXVC 5ITBH 1XFPA 3QEHA 3FB7B 2AJ3B 2W9EH 1A1MB 3L5IA 1D5BA 1MCPH 3TPKA 2DQJL 1T6WA 3G9AB 2BHZA 1ZS8B 3MV9A 1NCWL 1MCDA 2Y25A 3SDCD 5GGVL 2WBJD 5CEZH 3BKJL 4O2FA 3QEQB 2OLDA 4EUPG 3GB7B 2MQCA 5FYJU 3UX9B 5GRVL 1XGUB 1CGWA 5CBAB 1S8DA 5FYKE 1UZ6E 1DN0B 5F7HA 2FX9H 4JVWA 3PL6C 1T6VN 3ARDB 4UIKH 2CLZA 2KQMA 1CLOH 2C3WA 1DN0A 2F19L 1WC7B 4Z7QE 2PR4H 3CDYA 5HBBA 2YN3A 3CVIH 5C0CE 4QXGH 5TH2A 5T1KD 4PJAF 2NLJB 3BX7C 4WCYL 3S36H 3RAJH 1PG7W 4BFIB 5EZIH 3UC0L 3ARGB 5HI5C 1N8ZB 2VXTH 2IWGA 3RWIA 1DQDH 3UPCA 1FYTE 3TBSA 1OAUH 4LASL 3MRNA 1MREH 2ENSA 4X0KB 4R8WH 3CLFL 5HDQL 4NQCB 2C3HA 1MCLA 5DEFB 4D9LH 2D03H 4FQHA 4JDZA 4YHNA 3UTTD 4Z7WB 3W5MA 4XNQA 1NBYB 3PDGA 5IBUB 3DBXB 3DNKA 5IUSA 3W2DL 4FQHB 1JWSB 5EIIA 4OCYL 1UJ3C 1S3KL 3DUSB 1RURH 4GW5B 5ALCL 3P77A 4FFVD 1DVFA 1AIFB 5E7BA 1CE6B 4Z7NF 2NY1D 2AEQL 1BZ7A 5EG6C 3BDBA 4OLWH 2ARJA 3EDEA 3QB7C 3ARED 3ULUF 4PREB 1S7SA 1K8DB 1LK2B 5J6HA 1CL7H 5JQHC 4HKJB 1NBVH 2DLFL 4QCIA 4LNVA 4HZLA 4ZUWB 3H3PH 3CFCH 1ZK9A 3DSNA 3QHTC 3BWUC 4EJ1C 1S7SB 5CS7A 1F2XK 4GKZB 1DSFL 2G9HB 5CZKA 2XYCA 3JWOC 4F58L 2H9GA 4ONGL 1JYVA 1NQBA 3RVUC 1JPST 3HC4H 3M07A 5GSVB 1KTLB 4JPIB 2NY1B 3ROLA 3L3IA 4FQLL 5GRUL 1YUHB 4L4VA 1RZIA 4MB5A 1SBBA 5AAMA 3MJ7B 3ORJA 3W5NA 1TTUA 4K94C 4XPTH 2EECA 5LXGL 3FOMB 2EXWD 4MD4A 4NQEB 3V4PH 3UTZA 4OD1H 2EZ0C 4GRWH 1EO7A 3DYMA 1HQ4A 3B9KD 3M17A 4P5MB 1S7TB 5H37H 3QNZA 4R96B 1IC4L 5BV7B 3BPLC 5DD6B 2NY0C 5JR1H 3CH1A 3V0VB 5DFWH 3WNMA 4NCC1 3VGBA 4U1KB 3MRCA 4JZNA 4APQD 1I9RH 2VLRB 2IG2H 4MZ2A 5LAXB 3ILQD 3L6FB 2E7CA 4X6DA 1SJHB 1DVFC 3K46A 4RISL 3T3PF 3MRFB 3MLWH 3QDJE 4HH8A 3O4OB 3P0VH 5BVJA 2EDLA 2PW1A 4AMKH 2VDNH 3UZQA 5DD3H 4K94H 1BFOA 3VFSA 4HWBL 5D2NC 3ZKNC 3Q6GH 3MV11 3V6ZA 3OKDA 3REWA 3FQTA 3D0LA 4GKSB 3MNZA 1BIHA 4M8QA 4YDIH 3VXRB 2W9DH 3O4LD 3SPVA 3PDOA 5SX5H 1D5MB 2IH3A 4CMMA 4WW1A 4RA3A 5FCUL 5KSUB 4CVWA 4LSQL 3RI5K 3ABZA 4XCFH 5J12C 2VL4A 4EXKA 3MLPA 1WZMA 3BO8A 3RTQD 5MEQA 1AXTH 5EU3B 4PJ9D 3QO1A 5C0BA 3TA3B 1U8QB 5HYJD 4Y2OA 3PWVA 5FDWB 1CXFA 5FAAA 1C5BL 1JWUA 4X6DF 3PL6A 5FK9A 1ZS8A 3WE6A 3I2CH 3QXUA 1B88A 4HUUA 4NC1C 3VGAC 3HMXH 3OL2A 3RHWF 2VRAA 5CBAA 5CP3A 1SBSH 4AQ1B 4LVHC 1GPOL 4OCMC 5EBLA 4N0UE 3Q5OA 2R15A 3OR6B 4OT1L 5DJAB 4WO4C 3C60D 5DHYB 2DWEB 1TLKA 4LSTH 2RIKA 4ODTH 3MZTA 3CD4A 1QVOA 2XWTB 1X5XA 4ZS6D 2EDTA 4G9FE 1P2CA 3UTPD 1I1AC 2AGJL 4BQ6A 5LGHH 1A14L 1NCAH 1QPPA 2XWTA 4U33A 3LOWA 3WIHA 1JF5A 4HC1H 4JFZH 2EZ0D 4OB5L 4WDIB 1FVCB 2FZ3B 4HHAA 3PABA 5JW4N 2NX5D 3QUZA 4N0FB 2PYFB 2VDRL 3MPCA 4QYOA 1DQQA 2X5PA 4DN3H 3FFCD 4NKOB 3VFNB 4LSPH 4U1GC 1KPUA 2J8UF 3WMSA 1T21B 3IDXL 1AGEB 3NZHH 1P69B 4NZDA 5DJCA 2YA2A 1QFWI 5FEBA 3MJGX 3PIQB 2ZPKL 3MLSH 5DO2C 3Q48A 4MA8L 2ZCHH 5KZCB 5SV4A 5JORB 4WFGE 1GC1L 5CD3B 4GRLD 1UVQA 5E2WL 2EIBA 4MNQA 4TNWK 5FO8A 3BAEL 5E70A 4Y19E 1Q38A 3RA7L 4KY1H 1ZLWK 1Y6KR 1U92B 3O41B 4XPBH 4FFYL 4NRXA 4LCYB 3V52L 4ZTPH 4R7NA 5GSVA 4XX1E 1E4JA 2AJSH 5E8OB 4WV1C 3T65A 5GZOC 3L3IB 3AS2A 5K9QI 4Y16A 5H8DA 1UC6A 2R1YB 5DTFA 5IGXH 4LSVL 4XXCA 5J13B 3VWJA 3RJQB 3MA7A 1GGCL 1R5VB 2NTFA 4PRPA 2IMMA 5EIVA 5FYKH 3REVB 5IP4A 4EEEA 1U8OA 1HK6A 2ZUSA 4WWID 3HE6B 1OT1A 4NN6B 1N0XH 2ZKHL 4L8BA 1FNSL 1KLGB 4DKAA 2CR6A 5KSBA 2AJZA 3S36L 4ZNEE 4MYWB 3MZGB 5IG7A 2IF7A 4KJQD 3GMMA 5E95B 3PWNB 3MFGB 1RMFH 1FDLH 2YA0A 4TYUA 2R2HB 2XA8L 1ZA3B 4PJXA 2IG2L 1LE9B 5F1KC 3ARBD 4FXLA 1PG7X 4QRPE 1H8SA 1T1XA 3CDGA 5HYEA 1MLBB 4JB9H 3WDHA 3TYGH 2R2HA 1QO3A 4GW1A 1BQLL 3X3FL 4LEOA 2E9WA 5JUEH 4I5BB 2XKNB 1MH5B 3CFEA 4J8RA 3NCCB 4TSAL 2QSTA 4OIBA 3DGGA 3LKPA 4JY4A 1OT2A 1IGYB 3ZO0A 3PDOB 3ARSA 2Q8AL 3SGJA 1MFDH 1FFOA 2AXGA 2HKFH 1NUFA 3VFOB 4JZJA 4LFHD 1JBJA 4H1LG 2VDQH 4F7EB 3V79C 1HOCA 4GLRH 5EN2B 4FQXA 4OFYD 2GJ6B 2VUOA 4JJHA 7FABH 4YDKH 2BZDA 4MJID 5C0BE 4I0PA 5JIPA 4PJ5A 4WO4A 1O5DT 5EOTB 1F97A 1T0NB 3O45B 1B0WA 2HT4C 3FCTA 5T3ZE 2UWEF 2R2EB 4J3XA 5DRZA 2QTEA 1VKXB 4WEUD 5BOZG 4ZUUA 5FHBH 3S35L 3BXNA 1V7NH 1OSZA 3HS0A 2EEDA 4TRPH 3EJYD 1VPOL 2K3TA 4Q6IC 2R0KH 2A9ML 2D31B 4UMGA 3NCYS 4N0YL 3M1BA 4PJBE 4WNQB 1C16B 3U46B 2AJXL 1IC4H 5L2JA 1CWVA 3D5OF 3A67L 1BVZA 1SQ2N 5F97E 4LHUG 1ACZA 2E9BA 1W8NA 2A6DA 3TVMB 2AJYH 1LO4L 3IFLL 4RMVA 1DLFH 4LQFH 1D9KD 4S1DC 1J1PH 2YPLA 5GIRB 5JOFA 4QRQA 3RWDB 2B5IC 3LSOA 1A6UH 3NH7L 3V6OE 4OUUA 1XMWA 4OCNC 3RX5A 1Q94A 5D4QA 3O81A 5GS0H 3QUZB 3ARXA 1JRHI 1X4YA 4GS7B 1A3RH 1AQDB 4PGJA 4JANA 2NY2C 4OJFH 1F02I 4DUVA 4MA3A 1QOKA 2C4FT 5CGYC 4ZODA 4OT1H 2Z31D 15C8H 1T2XA 5KVEH 4QLRA 4PJFA 5F8RC 4GG6F 5ENWA 2B4CH 1U8MB 1J8HE 2VN7A 1S7VA 4Y89A 1ZAGA 1OP9A 2KH2B 2ATKB 4I4WB 5EO1A 4JKWA 2NY4B 4JO2H 5DJYA 2VWEE 4C56B 5SWSB 1NANH 4KKLD 3WFEH 4OZHA 2GI7A 5DQDH 2CJUH 2ED9A 4YHOL 2Q6WA 4G3YL 2DLTA 3O2DA 5K59E 2R0ZL 4ZUVA 5KVEL 1E6OH 2CQVA 1JGVL 1URLA 2H32H 1H8OA 2V5YA 4J4PC 2A6IA 4P4KA 5E2TH 5IQ7H 1CBVL 4X7TB 1JNLH 4HULB 2FHCA 5GJSH 3O2VH 1I1CA 3QXAB 3HC3H 1QUNA 2GY7B 3L5XL 5DVNA 3R1GL 4DZ8B 4PLNC 5C0AD 1K4CA 4FXGA 4KI5E 2R4SL 1U91B 1WTGT 5DZLA 2R4RL 2J8HA 4Y7MA 4AT6B 2AXFA 1J0YA 4MNGE 4X8XA 1JPFA 3G6JA 3ARQA 4FZEL 3QIUB 5JTWA 1VADB 1I75A 3MBEA 3RL1B 4M7KH 5C0IA 1JPFB 3NIGE 1CD0A 2Q87A 4PJBF 1YY8A 4LCWE 2P47B 1KT2A 5IG7B 3ULVH 4L4TE 1HHKA 5CZXC 5I74B 2VXUL 2PXYD 1YMMD 2HLFC 4LRIA 3RNQB 3AC0A 3VGHA 1N59A 1I7RB 4TNWF 4PY8J 3IAGC 3LMJH 5D7SL 1YEGL 3L9RB 1HHKB 4MA8H 4QHKJ 1FIGL 3BN9C 2XACC 5C0JA 4OCLC 3V6FA 3WHXB 2W65B 4HKZB 5KG9A 3EJZC 1KN2H 1RY7B 5E5RB 3TYFB 3CXDH 4LLDA 5FOBB 4LSPL 4QOKA 3DUSA 1WICA 1D5IL 3PDDA 5DRNB 5D7LA 1UZ6F 5GGUA 2FGWH 3PWPE 2VZUA 3G08B 1H5BC 4OFPA 3IAPA 4HXAH 5FGCB 5KW9H 5E6ZA 4YAQB 3D69B 2YPLE 2ITDA 1VDGA 2DF3A 3CJJA 3AGVA 3RZWA 5DHVB 5I1EL 4OV5A 1B4JH 1CDBA 4Z0XB 4JM2F 1YPZF 4HW6A 1FNFA 3S36X 5DEGB 2H9GB 2BVPB 1KG0B 4QT5B 1KYOJ 3P9LB 1WCQA 3MA7B 1XF4A 4CN4A 4OCXH 4OCRL 5C0EB 1Z3GL 1KUMA 2DQUL 3T1FA 3KYKL 5B3JE 2E8ZA 2R2EA 4I48A 3U4BL 1HXYB 3VH8A 5E6IA 4WU5B 3RGVA 4MD4B 4NQEA 1I3VA 1NCBH 1U6AH 3HZMB 1OAYH 2ATPA 2YC1B 5HHPB 1RIVH 3C6SB 5MEOA 1QEWB 2FWOB 3JV6A 4YK4B 5CIPH 5JW4R 4QHNA 4UQ2B 1ITCA 3LKQB 4XWGL 5HGHA 5T1KA 4TUOA 1I8IA 5CJ5A 5IEHB 4GW4B 3V5KB 5HD8D 4JGJA 3W9EB 2E7HA 4AIZB 4UQ2A 1A7OL 1IGMH 3CFDA 2YPLB 1FZMA 1CICD 3FO2A 4TSAH 4YK4C 4QRQB 4GW1B 3RVTC 4HGWB 4MXQC 3ZKQD 4DKEL 4ODHH 1DL7H 5DDHB 1H0DB 2G5RA 1C7SA 4QXTA 4XT1C 3Q6GL 5HYJE 1T1WA 1UZ8B 3FO1B 3FO9B 4KKAC 1FFQA 3MFFB 3C6LB 3HA0A 2NY0D 2WK2A 3ZE1E 5JZ7D 3VXQA 2JJUA 4UV7H 2VZOA 3BEWB 3SGKC 4M8QB 1JGLL 1RIHH 1YEEH 3TN0B 5I1GH 2AQ3A 2ZG3A 5B38A 4DAGL 3BN9D 3VFRB 1OM3L 5J1TC 3ZDXE 4UBDC 3U48A 3U0PA 5ISZD 2B4CL 1ZKAA 4WJ5B 3KXFB 3PHQB 4RBPK 1F4HA 9CGTA 4XZUA 5B38G 1A6TB 2VDLH 3LB6C 3BO8B 5JDSB 3VH8G 1T7WA 3I3BA 5HPOA 4ZNEA 4G6JL 4NO2B 4XRCA 5DC4B 2PKDA 3OXSA 4RWYH 5C71A 5CGYD 1YPZB 1TQBB 1A1NA 4N0UB 1WCBB 3K1KC 4UT6L 3I9GH 4M7JH 1YNLH 3MRPA 4K8RL 4NM4L 4Y4KA 4DUXA 5D5ME 5KSAA 1A1NB 4JDTH 5D71L 1AD0A 3QXDB 1AGDB 2AEQH 5KSAD 5DWUL 1KSRA 4PJ9B 5D2NE 2C1OA 5DURD 1EHLL 4HBQA 1YMHB 3ZE1F 4POZD 3BZFB 1CD8A 1I3RA 1QP1A 4JFOB 1FGNH 5HHXL 1JK8A 5IMLA 3K4DA 2Z93B 1K2DB 1YEIH 2APVA 2WUBL 5DK2B 1MY7A 2W1NA 4IRJD 1DEEB 3WFHB 3RIAF 3WFBH 4GMTH 4KC3B 3MJ9A 4MNQE 3EHBC 3KPSE 1TCRB 4XI5D 3P11H 4IRJA 5GJSL 5F9OL 1MLCB 2D0HA 1S7QA 3QCTL 5DC0A 4XAKE 1DQTA 1S5IL 2JELL 1AR2A 1LE5B 1MF2H 5ICXB 1NFDF 4N0FA 1NGQL 5FYLE 4RWYL 1UXSA 5HGDB 1TETL 4GT7A 4X4ZA 4G7YH 5HI5D 1SMOA 2X70A 2X40A 4G5ZH 2YD1A 4QXGL 5FGBC 5ICXA 4Z7VA 3C87A 4KK8D 3IDNB 1ZWIA 3MLRL 2PO6C 1BVKA 2UVFA 3FHQA 5KVDH 1RAMA 4RIRB 5C0CD 2CR3A 3QIWC 2DDQL 3BH8B 4I1NB 1X44A 2MJWA 3G5XA 5CJQH 5K93A 1MAJA 3PG2A 3DV6A 4BSJA 2CKBA 1UVQB 2VKXA 1PZ5B 2FRGP 5GHWL 2N7BA 3D69A 3U1SL 5ITFA 1HINL 4R2GD