5I1HH

Crystal structure of human germline antibody ighv3-53/igkv3-20
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
211
Chain Sequence
EVQLVETGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 211
sequence length 218
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1hH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1hH01
1EEYB 1N6VA 5I1LB 1RK0B 1UM4H 3HI6L 5FYKL 1OL0A 2BC4B 4HQQH 1CG9B 2MMXA 2JKXA 3D39A 1X6NA 1CF8H 1EAPB 5GS0L 1JNNL 4S11A 1MCHA 4JY4B 4MJID 2WIIA 1RIUL 3FFDB 1F5WA 3RWEB 4O9HH 4H20H 1FNAA 4P2QB 1S7XA 2VDOL 4NT6A 3P0YH 1FZMB 4UBDD 4BUGA 5L9DL 5C09D 5DJCA 4P9HC 1RMFH 3MJ8B 3U79A 4JRXB 2R0LH 1DZBA 4TNWK 1SMOA 4WWKA 1A2YA 2VITB 1J9CT 1LK3L 3I3DA 3KXFE 4CJ0A 3L3KA 3SOBH 1NBVL 2QV2A 2Z93B 4UIMB 2VOTA 1Q38A 4YDLB 4P5TC 3JV6A 3H3KA 4KH2A 3ULVL 4M6OL 3R1GH 3MLZH 5GGRY 5KJRL 4YK4C 5CZXC 1QP1A 4TUJA 4OZHA 5EWIH 1NC4B 1QA9B 2PR4L 2QHRH 2EZ0C 1F4WH 5DMIL 4TUKH 3GSNL 5HDBF 1U6AH 3NZ8A 2PN5A 3V7AG 4P0DA 1GL4B 1HHIB 5LJYH 5IMMB 2Z91A 3EYUH 5L2JA 3O2DL 5E2WL 4U33A 1LNUA 3S4SB 2LQRA 5J1AB 3QG6B 1QR1A 1CXEA 4HAFA 1SBBA 2XICA 4OZGE 2AQ1A 4QYOB 5SWSA 5M7QA 3VWJA 2C26A 1KULA 1Z9MA 1CXFA 3HUJB 3IB4A 1OAZH 2IGFH 5DRNA 1VFUA 5C71A 2ITCA 3EGSA 3VE0B 1F8TH 5DUBA 5B4MD 2P7TB 1PX3A 3LN4B 2ATKA 3CFKA 3MRQA 5CD3B 3QIWD 2NZ9C 3F5WA 3X13A 1CBVL 1G7MA 4XCCH 1OB1A 5A3IC 3KJ4B 4KTEL 4NO2B 2GFBA 4ZO8A 5FYLH 1IEAB 4J23A 1AC6A 1FO0H 5DD1H 1GXEA 1CFTB 5I1DB 4DN3L 5GGVL 2VXUH 4UT9H 3TVMA 5GGUA 1N3NB 4ZNEE 1A1MA 1IC7L 4NPYB 1T0NB 3RUGE 5AUMB 4TUOB 1Q72H 3RJDA 4ZUSA 1G6RL 1S7UA 4IBLT 3HS0A 1HE7A 5INDB 3ESVF 2MJWA 4ZTOL 4XVSH 4YHYC 1TQBC 2AKRB 4O2FA 5DVLA 5J4MA 4M4PA 3SHSA 3IDUA 3OKNA 4CU8A 3PL6D 5HHNB 3DV4B 1BM3H 3VWKA 4D0CB 4IS6A 3CU7A 4U6TA 4CU7A 2O61B 4XBEH 4P5MA 1RZIB 3CZFA 2JLLA 1IL1B 3DVFA 1LWRA 5KVFH 1CDGA 2J8UB 2VKXA 3TA3D 4UZGA 5CLTA 2NY3B 3RKDD 3MBEA 3O6LH 4TRPH 5B38A 4ZAKB 1UKSA 3DRQB 4HXAL 1L6XA 4IMLB 4JO1L 2DLHA 1YEJH 5EZJA 3MO1B 4OSUH 4QRUA 3O6FB 2WIMA 1I3RB 4N90D 4LIQE 3RVWC 5HYSB 1JWMB 3VGAB 1NEUA 1A9EB 4JKPL 4QGYA 5DSCB 1T21B 3MOQA 4NM4H 3BUYB 1A14H 1KCVH 5AYUH 5IGXH 1UH2A 4XNXH 4HIJA 2H6PB 2EKSB 3F7RA 3MROA 4P9ML 2ZCLL 3MRNB 4CW1B 2L4OA 1OP5K 4OLUH 5CEZE 1EHAA 2NX5A 2Z31A 1HINH 3VD5A 4PJCF 4UIKH 4Z78A 5DK3A 1LDSA 1GVIA 2H9GB 3I9GL 3BYTA 4QRPA 4FQIL 1AO7B 2IADB 1IGYB 3WXWL 5CZVL 4OI8A 4F33A 4PJAF 2YR3A 3OQ3B 3EDFA 3GJFK 2KH2B 1S7VA 4HUXA 1P7KB 3CZJA 4XXDB 1TZIB 1OT2A 4FXGB 4EVNB 2AV1A 4ZS7H 4DQOL 4XPHH 4MA3A 3J7HA 3FMGL 3MREA 1RZ8A 3U0WH 1MJUH 1UM4L 3SE4A 3DLQR 4HQQL 4IOIA 4Z76A 4L4TE 3IRPX 1CF8L 3LPWA 5SX4H 4P2YA 3BEWA 3KYKL 2NR6D 2X09A 4JFQB 3OR6A 1XR9A 4O9HL 1OTUC 1TJHH 3Q0HA 4H20L 3UP1A 5KS9E 3HMXA 2F5BH 1OWRM 4JAMA 1KOAA 2Q20A 4JLRB 4MNQA 4X98A 3P0YL 4MCYB 5F7FA 1X5LA 4YFLF 2MKLC 5T1KA 1SEBB 1XGQA 1CS6A 4ZG1A 1ZAGA 1NGPH 1F11B 2R0LL 3L3DA 5JXED 2ICWA 2VDNL 1XCTA 4GXUM 3DX6A 4LPUA 1KJ2B 3SOBL 3OG6B 4OM1H 1NC2D 5D8JH 3PQYE 3MLZL 1D9KD 1XF1A 5GZND 5EO9B 5EWIL 5KVEL 1DQLH 2QHRL 1F4WL 2W60B 4TUKL 3VXSE 4R96A 4P4RB 3TIDA 1Y18A 5SX5H 1ONQA 4BM7A 4ORZC 3ARUA 4L3EA 4RZCA 1BZQK 5C2UB 1WCQA 1QSFA 3QZWG 3U2SA 2CUIA 2F54E 4M7KH 3BN9D 1MUJA 1GOHA 4I9WD 1FFQA 2Z31C 4FZ8H 4ODBD 4Q74A 5IESH 1OAZL 2YPVH 4YDVB 2IGFL 5IVXF 1YY9C 4HGWB 1F8TL 4Y8DC 5FYJH 3B9AA 2ZUSA 1QBLH 1YMMB 5FYJU 4BSWB 5K9QI 4CN1A 3TC9A 3DUSB 3JTSA 3VXPA 4R3SA 1QBBA 3QDAA 3DUUB 4XBPA 2OZ4A 5C0DB 3MRMA 4XCCL 1FG9C 3QCTH 1OGAB 4R4BB 1U95A 2RCSH 3SKMA 4F7EB 5FYLL 5BOZG 3SE4C 2X4PA 5DD1L 5E6IC 3IU4L 2ID5A 2VXUL 5CJQH 3VD3A 1LQSR 4W4OA 4TNVK 4UT9L 4XP6L 3OF6D 3EKCA 4K94L 4TSCH 1Q72L 4UNVA 5DEGA 3VXUE 5J11B 3HAEG 4V2CB 4WU5B 4I13B 4KHTL 2G5RA 4XVSL 2AK4D 1KB9K 1O7SA 4H1LG 5C0CE 3SPVA 4HWZB 4YGAB 43CAB 5IKCA 4HUWA 2OTUB 2N7AA 4JFPB 4HUVA 5GGSY 1IBGH 4JFDB 1TDQA 4JE4B 3ORJA 1DANT 1U3ZA 4FXKB 1P4IL 5JW3H 3BPNB 2DYPD 5BO1H 5L6YH 1VFBA 5B22A 1R24B 4PJGA 3TZVD 5FM4A 4LHQB 4KI5D 4O51A 4XNZB 1XGRB 4AG4H 4LGRB 1FPTH 5KVFL 4KKAC 3WL9B 2ARJA 1IQDB 2VO5A 4NN6B 5I1GL 5D2LB 4QRTA 3NH7H 3O6LL 2Q87A 2LU7A 4PBXA 5FA3A 3VFGH 1UJ3B 4UU9B 15C8H 3OKOB 4KGJA 1J1PH 5I9QB 5I18L 4ZPVB 3C09B 1G6VK 1YEJL 4P2QE 1D5MB 1XGTB 1C5CH 3CSPA 3H7BB 4QGTA 4OSUL 4LCIL 3DECA 2BJMH 1JJUA 4M6MH 4X7CC 5DHVB 3HHRB 5E99H 1INEH 4OGYH 5DRZA 1F2XK 4YHOH 3D3VD 4JRXE 5JDJA 5ADPH 1HDMA 4PJBF 3TYGH 3K46A 5BQ7A 4PJFB 3MBXH 4LSVH 1RZ7H 3EO0B 5A2KH 3TN0A 4NM4L 1A14L 2V5RA 3GO1H 1KCVL 4X4XA 5IGXL 4KFZC 3KLAB 5B3JE 4M7ZB 2AXGB 2R2CA 4Y16B 5DK2B 3C5ZC 5I8CB 4OLUL 3GBNH 4PG2A 1HINL 5DC0A 5BS0D 3D0VB 3P9WB 5E8PA 4UIKL 5BJTA 4X6CF 3O6FC 4KKBC 4W4OC 3STZA 1WWWX 3BVNB 4YO0B 1SHMA 5IOPB 5JHDD 1QOKA 1KPRA 1AD9A 3QUXA 4GBXD 1UZ8B 2HFEA 3ARFC 1QHOA 1B0WA 4OZGF 4P3CL 4ZS7L 4XPHL 2HJFA 3VGBA 4MS8D 3AREC 4P5KA 1H8NA 3HUJE 2AJ3B 3U0WL 1MJUL 2Z8VC 1WFTA 3ARBC 4N9OB 3QEQB 4ORGA 5BZDA 1EO8L 1H0DA 1WZMA 4GKNB 3SQOH 4TPRH 1IGCH 3CLFH 3T1FB 5D9SA 2R23A 3TESA 2YBRA 1BFTA 3RL2B 3ES6B 4GRWF 1QD0A 5EPMB 3JXAA 1JV5B 1FYHB 3BGMA 1TJHL 5J6GB 1JN6A 2XQYK 2F5BL 5KSAC 1NBQA 1OAQH 1TJIH 1I1AB 2BRRH 5DWUH 1QFPA 4WEUD 2VMFA 5DJAA 3A0OA 4EIGB 4GSDH 1MCFA 5MEOB 3WN5C 1BWMA 4F37K 4MJIA 2GT9A 4OM1L 1I7UB 5J1TC 4MQSB 5D8JL 3O9WB 4MNHA 2R69H 5C0ND 4WTZG 2CRZA 1DQLL 4WW2B 3HLAA 2DKUA 5CBEA 1HH6B 1XIWB 4FQ1H 5DJ0B 4XCYA 5E8OA 4OFDA 5D7KD 1NANH 4ZFFA 4MAYB 3L9RB 3PHOA 4LCWD 4Y88A 5KG9B 3OAUH 3KPRB 1NH6A 1FIGL 2WBKA 5DC9B 4M7KL 5BW7A 4IJ3B 4Z7OE 1JHKH 4BQCA 4Z0XB 2J8UE 4FZ8L 2OCFD 5IESL 2YPVL 3LN5A 5D1QB 4LLVB 4YC2B 4NUJB 5HGDA 2NY0D 4BH7A 1G7LA 1MCQA 5FYJL 2GK2A 4HJ0D 3MV7B 1YDPB 3ULUH 2I27N 3FT4B 3OMZA 3G5VB 4WCYH 2R2EA 4WV1B 3PABB 1WBYA 3QCTL 4U7SA 4F2MB 4BZ1H 2RCSL 1KB9J 4GO6B 1SYSA 3MRHA 3VXTB 1JZ7A 1NMCC 1AQDB 4KMQA 1U3HB 4CNIA 3VD4A 2JTDA 4WI6A 1M7DA 1DN0A 3WIIL 1DVFD 1NEZB 2D9CA 3A6BL 4OUUA 1BECA 1MCSA 4YBLB 3WCYA 2W91A 4DOHB 4HULB 2VLME 5D1ZB 4XNQA 5MENB 3NFPA 1KV3A 2WSKA 3ISWA 5E9DD 4JY5L 4MYWB 1X5AA 2F15A 3GZKA 3EO1B 5EZIH 5J0BA 1XF2A 4ZO7A 3MRPA 4LKCA 3VXMB 4EZMA 1AO7E 2NMSA 2HFFA 3MJ7B 1SJEA 3H3PH 1EHXA 1S9VA 3EOAB 1KB5B 2GUOB 3MGTA 2GKIA 2HT3C 1IBGL 1BFOA 3IDJA 3ZYOA 3WFHB 1DFBH 4LHUB 2OQJB 2HTLC 2X9WA 4CL7A 2VAAB 2VZ3A 5JW3L 1HQ4B 1N8ZB 5EU4A 5BO1L 4CVXA 5L6YL 4QHUB 4I2XB 1U8KB 1ND0B 3O3DA 1YECH 3GMRA 1UKQA 1YEKH 2ZCKH 3MRBB 3UO1L 1FPTL 2Y7QB 5EFIA 1FYTB 1BGXL 1IKNA 1NBZA 3NH7L 5DURD 4UBDC 5E4EB 2ZNXA 1S7WB 4CAGA 3QPXH 5JQ6H 2ZUUA 3VFGL 3ILQC 15C8L 1G7QB 3QHTC 1J1PL 3T0XA 1EGJL 3KS0H 3KNBB 5KS9F 5DJZA 5A40E 4QXUH 1C5CL 4L9DA 1KJ3H 1I7RB 1MI5D 1IAKB 1VCAA 2PW2A 2VAJA 3KPPA 5F88A 1NL0H 1FORH 4HIXH 5C0JB 2BJML 4M6ML 3O3BB 5ICXB 4LL9A 2ICWJ 1U42A 3RNKA 1INEL 2J8OA 3VXQB 4OGYL 4XP1H 4YHOL 5ADPL 3TYGL 3ZDZF 4LNVA 1CFQB 3HPLB 3MCKA 3OSKA 3MBXL 2Y25A 1RZ7L 4LSVL 2FH8A 1M05B 3TA3A 1BFVL 3TFKD 3VCLB 5IHUH 3RZWA 3GO1L 5TDPA 3QI9D 5BRZB 4P4KD 4PY7A 3SDXB 5L2KB 4R8WH 1Y0LA 3NCYP 4O00A 2R1XB 1UJ3C 3BZFB 2DI8A 4NQCA 3GBNL 3C09C 4U6VH 2E5EA 4CGTA 4MA1C 5CS7A 1VFMA 1ADQL 1FDLH 4CUCA 3QUMA 3IJSB 4I5BA 4ETQB 3ZT7A 1CTOA 2CO7B 3T77B 3FHAA 3KLHD 5B4MC 1K5NA 1MCPL 5FV2A 1AHWA 1T5XB 2FX9H 3MXVH 2OK0L 3SJVB 2OL3H 2BY0A 3NN8B 3LRSB 1BLNA 3O6MH 3P77A 3QIWC 1BIIB 5JOEA 1IGFH 1T5WA 2K7PA 4U6YB 3B6SA 1NFDB 4HWNA 2VLJD 4N0UB 1YMME 3SQOL 4TPRL 2EDBA 1IGCL 3CLFL 5EO0B 4YX2L 3CDCA 3O11A 1NCWH 2UYLB 3PWVB 1Z5LB 1L4IA 3OBAA 3V52H 5IG7B 1OGAE 2WQ8A 4PTUA 2VSDA 2E6JA 3L7FA 1ZXQA 1CDBA 3QFDB 4HK0B 3FRPG 1OAQL 1TJIL 4HUUA 1LEIA 3C6LD 5IFHL 2BRRL 4PD4J 5DWUL 1U8LB 3BAEH 1CI5A 1KJVA 1CFSB 4LCUB 4JPIA 2J6EA 3PGCB 3IXTB 5DVNA 1M6OA 4WIQA 2AXFA 4F7TA 1Q8MA 4P2RD 3PL6C 4UAOB 2NY1B 4A2MA 2R69L 1Z0MA 1AXSA 4CADA 4G80B 2NY5C 4XPAH 1N5YH 1PBYA 3PP3H 4FQ1L 4IRJB 4JFDE 4LIQL 4MNGB 3PIQA 5JORB 2OLDA 1C12A 4IIQC 3D25B 1LEKA 1QKZH 3TA3C 1L9NA 4FQPA 5FGCB 2B5IB 4R2GD 5JXEA 2V2XB 1JMXA 3RKDC 4CN4A 4XNYH 3BRDA 4HS3A 2B1AH 2ZG3A 3OAUL 5A43C 1M7IB 4JJ5A 4TNVF 1MFDL 1JZ5A 1NC2A 4MQ7B 3B9KD 1JHKL 3FKUS 4Q9CA 3RGVB 2MFNA 1D9KA 5D2LE 3O9WC 4Z7WF 2FSEB 3U7AA 4NO0B 4P2OA 5IHBA 4K3EH 3WXVL 3LDBC 3ZZ1A 4ZYKB 3ULUL 1RJLB 3MV8A 4C55A 4WCYL 2AP2A 3RIFK 4ODXA 3CMGA 4HIEA 3BD3A 3EYOB 4BZ1L 1X5FA 3OXSB 2WLYA 2VDKL 3MRCA 4HH9A 3FQTB 4L8CA 4PJFE 2IANB 1MELA 2BVTA 3UYOD 1DUYA 5IMLA 2C3VA 2VUOA 4JDZB 5I74C 3T0BA 4YZFE 2QL1A 4OD2B 4K2UH 3E0GA 2CDEB 2W9DH 4G9DA 4U1JB 3LZFL 3S3PA 1AGEB 2DBLH 3VGHA 3BP4A 2JCCB 4AL8H 5HVGB 3SCMD 3CX2A 5ACMA 1JRHH 3NZHH 3OKYA 5EZIL 2L7UA 3C87A 1X44A 5HI3D 1SYVA 2GJ6D 4BFIA 4OZIF 1F3JA 4U1LB 5JQHC 2YUXA 4PGDB 3ULSB 1UWXK 1G7JA 4G8GA 3W9EA 3JWDL 3GM8A 5F1IB 1S5HA 3GMMB 2DQIH 3GSNA 1DBMH 3OF6A 5FM5O 1LO5A 4NQED 4OQTA 3ZTNH 4B53A 3MNZA 4Z7QF 5JMOC 1NAMA 2NR6C 1BJMA 5D6CA 3HUJF 3QEQE 1YECL 5C0GA 1WWCA 4ZFZB 1YEKL 2YMXH 5AEAA 1T03H 3G5ZB 2CK0H 2ZCKL 3O3AB 3RIAK 1VENA 2XWBB 2DMCA 3MRDA 3IFNH 4ZD3H 2NCMA 2AK4A 4FQJH 1A7OL 4QXGH 1NGWA 2EE6A 4PY8I 1FP5A 3QPXL 5EB9A 4DGYH 3D39B 5JQ6L 1BP3B 1F4AA 1CLYH 5DRXA 4U6HA 5C1MB 1VSCA 1MCWM 5IB4A 4QXUL 2W0LA 1KJ3L 2V9TA 2WIIB 4H1LA 2X4SB 1FORL 4HIXL 4Z5RB 4PJIF 4XZUA 1F3RB 5CIPH 3NMEA 4XP1L 3TZVA 5GZNC 4JPVH 4JR9H 4NM8H 1S7XB 1J8KA 4NT6B 5EU5A 5CSZB 5FB8A 3RVXD 5DA0B 1KGCD 2Y1VA 3SGEI 4KC3B 4WWKB 4R8WL 1A2YB 1V3KA 2BVQB 4FFVD 4AT6A 2R29H 3L3KB 4WFGE 3O2VH 3UBXB 3G6DL 8CGTA 1MCRA 3S36L 1YC7A 3QBTB 3BN9C 1TITA 1R5VA 2LAGB 4TUJB 5SV4A 3H9ZA 4BFEA 1ZA6B 4EUPG 4X9HA 1BPVA 5F7WC 2VZOA 3KPRE 3BMWA 1RZJH 2FX9L 3MXVL 1K2DA 2Z91B 2OL3L 3WBDA 5L2JB 4Z7OF 3O6ML 2J8UF 1LNUB 2NNAA 1IGFL 3DURA 4I0KA 1QR1B 4LBEA 5KSBB 4F37F 2V6HA 5SWSB 3OAYK 4W81A 3M17A 4NN5B 3MV7E 5EC2B 4EN3A 1G9MC 1NCWL 3K4ZA 2PXYA 1NGYA 4Z7NE 3EGSB 2A6DB 3V52L 1FFNB 5DUBB 1VESA 1JGLH 4GBXA 3ARGD 2ATKB 4HXBL 1JGDB 3MRQB 4UTAL 1J10A 3BGFB 5JPMA 4OM0H 2V9RA 4U31A 5IF0A 1BZ7B 3F5WB 2V17H 3QQNA 3X13B 2VYRE 1G7MB 1XZ0B 2I5YH 4PYGA 1IGIH 1OB1B 4DOHE 3BAEL 5MENE 1J12A 3BYYA 1T1WA 2XWTA 4M3JA 4OCSH 1SBSH 2H32H 3INUH 5BXFA 3DVGA 3TVMB 5GGUB 1A1MB 1IE5A 3VXME 3VFTB 5EOTA 3QXWA 2MQ0A 4PJ5A 3G9VA 2B1HL 4ZUSB 3U7WH 3QFJD 1N5YL 3V9FA 2KL6A 2X4NB 3TZVC 4N0FB 4H0GA 3HS0B 2QADB 1WT5C 4YUEH 4KXZH 4OF0A 4I4WA 1RUAH 4JN2A 5TF1H 1E28A 1QKZL 3ELAT 5F70A 4O2FB 4I2XE 2R0KH 5IBLD 3QDGD 1O7VA 3OKNB 4TTGA 1WWBX 3G08A 4IS6B 1FYTE 1YZZA 1U0QA 4S1SH 1CIUA 4P5MB 1DQQA 1GZQA 3A6CH 1FNEA 4KK8D 1E4KA 4HKZA 4K7PX 2O93L 4K3EL 2EDEA 1C7TA 4C54A 4IRJC 1VKXB 1YEDA 4YFLI 5EH1A 4HLZG 4XP5L 4JY6A 3MBEB 5B38B 2WUBH 1Z9OA 2NY6C 5TDOA 3ZHKA 2DICA 1KLGA 4XX1G 5EZJB 4XH2A 5ISZA 5SWZD 1U92B 4QRUB 4NRZB 1YA5A 1MLCB 2YN5A 1JYNA 5INCA 1D5XA 5BRZE 4K2UL 5K9QG 5L2KE 3SDXE 3BZ4A 4JQVA 3BIKA 1LP9A 3QNXA 2DBLL 5C0AD 5IHZA 1C1EH 5EBGA 1DQDH 4AL8L 1JRHL 4L29A 2Y6SD 2R1YA 3ZTJG 1QSED 1P9MA 3FZUD 4MS8C 3S35X 5EIIA 3BDXA 1HYRC 2NX5B 3G5YB 1DVFA 4DUVA 3OJDA 4R97C 2DQIL 4PGCA 4Z78B 1DBML 2YPKA 3V4UH 3C5SA 5CILL 5LGHH 3SJVE 5CSGA 4GAGL 1V7NH 4WVRA 2HRPH 3LEYH 4F33B 3T2OA 2P5EA 4JFYA 1S7VB 2FL5B 5E9DA 2DIBA 4DKEH 1NFDE 3QSKB 3H9SA 5DXWA 1T03L 2AJVH 2CK0L 3K80A 1JTPA 4N0UE 4MA3B 1YN6A 2X4OA 1R3LA 3MREB 4LASH 2NY4B 4ZD3L 4FQJL 1OW0C 3IDMB 4QXGL 2BVUA 4IOIB 1G7IB 3G6AA 2EDFA 3EUUA 4DGYL 1KT2A 3S3SA 1CLYL 5F7NC 2NTFA 2V5TA 4X6DA 5I73C 4L3AA 4QHMA 3BEWB 1NAKL 3WO3B 3LPGA 2I26N 4RFEA 1NUDA 3OR6B 3ZKND 2EO1A 1XR9B 2EDYA 1I1FA 2FD6H 2V5YA 3G6JB 3U36A 3FFCA 4JPVL 3T0VA 4JR9L 4NM8L 5C0NC 4X98B 1FO0A 4BELD 4KJWD 4Q9BA 3MFFA 4OB5H 5T1KB 2WAHA 4J2XA 1F90L 1A4JB 3V2AR 3TT3H 5D6DC 2A6JA 3L3DB 1D6EA 2A9NH 1I9IH 1XCTB 4J6RH 5T3ZD 2R29L 3RDTD 5F9DC 3O2VL 1MI5A 4RA0C 4MNGE 2XN9D 1P2CA 2A2QT 2BY3A 4H5SA 5FGCE 4J3VA 3NGBC 1L9MA 4AH2A 4QTHB 3B3IB 3T2NL 2NY0C 1RZJL 4MCZA 4HJ0C 3V7MA 4R96B 3VXOA 4GW5A 3TIDB 1YNTA 1Y18B 1MCJA 4P4KA 3TP4A 1MJJB 4L3EB 5D2LF 4F58H 3G5XB 3K81A 1T7XA 3WDHA 2BOBA 3SDCD 4G8EB 4LK4A 4MHHI 1KN4L 3U2SB 1FVEA 5SWQA 2I60L 5TPWH 1MUJB 1FBIL 1FZJB 3EDKA 3RTQD 4RDQG 1AIFB 2D03H 5F1KC 5JW4N 4PJ8A 4LSSH 2FEDD 3STBA 3LEXB 1DLFH 1I1YB 4ODHH 4N0CD 5I8KH 1QFWH 2O5YH 1XCQA 2K1MA 3GSXA 1QUNA 1WITA 5C6PB 3JTSB 4PJDA 4R3SB 2IANE 4PJFF 4OM0L 1UXSA 3MRGA 3WV0A 3MRMB 2I5YL 3K74B 3O3UN 1IGIL 1U95B 4P57A 4PJHA 3SKMB 4FZEH 3GM0A 2X4PB 4PJEA 2VLJA 2V7NA 4NNYA 4OCSL 1SBSL 2GCYA 5FO8A 5KSVA 1X4XA 2OJEA 2JCCE 3DSNA 3RVUD 2P45B 5GRWA 1YUHA 4ZFGL 2QKIA 4PRNB 5DEGB 2PO6A 3U7WL 2OMNA 2VDLH 5CJOH 4XWOD 4YUEL 3H2WA 3C6LA 3L6FB 3OB0H 3ARDD 3MTRA 1RUAL 1MFEH 1I3GH 1XGYH 4ZFOL 4HIIA 4P59L 2VLKD 3SPVB 4HUWB 2ERJB 3FRPA 2R0KL 5C0EB 1NBYA 4HUVB 2CIKA 2ZJSH 2F19L 3OAZH 5DS8A 3R0MA 5T5FH 1W0WA 2IQAB 3QEUA 3FTGB 4KTYA 1T20A 5DFTA 1EHLL 3K8KA 4Y4HA 2WINA 3WD5H 2HN7B 4S1SL 1EJ6A 3DTXA 2UZIL 2CLRA 2PW1B 3A6CL 3QUZB 3RWHA 3HCVB 3D39E 5L8JB 4GG8A 2HWZH 4O51B 1UEMA 2D7TL 2YEZA 1UYWH 1GGYA 1FV1B 2ARJB 4AYFA 1TCRB 4QRTB 3ZT6A 4R4ND 5FA3B 3QI9C 1DBAH 2F53A 4LVOB 5GS2H 4G8FA 1PGRB 2E7CA 1I75A 1ZHLB 3QIUB 4WUKL 2A83A 1JPFB 1MCDA 3VFWA 5JXAH 1OARL 3FO2A 2VNCA 5BQ7B 1V5JA 1HNFA 1ZLUK 3RIAF 2P4AB 1CGYA 4WFEE 1C1EL 1OD9A 3TN0B 3KLHC 1DQDL 1FC2D 2DOCA 5BV7H 3MOBL 2X89A 1EXUA 2M26A 4MX7A 1M4KA 4HMCA 1ZHKB 3BISA 5DF0A 5CKAA 5H35A 1Z9SA 4NKIL 5B39A 1ZA3A 4IRSD 1FHGA 5BJTB 3V4UL 3MJ6A 5LGHL 1V7NL 5FYKD 3STZB 2Q7YA 1AD0A 3FB7A 3LEYL 4PLJD 2H1PH 4DK6A 1AD9B 3QUXB 4F7CB 1WZKA 4WHTB 5KSBE 4DKEL 3VRIB 2KBGA 1DLHA 5DUPL 2WP3T 4NDMA 2AJVL 4FP8H 4O4YH 5SWSE 4C59B 2HJFB 3QJHB 3WS3A 1QRNA 4LASL 3I02A 3S6CA 4U7MA 2C5DC 4MMXC 3LKOA 4ORGB 4PLOB 5BZDB 4Z7NF 3K8LA 1FE8H 1H0DB 1UB6A 2W0PA 2ZUYA 5D9SB 2R23B 3RZCD 2YBRB 1BJ1J 3BZDA 1BD2D 4OF3A 2VE6A 3BGMB 2FD6L 4Y5YB 2ENSA 4PBVC 1JN6B 5FF6A 3BIAX 2IALA 4PJXA 4GG6A 3BX7C 4BZYA 4OB5L 2DQGH 1YJDC 1H3PH 3TT3L 5DJAB 3FO1A 2A9NL 5JUEH 1I9IL 2C1OB 4J6RL 1IFHH 4IRZH 4DEPB 1XFPA 2GT9B 5D7LA 5A16A 1EX0A 4POZD 4HF5H 3WDJA 1H3XA 4UQ2B 4OAWA 3B9KC 4LPYA 1KIPB 4W6XB 2ITDB 3WDIA 1RHHA 3L5XH 3LKQA 4XCYB 5E8OB 2EYTA 4JG1H 4RMWA 1NKRA 1YYMH 5GRUH 3O0RH 4G6KH 3PHOB 1VDGA 4NKDA 4X7EC 1VGKA 5TPWL 4HUMB 4KRPD 4WU7A 2XFXA 2LVCA 1PY9A 2D03L 3BPOB 4OZFG 3GJEA 4LSSL 5HGDB 3DNKA 1M1SA 2EYRA 1DLFL 5E8NA 4ZMAT 1X5IA 5GJTL 4ODHL 4W70A 1QFWL 2O5YL 1T66D 3I6KA 4EEEA 4KUCD 3DO7A 4M7LT 1Q9LA 3SDAB 2R2EB 4RGND 1U36A 1Q9OA 3RWCA 1NCUA 3SCMC 5E03A 5J7CC 3VI4E 1ZHBA 3RY5A 4UDUA 2JJSA 1SYSB 4NFCA 2LTQC 5BMFH 1FJ1A 3QNYA 2A6IA 3SDXF 4CNIB 4M43L 1J11A 4DKDC 1Q94A 1DN0B 4OUUB 1CL7H 2JELH 2NXYD 2EECA 1TETH 4XNQB 4E41B 3WUWG 3NFPB 1RUPH 4NO3A 3NIGE 4J3XA 4U1MB 3ARGA 1B9ZA 2RGSA 5GSVA 3T4YA 1S9KC 2VDLL 2NX5E 1IC5L 3D48R 4UNUA 2VQ1A 2J3SA 1VA9A 4L4JA 5ENWA 5FKAA 2DJSA 3L1OH 4YPJA 1XF2B 4PB0H 1MFEL 4XRCA 4AQOA 2R8SH 1XGYL 3MRPB 4QNPE 2AI0H 2HFFB 5CGTA 1SJEB 4GRWH 1S9VB 3MGTB 5GISL 2ZJSL 3IDJB 1BFOB 2KUTA 1NFDF 3CDGA 5DFVD 3WHE0 3BZEA 3HZVA 2OI9B 1FZOA 4F3FA 2NW2A 5T5FL 3PV6A 5E2TH 4JN1H 5FDWA 3IS0X 5HHPA 2IAMA 5EU4B 3WD5L 2ZCHH 3O3DB 1S9WB 1MFNA 3GMRB 2HWZL 4G7VH 1UYWL 2XZZA 5EFIB 2R1WB 1CQKA 4L1HA 3S5LG 5JZ7D 3T0AA 4NCC1 4F9PC 3RVXC 3KPNA 2ATPB 1BBJB 5DHXB 4WFFD 5JOFB 3MA9H 1RJCA 3OR7A 3G6JE 3AFLA 3HZYA 1PDKA 2CUHA 2CLVA 2PYED 5DJZB 3KPPB 5F88B 2Q86B 5C07D 2EEBA 3GSVA 5DMGD 1SJHB 2KZ1B 5T5NF 5JXAL 3RNKB 4L8BA 5E8DL 2LABA 4XVJH 2QR0A 3SDDB 2I9TA 3JTTA 3MCKB 4P9HH 5TE7H 3PG2A 1MNUH 3CPLA 1T3FA 1MFBH 1GGIH 3TV3H 1IVLA 5TDPB 5BV7L 5BVPH 4YPGA 2XQBL 2IWGA 1DBKH 3CFCH 3RX8A 4NBYB 2VLRD 1BQHG 2JJSC 2ZUWA 4NQCB 4JRYA 2OX5A 5GZOC 4ODTH 3BW9B 4KV5E 1MHPH 2UZXB 4XTRC 3V6OA 3KR3H 4I5BB 4CDHA 1IGTA 1K85A 3OKLA 2H1PL 4L3EE 3HNTH 3VXRD 2N4IA 1K5NB 5GGQH 1AGBB 4I18A 3C6SA 4O4YL 2G5BA 4RSVA 4AIXA 4ESKA 3P77B 4K3GA 4LGPB 3L3IA 1UC6A 1T5WB 1CLCA 3MZGB 1TENA 3WHXB 3B6SB 2XTJB 1D5IL 3IGAA 5C2BH 3ZYZA 5ESQA 1N2RB 2YUVA 2XA3A 3O11B 5IK3B 1CDIA 1CIDA 3RY6C 4ZUUA 4JM2B 4Z0BH 4POUB 1IAII 3OJVC 4JFZH 3PWJB 5FGSA 4PTTB 3RX7A 3L7FB 5CUSH 2M1KA 5C0FA 3UZEA 2DQGL 3ARZA 1LE9A 1X5GA 4JPIB 4LSQH 5J13C 3RWJA 1B6UA 3AY4A 5JUEL 4O2EA 2Y5TA 3LV3B 3NCMA 1IFHL 4IRZL 1M6OB 5IBLC 2BNUA 2XY2A 4F7TB 4PYHA 2V2WA 5T3XE 3LEVH 1R3IL 3VRJA 3BE1H 4M02A 4HF5L 4PLKC 1C16A 2BVPA 1OLLA 4I0PB 1AXSB 4AZ8A 4CADB 3CFEA 3FL7A 4Q2ZA 4Y5YC 1K8IA 1T89A 4KK8C 4JFFD 3L5XL 4Y2DD 3PIQB 1AQKH 3U1SH 1YYML 1LEKB 5CWSB 2N7BA 5I1AB 3O0RL 4CRPA 4G6KL 1R3KA 4FFZH 5JW4Q 5JNYA 3T2PA 4KRMB 3ZT5A 3JZ7A 3GMNA 4HS3B 4Y5XA 1E27A 3BRGC 5DEZA 1JRHI 4JJ5B 3RDTA 4BH8A 3FAXA 2AJXH 2ESVA 3W0WA 3GRWA 3LKRA 3MXWH 4P2OB 4ELMB 1GGCH 4NQDE 4MD4A 2EDWA 4PRID 1IC1A 3MV8B 4ODXB 4JHZA 2XKNA 4B7IA 4E42A 2Y6SC 3O41A 5BMFL 2ZZUT 5EUOF 4HH9B 3MRCB 3SDCA 4D2NA 4HBQA 4OKVA 1RAMA 3UDWA 5I30H 4R7NB 1DUYB 3RTQA 5IMLB 2C3VB 1LK2A 3QWOA 1CL7L 1EEZA 3S98A 2JELL 3JV0A 3WE6A 4MXVE 1TETL 1MOEA 5F9JA 1RK1A 1RUPL 2H26A 2ED9A 1NFKA 1JPGA 3CSYA 2YK1H 2HFGH 2YC1A 4XC3H 3B83A 3MA7A 1OPGL 4Y4KD 5LBSH 3T3MF 4D0BA 3HE7A 1CDUA 5C0BD 4L9LC 3QDJA 1A7BA 4BFIB 1SYVB 4D9QE 1BF8A 3L1OL 5ANMB 1SQ2N 4PB0L 2R8SL 1CTNA 2AI0L 5H37G 3MRJB 1G7JB 4G8GB 3W9EB 1S78C 3QNZB 3AAZA 3O6KH 3P4LA 1KJMA 1S5HB 5KSBF 3GSNB 4KU1A 5E70A 1J8HD 4FRWA 4QTIH 5E2TL 4JN1L 3BO8A 5D2NC 1UVQB 3MNZB 4JPKH 2OL3A 1NAMB 2E7BA 3BQUB 1MQ8A 5D6CB 3X14B 3ZKNC 2ZCHL 1G9NH 4XHJD 3SBWC 2IC2A 5C0GB 2YD7A 4DUXA 4QEGA 3NFSL 2CQVA 2YPLD 3MRDB 4NKOA 4KJWC 4NHUA 4LVEA 2AK4B 3QEHA 3DYMA 1H8OA 5D5MA 2P46B 2VLKA 3MA9L 1ZHNA 5HVHB 5DRXB 4U6HB 1K8DA 3VFVA 4Y4FD 4M1DH 3O81A 5IB4B 5CEYA 2Q7NA 3LY6A 5DHYA 4XZUB 4N5ED 4XVJL 4UT7H 1N6UA 4Y5VA 1BIHA 4V1DE 3KVQA 4P9HL 5TE7L 3VGEA 3QHZH 1KG0A 1MNUL 3UTZA 2W38A 3EJYC 4U1GC 5FB8B 1GGIL 3E8UH 3B5TA 4OZFB 3BWUC 5FFLA 5D71H 2D3VA 2R4RH 3T65A 5BVPL 3TH3T 1FAKT 3DETD 3CFCL 4PP1D 3QUYD 2JJUA 5FCUH 4BSJA 3SDCC 1PEWA 1DP0A 3HC4H 4J7RA 2EE9A 4ODTL 2XI9A 4MJ4A 4FQXA 1V8HA 1MHPL 2Q3ZA 3KPOA 3KR3L 1AFVH 5EBLA 3QCUH 2FEDC 3SDDC 3HNTL 5E24E 3T4AA 2X4RA 4X7SH 4CVUA 1K2DB 1A1OA 1AGFA 1S5IH 2Y06H 1I7ZB 2X1OA 1OP3H 3GBLA 2NNAB 2XA8H 1KIRA 3DURB 3RBGA 2VABB 1RFDH 4LBEB 3SE9H 3I6LD 4KXZI 2AXHA 5I16A 5C2BL 4IRSA 4ZUVA 3M17B 2PETA 1MFCH 1Z0NA 4EN3B 2OS7A 4HKJA 2PXYB 5ILTH 4JHWL 5HPMA 5IWLC 2IBBA 4Z0BL 1EUUA 3OKDA 4JFZL 3VI4F 4Y2OA 4GBXB 3RVUC 5HSFA 3KJ6H 4YE4H 5KW9H 3O3EA 4X6EA 5IF0B 1GIGH 2DM4A 1IJ9A 2C4FT 1JVKA 4XWOC 2MCPH 3ARDC 4OFIA 4E41E 4LSQL 1J86A 2CUMA 1WVZA 3NIGF 2V5MA 3BWAA 3PHQA 1WV7T 1BVKA 3K1KC 5BXFB 4CVZA 3DVGB 1JUFA 3AU1A 5KAQG 3LEVL 3BE1L 5IBUB 3RNQA 5D1XA 2BY2A 3GGWA 2FGWH 2VWEE 3LD8C 1MQKH 4R0LC 4QNPF 3HMXH 5EOTB 4PJ5B 4CKVX 2B39A 5CBAB 4K3DH 5E0QA 1TJGH 2FR4A 3F65A 4WUUD 2FNBA 1CD0A 2VLLA 4I4WB 3D1MC 4K7FA 3U1SL 1I3UA 2IQ9L 7FABL 3TNNA 4FFZL 4O5LH 5B8CC 2P5WD 4RAUA 5HY9A 3JVGC 3QIBC 4R4NC 2MKWA 4RFNC 2AJXL 4G6AD 3G08B 1H3VA 1N4XH 4OI9A 25C8H 2W9EH 4O58L 4OFVA 3VJ6B 3THMH 2L0DA 3AXLB 1GZQB 3MXWL 5IJKA 1DCLA 1ZLWH 4U0RC 1A0QL 1GGCL 2HLFC 3G6JF 3MODH 4YDKH 4LVHB 4E5XA 1P6AB 4FOMA 5C8JA 1RZKC 4FQQA 4JY6B 3EAKA 5EIVA 2VXTH 2P49B 4XMLH 4MHHG 1FCCA 5TDOB 3ZSTA 5CIPA 1D5BB 1KLGB 2DQJH 4XH2B 3E6HA 1HWGB 5I30L 1JZ8A 5ISZB 4LU5H 3B9EA 4IRSC 4XMPL 3KYOA 4URTB 1D5XB 5KN5A 1OQOA 4ELKA 4M93B 3BZ4B 3I75A 4MB3A 1NGQL 1ZT4B 2QTEA 3BIKB 1LP9B 2YK1L 2GK0A 3QNXB 2HFGL 1UH4A 4XC3L 2GIYA 5IHZB 1JIBA 5GGVY 4NQCE 5GS0C 2OZ4H 2NXZB 4J4PD 4XB8A 1WUNT 4KVNH 2R1YB 1V3LA 2VQUA 3BFOA 4KV5F 2ZG1A 3ROLA 1NLDH 1WEJH 3EDDA 3KXFD 5EIIB 2D31A 4WEBH 3BOVA 1FIEA 4N8VA 5IW6A 3S7GA 1DVFB 3C9NA 3OJDB 1UCBH 4PGCB 4ZXBD 2X4QA 2V2TB 2YPKB 3GBMH 3C5SB 4QTIL 4OGXL 3LQAL 4RIRB 4JPKL 1KFAH 3RZCC 4GJTB 1MHHA 4ZS6D 2P5EB 4JFYB 1G9NL 3TGXA 2XTJE 3H9SB 5I19H 1T2JA 4TULH 3N1GC 4F7MA 1JE6A 3WUWA 1R3LB 3ARPA 3UPCA 3EDEA 3GMLA 4AENA 3RP1A 3QO1A 3ULVC 1WBZA 3QXVA 3S96A 1A3RL 1U91A 3G6AB 4M9OA 5DVOA 4MD5B 5HXMA 1KT2B 1MCCA 2DQDH 3EDJA 5TF0A 1KTDA 2PCPA 4OV5A 1QQDA 3MQIA 4X6DB 1EV2E 4M9PA 3AMKA 2EDNA 5HHOD 1J0YA 4RFEB 3CD4A 4AEFA 4QRRD 4POZC 3DBXA 4WI4A 4FQ2H 4EJ1C 2AABL 3C8DA 3FFCB 4UT7L 3U36B 3CLEH 1U8QA 3K4AA 1FO0B 5H2BA 1JTTA 3MFFB 3UTTA 4F8QA 3E8UL 3KHOA 4MQXD 1DDHA 3U0TA 5D71L 5IB3B 2E9WA 2R4RL 2EDJA 3E3QE 4F15B 4JZJC 1TVBA 4KROB 2XZAH 4GW1A 3DYPA 3Q3GB 5ID1A 4WJ5B 1VB9A 4M03A 1MI5B 3HZMA 5C07A 1T04A 2HVJA 3EYFB 3BPLB 3DXAB 4LEOB 4KRPC 1P2CB 3PGFH 5IUSA 4H5SB 2LE9A 4ZFOA 3QCUL 4AH2B 5JHLH 3X17A 1U2HA 1OWWA 4JVPA 2CR3A 3WLWC 1YQVH 4MCZB 1T66C 2RR3A 4P3DB 3VXOB 4GW5B 1P4LB 1S5IL 5FUZL 3IRZA 4P4KB 4B7LA 1NCDH 4RGNC 2P8PA 4ZODA 2EIBA 2XA8L 2VLRA 1RFDL 3N1FC 2BOBB 1MCIA 3SE9L 3AS2A 4ELME 3AUVA 5SWQB 5GS3A 4HDIA 1PYWB 1A7PH 4LLQA 4NBXB 3MV8E 2VL4A 5ILTL 4TSAH 4PJ8B 1BQHA 5D7JD 2NXYC 1TNMA 1K9TA 3MJ9A 3GSXB 3GSOB 2MNUA 2VR5A 3D2UD 3KJ6L 4LCCB 1BAFL 1OP9A 4YE4L 5KW9L 5IQ9A 5CMAA 2QEJA 4PJDB 2JJVA 1K4CA 1QFWM 3MRGB 1GIGL 2LVEA 4I9WE 1NCBH 2MCPL 4P57B 2CKBH 4PJHB 5BVJA 3X11A 4MXVF 4QRSB 1KXTB 2X1XR 2H2SD 1ZT7A 4PV8B 1A6UH 2VLJB 3M45A 2V7NB 1U3JA 4NNYB 5E5MA 4MXQD 3UPRB 1A22B 3WSQH 1Y6KR 5FO8B 5JMRA 5KSVB 2OJEB 5D70H 1L0QA 5DFVC 1HSBA 5ANME 1YUHB 4GLRH 4L8SC 3HMXL 4PREA 2PO6B 4G8GE 2AEWA 4HS6A 2YN3A 4K3DL 3WO4B 1TJGL 4P46A 3CMOH 2YD1A 2Y07H 3C6LB 3I2CH 2UVFA 4HHAB 2YD6A 2DKSA 4HIIB 2J5LB 5CEZD 4GQ9H 4O5LL 2KDGA 5AWNH 1NBYB 2CIKB 4NFDA 1VEMA 1V05A 4KKLD 3GSRA 5DS8B 3QEUB 1PG7W 1IGML 1T20B 2P8MA 1N4XL 25C8L 2W9EL 3FT2A 3LRHA 1WLHA 4Y4HB 2WINB 5HPOA 3DTXB 4KJYA 5KOVC 2CLRB 3THML 1T80A 3RWHB 2FO4B 3MRLA 2B0SH 2UVEA 4GG8B 1T2QH 3MYJB 1JYXA 4Y2DA 2YEZB 3LMJH 3MODL 4YDKL 4M3KB 3WNNA 3WNOA 1B0GA 3MZTA 4HPOL 3CVIL 3VFMA 3MLUH 2VXTL 2QJDA 3BGAA 4L4TD 4N9GA 3TEUA 2F53B 5MERA 4G8FB 5MP6H 4KI5E 4D9LH 1HEZA 3NPZB 4HS8H 2A83B 4LU5L 1I7TA 4KDTA 3UJJH 2CJUH 2DKMA 2UY7A 2X1PA 3HG1A 3FO2B 1A3LH 4G8IA 1WBXA 4UUJA 3OTTA 4CU6A 2RIKA 3EYVA 1QFOA 5J9PA 2FDBP 4PRIA 1KN2H 2ZSWB 2OZ4L 4LVHC 5IMKA 4KVNL 4YLQT 1JI2A 2C7UA 3HE6D 2WM0A 1FLRH 2LU4A 4MX7B 1NLDL 4AM0B 1WEJL 4GS7B 4HCRA 1GGTA 5F7MC 3TBYA 4WEBL 1X7QA 5B39B 3Q1SH 1UCBL 4M5YH 3LSOA 1HI6A 2WBJA 2A1WH 3GBML 3T08A 2Q7YB 1AD0B 3BHBA 3FB7B 1KFAL 5DRWA 3QISA 2W0FA 5HJ3A 3EFDH 3VXSD 3UAJD 3P9MA 4Y4KA 4MDIA 5I19L 1DLHB 4TULL 4NDMB 4G43A 1MIEH 2QSCH 2BCKB 5D7IB 5C0BA 4Q9QL 2N56A 3LKSA 4U3CA 3VDBA 1QRNB 2JIXD 2IBGA 5E6ZA 5EO1A 4RBPK 3NCCB 1FFPA 1AR1D 2F54D 4KZEH 1UB6B 4JVWA 1RUKL 2DQDL 2G75A 1L6ZA 4FMKA 4YQXH 4IDLA 4Y89A 4LAJH 4K9EH 3Q48A 1WC7A 3HI5H 4KTDH 1F45A 5EZLA 3PJSB 4LLYA 1ZS8A 3DVIA 4PJCA 1KLFA 5FF6B 4KK6C 4ODWA 2JJTA 3FT3A 3CLEL 2IALB 3S35H 1AKJA 5I66A 3Q6FB 4Z7UB 2YPLA 3UZQA 4M8VA 1CE6A 1IM9D 3FO1B 3VXNA 4PJ5E 4HWEH 4X7FC 1OSZA 5D4QA 5FGBA 5FIEA 1HHGB 5FUCC 1P1ZB 1AY1H 5D7LB 5A16B 3N06B 4DZ8A 2B8OT 2ZOLB 5GJSH 3PGFL 3VXUD 3UTQA 3LS4L 4MJ5A 3TO4A 3U4AA 5HVFB 3N50A 3PDOA 4NGHH 4EOWH 4WTXA 1UWXH 5HI5D 1RHHB 1ETZA 3LKQB 4DUWA 2XV6B 3FONA 1YQVL 3JWOC 4QHLA 5KZCB 1M7XA 5ICZB 5C0CD 3TH2T 4PB9H 1NCDL 4NKDB 2J12B 2V5SA 4F15C 3L5WA 4K94C 5GHWH 1IKFH 1MRCH 4XBGA 1VGKB 1KPVB 4G42A 1SVCP 4JQIH 1A7PL 4WU7B 2XFXB 4H88H 3QUMH 4ZDHA 4K8RL 2BDNH 4TSAL 5D7KE 5D96C 3VG9B 4OJFL 4NRXA 2E8ZA 3I6KB 1HQRA 1MPAH 3TWCH 1T7WA 5ISZE 3PDDA 1Q9LB 4Y4KC 1P7QB 1Q9OB 1JL8A 3V4VH 2QHLA 4BJLA 4XXCA 2X7LA 2X44D 3OKMA 4P2QD 5I76A 1FJ1B 3QNYB 2A6IB 4J3UA 4OIIH 3T0EB 1A6UL 1LP9E 1PQZB 1Q94B 3VRLE 1H5BA 2RQ8A 4CMHC 4JREC 4NQVA 3ZL4H 5I0DA 5D70L 4XPGH 5IBTH 4NWTH 3CIQA 4LPCA 2APTA 1ACZA 1XF4A 2QQKH 3ARGB 4LLWA 5GSVB 4PRPD 4LCCC 3T4YB 4XHJC 1YNKH 3L3HA 5IVXA 3IS1X 4FTVD 3CMOL 5FKAB 5ENWB 1YY9D 2ZOKA 2Y07L 3I2CL 3WHE1 1NC4D 4Q6YA 2BHZA 3KG5A 3NFNA 4K3JH 2J6EH 3S4SG 4F7PA 2P5EE 5AWNL 1TZHA 2ADJA 3IDYB 3AM8A 1NLBH 2X42A 1QHPA 3H9SE 3CDGB 3HZVB 1FZOB 4Y4FC 3PV6B 5FGBC 1J88A 5F44A 5FK9A 5FDWB 5C0RH 4GOSA 1IRAY 2IAMB 5LQBL 3ZDXE 1U8JB 4DGVH 2WP3O 3R06A 5E6ID 3N0PB 5E1AB 4JM2F 5M95B 3WJLC 4N5EC 2JK5A 4E9LA 1T2QL 4OLVL 4UILH 2NY2B 1A6VH 3GMOA 1HHKA 4X6DE 3MV11 3I50H 3LMJL 1QLFA 4NKMA 3OAYH 2GITA 5A2LH 4XCFH 5EU7C 1RZGB 2CMRL 3L5JA 1H9VA 3MLUL 3F7YA 2IG2H 3KLDA 2P5WA 4JDVA 3QAZB 1DBJH 3ROOB 1X4ZA 3HZYB 3FFCE 3DETC 1JGEB 4M8QA 5MP6L 4PP1C 1TVHB 2CLVB 3V0VA 4JHBA 3QUYC 3QHFH 5F7YC 4D9LL 5CGMA 5JO5A 4NOFA 3MUZ1 1EHNA 2AEIT 2BNQB 2WK2A 2CJUL 4NBZB 1N5AB 4XAKE 5TQ2H 4L8BB 5DMKB 3FCTA 1A3LL 4LQ1A 4MMZC 1YPZF 5F96H 4I77L 3CPLB 3IFLH 4QRQA 1KN2L 1T3FB 3RWFA 2J8HA 4TOYL 5F3HA 1MI5E 4MB4A 2CLZB 3DXAE 4LNRA 1FLRL 5SV3A 2CIIA 4JFOA 1MY5A 1VFOA 4JRYB 3Q1SL 5MEQA 1N26A 4M5YL 2EDXA 3QDMD 1AJ7H 2EH7H 1TLKA 3SKJL 5B3NA 4WFHD 4KK9C 2X40A 1IGTB 3FO0H 3OKLB 4KAQH 4ZOBA 4ZOEA 3UXFA 4I18B 4ELMF 3C6SB 5F6HI 1LO0H 1MIEL 2UV3A 3CXHK 5K9JL 3QG7H 4J4PA 4PJBA 1IEBA 2F9BT 5F8RC 4D0DA 3RWIA 2P42B 3DMMA 3TCLA 4NRYA 1A6WH 2YUWA 3VW3L 2OR7A 1WZLA 4WI3A 1NPUA 2DRUA 3IGAB 1CFNA 4N0YH 4MWFB 3L95A 5ESQB 4YQXL 4K9EL 4OQTH 4PJDE 4JFEA 4MA7H 1JI1A 4ZAKD 4ZUUB 4KTDL 3GSUA 1R5WA 3C5ZD 3UBXI 4X9IA 3JWNC 1Q0YL 5HYSG 4PJHE 5GS1A 4X6CA 3S35L 1OHQA 3O6FD 1B2WL 1PZ5A 1JPSH 1CK0H 1G0DA 4HZLB 1IZKA 1OSPH 1R3JA 4AEHH 1E4XH 4XC1L 4HC1H 3NABH 4MDJA 3ULVF 3HAEH 1OCWL 4G6JH 4OLYH 3ARFD 1FNLA 3N1QC 3RWJB 3PWNA 3T2QA 3VFPB 4HWEL 2Y5TB 4PGJA 4H1LH 5HHOA 2BNUB 3W82A 1AY1L 2VLMD 2V2WB 5JDSA 3RFZC 3ARBD 2YD3A 4G6AC 2CRIA 3MRFB 3QPQC 5EIQA 5GJSL 4QRRA 3E2HB 3BJ91 4HKBA 3IKCA 4PY8J 4Q2ZB 1K8IB 2XKSA 4NGHL 4EOWL 1SJVA 3MJGX 3ZKSD 4YFEA 1MVUA 2LFGA 4XWGH 1AO7D 1R3KB 4PB9L 4JEGB 4MZ2A 3GMNB 4D9RE 4Y5XB 1E27B 5GHWL 3U48A 3NOIA 1IKFL 1MRCL 4BH8B 4ZNEA 1RV6X 3NA4A 3V0WH 1U8PA 2ESVB 4JQIL 2Q8AH 3X3GH 3W0WB 4H88L 2F74A 1M71A 2BXYA 3QUML 2VIRA 4AMKH 2BDNL 4TSBH 3QT2A 3QXTA 2BNRA 2F53E 4MZ3A 2MQ3A 4HFWA 1MPAL 2BSTA 3TWCL 5SX5K 4XNMA 2YD9A 4GFTB 5F7LB 4MJ2A 2IH1A 1A8JH 3B9DA 5C08E 4EDWH 3BT2H 4OIIL 4OKVB 3RKPA 1KCKA 1T2XA 5FCSH 3RTQB 1YYLH 3QO0A 1LK2B 1EEZB 4X6FA 4XPGL 5IBTL 4ZXBC 4NWTL 5IVOA 3E6FA 1AXTH 1EA9C 1RK1B 1CD8A 2H26B 1VEOA 4WDIA 3D2UA 4P5TA 3P73A 4ZS6C 4LCYB 3MA7B 1YNKL 2VKWA 4D0BB 3OKKA 3HE7B 1QPPA 3QDJB 3ESUF 1BQUA 1ZGLA 1ZVHA 5ITFA 5LVEA 4K3JL 2J6EL 5FHAH 4MSWB 5EA0L 5GXBB 3IF1A 1RUQH 1VACA 3AAZB 5I6XB 3O4LA 1V7MH 5D7IE 1GOGA 1EVTC 2BHUA 5J06A 3BO8B 5C0RL 1QRNE 2OL3B 4LRIC 3VGDA 4JZNA 2NZIA 2J7LA 4DGVL 1WTLA 1AGDB 1UXWA 4FFYL 2R0WH 1MHEA 1F97A 3L3GB 4UILL 1A6VL 3I50L 4JB9H 1NDMB 5L0QB 4XCFL 4NKOB 3F7VA 3QEHB 5I1JH 2P24A 5HHXH 4FNLH 3U9PH 1SM3H 2VLKB 2IG2L 3WEXA 4YXHH 1YMMD 2SEBB 5I2IA 5DO2D 1DBJL 2DI9A 1K8DB 3MACH 2BY1A 3VFVB 4U1HA 3DIFA 5CLWA 4PJ9C 5HBBA 2Q1EA 3QHFL 5CEYB 2EIZB 5J12B 4XCNB 1OGAD 4Z7UE 2IFGA 5DHYB 5TQ2L 1FSKB 1PW3A 2HT3D 4Y5VB 2HTLD 3CC5A 4DK3A 1J87A 1C5BH 2C1PA 3IFLL 2NY2C 2DM2A 4HWBA 5TH2A 1RUMH 5D7LE 3CXHJ 4KK5D 4PGBB 1EFQA 2BRQA 4L4TA 3UEZA 1T6VN 5DEFB 3OGCA 3OKEA 3D5OF 1CXLA 4FQXB 3IFOA 2E7LC 2EH7L 3ILQD 1U8OB 5KS9A 2ZUQC 2JJWA 5EBLB 3FO0L 2AJZB 4JFDD 4C56A 5D7JC 5DD0H 3T4AB 2X4RB 3GJFA 2FYYA 1LO0L 1PLGH 5GGRA 1A1OB 1CICB 3QG7L 2VH5L 1MAJA 2M2DA 5HI4C 1FRGH 3HE6A 4HK3J 3CSBA 2BSSA 1KIRB 2O5ZH 5LKNA 4Q6IB 1ZE3C 5I16B 3QXUA 4X5XA 3OWEA 2Q6WA 3BP5A 2H2SC 4FFWD 4FQHB 4I48A 4OQTL 1E4WH 5I71B 4MA7L 4MXQC 4OCRL 1NAML 1ZTXL 2OP4H 2ZUXA 5HPMB 1ACYH 1BX2A 4KZDH 2ADIA 5EN2A 3OKDB 4BA8A 4R90L 3MC0A 3VXSA 1XF3A 2A6KA 3T0EE 1KTLA 3O3EB 1LP9F 4X6EB 1MY7A 3HR6A 3VRLF 1JPSL 1YN7B 1CK0L 3B5GA 2JIXA 1OSPL 4AEHL 5ECJE 1E4XL 4K71B 5CGYC 3O8XC 2GHWB 4HC1L 3K4DA 5DJ6A 4PGZA 4PRDB 4G6JL 4OLYL 1FQ9C 2F54A 4X5LA 4XP9H 4W6YB 3MLXH 2R0ZH 1DQTA 3BWAB 1BVKB 1HN1A 3PHQB 5HDQH 1ZLUH 4CVZB 4HEPG 4NN7C 1JUFB 2J2ZA 1DQJA 4KKLC 4Y1AA 4OIAA 3RNQB 3EYQC 5D1XB 3H9YA 4Y16D 1OF2A 3AS3A 3BRFA 2X9XA 1NGXA 1YMHA 2VISA 4GXVH 2FR4B 1X3DA 4KGLA 4RMVA 4J8RA 4XWGL 1VHPA 5F93C 1TCMA 5AZEH 3R4DA 3ZE1E 4L8DA 5E00A 3TNNB 1HILA 2HVKA 3ZDXF 5HY9B 3M07A 2D7QA 4MAUH 2D0HA 4OTXH 4QXTA 4XCEA 3GUTA 3GSWA 3VFOA 3EOBA 1T1YA 3LH2H 4JCLA 5E4IA 4X6DF 1INQB 5FO9B 5IEKA 2MOVA 4DTGH 1RHFA 3QEQD 3U30B 1U8HA 2DBJA 4TSBL 4WNQA 3VXUA 1Z3GH 3E2HC 5IM7A 3DV6A 1AGCB 3QA3A 1T6WA 3ABZA 1A6TA 3WNPA 1U9KA 1WTGT 5GSRB 3JWDC 2RFXA 5C0CA 4FQQB 1HZHH 2HYMA 2BNQE 2EXYC 3RPIA 3UZVB 4MXWH 2EO9A 1SVZA 1J7VR 5CIPB 3HE6C 3HI1A 5IMOA 4EDWL 1ZSDB 3BT2L 4NQXB 3E6HB 1I1AD 5DQ9A 5I1LA 1RK0A 1YYLL 5EZOH 5I75C 2CRYA 2PUQT 3KYOB 1G84A 5CP7A 1CR9H 4ELKB 1AXTL 3I75B 3BKJH 3V6FB 1LO2L 4NZRL 5K93A 4PRHE 2GK0B 4UB0H 2BX5A 5JW4M 4Z7WA 4JRYE 3R8BB 3UAJC 2DIJA 4CJ1A 5HHQB 3O9WD 3RWEA 1FNFA 2AEQH 2AXJA 2G2RA 3ROLB 3V6OE 4WFGD 2D31B 5HHVL 5FHAL 1MFAL 1XIWD 5IP4A 3RA7H 3NACH 1AR1C 4N8VB 3IVKA 4EI5B 5IW6B 1W8NA 1JHLH 4M6NH 1RUQL 5IT2H 1V7ML 4KRNA 5F7DB 4MAYD 5IJVB 3U0PA 5F8QC 2VITA 1MHHB 3KPRD 2D7PA 1MCLA 1JCKA 4PRPA 4RISH 4Q9RH 1CVSC 2R0WL 3LIZH 5KBNC 1YEIH 4PRBB 4YNYA 3VH8G 4FTVA 4F7MB 3W11D 4OBRA 4JB9L 3WLBB 4AENB 3ULUE 1J0KA 1S7RB 3QO1B 4PJDF 2VERN 5I1JL 1WBZB 3ET9F 4X4YA 3S96B 5IQ7H 1NGZA 1HCVA 4FNLL 3U9PL 3N85H 1SM3L 1U91B 5E95B 3KWWA 4YXHL 3VGFA 4OV5B 1KTDB 5ACZA 1CGTA 1QQDB 3MV7D 4OZIA 3MACL 4GKZA 4X4ZA 5A2IH 4N5UA 3NCBB 2Z35A 1T1XB 2RBLA 3MLTA 1NEZG 4H0IA 4S1DD 3WIHH 3WKMH 2C3XA 3C60C 4OGZA 2DQFA 3DBXB 4QO1A 4BQ6A 1WK0A 5E6IA 1U3HD 4DN4H 1YJDH 1U8QB 2OJZH 1KLUB 3FQRA 1WFUA 4OZ4A 5H2BB 1C5BL 3ME0A 4NKQB 3UTTB 5A2JH 2H32B 3IFPB 3NPSB 5HI5C 1RUML 2I9LA 5D1ZD 4RAHA 3VE0A 5MEND 4KDWA 1TVBB 2A73B 2GQHA 4GW1B 1P5UA 1TPXC 5CZKA 4NSKA 4Z7VF 4G9FA 1QRKA 3V5DB 3HZMB 5C07B 4LHUG 1RZFH 3Q6GH 2HVJB 1I8KB 3VXMD 1RMFL 4YIQA 1PG7H 2PTTA 2BXZA 5DLMH 2FECI 4ZFOB 1XAUA 1CFTA 5ID0A 4JFHD 1FSKC 1GJIA 2WANA 4TQEH 3X3FH 4ISVA 4LHUD 1PVHA 5DD0L 4PJIA 2E7MA 5DGRA 1H15A 3MRRA 1PLGL 4GLRI 1PZUB 4NPYA 2ESVE 3R1GL 1T83C 3UTSD 3W0WE 2H8PB 1GYAA 3SGDI 1MRDH 3RL1B 3V5KB 5LGJA 2ZKHH 4HDIB 1U6AL 1FYTD 5FOBB 1MF2H 4LLQB 1E4WL 3EYUL 3QDMA 3CGTA 3KDMB 1ZV5A 4Y8AA 1ACYL 4KZDL 1U3YA 1QFUH 3MV9B 2YA0A 3HFMH 3RU8H 3UC0H 2P8LB 3DV4A 4LRNH 5CMAB 2FIRT 3CFDB 4OLZH 1K4CB 5JOPE 5EDXA 1GAFH 5E1HB 4U3XA 4YDLC 5EOQH 1RZIA 5IHLB 2BSRA 4LQFH 5BVJB 3X11B 2FX7H 4JGMA 1IL1A 1ZT7B 2YSSA 3MRIB 4P3WA 4Q6IC 5E5MB 4XP9L 3MLXL 2R0ZL 4BUHA 2Q8BH 5HDQL 3PHSA 5F7HA 1GC1H 2VDRH 1GPOH 3QWQB 2R9HD 3QDJE 5L2KD 4HW6A 1JNJA 1HSBB 4DGIH 3C5ZA 2E7HA 4U2YA 4IMLA 4PREB 3MO1A 4OLEA 3WNMA 1FO0L 4HS6B 4LDLB 3O6FA 4P46B 4WY7H 4GXVL 2HFTA 3LRGA 5KAQF 5D7IF 1F58H 2FIKA 2DF3A 5AZEL 4O2CB 5HGHA 5C86A 1RIVH 1T1ZA 3ARFA 1T21A 1FL3A 4XPBH 4MAUL 4OTXL 3GSRB 3SJVD 3AREA 3LH2L 3ARBA 1EAJA 2P8MB 3KPSD 4JKWA 4P23B 4DTGL 4KJYB 2CGRH 3KJ4C 3EJZC 1BFSA 1Z3GL 1SY6H 2VLKE 4XVTH 5GGSA 5F6IB 1NQBA 2VXSH 4Y2DB 5EUKA 2F8VA 3KPQA 1IM3B 3BP6A 1BM3L 5DZNA 1JHTA 1AO7A 2IFFH 1IGYA 2YXFA 3VFMB 4Z7UF 1HZHL 3ZKXB 4XBEL 2QQQA 4MXWL 2EC9U 5MERB 4BQ9A 5KSAA 4EVNA 1HXYA 1CD1A 2ICEB 2QQNH 3REVA 2X05A 1I7TB 5EZOL 3RWDA 1B4JH 5T5NG 2ZP0T 3HG1B 4TRPL 5AAWA 1CR9L 1Q9WA 4DKFH 4G8IB 1WBXB 4UUJB 3WN5A 4GAYA 3ZE2E 2EE2A 1EMTH 4EUPH 5FKPA 1QPXA 4JFQA 3MV01 5IMKB 3W5MA 2C7UB 1UH3A 2W59A 4MCYA 4IRJD 3SE8H 3TBYB 3HB3D 1ZGLP 1F6FB 1JHLL 4M6NL 3NCJH 5IT2L 1WCBA 5HYJB 3LSOB 1DSFH 1HXMB 2A38A 2WBJB 2E3VA 2NY6D 3FOLA 2XIDA 5DJDA 1VPOH 5AYUL 2NY3C 4XNXL 3I3EA 4ZAKC 1LMKA 2HLAB 1YEGH 4HPYH 5DRWB 4OI7A 4LPVA 5HJ3B 2MPAH 4RISL 1AP2B 3HRZA 3P9MB 3LIZL 4MDIB 3CH1A 2BSED 4G43B 3OXRA 3LKSB 3UCRA 4DZBA 1REIA 4HX1B 5J3HC 4KDVA 2DIAA 5EO1B 4NO0D 5IQ7L 2IPTH 3VGAC 2EDLA 3QJFA 3QQ4A 2G75B 2G9HA 4AIOA 2BFVH 4YFDB 3I6GA 4P4RA 1WC7B 1RZJC 2UWEB 3WIHL 3WKML 4KI1A 3MR9A 4LLYB 4NUGH 3BP7A 3L7EB 1ZS8B 4PJCB 1ZVSB 2CKBA 4ODWB 1UKTA 3FT3B 1AE6H 4WW1B 1YJDL 4DN4L 2H3NA 2OJZL 1AKJB 4GRLB 3FQNA 4JM4H 5I66B 3CFIC 2AEPH 1F2QA 2Z92A 3I85A 1CE6B 1YMMA 2B4CC 3VXNB 4RRPA 3DUSA 3V6BR 1NDGA 3QULB 4RGMB 1RZFL 3UPAA 3Q6GL 4R4BA 4Z77A 4F7EA 4LSPH 4DZ8B 1PG7L 1NGPL 3UTQB 5JIKA 2Z8SA 5DLML 3RUGF 3TO4B 3PDOB 1CDHA 5E7BA 3UMTA 1BOYA 4TQEL 2QLVB 1ETZB 4OCNC 3FONB 5MHSD 3V5HB 2DQTH 4BKLA 1UCTA 4Q7DA 1FFOA 2I24N 1KELH 1MRDL 3RVTD 3L5WB 1T0PB 4HLZH 1K4DA 3NAAH 4XBGB 5J89A 3QB7C 4G42B 5C09A 5DJ8B 2A74A 5F9WB 4GAJH 4P99A 1QFUL 4NO5B 5IB2A 4JFDA 3HFML 4NRXB 3UC0L 1KEMH 5EU6B 2MCG1 2H2PD 3ARSA 3DVNA 4LRNL 1KNOB 1GAFL 3IDIB 5EOQL 1J0ZA 5AZ2H 1P84K 1R24A 4LQFL 1FVCA 1NKOA 1MHCB 3MUGA 3TO2A 2X7LB 2FX7L 3B2UD 3B8YA 3OKMB 4LDEB 5I76B 2VDQH 4YHKH 3ZTJH 3STLA 1QBLL 3VH8B 4OF6A 1H5BB 1IQDA 2Q8BL 5DA4A 5D2LA 2C3WA 1GC1L 3UBXG 2VDRL 1GPOL 4WWKD 1UJ3A 5BV7B 4UU9A 3T0WA 1XF4B 4WFED 2AJYH 4ZO6A 3L3HB 2W1NA 5CJQL 4WY7L 5T33H 3OJ2C 3MMEA 4UOJA 3ZMRA 4M1CD 3TIEA 1F58L 2F5AH 4U1SA 3VG0H 3NFNB 4ZSOA 4TSCL 1RIVL 1J0JA 4PJFA 2YRZA 4NIKB 4F7PB 1TZHB 2ADJB 5J8OA 2DWDA 1BVLA 3EO0A 4Z8FH 3QIWA 5DO2C 2VDMH 2DWEA 1E6OH 4NJAH 5FK9B 3CSGA 3ULUF 3W39A 2UY6A 3QCVH 4Y16A 2CGRL 2FH6A 5I8CA 3R06B 3H9HB 2FB4H 1SY6L 4QWWD 4XVTL 5LCVH 1CCZA 3MUY1 3GMOB 2VXSL 4NKMB 1QLFB 2CXKA 5FHBH 2GITB 2BVYA 1F4YH 5DZOA 2IFFL 3V6ZA 2OR9H 3QRGH 4KK5C 3VGGA 2LV4A 3TJHC 4JDVB 5T3ZH 4M8QB 4ERSH 4NZTH 3SO3B 4Q58C 3V0VB 4AG4L 5J11C 4JZOA 4YXKH 3KLSA 3GRWH 2YUZA 5JO5B 3UTTE 3BDYH 4WI9A 1B4JL 5H94A 4P23C 4DKFL 5DD5H 1MH5B 1WWAX 2FATH 4X9BA 3T1FA 4QRQB 3TVMD 1EMTL 3PL6A 3RWFB 1U58A 5F3HB 1S9YB 5EPMA 1CT8A 2DB8A 5E99L 1RPQA 3BPNC 2DDQH 5CSBA 4LNRB 1X5XA 2NQCA 3SE8L 4OLWH 4JFOB 4IIQA 3P4MA 4XNZC 3NCJL 5MEQB 1EJOH 3LCYA 1X9QA 4NN6C 5GGTA 1LE5B 4FFWC 1RI8A 3ALPA 4ONOA 2YHGA 1YEGL 4HPYL 5MEOA 2K7QA 2MPAL 5I9QC 5D93B 3CCHA 2PNDA 4OF7A 1FH5H 4PJBB 3O9WA 1IEBB 4D0DB 3RWIB 2E6QA 1YY8B 3DMMB 4WO4B 4N8PA 3TCLB 4NRYB 2D7NA 2APVA 2IPTL 2R2BA 5TE6H 5B38G 3MV9E 3SE3C 2ZG2A 3O45A 3L95B 2BFVL 3ILPA 4APQB 4JFEB 3MBED 4OKDA 4HFUH 1TQCB 3PWPB 3GSUB 1R5WB 3OB8A 8FABA 4NUGL 5HDBE 3QQ9D 4M7ZC 5GS1B 4X6CB 3RWGA 1AE6L 4Y16C 4A6YA 2BHYA 4Z0XA 1PZ5B 2AEPL 1ED3A 4LLVA 1R3JB 4NOBA 4NUJA 1FL6A 4NC1E 5TDNA 3MLVH 1P69B 1ZANH 1D6VH 5FECA 3JSSA 5D72H 3FT4A 1GZPA 4I3RH 5HHOB 2DM7A 2A77H 4UMGA 5DZLA 5KOMC 5JDSB 5FV1L 5LAXA 2X1WL 1JWSA 1EUTA 4LSPL 4QRRB 3IJHA 4XGZB 1G7PA 1MCKA 1AQDA 3IKCB 4HKBB 1U3HA 3VFRA 4GSDL 2NX5D 4GRWB 1U8IA 4NC0B 1MVUB 4GRLC 4F57H 5DJXB 1A5FH 2DQTL 1ZLVK 5D1ZA 2HKFH 2BMKA 3P3YA 4XP4H 2DN7A 2EIDA 1P84J 4OFPA 3QH3A 2GTWA 1RULH 2DLTA 1KELL 2CRMA 3JV4A 5ESVB 5ABDE 3NAAL 4AEIH 4BZ2H 1XR8A 2WWKT 1U8PB 1CXHA 2NY4D 1I1AC 2F74B 1M71B 2VIRB 3QUKA 4YWGH 5HD8D 1QO3A 2ICCA 1CXKA 4GAJL 1KB5A 3EFFA 2VXVH 1RZKH 4BQ8A 2BNRB 2E27H 1KEML 4F9LC 2OQJA 4HFWB 4X4MA 5IR1A 4KY1H 2GJZB 1INDH 4G5ZH 4J1UA 4XNMB 3UTSA 4DJMA 4N1EA 4I2XA 1U8KA 5FO7B 5AZ2L 3ZHDA 3S8WA 5HHMB 3HG1E 4GRMA 1MLBA 3GKZA 2VDQL 1QVOA 4YHKL 4WW2C 5T1KD 3RVVC 1A1NA 1XIWC 4CN6A 2XNAA 1CGWA 3QO0B 5FYKH 4X6FB 5FYKU 3R8QA 1YQ2A 3U6RA 4MAYC 1ORSA 4U6XA 6FABH 1JNNH 4WDIB 3KNBA 3D2UB 4P5TB 3KPMA 3P73B 2AJYL 1JF5A 1I7RA 3FB8B 3OKKB 2KZWA 5C0JA 4YK4B 4L4VD 4IJ3C 5HYJE 5T33L 1JZ3A 3VXQA 3W11C 1FZKB 1ZGLB 2YOCA 2F5AL 3QZWA 4S2SA 5D1QC 3VG0L 1IAOA 4YC2C 3MNWA 5B3JF 1MAKA 4GUPB 2OTWA 4EDXA 3IF1B 2GW5A 5I1CH 1VACB 3O4LB 2VDML 4RWHA 1E6OL 2EDOA 4NJAL 1OAXH 2VJXA 4WV1C 3BKMH 2IBZX 4JZNB 2R1XA 4S1DC 1A4KA 2FB4L 3H3PL 5LCVL 4LEXH 3OB0K 1OQXA 1U3HC 1DFBL 5LGKA 5KJRH 2I25N 5IVZA 1F4YL 2XRAH 3F7VB 1C5DA 3IJSA 2UWEE 2P24B 3CDYA 4YBLC 5I1KH 4RMSA 3TH4T 5D1ZC 2OR9L 3OAZK 3QRGL 5DMIH 3WEXB 4PJCE 4U1HB 3DIFB 3NN8A 4YXKL 3GRWL 4QKXB 3NVQA 3KPSA 3BDYL 1N59A 4C58B 2ED8A 4HC1A 1NFDA 3GHBH 3HAEA 4RFOH 2VL5A 3SN6N 5DD5L 3CC5B 2FATL 3QQ3A 2XPGA 3OGOE 2YA1A 4KJQD 1Z5LA 1WAAA 4ODUA 4GW4A 1NL0L 3BKCH 2DYPA 2ENYA 1JYWA 4HGMA 2DDQL 2F8XC 1WT5A 3QFDA 4OF8A 3RQ3A 2FCBA 4OLWL 5T3XD 4YHYB 3OKEB 2X41A 5IHUL 3IFOB 1QBMH 1TQBB 5DJCB 1EJOL 1ZKAA 3MX0A 5E4EC 3FRUA 5IEHA 3PXHA 4QF1A 4C56B 3BH8A 1F13A 2RHEA 1MJ8H 2FYYB 3JV6B 4QOKD 4U6VL 1S7QA 5GGRB 2EIEA 1A9BA 5DUMH 1WJ3A 1AH1A 1FDLL 4OZHB 3QUZD 1FCGA 1KXQE 3D3VA 2BSSB 1Z9LA 4IDJH 4IRJA 5EU6E 2EDDA 4LLUA 4X5XB 3BP5B 3QP3A 3VMOA 3NZ8B 5E8EA 2XWJA 4I48B 1EFXD 2ADIB 4NQDD 2R9HC 1Q9KA 1D5ZA 1M7IA 5ADOH 5F97E 2P47B 1F6AA 3QIUD 5GZOD 2A6KB 1NCTA 4MQ7A 3VWJB 5BS0A 4XTRD 1KUMA 2JIXB 2Y36H 4HGKC 5DRNB 5DJ6B 3MLVL 2ITCB 1H3TA 4WO4C 2GSGA 2DL2A 5JHDA 3HN3A 1D6VL 5D72L 3SO5A 4I3GA 5KVGH 3CFKB 3TN0D 2JB6A 4I3RL 3IXAA 1VFAA 5CP3H 4Y1AB 4PG9A 5BOPA 2VN4A 2GFBB 5JIIA 1OF2B 3FQTA 1BOGA 1A02N 3IU3A 1NGXB 1YMHB 2J1KA 4OLXH 1FNSH 2VISB 3KYMA 43C9A 4F57L 2BK8A 4J8RB 1A5FL 4LP4A 4P48A 1ZWIA 4K8RD 4JKPH 4YBQC 4CBPA 4XP4L 4L8DB 5E00B 1HILB 2HVKB 2ZWLT 4BQBA 4MLSA 4XPAL 5CD5D 4QXTB 4XCEB 1S7UB 4AEIL 4BZ2L 2PF6A 4X9FA 1XH3A 1T1YB 1OW0A 2P43B 4ZOAA 4P2CG 5IEKB 2A9MH 4WHYG 5F7UA 1MCNA 4WNQB 1U8MA 3ULSA 3BIBX 2CDGA 4RBPH 4XNYL 3DV6B 2B1AL 3QA3B 2VXVL 3HC3H 2E27L 1A6TB 4KY1L 2FEEL 5IFJA 1INDL 4G5ZL 3I9GH 4PLKD 3VWKB 1G0YR 2ZPKH 1F4HA 3GB7A 2RFXB 3WXWH 3RHWF 5CZVH 4PLNC 3PGDA 4B0MM 3B5HA 3RPIB 4UAOC 2NY1C 3PWUA 1UQSA 1EBAA 3CZFB 4ZFZA 5IMOB 3HI1B 4DQOH 3O3AA 3RI5F 5EOCJ 3FMGH 2XWBA 4XVUC 5DQ9B 3S9DB 3T09A 3HB3C 4WTZA 5D6DA 5CP7B 4V1DD 3FB5A 4LCWA 3LKPA 3MJ9H 2B5IC 6FABL 3KYKH 4JANA 5IROC 4Z7WB 2X4SA 2C4FU 2FJHA 4Z5RA 1R0AH 1GGUA 3RGVC 5K9OA 2G2RB 1ES0A 1ZEAH 5SX4I 2W9DL 3NIFE 1I1RA 3GMPA 3DO3A 5CSZA 1EO5A 2HT4D 1N0XH 5I1EH 3IVKB 4UV4H 2XG5A 3WFCH 5I1CL 2ICES 4IOSD 3NZHL 4PJBE 5EUOA 2AV7A 1OAXL 3U0PB 3BKML 2BVQA 2VDNH 2W92A 4HIJB 1B88A 3MROB 1Q1JH 1KBGH 4PRPB 3UBXA 1U41A 3P4NA 2FJFA 4LEXL 1UGNA 3MCLH 2Z31B 4YNYB 3DGGA 4FTVB 3BEVA 2B20A 5E5RB 4JFEE 2XRAL 5KVEH 4X5WA 3ZTNL 4QRPB 3GMQA 1ZA6A 4X4YB 3PWPE 4LKXA 1NGZB 4MLIA 4LSTH 5I1KL 3FQXA 5DTFA 3KWWB 3B8SA 4HUXB 1IC4H 3F7PC 3WYRA 2WUCH 4LOUD 5ACZB 4OZIB 4X6CE 4GKZB 2YMXL 2AV1B 1WGOA 3V4PH 3SDAD 4JQXC 2Z35B 1T7YA 3MLTB 3WS6C 1T7VA 1RZ8B 3IFNL 3HPJA 1W72H 4NNXA 1S78D 2DQFB 4TN9A 5KSBA 1PD6A 3GHBL 4ALAH 5E6IB 4Z76B 4RFOL 1GRWA 3FQRB 3L3OA 4HZAA 5EC2A 3VDCA 4OZ4B 4GKSA 5HHOE 3ZKMD 3D6GA 2I9LB 2BERA 2A6DA 4E41D 1FFNA 3BKCL 5GQBA 3MUJA 4QRRE 3SGEH 4NZDA 5K59E 2ORBH 1JGDA 4JAMB 3LHPH 4MNQB 3RVTC 2VZUA 4NSKB 4GRWE 1BZ7A 3D9AH 3MLSH 4G9FB 1XZ0A 1HH9A 1XGQB 3EOTH 3IKKA 1QBML 3D69A 4YIQB 1HIMH 3RPKA 4HIHA 3HTLX 1SEQH 3K1DA 2PTTB 3AGVA 2FBJH 3JWOH 2ICWB 5ID0B 3IU4H 4YHIA 2HJKA 4ISVB 3DX6B 4XP6H 4PJIB 4YHZH 1MJ8L 1H15B 2H2PC 3MRRB 4NQSA 3WUZA 5I8OH 4K94H 5DUML 5GRJH 2ZUVA 3VFTA 2DTSA 4HCRH 1A6AA 3QYCA 2X4NA 5LGJB 3EJYD 1W8OA 4IDJL 4N0FA 2BNRE 3B2UC 4KHTH 4UOW0 4YAQA 5CJ8A 3QDMB 1WSST 1PFCA 2D2OA 3QI9A 3R0NA 1ONQB 4U3HA 4RZCB 5HHME 3GI9H 4OQ1A 4WWKC 4X0KA 4A2LA 1QSFB 5ADOL 5JW5A 4D3CH 1ZLSH 3GKWH 1P4IH 4J3SA 2HT2D 2IH3A 4ODVH 2Y36L 5L88H 2XKUA 2BSRB 3IDNA 3SDDD 5I1IH 1JNLH 1GOFA 2GSIA 3EBAA 1JGLL 4M1CC 2AAVA 5H8DA 3IDGA 2YSSB 2CD0A 4YHLH 3GIZH 3V8CA 5KVGL 3K7UA 1VKXA 5I1GH 3VXPB 5H37H 5JIHA 1EK3A 5A2FA 1U2CA 4XBPB 2V17L 2R15A 3C5ZB 4YZFF 3FB6A 3HA0A 1RURH 4HT1H 5I18H 4NQCD 1U92A 4OLXL 3VA6A 1FNSL 4QWWC 4NRZA 4LCIH 5EU3A 1C8PA 1MLCA 3INUL 3VWJC 3O4LE 5DC4B 1CFBA 4NN5C 5DJYA 2FIKB 3S88H 5HGHB 2KPNA 1T1ZB 3ARFB 4RWYH 5J6HA 3HR5A 1FL3B 5AD0A 2ARWA 5F72S 1BBDH 1DUZA 3AREB 4MVBD 3BGFC 3ARBB 3KYAA 4W6WB 2A9ML 4I0CC 5TF1L 4NCC2 2UWEF 2XTJD 5IKCB 5GGSB 4POYA 3G5YA 3HC3L 1MIMH 1QLEH 5EUKB 3B2VH 1FL5A 3KPQB 1X5KA 5HTSA 3BP6B 1JHTB 2ZPKL 1WISA 2FJGA 4P2RA 4JM2D 3TVMC 1VFBB 3WIHA 2FL5A 3LQAC 4TVPD 5D7SH 4PJGB 4LPXA 5KSAB 5C9JA 3BDBA 4P3CH 1HXYB 5DGQA 1G9NC 1CD1B 3REVB 2FO1A 2QADC 5K9KA 3RWDB 4U49A 3IDMA 1EO8H 1G7IA 1Q9WB 2WUBL 3IT8D 3QIBD 3WN5B 3LB6C 3MJ9L 4GAYB 3IAQA 1KCSH 5FKPB 3B9KA 3VWKC 1R0AL 2HA1A 1NCCH 5IB5A 3G6JA 4I0PD 1ZT1A 3SKOA 1EPFA 5DRZB 1ZEAL 2HLFD 4NNPH 1HDMB 2NPLX 5E5UB 1V3JA 4KJPD 4C56E 3M1BA 1N0XL 5I1EL 4UV4L 4V2BA 3WFCL 1WCBB 4WW2F 2DLEA 1A4JA 1MCBA 3EJJX 3FOLB 1EIBA 3IDXH 3UYPA 1P53A 5DJDB 4X4XB 4N1CA 3ZDZE 1UADC 3MBEC 4OZHE 3MLWH 1Q1JL 1KBGL 3P40A 3QQ9C 3HRZB 1CE1H 3MCLL 3CH1B 5C6TH 5ICYA 4L4VA 5E8PB 3GDBA 3OXRB 4DZBB 5MI0B 5ITBH 1NFIA 4LSTL 2HRPL 4QTHA 3B3IA 4P2OD 1G9EA 1CZ8H 3QJFB 1KPRB 3CXDH 4ZQKA 1IC4L 3QQ4B 2HFEB 2G9HB 1DTUA 2WUCL 4M00A 4NP4H 3RJQB 5GS0D 12E8H 4YEEA 3MV8D 3V4PL 3I6GB 1Y6NR 3SCMA 3DUHA 2GJ6A 4P5KB 1U93A 1W72L 1WF5A 1MJJA 3QDHA 4FS0A 3G5XA 3MR9B 1NMCB 3BP7B 1TFHA 4HMDA 1FIGH 4G8EA 5C3TA 4ALAL 2CKBB 1F02I 3HC0A 2CR6A 2YA2A 2H3NB 1FZJA 3NCFB 4GMSH 3FQNB 1NANI 4MA8H 1AIFA 3K3QA 4NQEA 1J1OH 1I8LA 2Z92B 3LEXA 4Y1AE 3TBTA 1I1YA 4ETYA 4PGEA 3G9AB 2D9QB 1S9XA 3F58H 4OGAC 2ORBL 1ERNA 1NDGB 3CFJA 3LHPL 3QWRD 5DMYA 2MWCA 3D9AL 3MLSL 3ULVD 1QSZA 3ZDYE 3QXDA 4MD0A 4JKKA 4Z77B 4YDJA 3EOTL 4WHDA 2NY4C 3ARVA 5CJBA 1HIML 1SEQL 4JO2H 5F9OH 2FBJL 4G8GD 3JWOL 4N0RA 5HD8C 1TTGA 3WIIH 1JF6A 3MRKA 3A6BH 4MJIB 1UM6H 4YHZL 2Z9TA 5K33A 4BKLB 5I8OL 4WGVB 5GRJL 3BQUD 1FFOB 4MNHB 4PRNA 5T1MA 3UJIH 4HCRL 3U46A 2OR8A 1QYGH 1C7SA 4PIRF 4JY5H 2YD4A 5I8EA 1K4DB 4ZPTA 3HLAB 5CBEB 1SY6A 3L6FA 2HTKC 2YZ8A 2X9YA 4F9PA 5C09B 4M61A 3D87B 2A74B 4ZFFB 1OAYH 2XTLA 2ILLA 4ACPA 5C0EA 3UYRH 4F58L 5IB2B 3WJJA 3GI9L 2NTSP 3DVNB 1WZ1H 4D3CL 2IQAA 1OP3K 3FTGA 4QOKA 1ZLSL 3GKWL 4OCLC 2HN7A 4ONGH 4ODVL 5TJWK 1OM3H 3LN5B 1PX4A 2PW1A 5L88L 3QUZA 1DE4A 1FVCB 3MUGB 3HCVA 3TO2B 1JNLL 1URLA 1G7LB 4BH7B 5I1IL 2Y5EA 1BHGA 1RJZA 3WLWD 4LLAA 5I8KL 3STLB 3UO1H 2LAAA 5KSUA 2IBZY 3GIZL 4YHLL 1FG2A 1FV1A 1BGXH 4OCWH 1TCRA 4Z7WE 5F6HJ 4EUPA 4CDGC 1EFXA 1WBYB 3LN9A 1C08A 3HRPA 4NQDA 1RURL 3MRHB 4HT1L 1EGJH 2FHFA 1I9EA 2G60H 4FZEL 4MA1B 3NIFF 1ZHLA 3QIUA 4LGSB 1M7DB 4I3SH 1GCFA 1JPFA 5HYQA 2E8YA 3DYOA