5I1HH

Crystal structure of human germline antibody ighv3-53/igkv3-20
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
211
Chain Sequence
EVQLVETGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 211
sequence length 218
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1hH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1hH01
3O3EA 4HDIB 5LGJB 2VIRB 3LAFA 3MRRA 4NHCH 1ZMYA 2NTSP 1HH6A 1NCWH 2H2PD 3MA7B 1F4XL 3GBNL 4YAQB 1Q1JL 3RX5A 1BFOB 1G1YA 4G5ZL 5IMMB 1RJYA 2LU7A 2R2BB 4LP4A 3ZL4H 4MQXC 4MXQC 4OQTL 4AQOA 3D3VE 4JFYB 4MXVF 4LEXH 2BC4B 3V6FA 3WYRA 3VXNB 2JKXA 2Z93A 1U42A 3NN8A 4XCNB 1IKFH 3HCVB 4WUUB 1YNTB 3V6OA 5JW5A 1CGXA 1YPZA 2VZSA 3CLFH 2XV6B 2XYCA 2VL4A 2HH0H 2GJZA 3NIGE 1I1AB 5EOQH 4Z76A 3T4AA 4KTEH 1QYGH 4CADB 1U8JB 1KPVB 2UZXB 4JRXA 5HHPA 2OMBA 4Y5YB 1Q9KA 2OK0L 3EOAB 5SWSB 3VXSA 2VDOH 4OV6F 5I1AA 1T7YA 5I1GL 3NBNA 1P7HL 1MRDL 1D5IH 3VG9C 2VLRE 3N1PC 3OKEA 1GGUA 2NLJB 4ONFL 3JWOH 4BZYA 1G6RA 3GSWB 4F7TB 3CVHA 1DSFH 4NM4H 3VJ6B 2Q8BH 1OTSC 3RX8A 1FNGB 3WIFA 3VXSE 1F8TL 1CD9B 3TYFB 2ITDB 3I2CL 1GH7A 4K9EL 3UTZA 3R1GL 5E9DA 4P99A 2NY0B 2BFVH 1GGBL 4K8RL 5DT1H 4X0KA 3UTTB 1P4LA 4HPOH 1TJHL 4OZ4B 1T5WA 1Y6MR 4R96B 2WZPD 3BRGC 5BQ7A 4CDHA 4CNIA 5JOEA 3VFWA 2IAND 3S9DB 2J88H 3HMXA 4HH8A 3T3PF 3EO0A 3CSGA 2HRPL 4JHBA 3O6LL 3ES6B 3GSNA 4GQ9L 5E9DE 1GIGL 2DLFH 1CI5A 1FN4B 3S4SA 1S7RB 2Z8SA 3QCUL 1LO3L 4HKXA 3VG0H 1QSFB 2NY3D 4LSSL 4ONHB 1N8ZB 4P2YA 3SPVA 2NY6B 1QR4A 5C8JA 4PJBA 4OTXL 2QADB 2NQCA 1T21B 4JFPA 4PP1C 2AV7A 1ZS8A 3CXHJ 3TVMC 1YEFL 5E2WH 2WSKA 4WU7B 4PRAB 4L3CA 2QQNH 1NCUA 4FXGA 4PJEF 1MUJA 4K23L 4RAHA 3EO1A 4I3SL 4UV4L 4KTDL 4WWKB 1PSKH 2K9UA 1OAZL 2NMSA 4G9FB 1AGFA 4MSWB 2MQCA 1MHCB 3DXAD 2YK1H 3LKRA 4DQOL 2M1KA 3RIFF 4WI6A 1YQVL 2HFEA 1A3LL 3HB3C 4GAJL 4HIJA 2XN9A 3MFGB 4O9HH 2EKSA 2VABB 1YEIH 4XCYA 5IW6B 5T33L 4DUXA 2EH7H 5IQ7L 1S9XB 4WFHE 5JQ6H 2XKSA 5DD6B 1I7RB 3L3KA 1DFBH 1QG3A 2OL3A 3VXQB 5I1IL 3HUJA 2XOTA 5KAQG 5MP6L 1AIFB 4KKCC 4P2QE 3O6FC 2QR0A 4PRBA 4LPTA 5F9JB 4WEBL 3DMMD 3MUGA 4LDLB 3RBSA 3ESUF 5GIRB 5EUOA 5DFTA 1IQDB 1I1AC 5DQJA 4Y5VC 3STLA 2VLLB 4RGMB 4NUGL 4WI9A 3HUJE 2W0FB 1MCRA 4JFFA 3IAGC 4LAQH 3D87B 3Q5OA 3TT1H 2XQYG 2EEAA 5EUOE 1KXTB 1FL5B 1KUMA 5L9DL 4XNMB 1J0HA 4HWBH 1MRFL 1RV6X 3CCHA 2GJJA 1JFQL 3TJHC 1XR9A 3AFLA 4JFFE 2Q76B 1OTSD 4I18B 5JA8B 3O45A 3QCVH 1T6VN 5D72H 3MYJA 2AKRA 4C83B 5DS8A 3QEQA 4P5KA 2GIYA 2GI7A 5DO2D 1E28A 1YECH 1TFHA 5CZXD 4KJQD 4UT9L 2VDML 5ALCH 2Y6SC 3EJYC 1RZ7L 3RZCC 2Z31A 4EUPB 1RK0B 3FQWB 3VWJC 1KEGH 4XP1L 2O61B 1A1OB 5C07E 3S36H 2P8PB 3MODH 1H5BC 4U1LA 1NCDL 1PY9A 4X5WB 2MSPA 3AREB 2V5RA 1AXSA 4KK8D 1P4IH 2XWBB 3GSQB 4MCYA 1K2DA 1JJUA 3OKOB 4Y2DD 2XZZA 1NMAL 3I85A 1SJHB 1I7UA 1UCBL 1CT8B 4UUJB 3QT2A 4PP1D 2J4WL 5FKAB 1S5IH 5FGBC 2DM4A 4YQXH 2YUWA 4M62H 1MPAL 2BMKA 4F15B 3DUUB 2EE9A 3AAZB 2B1AH 3AVEA 5GGVH 1U3HA 1QO3B 4P5TA 4NO5B 4ODWA 4P23A 4IDLA 3NZHL 4R90H 5LCVL 5E99H 1QSEE 3RIAF 3BKMH 1AE6H 3FQTA 1BQUA 1MFCL 4LLWA 5EN2B 2ZOLB 4MAYA 5ERWA 2DQFA 5ILTL 2NW2A 2V9TA 5E6IA 3P77B 4Y4HB 5IK3A 2EYRB 5LXGH 1WF5A 2Y25A 3RUGF 1NBVL 2OZ4A 4WFEE 1XR8A 2VL5B 2DKUA 4WUUD 5IMKB 4LSTH 3EOBB 1U8NB 4RAVA 5DFVD 5TDPB 3WIHA 3V4PL 3GFUA 4U1JA 3LD8B 4EN3A 1I1AD 5DEZA 1BM3L 4XGZA 4L8SA 4L4TA 5DHVH 1A7RL 2DN7A 3WDIA 5DEGA 1C12B 1KCUL 2IQAA 3QXAB 3RUGE 5D7JB 5E8EB 4OLWH 2ZJSH 5K93A 1I9EA 3QHZH 5SWSD 2ZCKH 4DTGH 1CS6A 4Q97A 3V4VH 2BY1A 4AG4L 4BELD 3BJLA 3LEXA 2ZUXA 5KSVB 5KG9A 2XA8L 4MJ6B 4PRDA 2VN7A 1WIPA 2K7QA 2DQTL 4KQ4L 5I19L 4Z7UB 1X5JA 4S10A 4NYLA 3WO3B 2V2XB 4OF7A 3L3GB 2H26A 4JFOB 1K8DA 5I8CA 3S36X 2QSCH 3VWKB 2NY0D 3AU1A 3ARSA 3UTTD 1R0AL 5IOPB 3JWDC 4IRZH 1NUNB 4WCYH 2EO9A 1UACL 2YD7A 4HWUA 1T3FB 3AY4C 3CZFB 2G75B 4PUBH 2NY7L 1XGTB 3P0VL 4ZFZB 6CGTA 2GEEA 5BVJA 3TO2B 1FORL 4QHLA 3MOBL 3O9WC 4ZUUB 1H3UA 2YMXH 3AS2A 4YXHH 4UB0L 4NFCA 2ED8A 4BSVB 1QSFD 5LWYL 1HN1A 1OTTD 4G8EA 4PB0H 3W9EB 3DETC 5EU4A 3VXOB 1KLGB 2CR6A 2QADD 4K55A 4BM7A 3KS0H 2VAAA 1A9EB 2QKIB 3LHPL 4IM8A 4RA0C 3T4YA 3KR3L 3MV9A 4GW1B 4I0PA 1FZMA 4Z78A 5FKPB 3STZB 1ITCA 4P2OC 5KTEH 3FO0H 3QQNA 4KY1L 5IF0A 2IFFL 4YEEA 4OF8A 4E9LA 1RJZB 4WWKD 4ZFFA 4M1CC 3NCFB 1IVLA 1Z0MA 4JPIA 4PGEA 1UCTA 4QY8B 4NZTH 3OF6A 3RWGB 4LSVL 1FFOA 1M4KA 3UROR 1QBAA 1V3MA 4JB9H 3MV9E 3WS6A 2F54B 4OV5B 4Y5XA 2HJLA 2YA0A 2QSVA 1DUYB 4R97C 5AYUL 3RJDA 3T0DA 1PZUB 4FQXB 5GRWA 1RQ5A 3Q1SL 3FJTA 3RWEA 3VH8A 4KJYA 3MLUL 5D4QA 5GGQL 4GG6F 3ULVF 4PGBB 2OJZL 5F6HI 4ZD3L 2I9LA 3CXHK 4PRNA 3W39B 3X11A 1YEGH 1UJ3C 3OXRB 4QOKA 4WUKH 3MV8A 5IEHB 5AZEL 3C5JB 4HGWB 1IQWL 3TC9A 4UINH 3ULVE 3ARBB 2R1WB 1DQMH 5EBGA 1RI8A 1MHEA 5J6GB 4NZUH 1BWMA 1IM3B 4P4KB 1G7MA 4UT7H 5DJZA 2P43B 5ITBH 3KXFB 5IHZA 3H7BA 3C60B 3GIZL 4QOKE 4UI2A 1CF8H 3H9SB 4IMKA 1G6RL 3ARYA 4MCZB 5EOCL 4X7FC 3CVHL 4FG6C 1IGIL 2H1PH 1FO0B 4ZMAT 4X83A 5DMGC 1PG7L 3ZDYE 5FYKD 4GKZA 3S4SG 4EZMA 2Q7NA 3MRKB 1MAJA 2WUCH 2ZUWA 2OQJA 2QEJA 5EA0L 1J11A 4F7EA 3FN0L 2P42B 3NACH 4RBPK 4RCAA 3OKLB 3OHXB 4HIHB 2VZTA 1IAIH 4G42A 5LKNA 3HPLB 3GSNL 3OB8A 1JCKA 5HDQH 1ACZA 5F9OH 3EZJB 3S97C 2DWEB 2WWKT 4JN1L 2NR6D 3ARED 2R56H 1CGWA 4L29A 3H42H 3CC5B 3O6ML 3G9AB 4GT7A 1A6WL 3ARPA 4YK4B 4P0DA 1J8HB 3IJYA 4HPYL 4Y1AA 3QEHB 3L1OL 5DMKA 4DCQA 3C8DA 2CSPA 3O41B 5F7MC 4FTVB 3TZVC 2M26A 3TH2T 4Z7OE 3IKKA 4PGDA 3TNMB 3O3BB 3RU8H 3L3HA 4O5LL 4M1CD 4Y88A 3FQUA 3QAZB 4FQJL 3T8XB 2GJ6A 5SWZB 1J7VR 4BJLA 1X5FA 5EU5A 2O5YH 1RIVH 1ED3B 4KRPC 1T04A 5IFHH 2BVQB 3AGVA 1A7OH 3MQIA 2WP3O 4Z7WA 4Y4HD 4UNTA 1K8IA 5HYQA 4IS6B 3GI9H 3DNKA 4PD4J 5I2IB 2BP3A 3TBSA 3H8NA 4LLDA 4KZDL 2OL3L 3V52L 2GJ6E 4LVOC 5HSFA 5F1NB 1RIHH 4WDIB 4HJ0C 3ARWA 4JFDE 4XNZB 3O4OB 5E2VL 2V5TA 3O2VL 1MCFA 4HFUL 4Z7WE 4BSJA 3CU7A 3M17B 1GPOH 4JO3L 2AEQL 4U33A 4W6WB 3N1FC 5C0EA 3LV3A 5D7JD 2CKBH 3FOLA 5DK2B 3BKYH 4UDUA 2LVEA 2NY2C 4P4KC 2R4RL 2JB6B 1N2RA 3RGVC 5LQBL 1J1OL 5CJ8A 3CH8A 1BFVL 1OAQL 4R0LA 3MRNA 3C9NB 3V7AE 3BKJH 2FO1A 4S0SD 3MGOB 1I9IL 3QEGL 4XB8A 3FOMA 1MHHA 3ZT6A 2Y5TA 5DMGD 4AH2A 3GSUA 2P8MA 3VWKD 3MRQA 3P4NA 4X9FA 3CFIC 2A74B 3L9RB 1SM3L 5ITFB 3NCJL 5KVFH 2DQJL 4ZQKB 5FUZH 1YDPB 2PYFB 3HAEA 3IDNA 5IWLA 4F9LA 2YUXA 2APTA 2X70B 4S1RL 2HMIC 4FXKB 1OLLA 3BD4A 4OM1L 5EO9A 4BH7B 4UTBH 5EIIA 5DD3L 5BV7L 3O0RH 4JFXB 5E8DL 3U46B 4PRPA 3FQXA 2D7PA 3VRIA 1T1ZA 4OKDA 5KW9L 4X4MA 4YK4C 1RZ8A 1EGJL 4JDTL 1XF2A 4U1NA 3WHE0 1YMHB 2ZUTA 3BT2H 4GRWH 5EZIH 1AJ7H 5TQ2L 1DANU 4HK0A 3T65B 4LSPH 1BZ9B 1HH9B 1ZGLP 3SBWC 2F5AH 4I77L 5F44A 1B6DA 1NGQH 1ZVHA 5IB5B 4K9EC 4J1UB 2CJUH 3TNNB 4K8RC 5FUCC 3TESA 2PW2A 5KVMC 4L4VE 4OB5H 3HNVL 3O81A 3FZUC 1WBZB 4X9BA 2CIKB 3CXDH 3UAJC 1T5XB 3OAUH 4IOIB 4HKBB 4LEOA 3CFBB 4YHLL 4P3DA 1N5YH 2PTUA 2GFBB 3O4LA 3SQOH 3CMOL 1FFPB 2OZ4L 3QQ9C 3AC0A 2X9YA 4G8IB 4JCMA 2X6MA 4M6MH 3O4OC 1LO5A 5ADPL 3D0LB 3SKOA 4TVPL 1YEKH 1IFHH 2FGZA 3DECA 5FF6B 3WIHL 1A7PH 2JELH 4K3DH 3H7LA 3I75A 4R4BB 3PL6B 1S7WB 1JP5A 1SBSH 4WW1B 5HI5C 4NZRL 4N0YH 3SE3C 1AKJB 4U3HA 3ARGC 5A2LH 2QBWA 5FYJD 3ARBD 3M8OL 1N6UA 2QL1A 4Q9RL 3S96B 4LLQA 2W0KA 4WV1C 1FNEA 4P4KD 1XGPB 4IEFB 5IB3A 4NWTL 3KXFD 2PO6C 3C60D 3H9SD 1RUAH 1FRGL 2X9XA 5C0NC 1RULL 2X44D 4U7SA 4BH8A 4NNYA 5D7LA 4LHUB 5E56A 3WIIL 2ADIB 4FQHB 3MROA 5CSBA 5E95B 2YPKA 3NFPA 4AJ0A 4YXLH 5DTFA 1CFVH 2O5ZL 3MRFB 2X4QB 1F4WH 5F7EL 1XGUA 2X4RB 1X5IA 5CSGA 4HJGA 5DJXB 4Z7VF 5FB8B 4GW5A 4M6OH 5FK9B 5ICZA 2BNUB 2JTDA 4S1DD 5D7LE 3QULA 2UZYB 4UILL 3KLAB 4UOW1 4XI5C 5HHQA 2EDWA 3G08B 1N6QL 3HC0B 4WHTA 3RQ3A 4D9RD 1RU9H 5EU7E 4CN1A 3W81A 4U6XB 3DLQR 1OSPH 3VFRA 5E1AA 3QUZB 3PGDA 4E0RA 4FQ2H 2CXGA 3I3EA 5KS9A 2JCCF 3GSRA 1LGVA 1K5NB 1J8HD 2ZSWA 5I9QC 1BGXL 3DOSA 3F5WA 3CSPA 4L4JA 4FTVD 1RJLA 1J9CT 2IBZX 5GHWL 4YHIB 3VH8G 1IGJA 2FJHB 3DVNA 4LLYB 1JWSA 3MBXH 1NDMB 2X7LB 4K8RD 5D5MF 2GQHA 1CL7H 5SWZD 3DO7A 3CFCL 1CLZL 4NO3B 5CGMA 1YZZA 3R06B 5JW4Q 2H2SC 2JJUA 3UAJD 1M7DA 1U8PA 4LSUL 4AENB 1JK8B 3WFEH 5I8OL 3OKKB 1NAMH 3LRGA 2D7MA 3SE9L 4N68A 2WINB 4HLZG 5H94B 1OT2A 4NJAL 5D5ME 5FDWA 5AUMB 3SHSA 1JBJA 1CZ8L 7CGTA 4Z0BL 5KOVC 3BZFA 4FQPA 2VXVL 2BNQB 3DHMA 1DEEB 2W0LA 2VR5A 5BS0E 3C6SA 1FYHB 3UC0H 4OUOA 5D71H 5HI5D 1M7IB 4U1HB 1KCLA 5IT2L 1KIQA 3O2WL 3D3VB 4MD5A 4XP4L 2EIDA 3QIBB 4O58H 5D96C 3NGBC 4UBDD 3ZE1F 3F65A 3TO4B 3X14B 1BJ1J 2CIIB 4O2CA 5IROC 2P48B 2VTFA 2QQLH 3GJFA 5D7SL 1MCQA 1YUHB 5BXFB 3BH8B 5C0ND 2WAHA 4G6JH 5CEZD 3DTXB 3RKDC 4WEUD 2GTWB 2DI7A 1WCBB 1P5VA 2P5WA 2G60H 4Z9KB 2Z93B 3B3IB 2E6JA 1T6WA 3HMWL 3B2UD 4OCNC 5FO8A 1QVOA 3FMGL 2R15A 2EDOA 1UM6L 4MA3A 2VLRB 4CGTA 5A40E 3BGMA 3ZYOA 3SDCB 1EFXA 3QIUC 4XI5D 4PY7B 4OLVH 2HJKA 3DUHA 6FABH 1FJ1B 2A0LC 3QUZC 2Z4QA 1J1PH 3T2OA 1Q9KB 1FGVL 3VXSB 2AJ3B 3ECBA 4IBLT 3VDCA 1S9WA 1IKNA 4MJIE 3RL1B 4NNXA 4YC2B 2UUDK 4YZFF 3OKEB 3NIDE 4EEEA 4E41E 3QDHA 1RVFH 3TIEB 1IM9B 3B9EA 5TPWL 1CLYL 4MNHA 1PY4A 4NQDA 5ECJE 3QPXH 4OAWA 4ODVH 4MA1B 4KJWD 5JO5B 1GC1H 1XH3B 4M7LH 4YZFE 3KYKH 3CUPB 2UWEF 3T09A 3WFHA 3L7EA 3PGCB 4RGNC 4NQDE 4JPVH 3VFWB 2CDFA 2OP4H 4JG1L 5IV2A 3B9KB 3CH1B 2NZ9D 2V7HA 3EO0B 4ZPVB 3SOBH 1EXUB 5IVXA 2NY5L 4DKFL 4U6VL 1U8MA 2ICES 1MI5D 2A77L 5DD5L 1KN2L 2HKHH 5EOTA 1VKXB 3WKNA 1ZKAA 1TJGL 2G2RA 5K9KB 2VUOA 1HNGA 5DUML 3KWWA 3VXRA 2V9RA 3WKML 3LMJH 4RRPA 3PL6D 4L3CB 5IVXE 3A6OA 3BN3B 4FS0A 4FXGB 1MUJB 1AKJD 2ZPKH 1KJ2A 4QYOB 4ZAKB 1DLHB 2AJYH 4PJXF 4F8QA 2MCPL 1R3KA 1QNZL 4RFEB 1GZPA 3VXRE 4HXAL 4JDVB 1GGCH 2EIZB 4P2QB 3RI5K 1XCTA 4YBQD 3KJ6H 5HVWA 4HIJB 5JIPA 4FZ8H 4LHUD 1A1NA 4XPFH 5CEYA 3MNZA 1TJIL 1I7TB 2IPTH 2APFA 5HYSA 3Q3GA 3RKDD 1ACYH 4N90E 4Y4KA 1T03L 2BVYA 1W0WA 3V6OC 3F8UB 4XPTL 3CFJA 2V7NB 5D1ZB 3WHXA 3E1F1 4BFIA 5EUOB 4HGMA 4OZIF 4QRQB 4ZSOA 5CUSH 5CGYD 1LD9A 1TNMA 1H15A 5FA4A 4RIRA 2GUOA 1R3IL 1HK6A 4YBLB 4JFFB 4J4PD 3BUTA 5ICXA 4PJGA 1ZAGA 4OT1L 2A0LD 3QUZD 1CFQB 4P57B 5FGSA 1AO7A 2QLVB 1KLUB 5MERA 5CJXA 2YPVL 4M3KB 4Q9QL 5I1JH 1TVDA 4JM4L 1I1YA 2CR3A 1BVKB 43C9A 1OM3L 4OZIE 3MCLL 1UKTA 2XA3A 1WC7A 3IU3A 3ARXA 4Q7DA 2B2XH 3RWIB 5GSVA 5C07B 1T4KB 2DQCH 3GJEA 5A16B 3VMNA 2AKRB 1RZIB 3CFKB 1KJMA 2XT1B 3O2DA 2BDNL 5D7IA 5D1XA 1BIIB 5DQDL 1WJ3A 1DANT 3MLYL 4XWGH 1FNSL 4TUOB 1NLBH 4IOSD 1T2QL 1T83A 1WISA 1AR1C 5JW3L 3EYFB 1X5HA 4OCRL 1J0KA 3WSQH 4UQ3A 1IGFL 2GK2A 1MCEA 4XXDB 4HZLB 2CLZA 3GO1L 1E6OL 4J3WA 4MZ2A 3IETA 2H45A 2E7CA 5EU3A 3VD7A 1LO0H 4B53A 1VB9A 5DC9B 3JBG7 4XC1L 2YD4A 2B5IC 1J10A 5DVNA 3SDYH 5FOBA 1QEWA 4NJ9H 2V17L 3QUKB 4CN6A 1OPGL 1A6VL 2ARJA 2BNQD 5GGRB 1WTLA 3MLRH 1QSEB 4GG8B 1MIEL 1G7PA 2AK4E 3C5SA 2Q7YB 3CSBA 1BAFH 1FAIL 4LARH 4UTAL 3D3VD 4MJ5A 3QIBD 1U8IA 4YHNA 3TO4D 4P5TB 4FOMA 4P23B 2EE6A 4UT6H 2E27L 3HE7A 1I8KB 1ND0B 4XTRD 3N85L 1FFNA 2DQFB 4MQTB 3CJJA 1OAYH 4X9IA 3U9UA 3NCBB 4PJAA 1HHIB 1ZLVK 1SJVA 1JE6A 1S7VA 1EPFA 2ARWA 1VCAA 2X40A 1XR8B 1U8QA 4QHNB 5L0QC 3KJ4C 3RUGB 5J57B 1WIOA 4J8RB 4WY7H 2VE6B 4XB7A 4PG9B 1NDGB 2VLRD 4YHPA 5GRUL 3FFCA 3SDCD 4EN3B 1EDQA 2VXQL 1HOCB 3TBVB 1QHOA 3I6GA 2C3VA 4EXPX 3I3BA 4V1DB 4TOYH 3DRQA 4X8JB 3VXSD 1T0NA 1UJTA 4CW1B 2DI9A 1KGCE 4M48L 3FRUB 2NY4B 4WW2A 1LEIB 3B6SB 4CKVX 4PJ9A 3NMEA 2CD0A 1LK2B 2P47B 2P45B 5E8OA 3ALPA 1IM9D 1HZHL 1ZEAL 1CXFA 4X4ZA 1U8KA 1B88A 4DZ8B 2E6PA 1F00I 1FGNH 3OAYK 4I0KA 1CU4H 4OI7A 5C0JA 1K8DB 5I8CB 2GAZA 5E9DD 1CD1B 2W59A 3EFDH 3TLRA 3UTPE 5IEKB 4P9HL 1Q0XL 25C8L 5AAMA 1NMBL 4OM0H 1NBYA 5EU6B 1JWUB 4JY6B 1RD6A 2Z31C 5DFWH 4N8CL 5I6XB 4ZXBA 2PTTB 1AR1D 3B9KD 2Z8WC 3CNKA 5CJOH 5BV7C 4N9GA 5BVJB 5E6ZA 3OQ3B 2HT3C 2NW3B 2X4UA 3HZMA 2X05A 1B90A 1VFUA 2ICWI 1OWWA 4GJTB 4P2CG 4G8EB 4PG2A 3CFEA 3TH3T 2C4XA 1LK3L 1D5MA 5CJ5A 3NFNB 2KZ1B 1OD7A 3ILPA 2Z9TA 4M6NL 5B8CA 2IBZY 3Q6GH 3QRGH 5EUKA 1XZ0B 4JHWL 5E5UB 3FCTB 4LU5H 4BSWB 3HC3H 3BE1L 5FIEA 1BOYA 3GMNB 4FQ1H 4ZAKD 1MCCA 1U3HC 3MRBB 3OJDA 4P23C 4WFHD 4JPIB 1U91A 1YN7B 2FX7H 5K59F 3RY6A 5EBWA 4XNQB 4P2QD 3OKDB 4MAYC 4AEIL 3RNQA 4K7PH 5DJAB 5LGHL 2HG5B 5E6IC 2WLYA 3KGRA 4KHTL 2R1XA 3CDFA 5E08L 1T0MB 1AGDA 4KJYB 1FVEA 4IRSA 4OJFL 1VFMA 5F88A 5E5MA 2Y7QA 5JOFB 3QXTA 1ZVYA 2C26A 5K59E 4JLRA 5D1ZD 5C3TA 1GRWA 2D2OA 5FYKH 1P4BH 4JKKA 1VGEL 5FM8A 4EN3C 1E27B 1Q94B 4L8SC 2R1YA 1ZLVH 5F6HJ 2XRAL 1G9NL 1MIMH 1N26A 4JFFD 5FO9A 4JEGB 5CP3H 1Y0LA 3QDAA 2I24N 2NY4C 4EUPH 5DJZB 2Q20A 4RAUA 1S5HA 3I6LE 2C3GA 3UBXA 2DQUL 4UAOB 2HT2C 4LLUA 2ICEB 3U4BL 5DSCB 4GKZB 4DAGL 3MO1A 4JHAL 4MWFA 3X13B 5C07D 4FA8A 2HLFD 2FIKA 1JNLL 4Z18A 3MXWH 3RTQB 1KTLA 4F2MA 4CJ0A 3EOTH 1DQDL 3R8BB 5J11B 3M1BA 1G9EA 4U6TA 1OARH 3C5ZA 4NKMA 2EDYA 4WI5A 1WGOA 4NN6B 2HFGH 3FHQA 1ORQB 1IZJA 3BPOB 4LASH 1GYAA 4K3JL 2DYPA 1Q8MA 3A0OA 5IB4A 4MVBD 4V2BA 1EIBA 1JPTL 1N64L 4HKJB 3FO1B 2XZQL 5ESVB 4F57H 1DBAH 2YEZA 3HRPA 2F58L 2GSGA 1NSNL 3MJ8B 3HKFA 5JXEA 1JF1B 4QRTB 3U9PH 4DCQB 2C1PB 4I0PC 3GMRB 3P0GB 1QSED 1TCMA 5IVZA 4JQIH 4DFIA 2R0ZH 4K7PX 4D8PA 4R4FL 1N0XL 3S35L 1KJ2L 2ERJB 3A6CH 3K4DA 5CMAB 2FJFA 4U1MB 1NBZA 4LCUA 4DVRL 2EDFA 4Q6IA 1AFVH 1WBXA 2SEBA 4P5TD 4P23D 1WZ1H 4LF3B 4WFED 3FQUB 3WS6C 5GZOC 2GJ6B 3OBAA 1MCOL 4XHJC 4Y5XC 4AQ1B 3WFCH 2CPCA 4JFDB 2X4SB 3QHFH 1GZQB 1P5UA 1ZLWK 3EFFA 4BQ9A 4YDLC 4GW4B 1YY8B 1K8IB 2GSIB 1MSPA 5F7LB 5K9JH 4XBEH 1P7KA 3VE0B 4A6YB 3SDDB 4XVSL 1CICA 3S5LB 4HUMB 5KVEL 2F53B 3MNWB 3TA3A 5D2NA 3CFDA 3FO2B 3OJMB 1LILA 2W9LA 2RJMA 1KG0A 3RPIB 3K7UA 3P4OA 4EN3D 1NFDF 2Y07L 3QFDB 5IFAH 1XGYL 2DMKA 3MRDA 1TZGH 2EE2A 4V1DD 4OKVB 2KBGA 2VH5L 4UDUB 5FEBA 5BO1H 2ZG3A 4WU5A 3AMLA 4IMKC 4TULL 2NY4D 5C09A 2FBJH 1I3GL 3MRNB 1NEUA 5EBMA 1G0YR 3QWRD 4I3RH 4W4NA 1GVIA 3DV4A 4PJDA 3MRCA 5DRWA 2HT2D 3U4EA 2MOVA 4JO4L 1MHHB 4O51A 2OR9L 3W82A 3BYTA 1UB5A 4PREB 1JUFB 3QDGE 4ZNEE 5GJSH 3P4NB 5C09E 3O2DL 3LEYL 4Q2ZA 3QJHA 4WO4A 5JW4M 1DUZB 4RQQB 5IJVA 5C0RL 3HAEB 4N5EC 4Y8AA 1PJ9A 4ZO8A 1O0VA 4MA8L 1I3RA 2I9TA 2ZZUT 1KF9B 5EO9B 2BRRL 3G6AA 5KOMC 2VISA 1MCSA 3VFMA 3W11D 3VRIB 2CRMA 3RFZC 3OR7B 4WWID 1RZ8B 3D85B 4NO0B 4OCSL 1A14H 2NTFA 4L4VB 5E5RB 1VENA 3SDAA 2YXFA 1QSZA 4XNUL 1I4FA 4PLKC 4V2CB 3BUYA 3C8KB 1RZJL 1SVZA 3HFML 3MV9D 4U1IA 3KYOB 3P9WB 1YNLL 2B1HL 4L3EA 2EC8A 4HIEA 1JGVL 3BWAB 4XH2A 3QQ3B 4D2NA 2A9ML 3D25A 3EO9H 4Y19B 3LS5L 4DWHA 2EICA 4D3CH 3MGAA 4KUZL 3Q2CA 2AI0H 5FM5O 4L3EE 5EOCJ 5C2BH 1T89A 4P3DB 1WZKA 2EECA 1QR1A 2CO6B 5DJ0A 1SYVB 2NY5C 1ZANH 2WUBL 2CDGB 4Y4FA 3I9GH 5A2JH 5I8EB 4MZ3A 5EORH 5F96H 5C0AA 3JTTA 5T3ZL 3G9VA 1LO5B 2D03H 4M43H 2EDHA 5MEPB 3ULVD 1FO0H 4S11A 3V6ZA 4YDIH 2PXYA 2OSLB 3MSPA 1W8NA 3TCLA 3LKPB 3WS3A 4P3WA 4QOKD 1CN4A 1MJ7L 3SKJH 2ZG2A 5C0AE 3SQBA 1A6TA 5B39A 3KPRA 4ZFGL 1A47A 3WN5A 3O8XA 3IFOA 4D9QE 4R0LC 43CAA 1UEYA 4HIXL 2I60L 4DK3A 5F97E 4BH8B 4NNYB 2AP2A 2FGWL 2YZ1A 5D7LB 5HJ3A 5GRVL 5A2FA 3DYOA 4NRYA 2HA1A 3QI9A 4HT1H 2FO4B 4LBEA 5DTFB 5KZCB 4NGHL 1DN0B 2JB5H 5GS3A 1MY7A 3RTQD 3DUSA 1DBMH 2OTPA 3Q5YA 4GW5B 5TQ0H 5IWLC 1EFQA 1CE1H 1NGWB 3FTGA 3IDJA 1J05A 4F9LC 4GRWF 4Z7VB 4N8VA 4HS6B 3SGEI 3VFPB 1H3VA 2XQBL 3ULUE 5E2TL 4D9LL 3CMGA 3VGDA 1S8DB 4LRNH 4CU6A 5E4EB 4WGVB 1MF2H 1MJJA 4BZ1H 5IGXH 1HQ4A 1ZHKB 3TJEL 4NQEE 3VFRB 1OLZA 3AMKA 3UYRL 4HJJL 2R2EA 4E0RB 4XNXL 3IJHB 3C2AH 2F9BT 4TUJA 2ATPA 2LVCA 2HN7B 1AGBA 3EKCA 4LQ1A 4PV9A 5DVMA 5J1AA 4YDVA 4ZFOA 1AI1H 2KUTA 3L95A 35C8L 3QBTB 3QFJE 4MDIA 1R3LB 4JY5L 2RAMA 2H9GB 5HGAA 4WRLA 5T3XD 2CO7B 2W65B 2VR4A 3V8CA 4OZGF 3MJ7A 4GFTB 3VRJA 1EAPA 4OZFA 4RMSA 1T20A 2CDEA 1C8PA 2YUZA 3IF1A 4QXTA 4DGIH 4BA8A 2GJ6D 2QQKH 4OFVA 2ZSVA 5FCUH 5D5MB 3T0WA 1JZ6A 4JFDD 3OZ9L 2UY7A 1ZLSL 1IRAY 1PLGL 2UZIL 1EBPA 4XVJH 5GS1A 1HXYB 5BS0B 1EHAA 2AEPH 3SDDD 3GM8A 5CILH 5FM4A 2DD8H 3FONA 1F58L 2C5DC 4ELMF 2DQDL 3O3UN 4PJCF 5F1SA 3T77B 5CEZH 4H25A 4MJ2A 3UBXG 1JN6A 2IC2A 4KMTL 1UXWA 5DJDA 5JIIA 1XF4A 2ILLA 5FM5M 3GK8H 3CLEL 4OCWH 2X4OA 4OLYH 4X5LA 1N5AA 2R4SH 1T66C 1XMWA 1KIQB 1YYLL 4S0TD 2VOTA 1OTUC 3H3BC 3MOAH 4A2MA 3TCXA 3VRLF 3SY0A 5JPMA 1NLDH 2YN3A 2ADGA 1PQZB 4XAWH 1BFSA 3BZ4A 1KCVH 1SJEA 1GOHA 1LNUA 1MFBH 1G7JA 3DBXB 1I3UA 3KPNB 1OWRM 2LAGB 1UVQA 1MRFH 3X17A 4ETQB 3BH9B 1XIWA 1F6AA 3B9DA 2AABL 2BK8A 3REWB 2EH8L 4MJIB 3JUYA 2VLKB 3C09C 3PDGA 2EZ0C 3BGMB 3MRHA 2C7UA 2CUIA 1EFXB 4E41B 4FABH 2B8OT 2VERN 4HXBH 1P1ZA 4G6ML 4HHAB 3RY4A 2JK5B 5J9PA 3RA7L 4XPBH 2P5EE 3D39A 4EDWH 2F5BH 4UOW0 4QRSA 2J2ZA 1O7VA 1ERNA 3D85D 4NO0D 3LDBB 4DUWA 4L4VD 4QNPF 3IFPB 2A6KA 5E2UH 5B22A 2BNRA 2OCFD 3B2VH 3QO1B 5CAYB 1A6AA 2VDRL 5CFHA 4MLSA 1S7SA 4NSKB 2VUYA 3PWJB 4MMZC 3EW3B 4MNHB 1TVHB 1FZKA 1W72B 3D39E 2Z0BA 1HYSC 1B4JH 3G5XA 3H9HA 5GRJL 4A2LA 2AJZA 1R5WB 3E6FB 3GMLB 3K4AA 3MLVL 2BNRE 4ORGA 1JMXA 4FFYH 4O2FB 4JQVA 3CD4A 1C5DB 3L7EB 1ZSDA 3IDMA 3FQRA 4RGOH 2UWEB 4L8CA 2BSRB 4NQUA 1AD0A 1IEAB 5F7DB 5BZWB 2MHAA 3TGXA 3BVNB 3WFDL 4HMDA 1A9BA 2AXFB 2FX9H 2YPLA 3TEUA 4N0UA 3KLSA 5EG6C 4TSBH 2HTKC 1DCLA 2HKFH 2AJSL 4DN3L 1F13A 4AT6A 3OKMA 1LDPL 3CPLA 1TQBC 4JG0L 5BJTA 4JGMA 2GCYB 1Q9WB 3PWUB 3FFDA 5IQ9A 4IJ3B 5M95B 5C92A 2Q8AL 3ZYIA 1T66D 2O5XL 1VDGA 2P46B 4NZJA 2E3VA 3HE6A 3GUTA 1N3NB 4FHBD 5D7LD 2VC2H 1MFNA 3EYSH 4B5EA 3V7MA 4TSCH 1MVUB 1EO5A 1KJ3L 4XP5H 5HYSB 3MRLB 1NBQA 3RWHB 5IBUB 5KZCD 2BX5A 1FV1B 3RVWD 3MXVL 5GRXG 4CUCA 3NABH 1W0WB 2FDBP 4ZUTA 4XBPA 3SGDI 1HHGB 3CFJB 4XCEB 5GGSA 3LH2L 4JFQB 4XMKH 3LOWA 3SO5A 3K8MA 4LP5A 1WQVT 5FHBL 1A5FL 3WMSA 1I8IB 1QA9A 1BJMA 1CE6A 1GOGA 4H1LB 3T0EA 5FA4B 1H15B 2EZ0D 2EDJA 5CD3A 1G9NC 3UMTA 1IT9L 4M93B 4JN2A 1HSBA 4OZIB 1E4XL 1ZXQA 5CJBA 1IKNC 5ICXB 1BVLB 3HI5L 5CGTA 4K3EL 3QNXA 3VU2A 4HUUA 1INDH 3T0EE 2BHUA 4FN0A 1V7NL 1U95B 1ZA3B 2Z92B 3UBXI 3IU3B 1ZGLB 2GW5A 3B5GA 5ADOH 1QLRB 4PJIF 4YX2L 5HPOA 4GRLA 2FZ3B 4HV8B 1HYSD 3L3DA 1HCVA 1PBYA 3O6KL 1EV2E 2GT9A 3U6RA 1ADQA 1EVUA 2BZDA 2EYTB 4LLVA 4ODTL 3ILQD 5F6IC 2WBJA 1E0OB 3VI4E 4KK5C 3BRDA 1P53A 3BW9A 1LO4H 4FZEL 4M1DH 4PJIE 2D4DA 4GAFB 1Z3GH 2A9NH 4LPCA 5EU3B 5B39G 3IRPX 5JHDE 5BS0D 3ZSTA 4Z95H 4GAGL 2AK4B 2IQ9H 5FYLE 4DGYH 3NCMA 2E9WA 4OGYH 3H0TA 3VXTA 2HTKD 4XWOD 1KV3A 2J8UF 5JW4R 1PKQE 3H2WA 1H3GA 3EYUL 3JTSB 5JORB 4MNGA 3I6KB 1G7PB 3ARQA 1CG9A 3O11B 2X89A 5I1CH 1WUNT 5IFJA 4DOHB 2NNAA 1U36A 3KVQA 1N7MH 5T1KB 1SY6H 4HC1A 1NEZA 3NH7H 4N8VG 2WANA 4JFZL 2CXKA 4N0CC 5L2KA 2OTUA 4MNGE 4YGAB 2GITB 4G7VL 4AEHL 3JWNC 4PRIB 3BXNA 4BFBD 2DBLL 1FFNB 5CIPB 2BY3A 1Q9LA 1CGTA 2FYYB 1DBKL 1UZ6F 5EPMA 5F7KC 3ULUL 4Y4KC 1S7VB 3BPLB 4LCIL 5DYOA 4QCIB 4BZ2H 4DKDC 1YEHH 4HW6A 5L2KE 2XZAL 3GRWH 4DZBB 2FR4B 3QP3A 3INUH 1XGQA 4MJID 2DIJA 2VLKD 1QBBA 4MDJB 4P3CL 4YHPB 3OKNA 3JV6A 2MQ0A 5I74B 4ZTOH 1EFXD 3KYNA 4E41D 2BJMH 2R0LL 5JR1H 2C3VB 5TGBB 5T1DH 1CTOA 4L5FL 3V0VA 3G6JF 3B9AA 5F89A 3QZWB 1GXEA 3FT2A 4OZFG 2JIXA 5CJXC 1XF1A 1TZIB 3MZTA 4X80H 3U48A 3ZDZE 5DI8A 2D7TH 3HMXH 5B3JE 2XKNA 1BQSA 3IU4H 5DEFB 5TE7H 5IM7B 4C57C 2DWDA 4ZFOL 5E8OB 2X2YA 1RUQL 1ZVSA 4L9LA 1MCBA 4XNYH 5FA3A 5I1HL 4NQDD 1B0GB 2JLLA 2WW8A 1ZT1B 4HLJA 1KB9J 4CMMB 4HS8L 3MV01 2GAZB 2BSTB 4ODUA 4WHDA 1MNUH 2AGJL 5D1XC 4XAKD 1IARB 4XT1C 5TFSL 4NPYB 5D1QB 2I25N 4J7RA 1T83C 2A6IB 5ISZB 4JRYA 2AXGB 3C08L 3B43A 1T0PB 4Q0XL 4H26B 4NKDA 5C6TL 1YYML 1LP9F 4OF0A 1WWWX 4OD2A 3VFUB 5FYKU 4K94L 5CJQH 3K2UL 3CSYA 3G5YA 4LKCB 3V5KB 1ZHBB 5DRXA 4P46B 4NDMB 1E4XI 4JR9L 3CFEB 2ADFH 1IAKB 2YWZA 1S78D 3HR5A 2IGFH 1ZTXH 2HFTA 5AWNH 4LMQE 4F3FB 1EZVX 1RZJC 3TWCL 4DEPB 1D6EB 3WDHA 4YUEL 1CIUA 1MREL 3V9FA 5DURD 1JNJA 1KXQE 2ICWJ 5IMLB 2X1XR 5C0GA 4X6DA 4YDKL 3VW3H 4HS3B 1J0ZA 1JGLH 2HWZH 1RZGA 2A1WL 2AV1B 2LTQC 3RI5F 1VFAA 1ES0B 4AL8H 4N90D 3HE7C 1OL0A 2XTJE 5EBWB 2VITA 5DJCA 4YXKL 3W0WE 5JA9A 5C0BE 5SX5K 2FD6H 2XFXB 3IDXH 1MAKA 1CD0A 2R69L 1HXMA 4X6DE 5T1LB 5L2JA 4NFDA 5EIVA 5LQBH 1FVEB 1BFVH 1UH2A 1MAMH 4HSQA 3ZHDA 4JLRB 1R3JB 1RUMH 3K2MC 2F15A 1XGRA 3LZFL 1XCQB 3MRJB 2PUQT 1UWEH 2F19L 3IFLL 2PETA 4PP2A 5L8KB 2KKQA 2VZ3A 5I1EL 4TRPL 3DROA 5AD0A 2BY2A 3SO3B 1VFBA 3T2QA 4HWEH 3ALXA 1Y0LB 4QTIL 3HRZB 2BOCA 4JPWL 4WW2C 1QZ1A 2ENSA 4PJ9C 1R5IB 4ZUWA 3LPWA 3WV0A 1VADA 4Q74A 1F4YL 3G6DL 1NL0H 1CR9H 1NAKL 1UWGH 5DLMH 1F42A 4Z7QE 3CK0L 1VGKA 4ZS7H 1OP5K 3WL9A 4P59H 4G6KL 3T1WA 3QUMH 3ZKMC 3P9LA 4HUWB 1OAKH 2M2DA 5J1TC 4F2MB 1V7ML 2FWOB 4PBWD 3DRTA 5GS0L 4ZXBC 3TBTB 2ZNWA 3QUYA 1WVZA 3MREA 4KU1A 5I16A 1CBVH 2WNGA 3C5ZB 1RUKH 4M6AA 1DLFL 3QH3A 4JJHA 5EBLA 2VDKH 3L3IB 1WAAA 2DYPB 3D18B 5ETUB 3DSFH 2DDQL 1XF5A 4H20L 2NXYC 4WHYG 4JKLA 3GNML 4X7DC 5IB4B 4PG2C 2AK4D 3MMEA 5KSBF 3DVIA 1F11B 4U7KA 4KROC 1QACA 5ICYA 1NMCB 3PWNB 5FAAA 5B4MC 1W0YT 1S7QA 3NA9L 4M9PA 5B8CC 4TYUA 1DQQB 1SEBB 3CMOH 5AYQA 2OZ4H 1LE5B 4K71C 4GOSA 4D8PB 4LCYB 3UTQA 5I66A 4OUUB 3IDYB 4LSRL 2IPUG 1CIDA 3BIKA 2OTWB 3CDCA 4OFYD 2IG2H 1WBXB 2N1KA 3RY6C 2SEBB 4U2ZA 3W9DA 3WXVH 5T1KD 1YNKL 3VGAC 3QHTC 3FO9B 1OGAA 4PJ5E 3PHSA 3HE7D 3QDJE 4N0FA 5D70L 1HI6B 3UDWA 3P11L 3U36B 2APWA 2VZ1A 3RKPA 1AP2A 3JV4A 4WJ5B 4I2XA 3T3ME 4IRSC 3S7GA 2DJSA 5D2LA 4PY8I 5GSRA 2R0KL 3UJJL 4U6HA 1OGAE 4XBGA 2EXWC 4OLXL 1NFIA 2DMCA 5DQ9B 3ARUA 1SJXA 4KQ3L 1L7TH 1KGCD 4UIMA 4I2XE 4ODSH 1REIA 4M7ZC 5TE6L 2Y36L 5D2LE 5HHOE 3WXWH 1LO2H 5B3NA 4NWUL 1NFDB 2YD3A 4O4YH 5FFLA 1HQRA 4LVEA 1EK3A 4EVNA 2Q1EA 3LQMA 2VKXA 3STBA 3W2DL 3QDGB 1KPUA 5J6HB 4WU5B 1M71B 3FB6A 2YD8A 3UTPD 1FCCA 4HWBA 5CP7A 4LCCA 1FL6B 3WFZA 3QNZA 2J5LC 3FAWA 1ZGLM 3DV4B 2NYYC 1ORSA 3BGFB 2FSEA 4HWNA 4AM0B 2WK2A 4QHUB 3MA9L 3J8F7 1P9MA 5FYJU 1UB5B 3PNWA 4RA3A 2XNAA 2YS4A 3ZKMD 1QFWL 2N56A 3P30H 5EO0B 1ADQL 4ZDHB 3KPLA 2Z8VC 5FYLL 5ISZD 3C5ZC 1JYVA 4JKWA 5D7KE 1V3KA 5L88L 1AY1H 1OP5H 3VXPA 2MKWA 2HJFA 1UM4L 3VCLB 4D0CA 5HYJA 4KAQH 2VMFA 3EJZC 5ACZA 2VQ1B 4HX1A 2VISB 2DQEL 3CFCH 3PV6A 1HIMH 1L7IL 4X7SH 4P46D 1MFEL 2PR4L 4X9HA 3MLZH 4Z77A 5JXEC 1CXHA 4KROD 3IKCA 3TBWA 4YHMH 3WFBL 3SDAB 2YBRB 5E0QA 1NANH 3TV3H 1WV7T 3BUYB 3VGFA 5HYJE 3KPQA 1BQHB 1KB9K 4U1IB 3SKNB 3IDYC 5F7UA 3ULVH 4I1NB 2A83B 4Q6IC 4XH2B 4RZCA 5IJKA 2G5BA 2R29H 3L5XH 3L3JA 3KLHC 3D25B 4HC1L 1TTFA 3MGTB 1JPSL 1QPXA 4GSDL 1QOKA 3QIWB 2X09A 2ZCLH 1DVFA 3UZQA 3ARFB 3DVGB 5TE4L 2E9BA 3FB5A 3BP7B 2H32B 3BEVB 1MFAL 5T1LD 3RAJL 1CICC 4MB5A 3NZ8B 3KNBB 3QYCA 4MS8D 1H3PL 4UV7H 5C0AB 1EJOL 3TA3C 5D2NC 4JZJA 2DLEA 3SJVE 1CDUA 5IMOB 1DBBL 2ESVA 4TSAH 1D6VH 3WS3B 4QO1A 1D5BB 1YC8A 3HZYB 1Q0YH 5EZLB 3VGGA 4QEGA 3L6FA 2CRIA 3NA4A 1T1XA 2CQVA 2R23A 5ACLA 1HINH 5C08A 4H88L 3WN5B 2ESVE 1X3DA 2QHRL 1INQA 3BN9D 3LEVL 3V0WH 1UC6A 5T1MA 1K85A 1R5VA 3C6LC 3AROA 3V5HA 3CX2A 4OCXH 1F4HA 4NRYB 3OB0H 1I9RL 2H6PA 2BRQA 4NQXB 4X99A 5BZDA 4TNVK 3TYGH 1IC5H 1G0DA 5C08E 1ODAA 2V2TA 1QTYT 1UWXK 3BIAX 4IIQA 4M1GL 1TETL 4JO2H 1EMTH 4WO4C 2Y1VA 4NQEB 3LN4B 3MUY1 5H37G 5DUBA 4X7TB 1YEEL 1KPRB 5DHYA 4NKIH 3C5ZD 5T3XH 1SMAA 2NXZB 2X4TA 3PWLA 1U8OA 4HIIB 4KV5F 3IGAB 3MV11 3ZKND 2DYPD 2W9DL 4JPKH 4Z7NE 1IGTA 5JDSB 3QFJB 1MCWW 3HPJA 2DJUA 4S2SA 4PJHF 1TQCB 3PWVA 3SDAC 3X3GL 2YD6A 3S6CA 5L6YH 2ID5A 1IMHC 4PV9B 1AGBB 5J1AB 2CUHA 1R3HA 2Y5EA 2C3WA 4LK4A 3BP5B 2ZKHH 4KDTA 4A6YH 1EO7A 2K1MA 4HUXA 4CVXA 2YWYA 1CGUA 1PZ5A 4KV5E 4E42A 4NRXB 1C5BH 5HGAB 2CLRA 3QDMB 5CSZA 5DMJB 3NOIA 5C0DB 1O7SA 4G80A 3BAEL 4WTZG 2KH2B 4S1SL 3MBEB 1CDGA 4OZGB 4DGVH 1AD9B 2DL9A 4PJ7A 5EC2B 4QKXB 4C58B 1M7XA 2RFXA 4NHCL 1QFWI 5A2IH 1NCWL 1T89C 3MJ9A 1BREA 1I85A 1UYWH 1HKFA 5IBUG 3ZL4L 5C7XH 2Q3AA 4MHHG 4Y4FC 5IHBA 3GMMB 4FQQA 4LEXL 5GS1B 2I26N 4PJ7E 2JJWA 2EXYD 1IKFL 5C9JB 3LSOA 1NCNA 2PXYC 1IILE 4OSUH 4RWYH 4LIQH 4F33A 2FJGB 1OT1A 5GGTH 1MLCA 4H25B 3DGGB 1EZVY 3IXTB 4H1LG 3CLFL 1AHWA 4O2EB 4XRCA 2HH0L 4LOUC 3KPPA 1UXWB 4MA7H 2Y4SA 5DJDB 5EOQL 4KTEL 1QYGL 5DRNA 3P4MB 4KK6D 1GSMA 3WLBA 1BLNA 1T1YA 1CFSB 2LAAA 2VDOL 3HAEH 3WN5C 3LRHA 3O8XC 2ZUQC 4KI5E 4AIZA 1D5IL 3QDGD 4GBXB 3UTSB 1RURH 5C09D 1CFNA 3JWOL 2ADGB 4DVBA 1DN2A 3GMOB 1DSFL 1DL7H 4NM4L 4GMSL 1SJEB 3QI9C 1WT5A 2DQHH 3ULUC 3E6HB 3MRGA 4ISVB 3FT4B 1G7JB 4QT5B 4U1SA 4GQPH 4L9DA 4JCLA 1PYWA 2BFVL 5DT1L 4Y16B 3CDYA 4HPOL 2H8PB 4ELKA 1XIWB 4YR6B 2P5EB 1Z9OA 3G04A 2OXHA 3LS4H 5INCA 2J88L 2OX5A 3ESVF 2KDGA 5INDB 5I1LA 2B4CH 5FUCE 2IH3B 3GHBH 3MRIA 2DLFL 4U7MA 2DF3A 5DQDH 4UQ2A 3VG0L 1TQCC 5E94A 4JZOB 3D39B 5LJYH 1A6ZA 4R7NA 1X5AA 1FDLH 3QJFA 2VO5A 3SDAD 2A6KB 1HSAA 5E2WL 3BDBA 1DZBA 2VXTH 2QQNL 1A6AB 2BVOA 1S7SB 1Z6JT 1FHGA 4E5XA 1DE4B 1FP5A 5IG7A 3X3FL 3IS1X 4NQCE 1PSKL 4NQVA 3G5XB 1ZV5A 4U1GB 3RX7A 5LAXB 5I1KH 4NRZA 1G7QA 4FQLH 4Q9BA 2YK1L 3RWFB 4FXLA 4R7DA 5SWQA 3GJFK 4N1CA 5MI0B 5KSAB 3VFTB 4EQ2A 5EWIH 3FAXA 3H3PH 1PFCA 4O9HL 3SCMB 3ARFD 5ESQB 3U30B 2EH7L 1MCPH 2BOBB 4K94C 4L8CB 3ALWA 2HVKA 3DJ9A 5GS1C 5JQ6L 2DLGA 5EB9A 1A9BB 1VA9A 1DFBL 1FQ9C 3F58H 4HZAA 4CL7A 4NO2B 4PTTA 2F74B 2XG5A 2XIDA 3GGWB 5C0AD 3D5OF 5DJYB 4I48A 4KKBD 2X9WA 5HHME 4NN5C 1YMMA 1J5OH 3QO0A 3BI9X 3LQZA 3QXVA 4D9QD 3GIVA 1RIUH 3MX0A 5E00B 3BPCA 3QQ4A 4LOUD 5KAQF 3QZWG 4LAQL 4WTXA 3WUWA 2CKBA 3TT1L 3C8HA 1QLFB 5GISH 1NKRA 2P8LB 1C1EH 3BO8A 5CEXA 5JZ7D 3PHOA 3OR6A 4HWBL 4LPUA 4YNYA 1IC7H 2OJEA 1YEDB 4U1KA 3VA6A 4X6CA 2XWTA 1OP3K 4NQSB 1FFQA 4GLRH 3QCVL 1U8LB 3JSSA 5D72L 1XIWC 4X6FA 3EYVA 3MPCA 1ETZB 2IWGA 3RDTA 1PAMA 1YECL 1UGNA 3T0BA 4NQED 5FDYA 5I17B 4HMEA 4JQXA 5DDHB 3UEZA 5IB1B 2ZUSA 5ALCL 5DK0A 1TCRB 2NXZD 3O3AB 4Z5RA 3ROLB 1QA9B 1CE6B 32C2B 3S36L 3VXMA 3MODL 3OAZK 4LGPB 2X42A 1RZFH 1IGYB 3QFJD 4HBCH 4BQ6A 4G8GA 3PQYA 1P4IL 4G8FB 4MHHI 1HHJB 3F12B 1T7XA 3BP4A 2W38A 4U6YA 4HUUB 3PDOB 5I15H 5I1DB 3FQNB 2IJ0C 5JLZA 2PYEB 4EOWH 4XP9H 5I75C 1ONQA 1S5IL 2R2CA 3PQYE 4YQXL 3GB7B 4L3AA 4M62L 2B1AL 5C0CA 5GGVL 5F3HB 4PJIB 3MBED 5JHDB 5MI0C 5GS0C 3U6RB 5MEQB 1BWWA 3L3OB 4JQVC 2YHGA 4R90L 5E99L 3VFVB 1LE9B 3BKML 1AE6L 2GTZA 3PIQB 1QRNA 3QG6A 1VACB 4XVTH 5ID1A 2CLVB 2FEDC 3GSVA 4G9DB 1PKQB 3BW9B 1FZJA 3MNVA 1OQXA 3PXHA 4F80A 5C0CE 5LXGL 1JGDB 4EI6B 3SKMB 3KPSA 2DIAA 3GM0A 4MAUH 4BFGA 3D1MC 4F7PA 1QQDA 3CX5J 8FABB 3PJSA 4LSTL 1I8MB 4UDTA 3H0TB 3E3QC 1E6JH 1MVFA 4KZEH 4JVUA 2J8UB 4MNGB 4LSDA 4GRMB 3B9VA 1KIPA 3KPTA 4OLWL 2ZJSL 4QXGH 3QHZL 1KT2B 4GKSB 3RGHA 1D5XB 1CGYA 2ZCKL 4P4RA 4DTGL 3LKNB 3V4VL 3U2SB 2NNAB 4GBXD 3VG9B 3ZYZA 5TDNA 1OW0A 3HE6C 3EHBD 5ALBL 1C08A 5BW7A 1NCCH 2YXMA 5GGUB 2XY2A 1HILA 5GS2D 4J3OC 3LQAH 1C16A 3HHRB 5B38B 2ORBH 4GS7C 2IALA 3HG1A 5HPMA 1D9KA 2QSCL 5DYOB 4KH2A 4Y16D 4IRZL 4POZC 3G5ZA 1UH4A 4XHQA 5L8JB 1XIWD 2XI9A 5F1IB 2P5ED 1FE8H 4PUBL 1XGQB 3VFSB 1P2CA 4KVCH 1JPFB 1W72H 4ENED 1DDHB 1BX2A 3T0EC 1FVDB 3WCYA 1JHKH 3OKNB 3DWTA 5FECB 4GXVH 5AG8A 1TXKA 3GSOA 1ZHLA 5CBAA 5DJ2B 2YMXL 2D3VA 4YXHL 1LEKA 4KXZH 3NCYP 3HLAB 4HKZB 3W5MA 5FHAH 5IB2B 3D39D 3FB8A 4PB0L 5H37H 4P2RA 1OF2A 9CGTA 3G6JB 2IADB 4I9WD 4ZOAA 3GMPA 4HF5H 2N7AA 5MENB 2RR3A 3TVMB 4EBQL 4C56E 3QWOB 4K3JH 4KJPD 4R2GC 1F3DH 2BSSA 3BZEA 5KTEL 4LNRA 3FO0L 4OGAD 4GRLC 4WVRA 3RZWA 4P2RE 2DQGH 3WJJA 5IVNA 1IC1A 3E8UH 4NZTL 5JIKA 1U93A 3VFGH 4UZGA 2JJTA 4JB9L 3U0PB 4HFWA 5KSAD 4K2UH 1A64A 1U2CA 4JM2A 2WBJC 3NIGF 3SCMD 3RWJB 1KJVA 3MCKB 3MJ9L 3QG7H 4HCRH 2DAVA 4CVZA 1U0QA 1IGCH 1LP9B 2ADJA 1BEYH 2I07A 2HFFA 3GEWB 1QFOA 2YC1A 2DB8A 4YPGB 1NAMA 4EKXA 1CQKA 1YPZF 4G3YH 4RISL 3KHQA 5HDLA 3O6FB 4YO0B 2AJXH 4PJFA 3B83A 1N4XH 1ZT4B 4N0RA 3QCTH 1JI1A 4XCCH 5HYEA 1WWAX 3V5DB 1YEGL 3BD5A 4U31A 1S9KC 2DIBA 4WUKL 1KB5B 4Y5VB 5ID0A 5FUOH 1HHHA 2IH1B 3W0WB 1L0QA 4F7CB 5HD8C 3JV5A 5C0BB 1BBJA 4PRHA 5IR1A 4UINL 4QHMA 3V6OE 2VXSH 5EIQA 1YPZE 1DQML 2NY1C 4NZUL 1RZGB 4EDXB 4UT7L 5ITBL 4H1LH 5F71A 5JDJA 1MCJA 1CF8L 4JRXE 3HC4H 3DX9A 1P84J 2X4PB 1CFTA 4F58H 5E8PA 5GRVK 3RRQA 5K9QG 2H1PL 1YJDH 3ZKXB 1JWMB 4PRHE 1U3YA 5JNYA 3VDBA 3O3DA 1RK1B 1HXMB 2YKLH 1RHHB 5L2JB 2WUCL 4JY4B 3KPMB 1MLBA 3CVIH 5DC4B 4ZTPH 3UPCA 5HGBB 4LPYA 3NACL 4GKNA 1T7WA 2EYSA 4NHUA 3BPNC 1CFBA 2A38A 2IEPA 1KTDB 1IAIL 5HY9A 4B7LA 3RZCB 3VWJB 2HLAA 1BQLH 1WBYB 4DW2L 3T0ED 2QHLA 5HDQL 1H5BB 3IXAB 4PJBF 5F9OL 3BDXA 4HWZA 1BF2A 5L8LB 1FCGA 1QSVA 2R56L 3ZTJH 3L5IA 3WEXA 5IP4A 3RL2B 3DHJA 3U0WH 3P40A 4PGJA 4RFOH 1FLRH 4HK3N 3ZT7A 4W6YB 5FO7A 3WD5H 4L9LC 2PYED 2GK0A 4LVHC 3IFNH 5SX4H 3BP6A 3BEWA 1EO8L 4PJBE 2VJXA 2QJDA 4J3SA 4WIQA 3D0VA 3BHBB 3UPAA 3RU8L 2YD9A 1DQLH 4J12A 4GRLD 1URLA 2PKDA 3QNYA 5JHDD 4ZNCD 4JANA 1CLOH 2VXUH 3MRMA 1FBIH 4JFHE 3MREB 1K3ZA 2O5YL 1RIVL 2E5EA 5IFHL 3EGSA 3I02A 1A7OL 1FG9C 3HUJF 2Q6WB 3DURB 4MQXD 3L7FA 5KANG 3LRSA 1RSFA 4MXQD 3GI9L 4QF1A 3DXAA 3WUWG 4QTHA 4M8QB 2DTSA 1NGZB 1B2WH 2BVPA 3Q6FB 2DQIH 1AQDB 3HNTH 5EUOF 1JYXA 1RIHL 1UA6H 2D31A 2BXZA 2XN9E 5IKCB 1EEZA 5CIPH 4KWUA 5KSBB 3ULSA 1S9VB 2Z8RA 3F7YA 4XCFH 1U92B 2XTJC 5C0IA 1GPOL 1F90H 3TBYB 2Z35B 3K74B 4PJ5B 1KSRA 3QDJB 2P7TB 4LLAA 2Z91A 3MR9A 2VKWA 2CKBL 5IBLC 3BKYL 2X89D 4WNQA 2WV3A 3DMMA 5HHNA 3RNKA 3BIKB 2J6EH 1ZA6A 1NC4A 4YGVA 4YDJA 2OBGA 3S3JA 5L2KD 3ZKXC 1TLKA 3BKJL 3MLTA 3AS0A 1OSZB 4KUCF 1RJCA 2OM5A 1CCZA 4QWWC 4N5UA 1AQKH 1ULVA 5JPNA 3P9MB 4NBYB 5AZ2H 2IFGA 1K4CB 2C1OA 3AS1A 3HI1A 4UNVA 3CX5K 5HHOB 3TFKC 1M6OA 4I13B 1HDMA 1RY7B 1AXTH 5KVFL 2PW1B 5EZOH 2HVJA 1JF6A 3UJIH 1V8HA 5FUZL 3ZE0F 5BOZG 3FT3B 1D5ZB 1AGCA 2X4NB 5H8DA 2RB8A 3IRZA 1HKLL 4X5XB 1BOGA 4PY8J 3QEQE 2CGRH 4ZODA 1QBMH 3P0YH 3O0RL 3O9WB 4L8BB 4IHOB 1UB6B 1X9QA 4OZHA 1EGJA 3DX6B 1FIGH 4EVNB 3K8LA 1I7ZA 3ZE0E 3JWOC 3FB6B 3BT2L 3LIZH 5EZIL 1AJ7L 5CP7B 5MEND 3TVMD 3QA3B 5F8RC 5CKGA 3QNZB 4D0BB 4LSPL 1H3WM 2VNCA 1GL4B 2F5AL 1F4AA 2FSEB 4OZHE 5H2BA 1CXIA 1NGQL 4P2OB 2CJUL 4Y2DA 3DX8A 3TIDA 2ITCB 4DFHA 5DK3A 2FEEL 4TNWK 4OB5L 3PG2A 5L7XH 3QUYC 1KIRB 1Y18A 2XY1A 3CXDL 1FZOA 3BQUA 3PDDA 3OAUL 3DX7B 5EO1A 3HB3D 4RNRA 4R97B 2A6JA 5CBEB 1G7IA 4Z0XA 1N5YL 3VXPB 4RX4D 3LKOB 4TTDC 3X12A 1IL1B 1IAII 4RMWA 3SQOL 1KCSH 5HYJB 1B0RA 1CDJA 4HDIA 5LGJA 2VIRA 3PGFH 3RWDA 5MEOB 4KKCD 4M6ML 3BMWA 3O6FD 1RMFH 2BCKB 4YAQA 1YEKL 1IFHL 1LEGB 1X4XA 1BFOA 5IMMA 2V5MA 3IKCB 3SGJA 5EZJB 1A7PL 2JELL 4K3DL 4JFYA 1UJ3B 2BC4A 4JJ5B 1NCAH 4PGZA 4OIIH 2OR8A 3VXNA 1SBSL 3W0WD 5A43C 4XCNA 3HCVA 4MQ7B 4N0YL 5ENWB 5C0BD 4TVPE 3LY6A 4MB3A 3QSKB 1YNTA 2XZCH 4L4TE 3NAAH 4JVPA 5GGSY 1H3TA 1RUAL 4CADA 3UDWC 1U8JA 1KPVA 3TJHD 1DVFB 2FLBT 3SJVB 4PLOB 4Y5YA 1MRCH 4YXLL 1A2YB 2W60B 1CFVL 5HHVH 1F4WL 1P69B 3LB6C 4QWWD 5DC0A 3SE4A 1HYRC 3OX8B 5KJRH 4P49A 3RVVC 1JV5B 1ZT7B 5EULV 4M6OL 4OI8A 4PYHA 3GSWA 3VJ6A 1FNGA 5FV2A 4EIGB 3GMQB 2Y6SD 3D9AL 3TYFA 2ESVB 3EJYD 3RZCD 4F8TA 2AQ2A 3VWJD 4XPHH 3UTTA 1L9NA 1RU9L 3R0NA 4R3SB 5F70A 1QFHA 3OL2A 4OZ4A 4YHKH 1G9MH 1OSPL 4R96A 5DJ8B 3LKQB 4ZUSA 3F7VB 5CWSA 1SEQL 2R0WH 4FQ2L 2EO1A 5C08B 1UEMA 1AGEA 1P84K 2VDNH 4NC2B 4LCCC 3P73B 3ES6A 5T1MB 1S7RA 5TH2B 1EHLH 4KRNA 3RHWK 2VQTA 4RMTA 3TZVB 1P9MC 4ONHA 5BZDB 1MWAB 3DV6A 1T21A 3MBXL 3VFOB 1NGXB 3C87A 4K07A 3SE8H 4PRAA 4LSQH 1CL7L 4EXKA 4ZUVB 4XC3H 1KBGH 4PTUB 4ZO9A 2XWJB 4KRPB 1M05B 2Y72A 4WWKA 3HNSH 1BVZA 2ZCHH 4PV8B 4G9FA 3WFEL 2FNBA 2L7UA 3S3PA 4MSWA 3HN3A 1MHCA 1TTGA 1IGMH 3WLWC 1NAML 3MUZ1 4LVOB 3RJQB 4W70A 2VABA 4G7YH 5IW6A 3PP4L 2H3NB 2AEIT 1S9XA 1HEZB 4PJHB 4AMKH 4G9FE 4U4BA 4YHZH 3ZDYF 4NP4H 4PJ5D 3QDJD 2Y06L 1AIFA 3UC0L 4M61B 5D71L 1PZ5B 3GHEH 2X1QA 2APVA 5F9JA 2CLRB 1I9JH 5IJKC 2NY2B 2P1YA 1R24B 4O58L 5GIRA 1IQDA 5HVGB 1WEJH 3RGVB 3MV8E 5HDOA 4PJ7B 2MNUA 2QQLL 1DVFC 3NCEB 2VLLA 2FEEI 1U58A 1OGAD 5C70A 3FHAA 5MHSE 2ATKB 1OOAA 5FCSH 4Z8FH 3MUHL 4G6JL 4HK3J 2MTPA 1FL5A 2G60L 1J18A 4MD0B 5HHOD 4XNMA 3BDYH 2EDNA 4JZJC 2QTEA 2ZUUA 1UENA 2DLTA 1A22B 2O26U 4F33B 3PV7A 3ROOB 1C5CH 4Q6YA 1DQJB 1K4DA 1W8OA 4I18A 4XRCB 3H9YA 2DM2A 2UYLB 4Z7OF 4OLVL 6FABL 5DRNB 4C83A 1JYNA 5KSUB 3O9WD 4NBZB 1J1PL 2P24B 5IW1B 5C3LD 3ZTNH 5CP3A 4P9MH 4BFEA 3DETD 4FFZH 15C8H 1PEWA 3LKSB 4EUPA 3D2UB 1RK0A 2L0DA 4H8WL 3OGOE 1A1OA 4KPHH 2P8PA 5JTWA 1RVFL 1WZMA 4X5WA 1TVBB 4ONGH 3AREA 2XWBA 2BHZA 4F7MB 3GSQA 4P2OD 4IIQC 3OKOA 4ODVL 3D69A 1VEOA 4Y1AE 1SJHA 3L5WB 5DA0B 1PYWB 1CT8A 3MLXL 4UUJA 1GC1L 4M7LL 3KYKL 4Z7WF 5FKAA 3GKWH 4JPVL 1S7UA 2OP4L 5INCB 3DUUA 1PDKA 3AAZA 1S9YB 4RMVA 3SOBL 1QO3A 2ICCA 4NO5A 5HYJD 4TPRH 3Q5TA 4QXUH 2R2HB 1MY5A 5EN2A 2ZOLA 1J1XH 4R7NB 2HKHL 2H32H 4NQCB 1MCLA 4PS4H 1F3RB 4Y4HA 4YWGH 2EYRA 4KDTC 4WFFD 5D6CB 3ZKQD 1HWHB 3LMJL 4HQQH 3FN3A 2VL5A 3EUUA 3UCRA 3ARGB 5IMKA 3EOBA 3G5VB 1S7TB 2AJYL 4D94A 4X4YB 3RVXC 3UO1H 4FFVC 4WV1B 1G7QB 1DR9A 1JHLH 4N1EA 1GGIH 1GGCL 2PO6B 3OWEA 1A7QH 3M07A 3SDXA 3KJ6L 1WWCA 5B38G 1C12A 1DVFD 1I85C 3HZVA 3QXAA 4FG6D 1KCKA 4FZ8L 5D7JA 5E8EA 3SJVD 2IMMA 1CL7I 4XPFL 5C1MB 1L9MA 1G7HB 1J8KA 2IPTL 4ODBD 5BMFH 4J6RH 1ACYL 4DKEH 4IMLB 5KSVA 2F8XC 2EIEA 3OGCB 2X1OA 3A67H 3LN9A 4Z7UA 3SDXE 4KI5C 2DS4A 2YRPA 5IHLB 3WO4B 1AHWC 2LABA 2V2XA 1W0VB 2A6DB 1N59B 2ESVD 3L3GA 4XXCA 1JNHA 2ICWA 4JFOA 4KHXH 5CUSL 3VWKA 3VGBA 5EFIA 5IOPA 4RBPH 3AUVA 3Q48A 4XMPH 1T3FA 3CZFA 2G75A 2X5PA 5C08D 4ZFZA 5M7QA 3QB7C 5I1JL 3QEUA 2RBLA 1NGPH 5I9QB 4PRPE 1WT5C 4ZUUA 3KLDA 4TNVF 2ZG1A 1YEJH 3TZVD 4BSVA 4X4ME 4L8DB 5JHLH 3W9EA 1IC4H 1F3JB 1MJ8H 1ZHNB 3VXOA 1KLGA 1OY3B 3BRFA 1OGTB 1A9EA 2DQCL 2QKIA 4X6FB 4HG4J 4G6FB 4NKQB 1IZKA 1NLBL 4POUB 1U6AH 4UIKH 7FABH 3EYQC 5FKPA 3STZA 4KRPD 5ANMA 5DK0B 3JXAA 1T22B 3N9GH 3WSQL 4R8WH 1NGYB 2VRAA 4QY8A 1MI5B 2P49B 3RWGA 1LO0L 3BKCH 3LN5A 3C08H 2F54A 3FL7A 4HJ0D 3SDYL 3RY5A 1DUYA 4WFGE 2AAVA 4NJ9L 2HTLC 4FQXA 2DJ4A 3BD3A 3BP4B 5ANME 4HGKC 5LBSH 5D93C 3O4LE 1ZOXA 1A1MB 5GZNC 5JLZB 3DGCR 3MLRL 1K6QH 4PGBA 5DD1H 1UXSB 4PGCB 3P4LA 2F54E 1BAFL 2VYRE 3QXUA 4ZYKB 3EDKA 4LARL 4DN4H 1BBDH 2NY2D 1GOFA 5C0CB 5D96B 3NGBB 3Q0HA 1SYSA 3RGVD 3RVXD 3OXRA 4UT6L 5IEHA 3C5JA 4JREB 5EH1A 4HGWA 12E8H 5BVPH 1KEMH 5ID1B 3ARBA 3KDMB 2R1WA 1OAYL 1XF3B 3SGKA 5F7NC 5J6GA 1UZ8B 2IPUK 2FATH 3KXFA 1UM5H 2B0SH 2LU4A 4C54A 3C60A 4F7PB 4QRUB 3H9SA 4TN9A 1SHMA 4MCZA 3WO4C 2AQ3A 1BZ7B 5GS2H 3KPOB 1FO0A 4B7IA 4WY7L 1XEDA 5EC1B 4KI5D 4UDTB 3MRKA 1FG2B 2HMID 1X5LA 5LGKA 3QIUB 1JPGB 1Q72H 5DMIH 3KXFE 4NT6B 5I30H 5KS9F 4OD1H 3OKLA 4TOYL 3OHXA 1JRHH 5BRZA 4HIHA 4M5YH 2VDQH 3D2UD 4WI4A 4WEMB 4O00A 2HT4C 3PWPB 1JGEB 2WM0A 4KGLA 2DWEA 1FGNL 2FCBA 5KS9E 1CU4L 5BRZE 3CC5A 4JO1H 1D9KB 3EFDL 3RDTC 1J8HA 2FBOJ 1JHTB 2VZUA 4JQXC 4LAJH 3FZUD 4OM0L 3O41A 4M5ZH 4RGNB 2E8ZA 4Z6AT 3EYQD 3TNMA 3O3BA 2CK2A 1ZWIB 5CJOL 4C56B 4PFEA 1TZHB 5D8JH 1J8HE 4YIQB 3T8XA 3QQ9D 4ZPTA 5SWZA 5GGVY 1ED3A 4NM8H 4NQCD 1B4RA 2BVQA 1OAUH 4NBXB 1RUPH 3U0TB 3CDGA 5D9SB 4IS6A 3V4UH 5I2IA 4NN7C 3U1SH 3BWUC 4H20H 5GZND 4CDGC 3Q6GL 3QRGL 4YHOH 5F1NA 4LU5L 4WDIA 3BZEB 3ARGD 2WQRA 4FQ1L 1AR2A 1Q9OB 2FL5B 4LDOB 1KELH 1GAFH 2RCSH 3O3EB 2UV3A 3M17A 4GMTH 4JREC 2FX7L 3MRRB 2PO6D 1HH6B 1DQTA 1MJUH 4K7PL 4PD4K 3NCYS 5T5NF 1RJYB 2VAJA 4OQ1A 3WDJA 5DK2A 5HHMD 1A6PA 3V6FB 2JB6A 2J12B 3IDIA 3NN8B 2I07B 2CRYA 4CVWA 2FB4H 3GI8H 4ZOBA 3NIDF 4EUPG 4MYWB 5JW5B 1YPZB 3MGOA 4YE4H 5FYKL 4XPAH 2DMBA 2GJZB 1P4BL 4Z76B 2P5WE 3T4AB 3VMPA 5J7CC 2R9HC 4JRXB 5HHPB 1OB1A 3L9RA 5ITFA 3MLSH 1E4WH 1MIML 5KVDH 4PRHB 5I1AB 1YDPA 2PYFA 3JUZA 1BHGA 1OW0C 1X4ZA 2DKMA 5DD0H 2X70A 5BW7C 1G6RB 4FXKA 1INEL 1I75A 3CVHB 4BH7A 4OLEA 3ZT5A 4M02A 2EDXA 4AIOA 4JFXA 2HT4D 3U46A 3WIFB 4OFDA 1KACB 4XX1G 2AJVH 3UTZB 5E9DB 1D9KC 2Y9RT 4X0KB 1P4LB 1YMHA 5FV1L 2FLRT 2QSQA 4X6EA 1RZKH 1MLBB 1T5WB 3MXWL 3PF2A 3R4DA 3ORJA 5BQ7B 2X1PA 4G6FD 3T65A 1BZ9A 1HH9A 4CNIB 3V8OA 4FQIH 3EOTL 4RFNB 4OCLC 1OARL 5IB5A 3TN0A 2VLME 5IVXF 2H2SD 4J1UA 5HY9B 3GSNB 4MB4A 3TNNA 1X4YA 2HLAB 1DBJL 2HFGL 3WNOA 1ZLUK 3S4SB 4B50A 4LASL 1FIEA 4HKXB 1WICA 4HWZB 1AC0A 4P5MA 1WBZA 3SPVB 2CIKA 2WWMC 2B5IB 5C8JB 4PJBB 1T5XA 4F57L 5E70A 1DBAL 3WEXB 4HKBA 1GJIA 4JFPB 2AV7B 1ZS8B 2DL2A 3NFSH 1L6ZA 2GFBA 4HMCA 1PG7W 1X6NA 3U9PL 3KHOA 2CRZA 1FFPA 2KQMA 4JQIL 2R0ZL 2YZ8A 1A0QH 4ERSH 5I18H 1FNFA 4G8IA 5LVEA 4WI8A 3EO1B 3BP6B 4LVNC 2MPAH 3WE6A 1BF8A 3WJJC 3A6CL 1A7NH 1K9TA 4HG4K 5FF6A 1AGFB 5C0CD 3LKRB 2JJTC 1AFVL 3QNYB 1WZ1L 4R4BA 3MACL 3PL6A 4JM2C 3HTLX 1S7WA 2C3HA 2HFEB 4LQFH 2XN9B 3WFCL 4XCYB 2EKSB 2LFGA 1AKJA 3QHFL 3THMH 3EGSB 3I02B 3S96A 3MRPA 3L3KB 5K9JL 3ISWA 4QF1B 2OL3B 4XBEL 3VD9A 1XGPA 3HUJB 4GAYA 5FGCE 3HR6A 4K3GA 2QR0B 3B4NA 4PRBB 2H2PC 5L0QB 3KJ4B 2YRLA 3MUGB 1CGSH 4LHUA 2ADIA 4FQHA 5DZOA 1NC2A 3CU1A 5JMOC 5DQJB 3K80A 3STLB 2X4QA 2WLZA 5C0IB 2X4RA 4PJGF 1S3KH 1UH3A 3QIUD 5IFAL 1MHPH 4IDJH 5DJXA 5FB8A 1TZGL 4QXWA 3UJTH 2BNUA 4GKOA 3KLAA 4ZSOE 5BO1L 1FVCA 5TF0A 3CCHB 2OI9B 3G08A 1NC4B 3HC0A 1XR9B 2FBJL 3KS0J 1FH5H 1FSKC 3PWPD 4I3RL 2I5YH 4U6XA 5JUEH 3U7WH 4J4PA 4PJGE 1AO7E 2FECL 5J4MA 3O45B 5D7IF 4CMHC 1FPTH 2UUDH 5CINH 3MYJB 5DS8B 1EVTC 3QEQB 2UVFA 1D9KD 4P5KB 5GJSL 5HHXH 1EHNA 1E28B 5DF0A 1QKZH 4RFNC 4YHIA 1I9RH 4RGND 2Z31B 2KQNA 4S1QH 1KN4H 2YD1A 1WFNA 3C2SA 3HI6H 3QUXA 4LLYA 4U1LB 5BV7B 1NDMA 2X7LA 4C56D 4G6AC 5D7IE 5HVHC 1AXSB 4KVNH 4MCYB 1K2DB 4NO3A 3LPGA 4ZOCA 3R06A 2WWMD 1A02N 4H8WC 5CKAA 1I7UB 2W92A 4M8VA 1A14L 4M7JH 1JK8A 3OKKA 2NY3C 5I76A 1I1FA 2WINA 2APBA 5H94A 4L1HA 2BMKB 3ARZA 3IAPA 3I3DA 2V9QA 3AXLA 4APQA 5AUMA 1U3HB 3TIDB 4ODWB 1GC1C 1EERB 1QFUH 2BNQA 1DEEA 3EO9L 1KB5H 1ZK9A 3FQTB 1CXKA 4LLWB 4D3CL 3ETBF 3BQUB 4MAYB 4PJAF 5ERWB 2AI0L 4ODHH 2NW2B 1M7IA 5E6IB 5IK3B 4U1HA 5C2BL 1ITBB 3D3VA 3QIBA 5F9AC 3TT3H 2GHWB 1ZANL 1CDYA 2M8XA 3TO4A 3X14A 1F02I 2CIIA 3I9GL 2BNQE 4OLUH 5EORL 3RWDB 5F96L 3CIQA 3H9ZA 4RAVB 2D03L 4M43L 1Z9LA 1FO0L 1MFDH 4YDIL 1YUHA 4LL9A 3BH8A 4P48A 4BQ8A 5BXFA 5J06A 4Q58C 3DTXA 4PJAE 4U1JB 4Y8DC 3NTCH 2GTWA 2XG4A 5J89A 1WCBA 2DTMH 4XGZB 4L8SB 4L4TB 4JRXD 3OPZH 5DEGB 2IQAB 3B3IA 5C86A 5T3ZE 3SKJL 4N9OB 3DMMC 4PRHD 4WW2F 3R8QA 1A3RH 3GSXA 4Y89A 2OI9C 3LEXB 2VLRA 5KG9B 4RDQG 3FFCE 3S37H 4PRDB 3SDCA 1SY6A 3BSZH 1I1CA 4PY7A 4W81A 4MXVE 4NYLB 1FJ1A 1CDBA 1MQKH 2LU3A 4XVUC 1S7XA 3L5HA 2AJ3A 3T2NH 2H26B 4HT1L 4MD4A 3AU1B 3RL1A 5C0FA 2XACC 2JB5L 1H8NA 5B21A 1J86A 2GYSA 3K4ZA 1KTRL 3OSKA 1DBML 5TQ0L 3I50H 1IM9A 3TIEA 5E03A 1CE1L 3GRWA 4GMSH 3WJLA 4U49A 4MXWH 1PD6A 4TUKH 4LRNL 4QHLB 5DUPH 5JO5A 5DO2C 1MF2L 4BZ1L 1XH3A 5IGXL 5CZXC 4KJQC 3CUPA 4G6AD 4ZUSB 5CWSB 5EU4B 3M45A 3PGCA 5E8NA 3C2AL 2VAAB 1AGEB 1JGUH 3B9KA 3CH1A 4ZPVA 4EQ3A 3S88H 2CK0H 3T4YB 1EXUA 1KFAH 3EIFA 3MV9B 4TQEH 4KK8C 4I0PB 1FZMB 4Z78B 1A7BA 1AI1L 2FH8A 4XPGH 4DK6A 1RFDH 4JFHD 5IF0B 1TPXB 1KCRH 4Y2DC 4ZFFB 2FH6A 1VKXA 4PGEB 2FX8H 3DV6B 4KRMB 5K9KA 2FECI 1FFOB 4WGWB 5GJTH 4DGIL 4UU9A 3BQUC 2QQKL 1FC1A 4Y5XB 3T3PE 2HJLB 1NKOA 2XN9D 5FCUL 5DWUH 3MLWH 4QYOA 4ZAKA 2DLHA 3X3FH 5F7HA 1DLHA 3RWEB 4YDLB 2VB5A 3VH8B 4PJEA 4XVJL 4RFEA 3V79C 2EC9U 1L0YA 2AEPL 4HULB 4FP8H 2I9LB 4JDVA 4LDEB 5CILL 2EIZA 4P2QA 5AEAA 2DD8L 4PRNB 1IBGH 3SGJC 5CD5C 5CEZL 1SVCP 3X11B 5KVGH 4QOKB 1I7TA 3S37X 4PJEE 3PP3K 3MV8B 5CCKH 3UP1A 1SBBA 4KMQA 4FQCH 1GHFH 3JWDH 5DFVC 1TMCB 1OCWL 1NUGA 3GK8L 4OCWL 4LRIA 4OLYL 2V7NA 1MHEB 2R4SL 3K0WA 5D1ZA 5DXWA 3MV7A 1G7MB 5IHZB 3H7BB 3MOAL 4KKLC 4QRQA 4D0DA 1NLDL 2LQRA 1NC4D 1P6FA 4XAWL 2FRGP 4Y5YC 1U58B 1KCVL 5C6PB 1MFBL 1BJ1H 1CFQA 1V5JA 4P57A 4NNPH 4XVUD 3FRPG 1KLUA 3SE4C 3MV7E 1NH6A 2OQJB 4F7EB 4KUCD 3QEQD 1QBLH 2AQ1A 1HCFX 1CK0H 2EKJA 1BVKA 4OGXH 4GH7B 4YJZL 2Z31D 4G42B 3OAYH 1K4DB 3RWIA 2NY0C 5C07A 3QXWA 1T4KA 4M7KH 4FABL 5I8KH 5A16A 1RZIA 2HT3D 3CFKA 4HXBL 1BIIA 1Y6KR 5IESH 4L29B 4TUOA 1TITA 2E7LA 1XAUA 4OD3H 4XPBL 4EDWL 5H35A 2F5BL 3EYFA 1MCKA 3IJYB 4HEPG 1LVEA 4Y1AB 1NJ9A 5DMKB 3MZGB 4KDVA 3CGTA 5F1KC 4XXDA 5E2UL 5DZLA 4HZLA 5K33A 4NUJA 3B2VL 1TPXC 1OAXH 1OTTC 2NY6C 2D0HA 1IAMA 4PGDB 4FFWC 2QADC 4LKXA 4JZNA 3L3HB 4TNWF 2AJUH 3V0AC 1NCBH 3D69B 1B4JL 3QUKA 1U3HD 3QUMA 2DKSA 4PB9H 4TVSa 4LHUG 5GGRA 1QSEA 4GG8A 5EU5B 2EDDA 4FFYL 5J12B 1T04B 1VPOH 3BQUD 4MAYD 3RPKA 2Q7YA 1B6UA 1S7UB 3A6BH 2VSDA 4OBRA 1I8LA 3QISA 4RGOL 4WWKC 5E6ID 3S34H 1MEXH 4Z7WB 5HYQB 5F7YC 3TBSB 1WK0A 2YA1A 4LLDB 4JKPH 4ALAH 2FX9L 1FL3A 2Q87A 3ZYJA 4TSBL 4TVPD 1I8KA 1ND0A 1KENH 2E8YA 5F3BA 2HKFL 5CD5D 2YD2A 1HHIA 1QRKA 4L4TD 2PN5A 4LGRB 1A6UH 5C0EB 3LV3B 3OJVC 4QHNA 3FOLB 2ED7A 3RUGA 5D2NE 3VD3A 4J8RA 1TENA 2VE6A 1N2RB 4PG9A 1NDGA 1H0DA 2KPNA 4QRPA 4PJDF 4R0LB 4RGMC 3PP3H 1HOCA 4KKLD 3TBVA 1LHZA 3SDXB 2IPKA 3C6LA 3EBAA 4V1DA 2VC2L 3EYSL 3FOMB 3HZVB 4X8JA 4TSCL 5J8OA 5HI3C 2Y5TB 1N6VA 4AH2B 4XP5L 3GSUB 4DJMA 4CW1A 2P8MB 3MRQB 4QRPE 2MJWA 3FRUA 5ALBH 1LEIA 3B6SA 1Z5LA 4MMXC 1LK2A 2JJSA 3QWRA 3TPUA 3NABL 4PJDE 3IDNB 4V1DE 4DZ8A 5IUSA 5IBTH 4I18C 1JNNL 4XMKL 1KC5H 2PF6A 1JNHB 2ICWB 1MWAH 5EIIB 5IHUH 1CD1A 2J7LA 2AK1H 4R26H 5EFIB 2VDLH 4PRPB 5IEKA 3FQXB 1T1ZB 4FNLH 2Q86A 5TF1H 1F45A 5EU6A 1JWUA 5T5FH 4JY6A 1XF2B 4U1NB 2PTTA 2Y23A 3R0MA 1KNOA 1INDL 3QEUB 3RHWF 4HK0B 5LG1A 4BKLA 1JI2A 2NR6C 2NW3A 3AREC 4X6BA 4I0PD 4X98A 4XP6H 4LPVA 5EU6E 1F6FB 5ADOL 2NY6D 2PW2B 1QLEH 3IDUA 4FFWD 4OGZA 3OF6D 3WUZA 3NFNA 4EBQH 2W9EH 5J12C 1EEQA 5GZOD 2R8SH 4XHJD 2KZWA 5FYJH 1XZ0A 4LEOB 3FCTA 4BSWA 4F15C 5ANMB 2VDPH 3GMNA 4OLZL 4PJ8A 3O4LB 3MRBA 1LO4L 2R39A 4G9FD 4M1DL 5DR5H 1Z3GL 2A9NL 1YN7A 5KBNC 4Z95L 4XNQA 3WNPA 2IQ9L 3SKOB 3LN5B 3OKDA 1F4XH 3GBNH 1Q1JH 5DJAA 4DUVA 2HG5A 4G5ZH 4DGYL 3MJ9H 4Y4HC 1GGYA 1MCNA 1ZLWH 4OQTH 4OGYL 1T80A 3I75B 1T0MA 3MV8D 4YEFA 4YFLI 2D7OA 2E7HA 4RISH 5JOFA 4GG6A 5MHSD 4LLQB 5I1CL 1JL8A 3B8SA 1FNEB 1FLTX 1A4JA 3LD8C 5IB3B 1E27A 1Q94A 1SYSB 1N7ML 3DSNA