5I1HH

Crystal structure of human germline antibody ighv3-53/igkv3-20
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
211
Chain Sequence
EVQLVETGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 211
sequence length 218
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1hH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1hH01
1MIEL 4LEXL 5IEKA 4K3EL 2VMFA 3U4AA 3RDTB 1HIMH 1GXEA 1XR9A 1NBVH 2VN4A 1I1YA 3EOYG 1XF2B 4D3CH 3R1GH 4AT6A 4XVJH 4F15C 2EE2A 2BXYA 4LIQL 3O3DB 5FYLD 1QFWL 1IC7L 3RHWK 2BX5A 2A6IB 2OZ4L 2YZ8A 4DQOH 4OZFB 3P9LB 1FV1B 1FLTX 2JF1A 3GIVA 5CGTA 4U1KB 1VERA 4R26L 2JJUA 4NFBA 1C5BH 5CHNB 3QIWC 3D69B 3E1F1 1BFOB 2D0GA 2VH5H 4G6AC 4JFQB 2O5ZH 3ILQD 1QEWB 5T5NF 3KPRD 2XRAL 5EO1B 1P84J 3DETC 3EUUA 3EOAA 1YY8A 4UILH 3INUH 1MCLA 4NHUA 3QIBD 3ULSB 5IT2H 1T2JA 1OSPH 1FCGA 5JDSB 1SJEA 3TFKC 4JPKL 3BUYB 4QRQA 3BRFA 2BRRL 3FQWA 4JFZL 4QOKD 1CL7I 2CMRL 1D5BA 2BNUA 4NO3A 2APTA 4NT6B 5MENB 4P49A 2BMKA 4HKBA 2OP4L 5M95B 2FDBP 4QHMA 2HJFA 4ODWB 1ZV5A 1S7XB 4OB5L 4U1GC 3TA3D 3WEXA 3CU7A 4XB7A 2F53A 1CDJA 2X4TB 1S3KH 1KTDB 4AIXA 3BPLB 5ALBL 2UVFA 5C07A 2FHFA 1A14L 3UBXB 3ZYIA 3ZKMD 3B6SB 3IDIA 3R0MA 5IMLA 5EC2A 1RUQL 3L5XH 1Q9LB 3NABH 5E4EB 5C0CB 5IJKA 2ZCKL 3OKOB 4M1CD 4HK3N 5ICZB 3MRBA 5D6CA 1J8KA 4J3SA 3MUHL 1UH3A 3GMMA 2HP4A 5HHNA 3MLTB 3T2OA 4ZNCD 4I77H 4X6DB 3KLAB 4FFYH 4PTUB 5HHVL 4N8CL 4RRPA 5ABDE 3PWJB 4RAUB 3QEUA 5I1EH 4UOW1 4TRPL 3OMZA 1FFRA 1RIUL 3JWOH 1A1MB 3BH9A 5CGYD 2R23A 2YEZB 1NC4B 5DA0B 2NY6B 3RDTD 4KDWA 2XKNB 4LLUB 4H26B 4PYHA 3ZDYE 1N6VA 3GKWL 1R5WB 1BF8A 1QSVA 4DTGH 2B0SL 5JORB 5ACZB 5E7BA 4XCFL 3QFJB 3OKLB 4D9QD 3PGDB 1OAZH 2BDNH 1HHGB 3RUGF 3CD4A 3LKPB 3UYPA 3EGSB 3D39A 5FO8B 3ULVC 3GUTB 2E7BA 3PNWA 5JW4M 1MJJA 2A0LC 2VLJB 1P4IL 3Q1SL 1UH2A 4X80L 4OSUL 4WW2B 5KAQG 1JYWA 1B0GB 4MNGA 4DOHE 4F37K 4X6FB 4YXHL 1G7MB 5K9KB 1HILA 3GIZL 2KQMA 2XG5A 4DK3A 1A6WL 5HHXL 3OAYK 5MEND 1ZHNA 3WKMH 1DBKH 4N0UA 5CD3B 5DRXB 4PG9A 1RJYB 3LMJH 2FO1A 1QVOB 5DQJB 2OX5A 3O45B 5EORL 2NXYC 4HIIB 5DMIH 3NFPB 5JHLL 4MB5A 4X7DC 4KZDH 3FRPG 1KXVC 1M7DA 5ITBL 1Y0LA 1FNSL 2ORBH 5I74C 4YH6A 3MSPA 5HYIA 3ECBA 3RJDA 5JXEA 3KPOA 5LWYL 4M1GL 5C0CD 1RU9L 3KPPB 5JHDB 4KJPD 3QI9C 1NDGB 1EFQA 5F7FA 1AQDB 1H5BA 3QG6B 3H7BA 4ZUUA 4KHXL 4Q6IC 5DEGA 2RCSL 1IKFH 1E6OH 4CMHC 1EAJA 2SEBA 4OGZA 3MRLB 2YWZA 5AD0A 1KENH 4RMTA 5J11C 1H8SA 4JO4L 2PYEB 4OCSL 4H8WC 1ED3A 3QCTH 1I7ZB 1R3IL 3DSFL 2XWBB 3SOBH 5B8CC 1IGYA 1U8PA 1UQSB 4ERSL 3U9UA 3MA9L 4HXBH 4JY4B 1LO4H 4NN5B 4F2MA 1TZGL 3V4UH 4Y89A 3FN3A 3DLQR 1WT5A 2NY6D 4G8EB 1FL3A 5SWZB 3RKPA 5IFJB 1ZHBA 1BQHB 4HJJH 1ZS8A 1CFQB 3IB4A 4YDLB 5HPOA 2X9WA 5EU4B 3X11B 1LP9B 1X7QA 4XGZB 3ES6B 3QFJD 4PJDB 2LAAA 3WDHA 3BQUD 2JCCA 4JR9L 5GS3A 3HZVA 1GGCL 1UJ3B 2QR0A 5KS9A 3SCMA 3R4DA 1SJHB 2VLJD 1JF1B 4X5WB 1S7TB 3FL7A 4MNGE 2ZG3A 1ETZB 3MRRB 4Z0BH 1S78D 4OIIL 3MJ8A 3MRNB 1TJGL 5HXMA 3DRTA 2EXYD 3H0TA 4Z7VB 3QWOA 4F9PA 3CGTA 3MLWL 1IEBA 1DBJL 3EHBC 1ZLUK 2V17H 3QH3A 4OGXL 2KZWA 2FX8H 3MREA 4NP4L 3VJ6A 5I16A 4I4WA 3PHSA 1S5HB 1YEGH 3HC0B 2GSIA 4YC2B 5HI4D 4BH7A 3HC4L 1WC7B 3VFUA 4CL7A 3HFMH 4OLEA 1T0MA 5I9QC 4P4RA 2R0LL 2XQBH 1FVDA 1DEDA 5HDOA 5KVGL 1LHZA 3UYRH 4WIQA 3QO0A 3ZHKA 5D7JC 43C9B 3TC9A 1B2WL 2BOBB 3GHBL 5EWIL 3CDGB 2R29H 1T1WB 2P42B 2PO6A 4IRJB 4ONGH 5CJBA 2HWZL 5DHYA 4KV5E 5F9DC 5HVWA 1HZHH 4QHKJ 5AAMA 5HGAA 2Y4SA 4HWZB 1RZKL 4HDIA 5FO9B 3EJZD 1FZJA 1X5GA 1FG2A 3WN5B 5KSBB 5E24E 5DJ8B 4HEME 4XMPH 4X4ME 4Z95H 3ZTNL 5IB3A 2PYED 3P0YH 4U1SB 3SPVA 2D4FA 4NKOA 1MFNA 2DYPA 3BW9A 4ZFOB 3BVNA 1QNZH 5DYOB 4HUWB 4JRXA 5FEBA 2VDNL 1W8OA 5ELIA 4Y1AA 3ROLA 2BFVL 1CFVL 1YNTB 1ITCA 1I7RB 2VNCA 3MPCA 1WQVT 4KFZC 3HI5H 1F90H 4YUEL 4P5KB 5SWZD 1U8NA 4NQDE 5A2KH 4WFHD 2X4UB 3OR7B 1UG9A 2A6KA 4PJCF 3IDMB 2AJYL 2HTLC 2JCCE 1K5NB 1NMBL 4LLDB 3LB6C 3D3VA 5AZ2L 4R2GC 3VWKC 2VZTA 3ORJA 4LEOA 5FYJE 3K3QA 1OTUC 3PL6C 3AREC 4PB9H 1XGTB 4O51B 4AM0A 5F7LB 1A6UL 4LSTL 1IGTB 1KJ2B 2B5IB 2YXFA 4M7LL 4M61B 1P9MA 2VXSH 4LPCA 4O9HH 1KLFA 1RD6A 1KELL 3BZDA 1XIWA 4UINH 5IMKA 1XGYL 3P9MB 2I9TA 4U1HA 5L0QB 2CXGA 3PWUB 4CU8A 3P4MA 2P43B 3FB5B 3I02B 4PJEB 2NX5E 2ZUVA 4OZ4A 2HJKA 1G7QA 4QT5B 1JGLL 3QEHB 4MHHG 4MNHB 3SGEH 1RZFH 1F6AA 1IAOB 3NFNA 4O2FB 1YZZA 1XGRA 2HLAB 5DJCB 3DTXB 4U0RC 1G6RB 1H3XA 3QQ3B 4NRZB 2FWOA 5EBMA 1S8DB 3UBXG 3VXPB 4AQ1B 2DLGA 1CD8A 3QDJE 1IRAY 2D3VA 5ACLA 1DP0A 1KPVB 4ETYA 5F9OH 3OKDA 5CZXD 3L3IA 4XMLH 1L7TH 4JAMA 1BWMA 1JNLH 2ZOKB 4M03A 4OLXH 1WFNA 4K7PH 1EV2E 1LO0H 4LCCC 5BOZG 1AQKL 1QO3A 5AYUH 4IRJD 5ANMB 1QYGL 1HYSD 1IE5A 4Z76B 4CMMA 5LGHH 3T0VA 2D31B 2C4FT 5AYQA 4QRPA 1GGIH 2DKMA 1CF8H 5T5FH 2J8UF 4XNYL 1U8HA 4EVNB 1KLUB 1MCSA 4JRXE 2BVYA 4HIJA 4KMLB 5IBUB 3NIDE 5H37G 2BVPA 4XTRD 2PR4H 3NIFE 4U33A 5DD0L 3FQTB 5ALCL 3MLRL 2M1KA 2X89D 3NMEA 5J9PB 4ZD3H 3MJ7A 1G7HB 3GRWA 1CDIA 4WDIA 2WIIB 2XG4A 4UDUB 4ISVB 4N8VA 1YEJH 4DFHA 1CD9B 1VGKB 3D3VE 3RL2B 5DVOA 1UZ6F 2AQ3A 4IIQB 3T2QA 3NGBC 3BP4B 1RUML 5BRZA 2IFFH 3QIWA 5L2KE 2YK1L 1A3LL 3VG0H 2ESVA 3TH2T 1SJXA 3V6OE 2W60A 4WI5A 1LDPL 5TDOB 1QOKA 2Z8RA 4X5XA 1ZVHA 1YNLL 4URTB 1KLGA 1AGBB 5E8PA 5CEZL 2A9ML 1HQRB 1AHWB 3TJEL 5DJ0B 1PKQA 1CICC 5J6HA 2H8PB 1U3HC 2IH1B 3S6CA 1G9NH 1BJ1H 3L9RA 2DWDB 5JOEA 1P7KB 4FQJL 3VFGL 5BJTB 2BHUA 3QDGA 4YR6B 4FHBD 4ELMF 3ALPA 2IALB 1RZJL 3D0VA 1FZKA 1DUZB 2UYLA 4PJGA 1RUKH 3EO0A 5CEZE 1JNHB 4HWNA 4AEFA 1TCRB 1J0IA 1K3ZA 4MLSA 1BOGA 2D7PA 2DQHL 4LCUA 1MRFH 3WIHL 2HRPH 2V5SA 4XC1L 3T0AA 4YLQT 1X3DA 5C0BA 1I85C 5EA0H 1D5MB 4RIRB 1HDMB 5JMRA 1IC4L 2G2RA 4Z7UA 5C08E 3GRWL 1X6LA 1YNKL 4FMKA 1MFCL 2AK1L 1UKSA 5BS0A 4JCLA 4QRPE 3ARVA 5T3XD 5CWSA 4WU7A 3QULA 4J6RL 3FZUD 1VFUA 1N64L 3EOBA 1IC5L 1JNNL 4YDIL 3BPOC 3L3JA 5IG7B 2AJ3A 2ZUQC 3RI5K 3NPSC 2OJEA 2WMPA 1IGCL 2YD1A 3UZVB 3T0EC 3Q5YA 4XPTL 1BX2A 1YN7A 3V95A 4E9LA 1UEYA 3B9VA 2XQYG 4XPGH 2QADC 5C0JA 3I75B 1K8DA 1T03L 3QPQC 4NM8H 3U30C 1NBZA 3O6ML 4JDVB 3CUPB 4C83B 4WI6A 1RK0B 4XCEB 3E6FA 1BQHG 3IJHB 4ENEC 4ONHA 4OZIE 2ADJA 4N0CD 1YEKH 1Q0YH 5BRZE 2EYTA 3ZDYF 4JG0H 4WHCA 3H9ZA 4O2EA 1J0YA 1ND0A 2ESVE 4OM0H 3V52L 3WLWC 1CBVH 2YC1A 5F6IB 3VDAA 4POYA 3L3GB 1CI5A 4XBEH 3BKYL 3LS4L 4GKZB 1PY9A 3ZHDA 5JXAL 1EHNA 1MUJA 1BBDH 1II4E 1R24B 4F57H 2DDQL 4MCYA 5F1OB 4P3WA 1PKQE 3JUZA 1MLBA 3CFJA 3WHXB 3RL1A 2OSLB 4NUGL 1S7UA 1X4ZA 2L7JA 5F89A 3ZE1E 3OKKA 2NW3B 3NH7L 1ZOXA 1L6XA 3SDXA 3V5HB 2XKSA 1OHQA 3QDGE 5C0DA 3EFFA 5E99H 1IMHC 4YEFA 1Z9SA 4YDKH 3RY5A 4KI5F 4KUZH 3HRPA 4BZ1H 4U1NA 4PJGE 4J3TA 3BIKB 4I0PC 4QWWC 1URLA 3G9AB 2V2XB 1MIML 2DQTH 3GSQB 1I3RB 4RMWA 3LKOB 1IT9L 3V7AE 2XWTA 4G6JL 4K94C 3VXSB 1BD2E 5D2NC 5I18H 3UTSA 3MCKB 1YQVH 1OGAB 2W9DH 2ICEB 4YGVB 5IKCA 3RY6A 4RSVA 4LLMB 1H3WM 3G5VB 1JZ7A 1CE6A 4PV9A 4D0CB 3O2DA 5ILTH 5C3LD 4P2OB 4P0DA 1U3ZA 1J8HE 3VW3L 1H8NA 4FQXB 5A3IC 3E6HA 1LE5B 2VZUA 4NKDB 2YPLB 1EFXB 2ATKA 2W1NA 1NCDH 4WTWA 3P4OB 4Q6IA 5JW3H 5I1IL 5INCB 1DQDH 1A0QL 4XNZB 3BPNC 4UB0L 2QSCL 1MNUL 4XPFL 3KYAA 5DRWA 1IBGH 4NQSA 3FFCB 4LVNB 5TF1L 2A77H 4UUJA 5TE7L 1Y6KR 2GITB 3MRQB 3ULVL 5DD3L 2MMXA 3MNZB 4RMVA 4WUUE 1DFBL 3DV4A 5DFVC 5B8CA 5FKAA 4EOWH 4FFZH 2Q7NA 4TVSa 5T1DH 1PZ5B 3PP4L 4LNVA 1I1RA 5EFIB 1QR1A 3MGTA 4P2QE 5IVXE 3SN6N 2JB5H 4I3RL 1RVFH 1VADA 3RUGB 3S7GA 4UT9L 3JWDH 1OGTA 2FJHB 2W92A 2YPVL 2HH0H 1LEIB 2E8ZA 4JANB 4WCYH 2NTFA 4LHUA 3GSXB 1QSFA 3LQZB 2ZUWA 3GBNL 4JM4H 4XP6L 3OSKA 4DZBB 1KTLA 3DUUA 5IW3A 5E2TH 5EN2A 4TTDD 5IROC 4X0KB 3T2PA 3KJ4B 3C6SB 2YPKB 1A64A 5GRUH 3RIAF 3F12A 3QO1A 3TBTB 1TITA 3LEVL 2BSRA 3QNXB 1JFQH 2A38A 4UT7H 3VH8A 3VXQA 4YGAB 3MLYH 5GGVL 2D7NA 3C08H 3BZ4B 3SDXE 2OBGA 4MXWL 1Z9LA 2RFXA 5C0FB 3O2DL 1A3RL 5IW1B 1BM3L 3B5TA 3LEXA 3RWGA 4O2CB 3T2NH 4S10A 1Q94B 4XP4H 1NKOA 1CFSB 1EH9A 4NYLB 5DK2A 4J12A 3S96B 3LDBB 2B1AL 3TNNB 2PTTA 1M05B 3PG2A 3PHQB 4GQPH 4MD5B 1OF2A 5KVFH 2CKBB 1KTRL 1OGAD 4H8WL 1Z0NA 1VESA 1A6ZB 1DEEB 2KH2B 4MD0A 1QA9B 4KROC 1CZ8H 2JJVA 1OAYL 1MPAH 5HYEA 5IFAL 5D7JA 5C0EA 2OR9H 4P2OD 5TFSH 3P4LA 3GMRA 3MLZL 3TT3L 1RURH 1RJLA 3PABA 3QXAA 3FB6B 4RDQF 2HFEB 4FQXD 3QDMB 6FABL 4JB9H 1MCCA 4XP1H 5FCSH 1MAJA 4M43H 4G8FA 1NCBL 3TYGL 4JKWA 1MFAH 2YPLD 3DRQA 4JO2H 4UQ2B 1A6TB 15C8L 2NPLX 4FA8A 5E5UB 1MAML 1QBML 1Z9MA 1MVUA 2WM0A 4DGVL 1I8LC 2R2EA 3GK8L 4BQ8A 2V5MA 4KV5F 1J1PH 4Q9CA 4J8RB 3ARBC 4OAWB 4YHIB 3BWAA 1I1CA 1XGQA 3ZL4H 2EEDA 5E5MA 3MACL 5LXGH 4FQHB 4PJ8B 3RAJH 2UWEF 2FH8A 2VQTA 2VC2L 5KVEL 2ITDA 2F5BL 1RHFA 1T2XA 4WFFE 1DN0A 2BY3A 4Q7DA 3CDYA 4K7PX 1GCFA 5D1ZB 5EIQA 1T20B 4NC2B 1A9EB 3EYFB 4WEUD 1VFMA 1A6VL 1TTFA 2PNDA 1X5IA 5AZEH 2OK0L 1GC1H 1EZVX 3QG7H 5TGBA 3OKYA 1G0XA 4D0BB 3PDGA 3VWKA 4M48H 4KMTH 1YJDC 3VCLB 3M8OL 4XAKE 2JKXA 3PL6A 1N2RA 4DKEL 3AREA 4PTTB 4KDTC 1PKOA 1PVHA 4NFCA 2VLKE 5ERWB 4R4ND 4QHLA 5L9DL 3K1DA 2IANE 4Q2ZA 4ZUTB 1SYVB 3D48R 3M45A 4K9EH 2FBJH 2GFBB 4N1EA 2EDWA 3BD3A 5ID0B 4JFYB 1EAPA 4OFYA 3SKMA 3BPCA 4OZGA 2Q8BL 1C5DB 1B88A 3FT4A 4C55A 4FS0A 3BMWA 3HPLA 3IDNA 3WYRA 4KPHL 3MRFB 1YEIH 3IFNH 1ZAGA 4FQCL 4L4VE 3N1GC 4PR5A 2XWJA 4LVEA 3TCXA 3TIEB 1SBSH 4JZJB 4RWYH 5DGRA 2WZPD 3HAEH 3CXHK 2F54B 5F7UA 3VMNA 4YQXH 1C16B 3B3IB 3O41B 4PBWD 5GGQL 3T4AB 4E0RA 2HRLA 5F6HI 1UXSA 3EDDA 3N1MC 1RIVL 1TPXC 3MLVH 3WL9B 3RPIA 3JTTB 4WU5B 4LCCA 2VERN 2X4QB 5MEOA 4B5EA 1ZANH 3QDMD 4M5YH 3WUZA 1ZSDB 4HC1H 4R8WH 3RVWC 3WV0A 3D0LB 4LVOB 2IG2H 2VDML 4PJHE 1BREA 4UNTA 4G6ML 2HN7A 2Y5TA 3RY4A 3SKNB 4L29A 4LNRB 2XNAA 2LAGB 4YHZL 3V6FB 5D6DC 3RZCA 2WAHA 3RNKA 1IM3B 1M7XA 1YMMA 2ZUYA 3O4LE 4PJCB 4RMQA 4PJ8D 3HNVL 4P9HC 1BAFH 1BGXH 1HH9B 2DI7A 4GRLB 4PJXF 1AO7A 1NDMB 1UM5L 3LKRB 1UWGH 3A67H 5FYKL 3GJFK 4ZNEE 1HHIB 1PEWA 3PHOA 5D1ZD 4LCIL 5GRVK 1F3JB 3E8UL 2AJZB 5FF6B 1I8IA 4L1DA 1WICA 4I18C 4WNQB 4KVCL 3LQMA 3QIUB 5DRZB 1TQBC 1LE9B 4NHCL 5I19L 4LBEA 4KRNA 1F97A 4YK4B 1M1SA 1S5IL 4KJYA 5T3ZL 1FLRL 2G9HA 3ARQA 4JY6A 1CICA 4XCCL 3MLUH 5EBWA 4EI6B 1A1OB 4H1LA 1U3HA 2XV6B 5DJXB 4OUUA 2E27L 5TPWH 2VXVH 3MXVL 2D7OA 2VLMD 3SDYH 2Z91A 4GRWE 4OZGE 1OP3H 3QIBC 1JZ5A 1S9YB 5K9QG 5JLZB 3KYOA 4MB3A 5EBLB 1GIGH 4ONFH 1LEGA 4HFWA 1AJ7H 3DVGB 3LKSA 5GJTL 4XH2B 1LWRA 4X98A 3CAFA 3UEZA 5IFHH 1T7ZA 2YA1A 4YFEA 4PGEB 1G7IA 3X14A 5FA4B 5EU6B 4UOJA 5KVMC 2Y6SC 1G0DA 3IJYA 4MA7H 1O7VA 1UA6H 4JFPB 1E28A 3TA3C 3UROR 3L3KB 3OAYH 2F8OA 2F54D 1N6QH 3GSWA 1I85A 1TTUA 1MIEH 5FHAL 2LQRA 3ZT7A 3CFBA 3ZLQC 4K3EH 5I1LA 3ZKMC 4NQVB 4W4OC 4L4TA 5SWSE 3MGOB 3ZDZE 4UTBL 3WFEL 2H9GA 4RMSA 1TETH 4I2XA 1FN4B 4DGYL 3BH8B 1L9MA 4RX4A 1QFWH 1IC7H 3PIQB 2DD8H 2OZ4H 4NC0B 3REVA 2DN7A 3VI3F 4JFOA 5IWLC 4H25A 1Q0XH 5JR1L 4S0TD 4C4KO 1DBBL 3T0EA 2IH3A 4U7MA 1B9ZA 2VDKL 5J1TC 3N1FC 5J7CC 4XVUD 2ATPB 1JE6A 3Q5OA 1AO7E 4BK4A 2IWGA 1A22B 1L6ZA 4F33B 2XRAH 3VXMB 3CVHH 5HJ3A 2O93L 4GRLD 4NO2A 4HUVB 4P23D 5CGYC 1MCFA 4WO4B 4OCWL 5IGXL 3RWEB 4QGYA 1S9KC 3RDTC 3S36L 4LDLB 3K74B 4JPKH 3QA3A 5FDWB 3MA7B 1SVCP 4H88L 1GGTA 2CMRH 1IAII 4XWGL 2FSEB 1J87A 5EOTB 3TBVA 4OZIF 3STZB 2OP4H 5EIVA 5C8JA 4WHYH 1OD9A 2VKWA 1SEBB 3QIUD 3D2UB 4OB5H 2F5AL 4ELMB 3STBA 3FFDA 4KK5D 4QYOB 5ALBH 3VD9A 4X9GA 5JTWA 4CUCA 1A14H 2Z31B 2R0ZL 4FFWC 5HBBA 1HSAA 1U8QA 2X4NB 4B7IA 4WWKC 1DQLH 3IJSA 5DXWA 3UTZB 3HR5B 4PRNB 2WP3T 5EUKB 4X6CF 3VGFA 3ZT6A 1C12B 4KVNL 2X05A 4U7KA 5TE6L 4I0PA 3SGJC 1P53A 3MRDB 1VFBB 32C2B 4EIZC 1RJZB 4NNXA 5D2NA 4QEGA 1ADQH 5HGDB 1WIPA 4EDXB 2BCKB 4R7NB 5EU6D 1RK1B 4HS3A 4XBGA 1JZ4A 4GFTB 1U8IA 3EDFA 4ESKA 5HHVH 4UZGA 4XMKH 3L5HA 1F6FB 4M6ML 5TH2A 1U6AL 3UO1H 4TRPH 4Z7QF 4L4TE 3BPLC 1RIUH 5DJZB 1P1ZA 3T1FA 5DHVA 5E8DH 3U7WL 3NOIA 5EUOE 1DZBA 1X5HA 2Z4QA 4XP5L 4MJIB 2Y25A 4X8XA 1A8JH 1T1YA 1DSFL 3GM0A 3O3AB 5E4EC 4HWBL 1B0RA 4YBHA 3GKWH 3SQOH 5D9SB 4KJPC 4JHAL 3SJVA 2VE6B 4ZUVB 2B0SH 1PLGL 5ACMA 4XCFH 1P6AB 3RWFB 4ZSOE 4TUOB 5FHBL 2CK0L 2KDGA 3DECA 2RBLA 3VDCA 4MAYB 1Q9WA 4NC1C 4E41A 4PLJC 4LCYB 3IFOB 1S7WB 2EYSA 4ZOCA 1VACA 5IHUH 2XACC 2J7LA 4NCDA 2YD9A 5F7DA 3Q1SH 5CLWA 1NGWA 1U95A 5DQ9A 5I8CA 1N5YL 5J1SC 3ARDB 1JHKL 5GGSY 1FGVH 1ZGLA 1YEHL 3EOTL 3UC0L 4PRIB 3VGBA 3VXMD 1P7QA 2Q7YA 4PJFF 5IVXF 4MCZA 3X3GL 4BA8A 4WO4D 1GZQA 4NM4L 4YXHH 3RVVD 3WFDL 3ESUF 3GHEL 1C08B 2JK5B 4ZQKB 3BEVA 4JFXA 3GIZH 3QPXH 5IROA 2B7DT 5DD6B 4EN3B 1HQ4A 2JLLA 1A6WH 3BE1L 5HHXH 1SYSB 4K94L 4Y19B 4JGMA 5DI8A 2ZSVB 2APXA 1Q9OB 3VFSB 4MA3B 1WF5A 1C5CL 2FJGB 1NMAH 3CSYA 3D2UD 4IDJL 1ZLSH 4PJBE 3V4VL 4ZFFB 5JHLH 1CXFA 5INDA 3NFSL 1KN2L 1MFBH 1FDLL 1FNSH 2Z31D 1S78C 4G9FA 4JQXC 2ID5A 5EZJB 3K4ZA 3KPLB 2I07B 4QHUA 4DKAA 5J06A 3KPNA 5LWYH 1M6OB 2F58L 2ICWA 1RU9H 5JW4N 3QWQB 1TFHA 5LKNA 4MQSB 4KHXH 2RCSH 1P4LB 1H15B 3K2UL 1A2YA 5MEQA 3U4EB 2Q6WA 4JO4H 2OTWA 2D0FA 4LU5L 5FV1L 3MV8A 5HI4C 1JRHI 2X4OB 4UTAH 1R3IH 3VFMB 4E5XA 2W0PA 4ERSH 3HZMA 3MA9H 4UMGA 5JIKA 4MVBD 1GOHA 2AW2A 2N4IA 3RBGA 1LQSR 5GGRA 3UPCA 3SJVE 3OHXA 3UJTL 1D5ZA 2LABA 4MJID 4YNYB 3LV3A 2ENSA 4P2RA 1EEQA 1ZT4B 1I8LA 3AAZB 3LRGA 1MCWM 3U7YH 3EJYC 1CU4H 3BOVA 3NCJL 1F11A 3PGCB 3KLHC 1FO0B 4E41E 1NMCB 5EO0B 4XPHL 2FYYA 3ARBA 2E6PA 5K59E 5IOPA 3EJZC 4JR9H 1JGVL 4MAYD 4F7PA 2YUZA 1S7VB 4HIXL 2R9HD 2FRGP 2GJ6E 3P4NA 1ZLWK 3ARDD 3BGMA 3FB7B 2GCYA 3K7UA 3QUMA 4OIIH 2FO4B 4Z77A 4JFFB 1SQ2N 4U3XA 4PRID 5B38B 3T3PF 2CIKB 1TJGH 1W2KT 1UVQB 1CQYA 3IKCA 2M2DA 1EIBA 4NN5C 3TP4A 2V7HA 1F4AA 2X4RA 3SE8L 3OJ2C 4NQXB 4BUHA 1U92A 4MX7A 1R3HA 4PREA 5E8OB 3WCYA 1W0WA 3WFCL 1NGYA 5DJAA 4HZLA 3UPRA 4NP4H 4OLYL 2BHYA 4EN3D 4KDTA 2NNAB 5LG1A 4Q74A 4YDLC 4CDHA 3AXLA 4KJWD 4Y19D 1I4FA 4X99B 5CZVL 5DVNA 2HFFB 3W39B 2W38A 4KI5D 2EZ0D 3DJ9A 4MMZC 4NUJA 2CLVB 1UJ3C 4Q0XL 5F88B 3FCTB 4G9FE 2NW2A 4TNWF 4QXTA 3HUJF 2BSTA 2ZSWA 5IEHA 5MERA 2FB4L 1KIUA 2V2TB 5KVGH 5D7LE 3DXAA 2VQ1B 4H0HB 3FTGB 3OGCB 3VA2C 1OAKH 1B2WH 3T09A 2C4XA 3GHBH 5EWIH 1BIHA 4LASL 1NC2B 4PP2B 4TUJB 1V3LA 2DMKA 1ZVSB 4Y2DB 3NZHL 2HWZH 4NO0A 5GHWL 5GGUB 2MHAB 4WENB 2IBGA 3MV8E 2FNBA 2CIIA 1RZKH 2FL5B 3GI8L 4RFEB 5FDYA 4YC2C 4WFGD 1PG7L 1CGTA 1AP2A 5LCVL 1A4JA 2P5EA 4HWEL 1NGZA 3MBXL 2XFXA 2ZUUA 2BOCB 3IDJB 3C9NA 4I0KA 4NGHL 4P2RE 3QUML 2F74B 1CFVH 3A6BL 3QFDA 4TOYL 3G6DL 2UWEB 3DPBA 3GBLA 4PJ7F 3WNKA 3IDGA 1MCHA 3RHWF 3WO4B 5I1JL 5I1AB 1YJDL 4IRJC 1NMBH 1HYSC 3HR6A 4K7FB 3ILPA 3V0WH 4PJIA 5D6DA 1DBML 4NBYB 4PJHF 3C60B 4KUCD 3V5KB 1T3FB 4R7DB 1BVZA 2GAZB 2IPKA 2QKIB 3WN5C 1JWSA 3BFOA 4P4KB 1A7NL 1A6UH 4P5MA 1T5WA 4NQDB 4LSTH 3UTPE 1AXTL 5KJRL 5MEPA 2Z93A 4N1HB 4XTRC 3VXOA 25C8L 4EUPH 2V9RA 4M7LH 4XZUA 1JWMB 4JFFD 4NZTL 1T1ZB 1XGYH 4I18A 2WWKT 2DQEL 43CAA 1EEZA 5ICXA 3EKCA 4Y4FB 1KEML 4LSUL 4YE4L 1U8JA 1JGLH 3TCLB 3LSOB 2NZIA 5DJDB 1PDKA 2B1HL 4YBLB 4FTVB 1DL7L 3KPRA 4CW1B 3DXAE 1WTLA 3HPJB 1VCAA 5LBSL 2BVOB 3QIBA 2VDOL 2NX5B 2IBZX 2DIAA 4I5BA 4CADB 1DLFH 3EYOA 2CLRB 3BI9X 4MDJB 3MBEB 4QCIA 1FNGB 5JNYB 4PLNC 4HIHB 4QOKA 4TVPH 1E0OB 3W9EA 4BH8B 1A7OH 3MLSL 3CK0L 3G6AB 3O8XC 1NFDE 3CZFB 2EEAA 1NC2D 5L0QC 4Y2DD 1LMKA 1QYGH 3QSKB 3QDJB 4B50A 2X10A 2AEQH 3ARWA 3KLDA 5FGCE 3TA3A 2FR4B 1WSST 2COQA 4OCRH 3OXRA 1GHFH 3EYVA 1PX4A 4XNYH 1AGFB 4I3GA 4CNIB 2KQNA 4OV5B 5MP6L 4P59L 1NEZG 1P2CA 4ZUWB 3V79C 5IUSA 4P9HL 5C0GB 4W4OA 3QAZB 5HPMA 1FZOB 3D18B 1KYOJ 5KSUA 4XI5C 1LO5B 5DD0H 3S88H 5ALCH 3MLRH 4F7CA 3GSOA 3TJHC 3CDFA 2P7TA 5DJ6A 3F7YB 4IEFB 4Z7NE 1WLHA 1N0LA 3ARPA 1PW3A 3ZDZF 3QNZA 4TTGA 1RPQA 4PJXB 1OVZA 3UTTE 2NLJA 1RUMH 4PJ9D 4PIRF 3FZUC 2EDLA 3WO3B 3QUZB 1YY9D 4AQOA 1A3LH 4FXGB 5DTFB 5EZOH 3C60D 5IV2B 3LOWA 5DK0B 3NCMA 5D7IA 1E4JA 1PYWB 1K2DB 4XXCC 1UWXK 3MRJA 5FCUL 4Y7MA 3WS3A 1LDPH 4HSQA 4TVPE 3U0PB 5I1CL 1YNLH 3CSGA 4P4KD 4NQDD 3RDTA 3T0DA 5FYLE 3ARRA 1XF2A 2DTMH 3CMGA 4ZTOH 3VFGH 2BVQA 3O3DA 3KDMB 4K3DL 5FYKU 4KK8D 4NZUL 2HKFL 2A6IA 5KANG 4OZFA 3P9LA 1FV1A 4N0CC 2ZPKL 2DTSA 5I30L 1CQKA 1RZJH 2JELL 4Y4FD 3HMXA 5FUZL 4U1KA 4IIQC 4RGOL 1DUYB 2AXGB 5CHNA 3D69A 2AV1B 3ZKND 1BFOA 1X5JA 4A6YH 5C0ND 4JFQA 5GISL 2DQHH 1BWWA 2A1WL 3WIHH 3G5XB 4FTVD 4WWKA 4NPYB 2F8VA 2G60H 5EO1A 3QRGH 1RULL 4XC1H 2P4AB 5FXCH 4QOKE 4W81A 5ADOL 2NX5D 3B43A 3RX8A 2OM5A 3SDDB 5JDSA 3SGJA 5I2IB 1HWHB 4FQPA 3VD3A 3BUYA 4S1RL 5BQ7B 1MJUL 3QEGL 3MBED 5D2LA 1IC4H 3S4SB 3GRWH 3VFRB 4NT6A 1YNKH 5MENA 4AEHL 3BD5A 3S35X 3TT1L 4L3EE 4ODWA 1KIQA 2DMCA 2AQ2A 4NNYB 3QXVA 3QDJD 3VXNB 1FIGH 1GAFL 4L5FL 4F8TA 1S7XA 2E6QA 5SV4A 1PD6A 3S97C 1ORQB 1U9KA 2XZAL 2X4TA 1IGCH 1KTDA 1EPFA 4ZS6C 4KKLD 4XPTH 5C08B 3UBXA 3B9KB 3DBXA 3B6SA 1T03H 1KCKA 1LO2H 2XPGB 1Q9LA 2EDJA 1MRCL 3BSZL 5C0CA 2X1QA 3O6MH 3OKOA 2VXUL 5HDQH 4P3CL 5E8EB 5ICZA 5EUOF 4N5ED 1F13A 3HE6B 4L8DB 1NANH 3RVXD 1BP3B 1FVEB 1GZPB 2YS4A 3BP6B 3GGWB 3V52H 3GJEA 2FBOJ 4X6DA 3BKYH 3KLAA 4X4YB 2FGZA 3HMXL 4PTUA 5JXAH 1T2QL 3PWJA 4RAUA 2DDQH 3G08B 5F93C 2W91A 2AGJL 1CLOL 4OZIB 1A1MA 2IPTL 3MRHB 3RWDB 1ZMYA 3FQXB 1J1XL 3NH7H 4Y16B 1MJ7L 2YEZA 5B38G 1NC4A 1QBLL 2QQKL 3MV9D 3NA9L 4WI8A 2XA8L 5I8KL 5CS7A 3WDJA 2XKNA 5I1DB 4H26A 4DN4H 4GO6B 5BVJB 3AS0A 5EOCJ 1R5WA 4HGWB 2GTWB 2CUHA 3LN5A 1BLNB 1MCPH 1EHAA 5JORA 5ACZA 1L7IH 3OKLA 1IT9H 4PGDB 1UM4L 4G6JH 4X6CB 1KT2B 3O6FB 3PGDA 4TTDC 1HHGA 3LKPA 5F6IC 3EGSA 5BOPA 1V7NL 5FO8A 3GUTA 3QZWB 3BZFA 4X9IA 2VLJA 3K81A 3QJFB 1UZ8B 3O0RH 4LSSH 1A7BA 2C3WA 5F3HB 4WW2A 2CRZA 4JQXA 4PJBF 5DJ2B 1B0GA 4QF1B 3VW3H 1ZK9A 5KBNC 3P73B 4WJ5B 4R90H 3SDDD 5MENE 3BGFB 5K9KA 4LHQB 3SE3A 1ZT7B 5I1IH 4EBQL 4ZO8A 4UB0H 2YKLL 2QSCH 1MNUH 4RDQG 3C6LB 5CD3A 5DRXA 3WLBB 5TE7H 1INEL 1RJYA 1ZA3B 1TENA 3ULVH 2M8XA 1QVOA 3L5WB 4X4ZA 3O45A 4GW4B 4ZTPL 4HIIA 3NFPA 1IC1A 5C0CE 4HJ0C 4BSVB 3B9KD 4P2OC 3IETB 4UT9H 2J8HA 3WIIL 2YPVH 3H8NA 4FQXC 5JHDA 1WTGT 2ERJB 4P48A 1NDGA 3GBNH 4NC1E 3KVQA 1AQDA 4HKXB 5FOBB 3QG6A 2A9NL 4XP6H 3HE6D 5KSAC 5GRZA 4P2QB 4HG4J 4PJFB 3MROB 4XNZC 3MRLA 5IVXB 1HHHB 2HKHL 2BVTA 3FT3B 3QP3A 3BX7C 3I9GL 4LVNC 1I3VA 2OCFD 2PYEA 3IXTB 5GGVH 2VZSA 1I7ZA 4LCWB 5J89A 4HF5H 5JA8B 4ZS7H 2XWBA 5CJQL 1UQSA 4LSVL 3R8QA 5JZ7D 1OT2A 4JY4A 3O2DH 1A3RH 4Y16D 2OJZH 3U0TA 1BM3H 5GRWA 4X6EB 1DDHA 4G8EA 4G43B 5SWZA 5IFJA 3PWLA 1BQHA 3QFJE 1CFQA 4PG2C 4Y2OA 3VGAB 3O3BA 1VHPA 5IBLD 3F7RA 2B1AH 4HPYL 1LP9A 4XGZA 3ES6A 1P69B 4WW1B 4PJDA 1I7TA 1GJIA 2O5XL 2ITCB 1KB5H 2Z92A 3UZQA 3O6FD 3QRFM 3KJ4C 4M02A 5F44A 1UJ3A 2JE8A 1TQCB 1SJHA 4H8WH 4X5WA 1JF1A 4Z7WF 1S7TA 3TYFB 4R4NC 1ETZA 3MRRA 3CX5J 1OAYH 2W9EL 4LGPB 5IFAH 1K6QH 1CWVA 5K33A 2F19H 3MLZH 2VZ1A 3TT3H 3HG1B 4CAGA 4Z7VA 5ADPL 3SKJL 2AI0L 4GKOA 4LK4A 6FABH 1HEZB 3TYGH 2RIKA 2I26N 3IRPX 5TQ2L 15C8H 1KEGL 1MAMH 4QXUL 3VD7A 1S5HA 3LDBC 3HC0A 1WJ3A 3C6LD 1B4JL 5BVPL 2J88L 2UUDH 1WC7A 3GO1L 4MJ6A 2J4WL 1NAMB 4V1DE 5IQ9B 4LGRB 1A6AA 2EDQA 1T1XB 5GGVY 2VC2H 5KVEH 4UV7L 1JPTL 4O58L 4YHPB 3NIGE 43C9A 1WZMA 4N0RA 4PV8B 4R4BB 3V0AC 2BOBA 1A6VH 3CDGA 5GIRB 1T1WA 3IFPA 2OK0H 1FQ9C 5IM7B 1A4KB 4IRJA 4NQCB 4JFEB 3ESVF 3KLSA 5I1KL 2YUXA 4HWZA 1EJOL 3M8OH 3DI2B 5FO9A 4D9RE 3ZYZA 3QDAA 4DKEH 3WN5A 5KSBA 5DJ8A 3ZMRA 4OF0A 3DVNB 4U1SA 2PXYC 5L9DH 1IQWL 4LCWD 2CR6A 4ZFOA 4YFLF 1FH5L 1EO8H 4PJ8C 4HUWA 2X89A 1NCCL 5FO7A 5SWZE 1U8LB 4WFHE 3OJVC 1YUHA 1T22B 5BZDB 4LDOB 4LF3B 5D1ZC 2FX9L 1I7RA 1MHEB 2BNQA 4HFUL 2VITB 4OD2B 2ED8A 4TN9A 3FN0L 3D9AL 2Q8BH 2VLKB 2X4UA 3OR7A 4PJDE 2V2WB 3HUJB 3IDMA 4U2ZA 5IB1B 3IVKA 5I75B 4L8SB 4KPHH 3U4BL 2IANB 2AAVA 3MV01 4FQCH 2C1PB 2ICWI 4KGLA 1ZWIA 5I73B 4PLKD 3B9EA 2UY6A 4GBXB 3SY0B 2FECL 2IGFL 1XGTA 2NMSA 2H32B 4O51A 3GMLB 1MQ8A 5GGQH 1IGTA 1KJ2A 4BQ9A 4OGAD 3VFNB 2HT2C 5DD5L 4M61A 5GJSH 5F71A 2ZWLT 4L4VB 3JV0A 4KC3B 1SM3L 3HG1D 4HS8H 3UDWC 5I1HL 5GZND 3QCUH 3S4SG 3P9MA 3O8XA 3WIFB 12E8L 1DE4B 3PWUA 3I02A 1GVIA 3FB5A 4PJEA 4YZFE 4ZXBC 4M7JH 2VDMH 5E08H 4J1UB 1OB1B 1KCVH 5FKPA 1NFDF 1GPOL 3QEHA 4MNHA 4G6MH 4QT5A 1KULA 1IAOA 1ZA6B 4O2FA 4LP4A 2HLAA 1EEYB 3EIFA 4TNVK 5DJCA 4YHZH 2EIBA 1G6RA 3WHE0 3RI5F 3QQ3A 4PJ7B 1YYLL 2W0FA 4JZJC 4NRZA 5CUSL 4XWOD 1S8DA 3VXPA 3B8SA 3RTQB 4MQXD 4R3SB 2YRZA 1KPVA 3QBTB 4PJHB 1UM5H 5FYKH 3CFEB 5DVLA 3WNOA 2APWA 4LCIH 4YFLI 3NAAH 2FEEI 4BKLB 4F7TB 4OIAA 4NQCD 4JFED 5D8JL 4DCQB 4Z76A 4F58L 4IRSB 2FLBT 3KG5A 4LVOC 4RGMC 5KSBE 1NGQH 2D31A 1UKQA 4OGYH 5C0IB 4XXCA 4WFFD 4EVNA 3VFVB 4NHCH 2VAAB 5I19H 1KLUA 2D9CA 4LPUA 5T3ZH 3MZGB 4RAHA 4XVUC 2DL9A 3NZ8B 2CR3A 2I25N 4Y88A 3CLFH 5ESQB 2E27H 3MNWB 3FQTA 5ENWB 2R4RH 5J9PA 1KJ2L 4GRLC 2DI8A 1G7HA 2OI9B 2WIIA 4UDUA 4XAKD 4ISVA 4K8RD 4OFDA 4JQIL 3N85H 1VGKA 5GJTH 3DIFA 4IIQA 2VLKD 4MQTB 3AM8C 3BP4A 1WV7T 3O3UN 2IAND 5E6IB 5GRJL 4L8CA 3QZWG 4MJ5B 1J88A 3QIUC 4GBXD 5ESAB 5TDOA 3ARFB 1MRDL 1WBYB 5EPMB 4YK4C 1AGBA 3K2MC 4FP8H 4KK5C 3RIAK 1HQRA 3WDIA 2NY1B 5DJ0A 2VO5A 2BJMH 2DQGL 2HG5B 1QFWM 5FHAH 2H8PA 5I0ZA 2IH1A 3CVIH 1QACA 2ADFL 4XVTL 2DWDA 3CFKB 1FE8L 2GJJA 3LPFA 2QL1A 4L4VD 1G7LB 3CIQA 4PJEE 2EDYA 4WUKH 5BJTA 4YR6A 5F1SA 4UTBH 3WFEH 5DURB 1QRNB 2ARWA 5LJYH 2IALA 2Q86B 2DAVA 2DQFA 2DBLL 3W2DH 1CDYA 5JO5B 2P5WB 4KH2A 1DUZA 4M7LT 5JR1H 1JNHA 1DBBH 3OKNB 1BQLL 3GMOA 1TCRA 2H1PH 5SWSB 3OXSB 2VDKH 2DJSA 3WBDA 4POUB 2VWEE 3OKMB 3BN9D 3OF6D 2F8XC 3J8F7 1D5MA 4RIRA 4NKIL 1QFUL 3TN0D 4M6OL 5T3XE 1F4YL 1HDMA 4M6AA 5JQ6L 5ANME 3V4PH 5DFTA 3S36H 2VR4A 3ZE0E 4UQ3B 4XWGH 3VD4A 1P4BL 4MSWB 5J3HD 4X9BA 2K3TA 4APQB 5A2LH 3QQ4B 3IDYB 5IG7A 1H3TA 4OBRA 1C8PA 5EOQH 2LE9A 4TSBH 5E2UL 2F5AH 3HE7B 2LVEA 3REWB 3RZWA 1LNUB 3I75A 2XY1A 1GGBL 2V5YA 3HA0A 1WISA 4LPTA 5CJ5A 4NDMB 1UT9A 4JDVA 3CUPA 4C83A 1F4XL 4XCEA 4F7MB 3IJHA 5TE6H 4KHTL 3QXDB 3RVVC 4U1IB 3RX5A 2VL4A 3VFTB 4YFDB 3UTQB 3BP5B 2EDEA 1AC6A 3P77B 1CL7L 2KPNA 3CH8A 3L3GA 2W65A 1QQDB 3KYMB 5HGBB 4JO3L 5E6ID 1R24A 2VZOA 3WHXA 1AI1L 2OSLA 3ARFD 3HMWH 5SX4I 4HV8A 1MELA 1U6AH 5DVMA 2NY1D 1J12A 1CLYL 4JKPL 3V5HA 3VA6A 2DL2A 1JZ8A 2Z31C 3CPLA 3HNSL 2FD6H 3HS0B 4N0YL 3U7WH 5EBGA 3KNBB 2E9IA 3CVHB 4XP5H 4YXKL 1RMFL 4LQ1A 3OTTA 1DSFH 1Z5LB 3U36B 4HWBH 5DURD 1QRND 3BIKA 1LO3L 2A73A 5IHBA 2V2XA 3NCYP 4JHAH 4OM1L 1CE1H 1I3RA 4NWTL 4TPRL 3UP1A 1EBPA 3LKOA 2ZOLB 4NQUA 3RA7L 3UAJD 4EJ1C 2P5WD 1KPRB 3VXSA 3MCKA 5FHBH 1OGAA 2CK0H 2ICEA 4YGVA 5EZIL 4F9LC 4LLMA 3RKDD 3AS2A 2FCBA 3G5VA 3P0GB 4GKSB 4D0CA 1FNAA 3MC0A 1CR9L 4P2OA 4Y8AA 1N5YH 1JHKH 2MKWA 1YEHH 3EOTH 4OCYL 3UC0H 1FFNB 4FQXA 1ULVA 5CSBA 1LE5A 1UM6L 3VMPA 4MVBC 4I8DA 4ZSOB 4JGUA 4NKDA 2YPLA 1EFXA 3WFDH 1CFBA 3DGCR 3GHEH 5H94B 5IEKB 4EXKA 2J6EH 1XR9B 3U9PL 2AABL 3VRIA 4AT6B 1A47A 3FFCA 4K94H 4EEEA 4APQD 1NCAL 2GITA 3MRQA 4WEMB 1YC8A 3HCVB 3MNZA 4JREB 4KKAD 3RPKA 1X4XA 1UEMA 4MAYC 1C5CH 2WK2A 3MGAA 4IDJH 1PZ5A 1KIRB 4ODSL 2R9HC 3TH4T 4GLRI 3Q5TA 2HYMA 1A5FL 3ARDC 3RUGA 1BZ9B 4HMDA 2FJHA 3GB7B 5JPMB 5T33L 1LEIA 3V9FA 4JANA 4PG2A 2AXJA 2G5BB 1K85A 3GSXA 3LQZA 3OKEB 4GSDH 3R8BB 3HZYB 4DZBA 1XZ0B 2FZ3A 1E4XI 4HUKB 1FC1A 5F9AC 1T7VA 3GKZA 1EJ6A 2R2CA 4PJBB 1R3KB 4X0KA 2O61B 2YPKA 4EN3C 5TE4L 2Y07L 3TBTA 4F3FA 3QNXA 2P24A 2IADA 3DUSB 3BZ4A 4LU5H 1X5XA 4KI5C 1QP1A 3TPUB 5KTEL 4MHHI 5C0FA 1A7PL 3FQNB 4KKCD 5IW1A 1JTTA 4P5TB 3G6JF 4O00A 3VG9B 1JL8A 5E1HB 1A7QH 5C07B 4WY7L 4G7YL 3JWOC 3UJTH 1CFSA 4M9OA 3LHPL 3TNNA 3TVMB 5EC2B 1M05A 3PHQA 4MD5A 1PFCA 5EZLB 4WWID 1NSNL 4XPHH 5DWUL 5B4MD 5ISZB 3AU1B 2Q20A 2ZUSA 3G04B 2CKBA 4JKKA 5KN5B 5F3BB 1EBAA 1U41A 1A6ZA 3QEQA 3UPAA 1F4WL 4ZFGH 5L8KB 1QA9A 4M00A 5ESVB 4B7LA 1C1EL 4ELKA 3A6CH 3FB6A 1S7SB 2HFEA 1F4HA 3QDMA 1OM3H 1BHGA 3NIGF 1JCKA 5DEFB 2X1XR 3LAFA 4UQ2A 1A6TA 4POZD 2V7NB 1DQJB 3VGGA 3WFCH 4CRPA 1OCWH 4IBLT 2GJ6B 1FGNL 2AVGA 3H9HA 1NMCC 1TDQA 4J8RA 4GXVL 4OAWA 4YHIA 4OCXH 2PXYA 2XZQH 4JN1L 4TQEH 4FQHA 4UT6H 5E5RB 3B2UD 4PJ8A 3RUGE 3HAEG 5L7XL 2A74A 1S9WB 1DBAL 2O5YL 1QKZL 1B6UA 5EOCH 3EO9L 5D1ZA 3PNWB 1T20A 1A9EA 1UWXH 3EYFA 5CBEA 4WHDA 2AJXH 5LVEA 1CG9B 1Q72L 2R1WB 4RGNB 4Z7WB 2WIMA 1GH7A 4MA8H 5GS1B 3O6LL 4D0BA 5F9WC 1OY3B 4LASH 3RQ3A 3N9GL 3NZHH 2Y1VA 5GHWH 4EKXA 3VCLA 1MQKH 2VJXA 1T7YA 4PTTA 3GMNB 1AR2A 5D7LB 5J13B 1BZQK 2D03L 5ERWA 2CKBL 1FBIL 1PG7H 3PUCA 4Y5YB 1AE6L 5LCVH 4HWEH 1KG0B 3MBXH 1MHHB 3V6BR 2B4CC 4ZUTA 1SYVA 5BCAA 4W6XB 2GFBA 3UDWA 3N1PC 1RZIB 4GAJL 4LPVA 4D9LL 4OF6A 5ID0A 4P5TD 4JFYA 4S1SL 3ET9F 4S2SB 3H3KA 1HHJB 1QPXA 5C07D 1X44A 4ZXBA 4OF5A 1Y0LB 1C5DA 1NEUA 4TOYH 4ODTL 3MRFA 3TVMD 4NCC1 1VEPA 1RI8A 3SE9L 5I1JH 4Y2DC 3TIEA 1YEEL 3MLXL 1DBMH 5ISZD 4JZJA 3FONB 1DCLA 2DLFH 3O2VL 4UNVA 4YBQD 2EYRA 1XCTB 4GMSL 3B3IA 3O41A 1H5BC 3T4AA 2OXGA 1A7NH 3QDME 3SKOB 4J4PD 4HLZH 2W59A 4WEBH 4M6NH 1AXTH 1F58L 2MQ3A 1XEDA 1NCNA 4YHKL 3L3DB 4HCRH 2IQAB 3WL9A 3JTTA 4WU5A 5GZOD 2X4QA 2LTQB 1DANT 1ZSDA 2MNUA 2PTVA 2R2BB 1U8PB 2XXCB 3D0LA 5J12B 2CQVA 4DAGL 2DQEH 1C7TA 1ZEAL 2JJWA 2OL3A 2IMMA 3EW3B 4YAQB 3HHRB 5TF0A 5GGRY 5TDPB 2Q8AL 4LSUH 2GJ6D 5IHLB 3WO4C 3IGAB 5DEZA 3SKNA 4PD4K 3V6FA 1H0DB 1KJMB 1YY9C 3RGVB 1F2XK 2B1HH 1IM3A 1JTOA 4R6UA 1DL7H 2NY7L 5HTSA 2VSCA 4KDVA 3TBYA 1HH9A 2XA3A 2QQLL 2A2QT 4GRLA 4P4KC 5LBSH 1NDMA 2J1KA 3LKRA 1CLCA 3PP3K 3S36X 3D39D 2HT3D 4M8QB 1QPPA 1F3JA 2AJZA 1YECL 3MLSH 5FF6A 1Q1JL 3AM8A 3I6GB 2BNRB 4RGND 3CK0H 4KK8C 2BXZA 4KZEL 4WNQA 5D1QB 1G1YA 3QIUA 2AJUL 4Y4FC 5DRZA 1JIBA 3ARGB 1LE9A 1O5DT 4X8JB 3QH3B 4JPVH 2VLME 5D7LD 5I76B 4LLQB 1N3NB 3EAKA 5E2WL 4P59H 5C0NC 4EI6A 3EBAA 1A1OA 4LHJB 5DJXA 2FECI 1XGPB 2WW8A 3HB3D 1P5VA 4YBLC 2BC4B 1QLFB 1NFDB 4W6WB 1GOFA 1FFPB 2VKXA 1ONQB 3U83A 3OPZL 4M7KL 3VFUB 5C7XL 4CVXA 1H8OA 1UYWL 2MCPL 3EDKA 3BP7B 5EBLA 2X1WL 5JLZA 3F58L 4EUPB 1I3GH 3DVGA 5CINL 3MBEC 4XH2A 1FVDB 1RFDL 4U6XB 1KJVB 1R3LA 4PGEA 2OL3L 3D5OF 5FA4A 5EU6A 2AEIT 5DGQA 2F54E 2FX7L 2OR8A 4HS6B 4JFPA 4YWGL 4WHYG 4I3SL 4M5ZL 4ZG1A 2BRQA 4PRPB 5FCUH 3L3KA 4S1DD 1OSZB 5L6YH 5I1CH 1UGNA 3KXFE 1FZJB 4KKBC 5DK3A 4IOIB 2QHLA 3UTTB 4NQVA 3QAZC 2J8UA 3MGOA 3V2AR 3H9SB 4HQQH 3BYTA 2MKLC 1VDGA 1FN4A 2I5YL 3MYJB 4ORZC 4LFHD 4CVWA 1NJ9B 4K3DH 3PIQA 4NRYB 4NZUH 4N5EC 1CDCA 4OFVA 2ZPKH 4Y1AB 3O6KL 5I30H 3ROLB 1TZIB 2D4DA 3OAZH 5FUZH 2LU3A 4RGOH 3MRMB 4HLJA 4PJCE 3MLPA 1SEQL 1XF5B 3MOAL 2ATPA 2ZKHL 1P84K 3QUZC 3RGVD 3VE0B 4OBSA 3ZYJA 5GISH 3DURB 3O4OB 2A1WH 3QXWA 4YXLL 1KXQE 3K4AA 1JHLL 4ACPA 3VXMA 1MREH 4F33A 2DF3A 1WBZB 2X4PB 2VQUA 4HUVA 4GQ9L 5ADOH 3Q6GL 4WO4A 3RWEA 3MUGB 3VGHA 4DVBA 3MOQA 3ZTJH 4PD4J 4S1RH 4PY8I 5FDWA 1KB9K 3MA7A 1RHHB 1FYTE 3WS6C 1WGOA 2FSEA 2XY2A 5EOTA 3GM8A 2BNRD 4NN6B 3O3EB 3V6OC 4AEHH 3STZA 2GK0B 1U2CA 3TT1H 4ORGB 4QTHB 5D1QD 4FQ2L 4L5FH 1SEBA 4U1HB 4R97B 3D2UA 2FEDD 3ARGD 3GSNA 2VXTH 4ELMA 1HINL 3KWWB 2DICA 4QYOA 1TJIL 4GW1B 1TTGA 3LEYH 5DD1L 1BPVA 2Z31A 2X4NA 3UTZA 4PRNA 4L3EB 5EUKA 1C12A 1MRCH 3BSZH 5EBMB 3S34H 3EDJA 3DO7B 2DMBA 3MRDA 4P3CH 3E3QE 1VFBA 4KKNA 32C2A 4HK0B 1RJZA 3L3IB 5HGDA 4EDXA 1N8ZB 1CYGA 1QFPA 4FRWA 4OZFH 1SY6A 2BCKA 2DLIA 4J3WA 4R7NA 1LK2B 4F9LA 1RK1A 4DW2L 4BM7A 3HMXH 3EYSH 1JGUL 2WSKA 5D7SL 4PRPD 5E6ZA 1Q38A 2WLZA 5GXBB 2G5RA 1I8MB 3MJGX 4XNUL 4A6YB 2FIRT 3MCLL 2Z8WC 2VUYA 2IPTH 3B9KC 1J1XH 2WUCL 1BQSA 2QQKH 2XA8H 2B2XH 4JPIB 4HIJB 5L88L 3O3AA 5FGBC 3H9SD 3CSPA 1QSEB 3SQBA 1KCLA 5ITFB 3KYNB 2VE6A 1LK3L 5IK3B 4TVPD 4Y1AD 5C6WH 3CMOL 3RWFA 4TUOA 4N8VB 4MAYA 4IJ3B 1UZ6E 4LCYA 3IFOA 1S7WA 4G8IB 2EXWC 3VXME 3GSNL 3BESR 3P0VL 3QIWB 3ARDA 4AEIL 2VXQH 4HKJA 1TZHB 5AUMB 4LAJH 1CTNA 4PRIA 5JZ7C 2W60B 4FMFA 5C1MB 1J86A 4HAGA 4X5XB 4Y16C 4KK9C 1KNOA 4J2XA 1C08A 2JK5A 4ZQKA 3OAUL 5FM5M 3VDBA 1IFHL 4W4NA 5IQ7L 5CP3H 2QHRL 1HIML 4WHTB 5E00A 1NBVL 5HHPB 1ACYL 5A2IH 3NBNA 5DD6A 4EN3A 3R1GL 3VGDA 4M62L 1SYSA 3X17A 4ELME 1W72L 3AB0C 3MODL 4Y19A 3DOSA 2X1PA 1XIWD 5C9KA 4MXVF 1SY6L 2ZSVA 1Q9OA 3PXHA 3VFSA 2WQRA 4MA3A 4OLZH 1INEH 2FJGA 3RWJB 1TIUA 4DUWA 2JB6B 1H3PL 3QDHA 4ZFFA 4ZTPH 1KB9J 4HJGB 3MQIA 2AXFB 5E2JA 1RAMA 3ZHLA 1MCKA 5EZJA 4L3ED 3KPLA 2I07A 4GG6F 3WIIH 2XTJB 2YA2A 4XX1G 4UILL 3BGFC 3DNKA 5C0BB 1OSPL 5CD5D 1P4LA 1H15A 3DX7B 4Z7UB 3IYLW 3AUVA 5FB8B 2HKHH 3C6LC 3CX2A 4S1QH 1T7XA 2X4OA 1MH5B 3QCVL 3VFMA 4MJIE 4LSVH 1UENA 1S3KL 2ILLA 1PBYA 2NXZB 4KAQH 3LN4B 4M3KB 4LFHG 3MNVB 4YNYA 1K8DB 1WWCA 3BHBB 1ZT4A 1X5AA 3AAZA 1QSED 1WCBB 3L5XL 4XCYA 2ERJC 3NABL 3PGCA 4KXZI 1FO0A 5EO0A 4HPYH 6CGTA 4QY8B 4Q97A 5E7FA 3EYUL 3PQYB 2O5XH 5I1GL 2YD4A 4H5SB 2RQ8A 3VXRE 4RZCB 1S7VA 3NCCB 4I77L 4PRIE 3V8OA 3QIWD 3BQUB 3FB7A 4JFDB 2W9EH 2FO4A 4FXKB 4JFFA 5B38A 1ZLVK 2CIKA 5IB2B 1OP3K 1UVQA 1AXSB 3SKJH 1MWAA 4NQXA 4Y19E 4XBPB 1G7PB 1UWEL 3OL2A 3EFFB 3OZ9L 3TFKD 5TQ2H 1KEGH 3OX8B 2NNAA 3L3HA 1WWAX 2K1MA 4KI5E 3G6JB 4ODVL 5K9QI 4UIKL 5CEYB 4DTGL 5DR5H 3C5JB 2ZUXA 3EFDL 4X99A 5C6PB 4PLKC 4YHYB 2HFFA 1B4JH 1OD7A 2ADGB 4LSQH 4HPOL 1RY7B 3W39A 1KC5L 4PS4H 4JZNA 2J88H 2VR9A 2VZVA 2CLVA 3GO1H 3L3OB 2J4WH 5A16A 5F88A 1TQCC 2DM2A 5T1KB 2FGWL 4LVHB 3LCYA 4JKLA 1F6LL 2VDLL 5IKCB 4UV7H 1HI6A 1FCCA 3OR6B 1JPTH 2ZUTA 3FTGA 1P5UA 4EUPG 3V0VB 5I6XB 1E4WH 2H41A 5FV2A 3RY6C 5GZNC 1QBAA 2XTJD 4LL9A 3JV5A 1NC2A 2DIBA 4PP2A 4TUJA 2GIYA 1ZVSA 4Y2DA 4V1DB 3JWDC 5C0BD 2EICA 3ULUH 5GGUA 4WFGE 3QI9B 4HWUA 1FO0L 4QGTA 1AXIB 2DRUA 4PPTA 1AKJB 1EJOH 2FL5A 4JVWA 1QR4A 3GJFB 2ZCHL 2GY5A 4RFEA 4MLIA 1SMOA 1HSBB 1IGMH 4HXAL 3WKML 1HK6A 1KB5B 5IVNA 3H3PL 3IDJA 2BOCA 1IQWH 5E9DE 4UUJB 4MQXC 3WUWA 1FH5H 2WANA 3U7AA 1NCCH 4GKNB 1KFAL 3FO0L 5DMIL 2F74A 2NXZD 1EHLL 4HHAA 5HI3D 2FX9H 2ORBL 4HFUH 1N5AB 2UWEA 4X4MA 1MWAL 4Q9QL 4EIGB 3D9AH 3T04D 2MWCA 5I1AA 2GHWB 4LSRH 4ALAL 3U4BH 1FSKB 4K7FA 4LHUB 3VI4E 4QTIL 5KOVC 1T3FA 4NWUH 3PQYD 4R7DA 4KK6C 1E6OL 2HJLB 2I24N 2GAZA 2QKIA 2IGFH 3GBML 4P4KA 3ZT5A 1RQ5A 4JFFE 1KENL 2B4CL 4NQDA 3ULVD 5DMKA 1BZ7B 2BSRB 3VXQB 4IHOB 3RU8L 4JFDD 5C0RH 1NFKA 3DMMB 3QCTL 5DD5H 4M93B 2ZZUT 1JWMA 3HC3L 3SOBL 1T1ZA 2EDXA 4DFIA 4TSCL 3I6LD 2RFXB 12E8H 4FZEH 1LO4L 1NGPL 4K8RC 5CIPH 5DFWH 4Y4FA 5DLML 2XN9B 3RNQB 5I75C 1OL0A 2Z35B 4L8SC 3TCLA 5HSFA 3LSOA 5DJDA 5I73C 3QR2A 2KBGA 4GBXC 4FTVA 1YYLH 5CUSH 4CW1A 4RFOL 3HPJA 2BVOA 5T1KD 1JWUB 2NX5A 4CADA 5I9QB 2CLRA 4MDJA 4MD0B 3MBEA 1FNGA 5CMAB 4BQ6A 5JNYA 3AMLA 3PXJA 4BH8A 5FECB 5C0EB 3G6AA 5DQDH 3CZFA 1J18A 4I0CC 4V1DD 3QDJA 4F58H 2V5TA 1KPUB 4OCNC 2V6HA 3QI9D 1GC1C 2ARJB 1XF3B 3DRQB 2V17L 5C09B 5K9OA 2AP2A 4X7SH 1AKJD 3PWPE 5GSRB 4CNIA 1AGFA 1YN6B 4OV5A 1MVUB 1IQDB 4XP9L 1ES0B 2R2EB 3OGOE 3W0WE 4J23A 1KTKE 1CDHA 5C0GA 1FZOA 3RTQC 1NUGA 3D18A 5T1LB 5D1XB 4HKZB 1LO5A 1XGQB 4WI9A 3ME0A 4JJHA 3HFML 2UWEE 1EXUA 5E5MB 4PJ5B 3QUYB 4MWFB 2EDTA 1DQTA 3F7YA 2XQBL 4D9RD 4K9EC 2DQUL 2XICA 5KG9B 5FYJL 4JQIH 4PJXA 1FNEB 4PJIF 3VFPA 4N8VG 1WVZA 3O2WL 5J3HC 4FXLA 4IRSC 4RMRA 4LHUD 3QUZA 5GRJH 4FXGA 1QSFD 2VDRH 5DTFA 5IV2A 5DK0A 1U93B 1PYWA 1K2DA 5DVKA 1MRDH 3U0PA 3WNMA 1YA5A 4YX2L 4YDVB 4HBQA 1N2RB 4JG1H 4XMPL 2DQGH 1X5LA 1CIDA 2ADFH 5L2KA 3DMMD 3T8XB 4WFED 4H0GA 5DMGD 2OS7A 3WS6A 1J05B 1BEYL 2OI9C 3V6OA 3KDMA 3T08A 3FO2B 1T83C 1V7MH 2Q76B 3T0BA 2OTUB 4LRIC 2DBLH 5HVGB 1XGUB 3LD8B 5TDNB 1DUYA 2AXGA 2XN9D 3SKMB 3OB8A 1F90L 3S5LB 4FTVE 1BFVH 1BQLH 2AV1A 3MRGB 5E6IC 4Q6YA 4MJ2A 5CSGA 4CN4A 2RJMA 3ARFC 3G5XA 1N26A 4NPYA 2P8MB 2YSSB 2DS4A 3P9WB 2NY1C 4PY7B 1WFTA 4KRMB 4KQ4L 4LLWB 4OJFL 5I2IA 1K9TA 2AS5M 5BQ7A 4FQ1L 1F4YH 4OQTA 3HI6H 4I9WE 3S4SA 5JQ6H 4XAWL 1UXSB 3WKNA 5D7JD 1E6JL 2A6JB 5C70A 5D5MF 1T5XA 1ERNA 3RPIB 3T77B 2Z0BA 4LCCB 4NNYA 3VXNA 4L3CB 3MUZ1 3MJ9H 2BK8A 1ORQA 5C09D 2GEEA 3RKDC 1ZGLP 5C08A 4YHML 4F7EA 1T66D 2OXHA 2Y5TB 3B9KA 5SX5H 1K4DA 5FOJA 1ZHKB 2NY4C 3ABZA 1GGBH 2AK4B 1F42A 2XPGA 1KN4L 5JQHC 3GSUB 4RCAA 5T1LD 1HCFX 1JPSL 4O5LH 5D1XD 5FGBA 1UC6A 2F15A 1S7RB 5A43C 1F4XH 3NN8B 3U79A 4PJXE 4PJ5D 3QUYD 3MXWL 5E8EA 3RZCC 4L8DA 5E56A 1FVEA 3BKCL 5GS0C 1GZPA 5IF0A 1L7TL 5IIEB 2EH7L 3BP6A 1Z2KA 2XYCA 5J1AA 4U2YA 4OLXL 1CL7H 4K7PL 1IAIL 1LO0L 4X4YA 4NRXB 5D7IF 1CGVA 5D7KE 2NTSP 4MS8C 3NGBB 4JO3H 3IDYC 5AYUL 2HTLD 1CXLA 3L5IA 3C5ZC 4LLYA 3G08A 4OFPA 2DM7A 4DKDC 3H42L 1N59B 4CU6A 5LGHL 1I8KB 3MV9E 4C58B 4OZIA 2YUWA 1OTUD 3MRHA 5T5FL 3HE7C 3RWDA 3FQXA 4Y16A 5DF0A 4LBEB 1CLYH 3KS0J 4JKPH 2DWEB 5HGHB 5HHOB 4IMKC 3P11L 2MJWA 4KJYB 3S3JA 8CGTA 3FJTA 4NOBA 3X12B 5I1DA 1CICB 4N0YH 2C7UA 1Z3GL 5BVJA 3S98A 4YHLL 4YXKH 5F9JA 4CJ1A 1RMFH 4HGWA 3SGDI 2EH8L 2GTWA 4OQTL 5FYKD 1BLNA 4OM1H 4TPRH 4TSAL 3WD5L 3C09B 1EERB 4PGDA 3RA7H 4X6CA 1KT2A 1CFTB 1FAKT 2V9TA 4HBCL 2Y72A 4XNQB 3LKSB 3QZWA 5LGKA 2HVJB 5FK9A 2FIKA 1FAIL 5EZIH 2IFFL 1UZ8A 5F3HA 1CR9H 1OAUH 1MJ8L 3BZEA 5DJ2A 5T3ZD 1E28B 4Y0GA 2EKJA 4QF1A 4OCYH 4OT1L 4WJ5A 1UM6H 1BD2A 4KTDL 5D2LF 2WWMD 3QJHB 5I8OL 3L1OL 1WIOA 4N9GB 2E7LC 2C3XA 1ZT7A 4AMKL 4MB4A 1JUFB 4HGMA 4FQLH 3QISA 5I1LB 4HD9A 2QSTA 4ZUSB 4HIEB 2FATH 4K71B 4EDWH 2KZ1B 3C6LA 3B5HA 4YPGB 5B4MC 1J8HA 1J0HA 1ZA3A 4XPBH 1NCAH 3VI3E 2MQCA 3PWVA 1XFPA 1T21B 3L5WA 4GW4A 2P49B 1TJHL 3NPSB 5JUEL 4ODSH 3VWJB 4BSVA 2DQCL 3GSVB 3LH2L 5IJVA 2AK4D 1A5FH 4NZDA 4QNPE 3IETA 2FJFB 1JGDB 2FLRT 3DX6B 5CILH 4W70A 4HKXA 4G8GB 5FOBA 4AIOA 4WUUA 1JMXA 1EHXA 3U1SL 4POZC 4LHUG 4P2QA 1FVCA 4PJFA 3MROA 5CGMA 5IVXA 1T4KA 1FNHA 3I6KB 5TE4H 1IGJB 3T65A 5CJXC 4LCWA 4AG4L 3IF1B 3MRPB 5F7WC 3RVTD 3B2UC 3VH8G 5KTEH 4U6TA 4C54A 3DYMA 1CD0A 1A7PH 4TULH 4M7ZB 4U1MB 5E94B 5HHOD 4X6EA 5C2BL 4G80A 4G43A 1QG3A 1JPGB 2JTDA 1CICD 4WY7H 5DZOA 1OAQL 4GXUM 3MV7B 1HSAB 4EI5B 1D6VL 2VUOA 1ZVYA 4X6CE 4NM8L 3LHPH 5E70A 5F6HJ 3PP3H 3CCHB 5BV7H 4WTZG 3WNPA 1IEHA 4WW1A 5IBTL 5F7EL 4QKXB 5DWUH 1Q0YL 2ITCA 4GG6B 5D70H 4GAFB 1J0KA 4TNVF 3TYFA 2CDEB 1V3JA 1BBDL 4HS3B 1JRHL 3T4YB 4PRDB 1V5JA 1HN1A 2E7CA 4OTXL 2PW1B 1C1EH 3FMGH 1CGUA 4Z7QE 4BZ2L 4P5TC 1FNLA 1HEZA 3VG9C 5FIEA 3ZSTA 1FFOB 4YDKL 4I48B 3TVMC 4KQ3L 1OTTD 3BPNB 2I9LB 3LQAH 2H2PD 1U91B 1CIUA 4ZOAA 4AL8L 1WWBX 4G7VL 3MOBL 1NAMA 5IQ9A 1RUAH 4JN1H 3HKFA 4U6YB 2VDPL 4HH9B 5L7XH 1YQVL 1T1XA 4PBVC 4Z0XB 3ALWA 3T0ED 3BD4A 3VWJD 2O5YH 1QKZH 4J4PC 2I60H 5DUMH 4N0FB 4K3JH 3EO9H 2H26B 5ILTL 4PV8A 4R4BA 1WUNT 3I2CL 4H20L 1Q72H 1I7UB 5GIRA 3QPQD 4PJFE 2D7MA 5IM7A 1A4KA 1F02I 4NQCA 4JFEA 2HVKB 4G8GD 4HUXA 5LGJB 3N9GH 4KUCF 2AV7B 2CRIA 3S9DB 4LCWE 3GI9H 1DQDL 1MFEL 3VI4F 1IL1B 5KANI 1CK0L 8FABB 1WBXB 2D03H 3DVNA 3LIZH 2CKBH 1HQ4B 3I85A 3Q0HA 3RWHB 1AE6H 1P7HL 1NKRA 4KU1A 3BUTA 4KJQD 4MD4B 3RVUD 4R96B 1U8LA 4GAJH 4N90D 1YYMH 4D9LH 5T1DL 1TNNA 5FA3B 4LF3A 3ULUF 1MHEA 4OD2A 2CSPA 5EC1B 5FM5O 2VLKA 3MV7D 1WFOA 4RGNC 4EI5D 3JWDL 3HUJA 5IB1A 1OTSC 3IKKA 4R4FL 5DMJB 2HH0L 4L8SA 5GS1C 2IANA 3S5LG 4UIMB 4JM4L 4M3JA 1SVZA 1YEEH 3MLXH 4QWWD 4GBXA 3SY0A 3O2VH 2ADIB 5KW9L 2DLEA 3F6IA 2H32A 3PE9A 3GMLA 4JPWL 3SE4C 5J13C 5GS2H 1WAAF 1KCSL 2P47B 4GMSH 5GRUL 1MLCB 3HG1E 3WE6A 1NAML 3MFFB 5HDLA 2DQIL 4UT7L 4Y5YC 4A2LA 5H2BA 3HB3C 3VFNA 2OTWB 1F58H 4L4VA 4YHKH 2GSGB 3LN9A 4K07A 2UZIL 2AJSH 3WIFA 1DE4A 1NBYB 4LOUD 3DV6B 2VABA 3TV3L 4PRBB 5A3ID 4DAGH 1ZEAH 1FRGL 4J1UA 1OB1A 3MR9A 3QUKB 2E7HA 2Q8AH 4AH2B 1D5ZB 3SBWC 1ZA6A 4ZO7A 4ZOBA 2H3NB 3S37L 4GRMB 1EEYA 4HGKC 2Q87A 4PJ7A 3QHTC 3MRKB 4YHOH 3FAWA 3H3BC 3RTQA 1Z6JT 4S1DC 4R3SA 5ICYA 5KVFL 5CJOL 4DJMA 3ARZA 2QQLH 5AAWA 4PJHA 5DFVD 4Y4HB 5F1NA 4L3AA 5DRNB 5FFLA 4NQCE 4JFEE 1U8KB 2WUBL 5M94B 5JW4R 5D96B 4K8RL 2LTQC 3WJJC 4BKLA 1YECH 4GS7B 3T3PE 1Q1JH 4PGZA 3B9AA 4DCQA 4KRPC 4QXWA 5J12C 4KZEH 3O4LA 4IRSA 4RAVB 1MFAL 3F6LA 4OZHF 5C0IA 2X4RB 1JJUA 2AJUH 4P3DB 1U92B 4PREB 1R3HB 3VFVA 2VAAA 3MUJA 4ZNEA 1NGYB 1JF5A 5DJAB 5IVZB 3NZ8A 3RGVC 4DKFL 1J1PL 1R3JB 4JY5L 4Z18A 2BSSA 5ESQA 5I17B 2HLFD 3MNWA 4RWHA 5ENWA 1KV3A 3PV7A 3WXWL 5D71L 4J7RA 3OPZH 4M7KH 1T83A 1UYWH 3HUJE 3F58H 1JGEB 4LRIA 1KCRL 4QXTB 4KRLB 5A1AA 3QNYB 1D5IL 1RFDH 5B3JF 3B2VH 4HC1A 1HXMB 2OL3H 2CH8A 5AZEL 5E6IA 3QG7L 5TQ0H 3IAGC 2R15A 1FC2D 5D1QC 4YWGH 5ESAA 1J0JA 2FEDC 3ARFA 4I3SH 1WBYA 5EPMA 3ARGC 4M48L 3C8KB 4NO0B 2HG5A 1A1NA 3R06A 1ZT1B 3CFKA 1AIFB 1K8IB 1NGZB 3NPZB 3F5WB 1E4KC 4K9EL 1QRNA 1J5OL 4BFIB 5DHXB 1JHTB 1OAXH 4RFNB 5JO5A 4YHNB 2P5WA 4D0DB 2YRPA 2EDBA 3KXFB 4G3YL 4PJ7E 5DS8B 1HKFA 3KPSB 4ZYKB 5SWSA 2R8SL 3OXSA 3TZVB 1YEIL 5J4MA 2R2HB 5C3TA 3L7EA 2DOCA 3K80A 4I13B 1SBSL 4PJIB 2Z8VC 4YXLH 1JVKA 3OKMA 2JIXA 1WITA 3E0GA 1VFAB 5B3NA 2CLZB 5IW6B 3Q6GH 4Y4HD 4PGCB 3ETBF 4P5MB 1NLDL 4GUPB 5H35B 4U49A 1CLZH 2Z93B 4RBPH 5DC4B 4UQ3A 4P23B 1HNGA 3V6ZA 2X6MA 1OQXA 4MSWA 1NAKH 2XTLA 3QQ4A 5FYJU 2J5LB 4NJAL 4M1DL 3C5ZA 3GFUA 4C56E 3GDBA 1EEZB 1F3DJ 1M4KA 1JK8B 2J12B 5EU5B 1HINH 3HE7A 4CKVX 1LNUA 4FZ8H 1PEZA 1KOAA 1TJIH 4QRTB 4U4BA 4HUUA 4IMKA 5DD1H 1FYTB 3O4OC 4L1HA 4U1LB 4NDMA 2C1OA 5A2JH 2R1XB 3H2WA 3PDOB 1J7VR 4F7MA 3UJIH 3C87A 3QXDA 4NJ9L 1QLEL 1TVBA 4U1IA 1UFUA 3ILQC 4NO5B 3VFTA 4QRRB 3SKUD 4I5BB 4ZAKB 1ZLVH 3P77A 3EYOB 2HFGL 1JNJA 2EE3A 4NN6C 3L7FA 1QQDA 2DQJL 3KYMA 3QXTA 5HGBA 3O9WB 2YZ1A 3PGFH 1FL5A 5J6GB 3H9YA 1CFNA 1JGUH 2UUDK 4R97C 5AWNL 3L6FA 3MUY1 3FKUS 1OARL 4NO0D 3C2AL 5D5MB 4XNUH 3MCLH 3B83A 1U8MB 1QRNE 2E7LA 4OF8A 1NL0H 3CVHA 5DO2D 2P5WE 4IRZL 5TPWL 1VEOA 1Z5LA 5GS0L 4LEXH 1IM9B 4J3VA 2OLDA 1LK3H 2CXKA 2ZOLA 5EU7C 5HY9B 2BVUA 5CD5C 5C6TL 1KPRA 1GIGL 3CMOH 3KXFD 4ONFL 2D7TL 4C4KT 3DO3A 1I9JL 3HLAB 4LIQH 4M1CC 3VRJB 4U05A 3KPSD 5IHZA 3QNZB 5EUOA 4JLRB 5KSVB 3TZVD 4NSKB 4GKSA 1FFQA 3GSNH 3IXAB 3P0VH 5EG6C 1UA6L 4HK3J 3CFIC 1NLBL 1YMHB 4ZMAT 4R26H 1JI2A 5D7IB 1FFNA 3SGEI 3MX0A 1NGXB 4ZSOA 1N6QL 1G9MC 4QNPF 1H3VA 5H94A 3LRHA 3OAUH 1IFHH 4FG6D 5IQ7H 2QHRH 4S11A 5HHMB 1ACYH 3WHE1 4MAUL 2C3VB 3D85B 4M62H 1CXEA 1TETL 2GYSA 1W72H 3MODH 1S9VB 2BVQB 1ADQA 3VMOA 5CJXA 2DD8L 1SY6H 3HCVA 2BRRH 4JFZH 2QV2A 1Q0XL 4IJ3C 4NQEE 4J3XA 1KIRA 1H3PH 4XVSL 3SO3B 2EE6A 5JW5B 4QHNB 1D9KB 5CKGA 1FYTD 3LKNB 1BZ9A 1G9EA 4Z5RA 3GB7A 5JPMA 2G5BA 1CDBA 4WWKB 3OKEA 4YJZL 4LIQE 4B0MM 3CVHL 3HZYA 2BY1A 1XZ0A 4NIKB 4PYGA 4QRRD 4PJBA 4ZAKD 1R3KA 2O61A 1RUQH 5D2LB 4K3HA 2ZCKH 4DN3L 3O9WD 5HVHB 1BVLB 2VDQL 3DUSA 3K4DA 3CH1B 5KVDL 5CSZB 2D2OA 5IR1B 4L9DA 2Y6SD 1KIQB 3TPUA 3PWNA 3VXTB 3QCVH 1F8TL 3FQNA 3BKJL 4P5TA 1V3KA 3F7VA 4N8CH 4I1NB 2P8LB 3DBXB 1NEZB 1U2HA 3ARTA 1DQLL 5HHQA 2XTJC 4PJAF 3S3SA 3TVMA 1RZGB 1IM9D 5ID1A 5EZLA 3FO1B 5ISZA 2ZG1A 2AXHA 3AU1A 4NNPL 1HOCB 1QBBA 3G04A 4DGIL 5CFHA 5KN5A 3EYUH 5F3BA 5I1GH 1ADQL 4CBPA 4ETQB 5I66B 3DX8A 1PQZB 1YPZE 1MAKA 3GJEB 2EO1A 2CO6B 4J4PA 5ESVA 1M71B 1ZTXL 4LP5A 4NZRL 4GJTB 4XMKL 1S7SA 1M7IB 3UO1L 1P4IH 4O02L 4OF7A 2X9XA 2NXZC 5DEFA 4X80H 5HI3C 4Y8DC 3VXRB 5E8DL 2V7NA 1DQJA 4OSUH 5C71A 1CD1B 1UWEH 4CVZB 5HHMD 3OZ9H 2GJ6A 4YO0B 3D85D 2DM3A 4ODVH 3SQOL 2IAMB 2NY6C 4LKXB 4UIKH 3EFDH 1A9BB 1GYAA 3LN5B 2PCPB 4HPOH 1KC5H 3KS0H 4HW6A 1JZ2A 1T6WA 1INQB 1WZKA 2FGWH 5IB5B 1S9WA 1OPGL 1D9KD 5IHUL 4PP1D 3BZFB 3ISWA 2VDLH 2X70B 3BQUC 4HLZG 2WBJB 1EK3A 1IJ9A 1CG9A 2R1WA 4HH8A 3DVFA 4FFWD 1FGVL 4JM2F 4Z7WA 3U0WL 4WWKD 1KIPB 5EORH 5GS1A 2H6PB 2JJTC 2A83B 5ITBH 1FYHB 3CLEL 1D6EB 3JV6B 2WBKA 4WW2C 3DHJA 2GT9B 2A6DB 2EXYC 1FO0H 4KWUA 3GMNA 4M1GH 1VKXB 3QPXL 5D7LA 3SE4A 5LQBL 2ZCHH 4DUVA 3K8LA 4HXAH 4JDTL 3MYZA 1LEKA 4YHYC 4Y5YA 1UCBL 2F53E 4XHQA 3SE3C 3H3PH 1KG0A 1MHHA 4Y5XB 3S35L 1Y6MR 5DT1L 5C07E 3EO1A 4O4YL 5IMMB 1AGCB 3I3DA 1NMAL 1RZIA 4LVHC 1A7RL 4ZPTB 3KR3L 2UZYB 3GMQB 5HI5D 2OYPA 1ZLSL 4PUBL 3TPKA 1KFAH 4ODUB 4OCSH 4S2SA 5F7MC 3FO0H 1NQBA 1HHJA 1EHLH 1MFBL 1GOGA 1QRKA 5I6XC 1T0NB 3DSFH 5ISZE 1MWAH 4Q9QH 2OMNA 2C3HA 3SBWA 3SDAB 3X13B 1XCQB 1MCNA 1TZGH 5E9DB 4ALAH 1CGYA 1U0QA 4LAQL 4QTIH 3FONA 4QRSB 1K4CB 3OV6A 1FORL 1XCTA 4MGXA 1W0VB 4XNMB 4IOFD 3GBMH 4LSPL 3BRGC 3D1MC 4PLJD 3SKOA 2B4CH 3NCYS 2CPCA 1XR8B 3VD5A 3RU8H 2R0WL 2CRMA 3L3DA 2IQAA 3FHAA 2K9UA 1GGCH 4UTAL 3HC3H 4GMTL 2EKSA 3WJJA 5CP7B 2R2BA 1JZ6A 3HRZB 4LDEB 4JZOB 4TSCH 4UAOB 1NGPH 1KXTB 1E27B 3VXRD 3U0TB 4YAQA 3OJDA 1NC4D 3U46B 3ALXA 5TDPA 5DLMH 4HUMB 1DDHB 3IGAA 3JWNC 3PWLB 1L0QA 1FSKC 3MLWH 3U7YL 2E3VA 1H0DA 1KJMA 1CU4L 2IAMD 3RGVA 1DBJH 3O3BB 3UCRA 1FJ1B 2XZCL 4OGXH 3D39E 1EVUA 3RX7A 3GNML 1L9NA 1I7TB 1KCUL 4RFOH 4WI2A 3IFLL 3TBWB 2Z92B 4Z6AT 4RGNE 4Z7WE 2L7UA 1T89C 2RB8A 5D93B 3HC4H 3BDYL 3DMMC 4M8QA 4M93C 2WBJD 5DMGC 2X1OA 3I6GA 2BNRA 1JV5A 2VL5B 1NFIB 2R0LH 3CSBA 3T1WA 4LARL 5D1QA 2NZ9D 4XXDB 5CAYB 2DJ4A 4UI2A 4MXQD 1IAKB 1GGUA 2Y23A 3ARGA 3BYYA 5CEXB 4AK1A 4X8JA 4N0UE 5I76A 4LLQA 1N3NA 5IB4B 1KYOK 4XP9H 4K2UL 1ORSB 1XGPA 2LV4A 4N8PA 2ZNWA 2VSDA 2BC4A 1QLFA 1NFDA 4BZYA 5SV3A 1FFPA 3DROA 1ONQA 2OQJB 1E4KA 4MJ6B 4XX1E 1WWWX 3ZTNH 3BP7A 4OLWL 1XH3B 2DM4A 1A6AB 4EUPA 1MHCB 2G75B 3PWPB 2GUOB 3ZTJG 2DQUH 3FRPA 5FYJH 4CVUA 4U6XA 1KJVA 2NY5C 1AH1A 3W0WB 2VDNH 1OAKL 3BMVA 3SDAD 2FEEL 5CZXC 5GQBA 2BFVH 3O2WH 5CIPB 5E9DD 3AS1A 4HS6A 3IFPB 3EJYD 5JHDD 3KLHD 4U6HB 4YUEH 4PRPA 1OLLA 1OSZA 2AQ1A 4LPXA 2AJYH 4PJ9B 4YX2H 3MCG1 1J11A 1T66C 1V05A 4PRAB 5DSCB 4OZHB 5AZ2H 1R6VA 1QTYT 4IOIA 4LPWA 5FM4A 3UTTA 4WI4A 3RIFF 3CNKA 2E8YA 4U6VL 4NZJA 3M17B 3N06B 5D1XC 3H9SA 3IU3B 2VLLB 1CXKA 4U1JB 3O11B 1UB6B 3QUYC 1BEYH 1YEDB 3MYJA 1BVKB 1NJ9A 2GJZA 4NRYA 5FO7B 3MO1B 4LLVB 4AIZB 5HD8D 1YUHB 1X6NA 1TZIA 4JVPA 4PFEA 1WFUA 3VFOB 4P57B 3B8YA 1X5YA 1KELH 2BNQB 2P45B 3AY4C 3MRMA 4UNUA 4OZFG 3JTSB 1XF5A 3ULUD 2EDNA 4Z8FL 3GSRA 3IVKB 3DYOA 3VE0A 3V0WL 5KS9E 3DURA 4FN0A 4U0QB 1FZMB 1ZWIB 5BZWB 1QFOA 1WBZA 2X4PA 1BF2A 1PAMA 1HH6B 3JUYA 3MUGA 1MFDL 2BNRE 4KQ4H 4OJFH 1P6FA 4MDIA 4FQ1H 1RHHA 4PGJA 3CZJA 4XAWH 1AR1D 3O3EA