1FGNH

Monoclonal murine antibody 5g9-anti-human tissue factor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
214
Chain Sequence
EIQLQQSGAELVRPGALVKLSCKASGFNIKDYYMHWVKQRPEQGLEWIGLIDPENGNTIYDPKFQGKASITADTSSNTAYLQLSSLTSEDTAVYYCARDNSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN FAB 5G9
publication title The mechanism of an inhibitory antibody on TF-initiated blood coagulation revealed by the crystal structures of human tissue factor, Fab 5G9 and TF.5G9 complex.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 43
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1997-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fgnH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fgnH02
1FGNL 1NL0L 1KELL 2R0LH 2HTLC 1I1YA 2X4OA 3HE6B 4E0RB 2Z93B 1KPRA 2PR4H 3WHXA 3H9ZA 1NSNL 3U9PL 2DIAA 4ZAKB 3WDHA 1JGUH 3ARDA 2I27N 1IAIH 3VH8B 1LMKA 1N8ZA 5FYKE 4Z76A 5C7XL 1UEMA 2R4SL 3VWKB 5E8OB 5KG9A 4BQ6A 5C09E 1LWRA 5D71H 1UYWH 4KJQD 5F1OB 3I3BA 4OCSH 1Y6MR 3BN3B 3SE9H 1II4E 4K23H 3NPSB 3QRGL 4RX4A 3MRIB 5KVEH 3WFCL 3Q3GA 4XVUC 4FFZL 2J4WH 3HHRB 4KAQH 1FL3A 5HHMB 1IAKA 2V6HA 2WMPA 2H1PL 5BOPA 3EYOA 4S1RL 3QEHB 4TSCH 2XI9A 2MQ3A 4YPGB 4WVRA 4J8RA 3GMPB 4GW1A 5A16A 4F7CB 3MRGA 5F89A 1JHKL 3FMGH 3MV9B 1K3IA 4U31A 1XR8A 1A5FH 2MPAH 2P49B 3QFDB 4P5MB 2EDXA 4WUUE 4MNGE 4BK4A 2EIZB 5IUSA 4YFLF 1HH6B 2F53B 3QXAA 4R2GB 1UWEH 3FN9A 1LE9B 4MD5A 3S36X 1Q8MA 4XVJH 1IGTB 4PTUB 1I7TA 3TA3A 1P5UA 1ND0A 4NGHL 4IOIB 1PX4A 4NKIH 2ZUTA 1HOCA 4PJGB 3RWHA 1D9KD 5D93C 3I85A 4P0DA 4RGMB 5D1QA 3OXRA 4OCYL 3MOBL 2F5AL 5DUPL 4GT7A 4KJPD 3OKNA 4PGDA 1H8OA 4UB0H 3DX8A 3QUMB 3O3DB 3HN3A 4ZFFA 1HYSD 5DZOA 1ZLWH 3BQUA 3OF6A 3T0AA 3DXAB 4UUJB 2W91A 4QGYA 3SDXA 2GEEA 4LSPL 3IT8D 3TV3L 3CXDH 3LHPH 4YC2C 4XP6L 1LD9A 4BH8B 2G75A 5D5MA 5E08H 1T89A 4B0MM 4JPIB 4ENED 5D93B 3KPPB 5JOFB 5E8EA 1P4BH 4P4RB 3OPZL 1U3ZA 2ITCA 4JRXB 2BOBB 1GVIA 1MH5A 1QQDA 5H8DA 4L8SC 4ZNEE 5KSBA 4EDWL 4UQ2A 4F2MB 4MCYA 4XVSL 4KZDL 4BSWB 2ICEB 5TE4L 1CD9B 1VB9A 1FV1B 2WWMD 3QBTB 2H8PB 3U79A 3SE8H 5DI8B 4GG6A 1DLFL 1X5ZA 1AGEB 2JK5B 3CNKA 4KC3B 4U6HB 4YHNB 2JJSC 7FABH 1Y0LA 1JNJA 4WNQA 2B4CH 2BSTA 1YEJH 5DRWB 5IVNA 4CMMB 4L8SB 4XVTL 3H9HB 1KNOB 3QUXB 4FFWC 1AIFA 2ZCLL 4P5TC 2XKNB 5INDB 3NVQA 4QY8A 4JO3H 3TPUB 1FIGL 3EZJB 1FDLL 5GHWH 3X14B 4CU8A 5E1HB 1HK6A 1QO3A 1NGXB 1AO7A 3FO1B 5F88A 3MMEB 1ED3A 2P24B 3GRWA 4HPOL 5TQ2H 1IMHC 1NGPL 4QNPE 4K3JL 4PJ5B 4PJIA 5DRZB 5TDPA 2Q86A 4PRIE 1AY1L 1FNGB 2JJTC 1ZLVH 4HGWA 1KACB 4OLVL 1GRWA 1HXMB 1UVQA 3SKNA 3HLAA 3L7FB 1FG9C 3WBDA 4LVHB 1KLUA 1X6LA 5CINL 2VYRE 1ACYH 5JNYA 3IDNB 4YHOH 2BDNH 3WS6C 4KVCH 4TOYH 1N7ML 2OXGA 1OP9A 1HEZB 2WANA 2C3GA 4NO2A 3MBED 3V52H 4ZUUA 5HHME 1MELA 3ZYIA 43C9A 4R96A 2YPVL 1Q72H 3V79C 3P40A 3CFJB 4W4OA 4ZD3H 5KS9B 3IAGC 2HKHL 2IH1A 1OAUH 4PRPA 1FO0L 4OQTA 4YXLL 1TVHB 3MV9E 4E0RA 3MV11 5CEYB 3FHAA 1K2DB 4XNZC 3V7AG 2Z93A 3DURB 2EC9T 2Y06H 4NRXB 4MXVF 3T0ED 3QAZB 1LO5A 3FOLA 5DQ9A 3O2DA 5C0ND 4U1MA 1J1XH 1ZS8A 1NCWL 4XB7A 3VWKA 1RMFH 1P4LB 4NWUL 2VDPH 2IH3B 1KT2B 1KXQE 3RVUC 4IS6A 4HKXA 5DD6B 3GBML 3H7BB 5FYJL 1NLBL 8FABA 4P49A 3MRIA 4O51A 3A6BH 4K9EL 3X11B 4Z7NE 4HC1L 2HJKA 2XRAL 4HS8H 4JFYB 2QQNH 3B3IB 3NIGE 4PJFF 4V1DE 4HIXH 3S6CA 2CRYA 1AR1C 3AB0B 3QEHA 5IBUG 5D1XC 1F3JA 1KC5L 3RKPA 2DQUH 3HPLB 5L9DL 5ID0B 1NCDH 3GJFA 1JMXA 4IDJH 4WEMB 1BEYL 3D18B 5E99L 1P2CB 1IGCH 1HSAA 3ILPA 1AJ7H 3FO9A 4P5MA 3RPIA 3MA7B 2EIZA 4ERSH 4CAGA 5JHLL 4MA3A 1KB5A 4OUUA 2E7HA 4LQFL 4UI2A 4UOJA 2HRLA 4GG8A 4LSQH 4KMQA 1JHLL 3V6BR 2MQCA 5EO0B 3S37H 1I7RA 1AKJB 2W9EL 2P46B 5MP6L 5IQ9A 4IOIA 4EI5A 5GSVB 3O45A 3NIDF 2X9YA 5AAWA 4C59B 4HWBH 5HYJD 3V8CA 4B7IA 4PJGA 3RU8H 3UC0H 4NQSB 2A9NH 4HUWA 5GRZA 3UPRB 2GY7B 3TP4A 3ARGC 1F42A 4OJFL 2ERJC 2UYLB 4JDZB 4Z0BL 3PWPA 2YKLH 5AUMA 4UBDC 1YY8B 2YD9A 4XMKH 2EDJA 3FB5B 2RFXA 5T5FH 2OYPA 1N64L 5L6YH 5FYKH 2DKUA 2OTPA 5DMGD 3S3SA 3TZVA 5L2KB 2QADB 5CJQL 3P30L 4HCRA 2C4XA 4P3DB 2ZPKH 2I9TA 4P2YA 4TVPE 4Y5YC 5D70L 1CG9A 5EULV 3STLB 5J6GB 1NCAH 3L95B 4OLZL 1N4XH 4JRXA 1CZ8H 2BOBA 3GNML 3VG9B 1EO8L 1VEOA 3ARGB 3ZTNL 3BSZL 4F7MB 4LLDB 2ERJB 5H37H 2W92A 5J1AA 1F4YH 4JRWA 1G7MA 3WCYA 2OX5A 5BZDA 1F4XH 4PJ8A 1OWWA 2Z92A 2DQFB 1CR9L 1JNLH 4WFHE 1LE5B 1AGEA 1JI1A 4U6HA 4P59L 5FCUH 3HMXL 1NMAH 2R4RH 5I66B 2ZG3A 4KXZI 5E5RB 5IBTH 4DVRH 2DBLH 4Y5YB 2X42A 4M7JH 4U6TA 1WWWX 1FNHA 1Q9WB 3V0VB 3F7VB 3UJTH 2Z31C 1KNOA 3QUXA 3L1OH 4K7PL 3GBLA 4G5ZH 3CFCH 3ULVF 5EFIB 5TPWH 4EKXA 3O4OC 2ZOKA 3FN0L 2IAND 5DFTA 1GL4B 2NY1B 2GKIA 1TJGL 2R8SL 1YN7B 2J6EH 1FZMB 1IGFL 1OARH 3GI8L 3HAEB 3FJTA 4XCFL 1SM3L 3O3BA 3RZWA 4PS4H 4R4BB 4PJ5A 5DRZA 4OZHB 5FA3A 1D6VL 4LHUG 3GSUA 1JGVH 1RJLB 3HNTH 1P7QD 1TTFA 3SKOA 1HXMA 5BS0B 2Z31B 4H20L 2R0ZH 3BH9B 4QOKA 4YUEH 5DUMH 1KCVL 1PD6A 4AQOA 2Q7NA 2VXSL 2X1QA 1B3JA 1Q1JL 3UDWA 3O41B 3IDNA 4N0CD 3S37X 5H94B 3LV3A 1V3JA 4HZAA 3ARFB 4TPRL 2IAMC 1A7QL 1FZOB 2CKBH 4ONHB 2BNRB 1RJZA 2ZWLT 3P0YL 5T5NF 2R2HA 3S98A 3MRHA 2WBWB 5KS9A 2YXFA 3VG0H 3GI9L 1OTTC 2VN4A 4PJXF 3QDJA 5K33A 2AJXH 3HG1B 3RTQB 5BRZB 4K8RD 2OL3L 3STZB 5CBAB 3KPSD 1UWXK 4RGOL 3U36B 1XR9B 5JUEH 2YC1A 1CS6A 4P46B 4GFTB 3LB6C 5K9QG 1K5NB 5IKCA 3EJJX 3ILQD 1L9NA 2VABB 4PGEB 3JV6A 2IH3A 1DQLH 2GTWA 3D2UB 2H32B 5DD6A 1KPUB 5BXFB 3CFEB 3H7BA 5E2VL 5C0DA 3U4EB 5FGBA 4NQEB 1ROWA 2DM7A 4O2FA 4POZD 4ZPVA 4Z7WB 5D2NB 1TDQA 4LRNH 4WFGD 4PJHA 1MFEH 4AEHL 4EN3C 1EFXD 4XZUA 5HVHB 2FX7L 1FPTH 2GFBA 1KPVA 2YA0A 3HPLA 3D3VB 1RIVH 3TJEL 4RNRB 4LCWB 3D18A 5TH2A 4PJFB 2OI9C 4WFFE 4NO0D 1H3GA 2V7NA 5DK0A 5DJZA 3Q6FA 4JFHE 5H37G 4JR9L 5L8KB 3K2MC 2EDBA 4M1DH 1BD2A 5L2KE 1IRAY 4DAGH 3HC3H 4LSRL 1ZT7A 4MQ7B 2GSIB 4NSKB 1AR1D 4GRLC 5D6DA 3WN5A 3ULUF 1FVEB 5I18L 4OZ4A 4HBCL 1RK0A 4XH2B 1T4KA 2NZ9C 4JY6A 2FJGB 1MAJA 3ECBA 2GUOB 5DD1L 1T0MA 2BK8A 1NAMB 1EJOH 1DE4A 1JNHA 1JFQH 3RL2A 4LDOB 2NY0B 4F33B 3VWJC 4FQXC 3UPRA 3QDME 4APQC 1A8JH 4Z77B 4JJ5B 2J8UB 4DKEH 1YY8A 3MLUH 5C07A 1MVFA 3V5HA 3L3IA 4OZFA 2AJZA 4JHBA 4LASH 3TLRA 1S7TB 4S11A 2ZCHL 2VLRE 3MXVH 1Y18A 1Z3GH 1HKLH 2J5LB 4D9RE 1RHHA 2VDRL 1J0IA 3FOMB 1K9TA 4QRRD 3UTSB 1ZTXL 2ZUQB 3STLA 1L7TH 4KHTH 5BVPH 2ESVA 5FDYA 5I8OH 1OAZH 3BH8A 4Z0XB 2QBWA 4HK3N 2P5WB 3PV6A 4FQXB 4YHML 5HHVL 3JTTA 1CXFA 4JDTH 4JKPH 5EBMB 4F7MA 5IVOA 2CLZA 1DTUA 1FE8L 4K3EL 1JK8B 1H5BA 4QXUH 1YUHB 3CFBB 2YPLA 2OTUB 1RJYB 1TFHA 3SGJC 5BS0E 3WFBL 1ZHBB 2I26N 4JKLA 2EYSB 4J4PC 3FZUD 2DJSA 3ULVC 4I0PD 1T1XA 4YHZH 3EDEA 4BH7B 4OCXH 1WIOA 3GIZH 3L3KB 1KENH 4KV5F 5IT2L 1MWAA 4QXTA 3H9SB 3QHFL 3RGVD 5K9JL 3MRKB 5CWSA 3MLWH 2PXYB 1WITA 3OG4B 2FJHA 3EO1B 2EH8H 3I9GH 1T6WA 1WJ3A 3JWDC 2CIKB 3OX8A 4TTDD 1CFVH 5A3ID 3GEWB 3HI1B 1YN7A 2I07B 4M7KL 1NUNB 2X70B 2NR6C 2AJVH 2Y6SC 1BZQK 2AK1H 4NZUL 3BEVB 1CD8A 1CFNB 1T5WA 5GRUL 5EBLB 1MI5E 5D9SB 4DEPC 1MCHA 4XWOC 1I3GL 1RJLA 3K7UA 4H0HB 3SQBA 3ORJA 3C5ZA 5GJSH 2XA3A 4PG9A 2ARJQ 4MX7B 2BCKA 4WTXA 4QRTB 5FM5M 3EFFB 5E4EC 1CFQB 4W68A 4MXVE 1URLA 2N56A 3O41A 2YBRA 3ARBD 3ALXA 3G5XA 2D0FA 1Z0NA 5H94A 3VH8G 4G6KL 4QTHB 4TVPH 2VDLL 3PDGA 3QDHA 5D1ZD 3BP7B 1FYTB 1A7BA 3OAYK 1TNNA 4DZ8B 1INQA 2YD1A 1S7WB 3D3VE 4PP2A 1O7SA 4WEUD 4ETQB 1AGDA 3RTQA 5BRZA 4LCWE 4MHHG 5CBAA 4G7VL 4OZGF 4PJFE 4XHQA 2L0DA 1AGCB 4FFYH 4NWTL 5GXBB 1YYLH 3VMPA 1CGYA 5DDHA 4OD1H 1I75A 1IC7L 4PUBH 4PGEA 2J88H 1A9BA 1IGYB 3DV6A 1HQ4A 3VMOA 3OKOB 3PWUA 4KI5D 3KXFD 3B9KA 4CU6A 3LZFL 5I76B 1P84K 1RZ7L 3WLBA 4WI5A 1OP5H 1YYML 5ICYA 5DRXB 4JREB 3LB6D 4EDXB 1MRCL 2CH8A 4XCYB 1L6XA 4I77H 5F7UA 4XPTL 3IDGB 3TWCH 1VERA 1RUQH 2JJWA 3GSRA 3C5JB 5KVGL 2EDWA 5CUSL 4XC1H 3BGAA 4WDIB 5CBEB 3NIDE 3KLHC 1KUMA 4ZO8A 4E41D 1OW0C 3ULUC 5C9JB 4D9LL 1CXLA 1L6ZA 1ZT1B 2DMCA 3MROA 1BQUA 5L88L 5DHVB 1R3KA 4MQ7A 2GSIA 1TNMA 2IPTL 1NGYB 3OSKA 3SJVA 1MHCB 2BSRB 1FVEA 4WWKD 1G7LA 3V9FA 5DJYB 2D31B 2P5WE 5BOZG 2FJGA 5M95B 2F8OA 2HAZA 3AUVA 3MRPB 2GUOA 5DVNA 3RY5A 3BPOC 4PJ9D 1Z6JT 5CJ8A 4KH2A 1H3VA 3O0RL 1M7XA 3RDTC 3HZYA 1XGYL 3MRBA 1FNSH 3MV7B 3VRIB 5MEPA 3O6FC 2FLRT 3VE0A 1I8IA 1R24A 4DVBB 3O2VL 5F9DC 1JYNA 1KJ2H 4JJ5A 2J8UA 1IC5L 4JFZH 3IVKB 1BAFH 2ARJB 3H9YA 4TNVK 3VDAA 1AXSA 1NBQA 1I1CA 5IWLC 2A9ML 1CFSA 3AREC 1CICC 3DUSB 4Y1AA 5GGTL 2ICWI 1IEBA 3BPOB 5CMAA 4YHIB 3RKDC 3VXTA 5ACZA 2FD6H 3RDTB 4RDQG 2EDHA 3UTSA 5IESH 2NNAB 2AW2A 3BO8A 3PWJB 5EU3A 2DN7A 3O6FB 2AJSL 2GK2A 4WHCA 3IU4L 3ULVE 2W0LA 2XZZA 3NOIA 1DR9A 1S7SB 2XZQL 2XG5A 5HHXH 1QLRA 4X7CC 1VENA 1YUHA 3H2WA 5EC1B 4CVZA 2OTUA 1RU9H 1M1SA 3TF7C 1JRHL 3QG7H 4S1QH 2C7UB 5I1HL 2E27L 4S1DD 4N1HB 2ZG1A 5F3HA 3HUJF 4WEBH 3QFJA 4HS6A 4XMPL 2XV6B 1UQSB 5F1SA 4Y88A 2AKRA 2R2BA 3DUUB 2PXYA 4V2CB 3DECA 3T65A 3KPRB 3EO1A 3D39B 1F5WA 1FYTE 1Q9KB 3NH7H 4HFUL 4ZFGL 1DL7L 1FFPA 3DO7A 1X4YA 4EUPB 3SDDA 2EIBA 1MNUH 3NCJH 4HV8A 5TFSL 3MYZA 1UACL 1NCBL 3RIFF 4P2QA 4M7ZC 4F9LC 2FIKB 5LGHH 5M7QA 4EXPX 1CFNA 4RRPA 4ELMA 3B2UD 5FM4A 3VRJA 3SOBL 1QFWI 1UCBH 3M17B 3VI3F 2YMXH 4I3GA 1F58L 1NBZB 2DLIA 4PJXE 4BQBA 4CN1A 5IHBA 2HTKC 4NN5B 4GSDL 3U2SB 4X6EA 4X4ME 5CJOL 1E27B 1EA9C 3D48R 4MJID 4MX7A 4OF5A 4R26L 2HN7A 3UYRH 4QRTA 3C08L 1BGXL 4K3HA 4RQQB 1H3WM 5I1CL 5DJAA 1A7PL 4GBXD 2UZIL 2V2WB 4NKMB 1YEEL 1UENA 3NTCL 1OD7A 4RMRA 2MOVA 3EYVB 1MCWM 5LGKA 5IB2B 4FTVA 5J3HC 1S7VB 3EIFA 3HAEH 4DZ8A 2CDFB 2DQGH 5LWYL 2MJWA 1ZA6B 3CH8A 4HUUB 5FYJD 3REVA 1NMBH 2X10A 1SJHB 2UVFA 2ZSWB 2CGRH 1G84A 1P4IH 2PW2B 4NCDA 5BJTA 4OCMC 4IRJB 3TNMB 5I1AB 1EGJH 3BN9C 3G5ZA 5D4QA 4PJBA 3QHZH 3NA9L 3QXWA 5C0IB 2XKUA 1P7KB 2CDGB 1MCEA 1QUNA 4HT1H 3EGSB 3U7YH 1J8KA 4MAYC 1IGYA 1NBVL 1U2HA 1P9MA 3P9LB 4CGTA 5FB8B 1CK0L 3QIBA 3RVTD 4L4TB 5I76A 3E6HA 4Y19A 4GH7B 4I5BA 3ULUE 1MAML 2VITB 4EDXA 3MODH 4DZBB 4PREB 4UU9A 4WI4A 2EYTA 3IDGA 2IWGA 2X4TA 1CF8H 2PYFA 3C5JA 4XAWL 4HPYL 3QJFB 5EIIB 4N0FB 5ITFB 4K3DL 3JWOC 2VAAB 3TO4C 4Y4HD 1CQKA 2O5YL 2OXHA 3MLXL 1ZT1A 2X4UA 2JB5H 3C5SA 4NM4L 1ZVYA 3S4SA 3U0WL 3GMMA 3RZCC 1F3RB 2O26U 4ZDHB 4QXWA 1MHCA 2H32H 3GSQB 3K1KC 5DJYA 3GZKA 5E9DE 1EEZB 2PUQT 2V5YA 4KK9D 3MRPA 3FQUB 3RA7L 5E8NA 1G6RB 3BKMH 2LVCA 1BFSA 3IKCA 5IW6A 3TO4B 5TF1L 5GS2H 4Q0XL 4YK4C 5F7EL 4UDUA 1WCBB 3EYQC 4NQCD 2D03L 3VRIA 5I9QC 1V7ML 5FYJU 3LRGA 5GGRA 1OAYH 4BFEA 2IG2H 2ZJSL 3IDXH 4JO1H 4QHUA 1IQWH 2YRLA 4JN1L 4I2XB 2ARJA 4R0LA 2H9GB 3CFDB 3TBYB 3C2AL 1K3ZA 4XWGL 3SE4A 2VXTL 4QRPE 3CUPB 3T1FB 3DUSA 1KIRB 2VE6B 3KPRE 4AK1A 5DRNB 4YHIA 3D39E 4Z95H 4UNUA 4ODTH 4XPHL 1F90H 4Y4FA 1J0JA 4KV5E 1YQVH 3SEPA 3IDUA 5JO5B 5D7IE 1DQDL 2E9WA 5D6CB 1EUUA 4CKVX 1NAMH 2I25N 4P99A 4G7YL 4NCC2 5I1DB 1MJ8L 1DBML 4KK6D 5EC1A 2IQAA 3KJ6H 2VLME 3BD5A 3O8XC 3SGDH 1H0DB 1PG7L 4I0CC 2PCPB 1IM3B 4YEEA 3FAXA 4DN4L 3HZVA 2MHAA 4L3EE 3VD3A 2LE9A 4FQIL 3INUH 4M6OL 1D5ZA 1XIWD 1KOAA 3MFGB 4JGJA 4Y4KC 2VL5B 3DUUA 1U41A 1OP3H 1P84J 3TBTB 1JPST 3HUJB 4JFEB 4AT6A 1DQJB 1Q9KA 1T20B 2Q20A 5D8JH 3LD8C 4P3WA 3WEXB 4Q6IA 1CI5A 4P57B 3UBXB 4PJAF 3MBEB 2QQLL 1MUJA 1LP9F 5GRJL 2FIKA 5J1SC 3FFCA 2DQDL 3ARQA 4XP1L 3FO2A 1HHJB 2EDTA 1FSKB 4GUPA 5IBLC 3OR7B 4JHZA 4EZMA 2HMID 2XACC 4Y16D 1NBZA 1DBKH 1B0GA 3JUZA 3LKNA 1K6QL 3IFOB 4GKNA 4Y4KB 5KAQG 5I1GH 5EO9B 4OZGE 1S5IL 5C0BB 4S2SB 5CJXC 4AL8H 3IJYA 2WIIA 4LSVH 5FHAH 4FXLA 3WSQH 1QKZH 4HH9A 4U3HA 3T0EB 3VA6A 4FQCL 3LSOB 1UB6B 1ZHKB 4LU5H 4L4TE 4JQXC 1QFPA 1JMZA 1ZLWK 3MJ9H 5J9PB 1R0AH 2ORBL 5I19L 2DL9A 4NJ9L 4NQVB 5IB4B 5IB2A 4PRBB 5E8DH 4JY5H 4JFPA 1WBXB 5ENWB 3HC0B 5C1MB 4NOBA 2CDFA 1Z0MA 2HLAA 3MJ8B 2ITDB 4XHJD 2HKFH 5I0ZA 3A6CL 3TPKA 2C9AA 3ULVH 2CLRB 4IHOB 4OLYL 4AYFA 1C7TA 1KJ3H 3EJYC 5DA4A 2OZ4L 3BI9X 4Z7QF 1I8MB 4JO4H 3TYFA 1T5XB 4NRYB 2DQIL 4Q9CA 1KTLB 3ZKMD 4GO6B 5ICZA 1WTLA 1B4JL 1FZKA 2Z91B 2BY3A 2YRZA 2V2XA 3JWDH 5C0FB 3GUTA 3VXRD 3IJHB 3WL9B 3EGSA 3UTQB 1QBLH 4XX1G 5IVZB 5BZWB 1VGKB 4LOUC 5MEND 3T3PF 1TETH 4LL9A 1FCGA 2B7DT 1RUAL 2ADGB 3A67H 4HJJL 4NQXA 5EU5B 4N8VB 2UV3A 1M7IB 3UAJC 1NMCB 4AEIH 2G2RA 4LEOA 1WC7A 3WJJA 3GK8L 3QUYD 3UPAA 4FQ1L 2YUXA 1T83C 2IFFH 5FYLE 4I2XE 5GS1B 5HYJB 5DJ8A 2V7HB 5FO8B 3C6LD 5FECA 1J0KA 1D9KA 2V9TA 1QNZH 4HHAB 5ALBL 1BQSA 1UM6L 2DDQH 2FBJL 2APBA 3MACH 5FM5O 2ED8A 3DVGB 1ZLVK 4CU7A 4WUUA 2M8XA 4MNGA 1KCKA 4KDTA 4D0CA 4LIQH 3DGGB 2FGZA 1TIUA 5DD3L 4JFFD 1I9JH 1S9WB 3T0XA 2ZCKH 3THMH 2RR3A 5ID1A 2KDGA 4BM7A 1DLHA 5DJ0A 1M71A 4JKWA 2UWEA 2VDML 1A7NH 3MA9H 1JCKA 1IJ9A 3PWNB 1MPAH 1LO0L 4HUXA 4JM2A 4XNMA 4Y2DC 3T2PA 1KFAL 1RFDL 1GAFL 4DKFL 5IMKB 2I24N 1Q9OB 1JWSB 1K85A 1CFBA 1GGCH 4LVOB 3CFDA 3UMTA 3IS1X 5DHVH 5FGCB 1A64A 1IZKA 2BY0A 4M48L 3FRUB 4R8WL 1PJ9A 1KLGB 3U4BH 1LDPL 2D7TH 1XF2B 2IADA 3IXAA 3HUJE 4JFEE 4K94L 4OQTL 2VL4A 4Y2DB 5FIEA 4U1LA 1MCJA 4N90D 1INDL 4CMHC 2LQRA 4GKOA 1LEGB 3ULUH 2ATKA 5F6HI 1B4RA 3UTOA 3TO2A 4NDMA 3EJZC 1YEHL 4LP4A 4AH2B 2IANB 2CJUH 4PRHD 4GS7B 4ZOAA 3D0LA 3N85H 1IL1B 3PABB 4XMLH 3AM8A 4S1SH 5FXCH 5DMKB 4I18A 4Y5XB 1S8DA 5IFAH 5C0BE 4GRMB 2PCPA 4ONFL 4JFQB 1TJIH 1KN2L 3QHTC 2APFA 3E8UH 1S3KL 4IJ3C 4HMEA 3E6FA 3ROOB 4HUVB 3VI3E 3TBSA 2HFGL 2NY6C 3U4AA 4FABL 4F15C 3R4DA 4LAQL 2F19H 1U6AH 1DEEB 1Q94B 4OCRH 1GGYA 3O6KH 3U9UA 2WBJA 3FB7B 4YXHH 5GZNC 1WQVT 3MOAH 1E6OL 1IAOB 2QKIA 3Q5OA 5GQBA 1XCTA 1MLBB 3MBEA 3VRLF 1OCWH 1K4DB 3VD4A 5D2LA 2Z35B 4KFZC 3RWJA 2YEZB 1VHPA 2YWYA 3WLWD 3WFDL 1GGTA 4OM1H 3DNKA 2XA8H 1BFVH 1KCRL 4L9LC 3IFOA 4MDIB 4XXCC 3KPSB 1LP9B 4JANB 5D7JC 2Q76B 4PRIA 4HXAL 2GT9B 1X7QB 2H41A 3SO3C 3ARZA 2NY7L 3P77B 4LSUH 2JIXA 5CZXC 2A6JA 4XBGB 1JJUA 4JDVB 1I7UB 3HI5L 3EHBC 2V2TB 5FAAA 4EUPH 4OD3H 1EEQA 3G9VA 1CBVL 5HYEA 2QSCH 1P6AB 3H3PL 2MNUA 4NKDA 2GAZB 1RPQA 4YGVA 3PGCB 1RUPL 4NFCA 1QFWM 4QYOA 1I8MA 1KTRL 5AAMA 2LVEA 4R97C 4HCRL 3FQTB 1XF1A 4J3TA 4QXGH 1A7RH 1BX2A 1YJDL 2YZ8A 4N9OB 2Z91A 4P5KA 3T8XA 2R2CA 3WL9A 4NO0B 3CMOL 5BV7C 1VFBB 5KZCB 1A6VH 3EJYD 2FWOA 1HHKB 3I75B 3K74B 5CJBA 5KSVB 3MUHL 4PG2A 5E00A 4G8IB 3S4SG 3QXVA 5HI5D 4UTAH 3DIFB 1EAPA 3IETB 4HIHB 4UQ3A 1I8LC 2ID5A 4NCC1 3TESA 1IT9L 3DX9B 4AIOA 4G6MH 4JHWL 4F3FA 3QQNA 5C2BH 1NANI 4V1DA 1QR4A 5TDNA 1A6ZB 3FTGB 1SY6H 5HYJA 2V7HA 3DETC 4Y7MA 2R29H 1CDJA 1MCKA 1WBYB 1LGVA 4HHAA 1B6UA 1RURH 4KTDL 1DSFH 4ETYA 4MWFB 5I74B 5L2JB 3TBWB 4JEGB 3DVGA 1G7HB 1A4KA 2NY5H 4XC3H 2H45A 4JO2H 4O2EB 1T80A 3B43A 4NQTA 4LCUA 1GYAA 3M8OH 3DPBA 1S9WA 4F58L 3GHBL 3MREA 2WM0A 4N9GB 5F93C 4P2RD 1T1YB 1GPOH 4H25A 4HIJB 3UJIL 3S88H 3W5NA 4QRRB 1I1AD 3QDAA 1U8KA 4QRSA 4XT1C 3CVHL 4KKAC 3ZE0F 2GITA 4M61A 3PF2A 4OFKA 5DJDA 5HYQA 5ADOH 4OCWL 5F7WC 5IMKA 1JWSA 5E95B 2HFEA 2G60L 1OVZA 5CHNB 3AY4C 3Q6GH 5FKPB 4I3SH 4JZOA 7CGTA 4U1HB 4JG1L 5D7SL 3FRUA 5GGVL 1DVFD 2DM3A 4L1DA 1KLGA 4JAMB 1F8TH 3HCVB 5DC4B 4ZFZA 4LPWA 4NUGH 5DUBA 3RVWC 4Q97A 5KANI 1G6RH 4XPGL 2NTFB 3RGVB 1YEDB 3JWOH 5JQ6L 1R3IL 4WY7L 5GRVK 1CL7H 2IANA 4GAJH 3QCTL 3FFDB 4DGVL 3QIUD 2JJSA 1CE1L 5E8PA 5DMKA 3NCEB 3IDJA 5FYLH 3U6RB 4PJAE 4EUPG 1LP9E 1A47A 4FXKB 1IAII 1YMHA 1W72A 2LAAA 4PP1C 3WIFB 2NZIA 1XMWA 4M6NL 4MB3A 3L3OB 5EU4A 1NDMB 5LXGH 3W11C 3V6ZB 3WUWB 4P5TA 2NXYD 4BZ2H 1P7QA 1MRDL 1G1YA 5HHPA 3CVIL 4X99B 4OLXH 2KQNA 3ARBB 1GHFH 1EUTA 1GCFA 1CLYL 3HI6H 1FJ1B 1N5AB 3ZKQD 4XCNB 4UT7L 2AEPH 4IRSC 2Z35A 2XTJD 4PLJC 3IFPB 2GSGB 5LG1A 5GS3A 1ZA3A 2YD6A 4XP5L 4MDIA 4HDIB 3HNSH 1C8PA 5IHZA 5DD5L 3QJHB 2Q76A 1DBJH 5HDOA 1U3HC 4Z7QE 5DMJB 2GT9A 3EW3B 3IFLH 1ZHLB 1LO4H 1E6JH 4NHUA 3UTTE 2I9LA 3RWEA 2AAVA 1MF2L 5T1DH 1YC7A 1WT5C 3KHOA 1UZ8B 2DTML 3RGHA 5GRYA 5GZOC 3NZHH 3TVMD 4HGKC 1RZFL 4IRZH 4PGBB 3L6FA 4HWUA 5KTEH 3T3PE 3TCLB 2MCPL 4Z7UF 1YNTB 3VXNA 4M1CC 3ZTJG 5ETUA 5C0AE 3PGCA 3T77B 1U3HB 1EFXA 1QFOA 3V0WL 5J06A 4ODBD 4GW4B 2IALA 1TJHL 3RFZC 4OFDA 1N59B 2BNQD 3MRQA 4PJCA 1LNUA 4NBXB 4H8WL 2ZUVA 1NJ9A 5DLMH 4E41B 3X3GH 2NW2A 5B8CC 3T0VA 5DD0L 1VFBA 1AGFB 3HRZB 3ZYOA 3QUZC 4LF3A 1FRGL 4G8IA 4KY1H 4MJ4A 1UH3A 4HS3B 35C8H 4N8CL 3OR6B 5D1XA 4WWKB 3IETA 1GH7A 1C5DB 4GAGL 1ZANL 2C3XA 4MD0B 3D85D 4ZXBD 2VQTA 3MRNB 1J8HD 3QEUA 3C09C 5JHDD 2EO1A 4BZ1L 2CXKA 1WK0A 2AV7B 3L7EA 4QRQB 2RCSH 2PW1B 5AZEL 4PJ9B 5LKNA 1U91A 5EA0L 3FTGA 1PYWA 3BUTA 5HD8C 4RMWA 1NFDF 2NX5B 5T3ZL 5KVFH 2LV4A 3PDDA 3TBWA 4GMSH 1QRNE 1GGUA 3STBA 1FFNB 2AS5M 4KXZH 1YEKL 1YNKL 3C09B 3LS4L 3EZ8A 3TIDB 1JZ6A 2VLKB 1CGSL 4A2MA 1OSZB 4FQQB 4GQ9L 2MCG1 3GBNH 2F58H 4QRRA 2IEPA 4X0KA 5CKAA 4PGZA 4WWID 1S7XB 4ZUVA 3GMOB 8CGTA 1I9EA 5IM7A 4WFEE 3SKMA 1BQLL 3WIHH 3PV7A 2VLJB 5JIKA 1MIEH 4KK8D 5IFHH 4Q2ZB 3DGCR 2HT2C 4G43A 3QDMA 4U1HA 1OTSD 3RWIB 4YDKH 1ULVA 4PJEB 4RA0C 1U8LB 1QRND 2IMNA 3P9MB 4I0PA 4Z8FH 3FCTA 5HY9A 4CJ1A 1MCCA 3WNPA 3P0VH 1Q0XL 5EZIH 4OIIL 3RGVA 3RL1B 1T1WA 2LTQC 5HSFA 1YEDA 2VDOL 1R3LA 3G6JB 3RQ3A 4GQPH 2VXQH 4FXGB 1W2KT 3O6ML 4M9PA 3QI9C 5DT1H 4NT6B 1OP5K 1KGCE 3R8BB 2HJFB 3T2OA 3VRLE 2MKLC 2VZSA 3CJJA 4FXKA 5ISZB 1A6AB 3WIFA 1NBYB 1QSEB 5F9JB 2COQA 4DGYL 1EXUB 4ODSH 1SBSL 1YNLH 3WUWA 3ZT5A 3P4MA 1FO0B 2HJLA 5EOQH 1INEL 1J10A 3MYJB 4P4KC 4CDHA 3LH2H 3C8KB 1MHEA 2C1OA 3C60B 4DW2H 2WLYA 3LMJH 1O5DT 2DB8A 1FJ1A 4GBXB 4RISH 4H88L 1U8OB 5EWIH 4MDJB 5FO9B 5AYQA 4Z78B 4FG6C 5D1ZA 2GJZB 3LQMA 4NHCL 2AQ3A 4P9HL 1YMMD 4NP4H 3S35L 3GO1L 5F1KC 3I50L 3OZ9H 1D5MB 3JVGA 1Q0YL 1QG3A 2GJ6D 4EI6A 3QQ4B 1MI5A 3X12A 5L7XL 1JWUA 5KSAC 3VI4E 3UO1H 5E4IA 3RUGF 3KPLA 2GY5A 3HMWL 2A77L 1M7DA 1F4WH 2IAMA 2CRZA 3SPVB 1FORL 3S36L 3BAEL 1TVBB 5LBSH 3BP5B 1DZBA 1G9NC 3TCLA 1YNTA 5K9QI 4P2OB 3D0VA 3KXFA 4I8DA 5C08B 5CAYB 3F65A 3MBXH 4OGYH 4JPVH 1HH9A 3MCKA 3SBWC 5HVWA 3B5TA 5DJ6A 1ZWIA 3WFEL 5KSAB 3S3PA 5CEXB 3SDAB 3AROA 3DMMC 2NX5E 4N8VG 5MEOB 1RULH 1KIQA 2K1MA 5DHXB 1K4CB 2QSTA 4FOMA 5TF0A 5IB3B 2EH7L 3KYOB 2AI0H 2A38A 1YEGH 5DK3A 4YGAB 4Y4HB 3O2WL 4X6CB 4M1CD 4D3CL 3HZKA 3OJ2C 1AGFA 3NFPB 4U33A 2IBZY 4U6VH 2VLKE 4EN3A 4HLZH 5E6ID 2VDKL 5HTSA 5IFJB 4P48A 4GXVH 4YH6A 2VIRA 1GOGA 3DJ9A 4HJGB 4JVPA 4P9MH 3LN4A 1C5BH 1EHAA 4QT5B 4H0IA 1JGUL 2GHWB 1FNEB 2VLJE 1UXSA 4JRYB 2VN7A 3GSNB 1R3JB 2QHRL 4HFWB 1ZSDA 4NQCB 5A1AA 4NYLB 5CP7B 4F57H 2A73A 1P6FA 5SWZD 3ZE0E 2HT3C 5IMLB 5D71L 1UYWL 3W0WD 3DARA 1MVUA 4OCSL 3SE9L 4K23L 1UADC 3DTXB 4RIRA 2APVA 3AS2A 4JZJA 5KVEL 2FJFA 2K3TA 3MRRA 5JDJA 4KAQL 1EEYB 2OP4H 1W0VA 3KJ4B 3NZ8A 2DF3A 1EPFA 2AQ2A 4AEFA 1NFDB 1S78C 4PGCA 1TZIB 2EKSB 2WBKA 1H3XA 1C1EL 1H3TA 1I9RH 4AQ1B 3UX9B 3DROA 3OKMB 3FMGL 3GMOA 4APQA 2E9IA 2V5TA 4LBEA 1CFTB 3QA3A 15C8H 3QCUH 2MPAL 4MQXD 5ISZE 3PIQB 1I7ZB 1G1CA 1QSEE 3QZWB 4PIRF 3BGFB 1FNFA 3ARPA 3G5YA 4JCLA 1XCQA 1HZHL 4KJYA 3BZDA 5F9WC 3L3DB 1FVDB 1MY5A 4KKLD 4X5LA 1K8DA 4PJEA 3MV8B 4U1SB 4XVJL 3QWOB 5K93A 3PWLB 2NY3D 2V5MA 3PNWB 4I4WA 2R0WL 1DN0A 1TPXB 4TSAH 3BP4B 2BMKB 1OAXH 3ET9F 4NKIL 4OGXL 4E5XB 2BVPB 2A1WH 4YIQA 3O4LE 2FZ3A 3U30B 2IC2A 4FA8A 2B1HH 1I85A 5E5MB 3G6JA 1KIPB 4UV4H 3W5MA 2HH0L 3OB0H 4UB0L 4RFNC 5BVJB 4A6YA 3TCXA 2E8YA 2VR5A 4J4PA 1T04A 2LU7A 4PRNA 2HT4D 4RAVB 3MRMB 3C2SA 2DLFH 5HJ3A 3N9GH 3SGKC 3WD5H 3BIBX 5H2BA 1PVHA 1U8HB 1M4KA 2P45B 4YX2H 3BGMB 1CLOH 4Y16B 4NFDA 5E08L 3LEXB 2MMXA 3G5VB 1P4BL 1ES0A 2XN9D 1HI6B 2P7TB 4MJIA 4DTGH 5EORL 4ZUWA 2OL3B 4CADA 3MYJA 4KRLB 1CIUA 2CDEB 4RFNB 4MXQD 5MHSE 5C08E 2CLVB 4M6MH 1HNFA 5C8JB 5A2IH 1U8OA 5F1IA 2W07A 3GGWB 4X6DF 4MDJA 4FZEH 2A83B 3SE8L 5C0CD 4OFIA 2GJZA 4M5ZH 2VXVL 3MUZ1 1N26A 5ESAB 2BVQB 5AD0B 4Z7UE 2A2QT 2OTWB 3H0TB 1RZKL 5EOTA 5F7DA 4QCIB 3TNNB 2B4CL 3PWPD 1IZJA 5IVXE 1YEJL 1IAIM 2R1YA 3QQ4A 4X7EC 4HC1A 4UILH 5A2JH 4N1EA 4KDVA 5IF0B 5IIEB 4KMTL 4OD2B 3UXFA 3BT2L 1G7JA 3DX6A 4JO3L 3SPVA 4X4MA 1FCCA 4LLWB 1TVBA 4HBQA 1IILE 2A74B 3ZDXE 4MHHI 3ARSA 4AM0A 4ELKB 1JTTA 3IRZA 3GMNA 1WFUA 3VXRB 5TJWK 3BXNB 4PGJA 3F7QA 1NSNH 5TQ2L 4CRPA 2EDQA 4LK4A 4Q7DA 4JGUA 4QHMB 3Q48A 4PV8A 5IJKC 4U1KB 2BFVH 5F21B 2OQJA 4JRYE 4XBEH 1X5AA 4PJ8D 1ZK9A 2DKSA 1RIHL 1A4JA 5IJVA 1IGJB 1ACYL 3BX7C 5IB3A 4YHOL 2BDNL 5EUKA 4TOYL 4KVCL 4PTTA 1T6VN 1KB9K 3MR9A 1O7VA 3C6LB 4S1RH 4X6CA 3V52L 3NAAH 4FN0A 1A7OH 2PO6D 1NFDE 3QDGE 4Z5RB 1Q72L 4DK6A 4ZD3L 4FQ2H 1UH4A 1JHKH 3NCBB 3S34L 4PB0L 6FABL 3S96A 5IFJA 1X4XA 4MJ5B 3VMNA 3BKYH 4BQCA 1UGNA 4JFFB 3K8LA 1OP3K 1DJSA 4G3YL 2J8OA 2XXCB 4YBLC 3EAKA 2QR0A 2Y06L 1OW0A 3F5WA 3MRFB 3VXUB 1ETZB 5HYIA 3RWFB 4NNXA 1WAAA 1R3JA 5IMMB 5CEZE 2AXFB 3ZYJA 5ECJE 3MO1B 1F45A 4Y5VA 1RMFL 2H2PD 4BFIB 4DCQB 5HXMA 4D0DB 2GI7A 2VDPL 2EEAA 1IQDB 1OLLA 3MV8E 5C0EA 2ICCA 4QRUB 2BNUB 2DAVA 4FQJH 4KKBC 3WXVH 2R1XA 2DM2A 3MRJB 3QIWD 4OM0L 3A6BL 1PG7X 4HS8L 2QQNL 2K7QA 3FONB 1WZKA 5ALCL 3MOBH 2OJEA 3WKMH 1VGEH 4YXKH 5DUPH 4DKDC 5IMOB 4HIXL 1FFOB 2X4NA 1B88A 2MWCA 4YBLB 5GGUA 4L4JA 2EDYA 3RY4A 2DQUL 5EBGA 5I0DA 2FRGP 3SDCC 3T4YA 2CUMA 2HT3D 4OKDA 1IBGL 1NCDL 3VW3H 5T1KA 5IGXH 3MV01 4IDJL 4U0RC 3QDJD 5HGBA 1OGAD 5ERWB 4UDTB 1AJ7L 3MLZL 4XP6H 4IM8A 1KG0B 1MQKL 3PIQA 5FF6B 3GMQA 4ERSL 2ED9A 3O9WD 4PRHB 1CDYA 4WHDA 3OPZH 3EYFB 4YDVA 5JW4M 5DJCA 3CU7A 3L3DA 3LKRB 1DQQB 4HQQH 3LS5L 4NQDB 4R9HA 4U1SA 3M1BA 1NUGA 2BJMH 2DI8A 3S37L 3SDCB 3PNWA 1NCNA 5TE4H 4QRPA 5A2KH 3QULB 3VFTB 3QEQB 4N68A 1UJ3C 3D25A 3SHSA 1XIWA 3NGBC 4URTB 1BVLA 1PLGH 1ZT4B 2DQTH 3RU8L 3WUWG 3X13B 3UC0L 3VXMB 2P8PA 1XGTA 2VMFA 5DEGB 2VAJA 5D7IA 4ZUSB 1TZGH 1LDSA 2ZOLA 3O11B 1T0PB 4XMKL 4XVTH 5T5FL 2E9JA 5L6YL 3SDYH 4RAVA 5FYKL 3HPJB 1A02N 4TUKH 3MSPA 5INCB 4CNIB 1LK3H 2BHZA 3BZFB 2AEQH 1BD2D 4Y16A 4Z7VB 1A14H 4G6JH 3U48A 2G5BA 3HS0B 3G5VA 1NCAL 1FNLA 1HI6A 3FQXB 2A6DA 3P11H 3RUGE 4YNYB 1GC1C 1L9MA 1QPPA 4IIQB 3W9EB 4F9LA 3GSOA 3VGGA 1F4YL 3FQNB 1JF1B 2F54E 5EZOH 5C8JA 1F4XL 2QLVB 2XZAH 2A83A 3TBVA 3MNWB 4FQPA 5HI3C 4H0GA 2HVKB 1SEBA 5KW9L 3L5IA 3MPCA 3U0PA 3MLVL 5FCUL 5ESAA 1NMAL 1UB5A 4LHJB 3H0TA 1EJ6A 2R4RL 2BVYA 1F11B 2QL1A 4QCIA 2APXA 4KROB 5IBTL 4DVRL 1DQMH 5IG7A 2DBLL 4M7JL 2GCYB 4K71C 4X6DB 2YPVH 5C07D 3UJTL 2DWEB 3L1OL 4G5ZL 3CFCL 5GS0L 5TPWL 1MREH 1FO0H 1I4FA 4OZGA 1BF8A 3KPNA 2A74A 4V2BA 1S9VB 1LEKA 1AXIB 1EX0A 2J6EL 1OARL 4F7PB 2EEBA 3BDBA 4PBXA 2ESVD 3WYRA 3HE7C 4LDLB 3GJEB 3ESUF 4PJ7F 1V8HA 4B7LA 5MENA 2AP2A 3IDIB 4PS4L 1DQTA 3FB6A 2D4FA 4XP4H 4F7TA 4HX1A 3VXUE 1QD0A 4HWNA 1JGVL 4WI6A 2R0ZL 5FYJH 5JPNB 4YUEL 1CT8A 3R0NA 5DUML 5FOBB 2NXZC 2X4RA 3QUYA 1E4XI 5IK3B 2D7OA 4OF3A 1VKXB 4H26B 4KUCF 5FK9A 3CSYB 1EEUA 2XQYK 3C6LA 3VXSE 3NCCB 2CKBL 1KC5H 1AP2B 3VFSA 3CC5A 4QHNB 3PP3H 1OAKH 1KEMH 5DEFB 3TIEA 2PYED 3EUUA 3VG0L 5JORB 2DWDB 5T3ZD 1S9YA 3PGDA 1GSMA 1JGEB 4YFLI 2W9LA 2X4QA 2XNAB 3C8HA 4X7DC 1AC0A 5CGTA 4RMSA 1I3VA 2NXZB 3GB7B 3QO1A 5JUEL 1D3CA 5JHLH 2OSLA 4BK5A 4LQFH 2P5ED 4DKAA 3MRFA 1ETZA 1OLZA 3SCMC 4NO3B 3DVFA 2IGFH 2AXFA 3NFNA 3CDGB 3KYMB 3RZCA 1EMTH 4NQDE 1DQLL 5MP6H 4JZNB 3RVXC 3ETBF 2W0PA 1SYVA 5GRVL 4XGZA 1VFAA 4JQVC 3MRJA 2XG4A 4KK5C 5LAXB 3WO4B 5JZ7D 5HDBF 3MRLB 4XTRD 3QEQE 4O2CB 4LRNL 5FUOL 1FFOA 1ONQB 4OJFH 3VXME 1FPTL 1QRKA 4QHLB 2DYPA 4K55A 3CPLB 3VXQB 4MZ3A 1X5IA 3CSBA 3R06B 1TQCC 1PQZA 2DQCL 4KKBD 2XICA 3E3QC 4JFDE 5D7LD 4LMQI 3D5OF 1FZJA 3GKWH 3GSNH 1MCSA 1P1ZB 3OTTA 3QNXB 3U0TA 3U83A 2P48B 5CJQH 4KQ4H 3P30H 3Q5TA 4NKQB 1ZVHA 4M1DL 3DRTB 4NOFA 5MI0C 3HC3L 4PRHA 1EV2E 3P9WB 5D70H 4OF0A 1T03H 3PQYE 5IROA 4U1NA 3LAFA 4UT9H 3GNMH 2C3VB 1EO8H 1RUKH 4D94A 4TTGA 4LPYA 5T33H 1AHWC 2BXZA 3TN0C 1SHMA 1BOGA 1JWMA 3S8WA 1U58A 2AJYH 3QULA 4MB4A 1TQCB 1EJOL 1CR9H 2NXYB 1S9XA 5CD3B 3K81A 4P59H 3HMXH 3PHQA 3SE3C 3LPFA 4G6AD 1BBJB 2FEEL 5F9OH 5DHYA 3U46B 5GRWA 2IPKB 2DLGA 2VNCA 3O11A 4DKEL 3VFUB 4K7PH 1NLDL 5EU6E 2R2EA 4X6DE 4HK3J 2W0FB 3PDOA 3SDXF 4F7EA 5CEZH 1YEIH 5K9KA 3QNYB 2WLZA 2XTJB 3MXVL 3OKDA 3TN0B 4CNIA 2R8SH 1KB9J 1Z3GL 3BZFA 5DS8B 1IGFH 2GK0A 5B39A 4ZQKA 4XCFH 4NZJA 5D5MF 1L7TL 4KHTL 5BVPL 1FC1A 5I8OL 1OAZL 3FQXA 4JDTL 1FVCB 4JKPL 4LLVA 4FFVC 4YNYA 1D6VH 4IIQA 2E7MA 5KSBF 2P8LA 3P4OA 1IGIH 5IHUH 4H5SA 1BP3B 4ZOEA 4QXUL 3FQNA 1CU4H 2CPCA 2DQHH 4JQIH 1A1NA 1WBZB 4HW6A 3MNWA 4S10A 1KCVH 3MJ7A 5HHOE 4OLWH 2EXWC 3TVMB 4GG6F 4NN6B 3V0AC 4YHZL 4RGND 5TE6H 5GJTL 4OCXL 4PD4K 1SYSA 1A1OB 5CJXA 2FX8H 1KENL 1JE6A 4EBQH 1FLRH 5HGGS 4ONOA 5D72H 2QTEA 4JQXA 4M8QA 5I15H 1AE6L 1C08B 1QBAA 5DEZA 3N1MC 5FHBL 5HBBA 2EH8L 3GSVB 3I9GL 4KJWC 4X80L 3AXLB 2BVOB 3L3HB 4LLUA 4U1JB 1A6UH 5B4MC 2OL3H 1CFVL 2VLLB 5IR1B 5DJXA 1HSBB 3KLAB 1TCRA 5EC2B 4DQOH 4G8GD 1N6QL 5JIPA 4B50A 5L8LB 5CP3A 4KDWA 1G0XA 1G9EA 2AK1L 4MS8C 1R5WB 4YAQA 3OWEA 3HR5A 4PJIF 1WZLA 5EG6C 5GJSL 3BPLC 3DRQA 4ZXBB 5E2VH 5IOPA 1W8OA 5JHDB 4PJ7B 5FOBA 1V5JA 1TTUA 4X7SL 3I6KB 2FYYB 5IK3A 5H35A 1BLNB 4XRCB 5ILTL 1QLFB 4HJ0C 3LDBC 4RAUB 2FX7H 1DFBH 1NC4A 4QHNA 3VXPA 3IXTB 4TVPL 3BYTA 1BZ7B 4L4VB 5DEFA 1ZVSB 3TJEH 3WFHB 3O3EA 3JTSA 5EBWA 1BBDH 3ARDC 5F44A 3OJMB 5MERB 1GOFA 1S7UB 3M07A 5I16A 3SDDD 4LKXB 2XNAA 2OR9H 4JPKL 3V7AE 4JR9H 3FT2A 1JPFB 1XH3A 3EOAB 4PB9L 4FFYL 3I6GB 3GB7A 2J1KA 4LSRH 3KWWB 4P2RA 1YYLL 5GGTA 1YPZA 5C6PB 3LKOB 4OD1L 2R0KL 4OFYA 1I1AA 2XWTB 4PUBL 3TJHC 5ADPL 3SGDI 3UTPE 3QG6A 3RWCB 2J88L 2X4OB 2D2OA 5CGYD 1KPRB 3NMEA 1X44A 3ARDB 2JTDA 5TE7H 1YY9C 2X41A 3MRLA 1N8ZB 3QZWG 1MEXH 1AQKH 4O2CA 4Z76B 4J7RA 3E3QE 3CDYA 1ONQA 5KG9B 5HGHB 1DVFA 4CN4A 2Q8AH 3TWCL 4H1LB 2VH5H 5DR5H 3K2UH 4UTBH 5I1EH 1RVFH 1JHTA 4XI5D 3Q3GB 2JCCE 5A2FA 4RWYH 2CR3A 3CD4A 2YR3A 2D7MA 1FL3B 1IAKB 3QNXA 4X8XA 3EYOB 3MNZA 5DSCA 3SGEI 4M03A 1ZTXH 4X9FA 2AK4E 2QQKH 2XY1A 3TA3C 4C55A 4XBPA 4J8RB 4GW1B 4G9FE 4KHXH 5A16B 3QIUA 2JB6A 3KPQB 3MRGB 4U3CA 4U2YA 3D1MC 4MGXA 4RMTA 4GOSA 1CDCA 4IBLT 1FE8H 1XR8B 5EZLB 3FL7A 4UT6H 1X5YA 5D1QC 4BUGA 3RIFK 4U3XA 1U8PA 4O4YL 3NACH 2F5BH 5JXED 1NUDA 3U7WH 1PKQB 2LABA 1FNSL 3QWQB 3BQUC 3PL6D 4PJGF 4MD5B 4XPBH 1I7TB 2VQ1A 5GISL 1VACA 4K2UH 1KJ2L 5DFVD 2X2YA 3WDJA 3W9DA 5IT2H 1ND0B 4NPYA 1EZVY 2VO5A 5K9JH 3VFUA 1XF3B 5DVMA 1DCLA 1HOCB 4QWWC 1PG7W 1T89C 3DHJA 3RWHB 5F71A 1U8NA 3OXRB 4MA1C 3RNKA 4PGDB 5EPMB 2FD6L 1AGBA 5BW7A 5IESL 1S9KC 3DX8B 4Y8AA 4ZFFB 2GJ6B 4MXWH 2FL5B 3BQUB 1MAKA 4NZUH 4M3JA 1FVCA 5ITBH 3WHE1 1DBAH 2AJUH 4IEFB 4NJAH 1MIML 1C12B 1UZ6F 1LD9B 5D5MB 3OJVC 1JUFA 1RU9L 5FGRA 3EOBA 3TVMA 2JELL 3QG7L 5E8EB 5GIRB 1RZIA 5L0QC 1UG9A 4S1QL 3QPQC 4UOW0 4L9LA 1QQDB 1MH5B 4PJ7E 4XXCA 5KSBB 4GMTH 4GW5B 4WEBL 4G6KH 4MCYB 4IOFC 1P5VA 4KTYA 1QSZA 4QLRA 3UCRA 4BSJA 3KNBA 5F6IC 4GG6B 1C08A 3K1DA 4L4VE 4OAWA 3AXLA 4YO0B 2NY2D 2BNQA 5JOPD 2VLLA 3NH7L 3OL2A 3W2DH 5IR1A 1Y0LB 4G7VH 4WNQB 1HSBA 1MNUL 1T1ZB 3NCJL 2DM4A 4NWTH 3FT3A 4ZSOE 5I8KH 4TQEH 3I02B 4P23D 5LGHL 3ZMRA 1EHXA 2WAHA 1T2QL 1AIFB 4L3CA 3P73A 3TT1L 3BEWA 1UCBL 4QY8B 4WO4D 4MNQD 2YMXL 3WNMA 5F6IB 2J3SA 1QO3B 3ROLA 1AO7B 3D85A 4ZXBA 5B4MD 1J8HA 4U0QB 3UYRL 5D96B 5JHDA 3HB3C 2FHFA 1ED3B 5C0AA 1TVDA 2ARWA 3I6KA 1QSFD 2FYYA 3MZGB 3D87B 1CN4A 2VKXA 4W4OC 4PJIB 4XRCA 2E7LC 1GC1H 1QLFA 2B8OT 5TDPB 2Q86B 4EQ3A 3OKLA 1VADA 5C6TL 4HGWB 3DBXA 4FP8H 3HLAB 5SWSD 1BZ7A 3HE6C 2IBGA 5FUCE 1KLUB 2L7UA 1WZMA 2CUIA 4G8EB 2DQGL 5KS9F 3WHE0 4ZAKC 3REWB 3V4UH 5JNYB 1TZHA 1S7UA 1NMBL 5HDBE 1TQBB 1X5JA 4LKXA 2H2SD 2CGRL 2P47B 1P4IL 4IMKA 3R0MA 3I6GA 3L5XH 3LEVL 3VWKC 3V6FB 3QQ9C 3VGEA 5I75B 3FFCD 4R96B 1EGJL 2ZZUT 2WWKO 1YZZA 1EO7A 3VGBA 1U93A 2VSDA 4PRPB 1G0YR 4X4XB 1F13A 2EC9U 4TN9A 4HT1L 2VRAA 3RWCA 4B53A 1WWAX 5DFWH 3U7YL 5IP4A 3BRDA 1NEZB 3QISA 5T3XE 4DOHE 4C56E 3LY6A 3O0RH 4HXBH 2PKDA 2YSSA 1OGTA 4I9WD 5EDXA 1LO5B 3FOLB 5DQ9B 5CGMA 5I17B 3NIFF 4D8PA 4U1MB 1ZS8B 3MLSH 1UKTA 3MODL 4PJHF 5HGHA 1G0DA 1UXWA 1QRNA 1IC5H 4IS6B 4H1LA 4HKXB 4PR5A 2ZUWA 5DYOA 8FABB 1OPGL 3DVNA 4O51B 2N7AA 2HJKB 3T08A 1E4KA 1C5CH 4PD4J 4BFGA 4R2GC 4NFBA 3BZEA 4LNRA 4O5LL 4F9PC 1F3JB 2VUOA 2NY4D 4WUKL 3HZMA 3KPQA 2AJSH 3GJFB 4EI5C 3PXJA 1ZV5A 3IU3A 3MUY1 3IU4H 3S35X 1HSAB 5EZLA 3ILPB 3SDXE 2EZ0D 4RGMC 3FO9B 5FYKD 4OSUL 3HRPA 3RPIB 3BKML 2CO6B 2Q7YB 4MSWA 2NYYD 2AVGA 2WUCH 4JFOB 5CLTA 4FNLH 4MA3B 1KB5B 3C6SA 2WQ8A 4OUUB 1AI1H 5C09D 3T0BA 4ZO6A 1PKQA 3AMLA 3K3QA 4GG8B 2E27H 2FR4A 2XN9B 5DVLA 1IFHH 5T1MA 3IDXL 1I7RB 2H6PA 4JO1L 3QYCA 5KSBE 1IQWL 5AYUH 5EOCH 3TT3H 1WTGT 4ISVA 3TZVC 5IQ9B 4EI5B 2Q6WB 3O45B 1XF3A 5GGQH 3DUHA 2ENYA 1OD9A 4ORZC 4GG6E 4HUWB 1PDKA 1JPSL 4OGAC 1DL7H 2X6MA 1YMMA 4Z95L 5EPMA 2Q8BH 2C1PB 2EKJA 1F90L 2YA2A 1A2YA 2DQEL 3PWPB 2GJ6A 1PZUB 5AUMB 2FL5A 4L8DA 1YQVL 1JN6A 4WUUD 2RFXB 1RHFA 5I1KH 1RZJC 2AXGB 1NAML 2UVEA 2OZ4A 1JYXA 4X98A 2E7BA 4ALAL 5E2TH 1YECH 4X7TB 2DMBA 3TZVB 5GS0D 3QUKA 3T4AB 4IRSA 1C12A 1R5IA 2ICWA 4I48A 2I9TB 1CG9B 3KJ6L 4R7DA 4JM2D 5GIRA 1AO7E 1YDPA 5I1CH 3QUXC 4OI7A 4GW5A 2B5IB 4N0YH 2YS4A 3JUYA 4PJIE 3MXWL 3BZ4A 5J1AB 3INUL 3B9VA 1G7MB 5BZDB 2BHUA 4PJ8B 2XXMB 3S5LA 4AZ8A 2Z92B 3D9AL 3QB7C 1WT5A 4M3KB 3ARUA 5LWYH 4G8FB 4LRIA 3F12A 4YO0A 1A1MA 2VISA 5FYKU 3JV5A 3GDBA 5D8JL 3S7GA 1T1ZA 3B6SA 3GMRA 4CW1A 3I02A 4N0UA 5EIVA 2PO6B 1I1FA 4FMKA 1A6PA 4LVHC 3VFWA 4HF5H 5E6IA 2H26A 3MUGB 2ZOKB 4OZHF 4PRPE 5I8EA 3UDWC 1DBKL 4TVSa 5A2LH 3DHMA 1IGMH 3BW9A 1NCTA 2VZ3A 5I1GL 1NBVH 3F58L 5E24E 1UM4H 4AL8L 5FHAL 4LPCA 4LSVL 1CK0H 3WSQL 3X3FH 3O3BB 3U1SH 5B8CA 2GTZA 3OB0K 3GSWA 1MAMH 1PEWA 5FA3B 4OZIB 4LU5L 2GYSA 2E8ZA 3GSUB 2CRIA 3MJ9L 3H6JA 5DJ2A 4G9DB 3SQOL 1BOYA 5SWZA 3SKOB 2HLFD 3CK0L 2W9DL 5F3BB 4QOKB 3W0WA 4G8EA 3ARVA 4HUKB 1E0OB 2HKFL 4A6YL 3REWA 3IS0X 3QAZC 5CIPA 2WBJD 3ULVL 5KAQF 1ZAGA 3LV3B 1OTUC 1UWGL 1CL7I 4N1CA 3V6FA 4JO4L 2PN5A 2D9QB 1RJZB 2A6IA 4NRZA 5E2UH 2R2HB 3MRHB 4G80B 1GXEA 5J6HB 4X4XA 1T66C 3HE6D 1FAIH 3TFKC 5FGBC 3JWDL 3QDJB 1QBLL 1XFPA 1NEZA 4KQ3H 4PRID 4TULH 5DO2D 3DX7A 2D4DA 2GIYA 2YC1B 3AB0C 5TF1H 4Q0XH 5F7EH 5I30H 2ATPA 4JLRA 4N8PA 5I17A 3BUYA 4Q9BA 5I73B 5IKCB 3N1QC 4Z7WF 5IQ7H 3A67L 2JIXD 2F53E 1O0VA 3JV6B 2B0SL 4AEIL 4HG4K 2FB4L 2GTWB 2C26A 5C92A 1RD6A 3EDKA 1TITA 4M6AA 1MQ8A 2HTLD 3KGRA 2IFFL 4ZG1A 5E94A 2FECL 5C0DB 2VXTH 5HHMD 4O2FB 1W0YT 1MFAH 2ZNWA 4ZPVB 4PJHB 4UINH 1N5YH 4PJGE 1QNZL 4XZUB 1BVZA 4XPHH 1D5BB 3HNVH 2GFBB 1KPVB 2DDQL 5C0JB 4IMLA 3MV9D 2WWKT 3MACL 1GIGH 4DGIH 1KXTB 3EDFA 1FH5L 5TH2B 2X4SA 3KS0H 3DXAE 1JP5A 2M26A 4G7YH 4Y89A 2V7NB 4NNYA 1I9JL 5DK0B 5JW5A 2ZCKL 3THML 5IB5A 4XVUD 3Q6FB 5DJZB 1MJ8H 2W65A 1LO2H 2Q7YA 3KDMA 1BD2B 3Q1SH 4JFOA 1A7NL 1BZ9A 3BP6A 1ZT7B 3MA9L 4R2GD 3WN5B 1X5LA 1MPAL 4MNHA 4OZ4B 2XN9A 2ZP0T 4DN4H 3UBXI 1RK0B 2BVEA 1T4KB 4BQ9A 5EN2B 4JRXE 5C70A 4JY6B 3BWAA 3ECBB 4FQIH 1WFOA 5BO1H 4V1DD 2J8UF 2VZOA 1IKNC 1K8IB 1T0MB 1UZ6E 2Q6WA 2ZNXA 2Y1VA 2QADC 3IF1A 1DE4B 4OBRA 2Z8VC 4X4YB 1A22B 1JNHB 5C0CA 3RL2B 4MVBC 3K46A 4TSBL 1KBGL 4OIBA 4AG4L 3ZHDA 3LQAC 4DWHA 2ED7A 4OCLC 3U4BL 3VG9C 3OGCA 2C1PA 4K07A 1QVOA 5T3XH 5GRJH 4E42B 1H5BC 5C07B 3V5HB 3L3IB 4OZFB 2AJZB 1X5FA 3BVNB 4J3XA 3T09A 2AXGA 1G7PA 3SKJH 3ULUL 1ZEAL 3BESR 3WDIA 4X7TA 3U82B 1Y18B 2D7PA 2CJUL 1DEDA 3T4AA 1RHHB 1S5IH 3N85L 4XMLL 4S1SL 1MJJA 2ESVB 5IFAL 3BH8B 3PV6B 3JTTB 1XAUA 1DP0A 2CK0H 2CLZB 3E8UL 4PJ5E 5I8CB 2ORBH 3ES6A 2NY1C 1H5BB 25C8H 2YPLB 3RNQA 4OGZA 1U6AL 5I6XB 4G8FA 2FO4A 4OCRL 3A6CH 5IVXA 5ELIA 3O6KL 4OLYH 1T1XB 2B1AH 4J1UA 3F7RA 3W82A 4MAUH 1MWAB 1OCWL 4LCCA 4QXTB 3C5ZC 5ESQA 3ZKSD 2PO6A 5CWSB 2X7LA 2DQIH 4KKCC 3NBNA 4LCIH 2FJHB 4TVPD 5CILL 3MUGA 5KS9E 4O00A 3DMMA 3OX8B 4OM1L 2XA8L 3BD4A 3T0WA 2YPKA 1TCMA 5IV2B 1I3RA 4OF7A 3D69A 3ARFC 3OB8A 1SJEA 2A0LC 4MA8H 4GRWB 1T5WB 3WNOA 1GGIL 4OZIA 1FN4A 4G6FB 4WFHD 4FFWD 4P5TD 4X9GA 4G9DA 3C5ZB 3PHOA 3EFDH 3RTQC 3CVHA 5F3BA 4PG9B 2X1XR 4ZS6C 2BCKB 3GHEH 5EUOB 3BKCL 4OD3L 4HSQA 2QSCL 3PHSA 3IDYB 1JV5A 3QIWA 4P46C 2YBRB 3SY0A 3MRCA 4XNYH 3G5XB 4HMDA 3RAJH 4ODXA 2F8VA 2W59A 3Q2CA 5HGAB 3AS1A 2BXYA 5J12C 4G80A 5HI4C 4PJBF 1INQB 4H1LG 1A7RL 3QPXH 5J6HA 2OBGA 3GRWH 3HC4H 4PP2B 3OKEB 1AGDB 1OGAA 3NA4A 4AIZA 5I71B 5D2NC 2BRQA 2VDMH 1BJ8A 4OBSA 1A6VL 5HVHC 3BIAX 2N1KA 3CZFA 2YN5A 3O9WA 4WW2B 5FGSA 5DDHB 1JGLH 2DS4A 1GAFH 5DC0A 1QBMH 4ZOBA 5EZJB 4UNTA 4PV9A 2Y5TB 1A9BB 1L0YA 2YUWA 3K4DA 5J12B 4KRNA 4NKOA 4G6ML 5I1LA 5LJYH 4RSVA 3DV6B 3TH2T 3KLSA 3QXUA 4YQXL 1HQ4B 5C2BL 3PWUB 3B9KB 4PJDA 1VEMA 1SY6L 3WLBB 1H15A 5ICYB 2EEDA 2R29L 1J05A 3RRQA 3ZKNC 3V7MA 1D5BA 1RURL 5EH1A 4K94H 4OQTH 3VXOA 1U95A 3GSRB 5C0JA 5JPMA 4G42A 4N5EC 3RVUD 3IRPX 4ZTOL 3O6LL 2ZKHH 4XC3L 1RAMA 4JO2L 3DI2B 4LARL 2VTFA 3M8OL 2ZUYA 2NY0C 3O2DH 3MROB 1GPOL 1YN6A 3S88L 4BYHA 4LPTA 1R3KB 2I5YH 1MHHB 5C2UB 3SJVB 3VFVB 5D1XD 1KJMA 4K7FB 4ZS7H 1G7LB 1AXTH 3G9AB 4R4NC 1E28A 5EN2A 5ADOL 3PP3K 3ZE1F 5F7LB 1QFUL 3VFGH 2BSED 4CVUA 4FABH 4MYWB 5EO1A 1K8IA 2J5LC 3Q6GL 4I3SL 4Q9QH 3L3JB 3HZYB 3ZZ1A 4X4YA 2WV3A 3MRBB 3AAZA 2ZUQC 4ORGA 5MEPB 2R9HC 3K4AA 4LMQE 1MCIA 4KKNA 3L9RA 3VE0B 1I8IB 3GJFH 1R24B 1PZ5A 3ISWA 2YD8A 1KCUH 4EJ1C 4WFFD 4L3AA 4E42A 4NUGL 1OT2A 1WZ1H 4JFHD 1HILB 1G6RL 1AXSB 3ARWA 5C3TA 1BIHA 1GZQA 3BVNA 2XWBA 4LLYA 1CFSB 5JMRA 5L2KD 3JWOL 4Y1AB 1KB5H 5GGSB 3P3YA 1IEBB 5CMAB 1CL7L 1CGVA 4GAJL 5ICXA 1XZ0B 1MRFH 3VXTB 5ACZB 3T3MF 2IF7A 1MCPH 3BO8B 3ARGD 4G8GB 5EU3B 2NY7H 4W6YB 2C4FU 4UBDD 4RWHA 2X5PA 2PXYC 3JV4A 2G5RA 4U7KA 1IVLA 5D7KE 1XGQB 5I8CA 2OCFD 4OZHE 5LXGL 1QLRB 3HI5H 4BZ2L 1ORSB 4CVZB 3PGFL 3DLQR 2HRPH 4M8VA 3QDMD 3ZT6A 2UUDH 3QUMH 3H3PH 2RB8A 3BPCA 4OLXL 5F3HB 4WCYH 1BF2A 3QFJB 3HI6L 4HS6B 4HG4J 2GW5A 2CIIA 4FMFA 2VLRD 4YHKL 2AEPL 2J8HA 2AKRB 2R2BB 4D9RD 1MCDA 2NY1D 3QH3A 3T65B 4HCRH 1P69B 5JW4Q 4ZO9A 1T3FA 2BNRE 1J88A 1DUZA 1YJDH 3V95A 2PYEA 5DQJB 5ABDE 2YWZA 1FFPB 2CR6A 5IV2A 3HNSL 3DO7B 4ODUB 3SDDB 1M6OA 3HG1E 3AFLA 4HV8B 3G6DL 5BRZE 1DBJL 4P2QB 3TYGH 2P5EA 1E6JL 4ELMB 1RZJH 2FBOJ 3RHWK 5T1DL 3IJSA 3VRJB 2CKNA 5BS0D 2Z31D 4C57C 3EYSH 5C0RH 1IT9H 4C54A 1UKSA 4X6EB 1MFBH 1NAKH 4IRZL 2DMKA 3JZ7A 4PY7B 2HN7B 5EUOA 4O02H 4Q74A 5C3LD 1NEZG 4U6XA 5BMFL 4PLKC 4NZDA 5DJAB 4NQEE 3TC9A 4Z7WE 5D2NE 5GSRA 2ICWJ 1J86A 5LVEA 5HGAA 1WWCA 5CSZA 4FTVB 3T0DA 4NO5A 1JGDA 4LKCA 3PJSA 5DLML 3OKEA 3QIBC 3REVB 4F58H 2FGWH 3PXHA 3X3GL 4PPTA 5D7LA 1MI5D 2HWZH 3DV4A 4XX1E 3UJIH 4JREC 5BJTB 2WZPD 4WW2A 3G5ZB 2IAMD 2IBZX 4KY1L 4PJBB 1QFHA 1FC2D 4C4KO 35C8L 4KGLA 2MSPA 3D2UD 4R3SA 3SJVE 5EZJA 2LFGA 4OFPA 1RZGA 1OTTD 2Y5TA 3T1WA 1CE6A 3LPGA 4FZ8H 4NQED 4WTZA 3KLDA 4U1IA 2QSVA 1AD9A 1QYGH 1HINL 3QIBB 3E6HB 4Y19B 4YWGH 5GGVH 2R56L 4I5BB 5GS2D 2FEDC 5E6ZA 3ZKXB 1HXYA 1KXVC 3D3VD 4UU9B 2EYTB 4UMGA 4QO1A 4RMUA 4YR6A 5KVFL 2X4TB 4ZTPH 3B4NA 2PYFB 4JFDA 4WHYG 4LCWD 2H3NA 3VJ6A 1DBBH 4GMSL 2J8UE 1XF5A 1F2QA 1NGWB 3CIQA 5KSUB 1CDUA 3I6LE 5C6WH 4R7NB 2FX9L 1L0QA 1UJ3A 4Y1AE 1HHHA 2X4UB 3C5SB 2ADFL 2C3HA 3S4SB 3CX5K 3V4VH 3GMMB 2UWEF 1CE1H 4EN3D 1A3QA 4XNXH 3G08A 2F58L 3QEGH 1MHHA 4OB5H 3DYMA 3VFVA 1D5IL 3UTSE 3OKKA 4WV1A 4ESKA 4K7FA 4YE4H 4ZPTA 2ZUUA 4HUMB 4XPAL 3S97C 3QNZA 3WIHL 3SKUD 1KEGH 1CXHA 2BVTA 5E8NB 1MFCH 1MIEL 5IFHL 3IKCB 5IW6B 3L3JA 3LVEA 4D9QE 4YJZL 4Y4FC 3WFZA 4UDUB 1I8KA 5BQ7B 4WU5B 4YDKL 1R3HA 5GGRB 4GRLD 1JYVA 1CLYH 5EU6A 4QHUB 1MLCA 3ZDZF 3I6LD 4R0LB 2NZ9D 3QFJE 1E4XH 1HILA 3P0VL 3VD9A 1EDQA 5EZIL 5J13B 4E9LA 3H9SE 4I13B 3CLEH 3MOQA 5GGSA 1F3DH 3V8OA 1XZ0A 1NH6A 3WXWH 2CUHA 3VWJD 4Y4FB 5DT1L 2P5WD 4FQXD 3EO0A 3W39A 1KN4H 2EXYC 4G8GA 3NN8A 4APQD 2UZXB 4HK0B 4KRPB 4P23B 4P2QE 4PRDA 1MF2H 1V7NH 1XGQA 2DTMH 3MX0A 4WO4B 4ODSL 3V5DA 1YNLL 3S3JA 1FHGA 1ORSA 4HKBA 4WRLA 5F1NA 2W60B 5SV3A 2IQAB 4Q6IC 2YN3A 1PSKL 2DJ4A 4DW2L 3LMJL 1VPOL 4OZFH 3O3AB 3HZVB 2MHAB 4BELD 1UA6H 3HE7A 3ZYZA 4JN2A 3KAAA 1UH2A 1XGRA 1D5ZB 5EWIL 4NN5C 4OTXH 1X5XA 5D2LF 4L8CA 5J11B 5DQJA 2J2ZA 4FTVE 4M1GH 2F8XC 4AT6B 3LN5A 3LQAH 5IEKA 4HKZA 3G04B 3QO0A 4J4PD 4MD4B 4ODUA 5J1TC 4Q6IB 3ULVD 1BM3H 3MCLH 1MUJB 4KWUA 3UO1L 3WE6B 3FFCB 2O61B 4WENB 1F4WL 2KBGA 3CLFL 4KJQC 3BIKA 3FO2B 4NZRH 1Y6KR 1GGBL 4YPJA 4PJBE 4OT1H 1P7HL 4GUPB 5LBSL 3NABL 4AIXA 1B0GB 1CGXA 3LKNB 4GKNB 1BQHA 4OKVA 4PY7A 3IJYB 2WIIB 4AJ0A 2XTLA 4HH9B 1MWAH 2NR6D 4IRJC 2Y6SD 4LIQE 1PAMA 4OGYL 4JPVL 1OF2A 2RGSA 4QKXB 3SCMA 1FYTD 4LP5A 3NFSH 3UYPA 4NM8H 5CD5C 3VGAB 3MJGX 4XWOD 1RULL 3DO3A 4JFPB 2HLAB 2NY5C 5SWQA 1YNKH 3LS4H 2AI0L 1CD1A 1YEGL 4JQVA 1RIUH 2XKSA 4K7PY 2E6JA 5HHQA 4RFEA 4U6VL 2MTPA 4XXDA 3QCVH 3TYFB 3WJJC 2NY4B 3DYOA 5ICZB 4LFHD 4O58H 1G9ML 1BQLH 1FZKB 4GXVL 2V2XB 3GUTB 1F6AA 1AFVL 2Y25A 4M5YL 4YEFA 4P9ML 1C5BL 5JOEA 4KJPC 4RZCA 3C9NA 3CH1B 5JXEA 3AU1B 2APWA 4JVUA 1HYSC 4F57L 1D6EA 3PL6A 1ZKAA 3EYUH 3ARTA 3MV7E 4NQXB 4Q6YA 2NLJA 2JCCA 5HDQH 3ZE1E 2G2RB 4LEOB 1WC7B 1WVZA 1FBIH 5E1AA 1NGWA 5KSUA 2OP4L 2L7JA 5DJ8B 2AK4A 4OLUH 5FECB 3WNNA 1D9KB 1NC2D 4R7NA 4ENEC 4ZFOA 1JPGA 2Q3ZA 4HZLA 1WEJH 3BJLA 3CSGA 3X17A 3E1F1 2FSEA 1OL0A 1TLKA 5F70A 3ULSA 3KPOA 3FRPA 4WGVB 1SQ2N 4WI2A 3V6OC 1VEPA 3L5WA 1ZGLB 3BISA 4C4KT 1WUNT 4WUUB 4MNGB 4D0CB 3FT4A 3ESVF 2WWMC 15C8L 3QCUL 4OZFG 4DGYH 1CVRA 3KLHD 5ID1B 5BV7L 4GLRH 5HHNA 1DLHB 5DJ0B 1M71B 4YHYB 1MFDH 2UWEB 1KTDA 3ULUD 3F6IA 1MCOH 1INEH 3T3ME 4GAYA 4HUXB 5BQ7A 1VCAA 4JM2B 4WU5A 4XNMB 5KVMC 5IEHB 5FKAB 1FP5A 2Y7QB 5F8RC 4F8QA 1AQDA 3FQRA 4M62L 4TSAL 5SX4H 1OAXL 3MRDB 2Y36H 4ZNCD 5CCKH 2A1WL 4NHCH 4PY8I 2B1HL 3AM8C 2KL6A 3RDTD 1Z9MA 3I50H 2RBLA 4FRWA 1Q0YH 2L4OA 2AQ1A 1WIUA 2IADB 4D0BA 3IXAB 5E9DD 5ESVA 3O6FD 4XPFH 3BPNC 5T1KD 3VFNB 4N0RA 5FOJA 5HYSB 5HPMA 4U1LB 4HK0A 5JR1H 2A77H 4P23A 1WLHA 5ANMA 1FORH 2DLFL 5M94B 2ATKB 3N9GL 4XAKE 3TO2B 4NDMB 3WD5L 4WO4A 3ARED 2AXHA 1CICD 4MNQA 2KZ1B 1CLOL 2Z8RA 2G9HA 2EE6A 4DJMA 3D0LB 2W60A 3B8SA 3RKDD 5FEBA 4DTGL 4I18B 1S8DB 3MBEC 4BSVB 1H3PL 1QSFA 2ADJA 1UJTA 3O3AA 1NDGA 3BPNB 3NCMA 4QRPD 3WFEH 4M6ML 3LKSB 1MHPH 1FSKC 3E6FB 3KPRD 5F7MC 1XGUA 4ZUTA 3TBSB 4FZEL 1X5KA 3D39D 4WW1A 5SWSA 3BRFA 4M5ZL 4TRPH 4JY4A 4WTWA 4ZSOA 3T0EC 3U9UB 3F7YA 2P1YA 3RY6A 2XZCH 4EXKA 2WBJB 3G04A 2CQVA 4MD4A 5F7KC 2Z4QA 2QKIB 3KR3H 4UILL 5C0NC 1XCTB 5JDSA 4TUJA 3W81A 3WE6A 5D2LB 3RWJB 2O61A 2VDKH 1J1PH 4F8TA 2VLMD 3SGEH 2MQ0A 4XCCH 4GAFB 1MCQA 5AWNH 3CX5J 2CXGA 4L3ED 4PRIB 1RZ8B 2R1WB 3BKJL 4NN7B 2QHRH 1WSST 4IDLA 2P44B 2BFVL 4KVNL 2BRRL 4XBEL 5B21A 4OIAA 2JIXB 2A6JB 2YA1A 5J4MA 3GIVB 2HTKD 4GKSA 5KOMC 5DK2B 4WTZG 4ODWA 4PJCF 4NKDB 4MB5A 4PG2C 5CZKA 4YGVB 1CGTA 3RJQB 1Z5LA 4IRJD 1D5XB 1SBBA 3MCG1 4HWBA 5C9KA 3NAAL 1MCBA 1A7OL 4QYOB 5F6HJ 1QEWA 1N6VA 1NMCC 4FQ2L 4QF1A 1C1EH 1ADQH 3J8F7 4NBYB 5T1LA 5CD5D 3IDMB 2AV1A 3OXSA 1BX2B 2O5XH 4C56A 2X4PA 3BKYL 4P5KB 5J3HD 3T8XB 5GS1C 1NFIB 2EC8A 4WJ5A 2E6QA 4L4TD 1OM3L 2FWOB 1L4IA 1HZHH 2UWEE 3CH1A 5E00B 3AU1A 5C09A 5SX5H 1EAPB 4KU1A 3P4NB 3BN9D 3GFUA 4UQ3B 2XY2A 1A3RL 2R0WH 3ARXA 4FQJL 4L5FL 4OGXH 3WXVL 4F3FB 5DMGC 2EYRB 4V1DB 4YHLH 1QR1B 5TDNB 4MAYD 3V6OE 3VDCA 4P3CH 3WKML 1VGEL 4YXKL 2B39A 32C2A 3UJJH 1GOHA 1LO3H 2HH0H 3FB8A 4QTIH 4I3RL 4CVXA 3ZDZE 3VW3L 2X89D 5IGXL 1U8QB 4LVOC 3RBGA 1X3DA 1ZGLA 1A4KB 4HIEA 1NCCH 4LCUB 5IB1A 1NGZA 1KJVA 3MREB 4YFDB 2VQUA 3TO4D 4H25B 4Z9KB 4JG0H 3L3GA 2ADIA 5EORH 1U8KB 1QFWL 4QRSB 4HIIA 3PP4H 2QSQA 3RZCD 4HQQL 2J6EA 3PUCA 1KLFA 2GITB 4M61B 4FQLL 1Z2KA 5IEHA 5FKAA 2BJML 5DJDB 5FYLD 1J5OH 5HYQB 2Y7QA 5J7CC 4X5WA 1KCSL 4MA7H 1QA9B 3ELAT 4HULB 2HFEB 1JNNH 4LPXA 5KANG 3MRDA 1X5HA 1PLGL 2DQTL 4GS7C 4YC2B 2VXVH 4JZOB 1G7QA 1IEAA 1GZPA 4Y5XC 3LQZB 1RZKH 3IGAB 5HGDA 4YZFF 1HIMH 4LGRB 2DYPD 3EYQD 1KIUA 1TZGL 1W0WA 2I60H 3VFNA 5E5UB 4ZFZB 4KMTH 5HYSA 4GJTB 1HWHB 5DUBB 4MLIA 3BT2H 3SDYL 5GPRA 4D2NA 2CKBA 1BFOB 5LCVH 1YQ2A 4TUKL 5D2LE 1U36A 4W6XB 1A3LH 1LK3L 2V5SA 2AEQL 4KTEH 1A14L 5FDWB 4G6JL 4N0CC 4ZNEA 4K3GA 5E8PB 1LK2A 2K7PA 3IDJB 3BWUC 4BSVA 3P11L 1YMHB 1W72B 5CZVH 5DQDH 3T0EE 3B2VH 5B38A 4RRPG 3LKSA 5EU4B 2R23B 5EZOL 2JKXA 4P5TB 1P7QB 2XZAL 3QXDA 1RIHH 4K8RC 4JFED 1H8NA 1FG2A 4OF8A 5JQHC 4ODVH 5HHPB 4UV7L 1BQHG 2FO1A 2NW3A 1CTNA 1IEHA 4XNUH 2DD8H 1DQML 3O8XD 4X8JB 4JHAH 2BSSA 4YHPA 3ILQC 3D6GA 3MGTA 2KH2B 3RX5A 2E7LA 1PKOA 4MMXC 3QQ3B 2R15A 1MREL 2VDNH 3S34H 4PB0H 3MLRH 3NPZB 6FABH 2QJDA 4Y4KD 1ZA3B 3HE6A 1QLEH 1BHGA 4DK3A 5C0BD 1HYRC 5F96H 4G3YH 4POZC 3P2TA 5IHZB 1N0LA 4ZAKA 2D0HA 1IKFH 3EBAA 3VH8A 1RZ8A 2R1WA 4XP4L 1MCLA 4KI5F 4NHUB 2I9LB 5DMIH 3RWEB 5E8OA 3H8NA 1U3YA 1SMAA 2P4AB 2O5ZH 5IBLD 4OM0H 3GIVA 5HVGB 3L6FB 4LAJH 5DK2A 3SO5A 3VXNB 5ALCH 3BE1H 4XNZB 5ETUB 1OAQH 1D5XA 2P8MB 5HYJE 4PYHA 4YPGA 3GMPA 12E8H 1EFXB 1U9KA 4OI8A 1IBGH 1OAKL 1KEML 4F7CA 2IALB 3CDFA 3MV9A 3EO9H 3IDMA 2R39A 3MRQB 4PJCB 1LNUB 1KJ2B 5AZ2H 4Q58C 3MLZH 2VDQH 1NJ9B 1XF4B 3QFDA 1MQKH 1NFIA 2NW2B 2IFGA 3QR2A 4Z7OF 1HH6A 1V3KA 4JB9H 2F53A 4LF3B 1LE9A 2IGFL 3WIIL 3LS5H 5I74C 3P4NA 1IGTA 4PTUA 5D1XB 4F9PA 3FRPG 3ZDYF 1EMTL 3QEUB 2EDEA 4LSTH 1G9NL 1HKFA 3L7EB 2AABH 2EYRA 2UY6A 1QR1A 1U91B 4PRAB 1LQSR 1PYWB 4LOUD 4HAGA 5CSGA 1SEQH 4TNWF 5FGCE 2DLTA 1NC4D 1CLZL 3QUMA 3O3DA 3HFMH 4J6RL 4DN3L 3DXAA 4UUJA 3IFNL 3UAJD 1U8QA 5I2IB 3ZTJH 4YDIL 3GKWL 3GSNL 4WI3A 4U05A 2Y07L 4BH8A 4KQ4L 2VB5A 1T7XA 4KPHH 5JXAL 3FZUC 4JPIA 4RFOL 4I0PC 5JOFA 3KPPA 2IANE 3T2NL 1T03L 4IOSD 4POYA 4OFYD 4P4RA 1CWVA 2E6PA 5IW3A 4UT9L 1RUKL 4QGTA 4X0KB 4Q9RH 4ZUVB 3E0GA 2DLHA 5EOCJ 2Z0BA 5IM7B 4F2MA 4PJEF 3RGVC 3SKMB 2HP4A 5T33L 4BSWA 1QA9A 2ICEA 1ZLSH 1VDGA 1FV1A 2AJYL 3OMZA 2H8PA 3CU1A 5DI8A 2AGJH 4TTDC 2JK5A 4YHNA 4G43B 5A3IC 5KW9H 3QDMB 3MLVH 4P2CG 3LQZA 3IGAA 4XB8A 2OMBA 3G6JF 5F9OL 4I0PB 1HDMB 2BERA 3FCTB 1GJIA 4Y2DD 5DRWA 5HY9B 4CMMA 4L8SA 3H9HA 2VLRB 4J3VA 3JXAA 5GS0H 2XKNA 5INDA 2Y23A 1EZVX 5CEZL 1T1WB 3TPUA 1BFOA 1YEIL 3X14A 5I1IL 4U7SA 3A6OA 1R3LB 3R1GH 5AG8A 1RUMH 1NGXA 4LLAA 1ACZA 3FO1A 5FDWA 2YK1L 3ARBC 3MMEA 3N1PC 2P24A 4RA3A 2DL2A 5E2WH 1KULA 1HCFX 3KPSE 2VXUL 5AEAA 1FNGA 2OK0H 1IGIL 5D1ZC 3MNVB 4PFEA 5IHUL 4Z18A 2R23A 2PF6A 3L7FA 1CU4L 3RI5K 2DQHL 4JQIL 1A6WH 3EJZD 3P4MB 3O4OB 3JVGC 4HMCA 2HJLB 4OLWL 2RQ8A 2YD2A