1FGNH

Monoclonal murine antibody 5g9-anti-human tissue factor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
214
Chain Sequence
EIQLQQSGAELVRPGALVKLSCKASGFNIKDYYMHWVKQRPEQGLEWIGLIDPENGNTIYDPKFQGKASITADTSSNTAYLQLSSLTSEDTAVYYCARDNSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of an inhibitory antibody on TF-initiated blood coagulation revealed by the crystal structures of human tissue factor, Fab 5G9 and TF.5G9 complex.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN FAB 5G9
total genus 43
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1997-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fgnH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fgnH02
4DVRL 2NY6C 3B8SA 2F54E 1KXTB 1BVKA 5K9JH 2BVPA 1BM3L 1CXKA 5BO1H 2CLRB 5J1TC 2B2XH 4Y4KA 1WWCA 1FLRH 2AJSL 2J1KA 4MNHA 4R90L 1L0XA 3QDGD 1JP5A 5ICXB 1E27A 1KXQE 4BJLA 1D9KC 1QFUH 3WFHB 4XBPB 5CJQH 3IDGA 2P49B 4KQ4L 1NCBH 3V0AC 4NFCA 1DTUA 2BVTA 5ERWA 4UOW1 1QFUL 4HHAA 1FBIL 4NNXA 1RZKL 1EO8H 4YJZL 4YNYB 3RVVD 1T2XA 5FYJU 3VXUE 2G75A 4PLNC 5HGDA 3O2DH 1GSMA 1PVHA 4YE4L 4LBEA 3QJFA 1RZKH 1MEXL 5HHOD 4IM8A 5KG9B 1N5YH 1MHEA 3MJ8A 4RIRB 4YDLB 4Y4HD 5HVFB 3BGAA 3DRQA 1OP5K 4F7CA 4UMGA 4U1HB 4WO4B 5B8CC 2CH8A 1K4CA 1I7UA 3BWAA 4TULL 2J8HA 3M8OL 2A83B 2OYPA 4O9HH 3VFTB 4PJCF 1G7MB 2MWCA 3U48A 3BH8A 1ETZB 4BM7A 3FB5B 2O5ZH 2CRYA 1RAMA 5TDPB 1TJGH 4N5UA 4OT1L 4PGJA 1CLYH 4GAYB 1D6EB 4ODXB 4JM2C 2AXFB 2NW3B 3SJVA 1S9WA 4NT6A 4XNZC 3IDMB 5GS1C 1UCBH 4PY8J 3U0TA 5HYQB 3B2VL 4X4MA 2RFXB 3E6HA 3LMJH 3M07A 1V5JA 4PJ8D 1QO3B 3ZKND 1PZUB 2OJZH 5MENE 3DROB 3HZYA 2XY2A 2DM3A 2C3XA 4S1QL 4HIJA 1E6JL 5GS0D 1S7SA 4P59H 1NSNH 3NFPA 4JFEA 3VRJB 1U8JA 4UTBH 4N0UB 1F3JA 5GJTH 4NQCD 1FNSH 3DSNA 4IIQB 4N9OB 5TGBB 1J8HB 1T20A 4XMPL 5EU6D 3S5LB 1MI5D 1A7NH 4M7KL 4PRHE 2NY7L 4YXKL 4NN5B 4F33B 5JA9A 3GSUA 2W38A 5HGHB 4FABH 4MCYA 1GPOL 1HKLH 3CU7A 1J86A 1JGVH 4NRXB 4LPWA 2JJVA 4LLDA 4M7JL 4RGND 1NCDH 2DBJA 4TUKH 1UJTA 4Y4FD 2IPTH 4HXAL 1RUML 1FZOA 5D1XB 5C0DB 2O5XH 3M17A 3LN5B 2BNQE 1R5VB 1OAYL 1MCPL 1F6FB 4OFDA 4PJHE 4AIOA 4LL9A 2NXZB 1DVFC 4LLWA 4MHHI 1QSED 5JHDA 2AJVH 1Z2KA 3MOAH 3QSKB 5EC1B 2QSQA 5IVXB 5HI3D 1XIWB 4GOSA 4LHUD 5I74B 43CAA 5TDNA 3VCLA 3EOYG 3DUUA 4YWGH 3UBXG 7CGTA 3MLWL 2AS5M 2AJVL 4R2GB 3RWHB 1BX2A 2W65B 3MOAL 4ZUSB 4HG4J 3IS0X 1JHLH 4NCC2 2X40A 5T3XD 3WCYA 3ZYIA 1F00I 1QVOA 1MQ8A 2NY0D 5DRWB 1NCTA 1YMME 1UXSB 3BAEH 5DD0H 4RA3A 1IBGH 1WBZA 3SBWC 1N6UA 1A21A 1T5WA 3DETD 5DEFA 2ITCA 3SKNA 4IDJL 3STLB 3VRIA 3WUWG 2EYSB 1Q38A 5HDLA 4KTDH 4N0RA 1X7QB 1T3FB 4XWGL 4IOIB 4ONFL 4YHOH 2OSLB 3QQ9D 1DZBA 4I0KA 5D1ZC 4ZFOL 5GGUA 1UQSB 2Y07L 5CUSL 2BNRA 2Z0BA 3U30B 1CU4L 5EPMA 4PGEA 3P2TA 1NBVH 3MPCA 1X5KA 1BQLL 4YIQB 3NCYP 3IAGC 3PL6D 1DE4B 5SV3A 5IOPA 2NTSP 5CUSH 3IB4A 1VFAA 3VMOA 1CE1L 4XPBL 3QIUC 3W0WD 4JFYA 1Q0XH 5F7EL 3MJ9H 1CDGA 4P3DA 5C0CE 3Q5TA 3MNVB 2ADIA 2CDFA 4TUOB 3GSXA 1CDHA 4YBHA 4LFHD 2W92A 1CG9A 1QOKA 2C7UA 4QT5B 4CJ1A 3VRIB 5I2IA 3MV9A 1NMAL 5CBAA 5EC2B 4HWEL 4M6ML 1MPAL 1JFQH 5CILL 4HAGA 4GJTB 4Z7UA 3BZFA 3EUUA 4OCYH 5EU4A 2QL1A 1D9KB 4ZAKC 1C5DA 2KKQA 4L5FH 1UWXK 4NJAH 3LB6C 4GW5A 5E5MA 5EOTA 2W65A 3QG6A 1UM4L 1UB5A 4DKFL 3EHBC 4WWKC 3U0WH 5GRJH 1RZJH 1OW0A 1RUKL 4DTGL 4ZFFB 3WNMA 2YC1A 3L3HB 4GLRI 2LAAA 3BXNB 3ES6B 3G5YB 5IJKA 3C8HA 5KN5B 2VE6B 5F44A 2BSSA 5GRJL 2FD6H 3K2UH 1A9EB 5EO1A 5BV7L 2VISB 4HV8B 4XPFL 5HJ3A 5JMRA 3DX8B 1A7RH 1DQQA 2IWGA 1J5OH 3HZMB 2AGJL 2AEQH 3IF1B 1YYML 2FD6L 4MS8C 3TCXA 4WEBH 2H2PC 4NO0B 4JGUA 2ADGB 4FTVA 1R3HB 4Y5XA 3ZDXF 3GRWA 4GW1A 1TMCB 5C08A 1DQML 4JPKH 5L88L 1TETH 2R0KH 3B3IA 1TVHA 4JG1L 3JWDH 5CEZL 1A7QL 4XGZB 4JO1L 4XNQB 4OZFH 1RK0A 4JRYA 4JO2L 2EKSB 4XP1L 4O00A 4JFEB 1DBBL 3VRJA 2VZ3A 1MCDA 5DQ9B 1NGYB 3I85A 4HPYL 2V7HB 3F12B 4JO1H 4IRJA 3DJ9A 3VXSE 3DTXB 3FO0H 4RZCA 5IK3A 4M7LT 4RISL 3IDXL 1BVLB 3U7WH 3BWUC 1HWHB 4O58H 5HYQA 1U8MB 1RUPH 1J9CT 3EYQD 3JUZA 3LKQB 4WRLA 4RFOH 5J1AA 4LCIH 5EZIL 4QWWD 4XRCA 2CIIB 3HE6C 3RPIA 1ONQA 3O6KL 4LP4A 3I75A 4JRXB 4P5TD 2MCPL 1WCBA 4NQSB 3WFDH 5FUOH 3O6KH 3FCTA 5L8LB 4M7ZC 3DXAB 4ZPTB 4G5ZH 4OLEA 3VFNA 1YN6B 4JFHD 3QDAA 3MRFA 2A83A 2VSCA 5CINL 2H32A 2IPKA 4DZ8B 1T1YB 2F5AL 3PQYE 3S88L 2ARJQ 4F7CB 1BEYL 1INDL 1QKZL 3IT8D 4LSPH 1O7SA 2FIRT 4RIRA 1U8KB 2ZG3A 1ED3B 1WC7B 2E8YA 3RDTA 4PV9B 3EOAB 1MJ7L 4K2UL 3KPMA 4FFWD 2F54A 5E4IA 3WLWD 4QRUA 4WI7A 4G3YL 5GRUL 3WIHH 4PREA 2VB5A 1AO7B 1S8DB 4OGZA 3WJLC 15C8H 4HHAB 1H3XA 3L7EA 5IBUB 4B53A 4HUVB 3BT2L 2ICWA 2WIIA 1IRAY 1WC7A 3FN0H 5D8JL 3T65B 3HFML 1IM9B 4WW2A 1RIHL 2BSTB 1HIML 1PX3A 2NYYD 1TTGA 3ARQA 1KB5L 3DV4A 4MXWH 2IMNA 5D8JH 2EDBA 1H5BB 1G7QA 4MNHB 4XXCC 1H3PH 2P43B 5BXFB 1MRDH 1EAJA 5FF6B 4K8RH 5A2JH 2EE2A 1KIPB 1SJHA 5HHMD 1KGCE 3FCTB 5F8QC 4P3CH 3KPSD 5FM8A 1HCVA 5F93C 1MRDL 5KAQG 1WCBB 4NQSA 5DQDL 2P5EA 4NO2A 4K8RL 5B8CB 3MRHA 5F9OH 1IGML 4OF5A 5CJ5A 4HC1L 1DLHB 3GMPB 3QUMA 2JCCF 2YRZA 4QXWA 3BOVA 1U8PA 2EEBA 2PO6A 3ZHLA 4DEPB 1XF5B 2F74B 3MLVL 4GRWE 5IB5B 2B0SL 1A6ZB 1IAOA 5CIPB 2DQTL 2PYED 2EH8H 4ELKB 1QA9A 1W0WB 5ACZB 4MX7A 4K3GA 4U6YB 5GS2D 4IRJB 2VLKB 4KRMB 3WKML 1S7VB 4CVXB 1LP9B 1RK1A 4PRHD 4G8EB 3OQ3B 3LPWA 4G7VH 4YLQT 3QFDA 3IETA 5F7HA 1ZT7A 3O81A 4FFZL 1BQSA 1YJDC 3BKYH 1FN4A 4PGCB 5MERB 4X4ME 2VLME 5IBLD 3V6ZB 1JZ3A 2VC2L 1U95B 3VFVB 4U0RB 3O3BB 3MRCB 2J4WH 5ALBL 2NTFA 3QDMD 3GJFH 3GDBA 3BH9A 4JVUA 4K3DH 4LASL 4S2SA 3X11B 6FABH 3UPRB 2ARJA 1UM5H 5GISH 3HZMA 2AJXL 2YRPA 4UZGA 1IC4L 2CKBA 4HXBL 4RGOL 5F89B 1VGKA 2VAAA 3KS0H 3CC5B 4XMLH 2LE9A 4Y4FA 3TO2B 4KK5D 1IJ9A 2R8SH 2MHAB 4W70A 2Y72A 2LTQC 3P11L 4P46A 1X4ZA 2BXYA 3BO8B 3WN5A 4L29B 5DVLA 4XVUD 5D7KE 4C4KT 3PIQB 2DI9A 4NC1E 5DC9B 1IEHA 4XMLL 2C3VB 2F15A 1SJVA 4PRDA 1BLNB 2W0LA 3T3PF 2DQGH 3U1SL 1I8LA 4GFTB 5HYFA 4NQED 4JFDA 5TFSH 4JRXE 2R1WB 1UFUA 3QDHA 1FO0B 4QY8B 4N8VA 4M61A 5E5MB 3FQTA 3W2DH 1F3DJ 4X99A 1N26A 3ARWA 3CMOH 3QNYB 1X5AA 5L6YH 2OCFD 3EYVA 2GSIB 1S5IH 4JKKA 5HHVH 3MMEA 4MA7H 4AQ1B 1IC5L 5LWYH 3B2UD 4WTWA 4GG6F 5F7YC 4DN3H 2HFGL 4YO0A 3KGRA 1AQDA 5L0QB 5HHVL 2B5IC 4HJGA 1KEGH 3QDMA 1IQDA 2WW8A 3UBXB 5ILTL 4NOBA 4R4BA 5I8EA 3H42L 1U3HA 1KNOB 2HFGH 4RX4D 2MNUA 4HLZH 5K59F 3QWRA 2ZUYA 3WIIH 3OKLB 3CXDL 3T2QA 4HFUH 5I6XC 5EORL 4P3DB 1VPOH 4GS7C 5ECJE 5IR1A 4CW1A 1U93B 3WFEL 3NFSH 4PJ5B 1B0GA 3OXRA 1DE4A 2UWEB 1QBMH 4HIHA 2MJWA 5KS9B 1GOHA 5SX5K 4EN3B 3LD8B 4L9LB 3QIUB 2WNGA 4U1MB 2J6EA 4HDIA 1WAAA 1XGTB 1AJ7H 2BJMH 4LSVH 3OKDB 1H0DB 2D0FA 5LGKA 1PG7W 3IKKA 3FFCE 3WXVL 1BF2A 4RWYH 5GJSL 4XVSL 4ZFZA 4GMTL 2ITCB 3U7AA 4OZHA 3HZKA 5D72H 5IB3B 2DB8A 1U8OB 5EH1A 5J6GB 3CFBA 5ESQA 1QVOB 5DUML 1OL0A 1S7WA 1UWGL 3MBXH 1ZHKA 4AQOA 3P4NB 1JWSA 5F7DA 4QRQB 4OLWL 2DAVA 1MLCB 4QF1A 1XZ0A 4EVNB 4YPJA 4JO4L 2OJEA 4PP2B 2ZSWB 5DRZB 1ZGLM 5HDQH 2PR4H 4CU6A 4K71C 3LN4A 3ZE0E 1KGCD 3O9WD 3D2UA 4MD4B 4B41A 1U8HA 3NH7H 5JOFB 3GSNB 2A77L 4EBQH 2O5XL 4R4NC 5E95B 3CH1A 5EZLB 5F6HJ 5E2VH 1MY5A 2CRZA 3FOLA 4XP6H 2GEEA 3TNMB 5I1LA 1OARL 4OGAC 5LBSL 3UTPD 4XPHH 3V52L 1MCQA 4MWFB 4B0MM 5MEPB 3KNBA 4LVEA 3GMQB 4PRIB 4MMZC 1P2CA 2DTMH 3SDDC 3L3OA 4LMQE 4G6FD 3WIFA 5LAXB 3P3YA 5E9DB 5JIPA 3SGEH 4WFHE 3PJSB 4LRNL 5D6DA 1FORL 3W9EB 4GUPB 2V2XA 2X6MA 1EJOL 4IS6A 1O0VA 3NGBC 4LOUC 2AVGA 1I9EA 2FIKA 4LRNH 1S7SB 5FECB 1PY9A 5I75C 2PXYA 1JL8A 3RKPA 1FIGH 3BUYA 4J6RL 3HZYB 4M8VA 12E8H 4L8CA 5IVNA 4CAGA 4YHMH 1AKJA 1J87A 4AYFA 4LNRA 2V17L 3F7VA 1JWUA 4WTZA 5C09E 4OBRA 5TH2A 3E3QC 5T5FH 2APFA 3U4BH 5IROC 2G2RA 3MRKA 2Y07H 3ARDA 2NW3A 2HFFA 1Z6JT 1KCUL 1VACB 1B2WH 4X6DA 3O4LA 1BQLH 4P57A 2BCKA 2JK5B 2XPGB 1YPZB 4HCRA 5LQBH 1AGEB 2OTWB 1G1CA 1KCUH 3RPKA 3ZE1F 2H8PA 2DQCH 1F4YL 4MJ5A 4M02A 1K4CB 5EIIB 2NYYC 2YOCA 4P23C 3MBED 3ET9F 1OCWL 2OL3H 3PWNB 3QEQB 2PTTB 5DHVA 5I16B 3U2SB 3MRMB 4LSSH 2DI8A 2IANA 1T2QL 2RCSH 1MCRA 4L1DA 3LIZH 1MPAH 3D69A 4S1DD 4GBXB 4LKXA 3PWPD 1MWAA 1P9MA 1T2JA 4LBEB 3MRGA 3S97C 5BV7B 2VUOA 2AJZA 4HKXB 4LK4A 3QUKB 2VABB 2GY7B 4J3XA 5FAAA 4OUUB 2B1HH 5IQ7H 4RRPG 4PLKD 3OKMA 4S1RH 4UT7L 1LNUB 5B38A 1WFOA 3QA3B 3I3DA 3QEGH 1R3LA 1JPGB 3CZFB 3UYRH 1R3JB 3BP5B 3CXHK 1XIWC 2H2SC 3BX7C 4LHUG 4XWOC 1JBJA 1N5YL 5FO7A 5F97E 4PUBL 2EDYA 2Y36L 5E00B 4FXLA 1FFQA 2QR0A 3QIBD 3U0PB 4X7CC 1MNUL 2XA8L 3Q6FA 4AG4H 2GITB 3FONB 4Z7WF 3WNKA 2VDLL 3T4YB 5CHNB 4ZMAT 2PO6C 3DI3B 3U36B 3VFUB 5E94A 1I7TB 1NBZA 2YUWA 4ZQKA 1J1OL 3STZA 3ARTA 1S5HA 3RTQA 4HBQA 1OLLA 1NC2A 5IBLC 2R0KL 2FHCA 1QSFD 5DEGB 4QHKJ 2Q86B 3V4PL 1A7QH 5A3IC 3UDWA 1M05B 4NQCB 3KPLA 5FGCB 5D4QA 1T6VN 2JB6A 5EBLA 4Q9QH 1S5HB 4BZ1L 2W9DH 2P5EE 3RAJH 4JY4B 1A9BB 2IAMD 3VFUA 2BSRA 4M62L 3WNPA 3VGEA 1FE8H 3O9WC 4GKNA 5IFAH 3QEHB 5HYSA 3MV8B 2X09A 4BZ1H 4TNVK 1S7RA 1UJ3A 1AQKH 2FGWH 1MLBB 4P5TA 2ORBH 2EC9T 4IRJC 1VADB 5A43C 1IM3A 4EEEA 3FL7A 3PP3K 2IBGA 5A2KH 1R3LB 2AK4A 1FH5L 4RAUA 1Q1JL 4FQ2L 1A3LL 5IB4A 5SWZA 3ULVH 5AD0B 1GZPB 5C6TH 4PJIB 2ZUTA 5D6CB 3QUKA 1HINH 2NX5B 1ZS8B 4UDTA 3AXLB 1C7SA 5EBGA 2OTUB 3NABH 4O2FB 3NFNB 4HKJA 3ZT7A 3IVKA 4YHIA 3OAZK 1HCFX 3TH2T 2E5EA 2VDMH 3NIFE 5FUCE 5TDOA 1OT2A 3JV4A 4MXQC 1FYTB 3CFKB 4H1LH 4PRNB 1KTKE 2R2CA 4FNLH 4BA8A 3D85B 3E6FA 3KPOB 3ZZ1A 1KPUA 5E8PB 2FHFA 3KXFE 2VLRE 4Z7VA 3MLWH 1VEPA 3O6MH 4UDUA 5IFJA 4MNGB 4X5XB 3C09B 4M6OH 1SMAA 2ZOLB 3MLSL 3JUYA 3VXSB 3T0AA 3DWTA 4CDGC 1CLOH 4XBGB 3TZVB 3C6LB 5ADPL 2Q86A 3SDXB 1FL3B 1LP9F 4YFDB 4X0KA 2VWEE 1FZJB 1CL7I 3I6KA 1NUDA 4ZAKA 3LQMA 4JKPH 4XHJC 5HHNA 3OR7B 3WS6A 5ADPH 1MFDL 3GBML 1KJ2A 2NMSA 2F58L 1RZGA 4Z95H 3F5WA 4U1IA 2QQQA 5KSVA 4HMEA 4XC3L 5MP6H 5JQ6L 2OM5A 4L8CB 1A7PL 1TZHB 5ADOL 1KCRL 3OAYK 1WBXA 4KVCH 5F9OL 4OQTA 3STBA 2AK4E 3B5TA 4HBCH 3LD8C 3T8XA 1X44A 5ADOH 4GS7B 5HHXL 4RAVB 5I30H 3B4NA 3V6OA 3VXPB 3PF2A 3ARYA 4EQ2A 3BGMA 4FOMA 4HIEB 3BEVA 4XH2B 2D31A 4P4RA 5HHXH 1U3JA 3PP4L 4OBSA 4TSAH 3V9FA 1S7QB 1I8KA 4XNXL 4PIRF 5IFHL 3CSGA 3KNBB 5MEPA 3MRJA 3MYZA 2DS4A 5I1HL 1NDMB 2ZJSL 2R0WL 4JLRB 2VH5H 4N0CD 4ERSL 3G6AB 3I50H 1IAMA 3RP1A 1JPST 1SJXA 1QR1A 3KYMB 3ROLA 1T04A 2ZJSH 2A73B 4UUJB 4RMTA 2IANB 4XNMA 2A2QT 3MRMA 4KK9C 3MCLH 1NBQA 2O26U 5HHQA 5I16A 3PWNA 2EDFA 4NJAL 1J0KA 1RZ8A 4OTXH 3LKNB 2SEBA 4KJYA 5H2BB 5C70A 4K3DL 1GHFH 3OJ2C 2IBBA 2G5BB 4JM4H 4L8DB 2CRIA 2X4UA 4RNRA 1U92B 2YPKB 5HHQB 1MHCA 5HGGS 2PNDA 1Q9KA 5D5ME 5HHOE 3P9MB 3QUML 4JPVH 2PW2B 2BSED 4YR6B 3QNXA 4PJ7F 5BW7A 4KFZC 2R8SL 4P2CG 3O45A 2BX5A 4DQOL 3DURA 4EI6A 3K2UL 5BV7H 3ARPA 2HFFB 3QUMH 2X4OB 3N1GC 4NP4H 4S1DC 1AGFA 3DVIA 3LRGA 1I8KB 3VGGA 5FYKE 1WSST 2AEQL 4FZEH 2AAVA 3LEVL 3D3VE 4M8QB 4M3JA 4PJBB 3TEUA 1I9RH 4P23A 1XGTA 2I9TB 4OAWB 4HDIB 1DANU 2IBZX 2YR3A 3H7BB 1ZT1B 1HNGA 2VXSL 3IDNB 2VXQH 2B8OT 2FIKB 3PWPE 3SPVA 4E42B 1I9RL 3F7RA 1D6VL 1KPRA 4P0DA 3LS4H 3C60B 1IKFH 3HPJB 4X6CB 5CEXB 3AY4A 1YMMB 2GIYA 3BPCA 4WDIA 1RZGB 1KC5H 1D6VH 4QTIL 5DC4B 1FZMA 3MOBH 1REIA 4NKMA 4Z76A 3ZE1E 3N9GH 4UINL 2WWKO 4QYOA 3X3FH 4ZFOB 4KROC 2VDPL 5C07E 3FB7B 5I8EB 1KC5L 1EEQA 3WUWB 2VDNH 5FOBA 3U83A 1FZJA 3I6KB 4OGYH 4XNUL 3DECA 4I9WD 4FMFA 3RA7L 3MXWH 4Y7MA 1FVEB 5DMKB 1IILE 1SM3L 3MUHL 4RFOL 5IEHB 3GIZH 4P2QB 1W72L 5EZJA 5ICYA 2NCMA 3QXDA 3JBG7 4N1EA 5C0AD 1AE6H 3RA7H 3VXNB 3MGTA 3QNYA 5LGJA 4GQ9L 5T1KB 1ZEAL 1S9YA 4OI9A 3MJ7A 5BS0D 5GS0L 4Z7UE 2XXMB 1KB5B 2EE9A 4PRNA 2HJFB 4K3HA 4PRDB 3VD5A 1CD1A 4H0GA 3DMMB 5GS0H 3CLFH 5DJZA 2OTUA 1MCWW 3OKYA 2V5TA 3IU3B 2HP4A 1DEEA 2HRLA 4JN1L 1UJ3C 2K1MA 1E4WL 4XT1C 3D48R 5DJXA 2EDNA 1IGYB 4U1GC 1F4HA 4XXDA 1JNHA 3PNWA 4I4WB 1F2XK 4E5XA 4LKCB 1CF8H 2E27H 1F8TH 5JIHA 1HI6B 3NH7L 4KRNA 4F9LA 1RZFH 3OKEB 4DFHA 4EBQL 1ZLWK 4M1GH 4KKNA 3OB0H 3GHBH 3RZCB 1BZ9B 3THMH 4M48L 4MCZB 4F15C 4U3XA 4LVHB 4X9IA 2E9IA 1ITBB 3TN0C 4OZHE 1MHHA 1PQZA 3R4DA 1F42A 4JO3L 3P77A 2WM0A 3DX6A 3V5HB 3V52H 4Y1AB 4IMKC 5C08E 3VI4E 1OP3H 43C9B 1BZQK 3VJ6A 3KPQA 1VFOA 1NL0H 4FHBD 3GB7B 2J88L 3FQWA 4ELKA 1TZIB 3KPLB 3PWVA 3VFGH 4Y2DD 1CICB 3AVEA 4APQD 1W2KT 4CBPA 2DQUL 1BZ7A 4X4YA 1FIEA 1SYSB 3OHXA 4U1LA 3DIFA 4UV7L 5M95B 3QUMB 1DLHA 1EFXD 4KKAC 5DD5L 4F2MA 4FG6D 4HW6A 3JV0A 1WQVT 4HPOH 4HWBA 4QNPF 4J6RH 1JRHL 3MLUL 3TIEA 3HLAA 3JWNC 1PEWA 3T0WA 1HSBA 4OUOA 5FYLL 4JEGB 2V17H 3FFDA 1AD0A 1ZHNA 3S36L 1UB6A 4L9LC 2HT4D 4UI2A 5I1KH 3ZDZE 4F2MB 3EHBD 4WWKD 3M1BB 4DN4L 1U8QA 2HAZA 3O4LD 4OLYL 3KR3H 3MUGA 4PJ9D 2A74B 4X8XA 5JQHC 4PJ9A 1GVIA 2YUXA 1MHPL 4GQPH 2MHAA 4DN4H 3TVMD 3QA3A 1DBAH 1LK2A 3VXRD 3T65A 3JWOC 2VC2H 4WFEE 3V0WH 1T0NB 4CMMB 3E0GA 4H26A 4TRPH 2BNUA 2ARWA 2DQCL 3K0WA 5CZVL 1SVCP 3X11A 3BH9B 4GAGH 4XBEL 2YD6A 4K3JH 2F54B 3CUPB 4H88H 3VD3A 1A0QL 4LGSB 4LNVA 5SV4A 2FX8L 2H32H 2NY2C 2ZUQB 5I18H 1ZT7B 4JKWA 2IALB 3QEQA 3U2SA 3L3DA 25C8H 1NQBA 3VXOA 5L2KE 4HMCA 5D70L 3IDJA 5FGBA 1XGRA 3DGGB 3GKZA 1P6FA 4EOWH 1G84A 3SDCC 3MRFB 3OB0K 2F53B 3UTZA 3TBYA 1MELA 5JHDE 1JF5A 4KJWD 4JZOB 3WO4C 4QRRB 1YZZA 2XI9A 4HWZB 1N64H 2ZOKA 3IU3A 4WO4C 1BECA 4KUZL 1BD2E 4BZ2L 1KPVA 2NLJA 2PXYC 5DLMH 3T1FB 3MFFA 1KTDB 3DO7B 2CIIA 2WUBL 3QH3A 1G9NH 2Z8SA 4UIMB 2ID5A 5I0ZA 5TH2B 3MRHB 4R7NB 4PJDE 1KEGL 3I9GH 5E1AA 4Z7VE 3NCEB 5GZOC 2C3WA 4I48B 2AXGB 2NY6D 1BFOA 5JA8B 5JUEL 3RHWK 1TJGL 1FAKT 3OB8A 4ODWA 1G6RA 1G0DA 2X1OA 3MGTB 5FA4B 3BUYB 5LGJB 2WV3A 2J2ZA 3VXNA 2CLVB 4L4TB 5TE7H 3P4OB 3RL2A 3MZGB 1VENA 1B6DA 3H9HB 4OLVL 2BC4A 3TBSA 3HUJA 1MWAL 4NQDE 1OLZA 3PJSA 2BSTA 3B2VH 1Z5LA 4Y2DC 1B3JA 2GAZB 4KVNL 5B3NA 1HDMB 3BP6A 4AEHH 5IW6A 2ZP0T 3BD3A 2KBGA 2W9DL 1URLA 4IIQC 5M7QA 4NQEA 5I8OH 2PW1B 4HFWA 1WZ1L 3GKWL 3V4VH 1FZKA 1KN4H 4GMTH 3TN0D 5DI8B 3PGFL 5DRNB 4X8JB 3KLHD 4HS8H 2NY7H 3GSWB 1XF4B 2A1WH 2YPLB 5C0GB 3FB8A 3IDNA 5C0ND 1WTGT 3GSNA 4WW1B 5MI0B 4RMSA 2PN5A 4KK8D 5K33A 3GUTB 1HXYA 4X6DF 2GCYB 4FQIH 1A1OB 3VU2A 1ZGLA 1DCLA 3R1GL 4NQVB 4PRID 5FYJH 1D5XB 3EFDL 3GBNH 3O2VL 4PJIE 4FQIL 1ZOXA 1U3ZA 3U9UA 5MEQB 3BDXA 5DK2B 2MPAH 1F90H 4EUPB 4NJ9L 4BFGA 3UYPA 4Z7UB 1BJMA 3C87A 1R5WA 3PL6B 3U4EA 3WO3B 5F3HA 4R2GC 1H15A 4ZFZB 4PJXF 1XT5A 3QXTA 1PW3A 4HT1L 4YWGL 3DVNA 1I9JH 3TWCH 5INCA 1VA9A 1CZ8L 2HN7B 4FQ1H 3LKNA 4KJYB 1CG9B 5H2BA 3WYRA 1I3GH 2ENSA 3SHSA 3LHPL 5EU3A 3BISA 2LABA 1FL5B 1CZ8H 1HH9A 4TNWK 5SWSD 3I6LD 5GHWL 2EIZB 4IRZH 3MUY1 4YIQA 5CSBA 5IVOA 1DUYB 3X13B 2B4CC 1LK3L 4CW1B 2NY5L 1KTRL 5EU6B 2Z92B 4IRZL 4ZS6D 4ONFH 2X4RB 3ME0A 4PLKC 2A9NH 3O11B 3NGBB 2QSCL 4YHML 1JI1A 3MNZB 3V6BR 1U3HB 5MEND 3BGMB 5FDYA 2EYSA 1F11A 1I8LC 4MXQD 2HTKC 3IU4H 4OGAD 4QRPA 2HWZL 4YGVB 1VFMA 3O3AA 1ZWIA 4E0RA 1FNGB 3O4OB 4WENB 2VISA 1Q9OA 4JVWA 4XPBH 4NHCL 5EUOA 3MMEB 2BSSB 2GSIA 2VE6A 2EECA 4R96A 1NUFA 1NKOA 3HI1A 3PDOA 4NNPL 4P5KB 2UVFA 2GUOB 4PJ7B 4M61B 1WCQA 4ZUSA 5F1NA 5DMIL 1U8NB 3MLTB 3R06B 2OBGA 4WWID 4MSWB 1F4YH 3OR7A 43CAB 1OGTB 1SVZA 3I84A 4JZJC 5CD5D 5EC1A 2R2EB 4HWEH 4AL8L 4XNYL 2GUOA 2P44B 2VH5L 3KJ6H 4XAKD 3SGKC 2WQ8A 5A2IH 3OF6D 4Z18A 3SDAD 4XI5D 1ES0A 3VXSA 4XNYH 3CC5A 1A2YA 2E6PA 1WAAF 3LN5A 3SE3A 5KSAA 2XZQL 1TNNA 4Y8DC 4DKEL 1UZ6E 4UDUB 3SEPA 4OKVB 1JYXA 1INEL 3BZDA 4G6JH 1BFVH 1YEFL 4LPTA 5IVZB 3UPRA 2C7UB 1T80A 5LJYH 1BWMA 4PJDA 1I4FB 2HMID 1S7XA 4TUOA 5I8KH 1FNHA 1EEUA 2X4RA 2Y6SD 3KHOA 1KN2H 3ROOB 4ZUUA 3ULVE 1PD6A 1A5FL 4U6VL 5C2UB 1V3MA 1EHNA 5KAQF 3T2NH 1G0XA 3FT4A 1IAIH 2BNRB 4QOKE 1YEHL 5JR1L 2DWEB 5GIRA 3V6FB 2DIJA 3SQOH 5IB2B 3IFNL 5EU3B 1CDIA 3RZCC 4KJQD 4P9HH 5IM7A 4NWUL 5SWZB 1T21B 3K1KC 4PTTA 1DQMH 1T7XA 5INCB 3SDCD 5L88H 2AK1H 3NACL 2AK4B 4ZUWA 1NAKL 2BOCA 3P30L 1W0VA 4AT6B 5C6WH 1H15B 4P2RA 2FNBA 3DRTB 1CFNB 4Q9RL 4ETQB 1MJJB 4HUWB 1WBZB 2NPLX 3QDME 1MLBA 2AK1L 3NACH 3SKOB 3SN6N 4Q97A 5DRWA 3QZWG 5SWZE 5MENA 3NIFF 3PHQB 3GSNH 5DS8A 4WHYG 2D0GA 3BQUB 3RIAF 2JJTC 4KHTH 3GSNL 3GSOA 4QRRE 3HC3H 1FG2A 3OAZH 3N1FC 3LKPB 5D1ZA 1HXYB 1EHAA 2BFVL 1M05A 3EIFA 2IH3A 2Q8AH 1NDGB 5J12B 1CGTA 4FN0A 2XTLA 2IG2L 5JW4R 1JZ4A 4F57L 5EWIL 5I8CB 3MJ8B 1MHEB 2ILLA 1OTTC 5BOPA 5GZNC 3KJ4C 4NN7B 1FZKB 3H6JA 5ESVA 4D3CL 3EO0B 1MI5A 4WFED 5EULV 5IV2B 4KY1L 1N4XH 1QBLL 2Z31C 4NNXB 2F5AH 3H9SA 4DGIH 1U0QA 1QPPA 4Z6AT 5KSBE 4CJ0A 3BPOC 5FXCH 1A3RL 1H8NA 3LRSA 1W8NA 1FQ9C 1FCCA 4BYHA 4DGIL 2NX5E 5E6IA 3CXHJ 4F9LC 5C07A 2FEDD 1LO2H 4IIQA 4XWOD 4F7EA 1ODAA 1MOEA 4BQCA 1U8JB 4KJQC 2W60A 5FO8A 1ZSDB 1AR1C 4CKVX 4JKMA 4NNYA 4PJFF 1C5BH 4YGAB 2PYEB 3RVUD 3EZJB 5IWLA 2ZUUA 4CDHA 1CL7L 2ZUQC 1T5XA 1WISA 4I2XA 4OD2B 3E6HB 1XCTA 4JCMA 4I48A 4X6BA 2AJZB 4WV1A 5DZOA 4AEIL 5L8JB 4UIMA 5FYJE 3QAZC 4MA3A 4KUCD 3EDEA 1HNFA 3PV6A 1MFBL 1YC7A 5EFIA 3GMMB 4TNVF 4AEIH 1U8MA 4PR5B 3RNKA 1G6VK 2D7TH 3TV3H 4O51B 5T3ZL 3SO3C 4WI6A 4PJEE 1KYOJ 2L7JA 3PWJB 1ETZA 3FRPA 1NBYA 2IAMC 1TNMA 3F12A 2V7HA 2EDDA 4PY8I 5D2NB 3LQAL 3IAQA 1IGMH 2GFBB 2QKIA 1P4BH 5JQ6H 1R24B 3P4MA 1GC1H 4PJGE 4XGZA 1AKJD 4LCWD 5BZWB 1IZKA 1U41A 3ABZA 3FZUD 3B3IB 3D9AH 4MNQD 1CIUA 3O4OC 4LSTL 4NRYA 4OF0A 3CU1A 2ZUXA 1QSZA 2H45A 3CUPA 4J7RA 5JORA 4DKDC 3O3EA 3GMLB 2C1OB 4NSKA 2E9BA 4OGXL 2W07A 1JRHH 1P69B 3MLUH 5AWNL 4MNQE 4YNYA 1EGJA 4JZJA 3TJEH 2OZ4L 3U6RA 4NKIH 4DGYL 3AY4C 3ARFB 1T0NA 3S36H 4NNYB 1I1AC 3HMWL 4G8FB 2OZ4H 4PS4L 1A9EA 1YY9D 4XBPA 2V2XB 4JRWA 5IKCB 3L6FA 1T4KB 5E1HB 3VXRA 1A6WL 5E6IB 5KVGL 4I18B 4NBYB 3BXNA 3FN3A 5I9QC 5GXBB 4PS4H 1FFNA 3QPXH 1BP3B 2MQ3A 1A6WH 2R69L 5KVEH 1I9IH 3QUZB 3KPRB 3TJHD 2VKWA 3RY5A 4RMRA 5FYLD 5HSFA 3I2CL 2LTQB 3QUYC 5IJVB 4TRPL 1IC4H 1SBBA 3QG6B 4FS0A 3MV7D 5IV2A 5D1QA 3F7YB 4GW5B 1YN7B 4XXCA 2QADC 5J3HD 2GYSA 4GAGL 4XBEH 1KT2B 4OZFA 1KTLA 3KPNA 5FDWA 2EXYC 1I1AD 1UG9A 5J6HB 3C5ZB 2OMBA 4JPVL 4YXHH 1TQBC 4DUVA 3CFDB 5CBAB 1SYSA 1FPTL 4QRSA 3HI6L 1X5FA 4XC1L 4HUKB 4EN3D 2XNAA 1CICA 1C08A 5ENWA 2IH3B 1F6AA 3GK8L 1S7UB 3G5ZB 3GRWL 3QG7H 4KPHH 4PJ9C 1EUUA 2AXJA 2OJEB 2DQDL 2Z4QB 2YBRA 1H5BC 2YKLH 3HR5A 3FTGA 5IQ9B 2JB5H 2FX9H 3LEVH 4XAWH 2ZCHH 5DR5L 1WIUA 3QFJB 2WUCH 1T22B 3HS0A 4FXGA 2R1YB 5LWYL 5EZOH 2LFGA 4FTVD 1VKXB 1QQDB 2GJ6B 3LKOA 2JB5L 4XAWL 3DARA 4NYLB 4BZ2H 2YS4A 3ALWA 5IP4A 2AJ3A 2ZCHL 1U8OA 3JV6A 4MCZA 2WUCL 1XGUB 3MCKA 3ZYOA 4A6YA 1NAMB 3G6JA 5ILTH 1MJJA 3MLZL 3MA7A 4MGXA 3EO1B 2VRAA 1W0VB 4AT6A 1GOFA 4QHKI 5DJ8B 4JRYD 1T1ZB 3UP1A 1DBKL 5EORH 2ZG1A 1H0DA 1ZA3A 2Q7YB 1MCJA 2YK1L 3BRFA 1Y0LB 4G80A 3QT2A 2CR6A 3NFSL 3ZL4H 2CIKB 5D2LA 1VGEL 4M4RA 1MJUH 1DEEB 4WHDA 2DD8L 3MA7B 3RNQB 1BD2B 4ZOBA 5TE6H 4BFIB 3VFOB 4HWUA 2DQJH 3FAWA 5KS9A 2XYCA 1SY6L 5C0BA 2FCBA 3DMMD 1VKXA 4ZUUB 1U93A 1AJ7L 2BJML 3DMMA 5EO0B 1OGAB 4MAYA 3RVUC 4WO4D 4KVNH 4MAYD 3DUUB 1AXIB 2OP4L 4XCEA 4Z7UF 5ISZE 2G5RA 1UCTA 5FK9B 5I8OL 2ZZUT 3NN8A 1Z9MA 4H0HB 2EZ0C 2H41A 4KMLB 1LHZA 3MX0A 4PGBB 5IG7A 1RULH 1YNKL 5CBEB 4ZO6A 3CVHB 4X98A 2DICA 4HS8L 2W1NA 5IEHA 1MCNA 4L8SA 3GI8L 5IHUH 3GSQB 5FOBB 2BVUA 5D1QB 4IMLA 1HYSD 1MAMH 3WFZA 3NMEA 3WHE1 3ULVD 4JPWH 5D1XC 3KLSA 5GGTA 3BPCB 4WDIB 2EDHA 4KRLB 4JB9H 1FNFA 2HLFC 1DBJL 2E27L 3DXAE 5HI4D 1ROWA 2NY4D 3OKKB 2NXZC 2VXUL 5AYUH 5IKCA 3TO2A 3C2AH 1TVBA 4N0UA 3V4UL 3RWFA 1J8HD 4KGLA 5DD6B 1QSEE 2KPNA 4JM2A 2LQRA 2X4SA 1FGNL 3B9AA 4RRPA 5EDXA 4ZTPH 4QRPB 5I74C 1F5WA 2QLVB 4KHXH 1OB1B 1EFXB 5KOMC 3HPLA 4HT1H 2JELL 1Y0LA 2WK2A 3MLXL 3MUJA 4X4XA 2NTFB 5CJOH 3GJFK 4XAKE 5DJ8A 4Z0XB 3TT1L 2Z92A 2CGRL 1CN4A 3MBEB 2A6JB 2C4FT 4ZTOL 3AB0B 4Q9CA 2AXFA 3BYYA 3QFDB 4GAYA 2IPUK 4BH7A 3P4MB 3TO4D 2EIZA 2PW2A 2QKIB 3TFKC 3HS0B 1BQHG 3RUGB 2AEWA 3L3KB 5D7IA 3BH8B 4ODUA 3TVMB 2YPKA 5DJ0B 1KENH 4U6YA 4WCYH 2IQAA 3HUJF 3HAEH 5MHSD 5I19H 1A6ZA 4LCYA 4JHAH 2BVQB 5K9QI 4OLXH 1XF5A 1UACH 2EE6A 2FH6A 2I5YH 3ZT6A 1QRNE 1S9XA 1V7MH 3IJSB 1T04B 2NY0B 4UUJA 3ROLB 4F7PB 3QCTH 1OY3B 4QRPE 5F7WC 1G6RL 4LCUA 1MREH 1ZTXL 1IVLA 5HGDB 4MLIA 3OPZL 1DQTA 3MLRH 1D5XA 4Y4KC 4YHZL 3QCTL 4MDJA 2X4NB 4HJJH 2YHGA 1DLFL 5DZLA 1NCWL 3MQIA 5IHBA 5C9JA 2ESVB 3QUZC 5FIEA 5CZVH 5H37G 3FN9A 4HIEA 4NQTA 3GUTA 4X9HA 2R56L 1IKNC 5ITFB 3SDYL 5HVHC 1RUQL 1EZVY 3UZVB 4PJEF 4HAFA 3S5LG 1CR9H 4KUCF 2Y1VA 1B9ZA 1FLRL 2AJSH 1FVCA 1KBGL 1OF2B 1ZLSH 4S11A 3FB6B 1RUQH 1MVFA 3O6FD 3W0WB 4XCFL 2Y25A 1EUTA 1AO7A 4HZLB 1YEFH 2VL5B 4R97C 1NCBL 1NEZB 1FJ1B 4XB7A 5C0JA 4UT7H 4QRUB 4U2ZA 2XOTA 4LDLB 1A6VH 2IPUG 3K4DA 1HK6A 5T5NG 4JFFA 4BQ9A 1JF6A 1NANI 4QOKD 4JN2A 4JQXA 3HI5L 1BHGA 1SHMA 3REVA 4R9HA 4PJCA 3MRIB 3AMLA 3N06B 3WO4B 5TE4H 2IF7A 1R24A 4Z78B 1CWVA 3FQNA 2WUBH 3RL2B 5IT2H 3D3VA 2ED9A 4N9GA 2GFBA 1CLZH 2AQ3A 4RQQA 3QAZB 4ZUVB 5B4MD 5TE4L 4KKCC 1J1OH 4HGWB 4MQ7A 4P9HL 5HI3C 1DANT 3LPGA 4LF3B 4Y2DA 2JIXA 5KSAD 2VLLB 4Z7OF 3IFOB 3IGAA 1P4IH 4PR5A 1CXHA 3BHBB 4P99A 3ZMRA 1CFNA 1KTDA 3DO7A 4OLVH 4P46C 4W4OC 3CX5K 4WV1B 4Y4FC 1Q9WB 3CAFA 4JDTH 1JPSL 1J0ZA 3P9LB 1E6OH 4OM1L 2GK0B 4QOKA 5FO8B 4G9FA 1MUJA 3NA9H 2XZCH 3QI9A 3TPUB 3V4VL 3IFPA 2P5WA 2IALA 1RUAL 1IM3B 2BZDA 3BSZL 2HKHH 2M26A 2XWTB 2JCCB 3H9SB 3UTTA 3ARED 1N5AA 3QEHA 5HYSB 3QUYB 1QFPA 2APWA 2EE3A 3SE4A 1RHFA 3RRQA 2NXYD 2R2HA 4FABL 3R1GH 4EJ1C 4F9PA 5F88A 5DVKA 3QXWA 4M7JH 5KVFH 5I17B 5L2KA 4ZNCD 4AH2B 4NCDA 4HQQL 3W9DB 4NQXB 3NZ8A 1NDGA 3EOTH 4E41B 4CGTA 1G7JA 1UXWA 2ESVE 3CH8A 1XF2B 1PBYA 2HFTA 4X9FA 5EIQA 5F1KC 2FO4B 4JFFD 5D96C 4DZBB 4OSUH 1RZIA 5C0RH 1JYWA 4NO5A 1EZVX 3F58L 3UXFA 4BELD 3NCJL 3K2MC 3HB3C 1TQBB 5F1OB 1K8IB 4Q6YA 1KYOK 4P5KA 3MLSH 3TIEB 1B0RA 3VFWB 2NNAB 2VAJA 3GSVB 3FMGL 3PHQA 5MENB 1CLOL 3L7FB 1D9KA 2AP2A 3U0PA 1SYVB 3CDGA 1EIBA 4YGVA 3G08B 4U1LB 4PRAA 4W81A 4OCXH 4JKPL 1MFNA 5DHYB 3S34L 5I2IB 2BOCB 1UC6A 4N0YH 1MFDH 1X5XA 5IBTH 5ABDE 4Z77B 5HPMA 3PG2A 1N6QH 2D7TL 1QLFB 4MQXC 3TV3L 4YUEL 1YEKL 3VH8G 4HUXA 3WDIA 2FDBP 2HRPH 2OXGA 3AFLA 1TDQA 5DHVH 1IMHC 2KH2B 1CYGA 4KTDL 1PKQB 3QIWA 5JDSB 1HXMB 4XWGH 3TBWA 3X13A 3ARBD 4PRIE 4LKXB 1EAPB 1QP1A 4XPGL 3BKJH 4PGEB 5EPMB 1YQ2A 3D69B 2G9HA 2QHLA 3D9AL 4JKLA 4G6KL 4ESKA 1GYAA 1DN0A 4Y16B 2VR4A 3UPAA 1CCZA 4LVOC 1DN2A 3ULUC 1BBJA 3UROR 5FCSH 4XNXH 2CDGB 4ONGL 1XCQB 5HI4C 1T3FA 5AWNH 1U8LB 4XX1G 3DVNB 3TJEL 4EZMA 2BNQA 2FJGB 1Q8MA 1UYWH 1MFEH 4ZSOE 5DJXB 4ONGH 5E2WH 1ZT4B 3BKCH 4JFPB 5D7SH 4UQ3B 5DDHB 3ZDYF 3UTQB 1NAML 2BRRL 4NQDD 3WKNA 2XPGA 2N1KA 4Y19B 5B39A 4JJHA 4LLQA 1P7QB 2FSEB 1IGIL 4OTXL 1CD1B 4HEME 3TZVD 2Q8BH 2CUIA 3OWEA 1NMBH 4KI5F 5KS9F 4LLVB 3IXTA 1WGOA 4KK6D 5AZEH 3OR6B 1K3ZA 3TC9A 1XGQB 2VZUA 1RVFH 3S3JA 5D2LF 3BE1H 4D0DB 5F7FA 3EJYD 1EV2E 4HJ0C 3IJYA 1CXIA 4QXGH 1YY8B 4X6FA 4DTGH 4LLYB 4NZTH 4C58B 1ZE3C 1GIGL 4LGRB 4PJXE 4N8VG 5CKGA 2V2WB 3W9EA 1F97A 1G9EA 5FYKD 2AQ1A 3BIKB 3RGHA 1MCKA 3ZSSA 5CLTA 1DFBL 3L3OB 4O2CA 4PJ5E 4X6EA 5I1DA 4Z76B 4U6XA 3VRLF 2J8UF 3CVIL 2FLBT 4L3CA 4BK4A 1H9VA 1UT9A 1BPVA 2JJSC 1DFBH 2DWDA 3GMRB 3PWLB 4AIXA 4H5SB 1K2DA 1JHTA 3P4LA 5EA0L 3LS4L 2WBJD 1F3JB 2IQ9L 4OM0H 5I1IL 3VW3L 1HH9B 1TETL 3EJZD 1Z9SA 4AM0A 4DK3A 1CFVL 5BRZA 3ZKXC 1JZ7A 4HIJB 4C56B 3WJJC 1UA6H 4BUHA 4M43L 3N9GL 4UINH 4XP1H 3VGAC 5DUBA 3REWA 1NLDL 2B7DT 2R0LH 4WI5A 1AI1L 4M00A 4R7NA 4NCC1 2ADFH 3CK0H 1XZ0B 4EVNA 3N1QC 2O5YH 3IDMA 3V5KA 3QQ3B 1FSKB 2DD8H 1JUFA 3KPTA 3MFFB 1TXKA 2DLFH 1I3RB 3QCVL 5MEQA 2IG2H 3DUSA 4I8DA 1AXTH 1K3IA 5EZIH 5EWIH 5TDPA 2ZOKB 2XZAH 2MFNA 3T0BA 1FLTX 4LPUA 5IVXE 1Q9LB 5F7NC 1KCLA 2I24N 5AAMA 4FQHB 1OTUC 3QCVH 4M1DH 3RI5F 5ACMA 5GGQL 5C8JB 2GCYA 4PB0L 4FFVC 1G0YR 4J3WA 5I1CL 3LKRA 3FQUA 35C8L 4LLUA 3RIFK 1YEGH 4LRIA 3DRQB 3QIUA 1WWWX 4NZUL 4UBDC 3AMKA 3QYCA 4X8JA 4EI5D 1A1MA 2QADB 5DD3H 5CZXC 3T0VA 4KZDH 4ZUTA 2G75B 5DJAA 3GI8H 3A67L 3FRPG 4A6YH 4K2UH 1D3CA 2AABH 1X5IA 2VQ1B 2Y06H 4JHBA 1R3IH 5DD3L 1CF8L 3MRRB 5ERWB 4U1NA 4HGMA 2PTVA 3GMNB 3OKLA 5I1GH 4H20L 1J8HE 2RQ8A 3LY6A 3BP6B 1F58H 5DVNA 3NBNA 2BERA 2DRUA 3A6BL 3UBXA 3SOBH 4U1SB 2HH0H 1TZGL 4PG2A 5I1GL 4PJ9B 4YO0B 2A74A 3MUGB 4U1JB 2HJKB 1FGNH 4MNQB 3O0RL 3HC0A 1KB5H 3QUXC 1QR4A 4MXWL 5BVPH 5LCVL 1CICC 3RU8L 2HMIC 3MACH 5CP7A 1WWAX 1NFDB 1DQLL 1QNZL 4HKBA 5E1AB 1OAZH 3VFGL 1KB9J 2XFXA 1MVUB 3LEYH 4YDIH 2Z8WC 4GO6B 1L9NA 1RZIB 2JJSA 3LQAH 4MYWB 4Z0BL 4ETYA 1VDGA 2YN5A 3EYFA 1LEKB 1DQLH 5FM4A 4L29A 4N5ED 1HHKA 1F45A 5EBMA 1D7FA 4DW2H 4J2XA 4HC1H 3ZKMD 3S4SG 3PWVB 1CBVL 2X05A 5E8NB 1WV7T 1WITA 4HUNB 2CKBB 2YN3A 1JHKL 4PJEB 3SGDI 1KJ2H 4X5XA 1R0AH 1NEUA 1HHGB 1KENL 1K85A 2DN7A 1QSEA 2M1KA 3DLQR 3P77B 2FHBA 3EJYC 4BH8A 4MJ6A 2VLJB 3KR3L 3BRDA 3UTTB 3ARRA 1HSAB 5GRVK 3CFEB 3RVXC 3WKMH 2Q1EA 3CFKA 3C08L 3CX2A 2XQBH 4WNQA 3W0WE 4X9GA 3OKEA 3L3JA 3IETB 5BMFH 4PJGF 2XRAL 1HI6A 4ZODA 3V0WL 1HSAA 4U0RC 2W0PA 2P7TA 2KUTA 3O6LH 1EHLL 2VLJA 1Z9LA 4XMKL 1MUJB 3QDJE 4D9QD 1PY4A 5BMFL 3VRLE 1JN6A 2X41A 4XXDB 5I9QB 4CMMA 1HZHL 2AXHA 5ALBH 1N59A 3S9DB 1GZPA 1LO4L 4LASH 4KKLC 5J7CC 5JW5A 1IAOB 5CIPA 3BN3B 1KJMB 2ERJB 2A6IB 3Q3GB 1OSZB 2AJXH 4L4TD 1BOGB 4D9RE 1LO4H 5EBWA 2F74A 3SDYH 3SGKA 4HXBH 1VADA 4ACPA 1AGDB 5BV7C 4F3FA 3BYTA 2L0DA 5GSRB 3UJJH 1ZLSL 4POYA 5D1ZD 1LDPL 2YPLE 3NAAH 5DJYB 3QISA 4GKNB 4M6NH 3H3PL 2IC2A 2J5LC 3S6CA 1GGBL 3SDDA 2DQGL 4YHPA 3ARGD 3RL1B 4UT9L 4KI5E 5KS9E 5EOQL 3ELAT 4M6NL 4G8IA 4B7LA 4RFNC 1MRCL 1X5GA 4NQCA 3FQNB 5EZJB 4P23D 4L4VA 4JGMA 4K9EH 1JNNL 3RWGB 3MRIA 2J8UA 1DJSA 3I9GL 4GBXD 4WW2B 1JGEB 1MRCH 1JNLL 5IT2L 3M8OH 5DJCA 2GY5A 4PJGA 3SY0A 5JXEA 2EDEA 5JUEH 1G7HA 1DDHB 3NIGF 4YQXL 5D7JD 4HUVA 1HHHB 1OD9A 4LU5L 3STZB 2VO5A 5HBBA 1K8DA 4POUB 5GGRA 3V8CA 3H42H 2GITA 2VWEC 3QCUH 5DFWH 3CSBA 2W9LA 4RBPK 3WNLA 3LS5H 4IOFC 3KPMB 1KPRB 1J05B 3VXUA 1BZ9A 1EEYA 1H8OA 2JF1A 2JE8A 4XX1E 1YEJH 2CKBL 2Z8VC 1TJIL 2YPVH 1EX0A 3BP5A 4QHNA 4LLUB 3SE9L 4KJPD 3TT3H 3AU1B 2CUMA 1HQRB 3LEXB 3QHZH 1M71B 4X5WB 2OP4H 2C4XA 4AEFA 4E41E 3DXAA 1YMHA 3VXRE 4OZIB 3J8F7 2D7MA 4BZYA 3DHMA 4WUUD 3VWKD 4JZNA 4WUUA 3I75B 4LCCC 2VITA 4GBXA 3QNXB 2CK0H 2F8VA 4QWWC 1RUAH 3ZDXE 1Y18B 3QZWB 1KLUB 2XG5A 3G5VA 3LKQA 3BSZH 5KSAC 5KTEH 3MROB 2R2BB 5IIEB 2HKHL 2XV6B 2CD0A 3H9SE 3V6OC 3AM8A 4MJ5B 5EU7C 1BVLA 2Q3AA 5C0CD 1QSFA 1JGVL 3ARBC 2QQKH 2LV4A 5JOPE 4NO3A 5DJ0A 5ITBL 3AAZB 2YSSA 4BSWA 3MV8D 3ILQC 3OGCA 5E08L 5BRZB 4Z5RB 2CXKA 2EKSA 3QP3A 3OXSB 1QR1B 1LP9E 1LEGB 4HWBH 1RK0B 4JREC 4OZGE 1JHTB 1FVEA 2A77H 4XVTH 1PYWB 4J8RA 2FBOJ 3PWLA 1JPTH 1BIIA 1IGTA 4JLRA 1I9JL 4Z5RA 1Q72H 2ZG2A 1HOCB 3QUXB 3ZKSD 1I3GL 3HE6D 4PJ7E 1P4LA 2W0FB 4XVTL 5C0RL 3FJTA 4O2CB 1RJCA 1FZMB 3BW9A 4U6TA 4K8RD 2OX5A 1GGUA 1WUNT 1G7LA 4FZ8H 4GSDH 5DJ6B 2NX5D 3TT1H 3I02A 2ICWI 4JFZH 2V2WA 4HS3A 3T8XB 2PXYB 3DX7B 3JV5A 5JW3L 4LHJB 1IBGL 4P4KC 4JG0H 1WBXB 4GUPA 4QCIB 2IBZY 1CFSA 3BKMH 2FR4A 3I02B 3MYJB 2YPLD 1FYTD 3GO1H 1D5IL 4YHLH 4ZFFA 5CSZA 4OCRH 2GT9B 3BW9B 4LSRH 4DWHA 4LQ1A 1NUNB 5FB8A 1X5YA 1BIHA 1KJ2B 4F37K 5JW4N 4WCYL 4Y4HB 4ODTH 3VI3F 3QUXA 3CDCA 1HOCA 2C9AA 3GO1L 4YHLL 5J0BA 4NHUB 2HWZH 2YD4A 3RWDB 2BY2A 5ETUB 2OK0H 1AXSB 3ARUA 5C09D 3RWEB 3A6CL 3KYOB 4XBGA 5EZLA 1FVDB 3GM0A 2COQA 3S3PA 5DRXA 2NQCA 3C6LD 4GKOA 5DDHA 2VN7A 4IOFD 3OGCB 4KV5E 5CBEA 5E8EB 1EK3A 5DMIH 4PJHB 4LP5A 1S9KC 4LLMB 5GGSB 2X4UB 3LN4B 1G9MC 4HEPG 1XCQA 2NZIA 1CGVA 4OD1H 1QSVA 3CPLB 4XCCL 4R3SB 5CS7A 3QZWA 3SY0B 3T04D 1MAKA 3SKMB 2IGFL 4J4PA 3U4AA 4YFEA 1MCLA 1AHWC 3VWJD 3IVKB 3ILPA 3OJDA 3VWJA 1D5ZB 4NKDB 3NFNA 4NGHL 1NC2D 5C0BB 4GXVH 1VSCA 2IGFH 1F13A 1ZXQA 4OCWH 4ELME 3VFOA 4OQ1A 2FO1A 2E8ZA 2EYRB 4RCAA 3WS3A 1YMHB 2W9EL 2WINA 5F9AC 1FGVL 3MV11 4M5ZL 5GGVL 4UOJA 5GGUB 3V5DA 5FM5M 1X3DA 1ZK9A 4R4FL 1OSPH 3AS2A 4QGTA 4WVRA 1ZA3B 2Q7YA 5A3ID 1FGVH 4MQTB 1T1ZA 2B39A 4KI5D 1GAFL 2DMCA 5DFVC 5SX4I 2CKNA 3RBSA 2Z8RA 3SKNB 5DEFB 3P0YH 4GW4B 4FQCL 3MCKB 1FV1A 1XGUA 1GIGH 1NFIB 2AJ3B 1GAFH 1J5OL 3IFNH 4RGNB 2NNAA 5CP3A 5CGTA 3VFWA 4QTHB 5DJDA 5D1XD 5DTFB 5F1IA 3P0VL 1K8IA 5E6ZA 4JFEE 4ZOAA 5T5NF 3D0LB 2Z4QA 1DDHA 4OCMC 2V2TB 4F37F 5CMAB 1ZMYA 3CVIH 1EHXA 2WSKA 2NXZD 1X5LA 3MXVH 1DVFD 4LHQB 1MIML 5ENWB 3BEWA 1P4IL 4LLWB 4R26L 4X0KB 1IAKA 3N1PC 3BQUC 4G43B 3JWDL 1AQDB 5CEZH 2B1AH 5C6PB 1QFWH 4WNQB 5HI5D 4I2XE 3M17B 4MDIB 3SDAB 1KTLB 5LKNA 2F8XC 3EYVB 2QQNL 4Z7VB 4JANB 3CFEA 2P8LA 2V5SA 4MJ6B 5HVGB 2OJZL 1N5AB 1IGFL 5DJYA 4Q0XL 1EFQA 2QQNH 4OLUL 4F7MB 4HUUB 1E6JH 1NSNL 3T77A 4H25B 3ULVC 2XZCL 1WICA 1RJYA 1MFAH 4Q0XH 5FO7B 2D4DA 3EYUL 3MZTA 4LCCB 1OSZA 2R4SL 1A7NL 4M7KH 3L6FB 4V1DA 1MF2H 3L95A 5FGBC 4NKOB 3NCCB 2F53E 4UNTA 3MOQA 4TVPE 2XZAL 4OFIA 4PRPD 2R4SH 3CDFA 4PJIA 1QEWB 1FH5H 5AD0A 4HKBB 5BRZE 1WBYB 1XF1A 3T08A 2Q7NA 3VD9A 4JZJB 4AENA 5C86A 2GKIA 2P7TB 1QFWI 1BEYH 3HNSL 1TVDA 4LOUD 5I1AB 3TH4T 3VXME 2VL4A 5DO2D 4C4KO 3E2HB 1MJ8H 5BZWA 8FABA 1HN1A 4U1SA 1GC1C 3E8UH 3WXWL 4G8EA 3T0ED 5D7IF 3WEXA 4OLZH 3WIHL 2ICWJ 4JY4A 4Y5XC 4FNLL 4PJCE 1OWRM 2ZPKH 3K80A 1JHLL 4N9GB 4OLZL 3ARGA 2NY3C 1KV3A 4OIBA 4P57B 5B38G 4FXKB 2FJHA 4LVHC 4X4ZA 1S78D 3GMMA 1IT9H 5EFIB 2J5LB 3NCYS 3CVHH 4XP5L 1LEKA 1Q94A 1MCOL 4JN2B 5D7LE 3FAXA 4P2OD 3QJFB 3JTTA 1A6TA 4GMSL 4XI5C 1EO5A 1ULVA 3U36A 4OF6A 3KWWB 4ODVL 2Z31D 3V2AR 4P3CL 4I2XB 4M03A 1FNEA 2HRPL 4NM8L 4Y4HC 3MV01 4X9BA 2P8MB 1CXFA 2QHRH 4ODVH 4DFIA 3CLEH 4P2YA 1G7PA 3WFHA 5LGHL 4F7EB 2DYPD 4BKLA 4IMKA 1N0XH 1R3JA 4UAOB 2BMKA 4JY5L 3UCRA 2BRQA 3D0VA 4G6KH 3LRSB 3CGTA 1CBVH 1NCAL 3QQ3A 3OKMB 4Y1AE 4OCSH 2WIIB 2ICWB 1B4JL 1T83C 5JHLH 1KJ2L 3L7EB 3CJJA 5C9JB 2VABA 2AJUH 3N1MC 5DJAB 1SEBB 3QFJD 5DUBB 3REWB 4K9EC 1EXUB 4JFED 2J7LA 5KSUB 2UY6A 5HGAB 2CUHA 3CH1B 3QXVA 4I3GA 4F7PA 1FAIL 2QEJA 3C08H 3QIBB 3ZT5A 2XQBL 4HLZG 3BKYL 4GKSB 4K7FB 4KV5F 2ZCLH 1YEDA 4H5SA 3D39A 1T1YA 3RJQB 4DZ8A 1UM4H 5JDJA 3SDXF 1ORSB 5EU7E 2GQHA 2H8PB 3PGCA 3GSOB 3U0WL 1FL6A 1KJVB 3O41A 3HB3D 5AZEL 5I1DB 4ODUB 1Q9LA 5B4MC 1YQVH 1RVFL 2DL9A 1IEBA 1I7RB 3BE1L 1YNLH 2NY2B 3X3GL 1S7WB 5ISZA 4M7LL 1T7ZA 2VDRH 2Q6WA 3O4LB 3W82A 3UJIL 3ECBA 2E7BA 4OFVA 1QHPA 4MD5A 4UOW0 4XPFH 4ZDHA 3R8QA 2Q3ZA 3VXQB 2A6JA 2MQCA 3DRTA 1QD0A 1N8ZA 4GAJH 2ICEB 1JWUB 3F7VB 5BCAA 4YDLC 2NXYC 3QBTB 2XG4A 5CWSA 4BUGA 2X4PB 3GJFB 4PTTB 3I3EA 3HPLB 3G6JF 1BOYA 4GAJL 4P9HC 4G42A 2FYYA 5E56A 4KRPC 4P2QE 3TCLB 2AKRA 3TPKA 3KHQA 4OZGA 4L9DA 3WLBB 3ULSA 3FT4B 4DN3L 1I1CA 4HIIB 1Q0YH 1K2DB 2FBJH 5HDOA 3ROOA 3W11C 4PLJD 5E9DA 1JYNA 5LAXA 4XP4L 5AUMB 1KIQB 4M43H 1C5CH 4KMQA 3IS1X 1NLDH 2EDOA 2YXMA 3IDXH 4EUPH 4DAGL 4FFYH 2CDGA 4EKXA 1KFAL 2ADFL 3CK0L 4G8GB 3X3FL 1OTTD 5IMKA 1FNAA 3LPFA 5DO2C 3D6GA 4X98B 4YHYB 4YDJB 4MZ3A 5C09A 3PV7A 2MSPA 1QLEL 2NY4C 1ES0B 3AC0A 5CEZE 3EDDA 5HHMB 1I1AB 1T1WA 2ZSVB 3BGFB 3OG4B 3D2UB 3DHJA 4F7TB 1AXTL 3FQTB 3OSKA 1YEEH 4U6HB 2EEDA 4EI5B 4LVNB 1J10A 1AE6L 2YZ8A 4QY8A 1QZ1A 5E6IC 2XTJE 1GRWA 4UTAH 5BW7C 4LLVA 4EQ3A 2CO7B 4ZNEA 5IMOA 5GRXG 3JTSA 2AEPH 3P9WB 3C6SA 4L3ED 5EOTB 4HS6B 3PIQA 35C8H 5D72L 3HC4L 4DCQB 5H37H 4GBXC 1GGCH 5MI0C 1BFSA 5IJKC 5EUOB 4NZUH 2BOBA 1Q9OB 2VXVL 4PB9H 1MJ7H 3CLFL 3F65A 2KQMA 2CMRL 3MV9B 1OAXH 2DQHH 1RFDH 1P7KA 4I3RH 1JF1A 3ARXA 5H94B 1MCCA 3QIWD 5D71L 4D0CB 4PV8B 3SCMA 4PFEA 4PYHA 1ZAGA 1C1EH 1H3GA 3L5IA 4UB0H 3K7UA 2DQHL 3RKDC 3VFVA 2LU4A 5FKAB 2VXUH 4DZBA 1P1ZB 3V6ZA 4X7TA 1UADC 1DN0B 1ZLUH 3G5XA 1V8HA 3IKCA 3CD4A 4E41A 3JV6B 5FO9B 1F8TL 1TZGH 1RZFL 1UENA 2UUDH 4KHXL 2HT2C 2XKSA 3CSPA 3DXAD 1LP9A 1L9MA 5GSVB 1T22A 4FXGB 3THML 3O0RH 5LCVH 2V6HA 3MACL 5JPMA 1YC8A 3G5ZA 2MOVA 1CDCA 3EYOB 4J1UB 4OF7A 1AHWA 1XAUA 4WW2C 2FWOB 4HJGB 2XWTA 2IAND 1U8PB 2PO6B 3HNVH 4LGPB 2QTEA 1EJOH 8CGTA 3IDUA 4PRBA 4KTEH 1C16B 4JE4B 2DI7A 5DK2A 2DQUH 1DQJA 5FV1L 4N1HB 1WWBX 3PHOA 2P5WB 1B0RB 5DA4A 1FCGA 4ZO8A 2RHEA 2UUDK 1B4RA 1RIUH 4PJFA 1BX2B 2PETA 1JHKH 2V7NB 2V9TA 3RDTC 4H1LB 4BQ8A 3N85H 1RMFH 3SJVD 4J3UA 5HGBB 1E4KC 4Y16C 3SDAC 4GRMA 2R9HC 2JLLA 1G7QB 5JHDB 2WLYA 1RMFL 1V7NH 4R0LB 3WN5B 4ZOCA 1PLGH 3TP4A 3SE4C 2XWJA 4NN6C 1B2WL 1T4KA 3BVNA 4NWTL 1ZTXH 3FB8B 3JWOL 3KYNA 4NIKB 4UBDD 4PGZA 4I13B 1L6ZA 3OPZH 1JGDB 3GSRB 5L2KB 2BXZA 4U05A 4KKAD 3ISWA 4HJJL 5DI8A 5DRNA 5D1XA 3PDGA 3W39B 1AIFA 1AD9A 4NWTH 5K9JL 2O61A 2JKXA 4TSBL 4DUXA 2J4WL 4KRPD 3RKDD 5FGSA 1CLCA 2Q76A 3MV9E 4HFWB 1A6AB 3CDYA 2R4RH 3GMLA 1ZHLB 5HGHA 5IW6B 5EUOE 2R1XA 3QIUD 1P9MC 4PV9A 5CJQL 1FN4B 1PDKA 1Z5LB 1P53A 2DM4A 3H8NA 2BY1A 4LAJH 4YX2L 4H88L 3UYOD 1KELH 1TCMA 1HWGB 1S9VA 4XCFH 4XCNA 4QHLB 1YECH 5H8DA 3MGOB 4P46D 2DKMA 3VG0H 4X7EC 2UZXB 2VLKD 5BQ7B 1GGIH 4W6XB 3DSFL 4Y19E 5C1MB 2VLKA 2EDLA 4JAMA 4YE4H 1F6LL 3PWJA 1FJ1A 1NEZA 5C0JB 3PWUB 3ARVA 4KMTL 1GGBH 2YD9A 4OZ4B 3BMWA 2IADB 1N3NB 4UT9H 5L2JB 1AIFB 1YUHB 4OFYD 4Z7WA 4EUPG 1NCNA 4KMTH 5J1SC 3UTTE 4PUBH 3MV8E 4YZFE 5T1KD 3C09C 3TH3T 2E9WA 1MFCH 3TBTA 3ULUL 2NR6D 1JNNH 5DLML 5L2JA 4IRSC 3V0VA 1GOGA 2P5EB 4NO2B 5SWQA 4AG4L 1FDLL 5AAWA 4Z8FL 4OD2A 5FYKH 2O5ZL 2I25N 2UWEE 1BQHB 1ZLVK 1MFCL 3ULUH 2APVA 1TPXC 3EGSB 3QUYD 1I3VA 5FGCE 1CLYL 5CD3A 5FF6A 2ZNWA 5BQ7A 4NBXB 2V7NA 3VXMD 4TUJA 4LIQL 1I7UB 5F96L 3PHOB 4QEGA 2H2PD 2Y5TA 4PJ8B 5D6DC 1JWMB 1QFOA 3VWKB 3NCMA 5T1LA 4LIQH 4YHYC 5CEZD 2UZYB 2CKBH 5F96H 4LQFL 4CMHB 4GW1B 4NDMA 1QSFE 3HN3A 2BNRD 1KCVL 4JFFB 2FWOA 4HLJA 1IGCL 3MRQB 4HZLA 2IQAB 4UTBL 1MI5B 1KCVH 4HK3N 3HAEG 3TA3B 4IBLT 1DQQB 5GSVA 1JGDA 2EDQA 3GSRA 1LK2B 3ZKMC 4PTUA 1TCRA 4HJ0D 4ZNEE 1WZ1H 3GIVB 3B9KB 3KLAB 1OP9A 4BH7B 1FFPA 5J13B 4OF3A 5ITFA 1GPOH 3D5OF 1H3VA 2YC1B 3G5XB 4FQ2H 4GRMB 3VFNB 4XMPH 2ZCKL 5SX5H 1UB6B 2BVPB 4DUWA 5E70A 2IPTL 4HXAH 1Y6MR 1HILA 4EXKA 3GGWB 2X4NA 2YD1A 2PR4L 2P47B 3SCMB 2QQKL 3HA0A 2ZCKH 1VEOA 1P7KB 4YEEA 3V7AE 5EU4B 2P24A 5T1LD 2N4IA 3QEQE 32C2B 1A14L 3NIDE 2EXWC 3IJSA 1BF8A 5ID0B 3EFDH 1K9TA 5CIPH 3RWFB 4HUWA 4ZS6C 3DO3A 3UTPE 5DSCA 4XP6L 3INUH 1D5MA 4ORZC 3HG1B 4W4NA 5C7XH 2HTKD 3IFLL 4X83A 2XN9D 3DPBA 3Q6GL 5KSBA 1MCPH 1AY1H 4YDVA 5IESH 5C7XL 2HG5A 4U3HA 3MNVA 1K5NB 3RUGA 3IFLH 1NGYA 1WIOA 5DQ9A 5DD0L 3VXTA 1N7MH 4GRLD 3LV3B 1VFAB 2DLEA 1PQZB 4OCXL 4XNQA 1XEDA 4ZOEA 2ATPB 5I66A 3P0GB 1R3KB 4YDJA 5C09B 3CVHA 1RU9H 3VGFA 1FIGL 4HUMB 4YHOL 5KSBF 3U7YL 3QO0A 3RX8A 1S7XB 2ZKHH 5DZNA 3GBMH 1R3HA 2EKJA 5E8DH 1Y6KR 3WIHA 5D2NC 3QQ4B 4NO0A 1AGBA 5D7LB 2VDKH 4HF5L 3PWPA 5FK9A 4IDJH 5H94A 2A9NL 2ZKHL 1U91B 4CADB 5BVJB 3Q48A 3U4BL 5HPOA 3STLA 5E7BA 4JPIB 5DYOA 5F70A 2N7AA 4LEXL 4JM2B 4M9PA 2WBWB 3C8KB 1W8OA 4IRSA 2BY0A 1LE9B 4HIIA 3ES6A 3G5YA 3BGFC 4M1CD 1IL1A 1ZVYA 5F3BA 4JDZB 1I85A 1NGXB 1NMCC 2AI0L 4XZUA 3TESA 4N0FB 5IUSA 3C6SB 4OZGB 4OCSL 1MQKL 5C0FA 3PP4H 1MFEL 4NNPH 3ZTJG 5HYSG 5F1NB 5IFHH 2PTUA 2EDJA 3BKCL 1D9KD 4PJXB 5I1HH 1JFQL 3GJEA 5CGMA 2B4CH 1B0WA 3KVQA 1MQKH 1C5DB 1OAUL 2ICEA 1SBSL 1FFOB 5TPWH 3RVWD 4ZXBC 3LIZL 1IGIH 1KCKA 3G6JB 4E0RB 5D7JA 1NAMA 2GW5A 3KJ6L 4K7PL 4YPGB 5EO9A 5C0DA 3RGVA 1R6VA 2D9CA 1IAIM 2P8PA 1RZ7L 3DMMC 3TO4C 4C56D 4LPCA 3A6OA 2HT3D 3WUWA 2ERJC 4NRXA 1KLGB 1RUKH 2XZQH 4K7PH 3P73B 4ZFOA 5T3ZD 1GHFL 3PABA 4JM4L 1YNTA 3GSUB 4NKMB 1T89C 3MJ6A 2LVEA 4YDVB 3ARFD 4S0TD 5EO0A 4YAQA 3C5ZC 2XQYK 4TVPH 1YNLL 4U1GB 3T0EE 1T03H 1A7RL 2X70B 1C08B 4GXUN 5MEOB 1E28B 1PZ5B 4Q7DA 4ZSOB 4GKSA 4LEOA 3RIFF 4ZXBD 1OAKH 1WFNA 4FQCH 5ID0A 2W91A 3WLBA 3X12A 1M1SA 3RNQA 5FDWB 3TCLA 3TIDA 4U2YA 1MNUH 2XA8H 5KSUA 1KUMA 3V7MA 3T2NL 3ZE0F 4RAHA 3EOBB 3F7PC 2VDLH 2YEZB 4I0PB 3BPLB 1TPXB 1J7VR 4QXUH 3QUZA 4AMKH 3U0TB 1DQDL 5C08D 2VXSH 2IQ9H 4OM0L 4BQBA 3U4EB 2D4FA 4WEUD 3VW3H 4UILL 4V1DE 3RGVD 3L3GA 4AMKL 3ECBB 4HPYH 1FC2D 4MD0A 4EI6B 3V4PH 4NO0D 4X7DC 3U9UB 5C0CA 4TTDD 4JPKL 4Y19D 3VA2C 5DK0A 5CJXA 1I7RA 1PX4A 2X1QA 1BGXH 1EBAA 5L7XL 1WFUA 5JLZA 2FJFB 2HLAB 1T0MA 5T1DH 1C5CL 1U92A 3PGCB 3UTOA 5I73C 1E4XI 2XACC 1E4JA 3MLYL 1FE8L 4WGWB 5I71B 3EBAA 2EEAA 4NQUA 1U42A 3BWAB 3D39B 4KK5C 1PEZA 4OLUH 1ZVHA 3FO0L 3DBXA 4DKAA 1UEMA 3V8OA 5J6HA 2F19H 3UJTH 3EYUH 2CLZA 3QHTC 2DDQL 3WBDA 3JVGC 4R4ND 3HCVB 1RUPL 1FZOB 4FXKA 4LVOB 5CGYC 4F57H 1U9KA 1P84J 4PB0H 2HFEA 3U46B 3WN5C 3ULVL 3UJTL 5CINH 2PW1A 3UTSA 2VIRB 5IJVA 3FKUS 1M7IB 1PGRB 5AG8A 1WF5A 3WFDL 1HINL 1BQHA 2GAZA 3WEXB 1QBLH 3IDGB 4QRTB 5DGQA 1KOAA 2C3GA 4K3EL 4RMUA 4I18A 1JK8A 4G5ZL 3HUJB 4RWHA 3TBSB 1LO0L 1I8IB 1R5IB 2VDML 4QO1A 2CLRA 1GGTA 4YXLH 4YZFF 3ARFA 3EO9L 1N3NA 2IADA 3E8UL 3WXWH 3KYAA 4LSPL 3U6RB 4U1IB 1XCTB 1NLBH 4Q58C 3HFMH 3S3SA 1WBYA 1RIHH 4TOYH 3G9AB 3O6ML 1VFBB 2I60L 3WHXB 5JORB 4ZXBA 3NIGE 2HH0L 4RDQG 4AJ0A 1TLKA 4FQPA 4G3YH 5GRUH 1L6XA 3MGOA 4TSCL 3HE6A 1A64A 5ACLA 3QDJA 3T0DA 1D6EA 3J7HA 5C07B 2J6EL 2EC8A 5T3XE 5L9DL 2VLKE 3JWDC 4TSCH 4HWZA 1HIMH 1BJ1J 1OAZL 2BY3A 4MNGA 5IFJB 4C55A 4X80H 5FM5O 2F53A 3UTZB 5I1JH 2H6PB 4P4KB 4XPTL 3UTSB 5FHAH 3AREC 2N56A 3X14A 3DGGA 4YH6A 5JPNB 4KDTC 3FT3B 3MV7A 2F5BL 1FYTA 2IMMA 2P46B 3JV4B 3G6DH 5CAYB 4FQXB 1INQA 3F62A 3HNVL 4IRJD 3T3ME 5KG9A 1JI2A 3NIDF 3ZKXB 4TQEH 3D85D 3DBXB 4KDVA 2F5BH 3UTSE 5J56B 2K7PA 1A4KB 2XWJB 3S35X 3V95A 3AXLA 3WE6B 4PRPE 1NCAH 3LKPA 1JTPA 1ZS8A 4MXVE 5D1ZB 4XHQA 3BRGC 1T5XB 5CMAA 1FG2B 4H26B 4ZO7A 3MLVH 5ANMB 5D6CA 3WDHA 1T0MB 2HLAA 2WP3T 3AROA 4G7VL 4M5YL 4H1LA 4G6MH 4Y5VC 3O2WL 1WIPA 5F1IB 2R0WH 4PJFB 4FFZH 1J0IA 1GJIA 2E6QA 3B5GA 3TM6A 2M2DA 2YXFA 4RAUB 5A2LH 1CK0H 2NR6C 3B83A 5CJBA 4LVNC 5K93A 3B9KC 3H2WA 4J3SA 5K59E 1ZVSA 4LCCA 1MHPH 2XRAH 3HE7B 4XCYB 1EHLH 5GGSY 1RJYB 4GW4A 1U3YA 3K4ZA 4Y4KB 4H25A 4L1HA 3MCLL 1OT1A 2FECI 1HEZA 3RY6A 5SWZD 4GXUM 2G60H 1ZHNB 1AD0B 5EUKB 3MRNA 1AHWB 3LQZB 3QQ9C 4HH9B 3QPXL 3QO1B 2IANE 4NUGL 5IM7B 2R69H 5JPMB 1HHJA 2P8LB 2G60L 2AV1B 1G9ML 2KL6A 4P3WA 2WINB 4YC2B 5BO1L 1UEYA 5C2BL 1IC1A 5I8CA 3BP7A 4TN9A 3X3GH 2FX8H 3IXAA 4M9OA 2R23A 4G43A 3UJJL 1IAKB 3Q1SL 1D5ZA 4NKDA 4YX2H 2X70A 3BDBA 3BEWB 3L9RA 3NAAL 4RGOH 1YPZE 3ZYZA 4NQEE 4X7TB 3FQWB 4KQ4H 4EOWL 3GB7A 3RTQB 5GGTH 4JFQA 1RURH 5FHBL 4OFPA 4M3KB 1IEAA 4N8PA 2X89D 3BPLC 1HYSC 4LSUL 1UWXH 5GGTL 4RGNC 1JF1B 1RURL 1MHHB 4KUZH 5FHBH 4OKVA 3OV6A 5GGSA 4P48A 3O2DA 1NC4D 2D03H 3GM8A 5E99L 5TFSL 1J0YA 1NC4A 1J88A 3PUCA 5K9OB 1A2YB 5DURB 2QQLL 4PRPA 4EDWH 1N2RB 4C56E 5L6YL 2FBJL 3RWEA 1IC5H 4ZUWB 2Y5EA 4E5XB 1VPOL 3GJEB 5B38B 1LNUA 1BAFH 3RUGE 1T21A 5LXGH 4HC1A 1XF3A 1OAQL 5TF1L 3WFEH 5I73B 4O9HL 1HE7A 3RIAK 3RZCD 5ESAA 5HYJD 1QBML 1U8NA 3R06A 4NKQB 5LXGL 1I8MB 4MA8H 4XNUH 4XZUB 5FA3A 3GNMH 4OKDA 3HI1B 4KXZI 2VDOH 1HH6B 1MJUL 4MXVF 5INDB 5TE6L 1FNGA 3MFGB 3SKMA 3WL9B 4KK9D 2OQJA 5DYOB 4JPIA 2HJLA 4LQFH 2PTTA 1T7VA 4GH7B 1KB5A 1U91A 4CADA 5BVJA 1I4FA 3HR6A 4M93B 1I3UA 1A6PA 1UKTA 3GEWB 4APQC 3QQ4A 2GTZB 1WFTA 2KQNA 4NC0B 4MB3A 5T1KA 2A6DA 1OTSD 2E9JA 4LHUB 5KSAB 5AUMA 3QXDB 1YPZA 2PYEE 1DUYA 4OLWH 4CVZA 1AFVH 4RMQA 4WU5B 2YD2A 5GQBA 1O7VA 3IYLW 3KPSE 3O3DA 3TYGH 2RAMA 4JN1H 2IFFL 1FL5A 2BDNL 5JNYA 3U79A 1J8KA 2WLZA 2CQVA 5D71H 1I1RA 2VLRD 2GT9A 5FB8B 2VERN 4R7DA 4XP9H 5ALCH 5KSBB 4ONOA 1AKJB 1C1EL 4PG9A 4P2QD 5E6YA 1EO7A 1NCDL 4R96B 4JO4H 4JQXC 3C60A 3HPJA 5E2VL 3RWIB 4B7IA 5CEXA 5DSCB 5C0AB 3S37H 5FECA 3MJ9A 4E42A 3PL6A 4XPHL 3VXQA 1SMOA 4M48H 5D2LE 4ZD3H 3QRFM 3H7BA 5F9WC 4D9RD 2Q6WB 4FA8A 5DJ6A 5ISZB 3UDWC 5IMLA 3BZ4B 2QSVA 5J89A 4WHCA 4WFFE 5DJ2A 3RWCA 2P5WD 4ZTPL 3MNZA 4UV4H 1A02N 1FORH 5IESL 1Y6NR 4JFZL 1ORSA 5EU6A 2X4OA 1XGPA 6CGTA 3LDBB 1QLRB 1KEMH 1N7ML 1YPZF 3DUHA 2XIDA 1PYWA 5GHWH 4KQ3H 2OR8A 3O45B 4OF8A 4WW1A 1EPFA 4ZPVB 1QRKA 3GIVA 4P2RD 3FO2A 5BZDA 1D5IH 1N0LA 4RMVA 4OCRL 1NFDE 4HPOL 4KQ3L 1RZKC 1EXUA 5L2KD 4L8DA 4ODTL 4LCWA 2MCG1 3MR9B 1I1YA 1PSKL 3N85L 1K8DB 3S7GA 2R2BA 3FRUB 5D7KD 3DX9A 1MLCA 3SGJC 5F3HB 1HDMA 5FGRA 5DJCB 2GJ6E 1ZHKB 4NUJB 3OKOB 1RHHA 4WI3A 3H9ZA 2BMKB 3RWGA 3KJ4B 4D0BB 2BC4B 5TQ2H 4BKLB 4Y1AD 2BNRE 5CEYA 1JPFB 5IB3A 3HZKB 3CFCL 4ONHB 1CE1H 4G8IB 1ZGLB 1Q0XL 3FT2B 5F7EH 1S7QA 1G6RH 2A38A 1M71A 1FNEB 2Z35B 1HQRA 4Z7WE 2RCSL 3KWWA 5I76A 4FFWC 2UYLA 4KDTA 3C8DA 4RAVA 3WS6C 4I1NB 3AREA 1Z3GL 1LEIA 3ARBB 1A1NA 3QH3B 4PP1C 5FYKU 4OCWL 2JCCE 1DL7H 5DF0A 2PXYD 3MLPA 1YUHA 3RHWF 1Z3GH 1CVRA 5ELIA 4MVBD 3HRPA 3MRPA 3I6GB 3ULUD 1ORQA 3QEQD 1MCBA 4QRRA 3KAAA 3DSFH 4GKZB 1B88A 1FBIH 2H9GB 2Z91B 2VR9A 2DKSA 1QFWM 2VJXA 4PJFE 5KANG 3JSSA 1KG0A 4R4BB 4WI9A 1C12A 4NRZB 5E8OA 4N0UE 1A6VL 3FOMA 1XGRB 4QHLA 3T09A 3ULUE 4TVPL 5ANME 4ODBD 3VXOB 3C6LA 3L3DB 4U49A 1T66D 2B1HL 4JREB 3OAUL 5IQ7L 1XH3B 1MI5E 1EEZB 3QEGL 4GRWB 5I1AA 1EH9A 1EERB 3OAUH 1G6RB 1J1PL 4ODWB 5FA4A 3DYOA 4LIQE 3SDDB 4Z8FH 2J12B 2Y36H 5B21A 4YBQD 1LGVA 5E2TL 1RJLA 4OQTH 1QEWA 4LAQL 4QXUL 3D25B 1DQDH 1AP2B 5TDOB 5EB9A 4YFLI 4DVBA 1LE5A 1BOGA 5D1QD 4U7SA 4J3OC 3Q3GA 2A6IA 3RAJL 1K6QH 1A6UL 1AGCB 2YA2A 3BDYH 1U8QB 5C0NC 2NY5C 5IFAL 4JZOA 4AEHL 2OLDA 5IGXL 4F8QA 1K6QL 3ZDYE 5KW9L 1L0QA 2ORBL 4KI5C 3IDJB 4PJAA 1MCEA 1U95A 5C0AE 3UO1L 1E4XL 2EDTA 4OFYA 2A1WL 2HJKA 1MF2L 4U1JA 4LCIL 5GJTL 4NBZB 1IM9D 2NY6B 3UO1H 2YUZA 3QULB 1KLFA 1RK1B 4G9DA 1KG0B 1N4XL 3EFFA 4U1NB 4F8TA 2XN9B 3DOSA 3S96B 4TPRL 2JTDA 3HNSH 4EIGB 4GKZA 1ZHBA 4HGKC 3QULA 1HYRC 1I7ZA 5IF0B 3TO4B 3UMTA 1J1XL 2EDWA 3T1WA 1HHKB 5FO9A 4NJ9H 1INDH 1A14H 1DVFB 2AEIT 4URTB 4U1KA 4BQ6A 5IHZA 3GMPA 4TYUA 4WI8A 1RIVL 3QWOA 4Z7OE 4CVWA 2R15A 1MVUA 4YXLL 3LKRB 1JTOA 1TTFA 5CHNA 4FQ1L 1NFDA 3DVGB 2HTLC 3GHEL 3TN0B 2Z35A 1RIVH 5C8JA 3NCJH 2X89A 3NA4A 2QR0B 1IT9L 3WS3B 4A2LA 5GZND 3TLRA 3GHEH 4PJIF 2ITDB 1H5BA 1HHIA 1D5BB 3C5JA 4JFOB 5A16A 3RI5K 2NW2A 2HT3C 1I3RA 1JE6A 1N6VA 4M6OL 3ILPB 3OJDB 1LK3H 4EDXA 1CXEA 4ZYKA 4OV5A 4NUJA 4J3TA 4JFDE 2UZIL 5I15H 2HJFA 1JV5B 3U7YH 3HHRB 4XC3H 4MQSB 5IMOB 4MHHG 2QSCH 2VQ1A 3FFCD 2QHRL 3SO3B 4PREB 2DQFA 4XPTH 2VDKL 2E7HA 2HKFL 3L3IA 4U6HA 4EI5A 2GSGB 1I1AA 5I75B 4LEXH 2XWBA 3RDTB 4ISVB 4NZRH 4JY5H 3G6DL 3ILQD 2HKFH 2DTSA 1U8KA 2PYFA 4F58L 2X5PA 5DHVB 2X42A 5DMKA 3NCBB 4KVCL 4XPGH 4NZRL 3CFJB 2AI0H 2H32B 2IPKB 3ARDC 5DVOA 5JIKA 3MJ9L 4F58H 3QIBC 2OR7A 4I5BA 4PRHA 3T0EB 1EA9C 3KDMA