1FGNH

Monoclonal murine antibody 5g9-anti-human tissue factor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
214
structure length
214
Chain Sequence
EIQLQQSGAELVRPGALVKLSCKASGFNIKDYYMHWVKQRPEQGLEWIGLIDPENGNTIYDPKFQGKASITADTSSNTAYLQLSSLTSEDTAVYYCARDNSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN FAB 5G9
publication title The mechanism of an inhibitory antibody on TF-initiated blood coagulation revealed by the crystal structures of human tissue factor, Fab 5G9 and TF.5G9 complex.
pubmed doi rcsb
total genus 43
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1997-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fgnH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fgnH02
4ZXBB 3UPRB 1T0PB 3D0VA 4WUUD 4IRJD 4GLRH 4MJIE 4P5TA 5LJYH 1DL7L 1KLGA 1W72H 1A4JB 4IDJL 4KPHH 4BZYA 4Q9QH 3GKWH 3MFFA 3VWKC 3HC0A 5A2FA 4JKMA 1PKQA 3OL2A 2Y36H 3IYLW 2Z91A 3HI1B 1FRGL 3OJ2C 3TT1L 5KVGH 5KSVB 5IJKC 4OFIA 1OP3K 5T1LB 2WP3O 4XMPH 3VXSD 1HH6B 2OTWB 4M6OH 3BGFB 4CVZB 2J8UF 4MX7A 5JPNB 1DBAH 2E3VA 2JLLA 3HI5L 3D39A 3IXTA 3JBG7 4NHCL 4QXWA 5F7WC 3VFMB 4XBEH 4HUVA 4HG4J 2AEWA 4MWFA 1DQMH 1YNLL 4JCLA 3FFDB 3W39B 4AH2B 1F3RB 2J8UB 1I85C 3KHOA 4GRMB 3UX9B 3NGBB 1BVKA 3CGTA 1TLKA 5KSAA 1T04A 1FORL 1MFAL 5I74B 2AP2A 3MRKA 1W72A 4JM2A 2A6KB 3H9SA 1DE4A 3QNYB 4HGWA 1PLGL 1CLYH 4OV5A 1U8OB 5B38A 1EO8L 2CMRH 2XTJC 3GIZL 4TNWK 4LVHB 4XZUB 5D72L 1NUGA 1NC4B 1E6OH 1NBVL 1VESA 3E0GA 3OAZK 2R0WH 3C5ZC 2DOCA 5C6TH 4EEEA 3ARGA 4Q6IA 5FYLE 1S9YA 3QXVA 2EE3A 1UA6H 3KGRA 2VZOA 3SDYL 1IC4L 2R9HD 3LS5L 5GGUA 5JQ6H 2X89D 5L88H 2H6PA 4JHZA 5F8QC 5DRXA 2ZUYA 4QHNB 1JUFA 3MREB 3VI3E 5D8JH 3ZYZA 2CXKA 1XF4A 2P8LB 3JZ7A 4QHKI 5IVXF 2FB4H 3VG9B 4F33B 3DUUB 4WGWB 5JORA 4LRNL 4MNHA 3L3OB 4K3EH 4LSVL 3VXMB 4GKZA 1IGCL 3IDYB 5TE4H 5C70A 3PWNB 1IAIM 3RPIB 3JUZA 5F71A 2AEPH 5E03A 4DQOH 4O51B 1IAKB 1RJZB 5IVXB 4OD1H 5J1TC 3CX5K 1NMCC 2VE6B 4DCQB 2ADIB 3K2UL 2HVKA 3QG6B 3N85L 3V0VA 5C07A 5IR1A 1KCVH 2YMXH 2PYFA 3HAEA 1V5JA 2WK2A 2YSSB 4LEOA 1CK0H 4YIQA 3U4EA 1MRCH 3AS0A 1M6OA 4NQCA 4FP8H 1GZQB 1MJJB 2VDQH 1IAMA 4OCRL 4LPYA 3IDGA 1Q94B 2D03H 1GGIL 2YUXA 2BSTB 4DZBB 1DQLL 1GOGA 1U3ZA 1AO7E 4N1CA 1RU9L 2HJLB 5DZNA 3FN3A 2MNUA 1H8OA 3MGOB 3GRWL 3IFOB 5EN2A 2I5YH 4UZGA 2JELL 1KB5L 5C9KA 4HCRH 3D2UB 5GIRA 3OPZL 3CSBA 3VXRE 4X4YB 1RUML 4DGVH 3QIBD 2ADGB 1QRND 5D7IF 3IKCB 3DMMD 3L5WB 1YEJL 4KGJA 4R90L 5DT1L 4ONFH 1S9KC 5DK0B 3V2AR 3PABB 2E6QA 4E0RB 1D9KC 5T3ZH 3V5KB 4F9LC 1A0QH 1H3GA 4FOMA 4KXZH 4J2XA 4AM0B 3VI4E 4PJ9D 4NC2B 4UT7L 4Y5XB 3RBGA 4GG8B 1MAMH 4EUPH 1S9XA 3U30C 4ONHB 2VLME 4M02A 3DOSA 2E7LA 3VG0L 3SDCD 1MFBH 4XMKL 5J6HB 2IAMA 2DQUH 3VFVA 3GBNL 3BRGC 2VDOL 1FFRA 1UZ6E 5IW3A 3KLSA 2UWEA 5ICZA 4R4ND 4R4FL 1KTLA 4Z95L 1ZK9A 5J06A 4XXCA 1QO3B 3LZFL 2FNBA 1N0LA 2NY1D 2A0LD 1Z3GL 3CLEL 4JPKH 2AJUH 2IH3B 1T2JA 3OJMB 3ILQD 4OLWH 4YHLL 1AFVL 4FQJH 4UIMA 1HYSC 3L95A 4Y4KD 4PBWD 3JTTB 2VB5A 2NXZD 5FOBA 2VLRA 5F1NA 1KJ3L 1G84A 3MODH 4X7SL 4JR9H 2NY7H 1S3KH 1JPFB 3VFTB 3JWOC 4EUPA 2OR9L 2ZUQC 1XF5A 1X5GA 2L7JA 4HFWB 4IHOB 4OCSH 1EGJL 1A1NA 5C0AD 3ZTJG 5D1QA 5I16B 2W65A 4NDMB 3GMPB 4FXGB 4NO0B 4OGAD 5FKPB 3GMRA 3KJ6L 4OIIH 4D0CB 4Y19D 5HYSG 1UADC 3IDJB 4WI6A 3U6RB 1V3JA 2ITDB 2C3VA 4YH6A 2WWKT 5GSVA 2DLTA 5H2BB 2ATKB 1JHLL 3MNWB 3SJVA 1OB1A 2DBLL 4DJMA 4OCMC 1GC1L 3HKFA 2XQYK 5I66A 3VXUE 4RFOL 4ZUTA 3FL7A 5EG6C 1TJIH 5CLWA 1NSNL 2VC2L 2AKRB 5IROA 5FO9A 3QUZD 4CW1B 1MHEB 4ELMF 4HIXL 4PJHA 2BERA 4IOIA 5E9DE 3HA0A 1U42A 2V5SA 4H25A 3BPLB 4M7ZB 1TJGL 5DRWB 4NM4H 3F12B 3MOAH 4RFNB 3SKUD 1IKFH 5CZVH 4NZRL 4UIKH 2OI9C 4WHYH 5I15H 3HR5A 3MLZL 4TULH 4ELMB 1OAZL 4KJPD 1BZQK 3QIBB 2J6EL 4I0PA 3U7YH 3U46A 5IFHH 5DC4B 3VXPB 1YPZF 5DJ2A 3TM6A 5L2KD 4XNXL 3PP4L 1XR8B 3ARFC 2PO6D 1UWXH 4ZSOB 4TUOB 1P5UA 4OLXH 5B3JF 4P2QD 4PUBH 5AUMA 4S2SB 2H41A 5EC2A 5C0ND 3WKNA 4F7TB 4U3HA 4PJ9B 1YPZB 1GGBL 5C09E 4YFLF 3BO8B 1HINL 2LFGA 5KJRL 2XA8H 3FN0H 2VIRB 1TITA 5DYOA 1V3KA 5DTFB 1OD7A 2DQTH 2R8SH 3RZCB 2CK2A 2Y4SA 4TTDC 5F3HA 2HWZL 2PW2A 1MRFL 3V9FA 5F9OL 1U8JA 2P5WB 3FOMB 3MLYH 2ZUTA 4ERSL 1R6VA 2VITB 2Z8WC 4PP1D 2ED9A 3A6BL 2NY1B 3IDIA 2B8OT 5DQDL 3TVMA 4L3ED 5AYUH 4ZAKC 4YBHA 4XNZC 1TQBC 3UDWC 5HVHB 4Y4KB 4OZ4A 4XC1L 4LQFH 4NP4L 1J8HE 2X4OA 4NUGL 4M93C 4JB9H 1IQDB 4Z7VE 4L9LC 4LSDA 1DEEA 1CTNA 1LE5B 1G7JB 4U1GB 4ODTL 4MNQE 4PV8A 2XQBH 4U31A 2YA1A 5KS9E 4PRDA 1H8SA 1UWGH 1B2WL 5FKAB 1AJ7L 2VN4A 4NKOA 3QDMA 3LEXB 1HXMA 4JPIB 2GJZB 3H0TA 5E2TL 2VDML 5IG7A 4E41A 2GT9B 3VCLA 2DLHA 1HIML 1DDHB 5C0FB 4Y19B 4PJCA 4DGIL 3UC0H 3MRNB 3KLHC 3QDHA 4XBGB 2YKLL 4O5LL 5CWSB 5LWYH 5FA4A 1AGEA 5IVOA 4F7MB 2B1AL 3QCUH 1PVHA 4H88H 2A38A 3ARVA 3SDDA 2MCG1 1U3HA 2BK8A 4N0YH 2FECL 1IAIH 2YS4A 4FQHB 1X9QA 1P6FA 2D9QB 1J5OH 4QNPE 4UV4H 3HZKB 4WI7A 3PJSB 4QYOB 2AI0L 2Q87A 1HHHB 1QSZA 3QIWA 1LE9B 1FYTD 3MNZA 3NOIA 5LGHH 4Y1AB 4G43A 4DGYL 4UNUA 4DEPB 2CLRA 1RQ5A 1TNNA 4X9BA 4XX1E 2DWDA 4QRRA 1MUJA 1QNZL 3I6LD 4NBZB 2AK4D 4LCIL 2YPLA 5ECJE 4EN3A 4ETYA 4N0UA 3X13A 4WFGE 5ACMA 4RRPA 3T65A 2VLKD 5L2KB 3EOAA 4LVNC 5I8CB 4JDTL 5C0JB 1E0OB 4N8VB 4JREC 4YHYB 4HK3J 3K1DA 3BGAA 1WEJL 1U58B 4HK3N 3K3QA 5KVDH 3LDBC 4KJYB 3VXTA 3UTZB 1G0DA 5KG9A 1TZHA 1IC5L 1GPOH 3I50L 3P40A 1LILA 3DXAD 4JPWH 3GMNA 5EIIA 2YK1H 1B0GB 4PG9A 4P23D 3LHPH 4Y4FC 4HUNB 3WO3B 5IJVA 3RGVD 1G7IB 5F70A 3ULVF 4LHUA 4Z18A 1A9EB 3PHOB 1KBGL 4TVPD 1HILB 4OSUL 4MD0A 4LCYB 2HT3D 4ZOEA 3B9KD 4KDTC 3MBXH 1DBKL 2DYPA 3NH7H 1BZ9B 2UZIH 2W0FB 1XIWC 1VACB 1CE1L 3SGKC 3MMEA 1YN6B 3MV9E 3OHXB 3TPUA 2QTEA 3R8BB 3MLWL 4JRWA 4OBRA 5IM7B 3TO4B 1ONQB 4KV5F 1A6ZA 3DV4B 3U4BH 4Y16A 3O45B 4S11A 4XHJC 5BQ7B 2O61B 5K59F 4Z7QE 3EDEA 5HJ3B 4JKWA 4FZEL 4MD4B 5IQ7L 4GG6F 4XNUL 4ZFGH 1FCCA 1RZFH 3LOWA 3QIUB 3Q5TA 5JMRA 3ULUD 4K7PH 3KDMB 3T2NH 5TJWK 3U9UB 3KXFB 1A5FH 4GRWF 1OTTC 1DFBL 1HH9B 4NN6B 5DVLA 5TGBB 2OLDA 8FABA 3BH8B 3IJYA 3GSVB 1C1EL 3LQAH 3UEZA 3NIDE 4QF1B 4EVNB 4GRWB 3EGSA 4F7EA 3W82A 5DGQA 1JV5B 5EU6D 4D0BA 4PRIA 3AREC 1JPGB 4K8RC 1J10A 5ISZD 4WI4A 2XT1B 4W4OC 4YDIL 5JHDB 1P1ZB 4YHPB 1R3KB 4FFVC 5D9SA 5LCVL 5LAXB 5MENB 3VFWB 4QTIH 5FUOH 1S9WA 4PY7A 4QT5B 1M7XA 4IMKC 1NAKH 4NM8H 2E5EA 2MSPA 3KYKL 3S36L 3UPAA 2R0ZH 4LL9A 1EX0A 2CRMA 2LTQB 4Q74A 2UYLB 4HKBB 3L3KB 4Z78A 5C0DB 1CR9L 3WHE0 5F9WC 2ZKHH 4GKOA 4WU5B 1KPRA 4PY8J 1RUAH 1IEHA 3EHBC 1F6LL 1IVLA 4ODUB 4F3FB 2WANA 1B4JH 3GI8L 3P4NA 4EXKA 3A6CH 1CGSH 1FZOB 4P46D 5CSZA 4WI2A 4QHLB 5BZDA 2YD9A 1K3IA 3BXNB 1XF2B 3HG1A 3CFDA 4QOKE 5JW3L 3O2DH 1U8LA 1OAYL 5L7XL 5EA0L 3N9GH 3F7QA 5J4MA 1SJHB 1KYOJ 5FA3A 1PQZB 3P4LA 4GJTB 3IFLL 1Z5LB 3VFOB 1X44A 1ZE3C 3VWJC 4ZNEA 2EKJA 4YUEL 3MA9L 1ULVA 1HZHH 1K2DB 2EYRA 3RGVB 4JY6A 2W91A 3WKMH 3LS4H 5E8EB 1HQ4A 2PTTA 2DIJA 1RUKH 4DKFH 3AB0B 3STZB 4IMLA 3DSNA 1RURL 5FCUH 3KPNA 1BBDH 3FT2B 5EIVA 4J3XA 3QUMB 2DRUA 3VRJA 5F44A 4QHMB 1CI5A 2APWA 2C5DC 5GISL 1ADQA 3SQOL 3ETBF 3SPVA 2OX5A 4X6DA 3I9GL 2CJUH 3TN0A 4K2UL 1INDL 1CD0A 1U8QB 3WDIA 3VXQA 3D3VA 2ARWA 2DD8H 5IOPB 4LKCA 3I02A 4X98A 1JGLL 5TDPB 4ZFZB 1ZKAA 2P45B 4APQA 1ZVYA 5C8JA 3O4LA 1KFAL 5C0EA 2DTMH 4FQCL 2P47B 2Q76A 1BD2A 2IALA 3MA7A 2FZ3B 3UJIH 1IEBB 2CLVB 3OKKA 1S7XA 2LVCA 1N5YL 3VXME 4LMQE 4PJIF 4OQ1A 1CS6A 3GSXB 4LRIA 4NZJA 4ZPTB 3REVA 1EFXA 1YMME 4KUZL 4X80H 5ISZB 1XGRB 4D8PB 1UQSA 3DBXB 5IVXE 4POYA 1K4CA 1HKLH 1PYWA 3MX0A 5E99H 1H3WM 1A7BA 3BAEH 4PJIB 4YDKH 3MRGB 5JW4N 5EUKA 1GGCH 1P2CB 3PP3K 3IXAA 1CICB 4L8SB 5D6CB 5C2BH 3ZDYF 4X0KA 3RVVD 3GJFH 1AP2B 1UVQB 1HEZA 4FS0A 2AEQL 4PJGA 2ICWJ 4WWID 4FTVA 4KK8C 1MCWM 4URTB 4E5XA 4HULB 4L29B 4NYLB 5JA9A 3TCLA 3UBXI 3VWKA 1MFEH 1G6VK 4JJ5A 2ERJB 1CWVA 2CLZA 3O3DA 1U3JA 4P46B 3MZGB 3H9ZA 3EYSL 4EZMA 1LK3L 2GITB 5IJKA 1R5VB 2KH2B 1DN0A 4XNYL 5EZOL 1LO3L 4P5KB 3W11D 4R3SA 5EZIH 3X14A 2B5IB 4M1GL 2OS7A 2A6DB 3FO2B 4PBVC 5K9OA 4PPTA 4OM1L 4EI5D 3H3PL 4GBXC 2EDLA 4M7LT 1P7QD 3BW9A 4P5MB 3RL1B 3GJFA 4YFLI 5D2NC 2HAZA 2IPKA 2JJUA 2VLLA 1I85A 3GO1L 2H9GB 4OF0A 3DX7B 4GRLA 4IOFC 2WV3A 1U6AH 3LKQB 3PGFH 4JFXA 4EOWH 4N5EC 1JF6A 3MNVB 4ODXB 5HDOA 1NAML 3EO9H 3MCLL 3NACH 1UM4H 4GQ9H 2R2BB 3JV4B 4XWGH 3DVIA 3GSWA 5KVEH 3RGHA 3RY5A 3EDDA 3FFCB 1F2XK 4HMCA 3SDAD 2X2YA 1OSZA 2XN9D 3V7AG 5BRZE 3LRGA 1MCNA 5DD5H 1SEBB 1T6VN 1JNHB 3BKJH 1U8HA 4YXLH 3RNQB 3TJHD 4HQQH 1F6AB 2ZCHL 4LCCB 3DVGA 2EEBA 4J7RA 2JB6B 4WTZA 2Z9TA 5I0ZA 3DIFA 4OZGF 4HC1H 2IH1B 3C6SA 2BVOA 1A7NL 4RGMC 4M6NH 4PJFE 2A83B 3OXSB 3QFJB 4OF8A 1TZIA 4CU6A 3D69A 1ZAGA 2VXVL 4OZGB 3CFCH 5CZXC 1IBGL 2ZP0T 1OLZA 4YDLB 2YD2A 3JTSA 1VSCA 3CH8A 3ES6A 2NR6D 2IAND 4J23A 1FJ1A 2N7AA 3E2HB 1WZMA 4AEIH 1R3JA 4EQ3A 3CFJB 1RAMA 1MCQA 4WHTB 4RMQA 4KMQA 5GZND 5HHNA 1OTUC 1KB9K 4LARH 2W38A 5E08H 1OGTA 5F1OB 3V5HA 1MCIA 3KPPB 1S7RA 1I1AD 3FO1B 1LGVA 5HI5C 1ZVSA 4R6UA 3LPWA 5JO5B 1FV1B 3QH3A 4K3DH 1PG7H 4BZ2L 3TBVA 1ZHNB 1CFTA 3UTOA 2A6JB 4JFQB 5IEHB 5HVGB 4ZQKA 3QXUA 1NKOA 4P57A 3PE9A 5J12C 5EZLB 3T2OA 4O2FA 4ELME 1NJ9B 1CGXA 4GW5B 4POZD 4HWZB 5LBSL 4UTBH 5DFWH 7CGTA 2DJUA 5ALBL 4KZDL 3NMEA 4F9LA 4B7IA 2XRAL 5FGRA 4R26H 3ZTNL 2HFFA 2OYPA 5BCAA 1F6FB 4M9PA 3U48A 3ZKSD 1RFDH 2J4WH 3JWOH 3RWCB 1CFBA 4MVBD 1NGZB 1YPZE 4Z7OF 1T7YA 4WJ5A 5EWIH 3NABH 4MJIA 1NBZA 4N8CL 3QA3B 1C5DA 4F9PC 1C5BH 3O6ML 1WBYA 4ODWA 5I1EL 4KKBD 2YA0A 3UYPA 5C0RH 2Z8SA 5M95B 5EFIB 4KJWC 4D9QD 3RKDC 1CGTA 2C4XA 1MCBA 2E8ZA 3P9MA 5MERB 3DRQA 5JIHA 5F1IB 3ESVF 1X7QA 2JCCF 3JXAA 1UH4A 4GKNA 4KK5D 4L4VE 2P5WE 2DIBA 5HHME 1MWAH 1L0QA 1V7NL 3HC4H 4JG1H 5EBMB 4AJ0A 5ICXB 4V1DD 1LO4L 1LEKB 4J3WA 1SYSB 5MHSE 2J5LC 2JCCB 1FDLL 4M8QB 3PDOA 4NKDA 4FQXD 2IQAA 3P73B 2AJYH 2HLAA 3LIZH 5DRNB 4XAWL 4OGXH 1YUHB 3QZWG 2F9BT 5FYKD 3EZJB 2PYEB 4PG2C 1CXEA 1KT2B 3NIGE 3S34L 2H3NB 1MVFA 1XR9A 2FIKB 5D1XC 2R23A 4IJ3C 3GZKA 3H6JA 5T1MA 1JCKA 2RIKA 5JTWA 1EERB 4G7VL 3RX5A 5IFAL 1MCDA 3GNMH 2FRGP 3G5VA 4JANA 2BNQE 2UY7A 5DMIH 2YD4A 4EI6B 4A6YB 1EBAA 2GK0A 3P3YA 2DQCL 2R56H 4NUJA 1N2RB 3WLBA 4ZPVA 4BSJA 2FR4A 1OAUL 1BQHG 2P42B 5E7BA 2Q8BH 3SE8L 2NY2D 4P49A 3BZEA 1MCJA 1T21A 2DQIL 3MRDA 4XP9H 2FBOJ 3QPXL 5ETUA 2NMSA 4LAQL 4JHWH 3O6FC 1CXIA 2EH8H 3MACL 2H8PA 1F11B 3HFML 4OTXH 3V6OE 4L8CA 4HWBL 4HPOL 1OOAA 5FO7A 4C56B 3R06B 5AYQA 5LGKA 4Y1AE 1BQLH 3F58L 3ARUA 4O02H 3Q0HA 3GBML 4Y7MA 3CH1A 4G80B 4F37F 4NSKA 2CXGA 3MPCA 4DWHA 3ARFA 3EJJX 3CSGA 1IGTB 4LF3A 2HVJB 3BQUB 3BJLA 3KLDA 1AO7A 2APXA 3SE4C 4WO4B 3BUYB 1RULL 2BP3A 1QR1B 4O2CB 6FABH 5CBEB 2I24N 5GGVL 4YE4L 2CUIA 3MYJB 1T0MA 2WWMD 1WBZA 2IPUK 3WL9B 4HUXA 2V2WA 4U1NA 3VXRA 4FMKA 3QUXD 5BV7B 5GS0D 3OKYA 4FABL 2HRPL 4KROB 3P0YH 3BSZH 5IBTL 4KTDL 3KPQB 3C60B 4OI8A 4WCYH 1EXUB 1FO0H 4ZAKA 2YBRA 5CD5D 3ARSA 1N6VA 1ZT4A 1EVUA 5FB8A 4M7JL 1A9BB 5MEQB 2FL5A 3ULVE 3G5ZA 1ZMYA 3O3EA 4JRXE 4NN7C 3CX5J 4UU9A 4L9LA 1TZGL 4X4ZA 4DN4L 1XF3A 1JWSB 3CX2A 1EHXA 3EYVA 5FGCE 3Q1SL 4UNVA 4G8GB 4KV5E 5H37G 2GJJA 3K4DA 2F15A 3FQNB 1QSFE 4L3AA 1BEYH 3NA9L 4I9WE 4P2OD 4XCFL 2ZOLA 4HBCH 4Z0BL 1NGYA 3U0WH 2X41A 1X4ZA 3LKPB 1DVFD 1HHGB 5DJXA 3QXAA 5CEYA 3VD9A 3UBXG 5INDB 4DKEL 4QXUL 4K3JL 3NIFE 1AKJB 2XACC 1TVBB 5I17B 4GXVH 4U1LA 4IBLT 4HMDA 1N64L 5JXEC 4ODHH 1RK0A 4ORZC 4PJ5D 1R0AL 3HZVB 4XMLH 4D9LL 3MRMB 5JHDE 4NRXB 5IT2L 4LBEA 5AD0A 3G04B 5BS0D 5MENE 1BZ7A 2ICWB 4JZJB 2EIZA 2VERN 1NQBA 3OKLA 4UT6L 2OQJA 3S4SG 4M1DH 3ARWA 4OD3H 4L4TD 1E4XI 3BP5A 2F54D 4XVSL 3C8KA 2DWEB 2ED8A 4GT7A 1IL1B 1DSFH 1IFHL 3FB5A 1G7PB 3RWIB 4KI5F 3EYOB 4EDWL 4D3CL 2E9WA 3WNPA 4OZFB 4UUJB 4WTWA 1W0YT 3PXHA 1MQKH 4LLUB 5D7JC 1CFNA 3VXUA 4LSSH 1WZ1L 3D85D 5JDJA 5L2JB 1KIRA 3RWJB 2QR0A 3UROR 4CKVX 3OJDB 5TQ2L 5E94B 3FQXA 3GJEA 2X4NB 4M9OA 1A3LH 3QJFB 4UTAL 1KJMB 2X6MA 3LH2H 5E9DA 3V6OC 4L4JA 2VLJE 3VFGH 4EKXA 1QHPA 2D31B 2DDQH 2RCSH 4Y2DB 3S37H 3OAZH 4NQSA 1PAMA 2HFTA 2AJSL 5A43C 3BKYH 3MRHA 3MRRA 2DQGL 3GIVB 4P5TD 5D7KE 3RDTC 5I8EB 3CU1A 2O5ZL 3VW3H 3P0GB 4ETQB 4OLZL 3LKRA 3QBTB 3Q6GL 1XCQA 3LQZA 4KDTA 4OLYH 2GTZA 1RZJL 3TO2A 1XIWA 4XNQA 3SGKA 4LLQA 5GRJH 2BDNL 2OZ4H 1GH7A 5K9QG 5CIPH 1J12A 2Y5TA 4K8RH 1QTYT 5D93B 3MUZ1 5EBLA 5I19L 3C5SA 4PGDB 3BKCL 1A7RL 1S7VB 1EV2E 2KBGA 4ZFOL 4Z9KB 3D39D 2WLZA 5I75C 2GAZB 1AHWB 5K9JH 4FHBD 4JFEE 3RWHA 2A73B 2LAAA 4DKAA 2C1OB 4S1DD 3MV7B 1PY9A 3HE7B 2RGSA 4KKNA 3TIEA 5E8NA 1CLOH 1DTUA 4JM2D 4G3YL 3H9SD 4IDJH 5I76B 5CD3B 5I1CL 1CDHA 1GL4B 3UZQA 2E27H 3WFBL 2C9AA 1FRGH 4DUWA 4XTRC 1CLZL 2OZ4A 2X4UB 1J8HA 2VR5A 4LLYB 1J05B 1RHHB 3WNMA 1MY5A 4Z7VA 2R1XB 4W4OA 1HXYB 3C6LC 1EH9A 1FGNL 2HJFA 4MNQA 4HJJL 4NKIL 5EOCL 1YEGL 5KS9A 1QR4A 3HI5H 5JDSB 1AIFB 1I8IA 4OZHE 4NHCH 3K8LA 1EEQA 4M62L 4PJIE 3PQYD 4J3UA 2DMKA 2VDLL 4IMKA 1YNLH 4PTUA 2B1HH 5A3ID 2AS5M 3FONB 4XVJL 4MMXC 4UV7L 4ZUVA 1U95A 2OR8A 5HGDB 2IGFL 3GHEL 3RIAK 4L4TB 2F54B 1FORH 5IHUL 4WV1B 1S8DA 2ARJB 1R3LB 3EYQC 3TZVC 2DLIA 2Q1EA 4QKXB 2ICES 1I8MA 1EO8H 1S7UA 5I1JH 3MGTA 2X4SB 1XT5A 3GIZH 4ORGA 4LGPB 3BRDA 5D72H 4ZODA 4PJ8D 1BIIA 1NBVH 1OAKL 3VDCA 3ZDZF 4H0IA 4JRYA 3IDNB 2Q7YB 1X6LA 2F53D 1XAUA 4MZ3A 3SKNA 4JQIL 1IC4H 3LS5H 5FM5O 4M61B 2YN3A 5FAAA 4R0LB 2D7NA 5GS1A 1FP5A 4QRTA 3PWJB 3P77B 1L7TL 4HKZA 3VWJA 35C8L 3FCTA 3CVIL 4P5TB 1KLGB 4LRNH 3WIFA 1XGPB 4YBQC 4LSVH 5JHLL 4NN5B 4EXPX 3MFFB 3SO3B 3CLFL 5KANG 1O0VA 2DI8A 3HC0B 3IU3A 3ZT6A 1PKQB 4OF7A 2Z91B 4BH8B 2BVPA 4FZ8L 3BDXA 3PHSA 4JO2L 5E5MB 2HLFD 2IMNA 2YUWA 4X4XA 4ZUWB 2AQ1A 5J57B 4MX7B 3WNOA 3QCVL 4OCRH 3MJ8A 3D39B 3IXTB 3FFCE 4HUVB 2HTKC 4MWFB 4JM2F 4ZTOL 3BP4B 4NBXB 3WIHL 1TDQA 3GRWH 1UCTA 1JIBA 1BVKB 4Z77A 5KSAB 1T04B 4HKJB 3T77B 4X7FC 3QEGH 2JELH 3MRKB 1KB5H 1W72B 4JM2B 3PL6C 1DE4B 3JUYA 5C0BE 1FNLA 3C9NA 3OPZH 4KRPC 2FDBP 4OV5B 3DECA 5CJOL 1LO5A 5B38B 1RUMH 4HKXA 3MV9A 3TBSB 3FRUB 2GK2A 2VQTA 1JHTA 5F96L 1TVHA 1YEJH 1YN7A 3OR7A 2PF6A 2VN7A 5DT1H 5T1KD 2F58L 1X5ZA 3ARGB 4Q6IB 2XG5A 1S9YB 1OF2B 4CN1A 1NGXA 2MQ3A 3IFNL 2FLRT 3RNKA 5GGUB 1L7IL 1J18A 4NO2A 1GSMA 5GGQL 2MMXA 4UT7H 2H6PB 5KTEL 1AXTL 4XI5D 1KJ2L 4WW2A 4J6RL 5ILTH 5DRXB 2GY5A 1QSEB 3TNNA 1JUFB 5DMYA 3FQUA 1C5CH 4CNIA 3GRWA 2FGZA 1XF4B 3VG0H 4PY8I 5D1QD 5JORB 4XMKH 5HDBF 1KB5A 5ID0A 3GBNH 4GKZB 1WVZA 3HZYA 3SOBL 4M1CD 5DA4A 1JPSL 1INEL 5BVJA 3EJZC 1MCEA 4R4FH 4WFFE 1JI2A 2WBJC 3NPSB 3DX8A 3CLEH 1Z3GH 2WP3T 4PLKD 4Y2OA 4UQ3B 1IZJA 2HVKB 4YHLH 1AFVH 5C07B 5IR1B 2UY6A 5J11B 4HIJA 3HAEB 4LEOB 4YIQB 1M6OB 3QJHA 4NQCB 3HB3D 1KJ3H 3IDGB 4NCC2 2D0HA 3RWEB 2DQFB 5D71L 4G6ML 2ADJA 5GZOD 1JZ7A 1WLHA 1J1OL 3B5GA 3CC5A 4GBXA 2OR9H 4JFDE 5EN2B 3DHMA 2VJXA 3NTCL 3S6CA 3N0PB 4WDIA 1L0YA 4ZXBA 3UPRA 3WXVL 3ARYA 2BNRE 1YY8B 2R0KL 3QAZC 1NFDE 3IDMA 1A4JA 4LP5A 1Q9KA 4G6FD 1VA9A 1JI1A 3EW3B 4Z7OE 3P9WB 1ED3B 1JHLH 5D7LB 2B20A 2DBLH 4ISVA 1GC1H 3ALWA 4QOKA 1MFCL 4RFOH 1I9RL 3O6LH 2OTWA 1NSNH 2VC2H 1S9XB 4IIQB 4Q0XL 2UWEF 4U7KA 3MLRL 3DYOA 1DBML 3VFMA 2IAMB 1ZT7A 4BQ6A 3FFDA 1FC2D 4GRMA 5KSBE 1CVSC 2UWEB 3QWOB 2PYEE 3T0EE 4NZRH 1KTLB 3BYTA 3MLZH 2JJTC 4U6YA 1OAZH 3MLVL 5FV1L 2J6EH 3DYMA 5DC0A 3FKUS 2EDFA 2W1NA 4UIMB 5I1GL 3U82B 1JK8A 3I6KA 5SWZE 1G7LA 4XZUA 5FOBB 2B2XL 1NC4A 1VPOL 1N5AA 1ZVHA 3PP4H 4XNXH 4OI9A 2VLRB 5F1NB 4GW1A 1T2XA 1EZVX 3UYRL 5ACZB 2ICWI 1IC7L 3RTQB 5CEZD 4I3GA 4KDWA 4HUMB 3ET9F 4EUPB 1CGWA 3Q2CA 5KAQF 5HHOE 1HINH 5IW1A 1I1YB 1WJ3A 5E2VL 3HNSL 3U2SA 5KJRH 2A6IA 4LVOC 4MNGE 4XHQA 3QDMD 3JV5A 2W65B 1RZIA 5EOQL 1WIOA 4FQIL 4ELKA 2HWZH 3G5YB 3FHAA 3GMRB 5F9OH 3MUHL 1HSAA 1FN4B 1X5JA 3VXMA 4EDXA 4P0DA 3ARBD 3A6BH 3LD8C 1YMMA 5GSVB 3DRTB 5DQDH 5SX5K 4C56E 3LPGA 4S0SD 5IVXA 1ZOXA 3DVNA 1OB1B 2JF1A 3SJVB 1HWGB 1J87A 4NP4H 4PJHF 3QG6A 2HMID 4NUGH 4MHHI 4RA0C 1U3HD 4K7FA 3QQ9D 2YSSA 3WS6A 1AQKL 1KGCE 3D1MC 4ODTH 1YQ2A 4Y8AA 4PJHB 3VD5A 1MCOH 3WUZA 2FO1A 4IOIB 4DZBA 4KHTL 4KRNA 1B2WH 4H25B 2HJLA 4PJDE 1AJ7H 1V7MH 2XPGA 2Y9RT 1X5FA 1S7SA 3AY4C 1KCLA 3MXWL 4F9PA 1P84J 3HR5B 2VDMH 5J7CC 1D5BA 4I0PB 1HIMH 2YPLD 4EN3D 3U46B 4DGIH 5DK3A 1KPVB 1U8IB 2FHCA 1ZA3B 2YKLH 3KVQA 4O5LH 4YHOL 4KKLC 5B39G 1U3YA 2R1YA 3L5WA 1WFUA 2B1AH 3JVGC 3BP6A 2WWKO 4HIEA 5IVNA 3ILPB 3BYYA 2HT4D 5AUMB 1GRWA 2D0FA 3VH8A 1UKSA 3V5KA 1FZMB 4YHIA 5DHVA 2NY6B 2NW3A 1S7TB 3HR6A 3B8SA 4AM0A 1RPQA 1A47A 2EDNA 4EQ2A 4CMHC 1TFHA 4GG8A 4J4PC 3NCBB 4KKAC 2UVFA 4XC3L 1IT9L 2FJGB 2PW2B 4UILL 4DGYH 4LHUD 1AC6A 3MJ9H 3FRPA 2XICA 1JL8A 2FYYA 4NHUB 1I3VA 1QNZH 3EJYD 3ZHDA 3TVMB 4Z6AT 4HJ0C 1MCCA 1BFVL 2WIMA 4OZ4B 1G6RL 4HT1H 2IBZX 3L3JA 5DUPL 5BRZA 5L0QC 2MCPL 3TLRA 2X4OB 4JDTH 1YDPA 1F8TH 1WEJH 3PG2A 1DEEB 2P7TA 2XKNA 4PRHE 2DJ4A 3NFSL 3G6JE 4XPGL 1JWMA 15C8L 4PRDB 4BQ8A 4OF5A 2VOTA 4KMLB 2ZPKL 3I50H 3MRJA 3QDMB 3O6FA 4PJFA 4ENED 1NLDL 4P4KC 3T0EC 3T8XA 1CL7I 1A6AA 1HXMB 2EYTB 2NLJA 3OKMB 2EXWC 3MJ9A 5IG7B 1CGYA 4E41B 1KLUA 5I16A 5DO2D 3VCLB 1KBGH 4ZDHA 4OSUH 4JO3L 2VXTL 1LDPL 3AAZA 1MJ7L 5B22A 1DBKH 4RWHA 5HXMA 1BAFL 5FA4B 1AGEB 4PRID 3O3UN 4XWOD 1JGEA 4D0CA 3IDJA 5EH1A 4D94A 1FYHB 3MLWH 3GM8A 3SDDB 4HMEA 4RQQA 5IQ7H 2LVEA 4XNUH 5HHXL 3D5OF 1NLBL 5HI4C 3QIWB 3MNZB 1P9MC 1GYAA 3LN5A 2FATH 3J8F7 1QPPA 1P7HL 4NRYA 3PNWA 1QOKA 1QRKA 2CLRB 4LLAA 2DWDB 3F12A 1MUJB 4QRRB 5HD8D 4TSCL 5DD3L 3B8YA 3KPSB 1YC7A 1C1EH 1YNTB 4P9HL 4EN3B 1SM3L 4N0UB 3P11L 1RZJC 4QRPD 1H5BC 1DP0A 3DARA 2NY3C 1U92A 3EOAB 5J3HC 1ZLVK 4C55A 1HK6A 1J86A 3VXPA 2JJWA 3LV3A 3IT8D 2HKFL 1T1YA 1WWCA 5CGMA 4YDIH 1K6QL 2P44B 1TQCB 4G8FA 5J6GA 5LCVH 1U0QA 2XV6B 3HG1D 1JYXA 5IGXH 3VXTB 4JFOA 1TZHB 3QFDA 2NQCA 3QI9D 4P59L 1HI6A 4S2SA 1DQDL 1YPZA 1OQOA 3GSQA 1FL5A 4KAQL 2PTVA 2X4QB 3L7EB 5EIIB 2EDHA 4U6VL 4PRPB 3KYKH 4PG9B 3S36H 1RJLA 2EECA 4H0GA 2VIRA 5T5FL 3X11B 3QCTH 3QDGD 4MD0B 3RZCA 3LKSB 2R4RL 4U4BA 3W2DL 4CN6A 5JOPE 3MV7E 2DYPB 4GH7B 4L4VA 2YRLA 3FOMA 5ICYA 2NTFA 2VITA 3MMEB 3TPUB 1AD0A 3GI8H 4OKDA 4CJ1A 4Y16B 3WS3A 3TN0D 5CGYD 5HHQB 1JNLH 1NEUA 2QSCL 5AG8A 2V2TB 3D3VD 2GFBB 5JXEA 3OR6B 5JW3H 3BD5A 4APQD 5EA0H 1NUFA 4X5LA 1LE5A 4TOYH 1G7JA 4K94C 3ZKXC 4DW2L 3IFLH 3QUYD 1BD2D 1CCZA 3VXSE 5FKAA 5E00B 4WWKA 1AY1L 3STBA 4DVBA 2NY5L 8FABB 1IM9A 2QADD 3IJYB 1SVZA 3QQNA 3QO1B 5IBLC 1QBLL 2X1WL 5ESAA 3O81A 1PSKL 4F7EB 2BNQA 4PJEE 1DDHA 4D0BB 4PRIB 3L7FA 2DQDL 1TJHL 4ALAH 5GISH 3SQOH 5E6IC 3DETD 3I9GH 5D9SB 4F7MA 5I18L 5T5NG 4K2UH 1J8KA 5HYQA 1OM3L 2EEDA 3O8XC 2JIXB 5BW7C 4MCYB 4R9HA 1S9WB 1BJ1H 4IS6A 1JGLH 1X5KA 3K8MA 4FQHA 3V6OA 1KFAH 4BYHA 2OK0L 4U6TA 4F7PA 1VFOA 2H26B 3PJSA 5FYJD 4FQCH 1FCGA 1HHIB 4HBQA 1LE9A 1CYGA 4FTVD 4PJXF 4Z78B 3O3BA 1CF8H 4Y1AA 2X4RB 3RDTA 1X5LA 1WTLA 2DTSA 5ESQB 1MCPL 4Z5RB 2VZTA 1FFQA 3B9DA 4XPHL 3VWKD 4JDZB 4PJXB 1N5YH 2ZG2A 4AENA 3T0DA 3UJTH 5FGBA 2P5EB 5CSZB 1HQRB 2GQHA 1FZKA 4KUZH 5CAYB 2ZSVA 4TVPL 1K4DB 2CRYA 2N56A 4U0RB 2X9XA 4U05A 2C7UA 5T3XL 5C0CE 4C59B 5C0JA 2UUDK 2EDOA 3HG1B 4P2RE 3QUML 1F02I 1U8LB 3UO1L 5FA3B 1C12A 2EXYD 5HHPB 3UTZA 1B3JA 4AK1A 3VA2C 5D7SL 4F58H 4W70A 4PRAB 2EYRB 3QWRA 1KULA 4JY6B 1FAKT 2BSRA 1HQ4B 5HY9A 2PTTB 4GRLD 4YLQT 3REWB 4IMLB 4X6DF 3KPNB 1G7IA 4MA8L 3ULUL 4XP4H 3PHOA 3V6ZB 3VRJB 4C83B 3ARTA 2D7TL 2V6HA 3HNTL 4TYUA 2XTJD 4UBDC 7FABL 3SPVB 1P6AB 4X6DB 1I1CA 1Q9OA 1VACA 5DVMA 2YWYA 1NC2A 3EYSH 4PLOB 3ZTJH 2XXMB 4JRXA 4FFYL 5D5ME 4TTGA 1CLCA 4XNYH 5EZOH 3VXQB 1ONQA 5IM7A 3L3GB 3DV4A 4YJZL 1LO3H 3C6LA 4LKCB 3I02B 1FFNB 2Y6SD 4M1GH 4P3CL 4X98B 2O61A 4OF3A 3N06B 1QRNE 5HJ3A 2QSVA 4ZO7A 5C8JB 3O4LB 4LPVA 4WEUD 3H3PH 4YGVA 5C0EB 3OJVC 3FB7B 4H1LG 5EU7E 3BDYH 2DM2A 3HE6B 2Q76B 1BD2B 1QSFA 3KDMA 3CAFA 1QSEE 4N5UA 4ZFFB 2VR9A 1PJ9A 3OKKB 3OWEA 2JE8A 1HH9A 1S7XB 5TGBA 2PXYD 3BH8A 3HMXL 3GSVA 5SWSE 3C5JA 4GMSL 4XAKE 3MCLH 1EFXB 4IRJC 4QF1A 4EVNA 5IF0B 2VUOA 3MFGB 3V0WL 1K4CB 4F80A 5HDBE 4B7LA 3P4OA 4KU1A 5EUKB 5JHDA 3DTXA 1P1ZA 4YHPA 3FO0L 2Z31D 4PJGF 4U6HA 5MENA 3VFWA 5JNYA 5HYSA 2ZCHH 2WINA 1Q8MA 5EIQA 3WO4B 3MOQA 4YBLB 4QT5A 2IG2H 4PJGB 4RISL 3OAUL 4MA1C 1A7NH 2W60A 5KZCB 1URLA 4P9ML 4RGND 2UYLA 4Z76A 3L3KA 3TCLB 2VXVH 4IRSD 4K3GA 3VWKB 1BOGB 4JJ5B 3I2CL 3C8HA 3O3DB 5TE7H 2V9QA 3PWPD 4HXAL 1U9KA 1DN0B 1NGQL 3BD3A 3QXDA 1FZOA 3BFOA 4K3HA 4R3SB 5K9OB 3UCRA 2EDQA 4QHLA 5D7LE 1B0RA 1UGNA 1RZGA 2VLJA 5FUCC 1UCBL 3WV0A 3QXTA 1Z9SA 3GJFB 1CFVL 1TTFA 5CMAB 2IPKB 2F5AL 5DMGD 3NPZB 3RBSA 2VLLB 2R9HC 4MJID 4OZIE 5F21B 4RMUA 1JWUB 5DJ6B 4JFXB 2UZYB 3OGOE 1I1RA 5E8EA 3PL6A 1GIGH 4MB4A 4OFDA 4BZ2H 2HH0L 4O2EA 2XTJB 3X12A 3BPCA 2G9HB 5EU3B 3QSKB 3FJTA 2X1XR 2WLYA 3C5ZB 1ZLUK 1OSZB 1MF2L 1XF1A 5ALBH 4JHAL 4KZDH 5DI8B 3MLSL 4WNQA 1A6UH 1U8HB 5KBNC 5T3ZE 4I3RL 4JFEA 3V5DB 3GEWB 5IOPA 4N68A 4X7EC 2DI7A 3THML 4ZFZA 1WV7T 1V05A 5AZEL 2AEIT 3DIFB 5DFVC 4ODVL 2EE2A 1R24A 5HI3C 4I48A 2YUVA 4N8CH 1KEML 2CIIB 3H7BA 3O6MH 3D69B 3R0MA 2AVGA 2EH7L 1ZV5A 1D6EA 2I25N 3KPMB 5C08D 5TQ0L 3X17A 4C57C 4JO4L 1CG9A 1A14L 2CLVA 3OMZA 2WBJA 1NMCB 3ES6B 5JMOC 1JGUL 5FYLD 4XGZB 1MVUB 1S7WA 1V7NH 1FJ1B 4P2CG 3GSXA 1R3JB 4TRPL 1LO4H 1XGRA 1F4AA 3DMMC 1OTSD 3FOLB 5F9AC 1FDLH 1T4KB 3S3PA 1JRHI 4M5YH 4OZHA 5E56A 4U1IA 2R2EA 5EU7C 4PJIA 1FNAA 4PGBA 1P2CA 3BPNC 1OPGL 5F7FA 1CICA 1WQVT 4I77H 1NANI 3V5HB 4A2LA 1BLNB 1S7RB 5I30L 1AP2A 1UVQA 1ZVSB 3S34H 2XWJB 4ZS6C 3QH3B 5L8LB 3O9WD 5DSCA 3TBVB 1CFTB 5E4EC 3WD5L 3WN5C 3SDCC 4LSTH 2EZ0C 4P57B 4PIRF 3QYCA 4G7VH 4O2FB 4XRCA 2A74A 3SN6N 4R4NC 4J12A 3CXDL 3RAJL 1B4RA 1KIUA 1QVOA 1Z0MA 1AD9A 2DQCH 4N8PA 2GITA 2NY1C 2A0LC 1R5VA 5F9DC 2HFFB 1AO7D 1OAUH 3ILQC 4Y5YC 1YEDA 2NW2A 3SE8H 4JFZL 3H3BC 2ORBH 3FO2A 2DQIH 3U30B 2NXZC 3QPXH 1R3IL 1Q1JL 4LAQH 1JHKL 4OB5L 4WJ5B 1UH2A 4H0HB 5FF6A 1U8MB 3MACH 1NBZB 2ILLA 1C5DB 3S98A 3HFMH 4ODWB 5CCKL 4HWBH 3VXRD 4HPOH 3UTQA 3EDKA 1NCWL 1BWMA 1ODAA 3P9MB 4BSWB 3DRQB 1LWRA 3LKQA 2JJTA 4GKNB 3F58H 3MUGB 3LVEA 1FYTE 4QY8B 3GBMH 3HAEG 2FBJL 4UOW1 5MEOB 3P0VL 4Z8FL 1YQVL 4NJAL 3S3SA 4OGAC 2FSEA 4X6FB 1MIMH 3JV4A 5DGRA 5I6XB 2OJZL 5K33A 4AEFA 4NKDB 2VL5A 1EMTH 2QSTA 1Q9WB 2IQAB 1YNKL 3FFCA 4QRQA 2HLAB 3I6LE 1H3VA 2VLMD 4TSAH 4NZDA 1P4LB 1INQA 4QGYA 3KHQA 1JBJA 1RULH 4A6YL 3RNQA 2ZUQB 3VGHA 2FWOB 2VLKE 2LU4A 5GGVH 4YE4H 4MS8D 2XY2A 4HWBA 1TIUA 3RVUD 5C0BA 2IQ9H 5F7EL 4BK5A 3QQ4A 3QUZC 3VGBA 4OFKA 4HPYL 2GYSA 2H32H 1QLFA 5CSGA 1ZSDA 4AMKL 4X5WA 5T1MB 3NCEB 4XVTL 4FABH 2HRPH 5SV3A 2C26A 1MWAB 4JANB 3G5VB 4PB0L 3DXAE 4P2YA 5IBTH 4KTDH 3TT3H 4F15C 5J13C 3MV01 1XEDA 1D5IL 4MQSB 4AY0A 2GK0B 3VI3F 1BFOA 4KJPC 1SMOA 4NUJB 3WLBB 2VQUA 4HGMA 5IHZA 1LO0L 2FR4B 4M7JH 2E6JA 4YO0A 4LFHD 3VD4A 2CPCA 2KQNA 4RBPH 1T21B 4S10A 1CDBA 1TZGH 4LSPL 4QWWD 4DN4H 5ETUB 5T33L 4WHTA 2PO6C 4S1QL 2H8PB 3GK8L 5CP7A 5TE6H 4B50A 1ND0A 4L8CB 4JE4B 3Q1SH 1U8PB 5C0NC 3HUJE 5FO7B 4I18C 4OCWH 3KPPA 4XCFH 2H32A 3NA9H 3C09C 3ME0A 3FO1A 2OI9B 1UM6L 4FQ1H 4Z0BH 4P9HC 1NDMB 1S9VB 4AEHL 1FV1A 4TUKL 1YC8A 3CH1B 1ZHNA 2RFXB 4DKEH 4QXUH 3AFLA 5IEHA 3KPSE 1VB9A 5A16A 12E8L 3VXUD 5BV7L 4PP1C 3LB6C 4M43L 3JVGA 3ARFB 4LPUA 4NCDA 5L9DL 4LF3B 2EC8A 4LOUD 1N64H 2WBKA 1R0AH 4D9LH 4FQ2H 1DLFH 4JFDA 5E9DD 1F4WL 4JHBA 5IWLA 5EU6E 4PP2A 5IT2H 2J3SA 2XI9A 5E4IA 5KAQG 3IAGC 3QISA 2V2WB 4HUXB 1DLHA 2UZXB 4U1NB 4XCEA 4UT6H 2BNRA 5GHWL 5IQ9A 3IETA 1NFDA 3SO5A 3QA3A 3PV6A 5KSUA 4PRPE 4XVSH 4LASL 1NMBH 5FYKL 3L3DA 5EFIA 4GSDH 3VI4F 2Z93B 1IFHH 2Y06L 3P9LA 1XIWD 4D3CH 4RMRA 4ZAKB 4XNZB 4YEFA 1TQBB 2ZCKL 3ARDD 2WUCH 5FB8B 1WZ1H 5ICXA 3U4AA 3O3EB 5C09D 5A2JH 5TQ2H 4M93B 1UZ6F 4L9LB 4KY1H 5JW4R 4M8QA 5I1LB 2BY1A 2LABA 2QEJA 4UTAH 3P73A 3EYVB 1ZLWK 5TDOB 3ORJA 5DRNA 2ATPB 3TC9A 1QFWM 1MAKA 1RVFL 4DK6A 2R4SL 5KSBA 2AJSH 2PYEA 3T0EA 4PJ7E 2DQGH 2MJWA 2ZOLB 1KT2A 1NGYB 5DWUL 4MXWL 2H3NA 2O5ZH 2YXMA 1T83C 2XFXB 5F7YC 4OLZH 5DJXB 3QXAB 5CEYB 4JKPL 1A64A 3Q6GH 2LTQC 4MB3A 1JF5A 5SWZA 4XP6L 1YYML 1RZJH 3INUL 3QR2A 5CP3H 5GRZA 3GI9L 4U1LB 3DUSA 4UQ2B 2XQYG 4EI6A 3Q6FA 2HRLA 4MNQD 3WXWL 3BKCH 5TPWL 3UTTB 4MLSA 4F37K 2YXFA 3F65A 4FXKA 5HHOA 4LBEB 5FK9B 5AD0B 1BZ7B 5AAMA 3OAYH 4MNGA 2P8MB 2EIZB 3OKLB 2OQJB 6CGTA 2W0LA 3BP5B 4NKQB 1SY6L 2XIDA 1MIEL 1OGAB 4G3YH 2DQHL 3FB5B 4C56A 1ETZB 4G7YL 5TFSL 4P23C 3WFBH 2BZDA 4OLVL 1FG9C 1H5BA 2EC9U 5CP3A 1CFNB 3VXUB 1CLZH 3QEQE 4R8WH 4LVNB 4OBSA 2HT3C 3B9KC 5GS0L 1KIRB 2QR0B 5DLML 1R3HB 3EZ8A 4JREB 4PJXE 1AGBA 4RDQF 3LDBB 2P5EE 3E6FA 5I1IL 4HJJH 5EOCH 1YEGH 1B88A 3OF6A 4M7LH 4PJDA 4WO4A 3RA7L 4M62H 2VDLH 4K94H 4O2CA 4FA8A 1T20A 2OTUB 3VWJD 5F9JA 3TESA 1HCFX 4XVJH 3MRHB 2N1KA 1IEAA 3LY6A 1HYRC 2GJ6E 4LVEA 1RZKL 4Y4FB 1MNUH 3OB0H 5DEFB 2IGFH 2QQLL 3GHEH 3WL9A 4L1HA 4Q9CA 3ULUC 1UB6B 3G5XB 1YEKL 3LKRB 4YWGH 5ID1A 4UT9L 1XCQB 3LQZB 2QHLA 3ZYJA 1JYVA 4X4ME 1DJSA 1SQ2N 1XIWB 4XNQB 4U0QB 4LLQB 4YHZL 4J1UA 3BOVA 1MREH 4OCLC 4XXDB 1G0XA 2CQVA 1G1YA 4M3JA 1GJIA 1OAKH 4GKSA 5EBLB 3C5SB 5EB9A 4G9FE 1GZPB 2BHZA 3R4DA 4LIQL 1J0ZA 4JQIH 3MCKB 1F58L 1IGFL 2OMNA 1A3RL 1OW0C 2CKNA 3IVKB 3FAWA 1EAJA 35C8H 3V4VL 1ZT1B 3TIEB 3CVIH 1A02N 2QHRL 5JHLH 4Z7VF 2CKBL 3CLFH 1A7PL 2CH8A 3MV9D 4PFEA 1BP3B 5DJ8A 4K7PX 2F5BL 1OQXA 4NQEB 1IARB 3LKPA 4FZ8H 1HHGA 5KS9F 3OXRA 1J8HB 4OJFL 2C4FT 3AREB 4S1SL 4JO2H 5CIPB 4Z7VB 1AKJA 4WU7A 5E2WH 1TVBA 4S0TD 4PRHA 3G6JA 1RIUH 2G60L 5KS9B 2DM7A 1C8PA 4OFYA 2YPVL 3QEUA 5BW7A 3SGEH 4P46C 5MP6L 4KZEL 3H9YA 4PTUB 4ZTOH 3MRMA 4NRXA 4Y5VC 2Z8VC 4LHUG 1R5IA 3WIHH 2BY2A 4ZUVB 4U49A 4JZJA 4KKCD 1YY9D 4LNVA 2XN9E 2Y5EA 4KK6D 1S8DB 4RAHA 3I3EA 4OGZA 5LXGL 3ZYIA 3FMGL 5F9WB 1I7TB 3HCVA 5IUSA 5CJOH 1UENA 2FEDD 1S7UB 3MGTB 4QNPF 4ORGB 3CVHH 1FNHA 1ZHLA 1BIIB 3MLUH 4HS6B 2F58H 4OZFA 4JRYB 4UUJA 3T3ME 1JNNH 4LLUA 3SKNB 2EIEA 5IB3A 3ZE1E 5DR5L 3RWJA 4MB5A 4ZG1A 1NCBL 1NDGA 2PR4L 4QRTB 5GGQH 3RY4A 2X4NA 5KTEH 1WICA 3ESUF 1AXTH 3QJFA 1KJ2H 5I8OL 4J6RH 1KJMA 1KJVA 1OHQA 4HKZB 5BJTA 3HTLX 1A7QL 2IANE 3VWJB 1SBSL 1JZ4A 4OT1L 1FAIL 2D31A 3J7HA 4Y2DA 5IIEA 4XT1C 3AM8C 3WIFB 5SWQA 3DGGB 3CSYB 2Y72A 4IOFD 4HUWB 4LCCC 4ZXBD 3SOBH 4XB7A 5BVPL 3WJLC 1INEH 1JFQL 3L9RA 4UINL 5I8EA 2BVPB 3MRBB 3CVHA 4OLEA 2F8OA 4X4XB 4B41A 4RGOL 3GKWL 1KF9B 2BCKA 4XVUC 1ZGLP 2EDRA 1N8ZA 3B6SA 2XKUA 5D71H 3S35L 4BM7A 1KJ2A 4G6MH 2NX5E 2FGWL 1J1OH 4NO3B 1E4KC 5CJ8A 4M6OL 4Z77B 1T6WA 1DBAL 1RZ8B 1XGQB 3MV8B 3NTCH 3MV7A 4WUKL 3C9NB 4Z7QF 5HYJA 1DQML 3RVVC 4JKLA 4WRLA 3WXVH 1LO5B 2VABA 3MV9B 4LNRB 1AXSA 1KNOB 3TYFB 5SX4H 5I76A 5FECA 3QZWA 2AGJH 4DN3L 3CK0L 4IRJA 4RZCA 1F3DH 1QFWH 1NC4D 1NGXB 2X4UA 1AQDA 4D9QE 1SVCP 5F7DA 1J05A 4NO2B 3U7AA 1MFCH 2GIYA 4PGCA 1I9RH 4OUOA 1M71A 1HSBB 3O4OB 4XCNA 4I0KA 3KWWA 3TNNB 3NIDF 4Q0XH 4BUGA 1TPXC 3FQUB 4CNIB 1AIFA 2CGRL 2D7OA 3VXSA 1DBMH 1OTUD 3P30L 5ITBH 1KB5B 5ID0B 5DK2A 5L88L 1N26A 4EI5C 1ITBB 2AERT 2XKSA 1BQHA 5IVZA 3VXMD 8CGTA 4PJEA 4QRUA 2I60L 4LLWA 5JPMB 5D8JL 3SGJA 3RJQB 1YMMD 5FDWA 3DX8B 2ARJA 1RZ7L 1R3LA 4ONOA 5FYKE 2ZNWA 3IJSA 5I1GH 5TE4L 4OLUL 2BHUA 2YPKB 2X4SA 3FZUD 4DQOL 2B2XH 1VPOH 1BIHA 4Q9RL 5CUSL 3KG5A 5ANME 1RUPH 3UYRH 4JAMA 5CJXC 3MTRA 1D5MB 1IC7H 3QHFL 5C0GA 1KCVL 4GBXB 3CC5B 1VFAA 5FHAL 1I9EA 1MLCB 1AXIB 2RAMA 3SDAC 5DS8A 1CK0L 5E2VH 3HNSH 4HWEH 3PWJA 3P77A 2VDQL 3DHJA 2EDJA 3VXNA 5EOQH 4FQIH 1GXEA 1I7UB 3WE6A 4JZOA 2BVEA 5ALCL 3IDMB 1UG9A 3D2UD 1XGPA 3ARZA 1Q9KB 4WHCA 2I5YL 3M8OL 2EDKA 4BH8A 5IMOB 1WC7A 4AG4L 4DFHA 4ISVB 4X9HA 5C0CA 5E5MA 4QOKB 4P2RA 5H37H 5DVOA 4DGVL 2GSGB 4FN0A 4YAQB 5DURB 2N4IA 3SKMA 2NR6C 4ZUWA 1AQKH 2DF3A 4J3TA 1FL6A 4YK4C 4NNYB 2Y23A 4ZS7L 2VL4A 1ZT7B 4KHTH 3BP4A 1G7HB 4RGMB 3MXWH 3P2TA 4HKJA 3T77A 1A3QA 5GZNC 4PGJA 4U6YB 3H3KA 1NEZB 1MFBL 5CHNA 4FXLA 2J2ZA 3NBNA 1I1AC 1F4HA 1KUMA 1JK8B 3TBSA 3I6KB 3FRUA 2BMKA 1G7LB 3KPLB 5D5MA 4LCWB 1N5AB 5DMKB 4GW1B 3QQ3A 1A21A 1OF2A 1QRNA 4MDJA 1G0YR 3DMMA 1S5HA 2VXSL 5BO1H 4POZC 1ZEAL 5IW1B 3U2SB 5DJAA 3R0NA 4UOW0 1CDCA 2A6IB 4PGZA 3O6FD 3S97C 3MODL 1LQSR 1RZIB 1QSEA 4JR9L 4ELKB 2X09A 4XC3H 1CBVH 5E0QA 1IT9H 4UILH 3ZE2E 5EUOA 1YJDC 1HSAB 4EDXB 5SWSA 1RV6X 1FVCB 3R8QA 2OXHA 4IRZL 4NO0D 4OCSL 5H35A 1YMMB 4GXUN 1JZ8A 5F7HA 5FV2A 5J12B 3DVNB 5CS7A 1BFVH 1I4FB 1G6RH 4UQ3A 3VFSB 5DUPH 3S4SA 2MCPH 3MV11 4OIIL 3H42H 1G9ML 2C3HA 4K7FB 4MJ5A 1PG7X 4KK5C 1RMFL 4WTZG 3NFSH 4Y5YA 4XPGH 5JLZB 15C8H 1KN4L 2M2DA 3RWEA 2DQFA 1XGUA 2YOCA 4MZ2A 2XPGB 2ZPKH 1S7SB 4FQXC 3S5LG 1NLDH 1KIPA 4IDLA 1KCRL 1QYGL 1T22B 1D5BB 1LO2L 4YEEA 1I1FA 3MUY1 2VXTH 1LDPH 1MJ7H 5BS0E 1TNMA 1YY8A 1J1PL 1MJ8L 3W0WB 5IEKA 2R1YB 2E7CA 1G6RA 4UIKL 1T5XB 4TULL 3BP6B 4Z7WE 2J8HA 4HIEB 2B4CC 1ED3A 5D7LA 3VH8B 2J5LB 3VFNB 1DANU 1HWHB 4YHIB 5DHVB 1Q0YL 1NH6A 2NW3B 2LE9A 1OP5H 4NWUL 2C1PA 1NLBH 4LDEB 4OZIA 4IIQA 4MDIA 1H0DA 5EBGA 3KYNA 3RX7A 1ORQA 2ZUVA 3KJ4C 2NY2C 2BC4A 4CADA 2EYSB 1YEHL 2VXQH 5CEZL 3RZCD 1NMAL 4HCRA 3QUZA 2FYYB 3ZHKA 5D1XB 3FN0L 3PDDA 5DD3H 3UTSE 4IJ3B 2P5WD 2Q3AA 3QWOA 5HHMD 5C6PB 1QBBA 4P9HH 3P11H 1K9TA 5AG9A 2EO1A 2I9LA 3PUCA 1RIHH 2CDFA 2L0DA 4M8VA 4TPRL 4LSUL 3L3JB 5BRZB 2PNDA 3MRLB 5CILL 3ZE0E 1YDPB 3ECBB 1UJ3C 4UNTA 3QP3A 4PJFF 2P7TB 4QRSA 2XKNB 1UB5A 2ZJSL 5I1KH 3O0RH 5JXED 1JWMB 3TF7C 1J0YA 1BM3L 5ACZA 1KV3A 4P59H 1IGJA 3RTQA 1DQDH 3EBAA 5FDYA 3MRJB 1P69B 3O6FB 4PJFB 3UTTE 3O6KL 3T8XB 4U6VH 1XFPA 1A6AB 1I1YA 2XWBA 2NLJB 3HHRB 4WWKD 1FIEA 5T5FH 1KLUB 2IBGA 1W2KT 4ZDHB 1JRHL 3AAZB 3G5YA 2R4RH 4V2BA 4UDUB 3W2DH 1NCTA 2WWMC 3CDFA 1FN4A 3GSNH 4F2MA 1JGEB 1CE6A 4RWYL 5C0IA 1I8LC 1OGAE 3QUXC 3DRTA 5GS0C 1FVEA 3TYGL 1YA5A 1UM5L 1KEGL 1UXSB 3KYAA 3OGCB 4RQQB 2NPLX 3UC0L 2HTLD 3D9AH 3QEHA 3GMMA 1MLBA 5LWYL 3NCJL 2GCYA 5J0BA 1IKNA 5CD5C 3G08A 5E6ZA 2V5RA 5JUEL 3LN5B 3AU1B 4DW2H 4NRYB 4NNXA 4W81A 3BGMA 3PNWB 1RZKC 1SHMA 3V79C 3L3IB 1NFIA 5KW9H 1AY1H 2ZSWA 2FX7H 4Y1AD 2NY5H 3RDTD 3BWAB 1QBLH 3OSKA 4HLJA 4HDIB 3GSNA 4QXTA 1PSKH 3PQYE 2I9TA 1KC5H 1U92B 1EDQA 2DQDH 2VWEE 1UWXK 4P2OC 4OFPA 5D2LE 1KPVA 1U8IA 1FE8L 4MMZC 3LV3B 1ZA3A 1T1YB 5JA8B 3RI5K 1PEZA 4G8FB 1DVFC 5I18H 5J6GB 3CFKA 4PR5A 3RRQA 4JFOB 5HPMB 4NN7B 2VXUL 3QFDB 3ILPA 5IB1A 1HI6B 5HDLA 3QDAA 3GSQB 1FZMA 1FL5B 5ERWB 1NKRA 1S7TA 5E7FA 1N59B 3BEVA 1RJLB 1T5WA 2F53E 5LKNA 2OSLB 4U1SB 4AQOA 4H20H 1GPOL 2FJGA 4L4VB 1FYTA 5HHMB 3V6FA 5ICYB 1EO7A 1T83A 2NTFB 4KJQD 4HSQA 3D48R 3LHPL 4XPHH 2XNAA 1AD0B 4NHUA 3WS3B 1A1OA 1AGDA 1VERA 3JV6B 1NC2D 3RJDA 4TVPH 3ULVD 4OIBA 1JF1B 3TO4D 3NH7L 4NQEE 3NIGF 4KQ4L 3BUTA 3C6LD 1RHFA 1JZ2A 1ZTXL 4LSQL 3ZSTA 3S88L 2KZ1B 2VLKA 3BVNA 3U4BL 4EIZC 3WDHA 5IKCA 3EFDH 3QIUD 5D7SH 4WIQA 1QZ1A 1QSFD 3NAAH 4I9WD 4WWKB 4HIHA 1RZFL 4DVBB 5HGHB 3U1SL 1IM9B 2E7HA 2VAJA 3KXFD 1L0XA 1KCUH 2EYTA 3OKMA 4K7PL 4MA8H 5ESAB 1RD6A 1J7VR 3ULUH 2L4OA 3DXAA 2BNQB 1UWEL 2D0GA 3L7FB 2D7TH 1D3CA 2AJXL 3BN9D 4HUUA 1LMKA 2M1KA 4OV6F 3I6GA 3QHTC 5D7JB 2MKLC 2V5MA 2FHBA 3B9KA 3NFNA 4MJ4A 5HYQB 4FFYH 3BT2H 1BJMA 5HGGS 5EORH 5JHDD 2CDGA 5LQBL 4P3CH 1A6VL 5MEND 4IS6B 1D5ZA 4JRYE 3RVTD 5L6YL 4NZTH 1RSFA 3IDXH 4NQXA 4MA7L 4F7PB 3HUJA 3TFKD 1E27A 2CD0A 2R69L 3DVFA 4NOBA 2R2CA 2IPUG 1IM3A 5FUOL 2VSDA 3O3BB 1MJUH 1KIQA 3RDTB 1NAKL 1MSPA 3BZDA 4S1DC 3ZO0A 4NZUL 5J1SC 1NCAL 3RVXD 1T1ZB 3KPSA 2OR7A 4MQXC 1YNTA 4GMSH 4AENB 3S37X 1EUTA 1FZKB 2ZSVB 3DSFL 1C08A 2VDNL 2ZKHL 5IMKA 4LFHG 3V0WH 2C7UB 4X8XA 3ZKNC 2XZQL 1B4JL 3VA6A 4CBPA 3FO0H 5EU6A 2VLJD 1MCLA 1ADQL 1X5AA 5I75B 1C12B 1WAAE 2DKMA 3S7GA 1T1XB 4N90E 1K5NA 5CJQL 5DA0B 3PWLA 4O00A 1EEYB 5D7KD 2BSRB 5HY9B 2X4QA 2VAAA 3L7EA 4BQ9A 4PRPA 4HWNA 3N9GL 3QDJB 1BVLA 4XH2A 1S5IL 1MI5E 4P9MH 3X11A 5A40E 5A3IC 5IBUG 3MV8E 2VWEC 3FTGA 2ICEB 3LKSA 5DJCA 5T3XD 1FL3A 3I2CH 3L5IA 4OAWB 1CDGA 4MQ7B 1Q9OB 1RUKL 2VZVA 3H7LA 4DKFL 4AL8H 1NC2B 4JRXB 4HXAH 1NGQH 1FLRL 1O7VA 4XPBL 5EDXA 3C6LB 4KC3B 5A2KH 5HHQA 1WSST 1CXLA 2V2TA 5F7LB 3WMSA 5FGCB 3ARQA 4PJ8C 1DBJL 2GFBA 4YGVB 1UCBH 3OR6A 3P4MA 1CQKA 2J88H 1OAXL 4OKVB 1V3LA 4KQ3L 2F5AH 3NIFF 4Y5VA 4DTGL 1QSFB 4PJ7A 2QJDA 2IWGA 1PG7W 4LMQI 1T2QH 3MRIA 5E00A 2F74A 4P3WA 1OP9A 4FRWA 3TZVB 5AWNL 3C5JB 4GO6B 5JW4M 2ZOKA 3QO1A 5FYJL 4TSBL 3WUWG 2WBJD 4JN1L 1G7MA 2HH0H 3MGAA 1MCKA 1Q0XL 1OT2A 4LCUB 1SMAA 1FNSH 3P4OB 3NZ8A 5JW4Q 3DTXB 4JHAH 4U6HB 3MLSH 2YD1A 3FHQA 3T0XA 3FB8B 4I3RH 2EDBA 5JNYB 5HYSB 2WINB 2JIXA 4MCYA 2EDWA 1CICD 2WQ8A 3BJ91 5E99L 3THMH 1NCNA 2V9TA 5I1HL 1CD8A 4ODVH 1JYWA 2RBLA 4M3KB 1HN1A 2H26A 2W60B 1KEMH 1HHIA 4Z76B 3AM8A 4XB8A 5D2NE 2EH7H 5TQ0H 2E7LC 4H8WL 1A14H 2X4RA 4W6YB 5FFLA 1YEFH 2GUOB 2APTA 5ESQA 3QEQA 4ACPA 4Z5RA 1XCTA 4JDZA 1JGUH 4PJXA 3TH3T 3QXDB 4LDLB 4QGTA 4XXCC 3SDXE 4RAVA 3VGGA 2P5EA 1HQRA 4TRPH 1K4DA 1WFOA 4BFEA 1JGVL 4JFHD 3K7UA 1B0RB 2VLJB 1RZGB 4PTTA 3FQTB 1FNGA 5EPMB 3B2VL 4PRNB 1OPGH 3VGAC 2GJ6A 5EZIL 5E2UL 1E4KA 5B39A 5HHPA 4MSWA 3SCMA 4BJLA 5I30H 3PGCB 1YYLH 2P46B 4BA8A 2NYYD 4PRAA 4OD2A 4XI5C 3STLB 5A2LH 3PL6B 4X4MA 1UYWL 4KRPB 5CJ5A 1OARL 1MEXH 3REWA 1MY7A 3WD5H 5D1QC 4O2EB 3CU7A 3X12B 3BPCB 5I71B 3V6ZA 3QULA 2HKHL 3MRPB 4C83A 5GGRY 2X4PA 4M1CC 5TF1H 4EOWL 2FECI 4G9FA 1WT5A 1ZHKB 1TTGA 5F8RC 4FG6D 4WNQB 3FFCD 3QRFM 3WFDL 4PLKC 1UM4L 1WK0A 3KPTA 4GQ9L 4LCWE 4JFEB 3L3GA 2R2HA 5KVEL 4JFZH 3O2DA 4R7DA 1FFNA 2AABL 5EOCJ 1P84K 4G6AC 4XX1G 1FNFA 1OSPL 5FM4A 1R3IH 1Q1JH 1R24B 1JHKH 3F62A 3HB3C 4I48B 3FB7A 4ODBD 5DD5L 3F6LA 5GRVK 3H7BB 5C0BD 3FO9B 5EC1B 2FLBT 3BKJL 3HE6A 5CCKH 5I73C 1D6EB 5GZOC 1NCWH 4EI5A 1CG9B 3BH9B 4JDVB 3QFJD 4ZFFA 2XY1A 4Z7UA 3RWGA 4X6BB 1UH3A 3MRQA 2WBJB 3A67L 4M6NL 1I3GL 4OZHF 4RMSA 2W9EL 3SBWA 1S7WB 1Q72L 2RHEA 3LN4B 2FBJH 4G6KL 3P0VH 4Z8FH 4NJAH 3OV6A 4HZLA 3IU4L 4LGRB 3DURA 5IF0A 3CFCL 5ESVB 2OJZH 4OI7A 4OZHB 2JTDA 4U1IB 1YNKH 3UTPD 2R2EB 4WFEE 4Z7NF 4RA3A 3BMVA 3GJFK 4PGBB 5DJYA 5CJXA 2EE9A 1LK2A 2XZAL 3RUGE 3SDAA 2XN9A 1GAFL 3NZHH 2FEEI 4F57L 3C2AH 5F7EH 1E28A 2SEBA 3QRGL 3N50A 5DSCB 4LARL 4AMKH 5E08L 5D70L 2HFGL 2HT2D 3LEVH 1F00I 4NQDE 1A1MA 4XVTH 4ZUUA 4XRCB 2A74B 4PB0H 1BOGA 4CU7A 4K3DL 3GHBL 1QVOB 3L5HA 1MCSA 4UDTA 1AD9B 3W0WE 1MHPL 1HHJA 2VZUA 1LO0H 3UAJD 1MHCA 1YEDB 2NW2B 4JVPA 2ZCLH 4ZUSA 1IE5A 4MAYC 1UACL 4JFDD 4X6CE 4LSPH 2IANA 5DJDA 3I75B 3N1GC 3NCMA 4S1QH 3OG4B 5FF6B 2XOTA 3GK8H 2RQ8A 4R26L 4RMTA 5CMAA 1JJUA 4KKAD 3UTQB 3RWDA 3WJJC 1JWUA 1YJDH 5DJ6A 1QD0A 4K71C 4AEHH 1C5BL 4TUKH 2IC2A 2QQKL 2DLFL 1I1AA 5C1MB 2FSEB 4GAYB 2G9HA 3RIFF 4CDGC 12E8H 5EU3A 5BV7H 2VL5B 1P7KA 5INCB 1EA9C 3PWUA 1H3PL 1QQDA 3U83A 3ARBC 5L9DH 3C5ZA 4KDVA 4QRQB 4TVSa 3CD4A 1PKOA 3GUTA 5IESL 4NQUA 2NX5A 1INQB 4HEME 5DI8A 5FYLL 2GHWB 5IB4A 4QRPE 3VDAA 5GGTH 2HFEB 1KSRA 1CD1B 4JY5L 3V5DA 2HMIC 4JLRA 1U3HC 1JPTL 2DIAA 4LVOB 2OXGA 3QQ9C 5C0BB 2PYED 4TNVF 3T0ED 2MOVA 4D0DB 3QQ4B 4N0CD 5A1AA 1QLRB 4KUCF 3S96A 5GHWH 1QLFB 1ZSDB 2CIIA 4KTEL 1TMCB 4YZFE 3RL2A 4X5WB 3KNBA 3KPMA 3HRPA 5FYKH 2Q6WA 5DUML 3BPOC 4S1RL 1BFOB 2ZCKH 4DAGH 1H3UA 4FFZL 4XGZA 1MVUA 5IHZB 1GC1C 3QDGE 4G8EA 4EN3C 2B4CH 4YO0B 2CIKA 5E2JA 3MJ7B 3VE0B 4F7CA 3MROA 3FOLA 4U1JA 1T4KA 5GGTA 4M03A 2BXYA 4N9GA 1N3NA 5CP7B 2FH8A 1ND0B 2Z92A 2HT4C 3DJ9A 3DYPA 3RZWA 2Q8BL 2RB8A 4JPVL 4K9EL 1RVFH 4HFUL 2R4SH 4HC1A 1KPUB 1BLNA 2H32B 5DWUH 5DQ9B 4MXWH 2FO4A 1YECL 2XWJA 4KTYA 4XPAL 4C56D 1II4E 2PW1A 4JKPH 3WDJA 5IV2A 3BIBX 3T4YA 2WQRA 1YYMH 4GUPB 4XP6H 3CZFA 5A16B 1I9JL 4ZD3L 3CPLA 3MLXH 3QXWA 3GI9H 5ANMA 1I9IL 2HN7A 5HHVL 1F3DJ 3EJYC 1Y6MR 2P48B 4LEXH 4LLVA 1FVDA 3WXWH 1GCFA 4YX2H 1D9KA 2VO5A 4HW6A 5TPWH 3V52L 4JFDB 3BQUD 1NFDF 4PP2B 2OL3H 4WO4D 4ZTPH 2VZ3A 5KN5A 1FH5L 2P4AB 4DVRH 4CMHB 3T0VA 3ARPA 3MCG1 1DLHB 4XCEB 1T7WA 3DO3A 3BHBB 2BNRB 5IQ9B 3IETB 5CBAA 1U8MA 1NFDB 4WI9A 1QFPA 2W0KA 3PV6B 3PWVA 5KSUB 2Q8AH 1SY6H 1MIEH 1QACA 3L3DB 2XWTA 5IB5B 3BMWA 4BSWA 4ENEC 3P9LB 1JPST 5TFSH 4KROD 4OCXL 4NGHL 1A2YA 4OLVH 5FYJE 1KG0B 4H1LH 5DO2C 3MUGA 4QY8A 3C60D 5IK3B 5L0QB 2ADFL 2EDXA 5MEOA 1LP9E 2CR6A 2H2PC 5GS0H 5DLMH 4HEPG 3P0YL 3VFUB 4X6FA 4YDJA 1UJ3A 5KSBF 4UOJA 2FD6H 5I1IH 1Q9WA 2EEAA 4ZOAA 2OL3A 4R4BB 1P4LA 4QLRA 3RA7H 2G2RA 1G9EA 2B0SL 5KSBB 4K23H 2FWOA 4P4KB 3T0EB 3NCFB 1OT1A 3ROLA 1BF2A 1RZKH 4G8GD 1TCRA 2QQLH 1MRDL 4HJGA 1EHLH 3PIQB 1T89C 1YEKH 3OKNA 2ESVE 4UT9H 3T1FB 2PTUA 5M7QA 5SWZB 4F8TA 5EU5B 3RP1A 4H1LA 5E70A 4YHZH 1MWAA 3QUXA 3DUSB 3U0WL 1AKJD 1CDUA 3DLQR 3Q6FB 3VJ6A 3UXFA 1FNEA 4FXKB 5HHOB 5LVEA 4LKXA 3RVWC 5JIPA 4LIQH 5IW6A 1ZWIA 1F58H 5GRUL 4MNGB 3LSOA 1IGFH 4EJ1C 1CT8B 1SEQH 3TA3C 3VXOB 1T0NA 5FEBA 4W4NA 1A3RH 3FRPG 3F7RA 3GB7A 4H5SA 3V4VH 3QI9C 1U8PA 3OKOA 1PW3A 1OL0A 4G5ZH 3VRIA 1J1XH 2BJMH 1TTUA 2PETA 1Z2KA 2CKBH 1OAQL 1KCSL 1BQUA 1NDMA 2AXGB 1H5BB 2F5BH 4OD3L 1S9VA 3B83A 2NY3B 2DICA 3MR9A 3HPJA 5JQHC 4OJFH 3EOBB 4S1SH 2RFXA 4PJDF 3WLWD 1T1WA 5B8CC 2H2SD 2J7LA 1AGBB 1DVFA 1OLLA 3E6FB 2IADA 4ZFOB 1NCDL 3QHZL 3LRHA 1GVIA 3AMLA 4KI5D 1J0KA 4XPTL 2YPVH 3T4AA 4KZEH 4LSSL 4PJDB 3TN0C 2VISA 1T20B 5F9JB 3HNVH 5BOPA 3LKOB 5A2IH 1IEAB 1FQ9C 5IB2A 3WHE1 2CUMA 1DQTA 4Y2DD 2X7LA 5H8DA 4APQC 1J0IA 2LQRA 2QQNL 5ID1B 5BS0A 3HI6L 4TUJB 1X5IA 3QUYC 2J8OA 4YR6A 3QDJE 5ABDE 3BKYL 1HOCB 3L5JA 4J1UB 4Z7WA 2Z93A 4QXGL 2QADC 1C7TA 3VW3L 1FZJA 4GKSB 2V5TA 3B5TA 3BKML 3UDWA 2W0PA 5TDNA 5EU4A 5E8PA 5GGVY 5DR5H 5GRJL 1M05B 2OZ4L 1NCBH 1D6VL 2PR4H 4JGUA 5I1LA 3PWPE 4JO1L 3CMOH 3ZKXB 1ORSB 3OTTA 5TDOA 1HCVA 3MLTB 3WFZA 3DV6A 1FG2A 2ATPA 3KYMA 1FAIH 4OT1H 5AZ2L 4ZOBA 5JOPD 3MV7D 1NL0H 3UTSA 2VDKL 4JM4L 3HE7D 3WEXA 3TBYA 5BOZG 5ITFA 5DJ8B 4PRBA 3PGDB 1JFQH 3G6JF 3O2WH 4UINH 3F7PC 2XFXA 3OXRB 2OBGA 3NN8A 1CLOL 3OX8A 4WU7B 1FO0A 5E6IB 1F3JA 4PRHB 4RGOH 4Q9BA 3G6JB 4HD9A 4JFPB 5EBWA 2E27L 4R96A 3O8XB 2DI9A 4UQ2A 3QEUB 1M7IA 4Z0XA 1U2HA 4AZ8A 1I75A 1A7OL 3UTTA 3MBEC 3S35H 5FK9A 1R5IB 1FPTH 1NCUA 2FGWH 2XXCB 1QPXA 3RU8L 2X42A 2P8MA 4QTHA 4HH8A 1OP3H 3TBWB 1LHZA 5E8OA 5ADOL 1WIPA 2EXYC 4RIRB 4WUKH 3HCVB 4H8WC 1QLEL 2B1HL 1HDMB 4NJ9L 1OGAA 1HKFA 1BOYA 1ZHLB 5GS2D 4GRLC 1ETZA 1K8IA 1DZBA 4LLMA 4YXHH 2DQEL 4DN3H 3SGDI 1G7QB 3CK0H 1PZ5A 4BH7A 4MJ6A 5IB3B 5C08E 2P8PA 3MRFA 3RY6C 5I1JL 1R3HA 4X9FA 2JJSC 4BKLA 1NDGB 4MA3A 3AS1A 3U79A 3D25A 1KJVB 5BJTB 2CGRH 3HAEH 1MAJA 2AJZA 1QHOA 3OKDA 2Y6SC 4XNMA 3P30H 5IIEB 4MXQD 5SWQB 2OTUA 3QWQB 4V2CB 4PD4K 2D7QA 1VENA 4Y4FA 1JNJA 3L9RB 5DEFA 3EOTL 3PQYA 1XGYL 2I60H 1UB6A 2OP4L 3CVHB 3G5XA 5D2LA 5IMLA 1RZ7H 4GFTB 4HS3B 5J8OA 1MOEA 1I8KA 5DDHA 5C0CD 4OLUH 2D3VA 1J11A 3GMLA 4PJBE 3KR3L 2BCKB 4P2RD 2PXYC 4NWTL 3TIDA 4XXDA 1KELL 1KCKA 3ZDXE 5DJZA 1VADA 4Q9RH 1N8ZB 3B6SB 2BY3A 4HK0A 4ODSL 5CUSH 1VGEL 1FGVH 3WFHA 2N7BA 1GZPA 1KJ2B 2E8YA 5DUBA 3GSRA 4PJ8A 3QHFH 2X1QA 3FN9A 3MCKA 5JXAL 4JZNB 5FHAH 1AGCA 2F53A 1JGDA 3QPQD 5DFVD 3UPCA 2FX9L 2Z31C 3DI3B 5HI3D 3MRCA 4OUUB 3IVKA 5KSAD 5HYJB 3G9VA 1BQSA 1ZT1A 1QG3A 4GMTL 2VABB 2X70A 5ALCH 1AXSB 1DL7H 3NCYS 5FECB 4WVRA 5CSBA 3QZWB 5GS3A 3I84A 3QEGL 3R1GL 5CZKA 4WUUB 4IRJB 4RZCB 1F45A 3M8OH 4RGNC 1M7DA 1AGFB 4N8VG 3TH2T 2CDEA 4NQEA 4JFFE 4AG4H 3TT1H 4IRSC 1AQDB 3AREA 5CIPA 5F7DB 3ARGD 4PGCB 5FCSH 1FSKC 1M71B 4XCNB 1NUDA 3KWWB 5GGSY 2LU7A 3KPRE 5F88B 3VXSB 1QBML 2E9BA 4PJEF 1W0WA 4ZS7H 3MO1A 5D7IB 3BP7A 1QSED 5IMMA 5CLTA 5DK2B 1JE6A 3O11B 2VMFA 4MA1B 2NZIA 3I3BA 3EYUL 4BUHA 4MAUL 2PUQT 1L9NA 3CFIC 1BQHB 5ILTL 5IVZB 4HWUA 4ZS6D 5SWSD 4PJEB 2WM0A 4JN2A 4QRUB 4Y4HC 1MFAH 4LLWB 1C5CL 4XAKD 5DMGC 5FDWB 4Z7NE 1T03L 2BOBA 1A6WL 1I7TA 2EZ0D 1PLGH 1Z9OA 3IJSB 2ITCA 4H26A 2E6PA 4KK9D 5F6IC 3KYOA 5C07D 2EIBA 3Q3GB 4HS6A 2AV7A 2BOCA 1S78D 2BSSA 5IHBA 4JAMB 4NQCD 4L9DA 2VXSH 5C0GB 1WWBX 3SDYH 1VFAB 2DKSA 5T1KA 5I6XC 1JZ3A 5MI0C 1ZEAH 5D6DC 5DS8B 4HV8B 3VXNB 1CIDA 1X5XA 1T3FB 2RR3A 3SQBA 5JOFA 2I27N 2Q86A 3WE6B 4JZOB 5CKAA 4FFWD 2NY0C 4M7KL 3DGGA 3CSYA 1IGCH 2KQMA 1UZ8A 3HS0A 3BZFB 4HUWA 4LK4A 4IRZH 3T0BA 1BPVA 1SJEA 2FIRT 4U7SA 5K9KA 3QUKB 3MRBA 1WC7B 5C0CB 2K9UA 1B9ZA 2NY4C 4P2RB 3K2UH 2APVA 3MYZA 3N85H 5D7LD 1G9MH 3SKMB 2A1WL 1WAAA 1RMFH 4AT6A 1FL6B 4PJAE 1SBBA 1ZGLM 1GGIH 1KN4H 4UB0L 4JVWA 2DS4A 1DQLH 4HGKC 1OTSC 1RU9H 1IGML 3VD7A 4YXKL 1DUYA 1ZHBB 3TEUA 1F97A 2A9ML 4NO3A 5IFJB 3O6LL 1QFHA 5FM5M 1MI5A 2IAMD 5JZ7D 1F90L 1RZ8A 1G1CA 5D5MF 1XGQA 3MV8A 5HGBB 1KCRH 1QYGH 1LO2H 5CHNB 1LNUB 43C9B 2V17L 5D1ZC 3TPKA 5FGSA 2AV1A 3WFEL 1J1PH 1MJ8H 4LNRA 5ENWA 5B4MD 3V4UL 1KNOA 2BMKB 3TYFA 4RX4A 5D5MB 3GMOB 2Z35A 3O9WC 3QQ3B 3HRZA 4R90H 4U1HA 2LV4A 1QRNB 4MDJB 5T3ZD 3DMMB 1S5HB 2VLRD 3E6HA 4NQVB 1FFPA 2WIIA 4NRZA 1UXWB 1Q0YH 3FQWA 5EUOF 3UBXB 1X3DA 4D9RE 5DJAB 2QKIB 4NWUH 3RTQD 3BPNB 1HSBA 2GW5A 4J8RB 2FCBA 1TENA 4K9EC 1I7ZA 5DMJB 2X1PA 1UT9A 5DQJA 5EUOB 1YEHH 5CEZH 2LAGB 3NCCB 1GHFL 3E3QE 5BZWA 5SWSB 1NMAH 2VDOH 4I5BB 5E4EB 5H35B 3WN5B 3SDCB 1KLFA 2D2OA 1T66C 4GW4A 4Z95H 4BSVA 2FJFA 5JPMA 3LZFH 2VUYA 1JN6A 4TPRH 4LSUH 3S4SB 1OVZA 3SJVD 5CILH 3LB6D 4U1MA 4MJ5B 1QP1A 2YPKA 4MD5A 4R2GC 4TN9A 1TETL 2ZJSH 5FXCH 4Y5YB 1UKQA 4X7SH 1BM3H 1YEIL 3D18B 4MAYA 1LD9A 4JQVC 1XGUB 1DN2A 3OB8A 2NXZB 1D5MA 4FMFA 2O26U 3O6KH 5J56B 1MLCA 4AIZA 3EFFA 5D2NA 1KIPB 1EGJH 4KWUA 1VKXA 5I9QC 2PCPA 1MCOL 1I1FB 1REIA 3D0LB 3WJJA 1JRHH 4OFVA 4MS8C 1V7ML 5C0AB 1I7UA 2DMBA 5IEKB 4I0PD 3RVUC 3KJ6H 4RFEA 1G6RB 4RWYH 3SDXA 2WNGA 3F6IA 4XBPA 1AI1L 1NANH 2EDYA 4OGYL 5C92A 1Y18A 1R5WA 5I0DA 3TYGH 5IMOA 1UM5H 4CMMA 1KEGH 4OZIF 25C8L 1IZKA 4XP5L 3ARBA 5F6HJ 3QG7L 3NCJH 3LRSB 2GSGA 4YAQA 2C1PB 1O7SA 1FIGL 4L8DB 3IS0X 5JUEH 4OZIB 2NY6D 4MDIB 1H0DB 1ROWA 3KYNB 1ORQB 2OMBA 4NNYA 2KZWA 2BC4B 3TBTA 4HIXH 4CADB 2Y7QA 1EGJA 3SY0A 3V8CA 4WFHE 2W92A 4QWWC 4POUB 1G7HA 1TJGH 3QUZB 1FC1A 3B2UD 1K3ZA 1ZS8A 4PS4L 1WCBA 4CJ0A 1Z9LA 3WCYA 2R0LL 1QBAA 2I9LB 2CDFB 4QCIA 1N0XL 1NEZA 3ULSB 3UZEA 4AEEA 5J13B 2IJ0C 4F15B 3MJ9L 3TVMD 4LLDA 1FE8H 2MTPA 3KPLA 4LCWA 4QRSB 1UB5B 5DMKA 5CKGA 2VXUH 3BE1L 5C9JA 1NCCL 4W6WB 4HT1L 1IGJB 1Q38A 1GGBH