5DXWA

Crystal structure of mouse pd-l1 nanobody
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
b'QVQLVETGGGLVQPGGSLRLSCTASGFTFSMHAMTWYRQAPGKQRELVAVITSHGDRANYTDSVRGRFTISRDNTKNMVYLQMNSLKPEDTAVYYCNVPRYDSWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PD-L1 nanobody
publication title Crystal structure of mouse PD-L1 nanobody
rcsb
source organism Camelidae
molecule tags Signaling protein
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dxwA00
4FG6C 4NUJA 4KMLB 4OM1H 5E99L 1OD7A 2IC2A 3BDBA 3RVWC 2XTLA 3FOLB 2DIAA 3VFUB 2GSGB 2DL2A 3C60B 2DBJA 5DJ0A 3JV6A 1RFDL 4KK6C 2VC2L 5SWSE 2PTTB 5EDXA 5FUOL 3GBNL 4KHTL 3ZMRA 5MENA 1BLNA 4E41D 2VO5A 2QR0B 2C1PB 5GGTA 3NH7L 1RIHH 4NNPL 2A77H 3MLRL 5DS8B 1EO5A 1I9JH 4XVUD 1YPZF 1C5CL 4KTDH 4JDZA 2IALB 5IB2A 3GSVB 4NQDE 5GRXG 4HJGA 4U05A 3X14B 2B1AH 5HHPB 3W9DA 4F7MB 1GPOL 4H1LH 2FR4B 5T1LD 3QIWD 4LCYB 3OL2A 4EQ3A 4P2OD 1IGJA 3PGCB 4S1SL 3LPGA 1QFHA 5D71L 1KENL 4UINH 4PRNB 3KPRD 2XTJD 3VRLE 5LGHL 1J8HA 5F7EL 5E5UB 4I5BA 3RI5K 3VXRE 1UWGH 4HX1B 1Q9OB 2R2EA 3T3PE 3KJ4C 4UDUB 3VFNA 5CJ5A 1NFDA 4JRYD 3SGJA 4JZJA 5FB8A 1IE5A 1YYLL 5CSZA 4DGVL 3ZL4H 4ZFGH 4HKXB 4HXAH 4UNVA 3AREC 4LDLB 5FDWB 1XIWD 4NQEB 4V1DD 2A0LD 5J7CC 3CXDH 3PIQB 1VPOL 3L5XH 4KROC 4LLVA 3SBWA 1CGSL 4L8SC 4YBLB 5IHBA 1U2CA 4U1NB 3FO0H 5T3XH 2V6HA 3UPAA 4HGWA 5I8EB 2JKXA 1BQLL 4IDLA 3KS0J 4MNQD 1ROWA 5KN5A 5D2NA 2WAHA 2AJZA 5I19H 5IM7A 2NW3B 4OF6A 1OB1A 1TIUA 2CDEA 2EIZA 3C8HA 3WIIH 4PJ7F 2EICA 5E8EB 4JFYA 4JKWA 5DK0A 1ZWIB 2QEJA 1PZUB 5F1IA 2HLAB 4U1GC 3STBA 2GSIA 3CVHH 1CIUA 1KELH 2GT9B 3GGWA 1TQBC 4RGOH 3F12A 2XFXA 1AGBB 1VKXA 1KCVH 2GAZB 4YAQB 3RIAF 1HYSD 4MNHA 3S37H 3JV4B 5E4IA 4C55A 1PKQB 2R9HD 4TSAH 4XPFL 1FVDB 2R1YB 1DDHB 4CN6A 3STZA 4PJ7E 4M4PA 5CHNA 4G8GE 3IVKB 2X7LB 3ZT5A 5FXCH 5DD6A 4XBGA 1KIRB 4PUBL 2PW2B 4FFZH 1NBVL 4PYHA 4KJYA 4FZEL 5EZOL 5GGSY 3WFCL 1KTLB 5FUCC 5ICXA 3DIFA 3V6OA 1L6ZA 2NMSA 4XP4L 4KXZH 1KEML 1FVCA 1HIMH 3BPCA 3DVFA 3EYVB 4XVSL 3TYFB 3QUZB 4JQVC 3AXLA 3ECBA 3MA9L 1ZTXH 3KVQA 1BWWA 5I1EL 3U0PA 1FN4B 4GRMB 4HWBL 4YK4B 1BZ9B 4LLYB 4NGHH 1NFIA 4IJ3C 4DFHA 1CF8H 3WS6C 1KFAL 2ICWA 1MLCB 3VD5A 5IHLB 1HCVA 2BSTB 2XA3A 5FA3B 1QQDB 4L3EE 5FIEA 1IQDA 3BZEB 2XRAH 4FQQA 2LQRA 4P2QE 4NOFA 3O9WB 4ZPVA 4D0DA 5KVFH 4O02H 3QQNA 1NAMA 2DJUA 4MA8L 4NQXA 4NO5B 1VA9A 1F58H 1P7QB 4FFWC 1KN2L 2H3NB 3SDAA 4WI5A 1WAAA 2B0SH 1R5WB 1A6VH 3JWDH 5HHOD 4P3DB 1J05B 3JTTA 3KWWA 2GCYB 2HTLC 1K2DA 3UTZA 1SYSA 2G2RA 2PCPB 4POZC 1RU9L 3V95A 5GRZA 4PRPD 3ARFC 3O81A 4QOKE 3W5MA 4ZOCA 5CUSH 1HWHB 5I66A 1MJ8H 2VDNH 2PNDA 2NY0D 5A1AA 5A2FA 2DB8A 3INUL 4P0DA 1R5VB 4BZYA 4WI7A 5IOPA 2H2SC 2R2BA 3QXUA 5FCUH 2I07A 4FQXA 2VDQH 1T1ZB 4PRDA 1IKNA 2VWEE 4M6ML 3VG0H 5HPMB 5KAQG 2Q6WA 3QB7C 5EOCL 4L8CA 1W8NA 1E0OB 1VHPA 4XZUA 2EDBA 5JW4N 2R0KL 4CVZB 1QRNB 5IROA 3CUPA 3WS3B 2XQBH 2VITA 3C6LB 3P0YH 3CU7A 5IB5A 1T20A 4MD0B 1PZ5A 4FQ2L 4NC1C 5IHZB 4PJ5A 1ZLWH 2LTQC 5JHDB 3C60D 3MGOB 3MCKA 3CFCH 3SJVB 5DEFB 4OF8A 4CADA 3IF1A 3O8XB 3PHQA 3HE7C 5HXMA 2Z93A 2C1OA 3SE3A 1N5AB 4BH7A 25C8L 3U0WH 5HHVH 4GBXA 5EBLA 2L7UA 2IADA 2ZUWA 3B9KC 4K23H 4XNMA 2VL5A 4K8RH 5F6HI 4YDVA 1TJIH 4HPOL 1S9VA 2HFTA 3HC0A 3MRDB 3LMJL 4P48A 3L5IA 4M6NH 5IBUB 2X1WL 2FSEA 3TN0C 3PQYA 3FMGH 1UZ8A 2XZQL 5I8CB 3RIFK 3GMMB 4KAQL 4PBWD 2CGRH 1MJ7L 4MS8D 2ZP0T 2HMID 5I1JH 2XKNB 4JZNA 2CUHA 2FEEL 2WBJB 4U2YA 3K1KC 3HNTL 4HJ0D 3VI4F 1G1CA 3FQXA 3IDYB 2IH1A 5E5RB 5BV7B 1N4XL 1SJHA 3QZWB 5DRXB 1HXMA 5C07A 4EUPA 2FGZA 4LIQH 2P44B 5BZWA 3JV5A 5ADPH 5A16A 5IFHH 3DHMA 3OZ9L 3LDBC 3GI9H 1KF9B 5FM5O 4R3SB 1QP1A 1LEIA 4JR9H 3BAEL 4EN3C 4LEOA 2HH0L 4X4ME 4F9LC 5FM8A 1LDPH 3KPRE 2XTJE 4V2BA 1BZ7A 4YHIA 1JCKA 4NQED 1CD1B 2VUOA 4LSSL 1BD2B 3VI4E 1KSRA 4JRYE 5DSCA 1JWUA 5J6HA 1GIGH 2A1WH 3EYOA 4OLZL 1NMCC 2C3VB 4JO1L 3C87A 4UILL 4JG1L 3K46A 1J0HA 3HPJA 4NQCB 2AEPH 5DFWH 4G43A 4OGXH 2Q7YA 2D03H 1KGCD 4K3HA 4V1DE 4JVWA 1BBJB 3MV9B 4PIRF 5F9JA 4DGIH 2AQ3A 1MCSA 1MAKA 4LVNB 5J4MA 1NCDH 1S7TB 2XYCA 4MJ5B 4HIHA 4I0PD 1JNHB 1YNTA 3HZYB 4MNQE 4PJIE 4Y2DB 2BC4B 3ALWA 4QRPD 4ODSL 4RISL 5KZCD 1MH5B 1CGYA 1ZLSH 3O6FB 1OTTC 4HWBA 5GZOC 4X6FB 3ZTNH 1FZKB 3VWKD 1ORSA 5B21A 1KLUA 4CU7A 4TUOB 1MFAH 2X4QB 3LKRB 4U31A 2NLJB 1NEUA 1T1XA 1CT8A 4KGLA 4OLWL 4ZPTB 1UM4L 2VSDA 5GS0L 3O4LE 3UROR 3WNPA 3W2DH 4JQIH 1RV6X 1EJOH 3L5JA 3ULSA 2YPVL 4ZQKB 5D7JA 3O2WH 4U7KA 2ATPA 5E03A 3WKML 5IF0A 4X5XA 2EIDA 3HC3L 1OLLA 4KZEH 3BISA 1VFAA 4Z95L 3ZE2F 3BIKA 4OM0L 4L4TA 2FH6A 1UGNA 4KJQD 1ADQH 1LEGA 2JJVA 5AYUL 1E6OL 4OLYH 1QSEA 2Y23A 5C0RL 3QULA 2WW8A 3OX8A 3GMNA 2BNRA 4KXZI 5I0ZA 3MRKA 1PLGH 3VXOB 3CLFL 4WTXA 2GJ6B 2NY5C 4QY8A 2D31A 1WZLA 2NXZB 1AXTL 3GMOB 3P73B 4PGDA 2ARJB 5HVHB 2DKMA 5GSRB 1DEEA 3ZE2E 4NRXB 4PBVC 5T5FH 1H9VA 1XF2A 1KNOB 3N85H 1GGBL 1IL1A 5EA0L 4JFQB 2E8ZA 5ENWB 1N6UA 3O11B 5GZNC 3LQAC 3M1BA 3FT4A 3NAAH 3VD7A 1QTYT 2B5IC 1AD0B 2DBLL 3P0VH 3VFPA 3T1FA 3ESVF 3UYRL 4HF5H 3H7BB 4WU7B 2MQCA 1IEAB 1BIHA 3GSRA 3KPMB 5AUMB 3WIHH 1ZV5A 4ELME 5I1KH 5IV2A 3BN9C 1V3KA 1NMAL 3D39A 4M48L 1KIUA 1IAMA 4XI5C 3A67L 5HHOE 4MD4A 2A38A 4CN1A 2VR9A 1J12A 1PVHA 5ESVB 3L5HA 3IKCA 5FHAH 3FQRA 1MFBL 1YQ2A 4IM8A 2OSLB 4PRHD 2HT2C 1WCQA 1FRGH 5J1TC 4XCCL 4PRPE 5KSUA 4PJHB 4Q2ZB 3MOBL 1T89A 3GBLA 5HGDB 4UT7H 3EYUH 1DANT 1JPGB 2H6PB 3BKML 2YXMA 1KOAA 4BUGA 3RY6C 1E4XH 5IWLC 5J1AB 1FG2B 3C6LD 2CKBB 4F7PA 3BWAB 5TDNA 3ULUD 1CICC 2W1NA 5GGQH 4OQTL 3UMTA 5KVGH 1RHHA 3SJVD 4YIQB 4ZUSB 1RJZA 3O8XD 2JJSA 4AYFA 3EJJX 3VWJC 3SO3C 4F2MB 5BVJB 2NTFB 3OAZK 4Q74A 2YUXA 4FNLH 3LIZH 1UXSA 2A73A 5HGBA 4JFFA 5ESAB 2XA8H 3WD5L 4ELKB 1SJXA 3MV8E 3PP4H 2EYRA 2NY6B 3PV6B 4KQ4L 1OAYL 3MYZA 5F88A 5GRUL 3V0WH 2DL9A 5L0QC 5E7FA 1CE6A 3GHBL 3PWVB 2QTEA 3DUHA 4J4PA 3C2AH 3GK8H 4XPBL 1FIGL 1A6ZB 1E4KC 4WV1A 1LO3H 4JM2B 3LH2H 4XXDA 1CDJA 1FGVL 1I8LA 4DTGH 3RWGB 3C6SA 2F5AL 4P5MB 3LKOB 4RWYH 4WFGD 2HJFB 4EI5C 1MF2L 1F8TL 1U3HA 1ZLVH 2DQJH 2R0ZL 4YBHA 5I1LA 3CSPA 1YUHB 4GW1A 1TETH 4P9HL 1WWCA 3L95B 5E8OA 4KVNH 1CE1L 5F93C 1M7XA 4EOWH 4KKAC 3MNWA 4RSVA 3KPNB 1OP9A 5D7SL 1JPTL 1MQKH 1IC1A 2V5YA 4J2XA 4ZAKB 2ZZUT 2GFBA 1U8LB 4FQ1L 2BK8A 3L9RA 3GSUB 4X9BA 2ZOKA 3VGFA 1CTNA 3EOAB 1BD2D 2Z8WC 4ONFH 5IHUL 4JHWL 4QKXB 3MRCA 3VXPA 3OKDB 5EOQH 4OFKA 1VENA 5TDOB 3VMNA 2YK1L 5FV1L 1JI2A 3I9GH 5EU3B 1P2CA 1K8IB 3U36A 2B8OT 3QRGL 3LEXB 4NQEE 4WFED 4UV7L 1RK1B 3JWOH 4HEME 1SEBB 2Y06H 3OKKB 4U6XA 2G75A 1BM3L 1YPZA 1JJUA 5I17B 3E6HA 4Y2DD 1H0DB 3NIFF 3QNZA 3OV6A 5BW7C 5EFIB 5CBEA 1WWAX 2X4NA 3T0EC 3O6FD 3L3HB 4XPGH 4JO4L 1KGCE 4H8WH 1FBIL 1K3ZA 3UC0L 4FQHA 3T0AA 3Q1SL 5DMIL 5F1NB 4PS4L 2OXGA 1DBKH 5MERB 1KB9J 2BNQA 2DIBA 3H42L 1OP5K 1F3DJ 4JQXC 1DVFC 4QRQA 2DI9A 4QRPE 4NYLB 4JY6A 4PLNC 3BD4A 12E8H 3LPWA 1XR9A 3RUGA 5DJ6A 3NIFE 2OP4L 4OT1L 4DKAA 2DMBA 3ILPB 2A6DA 3LCYA 3D9AH 1P4BH 1U8OA 2UWEB 1EDQA 1D6VH 3T8XA 3V5KA 1O7SA 3RDTA 1HHKB 4UQ3A 4CUCA 2XKSA 3NMEA 2JB5H 1FFQA 3GRWH 2GJ6D 3CSGA 1JGEB 2NXZD 3LEVH 1MOEA 2OI9C 4GH7B 5T1MA 2R23B 1INQB 2OK0H 4C83B 3B3IA 1EEYA 3MLUL 3J8F7 1FLTX 2BP3A 2L7JA 3LHPH 3MA7B 3IJSB 4C56A 1JZ4A 2D9QB 1T21B 3M8OH 1CDCA 1MWAH 4HXBH 5FKPA 5DR5H 3MTRA 4F80A 1ULVA 4XCNB 4QTHB 4IMLA 4OGYL 1OSZA 3QIBA 1ND0A 4RIRB 4P2RA 5JW4Q 2PR4H 3SKOB 1BJ1J 3OKOA 4TSCH 4QGYA 5KSAD 1FH5H 4YHKL 2BSSA 1HOCB 4Y4HA 4XC1H 5E70A 4OQTA 4M7LT 1JFQH 4KDTC 4KROB 1DQLH 3MFFA 2X4SA 3M07A 1ED3B 4PB0L 3CSYA 4MA3A 3VFVA 1F6AB 5TE6H 5IESL 4S10A 1VGEL 3G08A 1YMHB 4FQLL 3SQOH 3CXHK 5I1IL 3ETBF 5DHVA 4IRJC 3MODL 1AGDA 3O3DB 1ZA6B 3PGFH 4H1LB 2WBWB 3IFLL 3I3EA 1JMXA 2I5YL 4HK0B 2DWDA 2ZUXA 1S5IH 4MXQD 1P84J 5ECJE 3TPUA 3VA6A 4GLRH 4PRHE 3BYTA 4HG4K 4MXVF 3WE6B 1EO8H 1GGIH 4NJ9L 4BFGA 1G9EA 2UZYB 4OFYD 5FYJL 2HVKB 2J4WL 5ALBH 5L8LB 1FNEA 3NFNA 1E4XI 3L7EA 1A22B 5TPWL 2X4TB 4I4WA 4ZTPH 2NY6D 3SDDA 1M7DB 3IFOB 3ULUE 4FQIH 5SWZA 3LS4H 4RA3A 5JXAL 3SJVE 2IBZX 5D96B 2FEDD 4L3AA 4MDIB 5BMFL 4P9ML 4PYGA 1QFPA 4ODXA 1T66D 1CWVA 3UZEA 2CK0L 2J8OA 1IEBB 1KTKE 3MRRA 32C2B 4ZSOB 4GMSL 5EUOB 4X5WA 2W9EL 4NQSB 3UJIL 5EIIA 4ONHA 4JFXA 1HI6A 3CVIH 1QA9B 1OAKL 2B4CH 1JVKA 3PXJA 3DXAB 3QDGB 3DTXA 2CKNA 1UKTA 3MXVL 4WI6A 1OSPH 3QUXC 4H0IA 1I1AC 4DZBA 2CIKA 4NP4H 3RWDB 3O0RH 4JFDA 4XRCA 3ARDD 1LO4L 4OZIB 4QXTA 2VDLL 3MRGB 1H8OA 4WFGE 3D2UA 5CS7A 1OM3H 3QI9C 2V2XA 1IGIH 4R0LB 3H0TA 4N0CD 4ZAKD 4N68A 2IQ9H 2VE6A 2BVOA 3PJSB 1U8JB 1XGRA 4LHQB 5KSBB 3S35X 1AE6H 1VSCA 4EQ2A 1AQKL 2X89D 2J2ZA 4I48A 4CW1B 4X9GA 4AEIL 5JORA 4DQOL 1K4DB 4X6CA 5C0DA 3SN6N 4J3OC 2X4PB 1EHAA 4WRLA 4MDJB 2IPTH 2Y6SD 3V4PL 2ZSWB 4YXHH 5IVXB 1SJEA 3MZTA 2A9MH 2DQCH 4ETYA 3ARBC 1D5IL 1KPUB 1AHWA 3DSFL 2VXQH 1BD2E 1DQDL 2VABA 3MUY1 3KPQB 4PJBE 4JG0L 1TJHH 1ZGLB 3DRTA 3PDDA 3QQ9D 4Q9QL 1HKLH 4MB4A 3ZSSA 1RUKH 4OIBA 1GGYA 4Y2OA 1CR9H 4BFIA 3QWRD 3RJDA 2O5YL 1DBAL 5BZDB 3I6KA 2D3VA 5H37G 3EHBD 4WFEE 1NAKH 3Q6FB 2JCCB 4JDTH 4ZYKB 5JW4M 3UDWC 4Z7OF 5E00A 5HJ3A 3U7YL 7FABL 1V7ML 1DQJB 3QNXB 5CZXD 3DUSB 3PWPA 4WW1B 1WBZA 4FG6D 2OR8A 3VXMD 4CU8A 5CP3H 2DQTL 3RGVB 2C5DC 3NA9H 1ZS8A 4MAUH 4XNQA 3RVWD 1X5YA 1XH3B 1FNGB 1RZFH 2Q1EA 1YEHL 4TN9A 4M7JL 4TVPD 5AYQA 1D5BB 3WJLC 1JWSB 4P5KA 3I6LE 4Z7VB 1MIEH 4W81A 4G6FB 4XTRC 3FB5B 2JJWA 3VXUA 1OAXL 3MUZ1 3OXRB 1XCQA 3MGTA 1NL0L 2FYYB 5T3ZH 3A0OA 4JO2L 4NKIH 5E1AA 4PJDE 4ERSH 4KK9C 1K6QH 1G9MH 1I3GH 4LOUC 4EKXA 3BJ91 3I75A 3P30H 4MX7A 3CGTA 4H26A 2Y5TB 4NO2B 3REVB 3KYMB 4MXWH 4ZXBA 3WV0A 3SE4A 1Q0XL 1QBLH 1CFVL 1IC4H 3V52H 3BKYH 4JRXA 3QXDA 4J1UA 4TTGA 4PRAA 4WO4C 4ZDHA 4N0RA 3HN3A 3TBYB 2IANA 1SBSL 1L7TL 1ZVHA 3DV6B 5CINL 2BZDA 3LQMA 1A5FL 5JDSA 3V9FA 3DI2B 1XGPB 1IMHC 4KH2A 1NGYB 4FABL 4M43H 1IGTB 2WIIA 4YC2C 5D1ZA 4LAQH 5DGQA 5JXEC 5F7UA 4Y4KB 1EXUA 2XG5A 3MRLB 3ARED 3BKJL 4G80A 5HYSB 1NLBH 1EGJL 5HYFA 4KROD 1A7PH 1N0LA 4UIKL 2HG5A 4PJHF 5F97E 5I71C 2AXGB 2YRPA 5JOFA 3GO1H 4NO3B 4B41A 4MQ7A 1JGUL 3RL2A 3ZE1F 5DQJA 3VH8B 3CFJB 3SE8L 4K2UH 4RFOL 1MAML 1FSKB 4OCNC 5EUKA 3PHOA 2AKRB 2XWJA 3CMOH 2WQ8A 2H41A 3R06A 2WP3O 2AV1B 4JO3L 3MV7B 2W65A 1B0RA 5D9SB 1MCNA 5E8NA 3GNML 3C2SA 4OD1L 5HGHA 3VXNA 4P4KC 1ZKAA 2C9AA 4PJHE 1F45A 5FHBH 4Z76B 3NFPB 2XNAA 4JPVL 1JHKH 2QQKH 2Q3AA 2JK5B 1J9CT 3ZE1E 1IC5L 5F89B 2F74A 2MKWA 2YEZA 4JPWL 1YDPA 3TH2T 1CDBA 4FXGB 1LE5A 4GLRI 1YNLL 4LSPL 5E2UL 3HZMB 3O6MH 1SBBA 2DDQL 4JM2F 4TUKL 3KPOB 3EJZD 1S7VB 4R7NB 2FD6L 3QDJA 1NGQL 4X6DB 2R1XA 1NUGA 1OAZH 5LAXA 5GGSB 4I2XA 4PJFB 4HWZB 4U1HB 3MJ8B 4FZ8L 2Q3ZA 4G8IB 2FZ3B 5GIRB 1EVTC 3RWJB 2HN7B 2DTML 2Z8VC 2WINA 3QDGD 3LZFH 4MAYB 5TGBA 4WEBH 5I1AB 1H3XA 3V6BR 2O5ZH 4W6YB 5HBBA 4H88L 5KVEL 2X05A 1S5HA 2EDJA 2VNCA 1U95A 4GAJH 1ZVSA 2PYEB 2X2YA 3VFUA 2GSGA 1OD9A 2MCG1 3ULVH 3VE0B 4I3RL 2Q86B 3B9EA 3FKUS 1LNUA 4D9LH 1Y6KR 2A9NH 4S1RH 2NW2B 3MLWH 2GTWA 2MCPL 4PLKD 1VERA 4YXLH 1QSFD 3KHOA 4NSKA 5BJTB 4ONGH 4M7ZC 1YEJL 4GKNA 2NX5D 3DO3A 4GUPB 2RJMA 2X4RA 3W0WB 4PPTA 1KIPB 2HTLD 4U1JA 2CD0A 5E0QA 3WSQL 2E5EA 4POZD 1TDQA 4OIAA 2IALA 3TJEL 3ARFD 2YPLB 4PRBB 3X14A 5T33L 2EEBA 5MP6H 5HHPA 3F7QA 4BELD 1EA9C 4XB7A 3KPSB 3FQTB 3VG9B 2FR4A 4OF3A 2H2SD 1LE9B 4M02A 3FQUA 3PGCA 4EUPG 4Y19B 2D0GA 3VXSB 1CXKA 5F9OL 1O7VA 4PR5B 1AGFA 3K81A 4PP2A 5CBAB 4XNXL 2OQJB 4S2SB 1VFBB 4JJ5A 1OWWA 1Q9OA 4HX1A 4J3XA 3RPIB 4BM7A 1S9WA 2Y07H 3VMOA 1GHFH 3QCUH 4YO0A 4P23C 5E8PA 3NACH 1WISA 1IKFL 2WLYA 3LN9A 1MCDA 1WZ1L 5J56B 3RGVD 3UBXA 4LLQB 2ZCHL 2MQ0A 1S9KC 1ACYL 3EGSB 3TNMA 5FDWA 2UWEF 2APXA 4LCUA 1KCSH 2NZ9C 4GXUM 3DURB 4S1QH 4OZGB 1BHGA 2HYMA 4G6FD 3AM8C 3HE7D 1T1WB 2Z35A 5BV7L 2VISB 3VXME 1HDMB 2N56A 5H37H 3WIFB 2NW3A 4LRNH 4NRYB 3B9KD 5DD1L 1IJ9A 5CZVH 4A6YH 1EBPA 4LCIH 1AC6A 5H2BA 5I18L 1ZWIA 1WJ3A 3DYMA 2CLVB 4JREB 5ADOH 4JLRA 4WTWA 5ITFA 2UWEE 2VERN 3QUYA 5EULV 3ZDZF 5D6CB 5J6GB 3P2TA 1EGJA 5ERWB 3FB8B 4WFHD 1KCLA 1GZQB 4U6VL 5E2VL 4EI5B 5AG8A 4I3SH 3QFDB 2KUTA 1YZZA 3GSNL 1DLFH 1FVDA 2R1YA 3EOTL 1NCNA 4H0HB 1CGTA 1RZJL 3T4AB 3ESUF 4FXKB 4K3EH 4G3YL 1S7WB 4DJMA 3GIVB 2ZUQC 2NY1C 2R29H 3VFMA 1DQTA 3HG1B 1INEL 2BOBB 1P4IL 1N6QL 2EC9U 5IW1A 5IR1B 1T0PB 3DGGB 2X9XA 4EN3D 4Y4KD 4DN4L 4JZJC 4MMXC 3DGCR 3E3QC 4GG8B 3GEWB 2VAAB 3IDUA 4PJ8C 3QUZA 2F5BL 1KB5B 2GK0A 3ALXA 4Q58C 4RGMC 2NNAB 4YHZH 1T0MB 5IBLC 2FL5B 3SBWC 1D5MB 4KUZH 4G6AD 3I50L 2AK1H 3HNSL 5KOMC 4OCXH 4NBYB 1MLCA 3IDXH 2V7HB 1DBJH 3EFFB 2BSTA 3OPZH 2Z31A 1I8KA 1KJ2B 5D2NC 4Z7NF 4YR6B 4TULH 3FRPA 1OPGL 4ZUWB 3B6SA 2RAMA 3FTGB 3MV7D 1QFUH 2X4UA 5GSVB 4YZFF 5B4MD 5BOPA 3ZKMD 4NO5A 3BPLC 4M1GH 4NUGH 3OR7B 5TE4L 5GS1B 1ZEAL 2EE2A 3T77B 4OCYH 4XBPA 1S7XA 1OTTD 2MKLC 5ANMB 1ZGLP 3LN4B 1IQWH 2W9DL 3HC4L 1J05A 1VEMA 2GCYA 2Y4SA 4KQ3H 5TDPB 2PCPA 1A1NB 2IG2L 4IOIA 4QWWD 2EDFA 3DMMB 5AWNH 4Z7NE 4DAGH 1NAMH 4M03A 5CFHA 4WEMB 5EUOF 1JYXA 1I85C 2P8MB 5IIEB 1HZHL 1Z5LB 1J1OH 2XN9B 3P9LA 4MB3A 1WICA 5HPMA 1FV1B 1A1OA 2OCFD 3R0MA 4OUUB 4CVZA 4OZIF 4POYA 1JIBA 2VDKL 1QRNA 3ISWA 1X5KA 1QR4A 5IMOA 4QF1B 1INDL 2QQLH 3Q6GH 5FUCE 2ILLA 1SJVA 4ZSOE 1OGTB 5KSBF 5IHZA 4PRIA 3EDJA 3MJ6A 5JHDA 3OKLA 1DL7H 3BEWA 4FQJH 2O26U 3MGOA 5AG9A 4JN1H 1JL8A 1MCLA 4J3VA 2O61A 4WW2B 3QDGE 4LF3B 2Q8BL 2X70A 4D8PB 4UTBL 1KPVB 4R9HA 4YDIH 3I3BA 2H9GB 2X1OA 5IVXF 5ISZA 1EAPB 1XEDA 4KDWA 4OZIE 1I8MB 2GI7A 3EIFA 5GZND 4WVRA 4UT9L 3W0WD 1U8MB 3BE1H 4LSTH 5DHYA 2P4AB 1FHGA 4EXKA 4NRZB 1A47A 3QG6A 2FATH 5KSBE 5LXGH 1UWXK 1HCFX 2J1KA 3GMMA 4AM0B 1QSFE 1M05B 3BN9D 4UB0H 4BYHA 4JZOB 1T0NB 2BERA 4XWGH 2WP3T 3KPSD 3MRQB 2WBJA 3SDXA 3RPKA 3ES6B 4U1SA 2NX5E 2JCCF 4Y19D 1HSAA 3VXSD 1CL7H 4YDKH 2AEWA 4Y88A 4K3GA 5L6YL 5DRXA 3C8KB 3CH8A 4DGVH 2EDDA 2HFEB 4NFBA 3A6BH 4HS3B 4PJAB 3TV3H 1WLHA 4X6EA 2B2XL 2ESVB 2EO1A 3RTQB 1LGVA 4NKOA 5DD0L 1GC1C 3PWUB 2LAAA 1X7QB 4HIEB 4X0KB 1BVLA 4Z7VF 4WGVB 3U6RB 3QA3B 4PLJC 1CD1A 1MWAB 5IROC 1CICD 5C2BL 5EORL 2JCCE 2E27H 4R7DB 3RHWK 4O2CA 2IQAA 2HVJA 1NC4A 3TYGH 3OG4B 3V8CA 3GSNA 4U7SA 1H5BC 2NCMA 4Z7QF 2C3VA 3VWJD 1LO5B 3DROB 4LBEA 4NQCA 5AZEL 4K55A 1YN6B 1G9NL 3WXVL 2D2OA 2AJXL 4GBXC 1TVBB 2RR3A 3HPLA 4GT7A 2F19H 4IIQB 4L1DA 3BVNA 5JZ7D 4WDIB 5CJBA 1ES0A 2YS4A 4MCZB 5F7DA 3S98A 4XX1G 4CVXB 1DSFH 3B5HA 3GSOB 1LO2L 4EI5D 4Z7QE 5CEZD 5J8OA 2AJYH 5J13B 1W72H 2XWBA 1T03H 5HGGS 3WYRA 3LKSB 3NCBB 1IZJA 4N9GB 4ZS6C 1BEYL 3EUUA 2X4QA 5AEAA 2XPGB 1I1FB 3TVMC 2HKHH 3P9MB 3JTSA 1HINH 3MRMA 4MJIA 4OCRL 4PGBB 5C0AA 3UO1H 3VXTA 3WFCH 1MCJA 1RURL 5J12C 4WFHE 2F53B 5IEHB 1UM5L 5IW6B 2LVCA 1R0AL 2BX5A 4G7VL 3QI9B 3BPNC 5L2JA 2OX5A 1A4KB 3D3VA 1IEHA 4F7TA 1IGML 3TCXA 1MHCA 3JXAA 4AENA 5JIPA 5DRWA 4HKZA 2IMNA 5GJTH 3VFGH 1MRDL 3MRFB 3MO1B 5L8KB 4L29A 3MJ7B 1KJMB 4AL8H 1DQML 3L7FB 3REWB 3B8SA 1U0QA 4KFZC 2NY4B 1RJLB 3OF6A 1UQSB 5LCVH 3LKPB 2AVGA 1UYWL 5HSFA 4WWKC 1KNOA 3ALPA 4MNGB 4JFQA 1WV7T 1PKOA 1IFHL 1BBDL 4UT6H 5DVMA 3WLWC 4F58H 1KJ3H 2FB4L 1AD0A 1JV5A 4EBQL 3OAYK 3GIZL 3KXFD 1J1XH 2Z92B 4OSUL 2YUZA 1TJGL 3DMMD 4X6DF 4M62H 4P46A 2KH2B 3W81A 1DVFD 1MHEB 3W5NA 3KYOB 1AI1H 3G5VB 1TFHA 4PJFF 2VDML 4CMMA 3T0DA 5JNYA 1M7IB 5F1KC 1N59B 1ZLVK 1F3RB 1FGNH 3QJHB 1I7RB 1HSBA 5DYOA 3C5ZB 3TFKC 2X10A 1DBMH 3QEQB 4V2CB 3GSWA 3HZVB 4P4RB 1P84K 3RWCA 1I8IA 4X6DE 4DW2H 1AD9A 1FG2A 3ZYOA 3B2VH 3UEZA 3C09C 3CFKA 1MI5B 1WCBB 2YD8A 1QFWM 2V7NB 4U1MB 1UKSA 3KLHC 5E6IB 4PFEA 5DI8B 1RIHL 2XWTA 2MJWA 2NY3C 4N5ED 5BVJA 5IJVB 1I9JL 5HHQA 4KTDL 4HPOH 2DAVA 3O6KH 3P3YA 5ESAA 2B1AL 2X40A 2OJEA 4XMLH 1IGYB 2VLKA 5EBGA 2E6QA 4XGZA 3GMLB 3RZWA 5BS0E 5LGJA 3BGAA 2JB6A 4UINL 3QEUB 3KPTA 4NIKB 1NGZB 3E2HC 4E0RA 2VUYA 1CFQB 2WM0A 1CCZA 1K3IA 4U1KB 1UWGL 2EE3A 1LK2B 3LKOA 3UTPD 1CTOA 3W0WE 4U0RB 2GITB 5L2KA 1PBYA 3ZL4L 4ZFGL 4HXAL 1YUHA 3BD5A 2I60H 4FA8A 3EO0B 3NPSB 5DEGB 2N7AA 4P99A 1RZKC 2PW1A 3LB6D 4EEEA 3BAEH 3CXDL 3L5XL 3FCTB 4PJEA 2GHWB 4X80H 3PWJB 4X4YB 4UI2A 3KPSE 3KLAB 2ESVD 4HK3N 3S3JA 3UTTD 4GMTH 3FO0L 5T3XL 5DMGD 3SOBH 3ZLQC 5A2JH 3F7RA 4OZGF 4Y19E 1CL7I 5E2TH 4X9FA 5HI4C 4MWFA 3VXSE 5FOBB 4F33B 5FK9A 1U8LA 5I19L 3GSUA 3WIIL 4AEHH 1A7QH 4OZ4B 2Q7NA 4A2LA 3DYOA 5TDOA 1BFOB 2D4FA 4DVBA 4PGCB 3CVHL 3WO4B 2QBWA 2NXYB 4RGOL 3VI3E 2JJSC 2EEAA 1EEZB 3ROLB 5CEXB 3MOAH 3LEXA 1JZ5A 3CFDB 1KCVL 4NN7C 4H0GA 4DGYH 5A3ID 5HTSA 3AROA 3C8DA 3S37L 4YE4H 1OT2A 4YFEA 3FO2A 4JKLA 3H8NA 5C6WH 2OXHA 2VDPH 4TSAL 5C0CA 3WN5C 1IAIM 1JZ6A 3QPQC 4J4PC 3H6JA 3ZKNC 1K8DA 2XT1B 1BOGB 3MRJB 4YDLB 4FFZL 4Y8AA 5FYKD 4PJ9C 1S78C 4WV1C 2J6EH 1I8LC 3HUJE 4HC1H 5MERA 3WJJC 4X6BA 5A2LH 2QV2A 2ZNWA 3FN9A 1HIML 4YDJA 4NJAH 4WUUB 1GXEA 4NQDA 1R24B 2F8VA 3HC3H 4HJJH 4I3GA 4N8VG 5B3JE 1ZTXL 4H25B 5JO5B 5CEZE 3QI9D 1ZLUH 3TZVC 3MNVA 4JFHD 4PG9A 4NGHL 5D7IE 2W0PA 1CF8L 1E6OH 1VFMA 4Q6IA 5C09A 1R3KB 4LHUG 4L5FH 4ZFZA 3VXRA 5I30H 2XRAL 5F9AC 1HHKA 3PWNA 2R4RH 1EFQA 3PL6B 4ZNEA 5KVFL 4O02L 1IGFH 5DRNA 1DLHB 2OTPA 3OXSB 5GXBB 1F58L 3EO1A 3TBVA 5IVZB 5GGUB 1BVKA 4XC3H 3RNKA 1FCGA 2B0SL 2NY4D 4WFFD 4C83A 1A6VL 3JWDL 3ARWA 2IAMC 3DVNB 3KGRA 4N90E 4XBEH 43C9A 3SDCC 2P5WB 1JZ8A 4M61B 1S8DB 5EOTA 1NBZB 3UYRH 5DK2B 4WJ5B 4RMUA 4PV8A 5DJAB 2D0HA 5CUSL 4QTHA 4QCIB 1MJ8L 2HJLB 2VDNL 1T3FB 4NN5C 1PAMA 4U6YB 4U0QB 4M48H 2G5RA 5FCUL 1UWEH 2VDQL 4RQQB 2IJ0C 3VG0L 1UCTA 2DMKA 3T0EE 1YEKH 4BSWB 1JNLH 5IJKC 5ANME 5I8OH 1MFBH 4NUJB 3QO0B 1G6RA 1HE7A 1A9EA 2CJUH 4KTEH 3BZ4B 4XTRD 3HB3C 3KXFE 5C8JA 1MHPH 1B4JH 1YMHA 1NKRA 4L8DA 2XQBL 3P0YL 5DJ0B 4Y5XA 2Q8AH 3EZ8A 3JV6B 3NFSH 4KK9D 5TQ2H 1NC2A 4MB5A 3CFCL 5DJXA 3QDME 4ETQB 4M6AA 4WI2A 3IXAB 1BLNB 4M1DL 4OQTH 4WW2F 1OT1A 3U0WL 5HHVL 4AMKH 4K23L 2LV4A 2MHAA 3D87B 5E6ID 4K8RL 5J11B 3DX9B 2MPAH 1TJIL 5IB2B 4ZUTA 4M6NL 4HJGB 4KV5E 2HVKA 1Q0YH 1ZT1B 4JHAH 4WO4D 3W9DB 4QNPF 3FMGL 1OAYH 3D0LB 2FX7H 1IRAY 2X4TA 4M7LH 2CGRL 2R8SH 1KLGA 3RZCC 1IGJB 4LK4A 2X9YA 1QUNA 4HUXA 5I1JL 1J8HB 3MCLH 5LJYH 1ACZA 1OP3K 3BIAX 4G6JH 2ENSA 1FGVH 4OCLC 1T4KA 4MDIA 2R2EB 3QPXH 1RUPH 2DQIL 3ARXA 4HIIA 1NFDB 2X09A 4I18B 4YHOH 5FB8B 1AR2A 3BW9B 3JUYA 5CSZB 4LIQL 4RFNB 4A6YB 1FORH 5ADPL 5IFHL 1G7QB 2BVEA 3GI9L 4QNPE 1V3MA 4PJAF 1QA9A 4X7CC 4JR9L 3CVHA 4LLVB 1YEGH 4XP5H 1J87A 5SWQA 1LDPL 3KJ6H 4UZGA 4HGWB 4ORGA 2ADIA 1KBGH 1MEXH 3RVTC 3UTPE 3MRGA 5KN5B 5D2NB 3WFDH 2DM4A 5IM7B 1OB1B 4U49A 1GIGL 2EIZB 3VGAC 3PABA 5HI5C 4JFYB 4IRSA 5CJXA 5DK0B 2AEPL 1C5BH 4P4KD 2P5EA 5F1IB 4OGXL 4ZG1A 5BRZE 1F13A 2D03L 3D25A 4PJAE 3GGWB 1Q94A 5GPRA 4DGIL 3F12B 1DUYB 2XFXB 2B39A 3QRGH 4OZHE 2ESVE 5DLML 5SX4H 4HKBA 3UTTE 2X4PA 1NCDL 1VKXB 2NXYD 5F6IC 2ZSWA 4MNHB 5FGSA 5FYLD 1GCFA 1OARH 4NCC1 2AV7B 4P9HC 1ZLSL 4QEGA 3STZB 1H3PH 1WFNA 3ZTNL 2N1KA 1RJCA 2GY5A 5DD6B 5DMYA 1MCIA 4XBGB 1MFAL 3SO5A 2VMFA 5EO1B 4KJYB 1TTUA 5ICXB 3DIFB 3W2DL 4JQIL 1EJOL 4BQ8A 3QAZC 3BPCB 3UBXG 5CCKH 3O2WL 3EDKA 4WW1A 3AXLB 3ECBB 4RAUA 5MI0C 4KZEL 2YA0A 5F7YC 1YEIH 4HZLA 1OVZA 1B88A 1UC6A 2OTWA 4OT1H 5GS2D 5TE7H 3U30C 1ADQL 1XH3A 3FAWA 1NFIB 3LN5B 2YN3A 2ICWB 4CDGC 5DO2C 1IAKB 3FB5A 4E5XA 4D0BB 1IQDB 4WI4A 4WHDA 4FQQB 1A6PA 4ODHH 5E8DH 1PLGL 3TO4A 5DC4B 4D0DB 1NAMB 5D1XB 4NQXB 4P2CG 5EZJA 4L9DA 1I4FA 3G5XB 3PL6D 3N1GC 4BJLA 3SDAB 3REVA 5T1LA 2VQ1A 4JFHE 5GQBA 3IETA 4XH2A 3N85L 4JFED 3JTTB 3KWWB 1K2DB 3UTZB 2G2RB 3NAAL 3P0VL 3SGKA 2DIJA 1XCTA 4W68A 4HF5L 3BOVA 2P5WD 3RBGA 4OGYH 1AGCA 4F37F 3WIHL 3QIWC 3DV6A 1BJMA 2R2BB 1F6FB 1B6UA 4P23D 2OTUB 2XQYK 4WFFE 4FQXB 1BVZA 4OLXH 4HZAA 4PRDB 1S9YA 3JVGA 4MLSA 1WT5A 3D69B 3HS0A 4L8CB 5FHAL 1F4YH 5FUZH 4XZUB 3MUGA 5HYQB 2JJTC 5CJQL 1FRGL 2IFGA 2NZ9D 3AS1A 3CUPB 4U33A 2PO6A 4GRWH 2UY7A 2BRRH 4KWUA 4UT7L 3MXWH 3EYUL 2VITB 2YD4A 1T20B 3D85A 1PZ5B 1XIWC 3STLA 2A0LC 4PJ5B 1JK8A 1AXIB 5AD0B 1E4XL 2DQHH 3MCKB 3CFJA 3SY0B 4CN4A 3RWFB 3FRPG 4CADB 3IF1B 3PHQB 1JRHH 5GGQL 3O4LA 2C1OB 5LVEA 2EDYA 3WHE1 5D8JH 4NNYA 1RZ8A 1L4IA 2EXYC 4XNMB 4KI5C 5FEBA 5MEND 1YJDH 2VL5B 4L1HA 4LPYA 4PGZA 4YDVB 2CIIB 2K9UA 3LIZL 4FNLL 3CZFB 1S9VB 3HC0B 1NCWH 2XA8L 4ZXBC 2FSEB 4Z76A 5I73B 3PP4L 3PQYB 1UZ8B 3VFOA 3ZE0E 3V0WL 2JK5A 4Q0XH 4UV4H 3WXWH 5F89A 2GYSA 3C2AL 5J89A 2EDLA 4HUVA 3GK8L 4JZNB 3TA3A 3MUJA 4F9PC 1LO3L 5DJCB 3BP7A 3LH2L 3FQXB 5DMJB 3HZMA 2FJGA 2R9HC 4DTGL 1MUJB 2IH1B 1J8HD 4RWYL 3L3GA 1HXMB 4Z8FH 4XPAH 4AZ8A 5C07B 4EUPB 2DQJL 5BZWB 1U8PB 4O58H 1ZGLM 1NEZA 4GRLC 1TXKA 1TETL 4NKQB 3RWIA 2OZ4A 4KVNL 5GGSA 5HVGB 4PJ8D 1OAKH 1LEIB 4EOWL 1TMCB 4LEOB 4HWZA 4U1HA 2F15A 5FKAA 1FNFA 4CGTA 2FZ3A 3HRZA 3NCCB 3RWJA 2HN7A 1KUMA 1MQKL 1BZ7B 2MOVA 4YHIB 2O5XH 4LDOB 3T3MF 4MAYA 3WDHA 5I1AA 1X5LA 5CIPH 5JMRA 5DSCB 1JWUB 1YY8A 4NZDA 4XCEA 4YWGH 5J6HB 3BXNB 3EYOB 1OW0A 3Q48A 2PYEA 4ONFL 3KAAA 4XNZC 3IXTA 3SEPA 1W72B 2V5TA 5EOQL 5DURB 3VE0A 2Q86A 1HQRB 2AGJH 3K4DA 5JMOC 1EHNA 3EO9H 3I9GL 5F9JB 4D9QD 4AEFA 4PV9A 4Z0BH 4HIHB 1YNTB 4HDIA 3T3ME 4Z7WE 3ZO0A 2Y06L 3U79A 5IK3B 3T0VA 3WNMA 4D2NA 5B8CB 3BP6A 1KIPA 1J1PH 2H8PA 2BY2A 2VL4A 3LY6A 1JP5A 1ORSB 4Y5VB 1QLEH 2V9TA 4XPGL 4H8WL 5I6XB 3FQTA 1T1XB 4OAWA 5SX4I 2I27N 1DBKL 4BA8A 4GG6E 2VXVH 5GGVY 5CBAA 3CZJA 2NY0C 5FYLE 2OS7A 2J8UA 3ULSB 2PXYA 1VFBA 2I26N 5D7JB 2ATPB 4NFCA 4X5XB 12E8L 1KYOJ 2AAVA 3MV8A 3G6JB 3S96A 5EZIH 1VFAB 4NM8H 3BIKB 3D18A 4L4TB 3LRHA 3ZKSD 3LQZA 5EWIH 1U58A 3U4BH 1LEGB 4LLQA 3D9AL 1P4BL 1QSEB 1D6VL 4QGTA 3QULB 1OAXH 3GMNB 1JN6A 4HIXH 3MRKB 5F7MC 4BSVA 1X6LA 4DK3A 3QIUA 1BF8A 2P42B 4Q7DA 4PREA 2JB5L 3VJ6B 4BFEA 3C60C 1EFXA 3WIHA 1OGAA 3GRWL 4PGDB 3CDFA 3LEVL 1DEEB 5A2KH 2OK0L 5DFTA 1Q0XH 2FNBA 1XF2B 4AQ1B 3SDAD 2IFFH 1IL1B 1T83C 1YMMD 1QYGL 2QLVB 1X4XA 1B6DA 3LHPL 3MZGB 2DWEB 3M1BB 3FT4B 5D6CA 1KCRH 3M8OL 5JOPD 3T1FB 2VLJA 1MWAL 4HXBL 5DR5L 3S36H 1PW3A 1LP9E 3ULVF 5IV2B 4MS8C 5D2LA 1CG9B 5ITBH 2PR4L 2RCSH 3D39B 3NTCH 2HMIC 4JHBA 4TSCL 3T4AA 4FXKA 1FH5L 1OAUH 3GIVA 1K85A 4JFEE 4XC1L 3HG1A 2BOBA 3FQRB 5E7BA 4FQXD 1JFQL 1J0JA 2YA1A 2KPNA 4UOJA 4KRPB 1QO3A 3QNYA 3B83A 2CXKA 2EECA 4UMGA 4PLJD 1EV2E 2VAAA 3P77A 3PGFL 4PG2A 1JGUH 4TQEH 1T0MA 4F7PB 4PJ5D 2YOCA 4Y16A 1D5MA 4YBLC 1S5IL 2P8PA 5DA4A 4JHZA 3MUHL 1RJZB 3QHZH 1TTGA 3F7YB 2V7HA 3EFFA 1OQOA 1EO8L 1GGIL 4QRPA 2VXTL 3GNMH 4GBXD 1UXSB 2A73B 4JFFB 3V5DA 3IAQA 5ALBL 2EYRB 2IBGA 3OKMA 5F88B 3OR7A 1CE6B 3T77A 2WLZA 4J3SA 4ZTPL 2VKWA 3PQYD 1JRHI 4FQIL 3NGBB 4FOMA 3LN4A 1TCRA 4N0UE 4XXDB 4MZ3A 3C6SB 5MENE 1CLOH 5BCAA 1C7SA 2WWKO 4M8QA 1U3HB 5F9DC 1Q9WA 1NFDF 4GW1B 1A1MA 5C07D 4Y4FA 3CVIL 1FPTH 2B4CL 2P47B 2E6PA 4O5LH 4G6KH 5DUMH 1Z5LA 3MNWB 1J5OH 2XN9A 1OSPL 4NP4L 2HKFH 1XF5A 4NOBA 3O0RL 3ZYIA 3IRPX 1JGVH 1J8KA 1QNZH 5LBSH 1QBAA 2GFBB 1CGVA 1TZIB 1OM3L 1IGIL 1MNUL 3L9RB 3QUZC 2ZOKB 5B22A 1IT9H 2D7QA 3BP5B 4KJQC 4LSRH 2IQ9L 5ACZA 4JM4H 3HR5A 3OAZH 4C4KT 1AE6L 5A40E 4YK4C 1RIVH 4CJ1A 4TTDC 5GGVH 5DURD 1P2CB 4CAGA 1B9ZA 1UXWA 4WW2A 1AO7A 5IT2H 4ZOEA 4LP5A 4LF3A 4HUUA 4YXHL 5I75B 2A9ML 2DQCL 2G75B 3O9WC 1DE4A 2H9GA 1UZ6F 3KLSA 2H45A 1I8MA 3E6HB 2VXQL 2D7PA 4P5TA 5FM4A 5D2NE 1DQQB 5CBEB 3BRFA 1W0YT 2FJFB 2X4NB 1P53A 4M7KH 4NRZA 3TWCH 1YQVH 1RUKL 5CAYB 3CAFA 4NKDB 3IDMB 3GJFH 4X8JA 1CR9L 4D9QE 1M05A 5EU4A 1NAKL 4R90L 1P6AB 3PWLA 3D6GA 3UJJH 2BNQB 3L5WA 3VU2A 3P11H 1FQ9C 4JY6B 3UYPA 1XZ0A 3TFKD 3GRWA 1XR9B 5T1KA 5D7JD 3C8KA 5IB1A 3NA9L 4MAUL 1JNNH 5DJ6B 3RUGB 4O00A 2HFEA 3OR6A 2H32A 1WZ1H 1RZFL 2A6DB 4HS3A 1U8OB 3U4EB 3TJHD 4L4TD 1ACYH 3T8XB 5IBTL 2CUMA 3V5KB 3ZHKA 2VRAA 1MIEL 3PWUA 2ZKHH 3EJYC 3RDTB 1FO0H 1X7QA 3NCFB 4QRTA 1GC1H 4L4VA 3BH8A 5T3ZL 1F6LL 1MWAA 4EJ1C 4NKIL 4UQ3B 1JPFA 4R7DA 2BNRD 4ERSL 1K6QL 1G9ML 1I3GL 2HA1A 3ZDXF 3P30L 3QBTB 4UNUA 3CSBA 2KQNA 1E27A 4MXWL 1UCBH 2X1PA 3B3IB 5I18H 3QDAA 1EEYB 1YA5A 1QBLL 3O8XC 1UENA 1YN6A 2J7LA 1CGXA 1IC4L 3V52L 5I16B 3H2WA 1FL6A 4C56B 3H9SA 3BDXA 4IIQA 4QRUB 1P7KB 3RWHB 2X41A 5FKPB 3AGVA 1LO0H 4MQXD 5C9JA 4JCMA 3EDFA 4IMLB 4U7MA 1OSZB 5K59F 3QIBB 4C54A 1ND0B 4RMRA 1OP5H 5CEYA 2FH8A 3PNWA 4P2RB 1WK0A 3GSOA 3OKOB 1QPPA 1RI8A 3HAEG 4XNYH 4M43L 3UBXI 2BSSB 4WHYG 1EVUA 2VLLB 4LAQL 3D39D 4Y4HB 1WAAE 1YMME 5IEKB 2WBJC 3MFFB 2P1YA 3G5ZB 2X4SB 2ZCLH 3DVIA 3P9MA 3CSYB 3VFVB 4PGBA 3IDYC 1NLBL 5BV7C 4BZ2H 1A7PL 2F53A 3NVQA 3G08B 5IEHA 2COQA 3IU4L 4PJBA 3O4OB 4KRPD 5DHVB 3TGXA 4F8TA 5K59E 3FZUC 3GO1L 2HFGH 3AB0B 1FNLA 1MELA 4MJ4A 4K2UL 4JKMA 4N8PA 1ERNA 3NZHH 4AIZA 2DWDB 3CMOL 1ZT7B 3IFNH 5DMKA 2DM7A 4J12A 5B39A 4YHLH 4O2EA 3DX8B 3AMLA 4W4OA 4K94H 5DJ8B 3MYJA 1RZJC 1RUMH 1WITA 3REWA 1FNEB 2GIYA 3NFNB 4TPRH 3L7EB 3QXAA 2CDFB 1JHKL 2QQKL 4JFFD 5CILH 2QQQA 5GHWH 1UQSA 1XF1A 3SDDB 4PJ5E 2BOCB 5IMLB 5JOEA 5SWZB 4LVNC 2RFXA 4J4PD 3S88H 3DO7B 1QKZH 3ZKND 5C86A 4D9RD 2CLRB 3O6ML 1CN4A 2UUDK 4Y2DC 1S78D 1QRKA 1ZT4A 1VGKA 2IGFH 1YC7A 2ICWJ 3MRRB 1JUFA 4DEPB 3VD3A 3LKQA 1RUQH 1LMKA 3O6FC 3WFEH 1OAZL 1GRWA 5EIIB 1HI6B 4F15B 1Q72H 4GOSA 3NCEB 4BZ1H 4CDHA 3KYOA 3DTXB 3UPRA 4QRRB 2OR7A 1A7OH 4RNRA 4DZBB 2CIKB 4JFDB 4XRCB 3LZFL 5LGKA 1M7IA 2CRIA 2HWZH 2Z9TA 3UP1A 4QXTB 4WEBL 3OJDB 1N59A 3S3PA 2O5ZL 1D9KA 2KKQA 3H7LA 4HD9A 3D2UB 3C5ZA 2V2XB 3QEQA 3H0TB 5FM5M 3VMPA 1A14L 4GAJL 2BVOB 5KTEL 3ULVL 5C07E 4I48B 2UV3A 4D9LL 5JORB 2A9NL 5C0JA 1KG0A 4GW4B 1PG7H 4S1RL 2V9QA 4TNVK 3MLWL 4X6CB 4XMKH 4FFVC 4YXLL 5C0DB 3GZKA 3FHQA 3BMVA 4MZ2A 4X5LA 4ONGL 1MI5A 1WCBA 2LABA 1SJEB 4P3CH 4RBPK 5F7LB 5KW9H 5GS0D 2OL3A 4HUNB 1WTLA 4WGWB 1AHWB 5D93B 2IAMD 2NXZC 2VABB 5D1QA 4BQ9A 5HVHC 1G0DA 5MP6L 1SEQH 5CWSA 4BFIB 2VKXA 2I9TA 1DANU 3I6KB 2X5PA 5H8DA 4UAOB 2M8XA 2RHEA 1JHLH 5A2IH 4PJCB 5IGXH 2J3SA 2F54A 5E00B 5HJ3B 4OV5A 5CGTA 3R8QA 3DJ9A 1LK2A 2BY3A 3PWPB 4XAKD 5T5NF 2Y07L 2BNQD 1GHFL 1WBZB 3B2UD 3QCUL 3C08H 3NACL 1ZS8B 1G0YR 1F2XK 1UJ3A 3G6JF 4XNQB 3HB3D 4FXLA 3WNOA 5DQ9B 2XZAH 5KSVA 2DLFH 3EO0A 3QO1A 4LCWA 3X17A 4P5KB 4N8VB 1JYWA 4OUOA 3W39A 1KCSL 3ILQD 3VXUB 1M4KA 4KJWC 4S1QL 1RZKH 1XCQB 3KLAA 5C0BB 3V2AR 1B0GA 2YZ8A 2YXFA 2ED7A 5C0GB 4Z0XB 5C2BH 3AAZA 2SEBA 4F33A 1ZLUK 5IG7A 3MROB 1DCLA 5EU6A 3I75B 4LRNL 4MX7B 3CX2A 4OFVA 4A6YL 4S11A 4LCIL 3LOWA 2EYTB 4WTZG 2R56H 4L4TE 2QHRL 3KG5A 4KDVA 4PGCA 2YUVA 5ADOL 2IPUG 2ZSVB 2AJSL 4JRXB 3QXDB 1F4HA 2ZG1A 3HE6A 3NBNA 3BN3B 3RZCD 3IAPA 3K4AA 4PRAB 4C56D 4GRWB 4ZDHB 3O45A 1BP3B 2IANB 2BNRE 1M6OB 2APTA 4I3SL 4HFUH 1FNSH 3X3FH 1IAOB 3SCMB 3GFUA 5I8KH 3NCYP 1DLFL 2NY6C 1SVZA 5FA4A 4DWHA 3QIBD 3LEYH 3Q0HA 4WENB 4K3EL 2WIIB 3BZFB 4P2RD 1DN2A 3ME0A 5D1ZB 4PY8J 1TQCB 1MCQA 4LQFH 3Q5TA 4JM2C 4M3JA 3ABZA 1HHJA 3KYKH 4R6UA 4Y4HD 1XGTB 4G80B 4UUJA 3WKNA 1A3QA 1EH9A 2HG5B 4HIJA 4NZUH 1KEGH 1G0XA 4WUUA 1ZVYA 5JOFB 2EDEA 1R24A 4MQ7B 3RL2B 5DQJB 1TVDA 1NCAH 4YHZL 3MLYH 5C6TH 3D39E 5EUKB 4KUZL 2D0FA 2AK1L 3PHOB 1RAMA 2XWJB 15C8H 3KNBB 2YKLH 3R06B 3IDXL 1DBJL 2C4FT 3OPZL 4ZAKC 2W65B 1B0RB 3CDGA 3HAEH 5GISH 3TPKA 5B38G 4TULL 1MRDH 4WHYH 5HGHB 1QFUL 3GSQB 1W0WB 3RL1A 1DLHA 1UA6H 4ZO8A 4R2GB 4M1GL 4NUGL 1KIQA 2YSSA 5GGUA 1T04B 4OCYL 2Y6SC 4TNWF 4APQA 2YEZB 3ZHDA 2ID5A 1IQWL 3H9YA 3SDDD 1TVHA 4KQ3L 3DVNA 5J3HC 4LRIC 4R26H 5F44A 3AVEA 5AWNL 3QDJB 1FZJB 1ZHLB 1FJ1A 4DAGL 5DJAA 1JGLH 2ZWLT 1NAML 5LAXB 1YEDA 4JFFE 3EHBC 2GQHA 1NGPH 3FQNA 1RMFH 1J1OL 4KY1H 5CZXC 5TGBB 1P5UA 4D9RE 2Y7QA 5KVMC 3QO0A 4JPIB 4L3CA 4JFDD 5DO2D 1S5HB 3BZ4A 5EOCJ 1U95B 4LKCA 4GFTB 2QQLL 3Q6GL 1U2HA 1ZVSB 3D2UD 3U9PH 4XP6H 2Z4QA 5GGRA 1LNUB 4ZTOH 1TZHA 1X5GA 4PGEA 4NHCH 4WI8A 5C0EA 5K9JH 2GTWB 1DL7L 4FQJL 1SM3H 5F1OB 4JN1L 3DBXA 4NKMB 2WBKA 4ETQA 4NSKB 5CD3A 3IXAA 5ID1A 4JVUA 5FGCE 1K4CA 1LVEA 2YD3A 4GKNB 3QQ3A 2X4RB 1G6RH 4YDIL 4KI1A 5TF1H 1CXEA 2DMCA 4U1JB 3DX9A 3BE1L 4LSTL 2R4SH 3E0GA 3RQ3A 5EB9A 2CQVA 4OB5H 3ZKQD 1ZT1A 1NKOA 2FATL 2ZUVA 5LXGL 3D0LA 2VH5H 2MNUA 5FO7B 4UB0L 3AREA 3FQUB 4XWGL 3X13A 4RGNB 5C08B 3IDGA 1MY7A 1AGFB 4N8CH 1NEZG 4PP2B 4L8SA 1WFUA 2ZCKH 5DVLA 3MREB 4IMKC 4JJ5B 4YDKL 1CL7L 1S9WB 4X98A 2V2WB 4YO0B 4I18A 5E8PB 2DLHA 3LSOA 3BW9A 1YPZE 1FYTE 2BHZA 4A6YA 3MBEB 3RUGF 7CGTA 1ZHBA 3UBXB 2RBLA 1MCKA 3A6BL 4JVPA 3TV3L 1G7QA 2VDRH 4MA1B 3TO2B 3P4LA 3SQBA 4POUB 3TNMB 4MQTB 4MJ6A 4LCUB 1NANH 1GGUA 1NDGA 4NZJA 3RX5A 1CDHA 5HHMB 1AIFB 4HEPG 3V79C 1PQZB 3VXUD 4GAYA 5D7LD 4YHPA 2WV3A 2Z35B 5C3LD 2E27L 4XAKE 2BY0A 3U9UB 4OZFG 1OTSC 3TYGL 2LVEA 2UZIH 1GVIA 4G9FA 2EXYD 4KI5D 3DOSA 3K2UH 2VIRA 4LMQI 5GRVK 2CK2A 5H2BB 2XOTA 1T7VA 3Q5OA 1CLCA 3JV0A 2YD5A 4M4RA 4ZXBD 4JLRB 5ITFB 3QUYB 4LCCB 1DUYA 4LPVA 4LARH 2F19L 1I7ZA 3UX9B 1FLRH 1GGCH 4JRXD 3UCRA 4HMEA 1MFNA 3OKYA 4PJGB 4F7EA 1U3JA 2NR6C 2LU4A 2AV7A 3K8LA 2IAND 1DSFL 2Y25A 3AY4A 3FN3A 2AJYL 4W4NA 4JQVA 1W72L 1T03L 3BSZH 1HHIA 4HQQH 4OJFH 4OI7A 3FONA 3VFMB 1KJVA 1KYOK 4GRLD 5E1HB 4JY5H 3WBDA 5IW1B 5D96C 3EJZC 3HMXH 5EO1A 3DX7A 2HKHL 3WS6A 1HINL 3UO1L 1Z9MA 3FB7B 4HUWB 3HZKA 4G6MH 6FABH 1YYMH 1PG7W 2DLGA 3GB7A 5DGRA 2GK0B 5HYJE 4MSWB 5FYJD 3BGFB 4JGUA 5EZLA 1I7TB 3S37X 1T7XA 3LN5A 1MFEH 1IAKA 5GJTL 2Z31B 3G6AB 1I8KB 4D0BA 4G8FB 3VFGL 1FG9C 2JIXA 4MA7L 4LASH 3B6SB 4R0LC 5E4EB 2X4UB 3RU8H 4AL8L 1FAIL 3ARFA 1W0VA 5D1XA 4ZMAT 4XPTH 5I9QB 4PLKC 3G5XA 4EDXA 5LCVL 1U6AL 4R2GD 4XBPB 3QHFH 1N3NA 1S7XB 4GQPH 4UT6L 4F58L 1KJ3L 4IOIB 2APFA 1J1XL 3MR9A 3U46A 4ZFFA 3QDJD 4M62L 1MRFH 5D72H 3NABL 2IEPA 2OTUA 1AI1L 1MCEA 3P9LB 1U8KA 2D4DA 4JGMA 1HEZA 1A1OB 4JB9H 3D69A 2BNUB 4N9OB 4E9LA 1HK6A 3UTQB 3GJEB 3HE7A 5HYQA 1FGNL 1IC7H 3JUZA 1RVFL 1BQHA 1DBML 2K3TA 5IMOB 4Z9KB 3B9KA 1QACA 3RGVC 3ARGB 3I3DA 1WVZA 3VFTB 1LWRA 2VXSH 1Z2KA 2EKSB 4PRIB 5AD0A 4DW2L 4LFHD 3OKLB 3BEWB 3TN0A 3SY0A 3B2VL 3UZVB 3RWFA 4X6CF 2O61B 3T4YB 3K8KA 1OHQA 2X70B 4M1DH 1U3YA 3QDHA 1NFKA 3IS0X 1BFTA 4RMSA 4JFDE 4NDMA 5ISZB 1WQVT 4PJXB 4UTAH 4ODWB 4NO0B 3D0VA 1CFNA 2CIIA 3OMZA 5DHYB 3CZFA 1L7IL 1FAKT 2W07A 3O6KL 3VCLA 5ESQA 2VR4A 2UYLB 4GS7B 4XMLL 3QG6B 1W2KT 5LG1A 3PP3K 3DPBA 1NGWA 2YRZA 4LDEB 3MJ9A 1FO0B 4X6CE 4E41E 3SDXB 3SGKC 4U1SB 3ZKXB 4F9LA 5DJCA 4FP8H 4PJCF 1HSAB 2GUOB 5C2UB 1MUJA 2DQIH 3HNVH 3VFWA 2PYFA 1QLRA 2CDGA 1U8PA 1G7PA 4DUWA 1D6EB 2Y36H 2I60L 3VGBA 4X6EB 1D5ZB 3JVGC 2HAZA 1R3LB 4NKOB 2ADJA 4Y4KC 1PDKA 4X80L 5D7KD 3MOQA 4PTUA 1BVLB 4GMTL 1TTFA 3SOBL 4K8RC 5E2TL 1BWMA 3LD8B 5HHMD 4O2CB 3O6LH 2IQAB 2HVJB 4NPYA 1NC4B 2A6KB 4KI5F 3GSNB 3BXNA 3IDJB 4AEHL 1A7QL 2EDTA 4G6AC 5IQ7L 1W72A 4LBEB 4K71B 4M6OH 1FSKC 2OZ4H 3X12A 43CAB 1HQRA 1GGTA 4HUMB 1H3VA 1I1CA 1NANI 3K0WA 2AS5M 4RA0C 4ZUUA 5T1DL 5DLMH 1UWXH 3HPLB 3MOAL 4DGYL 3QUMH 3VXUE 5B4MC 3BVNB 3QUYD 5D7LE 3VDBA 1ES0B 3EYSH 3ZKMC 4YE4L 5IK3A 2P48B 5CLTA 2A83B 4GRWF 2HLFC 5B8CA 5F7DB 3CCHA 2VDPL 2JELH 4KI5E 4DFIA 3CPLB 1ONQA 3UZQA 1J86A 2XWBB 3QJFA 2QJDA 5JIKA 4HT1H 4Y5VA 4OZFH 2EDKA 3TIDA 2J6EL 4QWWC 3JTSB 3MRMB 4MJIB 5C0AB 3VA2C 4HC1L 3VXTB 1OCWH 2MTPA 5DVOA 4KRLB 1AFVH 4NJAL 3T1WA 4N1HB 2IANE 2LFGA 4HJJL 3G6JA 5L2JB 3FFDA 2YWYA 1X5FA 2CMRH 3D3VB 3QUZD 2CO7B 3TBTA 5BS0A 2EDRA 4F7TB 1YY9D 1LILA 3OKEA 1MHCB 4Z7UB 3QEGH 4AENB 5DWUH 4L5FL 4MAYC 5DRWB 1Y6NR 4HKZB 4J6RL 1T5WA 4TTDD 5I30L 4LKXA 3L3OB 2Z31D 4L29B 1OW0C 5J0BA 2R4RL 4FTVA 1IGFL 3V6FA 3VJ6A 1PEZA 5IB3A 1AQDB 3O9WD 5HVFB 5FYJE 3IAGC 4ALAH 4XC3L 1P7QD 2G9HA 1I9RH 2DM2A 4PTTA 1F3DH 5DTFB 3QZWG 4FHBD 5HDQH 5H35B 4XBEL 2DWEA 4YGVA 2ZPKH 5C7XH 3D1MC 3TT3L 3IDNA 1JV5B 1CZ8H 1IARB 1SYVB 5EG6C 1WBYA 1CU4H 4HAGA 3S4SA 1ITCA 3V5HA 1U8HA 4P46B 1D5XA 5FO8A 1CG9A 2FHCA 3UTSA 1H3TA 3GKZA 3L3IA 1F3JA 3VG9C 1UWEL 2ARWA 4NT6A 2IF7A 3RY6A 4CMMB 5IWLA 2CSPA 2NY2B 5JNYB 1YEKL 2Z91A 1JNLL 3RIFF 5I8OL 1KXQE 2EIBA 2PXYC 1H15B 1HSBB 5DYOB 5ACMA 3F8UB 2QQNH 5CJQH 2AXHA 2CJUL 4KTEL 3VDCA 3GSWB 3EJYD 1KTRL 3VWJA 1F4WL 1OWRM 5EBWA 1MHPL 3GI8H 1B4JL 3OAUH 1QRND 3RWCB 1I8IB 2Q8AL 3NFSL 5ID0A 5TQ2L 5CP7A 5B39G 1AD9B 3NCJH 5GS3A 4I2XE 4PRID 3CFKB 5JHDD 1U8QB 3QG7H 4UIMA 4OV6F 4CNIA 2YHGA 3F7YA 4DOHB 3QIUC 1E4KA 4AMKL 2XWTB 4GQ9H 3MGAA 1BJ1H 5HHQB 2MPAL 3HFMH 1A4JA 5ISZD 1WZKA 4K9EH 3OAYH 1Q0YL 1A7RL 2E9WA 4JHAL 2OJEB 2E7LC 1BGXH 3QYCA 2VLKB 2PTUA 4XGZB 4ZOAA 2FX7L 5D7IA 3T0WA 4JREC 1HH6A 4M7LL 5LGJB 2R8SL 5JZ7C 1T2QH 1ZA3A 2JB6B 5FECA 5KBNC 4E0RB 3MCLL 2R39A 4G6JL 3QPXL 2WBJD 1CK0H 1RUPL 5HDLA 1VB9A 1A64A 4YHOL 2AK4A 4K07A 1YNKH 5E08H 4HGMA 4PLOB 5F7FA 5L2KB 4AT6A 1FORL 1P69B 3VGEA 3GJFK 2ICEB 3ORJA 5C0IB 3V7MA 1SY6A 3FOMA 2PW1B 3FZUD 4QXUH 4PJEB 1YEGL 4XP5L 1K5NA 4OLVL 3KJ6L 3N9GH 4GAFB 1KBGL 1MEXL 1Z3GH 4MWFB 4KK8D 1EPFA 3F6LA 5FK9B 3WFDL 1TZIA 2JE8A 4JFZH 5IKCA 1KXVC 3BP5A 4NZRL 4RRPG 4XWOD 4YHNB 3QSKB 1IM3A 2I24N 2OMNA 3W82A 1C5BL 4X4XA 4YEEA 5BW7A 4DVBB 3T0EA 4LGRB 4B50A 2V2TA 4NQCD 3QHTC 5D7KE 2J6EA 2YN5A 4HC1A 4NBXB 3TM6A 3MV9D 4JY4B 2E9JA 4Y1AA 5HHME 5JW3H 2HT3C 2DQUH 3FO2B 3MLPA 1MCCA 1OARL 5E2WH 1ODAA 4PJGF 5J9PB 1Q8MA 5C0CB 4NN6B 2XY1A 2N4IA 2PN5A 1X5AA 1H8NA 5GS1C 1DQQA 1H3PL 1CGUA 2H26A 4RX4A 2FJFA 5SWSB 5SV4A 1K8DB 3QDMA 4NKDA 3IDMA 4MQSB 1E6JL 4X6BB 5EC2A 1NH6A 1U91A 3DMMC 2VOTA 4MJID 4YDJB 2B20A 3R1GH 5C0AD 5CCKL 5KANG 4OD3H 2ITDA 4NQDB 1YEIL 3N50A 3OTTA 1PKQE 5TE7L 1NMBL 3MNVB 4PG9B 4YQXH 3U4EA 1KC5L 3D3VD 4Q6IB 1XGYH 5F72S 5C09B 3JWOC 5LWYH 4U6HA 1A6TA 4ZFZB 3VXRB 4XT1C 4FFVD 3M17A 3QCVL 1BQSA 3PWNB 4ODHL 5E8DL 5DRNB 1BZQK 4WCYH 5EU7E 3T2NH 2ICES 3EO1B 3TBVB 4M5ZH 2ADGA 2Z8SA 5MHSD 4H8WC 1BVKB 3RNKB 2H32H 3OF6D 5JQ6H 4WW2C 3ULUH 4GXVH 3CJJA 2AW2A 1QYGH 5I16A 4N5EC 43C9B 5CSBA 3O2VH 1HHGB 4KDTA 4LSUH 5EOTB 3S7GA 4QRUA 2FIRT 1P7KA 3RWHA 4PV8B 2AI0H 3BUYA 3G5YA 1JPST 2BMKB 2W0FA 4EXPX 3VDAA 4RWHA 4CVUA 4P46D 5BRZA 4FRWA 2A6JB 4IRJA 3CX5K 5DDHA 2IH3B 4BKLA 2P8LA 4OLXL 2VLLA 3MPCA 4OZHA 4KKBD 1FFOB 4M1CD 4UQ2A 1F4YL 5IEKA 2H1PH 5FUZL 3QFJA 1YEFH 2FX8H 3G5ZA 1G6RB 5E94A 2NY2D 1A9EB 2CLZB 3W9EA 4KJWD 5C8JB 2BRRL 3MXWL 2P7TA 4L8DB 2XQYG 3LB6C 3SDYH 4Y5XB 4RDQG 1NC2B 2DQHL 35C8H 3G6DH 3RTQC 4PGJA 5DJXB 5DMGC 4S0SD 2ED9A 3KPPA 1WIOA 1JRHL 4OGAD 3Q3GB 5ILTL 2XXCB 3PE9A 1MSPA 1ZT7A 2EDOA 3DHJA 5D8JL 3KYAA 3ROOA 1YJDL 2QSQA 1QFWH 2MHAB 2VXTH 4PJXF 3HMWH 4LSQH 1F42A 1G6VK 3DX8A 4GJTB 5DJ8A 1NCWL 1QRNE 1WWWX 3MV01 4ZUTB 3FAXA 1S7SB 3LVEA 2CDFA 4UV4L 4Q0XL 5I15L 4JPKH 3WXWL 4O4YH 1KLGB 4PRIE 5A3IC 2VLKD 2BOCA 5IMLA 4HUXB 5JHDE 5BQ7A 2RQ8A 3HI5H 1RZGB 4IIQC 3DO7A 1YC8A 3PV7A 3QUXA 3R0NA 3SDXF 1I1AA 1T4KB 1YN7A 2CLRA 1AKJA 4HIIB 4MXVE 4JM2D 4Z8FL 3V4VL 4XPAL 4K3DH 3T0XA 1PY4A 1ZXQA 5ISZE 4BUHA 2R0LH 4OIIH 4O58L 4YBQC 5J13C 2QHLA 3GMQA 2ZG2A 4KU1A 2E9BA 1DEDA 4LVOB 1MVUA 2ITCB 5L2KD 3CVHB 1VADA 3QUKB 2X44D 5SWQB 4QRRA 1FNHA 2O5XL 4ORGB 2APBA 4RCAA 2ADIB 1A8JH 1QD0A 1Z9OA 3OJDA 4QOKB 1Z0MA 1EHXA 3SDXE 4YWGL 1MNUH 1D7FA 5I1GH 1CFSB 3ARBA 3CNKA 3PABB 4OKVA 2VZVA 3B4NA 5C92A 4X7TA 4IRSB 2AGJL 2P5EB 4MYWB 1DN0A 4GW4A 3D25B 5ICZB 1MIMH 3EO9L 4MCYA 1Q94B 3U4AA 4ODTL 2Y1VA 2WUBH 1QFOA 4HKBB 2VN4A 4G42A 4Z0BL 5FFLA 3QXTA 1XAUA 3QISA 4W4OC 5KS9A 3BD3A 4G8EA 5J3HD 1OP3H 1TNMA 5DZLA 2NY4C 1J1PL 2B4CC 2CPCA 2DLTA 2GW5A 1Q9LA 3KHQA 1E28A 5C0CD 2OMBA 4Y5YB 2LAGB 1QLEL 3V0VB 1IM9A 1IAIH 4NQCE 4PP1D 1NJ9A 2XZCH 5FDYA 1XF4B 3MV9E 4MHHI 4ZNCD 4R90H 4I1NB 2VXVL 4U3CA 4PJCA 5FF6A 2FDBP 3NZ8B 4N0YH 1OAQH 2OL3H 1M1SA 5IUSA 3DI3B 3IT8D 4RAUB 5EZIL 4HZLB 4NM8L 3QRFM 4NQDD 2OTWB 3WHXA 5EWIL 3U4BL 1EZVY 5DQ9A 2E9IA 4U3HA 3GMPA 4XP9L 5IBTH 4N8VA 5GGRY 4Z7UF 4E5XB 5C09D 3C5ZC 5C0BA 2APVA 4HIXL 4MJIE 5C0AE 3TO4B 5C0GA 4Z0XA 4Z7OE 1UVQA 5CMAA 4LHUA 5EZJB 3MROA 4WO4A 1I4FB 4KMTL 1HHHA 1G1YA 3PDOA 1W8OA 5T1LB 2VQ1B 2EYTA 4P2OB 3IETB 4XH2B 2IFFL 1MPAH 4XB8A 2XTJB 3FT3A 2CKBH 4Y7MA 2ZSVA 5E6IC 5JXEA 1KCRL 1P7HL 4JRYB 3DYPA 1XCTB 5TQ0H 1FE8H 2WQRA 1Z6JT 3S36L 1HKFA 2R2HA 4HWNA 1M6OA 2HTKD 1AGCB 1IAOA 1A7BA 2GJ6E 3SCMA 5ITBL 3ET9F 2RCSL 3NTCL 4CMHB 5MHSE 3V4UL 4V1DB 2KL6A 1MCOH 4OFDA 1OAUL 3BZFA 3AFLA 2BHYA 1S9YB 2QL1A 1Y6MR 3HS0B 2W38A 3CFEA 3RVUC 2FO4B 3MUGB 5F7NC 4Z7WA 3OB8A 3V0AC 1XGTA 2VXUL 4MNQB 4PJIB 5F3BA 1DJSA 1R3IH 1BX2A 4KZDH 3BT2H 3WFHB 4KUCF 2PO6B 1IZKA 4U0RC 5D6DC 4AG4H 3IU4H 3RY4A 3RKPA 3IDIA 3MRBB 3D85B 3STLB 1JK8B 4P4KA 3WMSA 4QHUB 2KBGA 1FDLH 1OTSD 3NPSC 4TQEL 3WNLA 1PFCA 1CDIA 2BFVH 4QYOA 1UB6A 3O4LB 3HI1A 1KCUH 1MQ8A 3KNBA 3QHZL 4NNYB 4ZUVB 1RZ8B 2V17H 3WNKA 2FX9H 1R5IA 2GEEA 2A6IA 3EFDH 1H8SA 3GSQA 1W0WA 4OFPA 5I74B 1AR1D 4WEUD 3VFOB 5DHXB 2NR6D 4PD4J 1T04A 4XXCC 3WO4C 2NXYC 4HUVB 4WWID 5CGYC 3HE6C 3TA3B 5MEOA 1HILA 1XGQA 3BP7B 5F9WB 1MLBB 3U2SA 2FJGB 1GL4B 4WIQA 1CLOL 2J88H 1RHFA 4NQVA 3L3GB 5CIPA 1A9BA 2VYRE 1QFWI 5T3XD 3WUZA 1FZJA 1ZHLA 3LKNB 5EN2A 1XGUA 3BWUC 1NEZB 1N64H 1H3WM 3N1MC 3RWIB 4XNUL 1E4WH 1FPTL 3EDEA 4YDLC 4O5LL 4K7FA 1BQHG 4G6KL 4KK5D 2VLKE 2HFFA 5DUML 5FKAB 4QRSA 3LS5H 1J5OL 3HRZB 3RIAK 4QHNA 4PJEF 3BUTA 3DXAD 4XMPH 2HKFL 1JGVL 1Z0NA 1FFPA 2FECI 4KPHH 4LGSB 1QNZL 2RIKA 5LBSL 4JPIA 5HYEA 1YY8B 2DQDH 4XCEB 4ENEC 1LP9A 3P4MB 1IT9L 1A14H 4HH8A 4LSRL 4BQCA 4ELMB 4JM4L 2P46B 3IXTB 5KTEH 1XMWA 1UG9A 4HS6B 3SGEH 6CGTA 4Q97A 4P49A 4BK5A 1RIVL 5HHOB 4TVPH 1QSZA 4RZCB 4IRSD 5GGVL 2ZJSL 1AY1H 1ZAGA 2P5ED 4NKMA 4PV9B 4ZD3H 2P24A 5IT2L 3BPOB 4FS0A 4PJEE 4HDIB 1NBQA 4OCWH 1C12A 2XZZA 4GAGH 2ORBH 4JAMA 3U82B 3PL6C 3BP6B 5BOZG 4F57H 2H8PB 3DUUA 1UKQA 5INCA 3K2MC 5E9DA 1CXIA 4M7KL 3CK0H 3TWCL 1YQVL 3SPVA 3WCYA 1JTOA 4OAWB 5FO7A 2YMXH 3MLVH 3K3QA 4JFOA 2C26A 3MC0A 5C08A 3UJJL 1I75A 4LGPB 2J8UB 2PXYB 3MREA 3P11L 4FQPA 4YX2H 3VH8G 3AM8A 1LD9A 3ULVC 2V2WA 3KDMA 2HRLA 3MV8B 3S96B 1JNNL 3D18B 3JZ7A 3LQZB 2Y5EA 1U58B 3MBEA 5C0CE 3OBAA 1H3UA 4NWUH 1T7ZA 1IAII 2B1HH 3TO2A 1WZMA 1EZVX 2ICCA 1B2WH 4N0UA 2I25N 2OLDA 4LNRA 1UH3A 3VRLF 2ZKHL 3OG6B 1FO0L 1KACB 4P3WA 1X5HA 1AIFA 1GC1L 1JN6B 2BXYA 1MAJA 4TUJA 3T3PF 1PQZA 4BSVB 3DARA 3QIUB 3U9UA 3VXQA 4PREB 4L8BA 4LLAA 3TO4D 1EFXB 1OGAB 3BP4A 3MBXH 1S7UA 1J11A 2BJMH 1EUTA 3MRHB 1UCBL 5AAMA 5D5MA 4TVPE 2QHRH 3HA0A 1P5VA 1LEKA 2AJSH 4C58B 1RY7B 4LCCA 5C09E 2WNGA 4W6XB 1VEOA 2VLJB 2ZUSA 5EO0A 1LO0L 5J11C 4U6TA 2AEIT 2VLRA 3U1SH 4R96A 3WL9B 3V8OA 4ZFOL 4PJGA 1U9KA 4U1IA 4ZNEE 3CH1A 5D2LB 4PJ8A 2D7OA 5JW5B 4XNYL 2BDNH 3QWQB 5KANI 1X4ZA 1WF5A 5I1CH 4Z78A 2HRPH 4FQCH 3IS1X 5ABDE 1NCUA 5F3HA 1UJTA 2ZCLL 3ZDZE 2BCKB 1G7HA 5B3NA 4BZ2L 4I18C 1QO3B 2BVQB 3QNYB 3SGJC 3FB7A 4HUWA 3S34H 4R8WH 4KGJA 4RFNC 1G7MA 4BQ6A 4K8RD 4O51A 1EEQA 4HBCH 2PO6D 3IGAA 3P77B 2HFGL 2FRGP 3U83A 1HXYA 4MSWA 1CVSC 3D85D 3DWTA 1FVEB 3NZHL 3O3BB 4Y16B 1I7TA 2C7UA 2P8PB 4ONOA 4I0PB 3IFNL 2FLRT 1NDMA 4HMDA 3O4LD 5INDB 3G6AA 3ARPA 4QRPB 4YHLL 1A2YB 5KZCB 1DUZA 4G8FA 5K9OA 2B7DT 2WANA 3RVVD 2FCBA 4K94L 5DFVD 2FO1A 1RUML 2ATKA 3V5DB 3VWKB 4HCRH 4TPRL 3OKMB 1DBBH 2HLFD 3BEVB 5CILL 5GHWL 4WUKH 1PJ9A 1T5XA 2YBRB 1I85A 4Z77A 2VN7A 2VSCA 4DKEH 3S4SG 4OF5A 3S88L 1TCRB 1QKZL 4JN2A 4XCFL 3TA3D 3N1PC 4AIXA 3T09A 2DICA 4M8QB 3O2DH 4MD5A 4PB9H 4ZO9A 1Q9WB 2IGFL 1Z9SA 3AY4C 1T2XA 3QWOA 1RUQL 3WFEL 1A1MB 1BMGA 4YZFE 3WFZA 5KJRH 4Y4FB 2E3VA 4F3FA 1Q72L 4BZ1L 1RZ7H 2K7QA 3VFRA 3SE9H 2VAJA 3FB6B 4OD2B 4LLMB 1A7OL 1XF5B 3O41B 3V6OC 2BNUA 2HWZL 1R6VA 2NZIA 3UTQA 5E5MA 3GJEA 4GKZA 5T3XE 1MHHA 3QXWA 1A7NH 2EIEA 4MAYD 4OLEA 4YPJA 5I1HH 5K9KB 3F7PC 5ACZB 1D3CA 3HR5B 1CXHA 3ARGA 3N0PB 3X11B 3VFTA 4NHUA 5SX5K 2PYED 2EKSA 5EUOE 1PG7L 1P6FA 3GJFA 5F6HJ 4XMKL 1YMMA 1JTPA 2QSCH 1QHPA 4ZO7A 5J06A 1UXWB 1AO7B 3DXAE 3MLTB 3T4YA 1RULH 4G5ZH 4HUUB 2IMMA 5KW9L 4OF7A 4P3CL 5ETUA 1DE4B 4JANB 4YUEH 4PJXA 1IBGH 5D1XC 4FFYL 4ODWA 4P5TB 1FZOB 4NO0A 3SKMA 1S3KH 3SGEI 3SDAC 2UYLA 3VGDA 1I1RA 1SEQL 4X8JB 3N06B 2YPLD 3T2PA 3RKDC 1KPRA 3L3DA 2P5EE 1N2RA 4Z5RA 4PRHB 2C3HA 5EU4B 1JHLL 1FO0A 3PWLB 4ODUB 5IGXL 3L5WB 4F7CA 1JHTA 2H2PC 3H3PH 2GUOA 1U42A 1MFDH 1CQYA 1F5WA 1XZ0B 5IVXE 5DRZB 3C08L 2PXYD 5T1KB 1SQ2N 5JUEH 5IB1B 1P4LA 1PD6A 3OR6B 2H32B 3MV8D 1H5BA 1NCTA 2XZAL 4FQXC 1D6EA 2HT4C 2DLFL 1IKNC 1D5ZA 2EH8H 2C3WA 1R3LA 4NC0B 3MJ9H 1RZKL 4NM4H 1V3JA 4QRTB 4L4VB 3BH8B 4CRPA 5FYJU 4IOFC 1BECA 3WNNA 2XI9A 1JPFB 1CIDA 4ZFOA 3RY5A 3GSXA 2A6KA 3FFCA 3QIUD 3IDJA 1E27B 1OY3B 1EFXD 1OGAD 1XF3B 1Y0LA 2R56L 1WIUA 2KZWA 3TIEB 43CAA 2YC1A 4JGJA 4QHLB 3SE3C 1FL6B 4D94A 3H9SB 1UEYA 3QCTH 4Z7VE 4S0TD 1A6WH 1MFCH 3TVMA 1L9NA 3JBG7 5C9JB 1JYNA 1EX0A 2FGWH 2VLJD 2A83A 1FZMB 2DQEH 4HFUL 1FNSL 3X3FL 5CEYB 5I8KL 5I73C 3PNWB 3CPLA 1KB9K 2NPLX 3LEYL 1KXTB 3P4NA 3TC9A 2VTFA 3VRJA 3KYNB 5CSGA 3TESA 4LQFL 1MJJB 4XAWH 1MCPH 2EH7L 2CR3A 3KYKL 4TYUA 1SMAA 3HG1D 3DX6A 4IHOA 2J5LB 4PJIF 4LLDA 1NLDH 4OF0A 1ZHNB 3T04D 4NZUL 1KEGL 2JLLA 4PJBB 3GHEH 2HJKB 5GRJH 3P40A 5HGAB 1ORQA 1NCAL 3V7AE 4R4BA 3MLYL 3IJYA 4AIZB 5C6TL 5IB4B 3VFSA 5IMKA 1XT5A 5L7XH 4Z7UA 4HLZG 15C8L 3KPLA 4YPGA 4Y16D 2YKLL 5DMKB 4WWKA 5B39B 1N7MH 1BOYA 1YECH 4O2EB 5GISL 1QOKA 3L3OA 3CC5B 4MA7H 3Q5YA 5EPMB 4GKSA 3FO9A 3MYJB 4X7EC 4LLUA 1F90H 3PGDB 1FAIH 1UA6L 1GJIA 2NY5H 2HT3D 3DETC 1L0QA 2EO9A 1AQDA 2UZXB 3QXAB 1U6AH 5HYIA 4HW6A 2RFXB 1EMTH 5DTFA 4X83A 1I9IH 3SKJH 2VB5A 2DYPA 5HI3C 4ODVH 5H35A 4CBPA 5JA9A 2EYSB 4J3UA 2BSED 4R26L 4LPWA 1ZT4B 5B8CC 4PJDB 1U93A 1VGKB 1SYVA 3LQAH 3MV7E 4BH8A 1JUFB 4OLUH 5DZOA 3LKQB 3OGCA 5DUPH 1JGLL 2ZUYA 3BO8A 4LIQE 5L9DH 5HHNA 3OWEA 2OM5A 3QQ4A 4Y5VC 2GJZA 3NABH 1WUNT 5I6XC 1GOFA 1NGPL 1WBXB 1RMFL 4Y4FD 3OB0K 3UPRB 4XHQA 4KY1L 3L3JA 4RNRB 1V8HA 3L3KB 2XN9D 1D9KB 1H15A 3MACH 3B9DA 1RVFH 5D7JC 2FWOB 4R97B 2R1WB 5HDOA 3U9PL 3TJHC 4XP6L 5HHXH 4ELMF 2CRMA 4JKPL 3AMKA 5HD8C 1G7LB 4ZTOL 5C0JB 4LSDA 1KG0B 4NHCL 5K9JL 2PKDA 3UAJD 1SM3L 3MLZH 3MLSH 3DRQB 4PJFE 1I7UA 1U8QA 4O2FA 3BQUA 2OL3B 1AO7D 1G6RL 1I3RA 2EKJA 2VQUA 5TF1L 3F5WA 5F71A