5DXWA

Crystal structure of mouse pd-l1 nanobody
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
QVQLVETGGGLVQPGGSLRLSCTASGFTFSMHAMTWYRQAPGKQRELVAVITSHGDRANYTDSVRGRFTISRDNTKNMVYLQMNSLKPEDTAVYYCNVPRYDSWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PD-L1 nanobody
publication title Crystal structure of mouse PD-L1 nanobody
rcsb
source organism Camelidae
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dxwA00
1J0ZA 2GT9B 3T1WA 3P4LA 3LMJL 3QUXC 3W2DH 4PJHB 4OZIF 3L7FA 3GZKA 1I3VA 2VAAB 1RZGB 5EA0H 5L8KB 3O2DA 4QTHB 1NMCC 2AJYL 1T1ZB 2NY6B 2HFFA 5F7FA 4BFEA 4G43A 1J05A 4NKOB 5C07B 4LBEA 3QUKB 2BRQA 1JF1B 1WIOA 3F5WA 4JLRA 3MCLL 3M17B 3MREA 2VLKA 3BKCL 3T3PE 2PXYA 2R39A 1R3HA 4YHNA 4IRJD 1OAUL 1ZXQA 3UP1A 2VL5A 5FO7B 4NKIL 1G6RB 2EH7L 1SM3L 4MD5A 2IADA 4F37K 2ZCLH 4IDJL 5C0FB 2C5DC 2ATKA 1OSZB 1E4XH 2Y23A 5TQ2H 2AERT 4FZEH 5I1CL 4MAUL 4HJGA 4LSRL 4PJHE 3DX7A 5CJQH 3VMPA 5KS9A 4WUUE 2X4OA 3BHBB 5DQDL 2MTPA 3RTQB 4KAQL 4Z7UE 4QO1A 5I8EA 2FEEI 2HVJA 3OGCA 3UTTA 4UOW1 1TCMA 5F9WC 5IHBA 4XPBH 1CFVL 4XCCL 3LQAL 1TTFA 3TJEH 1DQDL 2P43B 3V4PH 3TN0B 5C0JA 3WD5L 3F7YB 1XF3A 3QIUA 2I24N 4G6KL 4M93C 1KB5B 4POYA 3GBNL 4JREB 3MV8D 3O6FA 4ENEC 4N9GB 3KLDA 4RGOH 2OK0L 4PJCE 5DJ0A 1C5CL 3A67L 2HRLA 3BWAB 4FQXC 1MH5B 5C0BB 5D72H 3MLVH 2XIDA 2ZG3A 4HFWB 4F7EA 1HI6B 1U91A 1AHWB 3PF2A 4CU8A 5I30L 1CVRA 2VXSH 5IVZB 5FK9B 3BX7C 2I26N 2YBRB 4PJ8C 1LP9A 3ZE0E 5JIPA 3B9KA 4OGYH 2X40A 2A73A 4JFXB 1FZMB 5B39G 1IGCL 2FWOB 3H0TA 3JXAA 3STLA 4DJMA 4H8WL 4FQHB 5D1ZB 4OZHF 4BSWA 3UJTL 4L5FL 1FNEA 4TOYL 1OWWA 1NCUA 1ZAGA 4QT5B 2H2SC 1MAKA 1U95A 4P23D 4UZGA 1R5VB 3QCVL 4HH9A 1GC1C 1IT9L 3MLUL 4HUVB 4FOMA 5DT1H 1U92B 2HKFH 4JM2F 3QXWA 5IVXF 3NIDF 3U4EA 1NC4B 2E3VA 1XGYL 1QQDA 3PHSA 1H5BC 1EO8H 2JB6A 1J8HA 3D18A 4IJ3C 1NH6A 4JFFB 4OJFH 4LLYA 5DD5L 5HDOA 3G5ZA 5EUOB 3N0PB 3KLSA 1JYNA 5H35B 2O5YH 1NGQH 1Y18A 1QFWM 2WUCL 4PGBB 4U6VL 1U42A 1HCVA 5IMOA 4U1NB 5E03A 2VDPH 1ADQL 5ERWB 3WN5A 2HKHL 3ROOB 1RUPH 2B5IB 3QI9D 4TTDC 3T0AA 3FZUC 2J6EH 3S3JA 3KLAB 4LSVH 3V5HA 3E6HB 2IH3A 5C8JB 2R4RH 1T1YB 2GSGB 1GIGH 3H3PL 1Q0YH 5D9SB 4LPUA 3VGHA 1DDHA 1IEAB 1CICB 3SGJA 3QRGL 1KGCD 1U8OA 1G7JA 1D5IH 3LKSB 4TSBL 5DVLA 2PO6C 4E5XB 4QF1B 1DBAL 5C0GA 2Z91A 4ZUSB 4HWEL 1E28B 3P73A 1YY9D 3SKNB 1DL7H 3IJHB 4G8EB 1E4WH 2EKSB 2P44B 2C4XA 3A6BL 3IETB 4W4OC 5T1LD 4JFFE 3TO2B 4FA8A 3VMNA 3SGKC 1VFBA 4I1NB 2LVEA 2HT2C 4G3YL 4GH7B 4PR5B 2LU3A 5I75C 3N85L 1X5AA 2XN9D 4LLVA 2H6PB 1X5XA 4POZD 5IW3A 5D7IA 1L0YA 5IESL 5AWNH 4H88H 3S3SA 3U7YL 2DM7A 1KNOA 1IAOB 4NFCA 3MJGX 4HF5L 1QLRA 2R0LH 5DK2A 3BIKB 4ZUVB 4L9LA 3HUJB 3O2DL 1QBML 4Z7WA 2DLGA 1MCEA 2XQYG 5L2KA 3NN8A 2EEDA 5B38B 3O6LL 1QSFD 3AVEA 1UWXH 3NABL 1ES0A 5HYSB 3G9AB 4A6YH 1MNUL 3PNWA 4LPWA 5GRYA 5GGSA 1UJTA 3V6FB 2VLJA 4Z95L 4KHTH 1PKOA 2AQ3A 3DX6B 4AH2A 4PP1D 4F7TB 2A83B 3S96B 4G9DA 3U46A 1CTOA 2M8XA 4LCWB 1B9ZA 4PUBH 2R29L 1LMKA 4J3OC 4WRLA 1UVQB 2E27L 4LSQL 2VDML 5TE7H 3LEVH 2ESVB 4FZ8H 4YHOL 3DMMA 4BQ6A 1A3LL 4QY8B 5ESQA 3VA6A 5C0IA 1BFOA 2W91A 3S37H 1NCWH 3ETBF 5HGBA 5DMIL 3OKOB 4JQIL 3QQ4B 4OI8A 2VH5L 5F7DB 5T1KD 5FGSA 2NNAA 1HK6A 2X1XR 3HE6D 1YEDB 5DRWA 5FOJA 3BPNB 2P8PB 1YPZA 5D2NA 4Z78A 4XPAL 2X1PA 4G5ZH 4TULL 1C12A 3HZMA 1KPRB 2AJVH 2HTLD 4PJXF 3QDGA 4YGVA 4XCFH 3MJ9L 4UOW0 2AJXH 1XCTB 4RNRB 4LLWA 4CMMB 4X4YA 2X2YA 1GYAA 2FX8H 1UM6L 1Z6JT 1DSFH 3QXUA 3CCHA 1UGNA 2J5LC 1QNZH 4TUOA 5C07D 4KDWA 4KI5E 1B6DA 1UM4H 1OW0C 2ORBH 4WHYG 2CKBB 4WNQA 5IIEA 3SY0A 1YNLL 3WSQL 4XXDA 1EJOH 1S7UB 5BO1L 2X42A 3NH7L 4XP1H 3W5NA 2VXQH 3VFOB 4XHJC 1QKZH 4A6YA 1ZTXL 5JHLH 3QPQD 3EYQD 4I0PB 3HPJA 5IB5B 1LDSA 4P3DA 4O51A 3RHWK 3M1BA 3QJFB 1KTKE 1TZGL 5E9DA 5JOPE 3QZWB 4LLAA 1KIPA 5CEZD 4NDMA 5E00A 4C56A 2F54A 2IQAA 3D0VB 3K74B 1OAKL 3ZKXB 4J12A 5TDOB 4V1DE 3SGDI 1FGVL 1IAIM 4ESKA 1ZEAL 4MHHI 3ZKMD 4M7JH 3OXSA 4GRLC 3NAAH 3EYVB 3U83A 3PL6A 1E4KC 3RZWA 4UQ2A 5BRZA 5F1SA 2RCSH 1HQRB 1V7ML 4I3SL 4U1IA 1KENH 3Q48A 4IRZL 3Q6FA 3EYUH 4X5WB 2A9ML 1Z9LA 3TN0D 1EVUA 2YPKA 4KVCL 3CZFB 4LGPB 3PXJA 5D7LA 3GBMH 5I18L 3CXHJ 2XKNB 1ZLSH 1KCKA 3N1MC 3RPKA 1CLYL 4BQ8A 1NBZA 4TNWF 1TVBA 3O4OC 4U6HB 3E3QC 3GJEA 4QRUB 2CXGA 1SYSB 3X13A 1L9MA 2L7JA 1HHHB 4HXAL 2UUDK 2IALB 3LPGA 1CN4A 5ID0A 4HEME 1IRAY 3BEWA 3I3DA 4WU7B 2EDDA 3GGWB 4JFPB 1Y6KR 4ODUB 1J0KA 3S34L 4HBCH 1G6RL 5I8OH 1F58H 2EIZB 2NYYD 3I75B 3ZZ1A 3QDAA 5D1ZD 2EDBA 4FG6D 1CD0A 4YE4L 4HUKB 5I0DA 3JV6B 3O8XB 3GUTA 5CEZL 3VCLA 2IMNA 4ODHL 5EC2A 3TT1H 1YN7B 2R2HA 5T5FL 4QCIA 1F90L 1QVOB 3VE0B 1HHGA 2BOCB 1FVCA 4PRNA 3KHOA 4FQQB 2BNQE 4KDTA 2ZUUA 1Q9KA 2DDQL 1DBMH 1BFVL 4HHAB 5DJCA 4JANA 3FRUA 1NC4D 1YEIL 3ULVD 1FNLA 3DVIA 4JVWA 3FOLB 3DPBA 3BPLB 4UB0L 1N2RB 4Q6IC 1J8KA 1U8JB 1KN4L 2XA3A 4JFFD 2AI0H 2AV7B 2VZ3A 3DROA 3E6FA 3NCBB 5GGTL 3WEXB 2W0KA 4Y19B 2VITA 2Q8AH 5BVPH 4PIRF 1KB5L 1J1PH 2BOBB 3HRPA 5C86A 3GNMH 1QP1A 1K4DA 1V3MA 4PBXA 1U93B 2W65B 3PHOB 1X5KA 4DGIL 4N8VB 5AD0B 1QEWA 3ZLQC 2GITA 3DLQR 2R9HD 4HS8L 3RIFF 2I60H 3OJMB 3R1GH 4Z7OF 3DBXA 4XCYB 3VFRB 1UXWB 3DURA 2Z9TA 1O7SA 1T7VA 2O61A 2H3NB 3RI5K 2AJSH 4BUGA 2VKWA 4JFOB 3MGOB 2B1HH 2A6DA 2X4SA 1SJEB 3G6DH 1WFOA 3DETD 4G9FB 4NJ9H 1MQ8A 4X5XB 5HGHA 1L9NA 4NYLB 1PGRB 2LAAA 5JXED 1TITA 3NPSB 5CZXC 3MLXL 4PJEB 1R5WA 3JWOL 4LIQE 5EC1A 3FFCE 3QA3A 4HDIB 3ILQD 1KOAA 2D2OA 1JN6A 4YFLF 4OZGF 1NANI 2GSIB 4P49A 3AU1B 5CILH 4G42B 2DLTA 4K94L 2WSKA 3ZE1E 3U0WH 3KGRA 2AK4E 1LO5B 2XPGA 1LEGB 3L3DB 2AEPL 1G7QA 4X8JA 2NX5A 3QXTA 1F6LL 5EOQH 3MR9B 1VADA 3DXAB 1E6JL 2D7OA 5DD1H 4NQEA 4IMKC 3LOWA 2R8SH 3SE4C 3NIGE 4YHYC 4FMFA 1FNGB 3OBAA 3JTTB 1T5XB 1BEYL 1F8TH 4JHWH 4NWUH 3SPVA 5HD8D 3ARBC 1CGSL 1LWRA 1FAIL 1RZIA 3JV4B 5CINL 4JG0L 2BVOB 2B2XH 2HLAB 4QHLB 3P9MA 3QDJB 3CX5J 1KLFA 5DD3H 1O0VA 1WSST 1MWAB 5MEPB 1BIIB 1J86A 4G9FE 3QUYB 1A2YA 4ZG1A 2JCCB 4LCWD 4PS4L 4ZAKB 4NM4H 4QXTB 1WC7A 4K8RC 4ONHB 3FB5A 4PJEE 2ESVD 4JY5L 4KI5D 1Q9WB 1JV5B 5IB2A 4TVPH 4DQOH 5K59E 4ZOCA 1JWSA 4P2OB 1NMAL 4PRBA 1MCWW 3MLSH 4OKDA 4UTBL 3VDBA 5HY9A 1KEGH 3V7AG 4Y5XB 3T77A 4U33A 3U36A 1EO5A 1BP3B 2YUZA 4Y5VA 5FOBB 4MNGA 1A1MA 2XWJA 5JOPD 2HT3D 5DFTA 3BVNB 1KJVB 3GSNL 4L3CA 2FIKB 3P4OB 2CUMA 5M95B 2AVGA 3C08H 3BOVA 4NO0B 4KJWC 2BVTA 4KH2A 3QDJE 1D6EA 4NGHH 5C9KA 5J13C 1MREL 2JB5H 3I6KB 3MRQB 2IC2A 4XT1C 5BZWA 4PRPE 3CX2A 4KC3B 2Y36H 4D0DB 2NMSA 5FKAB 5JA9A 3NGBC 1MJJA 3BQUA 3GMPB 3MACH 5KVFH 3BRDA 3TPUB 1UWGL 4NKMA 4CL7A 1KIQA 4WWKC 4YK4B 1AQDB 5DQ9A 3VG0L 5F3BB 1RAMA 1IQWH 3RX5A 4J8RA 2IBZY 2I27N 1I1FB 4I0PD 3LHPL 3OG4B 5E1AB 3KXFA 5J8OA 2Q8BL 4YAQB 5DR5L 2X10A 4LKCA 1MCIA 4ONFL 4GKNA 5T3ZL 3CFJA 1IGFH 5HYEA 4O2EA 3VGDA 2XZAH 2G5BB 3GSRB 1X7QB 3BEVB 5LBSL 4K3GA 4KI1A 4EI5B 1H3XA 2ZUWA 1X5GA 4XCNA 4MB3A 4DZ8A 3LQAC 3O0RL 5F88B 1KTLA 2MWCA 1NQBA 3N1PC 5IF0A 3NPZB 3ZMRA 5IQ7L 1ZA3B 1JZ6A 1EBPA 2GK0B 4YHLL 3OAZH 1F3RB 3RZCB 1KCVH 2VC2L 1FORL 5F7KC 5IR1A 2BNQD 4BFGA 1LNUA 5C0AE 1NGPH 3T65A 2LV4A 3PWLA 1FN4B 7CGTA 5IT2H 3KDMB 2K3TA 3HLAB 1U6AH 5DGQA 3O9WB 4Y16A 3PWNB 4HKZA 3V6OC 3MFGB 5ICYB 1GH7A 4OF5A 3C6LB 4KXZI 4JPVH 2BNUB 2VDLH 2XNAB 3SKJH 4XP6L 5C70A 1KELL 1FH5H 4OAWA 1IC4L 1U8NA 3GSOB 1FFNA 1RJCA 5SWZB 3BRGC 5JO5A 3SKMA 4H8WC 3KS0J 3U9UB 1G9NC 2AV1A 4NM8H 1MCRA 4LF3B 1J87A 1U3HC 4KQ4H 1C16A 4JPWL 2W9DL 2ZPKH 2IWGA 5C9JB 1JGLH 4MQXD 2O5XL 1KV3A 4EN3C 4JFDE 2FH8A 3FT4B 1EXUA 5FYJL 4UDUA 1A7NL 1PFCA 4HV8B 5D70H 5L88H 1FYTB 1LILA 4XRCB 3O8XD 1JRHI 3PE9A 3V4VL 4U1KB 1A4KB 1QFOA 3NCMA 3SOBL 1MAJA 2ZCKH 2Q20A 3CFDA 2QEJA 1I3GL 2OBGA 2OR8A 4AZ8A 5IEKB 4X4XA 1A0QH 43CAA 3UTZB 4PJIF 1BVLA 3HMXL 2AEWA 6CGTA 4KMQA 2R56L 2H45A 2BVPA 4RBPH 4GT7A 3FT2B 1MLCA 1ZLVK 4PB0H 4M8VA 4S0TD 2JJTA 4R97C 2G9HB 4LEOB 4Q9CA 3FFCD 3MJ8A 4HPOH 5IBUG 2IH1A 4Y19D 5L8LB 3P9WB 3F62A 1FSKC 2AK4D 4F57L 2FH6A 3MZGB 2WBKA 5DMJB 1FFOA 3GKWL 5J11C 3VXRB 1ZT7B 3MFFA 5BMFH 3FQUA 3RDTA 4ELMF 1D5MA 4ZNEE 3BP4A 4PJGE 4XNMB 4KMTH 1FYTE 4H1LG 5DLMH 2MCPL 1OCWL 1FE8L 2E9JA 1IC7H 2A74B 3PWPA 2V2TB 4WFFD 4NCC2 4KK6D 3W0WB 1Y0LB 4P9HC 3GDBA 4G9FD 4Q58C 2X4QB 2P8MB 3DYOA 1RIVL 1UEYA 5TH2A 3HE7A 1ZLUK 5DJAB 2X4NA 5IK3A 3EYOA 1DTUA 3C2AH 1N0LA 2C3VB 5SWQB 2CH8A 5CFHA 2DJ4A 5FYJU 3AY4A 3SJVB 3OR6B 1JPFA 1RV6X 1NFDE 2OTUA 2OSLB 4PJBB 2BMKB 1BLNA 5KN5B 4HXBL 2ICES 3FQXB 4APQC 3TEUA 3FHAA 2P7TA 3L5XL 2MHAA 1U3ZA 1WFTA 5D8JH 3CPLA 4NWTL 3SQOL 4XAKE 4J6RL 4KUCD 1KXVC 3QI9C 2AABL 2EDKA 4M61A 3V0WH 1I85A 1IC5H 4Y89A 5GS3A 4WFEE 3FQNB 2D7MA 3SKOB 1WFNA 1XGPB 5CMAA 3TNNB 5CZVH 5EBLB 4C83B 1QG3A 4J7RA 1NL0L 3QDJD 4UUJB 4F9LC 3HNTL 3QUYD 1A6AB 5LGHL 3L6FB 3HNSL 4HWZB 2UWEF 4ZAKD 4HUUA 1Q1JH 3RU8L 4HW6A 5KSAA 1XR8A 1YY9C 4XCEB 3HHRB 3GK8L 4PRIE 1P84K 3SJVE 5HGAA 4QOKA 2GJ6A 4P2OD 1Q0XL 4POZC 4OZFG 1F97A 3IXTB 4QXUH 1T83C 3OAYK 4PTTA 2DIBA 4YZFE 2Y5TA 4EDXB 1HHIB 2CIKB 4AYFA 1I7UB 1AKJB 3OKKA 3MRBB 4MA7L 3QWQB 5DUPH 1PZ5B 4LKXA 5GJSL 2DBJA 1SMOA 1FO0B 4P0DA 5IB3B 5EZJA 4OZIA 5CCKH 1A3QA 5I2IA 1ZGLM 4NZJA 3MGTB 1G6VK 4LSSH 5CZKA 3FONB 1ACZA 5I76A 1FG2A 3PGCB 1FL3A 5D2LB 3C09B 4P59H 2WM0A 1AO7A 1MCPL 1B90A 4PFEA 5HVHC 3G6JE 3KPLA 2DD8H 5CJ8A 1CTNA 2PR4L 3MRHA 3PV6A 3C8DA 2D7PA 4LCIL 4YDJA 1MJ8L 4ZYKB 3SDAC 3FO2B 3QUMB 3IDGA 4X7FC 3FTGA 3TA3B 3BYTA 4FQIH 4LQFH 1UFUA 4GAYB 2BVEA 3QP3A 5I1GH 4ZQKB 1PKQB 4PTUA 4G43B 1PG7W 3HE6C 5DUBA 2P47B 3GSUA 4QHNA 1F3DH 1OVZA 1AGBB 3MREB 4W4NA 4W6WB 1DQLH 5DC4B 4OD1H 3OJVC 5I1KH 1EEZA 2HTLC 4OUUA 3CK0L 5DSCA 1FIEA 3ARDC 4YHNB 1T2QL 1XH3A 2Z0BA 5JIHA 4RWYL 1SBSH 4EI5D 4HMEA 5E08L 1BZ7A 1D5XB 4QRRA 3HMWH 2W9EL 4QXGL 1UWEH 3MRMA 4JFDD 5AUMA 1S9YA 2APVA 4JGUA 1AGCA 1OQXA 2ATKB 1CD9B 4HS6A 3EYSH 1KB9K 1SY6H 1NSNH 2NY6C 1ZS8B 3RZCD 4HJGB 2QL1A 3KYAA 1H15A 2DI9A 2QR0B 3DHMA 2OTWA 3MRCA 5KS9B 2GIYA 2VYRE 1NJ9B 1XEDA 5JPMA 3RGVD 2VDOL 1QZ1A 3QG7L 1IZKA 4YDKL 1QBLH 3O9WD 3EFFB 2NTFB 3OGCB 1SEQH 4HGMA 2H1PH 2I07B 4G7YH 3VXPA 5BQ7B 1S3KH 1ZHNA 2HJFA 4TSAL 2X70B 3QPQC 5F1NB 1GJIA 5SWZD 2BNRB 2CDEB 1XGRB 3VRIA 1KBGH 1SJVA 2VLKE 4DGVH 2D31B 4KKLD 4XMPH 2AKRB 4LQ1A 1MFAH 3QIUB 1DN2A 3QDHA 5DMKB 3GB7A 4OZHA 4U7KA 5EO0B 3L3IB 4Z7NE 1N5AA 3MLRL 2W1NA 3H42L 4X9BA 1U8PB 5J3HD 2R0WL 4D3CH 4JG1H 4HG4J 1JGDA 2F5AL 2MQ3A 3ZKMC 5KSVB 4Z9KB 3RTQC 1FYTD 4ZTPH 4NFBA 1TTGA 1HHJA 4PYHA 5ID1A 1BX2B 3WXVL 4OLWH 5J9PA 1NCNA 1NEZA 4JM2A 5IVXA 5F9OL 1GVIA 4J3TA 4PJ9B 1MRDH 4G8IA 4YHZH 5KS9E 3KPTA 3STLB 4ZUWA 5IVNA 1A7QL 4OIBA 5IG7B 4OV5B 1U36A 3DIFB 3H7BA 5JW5A 3CXDL 3TN0C 4RISL 2XZQH 4PV8A 4K7PX 2OS7A 3HI5H 1M7XA 2QTEA 5E7FA 4JREC 1PSKL 4I2XB 1ONQA 1EFXA 1TZIA 4ZO8A 5CGYD 2J1KA 2QQLL 3VXQB 1AHWC 2VO5A 3Q6GH 3DI3B 1UJ3B 2I25N 1J8HB 1JWUB 1A7PH 1H8NA 5CIPH 3VXRD 1MCOL 4XAKD 1FLRH 1MRCH 4LLYB 3TT3L 2Z92A 3GMQA 3G5ZB 2NYYC 3LN9A 4HIHA 4UQ3B 1ZV5A 2YMXH 3P77B 1QSEB 4R90H 3RBSA 3MBEB 4AT6A 1NAMH 1X5HA 1YMHB 1Y18B 2EXYD 2GJJA 5BOZG 4WFED 4R3SB 2DB8A 1MFBH 4QHKJ 1LP9E 2ZUYA 1V3KA 1TQCB 4NO5A 3W0WD 1F3DJ 3MJ6A 1BD2B 3VFNA 4F80A 4WDIA 2CLZA 4DTGL 3KPMB 4FFZH 2PYFB 4KQ3H 4XGZA 4PREB 1EMTH 3MV9A 1AY1L 3GIZL 1A5FL 3ULVC 5ETUB 4N0UA 3NACL 4X9IA 2O5ZL 3N9GL 3PDOB 2XG4A 4PRID 2BSED 3SJVD 1F11A 3JVGC 3IS1X 4M5ZL 3MRJB 2QBWA 4OLVL 2WIMA 4LGSB 3U9PL 1TDQA 5C0GB 1INQA 1UB6A 1RZ7L 1IAKB 4LCCA 2ICEA 5FYLH 1J8HE 1N6UA 4GKOA 1X9QA 5BV7L 5E5MA 1Z0NA 3PIQB 4YIQA 4DK6A 2DKSA 1CU4L 5IW1A 3VW3H 3FFDA 1OSPH 4HLJA 1NC2B 2R9HC 3I50H 2VN7A 3DTXB 3AAZB 4RRPG 2QQQA 1JHTB 2FZ3A 4L9LB 1RFDH 1CICC 3KYKH 3SGEH 4HK3J 3LN4B 4MXQD 1F00I 1ZWIA 4NQSB 1IGJB 1RZ8A 3QIBC 3KPRB 4P9MH 1RULH 4M6NL 5E7BA 1HILB 1TQBC 2JJSA 3IDIB 4MD0A 4JHAL 3HC4L 4X6CB 4YHPB 4S11A 3FO9A 35C8L 5DYOA 5GRUH 3OTTA 2VLJB 4PRHB 1Z9MA 3S88L 5HYJB 5F89A 4R0LB 4U1HA 1CFTA 4U1MA 5FYKL 4HK0B 4G9DB 4OIIH 4PPTA 2BSRB 1EGJA 4IMLA 4Y8DC 4PJXA 1W72A 3DMMB 1X4XA 3N06B 3QQ3A 4O4YL 3O3DB 1SBBA 1PYWA 3GSXA 4G7VH 4XMKH 3PHQA 5D7IE 1NFIA 1CR9H 1MIMH 3CDGA 1UKQA 1MHCB 3HB3D 3IU4H 3TIEA 3L3JB 4G6AD 1A6UL 1P69B 1YYLH 1EIBA 4KPHL 3FAXA 5ESVA 5F7YC 2VLLB 3WNPA 1RUML 3P4NA 5D2NB 1RPQA 1OB1B 2XOTA 4Z78B 4Z7WE 1IKFH 3D3VA 5KVGL 4C4KO 5L2KE 3HZMB 3PWVA 5CP3H 4U1LA 4MSWA 1BBJA 5L6YL 5TE4L 3N1FC 2HRPL 5IWLC 2VLJE 3RVVC 1LEKA 1IGML 1P4LA 1WEJH 5E70A 3S35L 2AXGA 3OJ2C 4WCYL 2Z31A 4FTVA 4X4YB 3IFPA 3AS1A 4AG4H 2W60A 3OB0K 4RMRA 2JK5A 4NRZA 4EXPX 1WZ1L 4HUXB 4S1SH 1MI5A 1I9JH 3FN0L 3BE1L 2BSTB 3BPNC 2D9QB 3C5ZB 5IHLB 1S8DA 1AJ7L 1BHGA 5IIEB 3SY0B 4DKAA 2VLKD 3QHFL 3BKML 2PXYD 4P3WA 1I1AA 3CJJA 4P5KA 3RWFA 2YD2A 3CUPB 5C0NC 2P42B 4A6YB 1SEBA 5F8QC 1YPZE 4X80L 5D2NE 2KKQA 4ODXA 4WEBH 5EORH 4X6EB 1JYXA 4QHMA 2Y06L 5FYKU 5E9DB 4MDJA 1MHHB 1NUFA 1HCFX 2VABB 3MCKA 4MB4A 5BS0B 2J4WL 3QDGE 1S9WA 4NDMB 5BJTA 1U8QA 4C56B 2AJUH 5C0EA 2F54B 5B4MD 2IQAB 5B3NA 5DJ2A 2Z35B 3K2UH 3KWWA 1DUZA 2R23A 1IAIL 2JIXB 5DZLA 2FRGP 3FB7A 3O4LA 4XNXH 2BDNH 4BZ2H 1I8KB 5CBEA 1OGTA 4UV7L 4U0RB 1JHKL 4FXLA 1NKOA 3FQRA 4JCLA 3MXVH 3NBNA 4R8WH 3CIQA 25C8L 3CD4A 4I0PC 1QRNB 3BZEB 2XTJB 4BFIA 3QIUD 3MRFA 5B38G 3SDDA 2EDWA 4ZFGH 4HKBB 3BUTA 3O6FD 1CGXA 1NGWA 1FVDB 5F3HA 5HYSG 2GTWA 2G5RA 1CE1L 4U49A 2Z8VC 1TVBB 4O5LL 5E9DE 4JDZB 4NNPL 5LG1A 5C0RL 3B2VH 3OR7B 1U8HB 2HTKD 3GRWA 2EDYA 2Y7QA 4D0CA 3OWEA 2OM5A 3SHSA 5KTEH 5C2BH 4C56E 2HVKA 2F54E 4H5SB 1FLTX 3B9KD 3NCYS 3RWDA 2XT1B 5ITFA 4RQQA 4PGZA 3REVB 4WV1B 4NC2B 1IGIL 4ETYA 4R4FL 4X6FA 5E8PB 4WHDA 2EKJA 3NCJL 4AM0B 1FL5A 1TJHL 2ADIA 2VDNH 1S7RA 5JDSA 3RA7L 5HGDB 3CVHA 4QCIB 2XKSA 2XQBH 3BYYA 2R4SH 1FVCB 5BRZE 3I2CL 1QRNE 1Q9KB 2OQJA 3DX8B 4HULB 2XTJE 3IS0X 2HYMA 4JQVA 1QPPA 1J0YA 1K4CB 1XZ0B 2IGFH 1T20B 3O2VL 5F9JA 5D7LE 4D0BA 4LRIA 4R4ND 3DV4A 2A6KA 3VI4E 1J8HD 4DW2H 2HH0L 4MQXC 3DROB 3ZYIA 4HCRH 3I9GH 3P4MA 1QSED 5GS1A 4QHUA 1IGTA 2UZIL 5D1XA 3FN3A 4ISVB 4J3UA 1QFHA 2YKLH 4OFVA 4PJ5A 4J3VA 3UC0H 1BD2D 3WE6B 3SE3A 2ADJB 1EGJL 1LDPH 4HKXA 3X3GH 4FQCH 3QNZB 2BERA 1QEWB 2ADFL 5EA0L 4G6MH 2GITB 3O6ML 1KG0B 1GXEA 1RK0A 1N59B 4OZGA 4KK9C 3LPWA 2VDKL 1R3JB 3BPLC 3NIGF 2E6QA 1M7IB 4YHIB 3DRTB 1F02I 2ZG2A 2NTSP 1QFWI 3IGAA 2F58H 4AJ0A 4NUGH 1BJMA 2WWMD 3F8UB 1QOKA 3IU3A 3BMWA 3WIIL 4XPFH 4NRXA 4IOFC 2D7QA 3E2HB 4JO1H 4BSJA 5JR1H 1DZBA 5B22A 4XPHH 1X3DA 3LS5H 2HFEA 3MLYH 3QA3B 1DCLA 3VXUA 4ZD3H 4FFYL 1E4XL 3I3EA 1NC2D 2NY2B 5H37G 1JZ3A 4FZEL 2B7DT 2C4FU 4HZLA 3TFKD 1EAJA 2NX5B 5I1LA 1WT5A 3OG6B 1XGQA 2YEZA 4NNXB 3ORJA 5GGUA 2ZUXA 4WGVB 5GISH 1QLEL 5L2KD 1MFDH 4ZFOA 1X5YA 3KPRD 1GGCH 2EZ0C 3NPSC 3L3OA 2NY3B 4CRPA 1TJIH 2VLJD 2A6JA 2X4RA 1JGUL 3V4PL 3KNBB 3DHJA 3BP5A 4GLRI 5JLZA 3WKMH 5T33L 4YFEA 3P30H 1JUFB 1L7IH 2QQNH 3VJ6A 3FB5B 5JOEA 3GBLA 3DMMD 4JY4A 4MA1B 3MLVL 3MRKB 2FD6H 5KVMC 5FO8A 4U6YB 1JWSB 2WV3A 3SCMA 4U0QB 3BGAA 1JIBA 1A3RL 2VXSL 4ZUUA 2R1YA 3T77B 2IFGA 3HS0A 3RBGA 1T0NA 1N0XH 2NX5E 4OGYL 4QTIH 3F12A 4FQLL 4JZJB 1CFQA 4MZ2A 1OLZA 4NQEE 3X3FH 3GHEL 3PQYB 1CK0L 1IGYA 2DQEL 1D6VL 4P5TA 4D9LL 1A1MB 2XWJB 3EIFA 3RNQB 4RGMB 4Y2DA 1RURL 4X5LA 4B7LA 3LV3B 4YDIH 3D2UA 3G04B 2FGWL 4LASH 3BGMA 4PJ7B 1XF2B 5DT1L 5EUKB 1KLGB 5HGGS 4P2OC 4XP5L 2ITDA 2DQJH 1Q38A 2R69H 5L7XH 4DGYH 4Y5XC 3UYRH 4P2RA 3CFEB 4OBSA 4N0YL 3ULUL 1J11A 4OCLC 4Y4HB 3RY6A 5I9QC 1PY4A 5CAYB 3GRWL 4EUPH 3VGAB 3GI9H 3TYFB 1G7LB 1A6ZA 3C5ZD 5TDPB 4NKMB 3CLFL 2BJML 2DF3A 2ZNXA 1LE5A 2O5YL 4TQEH 5DQ9B 4CVZB 1GRWA 5TJWK 4IHOA 4RIRA 3L7EB 1U8LA 1N7MH 2A1WL 4J8RB 2WUBL 2FJHA 1UZ6F 4G8GA 1R0AL 3H6JA 3VH8A 1MVUB 1BM3L 2C1OA 5EZOH 4FFVD 4LKCB 4PGEA 5E9DD 3CVHL 2D7TL 2DQCH 3ZT5A 2R4RL 4K2UL 5BS0D 4EKXA 4HK3N 3WIHH 3UDWA 4C56D 5FM5M 2R0ZH 2F54D 1IKNC 5ISZA 1XAUA 5C71A 4HQQH 3W11C 2JIXD 4NQCB 1D5IL 4X6DF 5IF0B 4YK4C 3S36L 4CAGA 4HJJH 1IEBA 5E8OA 5E95B 5JHDA 3IKCB 5BRZD 1P7KB 3V9FA 4JN1H 4AMKH 1AR1C 5DQJA 1QRND 4WO4B 3CFIC 1ZGLA 3IFNL 2XTJD 3RL2B 3T2NL 5EU5A 2IQ9L 1FFRA 2PYEB 3AB0B 1HH6A 1F2QA 5D7LD 4S2SA 1IM9A 4NO2A 1YNKL 1IAII 4EI5C 2VJXA 3GSQB 4UU9A 4K23L 3KXFE 4ZDHB 4X7EC 4OSUL 5ACLA 4HSQA 3OKLB 4HPYL 4GW1A 1CDJA 4O58H 1F42A 5MERA 3C60C 2XXMB 3VXTA 4ZOBA 3GHBL 4OZ4A 3EHBD 3W5MA 1RQ5A 1KFAH 3RUGA 2IANA 1N8ZA 4WENB 2FHCA 1T3FB 3B6SB 1BZ9B 4TVPE 4OI7A 1RJLB 1WFUA 4X6BA 3S3PA 4HC1H 3LKNB 4XNUH 4OT1L 1GGBH 1JGEA 5K33A 1NLDH 3MA7B 5HHPA 4I3RH 5FA3A 4FABH 3IDMA 2HG5B 3O9WC 4NZRH 3FT3B 1LEIA 3C6LC 5C09A 2XG5A 3FN9A 4OQTA 3IDJA 4JFEA 2UZYB 3LEVL 4FZ8L 2UUDH 4XVSH 4CNIB 1ZHBB 4X4XB 1CDUA 3A6CL 3VXOA 4R26H 1BVLB 1S9XA 2K9UA 4U3XA 2W07A 2XKUA 3ZDXF 1MQKH 1TETL 1GZPA 4ELMA 2BVPB 3V6ZA 2YWZA 4OGXH 4YX2L 1CIUA 3FO0L 3FOMA 5HHMB 3WHXA 2DN7A 1V7NH 4ZFOL 3WJLC 5EOTA 2Q76B 5MEOA 1B3JA 1ZSDB 4FQ1L 3V52H 2IH1B 5DZNA 1BF8A 1HOCA 1XGUB 5DURB 4S1RL 3WL9A 2YC1A 3QULA 4ZXBA 4DAGL 2AK1L 4HUWA 4XCFL 4DCQA 3QO1B 2AJXL 4F58H 3TBTB 3MFFB 3FQUB 1A6WH 3RDTB 4LSPL 3BP4B 4U1JB 1TNMA 4Q0XH 4UILL 3R8BB 4WW2B 3PGFH 1TCRA 1QNZL 3PWPB 1CDGA 2H26A 5EU6A 3EOTL 5KSUA 2XWBA 4NSKB 1UM4L 1OAZH 4LPCA 2ORBL 2MNUA 5BV7C 4KK8D 1QYGL 4YDVB 1Z5LA 5DHVA 1EJOL 4J3SA 7FABL 5TH2B 2VXQL 3UBXA 1QKZL 3EYOB 5JHLL 3TV3L 4KRPB 5HHME 1JHLL 5HHNB 2WBJC 4JRWA 3VRLF 1L0QA 1RHFA 4HC1A 3ALXA 3ZO0A 2D7NA 2EDRA 3NTCH 3CC5A 1JPFB 2YD8A 2EXYC 4XNYH 1DEDA 2I9LA 5ICZB 2NY2D 4HKJB 4M02A 3CXHK 1IFHL 4DN3L 1TVHA 3B9EA 2DWEA 2NX5D 3B9DA 4OM0H 5D1QA 1FAKT 4A2MA 3CPLB 5F96H 2UWEA 2G60L 3BUYB 5IQ9B 1G7PB 4M7JL 2E7HA 5CP7B 2BVQA 2F53B 2OL3A 3WFEH 1DEEB 4Q97A 2NXZD 4YDLB 4PY7B 1MLBB 4EDWL 5CEYB 1HIMH 3VFSB 1RU9H 1HQ4B 3HC3L 1FJ1A 3PWPE 4MJ5A 2NY3D 3MUHL 3ULSA 1KPVB 4UINH 1E6OL 3EYUL 1TZHB 3OKMA 4MJIA 1LVEA 2VDQH 2VSCA 5IV2A 3GBML 4K3JH 4L8SB 1YNTB 4DVRH 1CFBA 2D03L 4GRWE 4JZNA 5F7HA 1F4YL 5KSAB 1NGZA 1ZLSL 5IJVA 2OJEB 1FHGA 4HAFA 4IRSA 1CL7H 4OD3L 1BWMA 5E6IB 5HGAB 2PW2A 3WUWB 2YK1L 2NY5C 4HAGA 5D5MB 1JWMA 4LLQB 4PTTB 1K6QL 2BRRL 5FECB 5JW4R 4U1GC 4HBCL 4NP4H 5GSVB 1F58L 3OKKB 3PQYD 4L4TB 2NZ9D 5GGVL 2C4FT 4MXQC 3VXSA 2F53E 1FL6A 2YA0A 4MLIA 4NC0B 2JKXA 5KOMC 2W0FA 1I8LC 3TT1L 3B4NA 3ARSA 5SX5K 1DBML 3OHXA 4FQPA 1QA9A 3RWIB 1AO7B 4BZ1H 4HIXH 3L3GB 2FCBA 2YSSA 2QSCH 3KPLB 1E0OB 1MEXL 1I9RH 5D7JA 2V2XA 4LDEB 1FGNL 2OJZH 4YDJB 5DTFB 4XVTL 5EWIL 2C9AA 4NOFA 3BQUD 4KUZL 4QOKE 3FTGB 4Z0XA 1LO4H 4GG8A 3U7AA 3BSZH 3QDMB 2GJ6E 1JNLL 5BVPL 2Q87A 3WFHA 1J1PL 3HZKA 3U82B 2DQIH 3WNOA 1A7BA 1REIA 4ZFZB 4CADB 2RB8A 1VFUA 1PG7X 5I66B 1DE4A 3GSUB 4YXHH 3WFZA 4NZTL 2DQHH 4DZBB 2HWZH 4RGNB 4OZIE 1PDKA 2I60L 3CZJA 3R1GL 1EEZB 1TXKA 4OCSL 5AEAA 1GOGA 1XH3B 5J6HA 4YNYB 3SDXB 1DBKL 2ZOKB 1BZ7B 4GUPB 1UH3A 4TVPD 2B1HL 5F1IA 3WJJC 4HFUH 4NQCD 1AO7E 2PF6A 1P7QB 1S9YB 3TA3C 4LAQH 3VFUB 1T4KA 4UIKH 1ZT4A 3HG1B 4M62L 5A2KH 1INEL 5E5RB 5E94B 3DX9A 3CDYA 3ZDYF 3CX5K 4JFYA 4OI9A 4OLYL 5IFHH 2IAMA 1SYVB 3L9RB 1HYSD 4JN2B 4JPIB 3TO4A 3U0WL 4KRMB 2PYED 4KTEH 5TPWH 2DLEA 3O45A 4PLJD 2HJFB 4BSVB 5E8EB 1TVDA 1EAPA 4U4BA 4M9OA 1DVFA 3VRIB 3RWJB 2ED8A 3QEUA 3B5GA 4BH8A 5DDHA 1ETZA 2BVUA 1KEML 4JHWL 1YEJL 5CGTA 1MHPL 1UB5A 4IOIA 5B4MC 4BZYA 5I16A 4GW4B 2N7AA 2X4TA 4OD2A 4QRRE 3QUXA 4O2FA 3MRNB 5B39A 1HSAA 5ALCH 5CD5D 2N7BA 1QACA 2DJSA 4KK5D 2OXGA 4O2CB 4P5MA 5I1JL 3WXWH 1E4JA 1ZHLA 1VACB 1OP9A 1JGVL 2R0KH 1WCQA 1KJ2B 2BXYA 3ZTNL 5EBWA 4P2QA 4YFLI 5JQ6H 2W9LA 4Z18A 4G8IB 4I18B 3PWJA 4MWFA 3MMEB 4P46B 1F6AB 4PRDA 1K8IA 1ACYL 5JW5B 3B83A 5FUOH 1YQ2A 4M3JA 5TFSL 1ZVSB 3ET9F 4MD4B 1PVHA 4V2CB 3C8KB 5HHMD 5IMMB 1MIEH 2YHGA 2OL3L 3LQZB 3LRHA 2FX9H 3FB8A 3WKNA 5IM7A 5DJ6B 3VWJB 1GC1H 2NY7L 2P24B 5EO9A 1GHFH 2J3SA 3HCVB 2VZOA 3QEHA 2HTKC 5DURD 5GS0L 4OZHE 1Z3GL 4NJAH 4K7FA 5CHNA 2V17H 4NO3A 5DK0A 4PJ9C 3MRDB 1ZLVH 4KWUA 4ETQA 5GZND 1HXMB 2Z92B 1KJ3H 3GMQB 3EDFA 3GI8H 2ZUTA 4HIHB 1T66D 4Y1AA 3RDTD 2QHRL 3WFBL 5LQBH 1VGEL 3DI2B 3BP6B 3O3AA 4N90E 4OBRA 5A3ID 1RY7B 3PUCA 5E8DL 5GIRA 5IVXE 3NIDE 2RHEA 4UBDD 3PWPD 4I5BB 3STBA 2RIKA 3V79C 5E8NB 5I0ZA 1MJ7H 4NT6A 3MV7A 4HEPG 4JR9L 3AREC 3LN5B 3EOYG 4PLKD 1UJ3C 1G84A 1U41A 1IQWL 4R4NC 4M6OH 1B2WH 4EI6B 5KW9L 1OARH 3QUZB 1FZJA 1KT2A 1AP2B 3GIVB 3RAJL 5HXMA 4WI9A 3CMGA 3ARGB 1NCDH 3B43A 2AXJA 3FCTA 4FQXA 3QH3B 3MBEC 4GXVH 2EYTA 2GTZB 5JZ7C 1QBBA 3FMGL 4HMDA 5C7XH 2B8OT 4PJ8A 3WDHA 1VEPA 4Z5RA 2DS4A 2CRZA 3OXRA 1J1XH 1HKLH 1EBAA 1GGIH 2UV3A 2IPTH 1QR1A 3FFDB 2F53D 5KVDL 5ADPH 2CMRH 1YEHL 3LEXA 3QEGL 5IFAL 3BIAX 1LK2B 2FBOJ 3KG5A 4XBEL 3GM8A 1K3IA 5IT2L 4PJFF 1A6TB 3KPOB 5F7EH 3MV9E 1CFSA 1KIUA 3ARQA 4L3EA 4Z76A 2FLBT 4N0UE 5CJXC 3AXLB 2MPAL 2FATL 2Y6SD 4JPVL 5EU3B 2VDLL 1T5WA 5KSAD 4MD0B 1H5BA 3ISWA 5CIPB 5DC0A 3T2OA 4LDLB 5E6ID 4QYOA 4FFWC 5T3XL 5F89B 1DUYA 2GJ6D 4O02H 5IOPB 1NAMB 5TQ0H 5I19L 3FB6A 3S4SA 3TYGH 2X4UA 1I7ZB 4ZOAA 3TH4T 4X4ZA 3P0VH 2ZPKL 5KZCD 3CSYA 3BN3B 4PRAA 1N6VA 1UADC 1OTUD 2E7CA 2VLRA 3CFCL 2HJKA 5I1DA 4L4TD 1PYWB 3G5YA 4LOUD 4LCUB 4TN9A 1A7OL 1NFIB 4BH7A 4NUJA 3OAYH 2LABA 2JJWA 3ULUC 4MVBD 4XBPA 1F4WL 1YEFH 5JOFA 4ODBD 4PGDA 1YMMA 2YPLA 1X4YA 2H9GB 3Q1SH 2SEBA 1AO7D 4R0LC 5KANI 3PWUA 3WLWD 4I4WB 3KR3H 3PWVB 2UY7A 3KLHD 2PO6A 4U1LB 4AEHH 9CGTA 5LGKA 5T1MB 4M1GH 5H94A 4KKCD 4NC1E 4Y2OA 3GMOB 4KVNL 4M5YH 1LEKB 5DK3A 4HPOL 5E2WH 3OMZA 3QWOB 4EEEA 4W4OA 4KZEL 3SO5A 1FNSH 5TGBA 5CBAA 3SGKA 2F74B 3FQTB 5LGJB 3WS3B 1AGFB 4NRZB 4PJXE 4CBPA 1FCGA 1T03L 3S8WA 5EUOF 1CBVH 4JDVB 4NPYA 1JZ2A 3U7WH 3RIAK 4KMTL 1C5DA 1ORSA 2W0PA 3ECBB 4NCDA 5L9DL 4CJ0A 3MRPA 1S7QA 4JDTH 2IG2H 4P5KB 3RWFB 1BFTA 4JY6B 1IC7L 1GPOH 1MCJA 5GGVY 3DJ9A 3VXMB 3QO0B 1J5OL 1MRFH 5GJTL 4Z6AT 1VHPA 4ODXB 3SDCB 1JTOA 4C59B 3D3VE 1P2CA 4XH2B 4ALAL 1P7QD 4YEFA 4MDJB 3D1MC 5DMGC 1Q72H 2X9XA 3NA4A 1B0GA 5JIKA 5J1AB 4PJAF 2R2EA 3TWCH 2ED7A 2R23B 3C5ZC 1WIUA 3LZFH 1CE6A 4FTVE 1HSBB 3DVGB 4XVUC 3FB7B 3O4LB 1OGTB 1DANU 4GO6B 2D0HA 4L4VA 4LFHG 5E6YA 1T04B 5K9JL 3KJ4B 3FQRB 1N5YL 2ICWA 5D8JL 3P0YL 5EDXA 5CJ5A 1MI5E 3WCYA 3MRLB 4NHUA 1BJ1H 2HMID 4JAMA 1S7TA 2FJGB 4XC3H 4FFVC 2DQDL 5I8KH 3NOIA 3G9VA 1I9IH 4BFIB 1HXYB 1INDH 2NY1C 3JBG7 3SDDB 1A6VH 3Q3GA 1NGWB 4M7KL 4KFZC 5J1TC 3HUJF 3OAUH 4RMWA 2GTWB 2DI7A 2XZCL 3CU1A 4MDIA 4CU7A 5CD3B 4N90D 2DWDA 3CH8A 4I9WD 3RWGA 4U0RC 1NLBH 5ENWA 4PJDB 2CJUH 4MQ7A 1UM5H 4KDVA 3QG6A 4J4PD 5GGRA 3RWDB 5IGXL 5ITFB 3SEPA 1WBZA 3O4LE 4X6FB 4P46D 1OW0A 2VZSA 1MAML 1MFCH 2ICWJ 4YLQT 2IBZX 4HX1A 4WJ5B 3WO3B 2VOTA 1S7RB 1UH2A 4Y4FB 5FUZL 3IKKA 3UBXI 1EFXD 5EU7E 4GQ9L 1JZ8A 4JKPL 4H0IA 2ZSWB 3ZYJA 2OQJB 5HI3C 3OX8A 5JW3L 4KY1H 3IDUA 4KV5F 3T0EC 4NKQB 4PB9H 4D0BB 4ORGB 3EHBC 1CGVA 5HDBF 4LSSL 2BZDA 3D85B 5JPNB 1HNFA 2JLLA 3UTSA 2IPKB 1G7HB 1PG7H 4P59L 3OKYA 5HI4D 4WV1C 2KQMA 5K93A 3WNLA 1IGTB 1PD6A 5EFIA 5DRZB 4TRPL 5DC9B 5HI5D 5EIQA 4GRLA 1V5JA 4FN0A 4X8XA 3IVKB 5I1HH 4W68A 3VFTB 1E4KA 3QEQA 2MKWA 1S5HA 2Q86A 2AJZA 3P3YA 4FQIL 4I48B 1Q94A 4MNHB 5I1GL 3MV9D 1RZFH 5ADOH 5HDQH 3BAEH 1VSCA 2DQTH 1KJ2L 1WICA 4MYWB 3OB8A 5HYIA 1U8IA 3QQ9D 1EHAA 3QXDB 4XX1G 3ARGD 1C1EL 1B0RA 4NOBA 3QAZB 1DQLL 3T08A 2IFFL 3U2SA 1CDCA 5I1KL 1CCZA 2V2WB 4Q2ZA 3NFPA 4OV6F 1S7SB 3NA9H 2FHBA 4BK4A 3MOBH 3MXWH 2A0LD 4LARL 1CT8B 5CUSH 4Z7OE 3HMWL 3MRGA 1EHLL 2AJ3B 2HFEB 5KG9A 1NBQA 1UA6L 2OYPA 3VWKB 1HKFA 4HIIA 2F15A 1FZKB 1SY6L 4ZFFB 4YEEA 4AQ1B 3MLWH 4HZLB 4PJ5E 4XC1L 1BJ1J 4YXKL 4HG4K 4WY7H 1TTUA 3QPXH 2DL9A 4KK8C 4ZSOA 4YUEH 4UOJA 4TUJB 1TIUA 1VENA 2ZCHL 1XIWB 2HFGH 3D0LA 4LU5H 2WBWB 1SEQL 2DLFH 4PGCB 4OZGE 3G08B 3L3OB 3C9NB 1T1XA 1H0DA 2X89A 4RFNB 2P8LB 4OM1L 3G5VA 1FPTH 2OI9C 1R3IL 5IEHA 4Q6IA 3QCUH 3QFJA 4GMSL 4XX1E 5EIVA 4FXGB 5BVJA 1J0IA 3BP5B 4LHUB 3LSOA 4F33B 4U6XB 3M8OH 3VJ6B 4WU5A 4KHXL 4AENB 1J0HA 5I73B 4K8RH 4JG1L 5SV3A 4D3CL 5DJ8B 4LLUB 3VXUE 3RWHB 3GMNA 1I8IB 3H9HB 5DVNA 3MA9H 1FVEA 1BQHA 3RWCB 2OR9H 3HS0B 4E41B 1DQMH 1T0NB 3QR2A 2Z4QA 2PCPB 1A9BB 5L2JA 1RK1A 1C08A 3LMJH 1C5BL 3G6AA 4WI8A 4LVHC 1V3JA 1HHKA 3SE9H 1NAKL 3QQNA 4RDQG 4Y2DB 3ZDZF 5FYLD 5GGQL 2DQFB 4LLMA 3WUZA 2AJYH 5EZLB 4TSCL 5HHXL 2AGJL 1XF5B 2NY4B 4LLDA 4MA1C 3NCYP 4NQXA 4HWBH 4FTVD 4WW1A 3GSWB 2XY1A 1U8KB 3EYFA 2FGZA 3BKCH 3SGDH 3BN9C 3CFBB 1I75A 1MI5D 3L3KA 1ZA6B 1MRCL 4JZJC 1F13A 1M05A 1OPGL 2CIIB 3TZVB 5HVWA 2YMXL 1GGUA 1E27B 1IILE 2NZ9C 1F3JA 1OAUH 4IMKA 1YY8A 4BQ9A 4CDHA 3SE4A 3MUGB 1CGWA 1PQZA 3CH1B 4RGMC 1I1AD 2KPNA 2M26A 4X6DA 4RFEA 4F7PB 3OB0H 4E42A 4R7NA 4MB5A 5DJZA 4YHKL 2PTTA 4CGTA 3ARBA 3VH8B 3FQWB 3BWUC 3O11B 2HLFC 3Q5TA 1B4JH 4X83A 4LSRH 1QTYT 4MA8H 4XHQA 1JPSL 1K8DA 4YO0B 3GO1L 2VIRA 5ANMA 4Z77A 1WISA 4LCYB 5E4EB 4F7CB 1T7XA 4Y4HC 1LD9B 1B0WA 5LWYH 3RWEB 3J8F7 3HAEH 3PJSB 3VGAC 4K9EH 3ARZA 1CD1A 1WBXA 1CFVH 3O4LD 5DRXA 3LQAH 4BA8A 1DQDH 2EYRA 3HZYA 4NKDB 4U3HA 4P2RE 1X6NA 5FYLL 3V5KA 5E8OB 3E0GA 5ACZA 4G6KH 5JHDB 1A1NA 4NQDB 3VD7A 1QLFB 4ZS7L 3X17A 1W8NA 2B20A 4JGJA 3VW3L 2OK0H 3KPSA 2IMMA 1OF2A 3A67H 3VRJB 2GQHA 2BC4A 3LKOA 3SDDD 3VU2A 1M7DA 3KJ6L 5DRNB 4NO2B 4G8GE 1RFDL 4UU9B 4KUCF 5GSRB 1JFQH 5EZIH 4DN4L 4Q6YA 1J10A 1IGCH 4BUHA 1JP5A 1IM3A 4H8WH 1RULL 4PJIB 4J3XA 4OZ4B 3UJTH 4TOYH 3O41B 4GG6B 2EO1A 2IANB 3DRQA 4EUPB 4U2YA 2VXTH 3LKPA 3QCVH 4OCYL 4WO4C 4QLRA 5AYUL 1IT9H 3MLUH 1HYSC 3RVTD 2JCCF 1R3LB 5FA3B 2B4CL 3IDMB 3L3HB 1MCFA 1NEUA 3N50A 1NGXA 3AB0C 4WWKA 5GS0C 1NBYA 4XPTL 3TH3T 1QFPA 2YUVA 1XGYH 4Y4FD 4NQDE 5JHDE 4MJ4A 3TCXA 3T4YA 43C9B 1KCSH 4IIQB 1XGTB 3D39A 5DD5H 3KPQA 1S7WA 3THML 3ILPB 3TIDB 1B4RA 1CQYA 1DBBL 3PABA 5DF0A 3D85D 2J8UF 3CVIH 2WUCH 4DUXA 4U6VH 5I1EL 2QKIA 3RJQB 3BRFA 5CD5C 1ADQH 1T1WB 4H1LA 3WL9B 4N1HB 1WGOA 2EEBA 3W9EA 4HUWB 1GAFL 3MC0A 4M4PA 2IANE 1P1ZA 1XMWA 4XZUB 1NANH 1WEJL 2D0FA 3ZYOA 1HZHH 3H3PH 4X7TB 4KJYB 4AG4L 1OD7A 3C6SB 5EB9A 1AIFB 1S9KC 3QRGH 4M43H 5C09E 4TSBH 3RRQA 3UZVB 3V6OA 4JFEE 2H32H 4BFBD 1ODAA 1NDGA 4CW1A 4HWEH 5FA4A 1RZJH 3LDBC 4WUKH 3RPIA 5FGBC 4UNVA 1D9KB 5INDB 4G3YH 4HGWB 4ELME 3N85H 2EYSA 2JJUA 5C0CA 1U3HA 2Q7YA 5ELIA 4HIJA 3GSVB 4G6FB 1AD9A 3VXUD 2H8PA 3VWKD 2DYPB 3JTSA 5E2VH 3O2DH 4EN3A 4FP8L 1QBMH 3ZKND 2DKMA 4JFHE 1FRGH 4Y4KB 4WW2C 4MAYB 2AJUL 4OFYD 3O6LH 5D1QB 3MRRB 3D69B 2UWEB 3QFDB 2YD5A 3ARFB 2WWKO 4WI5A 4BZ2L 4F9PC 3RFZC 4OLZH 1EO7A 2EE2A 2FYYB 5E2TH 4PLKC 2EE3A 3TNMA 3T04D 4R8WL 3TH2T 4KRPC 5EU6E 2R2BA 3SE8L 3MROB 2DMBA 4MJ5B 5JNYB 3UPRA 2R29H 2O93L 2DTMH 3MV8A 5B8CB 1HYRC 4LSQH 1ADQA 4TNWK 3UAJC 4YHOH 4MJIB 4LHUD 3SO3B 1A3LH 4GRMB 4OZFA 1UZ8A 1DN0A 2EDJA 5IV2B 5DMIH 4AIZA 4JQIH 2VH5H 4ZPVA 5L0QB 1KUMA 1I1CA 5CGMA 3HR5A 5B3JF 3V2AR 5C2BL 4K71B 1JTPA 4TULH 1WCBB 4M8QB 2H32A 1T22A 1B88A 3GM0A 1ND0A 5J12C 4EBQL 2UWEE 2VISA 2VR5A 2EDLA 2GAZA 3R06B 1K85A 1SJXA 5K9KA 2C7UB 2GJZA 3MJ9H 1AE6L 4XBGB 2FL5A 3KYOA 5HHVL 1BQLL 1D5ZA 3JSSA 4Y2DD 1FFPB 1OY3B 2Y6SC 2W0FB 4L8SC 1PAMA 1UM6H 3D2UD 5C0DA 1JYWA 1X6LA 3L5JA 4WUUB 2NY4D 5E6IC 3OHXB 4Z7VA 4LVEA 1HDMB 1TPXB 2KH2B 4MJIE 4GAJL 4Z7UB 4DVBA 5K9QG 2YSSB 3JWNC 1MHEB 4IS6B 1W0VA 4M7LL 2FJFB 3VGEA 1I3RB 4P2RD 1YNLH 2V2XB 5BO1H 1O7VA 3NH7H 4APQA 2ICWI 5F6HJ 3TJHD 3TGXA 2YD4A 3TZVD 1ZTXH 4Z0XB 4GG8B 3EDKA 2C1PA 2Y4SA 3BO8B 3QI9A 1BOGA 4LOUC 3RIFK 3HZKB 1TZGH 1IVLA 2CLRA 5A40E 1AXIB 1MF2L 4PJCB 4G8GD 2ZSVB 4G8FA 4D94A 2ARJA 3TF7C 1YEKL 1G7MB 3O3BA 4FXKB 3PDGA 4OF6A 3V6BR 1T2JA 2UYLA 2CDFB 3VXSE 2Q3AA 4KXZH 1R24B 1YEGL 2HT4D 4F9LA 1FGVH 5FHAL 1C7TA 5J0BA 4LPTA 5KVEL 2NPLX 3DSFL 1BQSA 2A77L 1U9KA 2HJLB 5I1IL 5T1LA 5BOPA 3ZTJH 5ECJE 1V7MH 4I3SH 3EJZD 5AZEL 2XN9A 4IRZH 4GS7C 2DLIA 1VFMA 8FABA 3RY5A 3ZKQD 1T83A 3EO1A 3ROLA 3D25B 4KVCH 1AGEB 5JR1L 3SBWC 5JHDD 4NQDD 4CDGC 4P4KB 3MLYL 4PBWD 5A2LH 2GCYB 1JRHH 3MJ9A 4PV9A 4I77H 1K9TA 2P45B 4ZD3L 3F58L 4PJBF 4RGNC 1CLYH 3FO1A 5I71B 1CXIA 4LVOB 1IM9D 4ODTL 4DEPB 1QSFA 2WANA 4MJ6B 5IW6A 5DO2C 1CFNB 1RUQL 4JM4L 4ZPTA 1Q9LB 2X7LB 2E7BA 2YD6A 3S34H 1UQSA 1UYWH 5FDWA 5EN2B 2V7HA 4BH8B 1GGCL 1FG9C 1CGTA 2VE6B 2CK0H 2GY5A 3BZ4A 4JPKL 4IOIB 4YE4H 2IAND 1LHZA 5EO1B 4RAHA 2X4TB 4O9HH 1XCQA 4ODHH 3RY4A 1G9NL 5T5FH 3SDAA 4YQXL 2MJWA 3WKML 4YBLB 1KTDB 1YN6A 2DDQH 3P30L 3STZA 2MCG1 1ZHLB 1BFVH 2QQNL 1G9EA 5EBWB 4P2QB 5T1KA 5DI8B 1YEIH 4X0KA 2CGRH 2OR7A 2FD6L 5JDJA 3HE6A 3MQIA 1EEUA 4M4RA 1KN4H 3Q0HA 1XR9B 5GGTH 3ARVA 8CGTA 5KBNC 5SV4A 1KYOK 4KZDL 4MA3B 3ARDA 2GT9A 4XI5D 1T0MB 2RFXB 1OP3K 5HHOA 5EO9B 2F19L 3TM6A 1WK0A 2VAAA 4ZNCD 1RZGA 4DGIH 3W39B 4ZXBD 2UVEA 2WINB 2P5WA 4NN7C 4QTHA 4I8DA 4J4PC 4WHTA 3HTLX 1T1ZA 1AFVH 5D2LF 4I18C 4ETQB 4NZUL 4XPGL 1MCBA 5C07A 2QQKL 3QUKA 1JF1A 4P46C 2APTA 3FAWA 2X41A 5KSBF 3K80A 3M17A 4LSDA 4IBLT 1U58B 5TF0A 4P2QE 3CDCA 5EU6D 1AC0A 2XRAL 2XFXA 5JA8B 2VKXA 3GI9L 4HJ0D 3VWJC 3MLXH 4K3EH 1MELA 5FO7A 4TQEL 1G6RA 3JWOH 5D7SH 4Q9RL 1D9KD 5H8DA 5C0FA 1LO2H 4IEFB 1OSZA 4M93B 4N8CH 4K94H 1RVFL 4P9HL 4YBQC 4J1UA 4RMVA 1KT2B 3C5JB 2AEPH 5HI4C 3IXAA 4G6FD 1HH9B 2VDRH 2IBGA 5SX4H 2DYPD 1E6JH 3IAQA 2RBLA 3UYPA 2BSSB 3BHBA 1FZOB 3WIHL 4XP4L 4Y4KD 3RTQA 5HI5C 1BBDH 4MAYD 4PJFA 5D1QD 4RRPA 1DQTA 3ARFD 4Y1AE 5CINH 1WTGT 4JG0H 1FQ9C 3LH2H 4OGAD 1QR1B 5HYFA 5GGTA 1JZ5A 3TN0A 1U2CA 2CLVA 3FRPG 4PP2B 5F7UA 1KB5A 3QUZC 4OF3A 3QQ9C 2XWTA 4S0SD 4NNYB 5A16B 3ARGC 4N9GA 4NCC1 4EQ3A 4JY5H 4MJID 3MV7E 3O6KL 1MH5A 1CD8A 3O3EB 2OZ4L 1JI1A 5C0BA 4Z76B 4HFWA 3DVNA 1HI6A 1AHWA 1KIRA 1A4JB 3MV11 5FK9A 2YBRA 3BXNB 4IRSD 3V8OA 4QYOB 2DICA 4JFXA 1FZMA 3S4SG 3Q2CA 3QWRD 2FWOA 4FQJH 4ZS6C 4FQHA 3NZHL 3FB6B 2V7NB 3F7VB 1EERB 1GZQB 3RKDC 1KFAL 3R0MA 4QT5A 4XAWL 3R8QA 2QSVA 3CSYB 3IJSB 1WTLA 4URTB 4M03A 3GSNH 2EEAA 1LK3L 4HUVA 2CO7B 2YD3A 1NLDL 1ZHKB 4FABL 2J12B 3T2PA 2ZKHL 2GFBB 3JUZA 1U92A 1MREH 1VPOH 1IMHC 3BPCA 1QSVA 2AQ1A 1IL1A 4HWUA 4V1DB 3K81A 4WUUD 1WWWX 5FO9A 2SEBB 4UIMB 1MQKL 2DM3A 4R96B 3JVGA 4L3EE 5EUOA 1R3KB 1LE9B 5H35A 5D7JD 4R4BB 1A6PA 4PGBA 3VG0H 5H94B 4KROB 1V7NL 4U1NA 5ERWA 1ULVA 3V52L 3DO7B 5SX5H 3ROOA 5E6ZA 3FKUS 1AI1L 3LHPH 5ESAA 1LO0L 2Q8BH 5DR5H 3KLAA 1L6XA 5T3ZH 3E6HA 3Q5OA 5C8JA 1T1YA 1S7XA 4U3CA 2GSGA 2X4PB 1A6WL 3E8UH 1Q9OB 5LBSH 2ENYA 3HI1A 4AL8H 4PJAA 3DYMA 1IEAA 1CICA 3O0RH 1S78D 1S7QB 5MEQB 4E5XA 4OLUH 1R5IA 5J7CC 3QIBA 1D5BB 4D9QE 5IQ7H 1OAZL 1K2DB 2VQUA 2EE9A 1E28A 1YMME 2YPLE 4EOWL 4TYUA 1T6VN 3SKNA 4G8EA 3CLEL 4YXLH 2EKSA 4YHLH 1P2CB 3IETA 1M6OB 2VC2H 1CF8L 4N5ED 4JO3L 1FORH 4RZCB 4YWGH 2HFTA 4PR5A 2H6PA 2CQVA 4OFIA 1PX4A 3KPPB 3GKZA 3RGHA 3GSNA 5M7QA 2BNQB 1IAOA 4P4KD 1N3NB 2R2EB 3LKQB 1KELH 3BIKA 3FJTA 3NTCL 4ZUVA 3U0PB 3HUJA 3TO4D 1TJGH 32C2B 4OLXL 5DEGB 2B39A 5C08A 5C3TA 4L4VB 5B38A 2YPVH 1X5ZA 1J1OL 5BZDB 5I15H 3REWB 1P4BL 4NHUB 5HYSA 5J89A 3VFGL 1OLLA 3SDCC 4JPWH 2W9DH 2WNGA 5IB1A 4XNQB 3MNZB 5CSZA 2O5XH 1L6ZA 2B4CC 3BKJL 3DX6A 2E8YA 1RU9L 2FEDC 5FYJH 4F7TA 1A7NH 2A83A 1CZ8L 3S96A 3VI3F 3OQ3B 1ZT1B 4LCWA 5IBTL 3V4VH 4UINL 3QUXD 3HZVB 2D0GA 3P11L 5IWLA 2ESVA 1YC7A 3DUSB 4Q7DA 3RX7A 3BW9B 2ZUQB 5DGRA 5IROC 4YR6B 4K3JL 4DVRL 3UTPE 3KJ4C 3QQ4A 3ULUF 5D6DC 2R56H 5H37H 1KC5L 1RHHB 4P2QD 4RMQA 1F4HA 5GGRB 2XTLA 2DQGL 3UJJL 3MO1B 4MCZB 3UROR 1YEDA 3PP4H 2P8PA 4X9HA 1JK8B 4KKAD 3T4AB 2BHUA 4L4VE 1KPRA 4CMHB 4PY8J 4NP4L 1P7HL 3FFCB 4F57H 3B2UD 4UT7L 3J7HA 1YYML 3GKWH 4OKVB 3OX8B 1XCTA 4RNRA 4CMMA 2X1WL 2AK4B 3HI6L 3H2WA 2ARWA 2RAMA 2QV2A 2QADB 3VFVB 3NZ8B 5AG9A 5T1DL 2MCPH 3UTSB 4M7LT 2KBGA 2WQ8A 1FE8H 1S7VA 5C1MB 1CDBA 2MQCA 4Y1AD 3UMTA 3VFMB 2CDGB 1RUAL 2CKBA 4U1SB 4P4RB 1VA9A 3S35X 3TC9A 3DVFA 3MJ7B 1CLZL 4GW5B 4LRNL 1S7UA 4XTRC 4GRLB 3MODL 4CN6A 3JZ7A 3TVMB 3MZTA 4TPRL 4Y4FC 1GSMA 3VFOA 1G0DA 2DIAA 4L1HA 3DGGB 1LO4L 2EICA 4I0PA 2AJZB 3E1F1 1DFBH 1OTTD 2PW1B 3QJFA 4AK1A 2HN7B 3QZWA 2OMNA 1WBYA 3W9DA 4X7SL 5E99L 4HXBH 3QIWB 2XYCA 3D0VA 3ARRA 5A2FA 1B0RB 1FNHA 4JRXA 3RVXC 4NWTH 5TDOA 5F6HI 3SQOH 3ULVL 3P9LA 3U2SB 4J6RH 1MJUH 2AABH 3HMXA 3ZYZA 5CWSA 3X14B 3EYVA 1ZK9A 2I9TA 4JFQB 3UTSE 3TBWB 5IHZA 4HFUL 5F71A 3WNMA 3V95A 1HQRA 4HIIB 4UIKL 2AXFB 5DEFA 1IAMA 1RJYB 3HNTH 1DLHB 1YDPB 5HPOA 2ZOLB 4YHML 3CZFA 2H2SD 4XVJL 3T8XB 2NW3B 4ONGL 2YD9A 5LGHH 3HNSH 3BZDA 3RU8H 1A1OB 3QEQE 3VMOA 2YRZA 5KJRH 3QAZC 3IFLL 3GK8H 3KS0H 4NN6B 4I0CC 2JELH 3HPLB 4PRPB 1W0YT 4KTEL 4U6HA 4XWGH 3EOBB 4QRUA 1SYSA 4X7DC 1HHHA 3WFCH 2IALA 4JEGB 3RVUC 1DQQB 5AZ2L 4F8TA 3QFJB 4ODUA 3VWKC 2EIZA 3I75A 2ZJSH 5GRJL 4MA7H 5JIIA 3E3QE 3LSOB 5GJSH 1YJDL 3C5SA 3JV6A 4WU5B 4M7ZB 3UTQB 1YN7A 3PP3K 1QVOA 1KLUA 4XXCC 3BKYH 1BQHG 4TTDD 2FO4B 3FZUD 2ICCA 1BGXL 3UYOD 1XIWC 3WNNA 2R0KL 4HHAA 3LB6C 1MCPH 2FR4B 3JWDL 3I6LE 5INCB 3VDAA 3FOLA 3VXNB 4V1DD 1F6FB 1CS6A 3LQMA 1RK1B 2PR4H 1YMMD 4WFHE 5JW4M 4N1EA 1MJ8H 2WP3O 5FUCC 2AV7A 5FUOL 1HHKB 2VZVA 3TBVB 2V9RA 3WEXA 3IF1A 4Y19A 3U30B 1VESA 1CXLA 4K3DL 4KROD 1WQVT 5I73C 5C0AB 3V4UL 3RVWD 3QFJE 4KTDL 4NQXB 4RDQF 4WW1B 3ABZA 3T3MF 2DQUH 2W65A 4PG9B 3BP7B 5FV1L 3RL1A 4N8VA 5AD0A 3T0XA 4LNRB 3V7AE 4QXWA 3QHZL 3WMSA 3CK0H 3GI8L 2B0SL 2KZ1B 3BDYL 1T2QH 5LQBL 4RWYH 4QRQB 5E08H 2H3NA 4Y88A 4JFOA 4WIQA 3MGOA 2W9EH 4X99A 4QXGH 4YHYB 1SJEA 4G9FA 4X6DB 4LP5A 4RFEB 4X5XA 1KPUA 2EDFA 3VFWB 3MYJB 1IQDB 4IOSD 4LDOB 4JFDB 2NY4C 1IE5A 5EU4B 5MP6H 1D3CA 2OX5A 3MNWA 4HDIA 4NRYB 1K8DB 3OGOE 2GSIA 3AU1A 1PLGL 2VDOH 4G42A 4Z77B 3MV01 4YDKH 5C6TH 2F5BL 1S9VB 4L29A 5TE6H 5FF6B 2FSEB 5EBMB 1LO5A 1LEGA 3MNVB 3ARXA 4B41A 5IB4B 1MFEH 3TZVC 1NCDL 3RGVB 1UZ6E 4TSAH 3DXAA 1AXSB 3MTRA 5JXAL 4GXVL 1P5UA 1WWCA 4L4VD 1FNGA 5IKCB 1OM3L 1CWVA 3RKPA 2WAHA 3HRZA 3QYCA 3JTTA 4IRJC 2LAGB 3M45A 2CKBL 3QSKB 1J1XL 3EO0B 5GRZA 4LK4A 3H42H 2HLAA 3BH8B 3QJHA 4S1DD 2HT4C 2CMRL 1MWAA 5MEPA 2DMCA 1BIIA 4X6DE 4GRWH 2JCCA 5E4EC 3GMLB 4QXTA 3WXVH 2XQYK 3KPNB 1G7IB 2DRUA 2R15A 4M9PA 4PJGB 5LAXB 3LVEA 1Q9WA 1JV5A 5IJKC 2KDGA 1A7QH 3T2QA 3WIFB 4P2OA 5ANME 4LHUG 5BW7C 4ODSH 4Y5XA 4RX4A 4EZMA 3KAAA 1PSKH 3UPCA 2J8UA 5DFVD 3RUGF 3WLBB 2VWEC 5FOBA 3TYGL 3VGGA 2QQLH 2GW5A 3BVNA 4BKLB 3ESUF 3P4OA 5EPMA 3WS6C 4NO0A 3RNKB 1I1YB 1NFDB 1MCOH 3TT3H 4K3HA 4UTAL 3KPQB 4JJ5B 4GMTL 2ITCB 2QADD 3I6KA 3PABB 4L8BA 4XB7A 4L8CB 1JNHB 1NDMB 1QFWH 2APWA 3UTSD 2X44D 3K7UA 4GAGL 3HAEB 4D0DA 4F2MB 5GRVL 1IKNA 5FKAA 1UKSA 1PY9A 3NVQA 4MJ2A 4MMZC 4WI6A 1W8OA 3KR3L 4JKWA 3TPUA 2FB4H 3ZT6A 5B21A 1ZKAA 2C26A 4P23C 4DTGH 1OHQA 4Q9QL 4GRLD 1AQDA 3GJFK 5EBGA 3ZDXE 4M1GL 5EOCL 3UJIL 1AY1H 3TVMD 3GIZH 5F3BA 4PJ7F 1LO3L 5DHYB 3NACH 5TDNA 3N9GH 1FNSL 3QNYB 4IIQC 3HC0B 5E1AA 4YAQA 3NCEB 4MCYA 3S5LG 1AXTL 4M5ZH 2XY2A 5KOVC 1MCNA 1NCBL 4PRIB 3U9PH 2MMXA 2NLJB 3GSRA 2G5BA 3QIWD 4E0RB 4E9LA 3BEVA 5E2UL 1CBVL 4JRYA 4EI5A 3U7WL 2FEEL 3D5OF 2X09A 5M94B 4LVNB 4AEIH 3D39E 5F88A 3KYMB 5BV7H 2ATPB 4G6JL 4N0RA 5C6PB 1CU4H 5C0CB 3C60A 4N0FA 1ZA3A 1U3HB 1RZKL 4LIQL 4RMUA 3SDYL 2FO1A 4TUKL 5GPRA 2QHLA 4GLRH 4RAUA 2GK0A 4YPGB 2V9TA 2YN3A 3JTSB 1CG9B 3LKRB 1P6AB 2NW2B 2VQTA 3B8YA 3BFOA 1Q72L 3HLAA 3O9WA 3PWNA 4BELD 1P4IL 3C6LA 4JQXC 3S36X 3TWCL 2BCKA 2BNUA 4M6NH 2FX7L 2XNAA 4WFHD 4HJ0C 4JHAH 3GSOA 3G6JB 4FNLL 5SWZA 1UACL 35C8H 1KJMA 4PRPD 1D9KC 3QNXB 4Y5YC 3VRLE 4AIXA 5SX4I 3S88H 3GMRB 1ED3B 4LF3A 1T21B 3V6OE 3X11B 5FYKH 3BH9B 2X89D 2VERN 4YPJA 5DFWH 1CLOL 2DBLL 1H8SA 3QFJD 5C9JA 3WJLA 4ZNEA 1WAAF 3FT4A 4HV8A 1A6VL 2AEQL 4Y4KC 5C0CE 3K8MA 4MAYC 3IJYA 3L5WB 4UT6H 1QSZA 3H8NA 4XRCA 2LTQC 3LD8C 2QLVB 1A4KA 4ODWB 5FB8A 5ALBH 3HA0A 1QFUH 4QRTA 1A6UH 3ARFC 1JNJA 4GBXB 1RUMH 4Z0BL 4CVXB 2VQ1B 5IEKA 2H41A 3UTZA 3WYRA 1HEZB 2CJUL 5ICXA 5KVGH 1A9EB 2N1KA 15C8H 1TMCB 2H32B 3FT2A 4OCXL 1BVZA 1VKXB 3ES6A 5L6YH 5B8CC 5DUMH 3S98A 1HE7A 5TE4H 2HRPH 4PP1C 2PETA 4D8PB 5K9KB 2G9HA 2VN4A 3SO3C 1D5ZB 3O2WL 3S35H 2C3WA 4LSUL 3QCTL 4NQUA 2MKLC 3OV6A 5D96C 4B5EA 5IHUH 3L7FB 3MV8E 4HZAA 5C0AD 1MWAL 1WZ1H 5L0QC 3VXRA 2WBJA 3IDXH 3FN0H 3BE1H 4HWNA 2KQNA 2HFFB 1H3PL 4PB9L 1AJ7H 4K71C 1J05B 3V5DA 3QHFH 1ORQA 4LBEB 3KYNA 3F5WB 2EDHA 2VZ1A 4JLRB 2A74A 2V2TA 4PY8I 3W0WA 2VLKB 4OCWL 2C1PB 2PXYB 3QHTC 1R3HB 2X4QA 2P8MA 3U48A 2VL5B 4MD5B 2IADB 3OZ9L 2EH8H 4KU1A 5F1KC 3ZE2F 2C3VA 3QXAA 1TPXC 5SWQA 1FCCA 4ZO7A 1RZFL 3CMOH 4UV4H 3OR6A 1IAIH 1RMFH 4WW2F 2OSLA 4PJBA 2BMKA 3DX7B 4UV7H 1UCBH 5KN5A 3FQXA 1JHKH 2DKUA 2HAZA 4K8RD 4Z7VE 2X4OB 3N1GC 4M1DL 25C8H 4JB9L 5I8EB 4DK3A 1YECL 4U7MA 2HVJB 4RA3A 3UTTB 4BQCA 4L4JA 8FABB 3MOBL 1PEWA 3EYQC 1RUKL 3FQNA 1IBGL 1XGPA 5EBLA 4C83A 5C0JB 1XF3B 2JF1A 4KRLB 3BZFA 4UUJA 1CE1H 4UNTA 1S78C 1B6UA 3FO1B 5FDYA 3O6FB 3MBXL 4O5LH 4NNPH 4JFZH 5C0RH 3MLTA 1A6AA 5DJ0B 3L6FA 4HWZA 5IW6B 1I8LA 3QPXL 3L1OL 4U6TA 4F3FA 2FIRT 4XCEA 5A1AA 4F7EB 4KJWD 1U91B 3ZDYE 4H20H 1M71A 1BMGA 4HT1L 4LU5L 1KGCE 2FBJH 1DLFH 2DLFL 1LP9B 4R4FH 1N6QH 3B9KB 1PJ9A 2A73B 3LIZL 3TBSA 3BZ4B 3H0TB 5LCVL 4MNQA 4P4KC 1HHIA 2C3HA 2CIKA 4BSWB 3QCUL 3RA7H 1FNEB 1AKJA 3WDIA 3MRBA 4LMQI 4PG2C 3UTTE 1U95B 1FO0A 5I71C 5IB3A 2XN9E 4LVOC 4AEFA 4HH9B 5FCUL 4DEPC 4TVSa 3BD5A 3O2VH 2OP4L 1T89C 3MGTA 3AUVA 5TF1H 4CN4A 3PGCA 3U4EB 5D2LA 5DJYA 1QQDB 2HH0H 3D39D 5D5MF 3GFUA 2OR9L 1G9ML 2JB6B 5KSBA 3D18B 1QSFE 2UZIH 4XWOD 5GHWL 3ARDB 1RI8A 1JF5A 5D1ZC 4ZYKA 4FG6C 2BVYA 3T09A 5HHOB 4Z8FL 3MUY1 3FO2A 3QUMA 3WJJA 2VLME 4YBLC 3SE9L 1EGJH 1RIHL 2J7LA 5IMOB 3TA3A 2ADFH 4S1QL 4JZOA 1U2HA 2YZ8A 2P5WB 4GAYA 3WN5B 5DJXA 3O6MH 3CDFA 1W72H 4WHTB 1MCDA 4ZQKA 1MY7A 1PKQA 2VDKH 4HWBL 3V5HB 4CVUA 1HN1A 3ARYA 4KKAC 2IH3B 1AGBA 1R6VA 3AMKA 1A7RL 2M1KA 1DDHB 2VUOA 3OJDA 5A2JH 2QJDA 2XFXB 3WIIH 3B2UC 1U8OB 1G7JB 3L5IA 1D5XA 2G2RA 3LEYL 1YZZA 2Z91B 1BAFL 4HS3A 3P73B 5C0CD 4FFYH 1GOHA 1U3HD 1RSFA 4J1UB 1ZS8A 1VFBB 2B5IC 5EIIA 5C2UB 3S6CA 1EEQA 4DKFL 1B4JL 3IXAB 4LLVB 3MYZA 5HHOE 5D7IB 1RJZA 2QR0A 4MA8L 3U1SL 3K0WA 4EN3D 3WHE1 1NJ9A 1KNOB 1OAQL 2NR6D 4RFOL 3DUHA 5DEZA 3NFSL 1QLEH 2P5WE 4PJFB 5DK2B 1QLRB 3SDXF 5LWYL 3EFFA 2NTFA 1FIGH 2I07A 4FHBD 4K9EL 5BQ7A 4Z7WB 2X70A 5C07E 5F1NA 3INUL 3DETC 4MQSB 3NN8B 5L2KB 2W59A 2Y72A 2BNRA 2CDEA 1XGRA 2EE6A 1OTTC 5JXEC 1FV1A 2XA8L 1JGUH 1ES0B 3U6RA 2D31A 1YJDC 2CLVB 2AKRA 3PNWB 5DMKA 5GGSB 5T33H 5EO0A 3L3IA 1FC2D 2XWTB 2VXVH 3ILQC 5J6GA 1CXHA 4AH2B 1U8PA 3U46B 3EFDH 5GGRY 4P3CL 1ZVHA 1PBYA 3DVNB 1RIUL 4JHBA 3AM8C 1Q8MA 5KSVA 1KIRB 2XXCB 3JWDC 1BX2A 1A3RH 4HMCA 5CEZE 5ESQB 5C0IB 1JFQL 1BFOB 5EZIL 1N4XL 5HGBB 4PJ9A 3CFKA 4GBXD 4FQLH 1DBJH 1TENA 5IG7A 3GHEH 4OB5L 4OV5A 2NNAB 1CK0H 5HYQA 3DIFA 4ZTOL 2DQEH 1D6VH 5HD8C 4PJFE 4D9LH 1UEMA 1X44A 5DRWB 4UDTA 1YPZB 4XNZB 3UTOA 1RURH 6FABL 2VXTL 4GXUM 4I2XA 1EV2E 2R1XA 3FHQA 2NY5L 1C12B 2VUYA 4ODVL 5E24E 4JJHA 2FGWH 5DD6A 3QDGB 5D7KE 2GK2A 3K2MC 3VXQA 4XP5H 1T7ZA 4YGVB 2ZP0T 3AREA 3BPCB 1A14H 1JVKA 4KI5C 2XI9A 1UJ3A 3EJJX 1IL1B 4LLWB 4N0YH 1JWUA 3ULUH 1KCSL 3AFLA 4YC2B 5FO9B 3LS4H 1PEZA 3GRWH 4UQ3A 5C0BE 1Y6NR 1SVZA 3CCHB 4LP4A 3P77A 5MENA 1QSEA 3CLFH 5K9OA 2BJMH 3MBEA 1FDLL 1YMHA 4TUOB 3CVIL 5FHBH 4R3SA 4APQD 1BPVA 3JV5A 1KCRL 2A1WH 4WNQB 2WUBH 2EC9U 4XXDB 12E8L 1BD2A 1R0AH 2HT3C 3T1FA 5ESAB 1BM3H 5ILTH 3KPMA 2PYFA 2IEPA 4PREA 1NBVL 3CVHH 1WZMA 2D7TH 5ETUA 3HPJB 4K2UH 4P3DB 1S7XB 4O51B 3PDOA 1JMXA 1HZHL 3M1BB 1FO0L 4X98A 2CK2A 3D9AH 3HI1B 4KKBD 3EO9L 4PJAB 4WI7A 1KIPB 1J18A 5E00B 3KHQA 4M43L 3MRJA 1FBIH 1R5IB 3ULVE 3QIBB 5CJXA 1IAKA 4KROC 3T0BA 3S36H 1TQBB 1RZJL 4WUKL 3RVWC 1KF9B 3OPZH 3OXSB 4QGYA 1AQKL 3PIQA 5LXGH 5EUOE 5E2JA 1BVKA 2ENSA 3UTTD 1WZKA 3PL6B 3IFNH 1NC2A 4UQ2B 3T2NH 1N64L 2IQ9H 3QUML 5BRZB 1OAXH 3GSNB 2E5EA 2J88L 1UC6A 3DTXA 4U1IB 3AAZA 1NCCH 2RR3A 1JMZA 3Q6FB 1YNKH 1JHTA 3H3BC 3IB4A 2YPKB 2V9QA 5E2VL 3WV0A 4PGJA 4K23H 5FAAA 2FECL 3PGDA 5D7LB 5C08B 4OSUH 1FRGL 3B8SA 3LN4A 1NKRA 1IEHA 4HPYH 4NQSA 1IGJA 3KPRA 2LQRA 3ZKXC 3HFMH 1HILA 3GHBH 4QEGA 1NBZB 4NN5B 3IDIA 4X6CA 1G0XA 3GJEB 4YHPA 2NY0B 3KVQA 2E7LC 4PJAE 5IB1B 3X13B 1HINH 4OLZL 4PRHA 2VLMD 5CSZB 5HYJA 1FNAA 4R0LA 5ID0B 5E2TL 1JBJA 2BHZA 5HVGB 4OT1H 1EUTA 3BEWB 4LPYA 1LQSR 4HK0A 4G80A 4C57C 2BSRA 2DTML 3SDAD 3O3DA 3K1KC 3GUTB 5ITBL 3A6CH 4RAVA 3VCLB 2J6EA 1CIDA 4UAOB 5EC2B 2R2HB 1YEEH 2NZIA 1HHGB 1TETH 1MHCA 4PRNB 4HH8A 5J1SC 3L3JA 4YX2H 3FO0H 2VLLA 5DJCB 4JANB 4GSDL 3FRUB 3HUJE 2VTFA 4U7SA 1OB1A 4S1DC 1YUHA 5C08E 4FQ1H 4KGLA 3WHE0 4NBZB 4OQ1A 4NQVA 4S1RH 3ARDD 1FFQA 3LAFA 5DD0H 3E6FB 2F9BT 4XP9H 4DAGH 4N5UA 2AK1H 3EZJB 5HHOD 1GOFA 4Q9BA 1KN2L 2VITB 2ZUQC 3O8XC 3UZEA 2BY2A 4LSPH 3W2DL 1K4DB 1X5LA 2P5WD 5EH1A 4LCWE 4UILH 3HN3A 2Q7NA 2NY6D 2APXA 4HUXA 2IJ0C 1S7VB 2ESVE 2BSTA 3EOTH 2FHFA 5DFVC 1OP3H 3C5ZA 3DBXB 4L1DA 1QYGH 3DURB 5T3ZE 4Z7QF 7FABH 1YQVH 4CMHC 2O61B 4KV5E 5D93B 3CUPA 1RZKC 1I3UA 1AD0A 2BK8A 5JMRA 5HDBE 2A6DB 2X4SB 3TV3H 1JHLH 5HGHB 4X6EA 1V3LA 3QZWG 2V5SA 2QADC 1MHHA 1WBYB 3W9DB 2VABA 1R5WB 1OTSD 5FM8A 5BS0A 3WFDH 5EC1B 3A6OA 1IFHH 1I7TA 4DN3H 2ZCLL 1JN6B 4EXKA 2AS5M 4JKKA 1QRKA 2Z35A 4JRXB 3P9LB 5TQ2L 1QD0A 2DAVA 2G60H 2JIXA 3MRIA 5D6CA 3WNKA 2XPGB 1G7QB 1AGDA 1UG9A 4X8JB 1I8KA 3RTQD 5CWSB 5CJQL 1CDIA 1JI2A 1VADB 4KK6C 3MGAA 1P9MC 4OTXH 3BPOB 3PV7A 3TVMC 2I9TB 4NQEB 4JO2H 5IHZB 4EDWH 2Y07H 2YZ1A 3HC3H 3IYLW 1MY5A 5T5NG 2BP3A 2NXZB 1QRNA 2UVFA 1EZVY 3SPVB 4OCRH 1E6OH 5D7KD 5DEFB 4M48H 3BZEA 4XPBL 1RZIB 3TJEL 2OMBA 3P9MB 3QIWC 4HKBA 2MOVA 3P2TA 2D03H 4LMQE 1FVDA 4WTXA 4DKDC 1F4YH 1JRHL 2ILLA 4I77L 1QUNA 1A2YB 4OD3H 4K7PH 5C0BD 5FYJE 4PYGA 1WC7B 4JDZA 3OR7A 4RGOL 3T0EA 1U8HA 2YK1H 2APFA 3RQ3A 3A0OA 1OAYH 1T80A 5IB2B 5D72L 2EIEA 4H5SA 1K6QH 2BRRH 4JRXE 4PRBB 3REVA 1UYWL 5HY9B 4WV1A 4C4KT 2UY6A 3K4DA 5GGVH 1KTRL 3QBTB 2CK0L 5E8PA 4BK5A 3C5SB 3U36B 4AY0A 4AM0A 1PZUB 3BJLA 4MX7A 4Y5VB 1KCUH 4O9HL 5HGDA 4MNGB 1KLUB 3QUYC 3MLZH