5DXWA

Crystal structure of mouse pd-l1 nanobody
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
QVQLVETGGGLVQPGGSLRLSCTASGFTFSMHAMTWYRQAPGKQRELVAVITSHGDRANYTDSVRGRFTISRDNTKNMVYLQMNSLKPEDTAVYYCNVPRYDSWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PD-L1 nanobody
publication title Crystal structure of mouse PD-L1 nanobody
rcsb
source organism Camelidae
molecule tags Signaling protein
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dxwA00
4O58L 4LSUL 4M7ZC 5LGJB 1AQKL 4UUJA 1K85A 4ZD3H 4G6AD 1EAJA 3KJ6L 1JZ3A 1RZJH 4KKCD 1OAXL 5B3NA 3SOBH 4RGMB 2CKBH 3A6BL 1U95A 5KSAC 2KBGA 4ZPVB 4OLXH 2X05A 5L8LB 3SOBL 1IAII 3CC5A 1UENA 3KPRA 3SDDD 1AR2A 4N5UA 1R5VB 2OJEA 1YPZB 4OLXL 3IFLH 1ADQA 3EDKA 1AE6H 4HV8A 4XWGH 4LQFH 3CXHK 4N0FB 5IVZA 5MEQB 3MRLB 4S0TD 2IQAB 3RWGB 1HH6A 1IGFH 3TBTA 1AE6L 2VLJB 3QDMA 3JUYA 3P4OB 2R1XA 5LXGH 2G5BA 3GI9L 5AG8A 2JB6A 4F58L 5IJKA 3DX7B 3CXHJ 2E9WA 4P46D 1LDSA 2VWEC 1IGFL 4RGNC 4K55A 1TCRB 3B2UD 5LXGL 5GGVL 5HDQH 1RZJC 4M61A 5IMMB 1JYXA 4GAJH 1KJVB 3ECBA 2Z31C 4DZ8B 2YPLA 3JV4A 3ULSA 4OLWL 5I1DA 4JO1H 5HDQL 2P1YA 5IMKA 4MDJB 1N4XH 4ZUVB 3RTQD 3TCXA 1ZHBB 1XR8A 5GGRA 4M00A 5IB3B 4HWUA 3BYYA 1DANU 4JO1L 1CQYA 4ERSL 4K23H 4KAQL 3IETB 1N4XL 2G60H 1M7DA 3JWOL 4YDJA 3RL1B 4X7DC 4YR6B 4ZAKD 3G6JE 1TMCB 1GGTA 2KL6A 1GGIH 1M05B 1KB5H 2WW8A 4D9LH 4QHLB 2PO6D 4K23L 2XY1A 2QADD 4HMDA 3LEXA 4PJDB 3H9YA 1UGNA 4MA7H 5ITFB 5IB2B 2DQTH 2ED7A 3L3IA 1KLFA 5CILH 1KB5L 3UPRB 4JHWH 1SQ2N 3P77A 5GHWH 3VG9C 1UC6A 3AUVA 9CGTA 2Y07L 5IF0A 4MA7L 4YHMH 1MRFH 3OX8A 2DQTL 1T04B 2LQRA 5CILL 3JTTA 2PYEE 1LILA 4MDIB 4JHWL 5GHWL 1ND0B 3DX8B 5ELIA 4UU9A 1MRFL 5I71C 3D18A 4NZJA 4S1QH 4NHUA 4RX4D 3AAZB 5C8JA 5E24E 1PGRB 1P5VA 4L8SC 5I17A 4XH2A 1F58H 4O02H 1PZUB 1ETZA 2XTJC 3VXUB 4HT1L 1U8MA 4S1QL 4U31A 2MNUA 4JDVA 3L1OH 2AKRA 4R7NA 1QFWH 4ORZC 2EDFA 4N68A 3DVNA 3MODL 2XG5A 2YSSB 1F58L 4O02L 3PABA 1JUFB 1D5BB 3QFJE 1KG0B 4MCYA 3SJVA 5L2JA 3L1OL 2ZNWA 5GRJH 5C0CB 5SV3A 1MIMH 3VXPA 5EO0A 4Y88A 5EZIH 2NR6D 2HG5A 3WYRA 4NKIH 1E0OB 1DVFD 5C09A 4JFYA 1G0DA 5GRJL 3G04A 1ZHKA 4JDZA 3DECA 1ZGLM 4NKIL 2MJWA 1MVUB 3BZDA 4D8PB 1HHHA 5C9KA 5DJ6B 1FV1B 4HK0B 5F6HJ 2F58H 2CLZB 4R8WH 3EYFA 3BIKB 1X5HA 2JJUA 1NAMA 4Q0XL 5E70A 5J11B 3W5MA 5FYKU 2DWEA 1YUHB 4CN4A 4TTDD 1VFBA 3BGFC 3GMLA 1UZ6F 3CSBA 4P3DA 1W0WA 4R8WL 5HYQA 5CS7A 3S88L 4OAWA 3FQXB 4ZFZA 1Y0LA 5I16B 4D9RD 1K3ZA 4XNMA 2X4NB 3CSPA 2P8MB 1ZT4B 3FB6B 4G6JL 4U1NB 4LF3B 4QRRE 3OV6A 1HIMH 5L6YH 1U92A 1ZVHA 4HS8H 5CUSH 1TVDA 5CD3A 4I8DA 1S7WB 4ZXBA 3C60D 3QEHA 3FO9A 1HIML 4HS8L 5T33H 5CUSL 3RX5A 5CFHA 1NANH 1XCQA 2BY1A 2GQHA 1T66C 4K3HA 5EBGA 1UT9A 1AGBB 1B6DA 2FJHB 5T33L 3RWJB 3KPPA 2X40A 2NW2A 2RIKA 3ZKMD 1HQ4A 1FO0B 3QNXB 3VRIB 1MEXL 3MRIA 3F7PC 4DK6A 1BFOB 1XH3A 2NX5A 1JPST 2PTUA 5E4EC 3H7LA 5DFVD 4JPWH 2P49B 3BEVA 4XNXH 3LS4L 3LVEA 4TUKH 5MEOA 3ARED 4LPWA 5C0FB 3VXSD 3DGGB 4NRYA 4PLOB 4PJCA 3BDBA 3AGVA 1IM9D 1RK0A 3VXOB 4WW2B 4XNXL 1I1FB 1QLRB 1T0PB 5HGBB 1CLCA 5E7FA 1IGCH 2ITDB 3X3FL 1JGLH 5DRWA 3QDAA 5ESAB 4H26B 1CL7I 1OSZB 3BYTA 4P2RA 4RRPG 3T65A 4MMZC 2E5EA 4BKLB 1E27A 4OLZH 1IGCL 1JGLL 2BOCB 4FA8A 2IMMA 5D2NA 3CPLA 4O2EA 4OQTA 3VG0H 4Z5RA 4PY7A 4N0CC 4YEFA 3C5ZA 4OKVB 4OLZL 5EC2A 1TZHA 3RWEA 1FC1A 1LK2A 4HKBB 5H94B 3WNMA 5I2IA 3VG0L 2EEDA 4FZEH 5J6HA 1JBJA 3PG2A 5D1XB 5E99H 5E95B 3EO9H 3HB3C 5DEGA 3PWVB 4JN1L 1AGEB 5TQ0H 3WKNA 5AYUH 2VAAA 3SKJH 2L7UA 2FBJL 3GMMA 5GJTL 5T1DL 3ZYOA 4KROC 4L9DA 1CXFA 1NAKH 4F7MB 5E99L 4CMHB 3EO9L 1MHCA 4NYLA 4Q6IB 3H7BA 4JRYD 1RQ5A 2BSSB 2FDBP 4PBVC 4YWGL 1BLNA 3RWFB 1I1YA 1NAKL 1UH4A 3EJZD 1QPXA 4NUJB 5BZWB 2GSGB 4HF5H 4UINH 1RZIB 4H1LB 4P59L 3L5WB 2EYSA 3IDGA 3V7MA 2XZCL 4KJWD 3HFMH 5GZOC 4UINL 3EAKA 1YYML 3SCMB 3ULVH 4X9FA 5BRZA 1T0MA 2DI9A 1W8OA 1A7QH 3FONB 4EIZC 1DE4A 4DGIH 4YBHA 4LPVA 1S7SA 3GSNB 4BK5A 1FLRH 4L8BB 2DM3A 3HFML 4NQDA 2ZNXA 4WUUA 1U58B 3ULVL 2R1YA 2E7LC 4S1DD 3ZYIA 5IW1A 1A7QL 4DGIL 4FQLH 4G9DB 5FUCC 5EU4A 2X89A 3LQZA 5AZEH 4GXUN 3V8OA 4W6YB 4TRPL 1OTTC 4H0IA 5TE6H 1ZVYA 3T2PA 5C08B 2NW3B 5H8DA 5EBLB 1T7ZA 2BRQA 1PEWA 1GGUA 4X98B 5TE6L 5H37H 5BO1L 3UP1A 2K7QA 4R4BB 2KQNA 1BFVL 4FQQA 4L9LC 3BGMB 1YNKH 3QBTB 3OKNA 3RVUD 1UYWL 2IGFL 1FYTB 5E2VH 3I6GB 1A1OA 3ARDA 3ULVC 1OWRM 2W60A 3CDCA 1CE6B 5LGHL 5IB1B 4PJ9B 3QDJA 1FZJB 5E2VL 4E42A 1ZV5A 4HMCA 1F42A 4TVPE 4Y4HB 4WU7B 2E8ZA 4OZGF 4B50A 4GKZB 2OJZH 4QTHB 3TBYA 1F3JA 1QQDA 1GZPB 3PWPD 5EZJB 4L3ED 1Q38A 5T3XH 4QNPE 4Y19B 3MFFB 3UJTH 3W11D 1X5XA 4OGZA 2OJZL 4Z7OE 4XPBL 4S1SH 3PQYB 3ARBD 3L3JB 3OR6B 2YXFA 3SGJA 1R5IA 4NO2A 1DANT 1UA6H 5CLTA 3S36H 3F58L 4S1SL 1AGCB 3TWCL 1QFWI 3MNWA 4U1GC 4Y2DA 3OG4B 5JUEH 2IBGA 4XVUC 1UA6L 3MV8D 4OKDA 4PRAB 3HG1B 2ADFH 3GUTA 1A1NB 4FXGA 1MCJA 5ETUA 3VJ6A 4ONOA 5JUEL 1W2KT 5CWSA 4JFEB 2ADFL 3GIVA 4WWID 3REVB 3KPLA 2IH1B 3I02B 5D7JB 3VXNA 3CU7A 5E5UB 2Q7YA 3NPSC 2R9HC 5D7LA 4PD4J 5KANG 2FWOB 5C7XH 5BZDB 5JXED 5CEYB 1FL3B 3BMWA 3H9SA 5KSAA 2G2RB 1XIWD 5INDA 3I75B 5CIPH 1QSFA 4X6BA 3VGBA 2FHBA 4JO2H 4U7KA 5FDWB 1VB9A 2NY0B 1U93B 4NPYA 1JGEB 4KKAC 1LE9A 2BMKA 3IGAA 4WEUD 2WBWB 4OZ4B 3Q6GL 1RZFH 1S78D 4HS3B 2NY5L 3SDXA 3DO7B 3C09C 4IOFC 1RK1A 3BZ4B 5DQ9A 2ED9A 5MENE 3VU2A 4JZNA 2CGRH 2WP3T 4PJEA 1OD9A 1RZFL 2JIXD 3G6JB 3HKFA 1U3JA 5FB8A 1LE5A 5HGHB 3V0WH 1LEGB 2XZAH 3VD5A 1HEZB 5DJCA 5DQJB 3GMRB 5CKGA 2DLGA 1UQSB 3IJHB 4M7LL 4NKDB 4PJHA 3BSZH 4YZFF 2XZAL 4E0RA 4JFQA 3A67L 3X12B 3BZEB 1CDGA 3IDYC 5DJ2B 4KKBD 1RJLA 3RUGB 4ETQB 2VR5A 4LSRH 1BJ1H 1XGPB 5L9DH 4LRIC 4J7RA 5E9DB 1NANI 5FYLE 3BSZL 2EH7H 2PYEB 2YA1A 3T0BA 1M7IB 2NY5C 4LSRL 5T5NG 3RVVC 4OF0A 1WWCA 3PP4H 5L9DL 3TH2T 3TVMC 2EH7L 3FB5B 5FYJD 5ILTL 2D4DA 4U1LB 2FH8A 2ZSWA 3PP4L 4JLRB 1IVLA 3ETBF 1FL5A 5L2KA 1ZWIA 5EU5A 1QVOA 1T5WA 3KPQB 4PUBH 1EDQA 3H2WA 2EECA 4PJ7E 5HHNA 4DN3H 4PP1C 1MHPL 5I1CH 3IFNH 2G5RA 3LH2L 1U8OB 2BNRD 3ROOB 3SKNA 5FDYA 4MZ2A 2AQ2A 4YJZL 3LN9A 5C0AA 4DN3L 1LNUA 5I1CL 3IFNL 3KLHC 4B0MM 5D1ZC 4M7JH 1ORSA 5SX4I 4HQQH 1N26A 3H3PH 1U8JB 1FZKA 3QEQD 4OV5A 4G9FE 4NRXA 3ULVF 4JHAH 4FZ8H 5B8CB 4M7JL 1TQBC 3HZVA 5FA4A 5FGCE 1D5ZA 3WFBH 3H3PL 5DHVA 1T1YB 4QRUB 5ESQA 3IXTB 4JHAL 2WLYA 5GSRB 1NUDA 2EYTA 4FTVA 4FZ8L 3A0OA 4JGMA 4NP4H 3NN8A 1GC1H 1KB5A 3P30H 1S9VB 2VZUA 4G8GA 4GG8B 4ZUSB 1TTFA 4Z7VA 4RWHA 4K8RL 1LGVA 4LLDA 4NP4L 4JFXB 1WZMA 3LS5H 3P30L 1PG7H 4XCEA 5F9AC 3D0LA 2VLRD 2VL5A 4IJ3B 4P4KD 4PRHA 4OIAA 4NDMB 3TV3L 2AJXH 3LMJH 1VSCA 3SPVB 3VFUB 5JNYA 1RZGB 3UBXB 1BQHB 3LS5L 3REWB 1CD1B 1PG7L 2VR9A 3LKNA 3GJFA 4FQJL 2P5EE 4MNHB 1IAOB 1KGCE 4O4YL 3S3JA 3LMJL 1YY8A 3M8OH 1F00I 3DX9A 5GSVB 5DJ0A 3TFKC 2A77H 1NPUA 5T1KB 3QULA 4JY6B 1PBYA 2GITB 4FFZL 1Q9KB 2NY4D 3C2AH 3QNZA 1G7MA 4MD4A 2BNQD 1J0YA 4U4BA 2W9DH 3I9GH 2DLEA 2VZ1A 2DQGH 3C2AL 3EFFA 2CD0A 3BXNA 2VLKD 3FJTA 4NFCA 4Q58C 4RMUA 4QO1A 2DYPD 2AEPL 2ESVA 2D9QB 4NQCB 3VI4F 1OP5H 4DKAA 5C0ND 1MWAL 3RPIB 4QCIA 2X9YA 3WIIH 5KANI 1OQOA 2A83B 1VESA 3F12A 3CD4A 3LEYH 1YMHA 3VH8B 4FQCH 1NUFA 2MKWA 3SDCA 4LPXA 4UIMA 5LJYH 2GYSA 1CQKA 4R9HA 2A6JB 3OKYA 4FQCL 4KC3B 3VXTB 3LKPA 2X4TB 4HDIA 1JK8A 2R8SH 2DLTA 1DTUA 1X6NA 1VADA 1EMTH 1FL6B 3IDUA 5E56A 2D7PA 1T6WA 4NNYA 2GFBA 1ONQB 4PS4L 2R8SL 1SVCP 2BJMH 1V7NH 2HJLA 1KF9B 3B9KD 4MA3B 1KFAL 4J1UB 3ROLB 1BZ9B 4XCCL 4XPHH 4MNQE 1IILE 3CFEA 1V7NL 5B3JF 2BVOA 3LSOA 4APQB 4HKZA 3VD3A 2P8PA 4AENB 2BSRB 5DI8A 4UNTA 3E6HB 2APBA 1A9BA 5FUZH 3L5XH 1ZANH 4ALAH 3F62A 3QJFB 4LLAA 4PJAE 4LDOB 4X9HA 3GIZH 5FUZL 3MRFA 5T3ZL 3TYGH 3L5XL 3L95A 4ALAL 3U9PH 4QHNA 1A3RH 4RGMC 4MWFB 3G08A 2NY6B 3KPSE 3PGDB 1J12A 1NDMA 5EZLB 3GIZL 3W82A 4S2SA 3DI2B 3O3AB 3TA3B 3TYGL 5HI5D 1A3RL 1CXLA 1G7IA 2APTA 2OBGA 4NZRH 3SE3C 3NCYS 3TGXA 1I1AD 3HPLA 1FVDA 1P84K 2BY3A 3E8UH 4P2OB 5E5RB 2A9NH 3MJ9L 3MNVB 3RKPA 5DJDA 3VFMA 2XKUA 2BVQB 1GOGA 5TDPB 3D39A 4YHOL 3R8QA 4JO3L 2A9NL 1LO3H 5IV2A 1P84J 2DKMA 3FO1A 1S7UA 4RMTA 4Z7WB 3BPNB 3R0MA 3OKMB 2IADA 5D72H 3DX6B 5DUBA 5ANMA 1LO3L 4PJXE 3RKDC 4HHAB 4Y1AA 1ZEAH 1MRCH 2E7LA 4ZOBA 2FZ3A 2VDRL 2X4PB 3CDGA 3RU8H 4U6XA 5D72L 5BW7C 4LCUB 4MAYA 4QXUH 3FQUB 1ZEAL 1MRCL 4MQXD 3HZKB 3E6FA 3PP3H 4YHKH 3RU8L 4KI5D 1BM3L 3K81A 1N59A 1NFIA 3OXSA 4GUPB 4QXUL 4GRLA 4JY5H 3CK0L 3FMGH 5AD0A 4L3CB 3DVGA 2PCPB 5EO1B 4BELD 2EKSA 5D5MB 3FMGL 2VUOA 3IT8D 3FB8A 2NY1D 3FRUA 2EO1A 3KLSA 2YBRB 5I66B 3L7EA 3WLWD 3FFCD 1NJ9B 4K3DH 1OHQA 1PLGH 1IC7H 3CDFA 4J6RH 1JV5B 3P9LA 1TZIB 3T0EB 2FJGA 3BRDA 3V7AG 3JWDH 3OKLB 4U6TA 1IC7L 3OKKB 1FP5A 4J6RL 3RY6C 4XP4H 4I2XE 3MRKA 3KNBA 4F7TB 3QG7L 3JWDL 4I48A 2Z8RA 2P24A 1RUQH 5J13B 4LMQE 1VFUA 4GMTH 1P7QD 3DV6A 4XP4L 1R3JA 3PL6D 1HHIA 3EYUH 4LAQH 3W5NA 1WVZA 1KT2B 5EU6E 1Z9OA 3KHQA 1RUQL 1JZ5A 3X17A 3CMOH 4JM2D 5E2TH 5EC1A 4KTDH 4JG1H 2ZUQC 3G5VA 1ZA3B 3EYUL 4LAQL 2I9LB 3GSRB 4Q9RH 2AJYH 2ZOKA 5E2TL 3DHJA 5F1IB 4KTDL 5MENB 2XV6B 3U36A 4I3RH 5HI3D 1TCMA 3WE6A 1F4AA 2V2TB 5IBTL 3RX7A 4Q9RL 3W39B 2HTKD 1MVFA 1A02N 4RMWA 2OTUB 4I3RL 2MOVA 2X10A 3AM8C 3JWDC 1F2XK 1FGVH 4J3SA 4OD1H 1A6UL 1CS6A 1C12A 4IRJA 2P5WD 5HYSA 1WISA 4KRNA 4N1HB 5F89A 3LN4A 4Z9KB 5J11C 5FGBC 4OD1L 1FO0H 1MH5B 3LN5A 3LV3A 4OZFG 1CFBA 3RAJH 1Y18A 2N7BA 2UUDH 2PXYD 1NCUA 1FO0L 4ZS6C 5KN5A 2X09A 1K8IB 3AMKA 4X6DA 3N1QC 3LKSA 1R3LA 3RAJL 4WWKA 5ACZA 5BMFL 1HI6A 1TJHH 2EC9T 4LFHG 3QH3B 1BOGB 5IM7B 5I1LA 2R2BA 3FTGB 1MIEH 5HYJD 1YEKL 4EUPG 3FB7A 3ZT5A 2HFEA 4MX7A 4HH9A 1HDMB 1YPZF 2CMRL 3NPZB 2M8XA 1S9YB 2D7OA 12E8H 4PJ7B 5IEHA 2H6PA 2W59A 4JREB 3KYMB 5EA0H 1NBZB 3JV6A 2CIIA 3BT2H 5GRUH 1ED3A 1JYNA 4JRXD 2D7NA 5IW6A 4LRIA 2ZG2A 5B4MC 3HZMA 2WWMC 1K8DB 1RFDH 5CIPA 1T1XA 4Q9QH 5EA0L 2XA3A 3BT2L 5GRVL 4LKXA 5CMAB 5GRUL 4OGAD 4Y4KD 3FOMA 4TUJB 3NIGE 3TVMA 5EDXA 4OFVA 5DFTA 4BH7A 4G9FB 1RFDL 2RFXB 5IVNA 4Q9QL 4KK8C 1DQTA 1JPGB 3BKJH 2VQUA 4QRPA 1WZLA 3KS0J 3MRBA 4WFFD 4NWUL 4R3SA 1FZMB 4WW2C 1JPFA 2K9UA 3WNPA 1AY1L 4C56A 4JQIH 3BH9B 1U8LA 1DLHA 1PZ5B 3LZFH 5FF6A 2YD8A 3QQ9D 4PGEB 1EXUA 4M48H 3CX5K 3K8MA 4D9QE 4RQQB 1A6ZA 5D1ZA 1H9VA 3QUYD 4LNVA 5AUMA 1EBPA 2CDGA 1ROWA 3QUKA 2EH8L 3CUPA 4M48L 3GSNH 2VXUH 3BMVA 5C6PB 2AV1A 2GJ6B 1HK6A 4KKNA 3TP4A 2FO4B 1JGVL 4X9GA 3IDJA 5D1XC 1GZQA 2MSPA 2R29L 2E7MA 4EVNA 3DTXB 4HCRH 5TFSH 4L4TA 5SWZA 1VGEH 3S37X 2YD1A 2ADJA 1PKQA 3FHQA 5FO8B 4JDTH 1MRDH 3ZT6A 4CMHC 3QUXD 4Q7DA 2EE6A 4MD5B 3FT4B 1QZ1A 4Q6IC 3L3HA 2VDKH 4FXLA 4HCRL 4ZOCA 1AHWA 1T22B 4M8QA 3PXJA 4G42B 1JMXA 3MJ7B 4UQ3A 1MRDL 5A1AA 5IMOB 5FYKD 1K2DB 4IM8A 5DWUH 3SDAD 5FFLA 4PJGE 4D9RE 4OLVL 4DVBB 4ZUWA 5MEPB 4J3OC 1JNJA 1O0VA 3SCMC 4N90D 5DSCB 2J1KA 5D2LB 3RZCB 1E4WH 3IFPA 4MCZA 2OL3L 3QNYB 5DD0H 3HLAA 4XTRD 4PREA 2OYPA 4G3YH 1TVBB 3UZQA 1E4WL 2BSED 4QRSA 5DD0L 1UWXK 5F44A 1SVZA 2YWZA 3MA7B 4G3YL 2F54D 4C4KO 2CJUH 3IKCA 3PGCB 5D7SH 3C9NA 3U0WL 1SEBA 3ZDXF 4NO5B 4XPAH 4QOKA 5FK9B 1DUYB 5ICYB 3O6FB 4LHUA 2CJUL 3BEWA 5D7SL 43CAA 4I3SH 3L7FA 5F7EH 1CTOA 3LDBB 2RQ8A 3O9WA 4LSTL 1GVIA 3VXSE 3ARYA 4MNQB 4CDHA 4I3SL 1CFNA 4L8CA 3FAWA 3MUY1 3RX8A 3PE9A 3UYRH 3IJYA 2D31A 4PJ9C 1II4E 2IANA 1RJZB 1FIEA 2NCMA 3MFGB 5D9SA 2VJXA 2V5TA 4Y4HC 5IKCA 3GB7B 1BECA 1FG2B 3UYRL 3DV4A 4LASL 2FLBT 5KBNC 2XICA 2FL5A 4WCYH 2YEZB 5I15H 3FO0H 3HI5H 2Q86A 2XZQH 1Z2KA 2QQKH 5CEZD 4GG6A 1EZVY 1KIRB 3BDYL 5JA8B 4W4OC 4OGXL 5F9JA 2CSPA 1CTNA 5F3BA 3KPSB 4XAWH 5GS0H 2R4RH 3TLRA 3OB0H 1F8TH 4F3FB 1MWAA 1R3KB 3NCJH 2HJFB 3HI5L 4WW1A 5F96H 1AXIB 2UVEA 2QQKL 4LSSH 4HIEB 3DHMA 4L1HA 3RNQB 1S5HA 2JE8A 5HD8D 2HT3C 5DYOA 5GS0L 4NT6B 4OZIE 3O3UN 4GKSB 1OF2A 5FHBH 3NCJL 5F96L 5CGTA 2IALA 4LSSL 3AMLA 1AJ7H 4ONGH 3G5ZA 4JRYE 3U4EB 2HFFA 2FYYB 5FHBL 4WW2F 1JJUA 5E08L 4OBSA 4ONGL 2YD3A 4HIXH 5D7JC 1OP9A 1DQDH 3SE4C 4Y8AA 4LPUA 1A0QH 4HIXL 4ZPVA 4M1DH 1K6QH 3QDMD 2IQ9H 2NY0C 2EE9A 1Z9SA 3KVQA 3C5SB 5DHYB 3NH7H 5GS0C 5D1QB 4ZO9A 3SE3A 4QT5B 1A0QL 1NMCB 1R5VA 1YPZA 4HS6A 2IEPA 4M1DL 3RDTA 1K6QL 1NCBH 2IQ9L 4FXKA 4Y2OA 3UAJC 4N0FA 1Z6JT 5MEQA 3ULUH 5DJAA 3NH7L 3MRLA 4OM1H 3RWGA 5E8PB 4B53A 4X6CB 4ODTH 2YPLD 1NCBL 2AI0H 2VLJA 1BQUA 4JPIB 1HHKB 2ICCA 3QDGE 3RWDB 3ULUL 5J3HD 1T7XA 3DX7A 1EAPB 3JV5A 4XP9L 1JPTH 1G6VK 4EEEA 4XNQB 1AXTL 3MTRA 5IQ7H 1TCRA 4YH6A 4PJ5E 2X1QA 5IMMA 4X7FC 5F7FA 4X8JB 1KJVA 2J2ZA 5HVGB 3SGEH 5KSBF 1P1ZB 2GCYB 4ODBD 3K46A 5B39G 4PLJC 4DZ8A 2BRRL 4Y16B 5DTFB 3MRGA 4PJIB 4ORGB 5ACLA 4P2QD 4ZOAA 5IQ7L 4MDJA 1GGCH 3QA3B 4ZUVA 4G8FA 4KTYA 2EYRB 3DROB 3MJ9A 4WI4A 1ZHBA 4IIQA 5IB3A 3V4UH 4MAUL 4LIQH 4DUVA 1N6VA 2VMFA 1VEOA 4MJIA 4P3WA 4RFOH 3RGHA 4AMKL 3IETA 4G80B 3RL1A 7FABL 4AEHH 4O9HH 4NKOB 5EOQH 2ZUTA 4CNIB 1A14L 1PSKH 4OF7A 3NAAL 3V4UL 1M05A 3ULUC 4YC2B 4LIQL 3RBGA 4L3EE 4RFOL 4PBXA 2WIIB 5AZ2H 3VE0A 32C2B 5EU6B 5DJZA 1P4LB 4AEHL 1S8DB 3O4OB 4PJDA 3GJFK 5ITFA 4NIKB 5IB2A 4ELME 1PSKL 1Q0XL 3BN9D 3UPRA 1EFXB 5CSZA 4BZ2L 4V1DB 4LOUC 3WFCL 3SO3B 3PJSB 5L7XL 4HGKC 4WI2A 1ACYH 2JELH 1T04A 3TN0B 4MDIA 2HN7B 4YUEH 1ND0A 3DX8A 3UEZA 3RY6A 3MV8E 2IFFL 3QXDB 3O0RL 1O5DT 4RNRB 5C3TA 3HUJE 5JW4M 2B0SH 2EIBA 2P4AB 3SJVD 4MVBC 2X1PA 2X42A 2VR4A 3AAZA 5LAXB 2H32B 4YUEL 4NQXB 4CN6A 4U1HB 5SWSA 4CJ0A 2V7NA 5B8CC 4XP1H 3VXUA 2B0SL 5C09D 4MB5A 1NDGB 1PYWB 5C9JB 2DM2A 2VNCA 2YSSA 4Y5YB 1RUMH 1JUFA 1D5BA 4XP1L 1KG0A 3QUMB 5C0CA 4MHHI 1QSEA 4PYHA 5CJOL 4XBEH 5HPOA 5CJXC 3UTQB 2X4RB 4IJ3C 3HC0B 3SE9H 4Z8FH 4FFWD 4WHCA 1W0YT 4H8WL 1K3IA 2LABA 4XBEL 3AM8A 3H9HA 1OOAA 4X7SL 1KN4H 2UWEB 2CRYA 5GJSH 2DQIH 4Z8FL 5DJ6A 1FV1A 4HK0A 4ZAKB 2CLZA 5HHVL 2PKDA 3BIKA 2X6MA 4KRLB 1YUHA 2FX8H 3NTCL 1J0JA 1KN4L 1MFEH 2DQIL 1NEUA 3S97C 1TIUA 4JM4H 1CLZH 1ZLVK 4ZXBD 3FQXA 2J8OA 1WAAA 1MFEL 4P23A 3MR9B 4F8QA 5I16A 1Y6KR 5E2WH 3THMH 1AD9B 3U0TB 2X4NA 4JM4L 5BXFA 1CLZL 4UDUB 4JFDA 1ZT4A 3FB6A 1NEZG 2EDEA 2E3VA 4U1NA 5FO9B 3BJLA 3MRNA 1UKQA 4RMVA 5E2WL 3F65A 3THML 1YMMA 3HC4L 3PUCA 1A6TA 4KGLA 4JB9H 1S7WA 4LSPL 1J1PH 5FYJE 3VFVA 5ABDE 1XF5B 2NX5D 2FEEL 3BKMH 1WCBB 4JB9L 4U1IB 3V6OC 4OCXH 1AGBA 3CZFB 1WK0A 2FJHA 4X4MA 1JWMB 4HLZG 5EU7C 3G6JF 3RWJA 2VDQL 3BKML 3QXVA 4RA0C 3UJJH 4JFHD 5M94B 2QSCL 2QSQA 5EU3B 1FO0A 5E8NB 1NBQA 1NCWL 1KPRA 3QNXA 4OCXL 3VRIA 1EHAA 5J7CC 2VAJA 3U6RA 2BNRE 2G75A 2J6EL 4WO4A 4LPCA 5J6GB 3UJJL 2DWDB 4P2RD 2VE6B 3ABZA 4N8PA 4LQ1A 5C0FA 2XY2A 2OM5A 3DGGA 1L9NA 1MCHA 3GNML 3L5IA 3QEQE 4U7SA 1ZSDA 3VXOA 5A2LH 1I1FA 1QLRA 2Z4QA 3C5ZD 3QJHB 3CX2A 2ITDA 4MJ6B 4O5LH 4X6FB 4H26A 4UAOB 2AXGA 1OSZA 2H3NB 3VGHA 5DGQA 3U7AA 3TPUB 2JCCB 1AGFB 2VLLB 4ODVL 1KUMA 4APQC 2PTTB 4O5LL 4UOW0 4KKLD 1T83C 2JJTC 2BHYA 4OKVA 3PIQA 4WI7A 3MJ8B 4HKBA 2VLRE 5H94A 1GIGH 4KQ4L 5EUOA 1ZVSB 3LKOB 3PWVA 1AGEA 4DKFH 2NY6C 4P46A 5F7WC 1GIGL 1AI1H 4F7MA 3BW9B 3TA3C 5C0BB 3TJEH 2EIEA 2DQFB 1RUAH 1Q1JH 1G7PB 4FQIL 4YEEA 4NHCH 5DRZB 4LFHD 3SKMB 4E5XA 5BRZD 3OL2A 2C26A 3RWFA 1F5WA 2VLMD 1AI1L 5BZWA 7CGTA 1P5UA 3TJEL 4X4YB 1YY9C 1RUAL 1Q1JL 1ZA6B 2GSGA 4NQDD 4P2OC 4WUUD 2DTML 5JPNB 3N1MC 4H1LA 1CDUA 2AGJH 3L5WA 4LNRB 4YAQB 4M4RA 4J3UA 4M6AA 1OP3K 3IYLW 2AGJL 2G9HB 2VLKE 3NFNB 4WIQA 1HH9B 4DFIA 3BPNC 4K7PX 1QBML 4L8BA 4LCWB 3ARUA 5KVEH 3UTTB 2XNAB 3DLQR 1L7IH 3FAXA 5IK3B 5MERB 4TSBH 2GTWB 4G9DA 2Y06H 4ENED 1IBGL 1OAZL 3K0WA 1JN6B 1V8HA 4HCRA 5FO7B 3SGEI 3FOLB 4FQXB 2PR4L 3LD8B 3S5LG 1ZLUK 3VDAA 4FNLH 4JN2B 1HINH 3DYMA 2Y06L 4EDWL 3ARDD 2NW3A 4KK5D 5ICZA 4F2MB 5EBLA 1J7VR 5K59E 1T20B 1G6RB 4X98A 5ECJE 4FNLL 1HINL 4M1CD 3EFDH 3QDJD 4R4BA 3AS0A 1JMZA 3VXQB 3WEXA 2QSTA 3EJJX 4POZD 2AJUL 4POUB 4PR5B 1A8JH 4TOYL 2OL3A 2HJKB 3HMWH 1H0DB 2YK1H 1P53A 2OXGA 3EFDL 1GOFA 4XCFL 4LU5H 1YN7A 4WNQB 4OZIB 4MJ4A 4YBQD 1KPVB 1N8ZA 3HMWL 2YK1L 3DMMB 5IB1A 3LEVH 4PJ9A 1JL8A 1FZJA 3T8XB 3LKRA 4ZDHB 3UTZB 3BISA 3T0EC 4Y4HA 3BP5B 2DM7A 1CDHA 1Z5LB 2FGZA 1J5OH 3D3VE 3PWJB 1ES0B 2H1PH 2DIBA 3LEVL 1GZPA 4AIZB 2IBBA 4Y19A 4Y2DD 1ITCA 1J5OL 3ESVF 3FRPA 4U6VL 5J13C 2H1PL 4W4OA 4MSWB 4XNYH 3PQYA 5FYLH 3L3JA 3PDGA 4C4KT 3OR6A 3CFJB 4HXAH 5KZCD 2AQ1A 1IQDB 1ZTXH 4XNYL 1TTUA 1OPGL 5FYLL 1AGCA 2JJWA 2BY2A 3TBSB 2EDXA 3G5XB 4O51A 4HXAL 5D7LD 2BVPB 4LEOB 1ZTXL 4PRAA 3HG1A 3H9SD 5KSAD 2I26N 1MNUH 3FQTB 4YXKH 4X99B 2E6PA 2EXWD 4PGCB 2X1WL 1QSFD 4AG4H 1MAJA 1CI5A 4OZHE 2P8LA 1UCBL 3MLWL 3X3GH 2UV3A 4JFEA 2Q87A 1CXKA 5E03A 3QDGB 1KCSH 2OP4H 4YXKL 1MY5A 2CUMA 2E9BA 2IH1A 3I02A 3L6FB 5D7JA 4W70A 3VXSA 4NN6B 3MUZ1 2FWOA 5BZDA 4F33B 4PJ5B 4BQ6A 5CEYA 1FL3A 1KCSL 2OP4L 2A6KB 2G2RA 2R2CA 3I75A 1IARB 3O6MH 2BDNH 1I1CA 5FDWA 3ZE0E 1U93A 2HFGL 3U9UA 1JGEA 4EN3B 3PHQA 1JZ2A 1SJXA 4OZ4A 3O6ML 1A3LH 5EG6C 3IU4L 4MZ3A 2AXJA 1D6EB 1EV2E 2EXYC 3BGAA 4HS3A 3HAEG 1FYHB 2W1NA 5I1EL 4WFEE 4H0HB 1E28A 3D9AH 4UOW1 5INCB 1K4CA 1R3IH 5IOPB 2YMXH 4P5MB 4RBPH 4XXCC 5DA4A 5EFIB 3B2VH 5J0BA 3G6JA 4MNGB 5HGHA 3RWHB 2EEAA 4O00A 1LEGA 4KI5E 3FFDB 3BRGC 3ALXA 1HEZA 1DQML 1FZOB 2LU3A 4QXTB 1R3IL 5DQJA 3GMRA 4U1JB 1HNFA 5IWLC 3B2VL 3IJHA 4ELMB 1IRAY 1NMAH 5I8KH 1YEEH 1OT2A 5HHPB 1IGYB 4JREC 3X12A 4AH2B 3RUGA 4CVWA 4ETQA 2V2XA 1XGPA 3MACL 1AD0A 1KPUA 1OTSC 5E9DA 1CFVH 3RY4A 4BFIB 1YEEL 5L2KD 3MV7E 1E4XH 3UTSB 2XA8H 2DDQL 3MV8B 3S4SG 3WHXB 1CFVL 3HUJB 4M03A 5I18L 3FB5A 3S96B 5BVPH 4ZTPH 1WBZB 2XA8L 1Q0YH 4U1LA 2CK2A 3MREB 1JPSL 5C0AD 6CGTA 2Y36L 3T4YB 5BVPL 5F97E 5C0DB 2DL2A 3KPQA 1Q0YL 4LARH 3NZ8A 4PGZA 3GDBA 4OV6F 1IGIL 1QRNE 4KUZH 1T89A 4JVUA 4GKOA 4DK3A 1F4WH 3AXLA 4QNPF 1MCNA 5JHDB 1H8OA 1U8OA 2IWGA 5SWQA 3FT3B 2XTJD 1KB9K 4Z7OF 2OXHA 4KUZL 2VXVL 1WSST 5KSVB 1I9IH 4NFDA 4FTVD 4Y0GA 4LPTA 3TF7C 2A2QT 3O45B 2YUWA 1QYGH 5L8JB 3QI9A 1U8JA 4NZTL 3BWUC 2R15A 1I9IL 2XFXB 1OTUC 1IGMH 5B8CA 5TGBB 3KG5A 2JIXB 3QXWA 3R06B 1S7XB 1QYGL 2YD2A 3P11H 1QD0A 3MCG1 1T1YA 4QRUA 2WUCH 4PRHD 3RNKB 1YEDB 2OTWA 4RIRB 3IXTA 4WTWA 5DURB 5GSRA 1N3NB 1IGML 2P5WE 2DLHA 3ARGB 1S9VA 1LDPH 3P11L 3WXWL 2HMIC 2O61B 4ZUSA 2WUCL 4HIHB 3QP3A 1EHLH 4F7EB 2ITCB 1WFTA 4QHUB 4D0DA 1NGWB 3HI1B 5IBUG 4JFXA 3U48A 3WFEL 5CJXA 4OBRA 1RULL 2N1KA 1NGXB 1EHLL 4NDMA 1V05A 4FP8L 2ZUVA 3VFUA 4QTIH 3UBXA 2Z35B 1BQHA 1KEMH 3REWA 1CD1A 4MNHA 4P5TA 3DSFH 1IAOA 3RZCC 2A6DA 3RA7H 4QTIL 4LGRB 1RVFH 3IDIB 3X13B 2XQBH 3DSFL 4M5YH 5GSVA 4K94H 3C5JB 4YHYB 4LLVB 5T1KA 5J56B 2ESVD 4BSWB 4ZSOA 4JY6A 1RVFL 3DJ9A 2P7TB 3QG6A 2XQBL 3RRQA 4NUGH 1Q9KA 2NLJB 5HY9A 3MLTB 4HZAA 4RZCB 4K94L 2BNRB 4PV9A 3OAUL 2LAGB 4AEIL 4O2FA 3C6LA 5A2JH 3M1BB 4ZFOB 3ILPA 2GUOA 2GSIB 4N0UE 4NUGL 1T66D 2R2EB 1CD0A 4PRPB 5CCKH 2XZZA 4IRSB 5JPMB 4XC1H 3O6FC 3SDCD 1JHTB 2DICA 3B9EA 4NQCA 2VZVA 3NA9L 3QEQB 4IHOB 5DEZA 4LCIH 4JFPB 5CAYB 3LDBC 4NNPH 1NLDH 3RPIA 3UDWC 4Q74A 1L0YA 1SYSB 3CCHA 3VCLB 1TJIH 2BSTB 2MKLC 4JFOB 4HUVB 3V6OA 3WHE1 3ZKND 4LCIL 4NM8L 1EA9C 3MPCA 4WFFE 3KPNB 4NNPL 1NLDL 5C86A 1HSAB 3VH8A 4F9LA 5DRNB 1N0XH 3BKYL 4F80A 4K94C 4N5EC 4LCCB 1FFNA 3ME0A 2A6JA 4NBZB 3VXTA 4PJBE 1PJ9A 4OT1L 2X4TA 4PJ7F 3U83A 3OKDB 5FCUL 4FQHA 2WIMA 1FORH 3I50H 3OBAA 1HYSC 2HTLC 3SHSA 4PG9B 4N0CD 1UB5B 3R1GH 4AT6A 1I7ZB 2DQUL 2DMBA 4MA3A 3T77B 3GMPB 4KH2A 4J1UA 3ROLA 1FORL 4U1KB 3I50L 5ACMA 5GPRA 1I8KB 5IT2L 4UTBL 1EEUA 4UILH 3R1GL 2CKNA 1HQRA 4QXWA 3ZTJH 3HB3D 1S7TA 5L88L 2H45A 3FHAA 1FPTL 4LCYB 4APQA 4G8EB 1A2YB 5I30H 2C4XA 4AENA 2BSRA 1H3GA 3CH8A 3EDJA 3E6HA 5DRXB 1T83A 2J6EA 2JJTA 4JANB 3O2DL 3T4AB 1A7RL 1J05B 2BNUA 5C2BH 5KTEH 5C0RL 1MCRA 3P3YA 5HSFA 3HS0A 3QIWB 1W0VB 1BQLH 2QSVA 4RMRA 5FYKE 2P47B 5CJQH 3B83A 5KTEL 4MWFA 5F21B 1AQDA 4JG0L 4GRWE 1CDJA 3D39D 3DRQB 4N90E 5EZLA 3TA3A 5GZOD 5CJQL 1JF5A 1OCWL 3EW3B 1CZ8L 4NO0D 2BCKB 5D1QC 4YHIA 3RFZC 5A2FA 3T2QA 1NMCC 3ARPA 1DBJL 1C16B 1X5YA 1WV7T 4P2OA 5CP7B 2B7DT 3LB6C 1WITA 5ICXB 3RWIB 5HBBA 3UTOA 5TDPA 4XNZB 4GMSL 1A4KB 3HNTH 4MAYD 4KXZH 1HWGB 2HLAA 1OTTD 3DSNA 4DQOH 4Z7WA 4JEGB 2H9GB 3OKMA 4OGYH 3DX6A 3HNTL 3QCVH 5DUMH 1UCTA 1LO5B 1KLUB 3VDBA 4GRLD 4HHAA 4ZUUA 1B9ZA 2DBJA 4HWNA 2FRGP 5K9OA 4YHPB 2X4PA 2MPAH 3B9KB 4OGYL 1IEBB 2VYRE 3QCVL 4LCUA 4PJFE 4XPTH 4Y16C 2BERA 2BHZA 4MS8C 5C0GB 3FQUA 1YNLH 3HZKA 3IAQA 1NC2A 4LVOB 4Z18A 3TIDB 3D3VB 2H32H 3ULVD 4QHMB 4XPTL 4BSVB 3GSVB 2PYFB 1E4XI 4GUPA 2D4FA 3EYVB 3F7YA 4G6FB 5HHOE 1SY6H 4L3CA 1VCAA 1QNZH 2PCPA 3OJVC 5IFHH 1YJDH 4HXBL 1GXEA 5HGAB 43C9B 3C2SA 2QQNH 4YC2C 5D5MA 2I25N 4RAVB 1SY6L 4KKCC 3O4OC 1ZGLB 5IFHL 3QUMH 2YBRA 5CEZE 1S7RB 5I66A 1F2QA 2QQNL 4O2CA 2F53B 5FEBA 1OAYH 5CGMA 1MAMH 3SO3C 4H88H 1JV5A 3QCTH 2IAMB 3QUML 4MJ5B 1TZIA 1XGYH 3T0EA 3TN0C 4ZNEA 1IKNC 2CK0H 5TF0A 3LCYA 3OKLA 4OZHB 1OAYL 3UX9B 4H88L 1KTRL 1YA5A 3QCTL 5JHLH 3EZ8A 3WD5L 4F7TA 4TSCH 3F8UB 5FGSA 3MRDB 4NCC1 3Q5OA 5HHQB 5JHLL 2GKIA 3KPRE 3DPBA 2Z91B 4LP4A 4Y4FB 1NH6A 2DQDH 4TSCL 4XP6H 1ULVA 3P0GB 5F7DB 5CZKA 1F6AB 1MJJB 1YJDC 4PJAF 1UACL 4IS6B 1FVCB 4Y5YC 3B2UC 5GGQL 4KUCF 1ZA3A 2DQDL 4IRJD 2R9HD 2DI8A 2I9LA 3GSRA 4OIIL 3JV0A 5T3XD 1MELA 5F1IA 3T1FA 4H20H 4OZGB 3CFDB 4P99A 4XMLH 2Y72A 3WUWA 5MENA 1SYVA 2X9WA 2HP4A 3QWQB 1CFSB 1ODAA 4KKAD 3OKOB 4YHNB 4LL9A 3W39A 1T0NB 3V5KB 2BFVH 3KPMB 4XMLL 1T5XB 2OTUA 2AJZA 4IOFD 2ENYA 3TT3H 1BD2B 4ZAKC 3BE1H 1IGJB 2YPLE 3QUZB 3BH8B 4C83A 5IUSA 2AK4B 1DBBL 1MH5A 2CLVB 1YZZA 5HYIA 1Y6NR 4J3XA 3NIDE 3OF6A 2FECL 3MV7B 3RBSA 2UYLB 4U6YB 2R69L 5H35B 3ZHLA 4Z6AT 5J06A 4NFBA 5IEKB 3GO1H 3K4AA 3RGVA 1D5XB 1I7TB 1TFHA 2UY7A 4XXCA 5IIEA 1DBKH 2W9EH 2ZG3A 1OW0C 3MXWH 5IM7A 5F9WB 4PJ8B 1KYOJ 2Z92B 5DS8B 1IKFH 1T3FB 3GO1L 3TZVA 1A4JB 1NFDE 4LLYA 3RVVD 5GXBB 5HVHB 5IWLA 3TCLB 1EO7A 3OAZH 4D0BA 2QHRH 4KK6C 1DBKL 2W9EL 2EDYA 4KMLB 3MXWL 1LEKB 1QRNB 5TQ2L 4I5BB 1S9YA 3TVMD 2VL4A 5CP3H 3OAYK 3ESUF 1IKFL 3HZYB 1U8KB 3KYMA 4LLQB 1NBZA 4B7IA 2QHRL 1J8KA 3MV9B 3RP1A 4QRPD 3B9VA 1K8DA 5SX5K 3MA9H 2GEEA 1JZ6A 4UV7L 4OM0H 2JF1A 4TULL 1JWSB 2IBZX 4TUJA 4PP1D 4J3TA 4C56D 5MHSD 1NGQH 1OB1B 5FM4A 1FNAA 2RFXA 3QEUB 2A73B 3L3OB 2R56H 1WT5C 1BBDH 1PDKA 2MWCA 1JPGA 1QBAA 1X7QB 1IZKA 3IRZA 1U91B 4WI5A 4IOIB 3AS2A 1A3QA 2F9BT 1EERB 1MJ8H 1AGDB 1SMOA 5TPWH 3NBNA 3KLHD 5D1ZD 4GW4B 1BBDL 3SE8L 1FZMA 2EDLA 4WU5B 2R0ZL 1MJ8L 1WC7B 2YR3A 1XT5A 1J1OL 4BQ8A 4UAOC 5C09E 2DS4A 2PW2B 4IDJH 4TTDC 2W0FB 2R0WH 3VFSB 1GOHA 4PGEA 4YQXH 5IGXH 3RVWC 1I75A 5B38G 1MFDL 4EKXA 4HIJB 3DIFB 4RQQA 4L4TD 4IDJL 5SWZD 2PXYB 4LHQB 2R0WL 3MV11 5F9OH 5IGXL 2HVKA 3HNSH 1UXSA 4YQXL 3V79C 3J7HA 1OD7A 3V52L 4BQBA 2MHAB 3F7VB 2Y7QA 1RUPH 2GJ6A 1CGVA 4WTXA 3QO1B 1N6QH 5F9OL 3ZZ1A 3HNSL 1RHHA 3I6LD 4X8XA 3QXAB 3DTXA 1AFVH 1RUPL 3KXFE 6FABH 3ZHKA 1NMBL 3L5HA 5FO8A 2YOCA 1JCKA 1CGXA 3L9RB 4JHZA 4NRZB 4MD5A 3FT4A 3MGOA 4JGJA 3JWNC 3GHEL 1AFVL 4N8VA 2ATKB 1T22A 6FABL 2ED8A 4G42A 1G6RH 2B2XH 3MJ7A 5EBWA 3DARA 4N0UB 2BZDA 4CGTA 3LRHA 4I0CC 2Y23A 3NFSH 4EQ2A 4M6OH 1K2DA 5AWNH 4LMQI 1P2CB 3FQRB 4Y4KB 1G6RL 3N85H 5MEPA 1WBXA 1AR1D 4QRTB 3TT1H 1C5CH 3WV0A 2YPKB 5DSCA 2Y6SC 3NFSL 1H8SA 4M6OL 1NGPH 5D2LA 5AWNL 4KHXL 1JYWA 1U3HB 3N85L 4KXZI 5ID0B 1MJ7L 4QOKD 2XPGB 1C5CL 4MGXA 3TT1L 2XN9B 3EYQC 3B9AA 4HUWB 1TVBA 3QIBB 4KWUA 4LHUD 1RIUH 1U8PB 5TE4L 3RJQB 1FAIL 1YECH 4X0KB 2YKLL 2NX5E 3PV6B 5D71H 1VDGA 4PGDB 3EO1A 1Q9OB 4LAJH 4FQXC 3LD8C 1BVLB 3QIUB 4OCYH 5JDSA 3VXMA 1URLA 3PGCA 5IB5B 2WQ8A 2CR3A 4UOJA 4PJCE 4JFHE 4NQEA 4UNUA 2A1WH 3DYPA 5FK9A 3GBMH 3STLB 3A6CH 3QXUA 3V0AC 3O6FA 5ICYA 3VGAB 3DI3B 3GKWH 2IAND 3UTPD 2XXMB 1PG7X 4WVRA 4P2RE 2A1WL 3GBML 3A6CL 3UDWA 5JQHC 1HKLL 3NIGF 2BOBB 3MRHA 4AEEA 3CFKB 3KYAA 3VFPB 5DLMH 4HULB 4Z7UA 5JW3L 2FR4B 1IC5H 3DMMC 3MCKB 2P45B 1QLEH 3WFDH 3GB7A 1FG2A 3FZUC 1WEJH 1IAIH 1Z3GH 4HWZB 3L3DB 1CU4H 2YEZA 4TQEH 4X5WB 4F57H 4JJHA 4IMKC 1WEJL 1IAIL 1KIRA 3VXRE 1A7BA 2Y5TB 4XMKH 4GRWB 4XXDB 1CU4L 1R3KA 1P6FA 2HJFA 4P2YA 2PUQT 2O5ZH 2J5LB 4F57L 3S9DB 4HIEA 3I3BA 1OARH 4KJYB 1H3TA 3NCYP 4TUOB 3FKUS 1G9ML 4WENB 4OF8A 5KW9L 2O5ZL 3NACH 1S9XB 3EHBC 1OARL 4U0QB 2VDPL 5BRZE 2VH5L 3U4EA 4MXQC 2HVJB 4MA8H 1DCLA 2SEBB 1FE8L 3RWCB 3NACL 2VLME 2B8OT 3IXAA 1ORQB 3ORJA 4NQDE 4YDVB 4WUUE 5EBMA 2APFA 2LE9A 4H25B 3RDTD 2NNAB 3BD3A 4M43H 4MA8L 5DVLA 4NN6C 1INDL 4LRNL 2DAVA 5E2JA 5DC4B 4HGWA 3SKUD 3DXAA 1ITBB 5MP6L 1S9WA 2VLJD 1HSBB 4M43L 2FECI 4JPVH 5GQBA 1W72B 3QQ3B 4EN3C 3E3QC 3C5SA 5D1QA 4Z95H 5T3ZD 4R4NC 1XCTB 2C9AA 3MLXL 4I4WA 3QZWA 4JPVL 3RKDD 3TPKA 3O11B 3IF1B 5HHOB 3AROA 2FGWH 4Z95L 1U9KA 3O2DA 4OUUB 1IFHH 2UZIH 5E8PA 5E00A 5IR1B 4X6CA 3BWAB 2VOTA 5CHNA 1HHKA 5AG9A 1T2QL 3RWDA 2FD6H 3U4AA 2VQ1A 2UZIL 1IFHL 1EAPA 3TYFB 4IDLA 4GLRH 1Z9LA 4XNQA 4LDEB 1U3YA 4MJID 4Y5XB 2H41A 1ZLWK 4RWYH 4MA1B 2OK0L 1OT1A 2O5XH 2Z93A 2O93L 3P4NB 2GCYA 2DKSA 4OTXH 4Y16A 5C0EB 4QWWD 5DTFA 5C07B 4K3JH 4PJIA 5EORH 2OCFD 3CAFA 4ORGA 4UUJB 3T1WA 1QBLH 4RMSA 3D25B 1EZVX 4KI1A 1C1EH 2EYRA 3DROA 3RHWK 1NBVL 4OTXL 5GZNC 2KQMA 3V8CA 1WIUA 4K3JL 4ZO6A 5EORL 4G80A 4AIXA 2YS4A 3MQIA 1C1EL 1TPXB 1K9TA 4NKOA 3CC5B 3LPWA 5IP4A 3BVNB 4CNIA 3KPRB 4HEME 3ARZA 4U1SB 3O8XB 3V5DB 5KSUB 2AAVA 1UJ3B 2WIIA 1I4FB 4ETYA 32C2A 5EU6A 4DZBB 1P4LA 1DFBH 3D5OF 2D0GA 5IG7A 4HV8B 4DUWA 5J9PA 5IBLC 1VACA 1EFXA 1CDBA 3MRJA 4JQVC 4V1DA 4TTGA 1GGYA 2E7BA 5LQBL 3PJSA 4HZLB 1A7NH 1DFBL 1L6XA 1U41A 3DWTA 3ARWA 3K1KC 3VXUD 5GGSY 3QUXA 2G5BB 1IT9H 4CU6A 3SQOH 1IKNA 4XHJC 1I7UB 4HMEA 2W91A 4W81A 1TNNA 2HN7A 4DCQB 5FYJH 5FUOH 1A7NL 3ET9F 5D7LE 3WS6C 1A7OH 5ALCH 3QXDA 4L4VB 1I8MB 4K71B 1IT9L 4NSKB 3SQOL 4OZIF 3ECBB 1QSFE 5F7HA 1WGOA 5LAXA 3VFOB 5C0CD 4NQXA 4U1HA 5FM5O 5FUOL 4HFWB 5ALCL 4G5ZH 3ZDZE 4J3VA 2C1PB 1SY6A 1PYWA 5C9JA 3GBNL 1MCBA 3SDXE 2YHGA 3BOVA 3ARGC 1GJIA 5ADOH 1X5AA 1M7DB 4YDJB 1YYLH 5FA3B 4KKBC 1KNOA 4FABH 4MLIA 4PJEE 3QUMA 1JI1A 2EDKA 2ZKHH 2ICWB 1EHNA 2K3TA 5ADOL 3UTQA 4ZFOL 2F54A 2X4RA 3HC0A 2X7LB 3LEXB 4FABL 5FOBB 2VWEE 1HXMB 4PJHE 3L3IB 4NBYB 1CVRA 3RL2B 1NFDB 3RHWF 4ZS6D 2UWEA 5IF0B 3GHBH 1RMFL 4BFGA 1FFPB 1F6FB 4G43A 1OAUH 2LTQB 3R8BB 4P3CH 5JIKA 1DLFH 1YMMD 4YHYC 1WWBX 2GK0B 2J7LA 4NHUB 3FO2B 1N5YH 5I75B 2EZ0C 1OAUL 3MR9A 3BPCB 1DLFL 3ZYJA 4XH2B 5E4IA 1AD9A 3U0TA 4ACPA 4UDUA 1BF2A 1FHGA 4UDTB 5L2KE 1CL7H 1N5YL 4JDVB 5FO9A 2AKRB 5KS9E 5CD5C 3JTSB 1LK3H 5B4MD 1OW0A 2WWMD 1G7JB 4IRSC 1LQSR 3MO1A 4K2UH 5JLZB 2F74A 4LLUB 5BOZG 1MF2H 5HDLA 1CL7L 3ZTNH 3W81A 1FNEA 1LK3L 1N5AB 3VXPB 2Q3AA 2VABA 1WCBA 4K2UL 4KK8D 5GGTH 1S5IH 1MQKH 4U1IA 2D3VA 3RIFK 1CFQA 3ZTNL 1QG3A 1QFOA 2AV7B 4U1MB 1ZHKB 1JHKH 1S5IL 1MQKL 3CIQA 5EU3A 4KJPC 1HHHB 5E8NA 3I2CH 4NOFA 4EXKA 4NC1E 4LCCC 5I0ZA 3VGDA 4ZMAT 4ZD3L 4ELMF 1MHHA 5J6GA 1RZJL 2DWDA 1WT5A 1JZ8A 1WUNT 2VE6A 3G6AB 1NBYB 3I2CL 1R0AH 1J9CT 3HCVA 4FTVE 3HE7B 3X14A 5HYQB 2APXA 2FIRT 3FT2B 2CKBL 3V2AR 4OAWB 5DHXB 4G8GE 1MJUH 1U8NB 4Z7VE 4KDVA 5IHUH 3KXFB 2LU7A 3QJHA 4XNMB 3H3KA 3SDYH 1T21B 3HUJF 4X6FA 1J8HB 3IFLL 4PRHE 4I18A 2H3NA 5IHUL 2FHFA 1U92B 3TPUA 5D1XD 4XWGL 5HXMA 1F02I 1AGFA 2JCCA 2VLLA 4LQFL 5CP3A 3SDYL 5HVWA 3X11B 2PTTA 5SV4A 3RI5F 2BVEA 2MQCA 1CVSC 3FO9B 3RPKA 3WL9B 3OTTA 1T1ZA 3DRTB 4ELKB 5J57B 1F4YH 2JK5B 4NM4H 1CDYA 1MCIA 1CN4A 3GMQB 3OSKA 1T03H 4Z76B 2F8XC 3QIWC 4OCRH 4ISVB 1ZVSA 3LKOA 2NW2B 4GAJL 3R0NA 1REIA 4J4PC 3W9DA 3EGSB 4XVSH 3MX0A 25C8H 1XH3B 3BW9A 5C0BA 4JRWA 2AQ3A 2DQFA 4HJGB 1G7PA 5EN2B 3SCMD 4L8DB 5DMJB 5DRZA 1JHLH 5HPMB 4BQ9A 3B4NA 2H2SC 1Q94B 4XVSL 25C8L 5MEOB 2XWJA 2FCBA 2NXZB 3RIFF 3INUH 4NRYB 2ESVE 4P2QA 4RDQG 4X4YA 1LO2H 2G60L 5A3IC 1JHLL 5JPNA 1RK0B 2YRPA 1NCNA 3P9WB 4YAQA 1OGAB 3D2UB 1GGIL 4XNZC 3GK8H 1MLCB 3INUL 4ODXA 4D9LL 2X5PA 1LO2L 5AAMA 1D6VH 1SJHB 4CDGC 3HRZB 3KLDA 2G9HA 3NFNA 1HH9A 3PWUB 5T1LB 5C08D 4R2GB 4LCWA 4URTB 4HIIB 3UTTA 2XNAA 1D6VL 4GLRI 4Z5RB 1I9JH 1HOCB 4WTZG 5IK3A 4YHML 5MERA 4CVXA 3B9KC 3BD4A 2GTWA 4XPFH 5BCAA 2EO9A 1X6LA 1MLBA 3RWEB 2J8UA 1JN6A 4X7TA 1LEIB 1T2JA 3FOLA 5I2IB 4FQXA 4LVOC 1I9JL 2YZ8A 3LRSB 1FYTD 5DD1H 2FB4H 4F2MA 3GMMB 1T20A 1G6RA 4JFZH 2EDJA 3OG6B 4PJ9D 2ZUQB 3VXRB 3GSWA 4NYLB 3CJJA 4WI8A 3VXQA 4Y4HD 1QFWL 2J3SA 2PF6A 2W92A 4PR5A 2GY7B 1JGDB 5I8CB 4Y89A 5LCVH 2HJKA 4OZFB 3RQ3A 5EOCH 4DTGH 4WNQA 5JW4R 3BRFA 4Y19D 1MIML 3CSYB 1KPVA 5LCVL 5EZIL 1WZKA 2NTSP 3DMMA 3MYZA 1JNLH 5EOCL 3PQYD 4HWBH 3T8XA 2IAMC 4FN0A 3VMNA 1DE4B 1Z5LA 1U42A 3PWJA 3KWWB 1ES0A 3MJ6A 1JNLL 2HT3D 4XMPH 4EUPB 1HCFX 1WQVT 4ZODA 4AIZA 2BVTA 1G7QB 3FN3A 3NZHH 4XI5D 1TETH 2F58L 2J4WH 5IW1B 4IMKA 4GW1B 3CFCH 5EU4B 1RIHH 3HG1D 1EVUA 3G5YB 2VC2H 4MSWA 1UB6A 4XMPL 1LMKA 4E41B 3B5GA 1RHFA 1TETL 1QFUH 3CFJA 4G6KH 4Y4FC 3D1MC 4JFED 3CFCL 4OCNC 5FCSH 1F3RB 1IQDA 1RIHL 3EOTH 4PTTB 4Z7QE 4WUKH 5D7JD 3EZJB 1ZHLB 4HKXA 1J86A 4LBEA 4G6KL 3TBSA 4HW6A 1MI5E 1A9EB 1IAKB 3D39E 3MOBH 2BVPA 4LEOA 3EOTL 5AYQA 5DFWH 4WUKL 3O4LA 3FQTA 4X99A 2B1HH 4PGCA 5L6YL 3OKNB 2R4SH 4Z0XB 2NY0D 2RJMA 1DQQB 5GS0D 2DM4A 5DR5H 4UB0H 5ANME 2AJ3B 3ARDB 3QDGA 5EO9A 4Y1AE 2B1HL 2FJFB 3L6FA 5EUKB 4X5XA 1EK3A 5FUCE 1C08A 5JZ7C 5DR5L 4PJ5A 1KTDB 3UZVB 1JNNH 1HHJB 1RD6A 3QUZC 5JMOC 3U1SH 4N8VG 4G7YH 4EN3A 1MPAH 1DJSA 4TNWK 5F9DC 3WLWC 1JNHA 1JNNL 1MCLA 1C5BH 2VUYA 3U1SL 1D6EA 4U0RB 5E8EA 4NO3A 4JPWL 5I73B 3SEPA 5INCA 4TUKL 5IOPA 1C5BL 4P5MA 4EOWH 4NO2B 4PLJD 5EFIA 1G7HA 4MNGA 3RWHA 5E9DD 5F9WC 5ITBH 4PJ8C 3MNWB 5GIRB 1FZOA 4U2YA 5HVHC 4EOWL 2V7HB 3HE6A 5DZLA 2WUBH 5SX4H 5DD5H 1CF8H 4HKJB 4DOHE 3VFTA 1KC5H 5HHPA 1IGYA 4ODSH 4WI6A 4FXGB 4AH2A 3VJ6B 5IROA 5K59F 5J1AA 4WI9A 2WUBL 1VA9A 3ULUD 3T3PE 2A38A 5ISZB 3C08H 5DD5L 1AC0A 3KPLB 3UTSA 2A9MH 2VDNH 1CK0H 4EI5B 2VSDA 1BHGA 3WHXA 4KJQD 3C08L 1EEQA 4LOUD 3D69B 4CVUA 4FZEL 4X6BB 1FNSH 1WBZA 5E6YA 2A9ML 3GJEB 1CK0L 5TDNA 3PF2A 3MREA 5TQ0L 4CN1A 2BMKB 5AYUL 4HUNB 1B0WA 1OM3H 3SKJL 1EEYB 2B20A 4U6HB 3T4YA 1P6AB 3GSQA 3T2NH 4YPJA 1I3GH 2CPCA 1FNSL 2C3VB 3MUJA 5EOCJ 2HLFC 1ZS8B 1JTTA 1FJ1A 3QPQC 3QI9D 4UV4H 3WMSA 4MVBD 1Q9WB 1VKXB 5KSBB 1P4IH 5I19H 4JQVA 3V5HB 3T2NL 5JHDA 1I3GL 5FB8B 5DF0A 3FT3A 4U3HA 2CRZA 4HF5L 5JW4N 5J4MA 4UV4L 1BFTA 4LLMB 5KSVA 1P4IL 5I19L 1BIHA 3O45A 2PXYC 4PJHB 5KVDH 2R2HB 4E0RB 4AL8H 1F3DH 4ODWB 3TO4B 2BY0A 1KBGH 2XFXA 3HN3A 1FLRL 5TGBA 3R06A 3BKCH 1S7XA 4S11A 3CVIH 3L3GB 1BVKA 5KVDL 1BVZA 1X3DA 4AL8L 1RI8A 3RNKA 4RIRA 1OGTB 1BX2A 1KBGL 4FQLL 5GS1B 4OZHF 1N3NA 4YPGA 1U8HA 1BBJA 3BKCL 1P9MC 3CVIL 5AZEL 1A7PH 4P5TD 4X6DE 3ARGA 5LBSH 2O61A 1QUNA 4HIHA 1XGRA 1ZT1B 1B0RB 5FM5M 1R24B 3S37H 4F7EA 1JP5A 1P7KB 4QHUA 2VXTH 4ZPTB 3QPXH 5TF1H 4W68A 3EDEA 5KJRH 1FL5B 1BOYA 3NCEB 1JFQH 4PRNA 5KVMC 2QR0A 5KS9B 1NGXA 5T1KD 1J1XH 3HR5B 2AXFB 2VXTL 3QPXL 3RVXC 3ZE0F 4Y4KC 5TF1L 4PB0H 2KPNA 2Z35A 5HHNB 5KJRL 1JFQL 3WDJA 1AP2A 1YNKL 3HNVH 2Y4SA 3K2UH 3SKNB 1VFAB 3PDOA 2B5IB 5DVNA 1KN2H 1J1XL 3C6LD 1H5BB 4X7EC 3MLZH 5DUPH 3IDIA 3X13A 4C58B 1U3HC 1LNUB 3GMOA 3HNVL 1WTGT 3C5JA 3QIBC 4BSWA 5DUPL 4NQCD 3UXFA 2P7TA 4KI5F 1I8IB 4OV5B 3QZWG 1QR4A 3MLTA 4RZCA 3QIUC 5FYKH 2HT2C 2K1MA 2P48B 3QFDA 4Q97A 4MXVE 5T3XL 1HHGB 3M1BA 4QRPE 5DHVB 5ESQB 4ZFOA 2GW5A 5BQ7A 3H0TA 2GSIA 3GKZA 3UJTL 4DKDC 4PG2C 2R2EA 5CEXB 4GRWH 4PRPA 2F8VA 5JPMA 3VGAC 1JHTA 2C4FU 4C56E 4G8GB 3ARXA 5MHSE 1FFRA 1TNMA 3VMOA 4IHOA 4Z7VB 1YEGH 4ZO7A 4OB5H 4LLDB 3S36L 3UPCA 5FV1L 3CVHB 3NCBB 4OD3H 3MBEB 4PGBB 1HCVA 1NKOA 4CJ1A 1SYSA 5KOVC 3VCLA 3D0LB 1LVEA 3NA4A 4JFOA 4HUVA 4FMFA 3U4BH 3WFZA 2C3HA 1YEGL 1E6OH 3HA0A 4TSAH 5DMGC 1VPOH 3KPNA 2UY6A 5JNYB 4KZDH 5E94B 1HSAA 1XEDA 2C3WA 4YNYB 5DRNA 3GJFB 3LKNB 2P46B 2V5RA 5DD6B 3U4BL 1X5LA 3BZFB 4JZJB 4CAGA 1E6OL 4TSAL 3UYOD 1VPOL 4NKMB 4LCCA 1IMHC 1YY8B 3DBXB 2Q3ZA 3LKQA 3TNNA 1JTPA 2EICA 5DJ0B 5K9KA 3OKDA 1FRGH 4L4TE 5SWZE 4XRCA 1PKQE 4APQD 5C7XL 1CICB 3P4MA 1A1MB 1BIIA 1W72H 3JVGC 1G7MB 3QEGH 2MQ3A 4PG9A 4MD4B 1UB5A 1V5JA 4JO2L 5B39B 1I7ZA 3KLAB 1FRGL 3T77A 4OQ1A 3V0VA 3GMPA 2FX7H 4KMQA 2J5LC 3HPJB 3MUGA 4UIKH 3EFFB 1NC4B 3BXNB 1W72L 1I8KA 5C6TH 3DURA 4MQ7A 2FX7L 4WDIB 1EO5A 1TVHB 4G8EA 1A2YA 4CU8A 4UIKL 2NY6D 2CGRL 4YHLH 5ADPH 5DRXA 3MJGX 3T4AA 4JANA 3TA3D 1J05A 4QCIB 4XCNA 3V0WL 2X9XA 2XWBA 1F3DJ 1S3KH 5CEZH 2Z31A 2Q1EA 4YHLL 3C87A 5ADPL 4JHBA 3O3BA 3QIWA 1UWEH 4GKNA 2RGSA 2CKBA 1YY9D 3SDCB 4P2OD 1XZ0A 4QLRA 5D93B 2XKNB 1S3KL 3S7GA 2IF7A 4J4PA 3SKOA 1UWEL 1ZT7B 3VGFA 3EOBB 4HDIB 4QOKE 1VADB 2BCKA 5JOPE 1V3KA 3GBLA 5CJBA 3AFLA 5CP7A 3HRPA 2N7AA 2GJJA 2GFBB 1MUJB 5ICXA 2HJLB 4M6NH 3HHRB 3QFJB 1ADQH 1T7WA 3QT2A 3DUUB 2ZUYA 1NC2D 1XGTA 4PUBL 4Z78B 1X5JA 2EC8A 2H9GA 4Z7NE 1TQCB 1LO5A 1KLUA 4Y5XC 2IANE 3UTPE 4MA1C 3STBA 3DUSA 4YHPA 5IMLB 1BZ7B 1I85C 4S0SD 5C0GA 4L8SA 4MD0B 5HDBE 3TIDA 4HQQL 3D3VA 2IC2A 1T80A 4GG6E 1QR1B 2XQYG 4QHMA 4BSVA 3GSVA 2PYFA 3EYVA 3IU3B 1NDMB 2EC9U 5EIIA 2V17H 1PG7W 3WFBL 1TPXC 2I60H 2OR8A 1G7IB 3T0ED 4Z77B 5HGAA 43C9A 4GQ9H 3O8XC 3UROR 4BUHA 1UJ3C 5TH2B 2V17L 4RAVA 1GC1L 5IB4B 1S7RA 4PJBF 4GAYA 4QRRB 4P0DA 3IJSB 5CJ8A 3Q3GB 2F53A 5IVXE 1MI5B 3K4DA 4HPYH 3CFBB 1SEQH 1AO7A 2V2WB 2IAMA 4KHTH 1A21A 1NEZB 1RUKH 4MJ5A 1JRHH 5IV2B 2AJXL 4S10A 3TM6A 3ZLQC 3E2HB 4HPYL 4R0LB 3Q6FA 4KHTL 4OF5A 1RUKL 1JRHL 4JFFA 1CLOH 4Y1AB 4K71C 5E1HB 4ESKA 2R23B 3M8OL 4U6XB 3MRDA 2AJSH 3F5WB 5MEND 3MZTA 4MAYB 3BP6B 2X41A 2WNGA 2WBJB 1CLOL 2A77L 4ZYKB 5JOFA 2Z91A 3GM0A 4Y4FA 1GC1C 3QWRA 2XQYK 1YPZE 2DBLH 2LVCA 2Q20A 3OGOE 1N59B 1MJJA 2AJSL 5HI4C 3ZSTA 1FVCA 4GRLB 3KPOB 2DOCA 5AD0B 2W9DL 4OLEA 5FM8A 2DBLL 3I9GL 4GW5B 3GRWH 3ILQC 2VLJE 2DQGL 4PRDA 1TTGA 4OZGA 3CFDA 5T3ZE 4GRWF 3FB8B 3VWJB 1S7QB 1CFSA 3B3IA 3D6GA 3FRUB 5HVFB 5GS3A 4YHNA 5FYLD 3GRWL 4GAFB 1T0NA 1R5WB 3V5KA 3OF6D 3KPMA 1EH9A 3MBXH 3OJDB 5T5NF 2AJVH 2EXYD 3WIIL 4WI3A 1I7RB 5D6DC 1BD2A 1YEFH 2ZOLB 5EWIH 4RRPA 3RGVD 3ZE1F 3MBXL 3QUZA 3BH8A 3LEYL 3M45A 4MMXC 1KJ2B 4PYGA 2AK4A 2AJVL 2LTQC 2CLVA 3S34H 4OI9A 3PHOB 3QHFH 4R90H 3TZVD 5EWIL 1NAMH 3K3QA 4MJIE 2PNDA 3MRKB 3TEUA 3BN9C 2UYLA 1CXEA 4I48B 4KRPB 4U6YA 5I75C 5BS0A 4CRPA 5H35A 1F45A 3QHFL 4ZUTA 5IEKA 2MTPA 1D5XA 1I7TA 1EMTL 2X4UA 5FOJA 1IM3B 2P42B 1OTSD 4PIRF 4EDXB 4PJDE 1ZMYA 1LD9A 2X4QB 3MRMB 4PJFF 4PJ8A 2Z92A 4ONFH 3G5VB 2BJML 3BAEH 2FIKA 3TCLA 1MCDA 4ZTOH 4PP2A 2ZOKB 1LEKA 1QRNA 4I5BA 4XPHL 4G9FD 3U36B 3OR7A 4WHTB 1U8KA 4LLQA 3M17B 4ONFL 3BAEL 1X5ZA 5I8OH 5KG9A 4I0PB 4P5KB 4PRIE 3MV9A 4ZTOL 4AM0A 3V6FB 2L4OA 4XT1C 1C12B 5BV7B 1ZANL 4IRJB 5I8OL 4C57C 1JWSA 3DVIA 5FKAB 5SWSE 5HYSB 1OB1A 2NY3B 3PNWB 4I0KA 3VXUE 3L3OA 3B5HA 4YK4B 5DDHA 1X7QA 1AKJB 1F4XH 3HE7C 3U9PL 4FFWC 4IOIA 1AGDA 1VEMA 3W0WE 4U49A 5KAQG 4DW2H 1YQVH 4GSDH 1QSEE 2ICWJ 3LKSB 1R3LB 4WWKB 1HI6B 4NZRL 3S5LB 1WF5A 2GJ6D 2F19H 2PW2A 2C4FT 1JZ4A 2W0FA 4DW2L 3E8UL 3OPZH 4GSDL 3VFSA 2GY5A 2V5SA 2OS7A 2ZWLT 4NO0A 3T0XA 3O6KH 4HIJA 4JKPH 3DIFA 1EUTA 2VN7A 2F19L 3U7YH 3S8WA 5TJWK 2HMID 3MRRB 3U7WH 2H6PB 3T3ME 3ARFB 2MHAA 3JV6B 3F7VA 2CIIB 1XR9B 2VITB 4M62H 3MOAH 4YO0B 3QO1A 4YXLH 1DN0A 5DT1H 3MOQA 4AJ0A 3QXAA 3LHPH 2AEIT 4LKXB 3P9MB 4CADB 1K4DB 1WAAE 3FOMB 1B4JH 3V9FA 3MOAL 4YXLL 5DT1L 3FQNA 2BP3A 4CU7A 1H8NA 4FOMA 1A6WH 2ICEB 4JFDE 4YHKL 3WLBA 3LHPL 2ZCKH 3RZCD 3IKKA 1E4KC 3BFOA 3O3EB 4FFVC 1EVTC 1B4JL 4X80H 4QYOB 1YMME 4L9LA 4QRPB 2NXZC 4GRMA 4JY5L 2X1OA 2HA1A 1A6WL 3KS0H 1LP9E 3MRBB 3GSXA 4YGVB 1JPFB 4HH8A 5F7MC 1RY7B 4OZFH 5DK2A 1U8LB 1DLHB 1A6AB 3NIDF 4QRTA 4NQSA 3UC0H 2YPKA 5FF6B 5C1MB 4GBXB 3VXMD 1AC6A 4X4ME 1EXUB 2YC1B 1U3HA 5ID0A 2IPTH 1BREA 4K3DL 4NQED 4PY8J 4R2GC 1PLGL 3UC0L 2XN9A 4HUWA 2GTZB 3QIBA 5M95B 4K7PH 3O6FD 1KIPA 1U8PA 4HUMB 4N8CH 3QUKB 1XGUB 2CR6A 1QRKA 5T1MA 3WSQH 2IPTL 2CDFB 3MLSH 4U7MA 3BDXA 3WXVH 5AAWA 3PV6A 1UM5H 2LFGA 3BHBB 4EUPH 1DL7H 1H3VA 1Q9OA 1NFDF 4EQ3A 4K7PL 1BVLA 3QIUA 1LO0H 3BI9X 4N8CL 5C6WH 3TO2B 3IDJB 4UT6H 4YFEA 1GZQB 5IB5A 3WSQL 2NZIA 4MNQD 4R7DB 3WXVL 2IJ0C 5JW5B 1UM5L 1MFBH 4PG2A 1DL7L 1XF2B 3STLA 4GMTL 3VGGA 1LO0L 4UT6L 4JCLA 5GRZA 4OCLC 4N5ED 1IGTB 1CIUA 1AHWB 3VWKB 3CMOL 5L0QB 3AB0B 4JG1L 1MFCH 1NCTA 2BOBA 4HWEH 4IRZH 1QTYT 4HUUB 4LPYA 3HAEB 3VFPA 2AJYL 4RFNB 5D8JH 2ICWI 1MFCL 2A6IA 1HYSD 2HTLD 3KPSD 4IRZL 2NMSA 3MCKA 5F8RC 5TDOB 1BP3B 5EUOE 5D8JL 4GFTB 1JRHI 5F93C 3I84A 4HWZA 1FGVL 2QJDA 4QXGH 3DYOA 5KAQF 3AU1B 1UM4H 4PGJA 1FN4B 2Y5TA 2D7MA 4QXGL 4XXDA 3L3KB 1EHXA 4WJ5B 5H2BB 1HE7A 3C9NB 1M7XA 4EJ1C 1UM4L 1T7YA 4Q2ZA 4TUOA 2E9IA 1UWXH 3K8KA 3S4SB 2ICES 4HG4K 3BEWB 2GIYA 1TJHL 1S9XA 3DXAD 4MB3A 3MRQA 3O9WB 2R39A 2HVJA 2J88H 2OTPA 1MCOH 2SEBA 3BQUB 3W2DH 1W8NA 3RWCA 1MIEL 4P2CG 1ORQA 1XF4B 3EJYC 5D1QD 3VRJB 3ARDC 4QKXB 4YDVA 5E6IB 3EYSH 2AK1H 4KK5C 4H25A 3WKMH 2J88L 1QLFB 12E8L 2NNAA 2I9TB 4M1GH 1U36A 2NY2B 3W2DL 3IJYB 1Q72H 2IANB 1UVQA 5D9SB 4R4FH 2AK1L 2YD5A 2ZCHH 1WLHA 3WKML 1HSBA 4M1GL 2X2YA 3NGBB 3QISA 1W72A 1Q72L 2FL5B 3AVEA 4PY8I 1SJVA 5EIQA 3RVTC 5FGCB 5F6IB 3F6IA 5EPMB 1XCTA 1MCCA 2Q86B 4GG6B 4U0RC 5DMKB 3O11A 3TBWB 1IC4H 3IF1A 1EUUA 1X5GA 5HHOA 3QQ4A 1MWAB 5F88B 5I73C 4OUUA 3BKJL 5IR1A 4HFUH 4KY1H 3BWAA 4Y16D 2VIRA 1WFOA 4MS8D 2YWYA 1IC4L 1I3UA 4IOSD 1FSKB 2LU4A 1UEMA 2ARJB 4HFUL 4XNUH 4JQIL 2HT4C 2XACC 4BH8B 1AQKH 4BYHA 4Y5XA 1CD9B 3KJ6H 3LZFL 5IVOA 1Y6MR 2Z0BA 5IVXB 4PJCF 2JJSC 5IBUB 2HFFB 3P4NA 4GOSA 2P5EB 4XNUL 2NPLX 5C0EA 5C07A 1B6UA 2M26A 1I85A 3A6BH 3MV01 3CX5J 1QOKA 2FEDC 2H2PC 5EU6D 4Y19E 3WNKA 3D25A 5IFJA 3GSNL 2VXUL 2F15A 4EI5C 3PQYE 1EFXD 2C7UB 4V1DD 1CFTA 2EXWC 3SGDI 1WJ3A 4FS0A 2D2OA 3DGCR 2AVGA 3BVNA 3TN0D 4U1SA 1XF1A 3O8XA 5KSUA 1U8IB 1LHZA 2RCSH 5TFSL 3V5DA 1UJ3A 1I4FA 1VGEL 4HS6B 3VFNA 4DZBA 3RDTB 4JDTL 1QKZH 3CSGA 1GL4B 5C3LD 1FBIH 4FXKB 3GI9H 3HG1E 5DJAB 2VDKL 4F58H 2RCSL 2CXKA 3WS3B 1QKZL 4HZLA 1NUGA 1FBIL 3OQ3B 4JFEE 5GGVH 3EYOA 1RIVH 1IL1B 1UWGH 4EIGB 5DWUL 1I7UA 4DCQA 1I1RA 1M6OB 2ZUUA 3IDNB 1DBAH 3DETD 4OLWH 1I8MA 4L4VA 4JAMB 1WTLA 1L7TH 1RIVL 1UWGL 1X44A 4NSKA 3TO4C 4JZOB 2DJ4A 1GRWA 4B5EA 3VFOA 2VERN 3ZE2E 2JJVA 1DBAL 3MRGB 4HFWA 2DQEH 5GISH 4ERSH 1L7TL 4KAQH 3EDDA 2C1PA 3JWOH 4G8FB 4OF6A 5GS1C 1D9KB 4IIQB 3B43A 2DQEL 4MJIB 2YUXA 5GISL 2CDEA 5DHVH 4NJAH 4A2MA 5FA3A 3OZ9H 1XGQB 1HILB 4XPAL 2ICWA 2AXHA 4DGVH 4PB9H 3S35H 1CT8A 4NJAL 3VE0B 2OSLB 3RZWA 5DJZB 4KTEH 2X7LA 2Y07H 2DJUA 3OZ9L 5FOBA 3VGEA 1HXMA 3CVHH 5F7EL 4DGVL 4PB9L 5CSZB 3RL2A 3OGCB 1NFDA 1PVHA 3S35L 5CKAA 1YC7A 5I0DA 4FRWA 2AERT 4BZ1H 4KTEL 1SBBA 3D85B 3RUGE 5D6DA 2B5IC 1H5BC 5E9DE 3CVHL 4KQ3H 1ZGLP 1FFPA 3GJFH 2RR3A 4N9GB 4BZ1L 4PRIB 3AC0A 4PJAB 5CBEB 4RFEA 3VFWB 3VFRB 4QY8B 2GK0A 4HT1H 4KQ3L 4WFGD 4M9PA 3JWOC 3T0VA 3FO2A 5C0IB 5BVJA 4KK6D 1I8LC 5SWSB 2V7NB 3BPCA 3FCTB 3MODH 4NC1C 3MLRH 4KMTH 3N1PC 2MCPH 3ULUE 4WCYL 2NXYB 5I15L 4UDTA 2NQCA 3FO0L 1FG9C 2XZQL 2BVYA 3GRWA 3JTSA 3GMNB 3MLRL 1G7JA 5F3HB 4KMTL 4XAWL 2MCPL 2R4RL 3W0WB 5JLZA 1F8TL 4LLUA 4NZUH 4AQOA 4D9QD 3BP4B 2CLRB 1DUZB 3IDMB 2DIAA 1KIUA 5I8EB 1N5AA 5CBAB 4LVHB 1QSEB 3SBWC 3MBEC 1GGBH 3IDXH 4FQ1H 5JA9A 4NZUL 3CH1B 1DDHB 4K3EH 2FSEB 2Z8VC 5LGJA 2HRLA 2AV7A 4U1MA 1AJ7L 4Q0XH 4AQ1B 1GGBL 3IDXL 3H9HB 4FQ1L 4CVZB 4JZJC 4K3EL 2XWTB 3QR2A 1FQ9C 4PJXB 4LIQE 2A74B 3S88H 4POYA 5I9QB 3G6AA 1DQDL 1NBYA 1G1CA 2WBKA 2V5MA 3HE7A 3RVWD 4D0CB 1GCFA 3FT2A 1CICC 4NNXB 4G6JH 3PWNB 1U8NA 4BQCA 3KXFA 4P23B 3O81A 3VA2C 2YXMA 5BXFB 4XBGB 4JFDB 2IQAA 3H8NA 1T21A 4HK3N 3O41B 1QFWM 5B22A 1J8HA 3KPTA 1ZLVH 3MRNB 1U2CA 3P4OA 1YMMB 3MLUH 1A6TB 3OKEB 4OM1L 4LSQH 3X11A 4YX2H 1LP9B 3ZDZF 3T09A 2L7JA 2ADGB 5FIEA 2GHWB 4ODTL 3VFVB 2AI0L 3PDDA 3WL9A 5C0BD 3SDXF 5F1NB 3DRTA 3MLUL 4ELKA 3CXDH 4LSQL 2JK5A 4YX2L 4GJTB 3GMQA 1JPTL 1MEXH 5BW7A 4Z76A 2C3GA 4PJEF 4ISVA 3W9EB 4ZSOE 4LKCB 3SDCC 3UZEA 3CXDL 4K7PY 1RU9H 5D93C 2BX5A 1KPRB 3LS4H 3EGSA 3K74B 3U6RB 4WV1B 2G75B 2E7HA 4I2XB 4ZQKB 4WO4B 1QO3B 4PJHF 4HJGA 5EN2A 1INQB 4XC3H 1RU9L 2Y6SD 1X5KA 1GGCL 4HBQA 4L8DA 4YR6A 4QGTA 1RJYB 4J12A 5HPMA 1E4KA 4XGZB 3ZKNC 1Q94A 1ZKAA 4RAUB 1PD6A 2CRIA 3PWPE 3X3FH 4LCWD 4QHLA 4NQCE 3EYQD 4XC3L 3UTTD 3ZKQD 1ZSDB 2YA2A 3BP7B 4O9HL 1X4ZA 2Z4QB 5EOQL 3G6DH 1OGAA 3D2UA 1MLCA 2ORBH 5AZ2L 2AXGB 4FQXD 3V6OE 1SJHA 4MLSA 3HRZA 4L3AA 3IFOB 3PWUA 5EU7E 3G6DL 3NIFE 2R1WB 5T1LA 2ZUSA 3SDDB 1UZ8B 2ORBL 1TQCC 1FNFA 4HIIA 1UFUA 5KS9F 1HOCA 4P57B 4MB4A 5MI0C 1ACYL 2JELL 3PIQB 4NQTA 1KCRH 4JN1H 2FLRT 1LEIA 2FBJH 5GJTH 5T1DH 3GGWB 5EUOB 5K9QG 3LRSA 1ZE3C 1EO8H 2E8YA 1KCRL 1NGYB 1M4KA 3H9ZA 4P46B 4YWGH 5F6HI 4HLZH 3DMMD 1TITA 1EO8L 1NCAH 3PHSA 3VXRA 2LV4A 4E5XB 4P59H 1SM3H 1AIFB 3FZUD 1JGDA 1PFCA 5I8CA 4JCMA 2GI7A 4OZFA 2OR9H 1RUML 2XZCH 1NCAL 2CQVA 3IAGC 4D94A 1YYMH 1SM3L 4P9MH 4IBLT 3RTQB 3CSYA 3TJHC 2OR9L 1MVUA 4D8PA 4YXHH 2UVFA 3SE9L 4C55A 3VDCA 4Z7VF 4P9ML 5JDJA 3E2HC 4CMMB 3KWWA 4R0LC 4EXPX 4JPKH 1Q8MA 5FGBA 4EUPA 1BF8A 2PO6B 3OHXB 4X9IA 2QADB 5GJSL 4YXHL 1G7QA 1SHMA 4TRPH 4UI2A 1OP3H 3LIZH 1KJ2H 4GW1A 4D2NA 4HGMA 3EHBD 4NQVB 3G5YA 3O4LD 4JPKL 4E41A 2FX8L 4MAYC 4MXQD 2WBJC 1H15B 4RSVA 3LIZL 1KJ2L 5BO1H 2P8MA 2A0LC 1KJMB 4PTTA 1BFVH 1OWWA 3QDGD 4LF3A 3TNMB 5ICZB 4GRLC 1ZHLA 2H8PB 1PQZB 2DD8H 1UYWH 1A9EA 1IAKA 2IGFH 1ZLUH 4PJ5D 5GGSB 3WEXB 1NCCH 3LAFA 4KK9C 3K80A 5K93A 2DD8L 2OL3B 4Y7MA 1J18A 4Z7WE 4Z0XA 4LK4A 5LGHH 3VWJC 4EN3D 2KH2B 1MCSA 2O26U 1DQQA 1YN7B 3A6OA 1J1PL 2AJ3A 4U3CA 4R4ND 2MCG1 1NCCL 2FJFA 1OQXA 5EUKA 1N8ZB 2QV2A 3O3DB 5JORB 4H5SB 3LKRB 4OFYA 2B1AH 5GS2H 1KTDA 4RAHA 1HHJA 1BFOA 2RBLA 3BIBX 3TC9A 5BV7H 5B38B 4NGHH 4XPBH 1A6PA 1X5IA 1DVFB 2ERJB 2B1AL 4HPOH 4QGYA 5DEFB 2EDNA 2DMKA 3HE6D 1TXKA 4KRPC 3DUHA 5BV7L 4NGHL 1KXTB 3F58H 3TWCH 4DWHA 4HPOL 4WW2A 5D5ME 3FQWB 1TZGH 5HGBA 3ZT7A 3K1DA 4IMLB 4LLWB 1N7MH 5ESAA 5EOTB 5E5MB 5GIRA 3UTSD 4BKLA 1TZGL 4O51B 2V7HA 5GZND 4EI6B 2Z9TA