4MA8L

Crystal structure of mouse prion protein complexed with chlorpromazine
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
213
structure length
213
Chain Sequence
b'DIVLTQSPAILSVSPGERVSFSCRASQNIGTSIHWYQQRTNESPRLIIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQSNTWPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSETDQDSKDSTYSMSSTLTLTKDEYERHNTYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major prion protein
publication title Structural basis of prion inhibition by phenothiazine compounds.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 54
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2013-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ma8L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ma8L01
4PJCB 5DRWA 1NSNH 4R3SA 3OAYK 1J7VR 2V7NA 3GK8L 1H15A 4FQ1H 4MA7H 3CDCA 4NUGH 1L4IA 3MREB 2NYYC 3CXDL 3KPTA 2DWEB 4GS7B 4JM2D 1DZBA 4JM2F 5F72S 1JHLL 2Q8AL 2NY4C 2PW2A 3G5YB 5IMLB 5IW1B 3VWJA 3CXHJ 2PN5A 2N7BA 1X3DA 2RFXB 3EAKA 3SDDD 3S9DB 4U33A 3GSVA 2DQIH 4G6KL 5EBMB 3WNNA 4MNHB 5EBLB 4XAWH 5EIVA 3OG6B 5MERA 3A6CL 1EHNA 3T4AB 3NCYS 4ELKB 1FCGA 4XP6L 4LF3A 3I6KB 1L0XA 3VXPA 4CMMB 1AI1L 2C5DC 2E27L 3MRPA 4ZPVA 4NSKB 3S3PA 5T33H 3PWPB 2JCCE 4R2GC 3OR7B 3GHEH 1LO0L 3FAWA 3P73A 4P59L 1U2HA 2EDQA 4LLWA 4YX2H 1BF2A 3PWUA 4FABH 1NAMA 4NT6A 1FL3A 1UXSA 4RFEA 4PV9B 1A8JH 1K3IA 3FB6A 3O2VL 4LGPB 4LCIH 3GJFA 5TDPB 2C3GA 1DBKH 1NGPH 5GRWA 2W65B 3H0TA 4PJEB 3JTTB 2VDRH 1AO7D 2ADIA 2CGRH 4ELMF 2XA8L 2Z31C 2QTEA 5DHVA 1AGCB 1N2RA 4OFKA 4Q0XL 4YHOH 3DVIA 3CFJA 1KEMH 2ED7A 3Q3GB 1MNUL 2L0DA 1RZFL 1FAKT 3TVMB 3KLSA 4P5MB 1QYGL 5BS0B 1F13A 3CVHL 3ULUH 3KPPA 4KJQD 1P5UA 3FN9A 2DDQL 5K93A 2I07A 4MXWL 4JQVC 2G5RA 5ITFA 1BAFL 1C12B 2FEDC 3SDYL 4G8EB 3MRMA 4Y5VB 4YDKH 4HK3N 1C16B 4HGKC 3REVA 2CDEB 2VLKA 4ISVB 3EDJA 3QUXB 2CKBA 1T1ZB 3P40A 4S0SD 5DJ6A 1DBMH 5E6IA 3WIHL 3T0AA 3VW3H 3TPUB 2YOCA 5ESAA 3KPRD 4QWWC 3BP7B 3KPMB 4PS4L 4CVUA 4FQXA 4XVTH 5KW9L 4HGMA 1RMFL 4D9RD 5FYLH 3CFDA 5B4MD 2M1KA 4R4NC 1VFBA 4I18B 5DEFA 5C0CE 2YMXL 4JPVL 3H9ZA 2BY2A 1OLZA 2R0WL 3Q48A 1GGCL 2ARWA 3TIEB 4TOYL 1MREL 2AJUL 4J23A 1A7NH 3OKKA 4YGVB 2R0KH 2A6DA 2A83B 4MAUH 1XT5A 1XZ0B 1ZT4A 5F8RC 1FH5H 1FQ9C 4MSWA 1OW0C 4HIJB 4P2RB 1I7UA 2JB6B 1QBLL 7CGTA 4GAYB 4NZUH 4LQFL 1HH9A 3BRFA 1F4XL 5GGVY 3O6KL 4QXTA 3MBXH 4PYGA 1R5IB 4QRPB 5ERWA 1NUNB 1CE1H 4WV1B 3WHXB 4BFEA 1A7OL 2HT3D 5HGBA 3VRIA 3GSUB 1U8JA 2LFGA 4PJXE 3U4BL 2JCCF 3MJ6A 1RURH 4RBPH 5B39B 4OZIB 1P7QB 1KLGA 1LO4L 5BZDB 4BQCA 2CKNA 4WRLA 1R6VA 3O8XA 4X80L 5T1LB 2PXYB 3WNKA 4D9LL 2XZCH 4S11A 4MQXC 3LZFL 1I9IL 2X89A 4I48B 4HEPG 3U82B 4NWTH 1CD1B 3G5XA 3BT2H 5HHNB 1H0DA 4LSRH 1HIMH 2FX8L 3BH8B 1FV1B 1BVKA 2EXYC 3QFJD 4Z9KB 5E8NA 3UC0L 4D8PA 5DURB 3OJVC 4GG6F 4MD5A 3F7RA 5ESVB 4O2FA 4B50A 4D0CA 2I60H 3KJ4C 4OKVB 1A47A 3H6JA 4NN5B 1L7IL 3P4NA 4XI5C 1T2XA 3TO2B 5CUSL 3QIWC 3AREA 1OOAA 2E7HA 1J05B 4ZO6A 1T03H 2N56A 4UQ2A 3WIHA 3H3PL 5D2NB 4OIIH 4O58H 4B7IA 3ZL4L 5J9PB 5HYJE 4YJZL 1FZKA 3MUY1 1QVOB 3SDCA 3HPJB 3L3DB 4PJ9D 4L4TB 3CFBA 1W2KT 4GKOA 4JRXA 3IDXL 4ZO8A 1OP3K 4IMKC 2MWCA 1NGXA 3RVUD 5C0CD 1YMHB 1A0QH 1U95B 2XWBB 5D7JA 2X5PA 5D96B 1QACA 4QHUA 4E9LA 3U4EB 5GGTL 5MEPA 4NHUA 3DBXB 1IGCH 1Z9SA 5GS0L 3BO8A 5B8CC 2ZCKH 4WU7A 1U8HB 1QEWB 4JEGB 1YNLL 4AEIH 4I0PD 2UWEA 4RWYL 1BJMA 4OD2B 3TNMB 2WP3O 1XF4A 2OR7A 4WI5A 3SE8H 3TBVA 1T2QL 3A6BL 1TTUA 4PG2C 3KLHC 1C8PA 3LQAL 3L6FB 3SHSA 2DIAA 1JNHA 1NCTA 3BYYA 3MOBH 2PR4H 1PQZA 4PJXF 2PNDA 1T4KB 4YEEA 1MJ8L 2EC9T 1B4JH 5KAQG 1LO2L 2X4OB 4ONGL 3LMJL 5GZOD 5C8JA 4J8RA 1WC7B 2IFGA 3MCKA 3DECA 5INDA 1MCEA 2G9HB 3MZTA 3I3BA 1F4YL 5I8OH 4L1HA 4OFIA 4PRPA 3NVQA 1UWEL 3HE7A 1JUFA 1TZGH 3CCHA 4PTTB 4GRLC 2WBJC 4XNMA 4XHJD 4RRPG 5HDQH 1JN6B 4MNGB 3AB0B 5E1AB 1YEKH 3EDFA 1FZOB 3IDMA 4XP1H 4ONHB 1KULA 1B6DA 1KCVL 4OD3H 3MNWB 5BXFB 2EYRB 4HZLA 4QY8B 1KEGL 5IBLD 2K7PA 1JZ8A 4G5ZL 2QKIB 5DHYA 3K0WA 4LL9A 3C60A 4A2MA 1CFBA 2APWA 3VH8G 5IHZA 1U3HB 1RU9L 2GQHA 5MHSE 5K9QI 4NCDA 4NRZB 5I8KH 4KZDL 1I3RA 1JNNL 2AXGB 5L6YH 2XTJE 4FTVB 5IB3B 5HYJD 3ZDXE 1RIHH 4M5ZL 4RMTA 2XKUA 3D39A 4N8VG 4TSAH 2D31B 4Y4FA 5GGVL 1ACYL 5I15H 3U0PA 1P4BL 3WLBA 4KUCD 2XOTA 2BP3A 4KUCF 5KOMC 3HZVA 4JN1L 5E9DB 4QHKI 5E6ID 4ZUTA 5EIIB 5ABDE 2HG5A 2BSTB 4O2EA 4QTHB 1BIIA 3FO9A 1EAJA 1IC7H 5GGTA 1VKXA 4RISL 4FQXD 3FAXA 4JM2B 3ARPA 3IDGB 4RRPA 3RA7L 3P3YA 4L8BB 4JG0H 5AZ2H 3PP3H 3BWUC 4XBEH 1DQDL 1W8NA 5D1QB 5J3HD 5IWLC 4YNYA 4EOWH 4KDTA 4C55A 4JPKL 5HY9A 2FEEI 4PRNB 1JK8B 4IRJA 3SDDB 3MLRL 4F9LA 1E6JH 2VN7A 2PYEB 1TPXC 1TCRA 3KYMB 3NIDE 5LXGL 2ESVA 3GMOA 1GZPB 4KK6D 1VFOA 5GISH 3QHZH 1MJ7L 4NO3B 1WIUA 4JKWA 5EDXA 1I1AB 4XPTH 3VH8A 3WEXA 4R96B 4BFBD 1S7VB 3UTOA 1OAXL 1I9JL 4Y88A 4FNLH 5FGBA 5KVGL 1F4HA 2WMPA 5CKGA 4P3CL 1JGDB 4JAMA 2AV1A 5HHMD 4N8VA 4Q74A 1D5BB 2OZ4L 5F7DA 2DL2A 2P8LB 4W4OA 1AHWB 2X4SB 3PV6A 1AD9A 1ZOXA 4X99B 3VFWA 2V2WB 5I16B 2HKHH 3O8XD 3KYNB 2GK0A 4GS7C 2BERA 4H25A 4L8DA 4PJHA 4NP4H 5DMYA 4HIEA 5C9JA 4POUB 2X89D 1EEZA 4L9LC 4HAGA 3QISA 5GSVA 3GI8L 4E42A 5BV7B 6FABH 5F97E 2R1XB 1OAYL 1Y0LA 3ZSSA 1OCWH 2GITA 4CW1A 3HFMH 2FWOA 4HXBH 1JRHI 1UH4A 4ZUVB 4J1UB 3CSYB 3C5SA 2VZ3A 1TZIA 4BSJA 1NKRA 2EE6A 3KS0H 3WDJA 2J12B 4S1QL 4JPIA 3TNNB 2FATH 3VXMA 2DLIA 1M7XA 4HS6A 4QXUL 1J0IA 1ED3A 3PF2A 3TJEL 4WFED 4P2OD 4XXDA 1S3KH 2BNRE 1OP9A 3K74B 4XMLL 3WKML 2W60A 3KPRB 3IDYC 4YZFE 4H1LB 3ZDXF 1YY8B 1PG7L 3ULSB 2CDFB 1FORL 1E28B 3BP6A 4XNZC 4PJ5A 3IYLW 1BQLH 4U6YA 4LSVH 1BF8A 4ZAKC 2X09A 4QRTB 1QFUH 1KIPA 3OXRA 3SDCD 5HXMA 4K23L 3OHXA 1RUPL 2R23B 1QHOA 3D5OF 2VH5L 4AZ8A 1V8HA 5KZCD 1KB5L 1QA9B 4UIKH 4JFEA 5I1JL 3UBXG 3F62A 1H8OA 1OGAE 2DTMH 5DWUL 4PRDA 1AQKL 2BSSB 3V6ZB 1TJGL 4WEBL 1P53A 4I13B 1FAIH 2AJ3A 5HHVH 3RWDA 3QXUA 5SX4I 3NIDF 4LSPH 2ADJA 3MRHB 4AG4H 4POZD 4Y5VC 3O2DL 4BM7A 1DEEB 2LAAA 3J8F7 3OKOB 4XP4L 5EU7E 1ONQA 4M1DH 3BKYL 1ACZA 3QUXC 5I66B 4L3EE 1H9VA 3JXAA 4UI2A 4R7DA 2VIRA 2JCCB 4D0DB 4FFYL 4YO0A 1FJ1B 3LOWA 5DJ0B 4NQSB 5FYJE 4RAHA 2YUXA 1LK3L 3RGVA 1RJYA 2SEBB 1PX4A 3OX8A 1P9MA 4NQXA 1F6FB 3G9VA 3L3KB 4PY8I 1A6TB 5F1IA 4I18C 5MP6L 2ENYA 4EUPG 3EOTH 4JM4L 1FFPB 1BQHG 2Y06H 1FZJA 1BX2A 3H8NA 5EU4B 1UXWA 4X7SH 3WIIH 4HBCL 3CAFA 3UPRB 5AD0A 1KCKA 1DQMH 3K2UL 2A74B 5JPMB 4XAKE 2EDLA 1Y6KR 3UBXA 3M17B 1Q9OB 4WUUE 1MCQA 2A2QT 4JPWL 1T2JA 3FFCA 3HE7D 1N3NA 3OGCA 4JQXA 2KQMA 5TQ0H 3FZUC 1MCNA 3EBAA 4M8VA 4LLUA 1HE7A 4WV1C 5D9SB 1INDL 4XWGL 4R4BA 3K4AA 15C8H 4CMHB 5J57B 5TE7H 3MV7A 4RAUA 1WT5A 2BVOA 2DM7A 4X6EA 4NZRH 1G6VK 5DJYA 1C1EL 5H35B 3Q5OA 4GKZB 5LQBH 2BDNL 4NQVB 4PP1C 3HR6A 3REWA 4OFYD 4XTRD 4YZFF 3VXME 4JO2L 3IKCB 4G43B 4OIAA 2ID5A 4LMQI 3RWHA 1MWAA 3W9EA 4EUPA 5FUCC 1BQHA 2WW8A 4N0UA 4YDIH 3LH2L 4LSTL 4JO1H 2EIZB 5C0CB 1ZLSH 1Z3GL 1H3TA 4YXHH 1JMZA 5E99H 5DZOA 4LEXL 4QHLA 1XGPA 2V7NB 4CN6A 4I77H 1BJ1H 5F6IC 3QNYA 4P46C 4GW4B 3MRGA 5JQ6H 5F9DC 1WZ1H 4BH7A 1Q8MA 3QEHA 2WINB 1OGAD 4I0PB 4NNYA 5LAXB 4LLYB 4OQ1A 4Y4HD 5GSRB 1OQXA 3MLSL 3IRZA 1NMCB 4LAQL 4KKNA 1C5CL 2CLRB 1MJUH 1DBAH 3MRJA 4KUZL 4NN5C 1X5JA 3GRWA 4EEEA 3HPLB 4JFEE 1ZGLM 4XVSH 3FQRB 2G60L 4ONFL 2WV3A 4IRJD 5FM5M 3OR6A 5CBAA 3RL1A 1OAKL 1OL0A 2FJFA 4NRXB 5D2NC 5M94B 1MI5A 4U1SA 2DI7A 3RWEB 1KG0A 4L3ED 5IMOA 1G7JA 3FB8B 5CS7A 1U93A 3CUPB 4PJXB 3W82A 2ZJSL 3BN9D 2HT4C 1FL6A 3MJGX 2DI8A 1OAUL 2IMMA 3VXPB 5IQ7H 2YD4A 2C7UB 4FQHB 5TE4H 3HC4L 1N59B 3DX8B 3ULVE 3NTCH 1DUYB 1RV6X 4OF5A 4HAFA 4D3CH 3KYOA 5AZEL 5KVEH 5D96C 4WIQA 2BNQA 4WW2A 2XXCB 3RU8H 3TA3D 1BVZA 3MRCB 4A6YB 1RUQH 25C8H 1FGNH 5FCSH 4XAKD 1FVDB 3K46A 3EW3B 4HC1H 4EN3D 5HDLA 1S5HB 3CFIC 2CUIA 3D85D 2O26U 1F8TH 4LPXA 2PTTB 3LRGA 2XWJA 2ARJQ 1N6QL 3BDBA 5EO9B 5DQDH 1CZ8H 1YQVL 1JNJA 2NCMA 3NAAH 4LFHG 1T3FA 4PY8J 3FOMB 1ZWIA 5IK3A 1VENA 5IFJB 2IF7A 1JYWA 3VDBA 3X11A 3QHFH 1IQDB 5GZND 1Q1JL 1BREA 4G8IB 3QWQB 3WD5L 3S5LG 2I07B 3GB7A 3ZE2F 4K94L 5HYJB 2Q76A 3MRMB 3E6HA 3X17A 4LEOA 1UCTA 3OKLA 4OKDA 5D7KE 3VXMD 1ZHBB 5GJSH 4NFCA 4PLKC 1CK0L 2NMSA 2CKBB 2HLFC 7FABH 4Z6AT 3Q1SH 5DQ9B 3SBWA 4GKNB 1SMOA 3QCUH 4BSWB 5AYUL 2OP4H 3VMPA 1QSFE 3ARFA 1EEYB 2LU3A 5JIPA 5BO1L 4PJ5D 2H6PB 1ETZB 3WUWB 5M7QA 4Z8FH 1FO0B 4DKFH 1GGIH 1JIBA 2XQBL 1K8DB 4B41A 1VFBB 3LEYH 3AY4A 5DEFB 3RUGE 1ZANL 1OP3H 4NM8L 4Y5XA 3BPLB 2HRLA 4FZ8L 4OM0H 4ZSOA 5CZVL 5LGKA 2VOTA 5ID0A 3RTQC 1I8LA 12E8H 5DSCB 1BQUA 2OBGA 3V52H 3HI6H 3MNVB 4JFED 2UZXB 3I2CH 3PP4H 1J0YA 1FNFA 2D7TH 4YHLL 1DVFC 2GUOA 4DTGH 1U3HC 5D5MA 5C0EB 3CDGB 5C07A 1G1CA 1NEUA 1T21B 2BY1A 4QGTA 3S5LA 5DVOA 3L3IA 4QXTB 3HB3C 1R3KA 3SO5A 5C0DB 2X1XR 4P57A 2BVPB 4K3JL 3JWDH 2ATPA 4PRHE 1KOAA 5IG7B 5E08L 1U8JB 3CZFB 4HLZG 3ULVD 3ULVF 4FG6D 4CVXB 1KLGB 5CHNB 5I76A 2P5EE 3QDJA 2MOVA 3KYKH 3O8XB 5ESQB 1J0JA 2IALA 3RGVD 3VFNB 5D1XB 5IVXA 1CXFA 3U9PH 3WDHA 4D9QD 4M7JH 5D1QC 3WMSA 3STZA 5T3XD 3NABL 5DJAB 3ROOB 2P8MB 2D9CA 3AMLA 4GLRI 1P7KB 2XPGA 3MLYH 1IM3A 1A1OA 3G5XB 3EOYG 1U8PB 4LIQH 3AXLB 3UX9B 3KVQA 1P84J 5IIEB 1H0DB 2PO6A 3BAEH 4YC2C 1JZ5A 2CLZA 2WUBL 4WHYG 4XCNB 5E2UH 5JW4N 1EX0A 5I17A 3MRDB 1N5YH 1GRWA 1EPFA 4OLUH 2D0FA 2ICEB 1I1AC 2JJUA 3FFCD 3QEGH 3UAJD 5IGXL 4TRPH 4MD5B 4D0CB 4RZCA 5ITBL 1REIA 4HJGB 2CD0A 3G6AA 4P2OB 2FECL 4LSDA 4DUWA 3MYJA 3P4NB 4G9FA 2BNUA 4U6XB 1T1WA 2XTJB 4LRIC 4NDMB 5FIEA 3MV7D 1GGUA 3WLWC 4UQ2B 5EC2B 3D25A 1XH3A 4L4VE 3HCVB 4M7ZB 1AHWC 1UKQA 3VGDA 3I9GL 3OZ9L 2A77L 3VRJB 4JQIH 2Q86A 4Z76A 3TBYA 2QQQA 3PGDA 1J0HA 1QSFD 1HXYA 4Y1AE 5LVEA 4TN9A 1T20B 3DYOA 4I4WB 1I8IA 4IHOA 4JANA 3MRRA 5DUPL 4Z7UE 1I1YB 3RUGF 4EJ1C 2H2PC 1WCBB 2GAZB 3CZJA 1I8MA 4Q9QL 3BO8B 3FQTA 1IGJB 4WU7B 4UT9H 3TFKC 2K7QA 4LLMB 3UJJL 3BXNB 1AQDB 4ZSOE 4RGND 4RMWA 5TE6L 3WHE1 5CEYB 3HS0A 3TBVB 2ENSA 1ZLWK 1MCJA 1T1XA 1X5GA 2HAZA 4YFLF 4J3UA 5C0JA 3TH2T 2QQLH 1RK1A 4ETQB 3VXQA 3S8WA 4LVEA 4UIMB 2VB5A 2NY1B 4WU5A 3GEWB 3WSQH 2QHRH 1YNTA 5IP4A 2XN9A 1MI5D 4MA8L 1HWGB 5C0FB 1YPZE 4LSQH 2DD8H 2A6IB 1PQZB 2DM4A 1M71A 3MGOB 3WFHB 4U49A 2P5ED 3DSFL 2YC1A 4MS8D 3EYFA 3ZMRA 3CSBA 1MH5B 1DQQA 3NZ8A 2AEWA 3KWWB 5I1CH 1A7RH 1RZJL 4XCEB 3D3VA 3JVGA 5ACZA 4ZPTB 3NCJL 3VFRB 4HKXA 4KQ4H 3GZKA 4JY6A 3HE7B 1GIGH 1G1YA 1T5WB 1RIVH 5C6TL 5CD3B 2IQ9H 3JUYA 3IAPA 4UDTA 3C6LD 1FE8L 4TUKH 4W4NA 4XC1L 4IBLT 1I75A 3I50H 4WCYL 4DVRH 3BH9A 5E5RB 5D72H 4JRYA 3TN0A 2NY3C 1CDUA 2BNRB 1MQ8A 5HVWA 2A0LC 1NBZB 4Y19A 3QJFB 3RVXC 2IGFL 5DMIL 2VLLB 4L4VD 4NQCE 4G9FE 5C0RL 2BSRB 2AK1H 5EOCJ 2R2EA 3VFOB 4Y16B 4I5BB 1Q9LA 4CKVX 4HXAL 5BCAA 4N1HB 5DVKA 5F1NA 1T0MB 1FL5A 2KPNA 2IPUK 4WI4A 1KSRA 3T65B 1E4JA 2X4RB 4KMTH 3HZKB 1OP5K 2HFGH 4W81A 1E4XL 4Z7UF 1VKXB 2GW5A 1OGAB 1LO5B 1OTTD 4Y4HB 4NBYB 5DDHB 5AAWA 3UO1L 1A6WL 2C3HA 3CLFL 3PWJA 3R06A 1U6AL 1E4KC 3ZTNH 4U6VH 4LDLB 2B39A 5DGRA 4CMHC 4YEFA 1UEYA 4N0FB 5FDWA 4IRJB 2R2CA 1ZEAL 1RUMH 4L3EB 4LFHD 1KXTB 5I9QB 3IDUA 2CR6A 4TVPE 5KANI 1JFQL 3GJFK 1M6OA 3GMOB 2BX5A 3BDYL 1ZVSB 4WO4A 5F7HA 3NPSB 3G6JA 5HBBA 4OGXH 1S78C 3O3BA 5HHOA 1FIGL 3SCMB 2R1YB 5C07D 1JI2A 4HF5H 4WFHD 1SMAA 1G9MH 1YPZF 4K7PY 3BZFA 4DGIL 3RVUC 4GJTB 4OGYH 4ZDHA 5E2VL 5J13B 4HUXB 5L0QC 5ENWA 1UACH 5AAMA 4JCLA 4MQSB 1D6EB 2WAHA 4RWHA 2J8UA 2VC2H 4WDIA 3TA3B 5TH2B 4PRAB 4CNIA 4UNVA 6CGTA 4P48A 4JFOB 3T4YA 5DR5H 5C92A 4LVHC 4UNUA 3VFWB 3QDJD 4UNTA 5HI5C 4KTDH 4WUUB 4EN3B 3QNXA 1QUNA 2DLGA 2FLBT 3D85B 5E2WH 1HN1A 1JNLH 4F7PA 2QQKL 1NMCC 4NGHH 5FCUH 4PJDA 4F7CA 4OCSL 1FNLA 1NSNL 3DIFB 2EE2A 5E8DH 1VHPA 2OK0L 2B1HH 2PKDA 1XIWA 2A9NH 4MA7L 5EA0H 4HG4K 2PO6D 1F5WA 4LGRB 3D48R 1IGFH 3OKEB 4YUEL 4XNQB 3ARGC 3ELAT 3OKDA 4PR5B 2D2OA 4Q9RL 3U2SA 4YDJB 3QWOA 4PBXA 3VXMB 4V2CB 4KKLC 3O45B 4HS6B 5KSAC 3V5DB 4NQCD 4G9FD 5KSUB 2DQIL 5D71L 2JJSA 1GH7A 2E6PA 2HT2C 1A4JA 5F1KC 3DGCR 3T8XA 4DGYL 4MJ2A 1UFUA 1EFXB 3L3OA 2E7BA 3O9WB 4JVUA 1PJ9A 1A1MB 1N6VA 3S3JA 1H3GA 3FHQA 4YXLH 3Q5TA 3RIFF 1X7QA 3GHEL 3BGAA 2J1KA 1YMMA 1Q0YH 2NW3A 1EGJH 3W5NA 1ADQH 2FHCA 3FN3A 3NIFE 4FABL 1B2WH 3DJ9A 1GGTA 4G9DB 5GRJL 3DYPA 1HQ4A 4JFEB 4Y4KC 4EI5A 1DLHA 2OX5A 4LLDB 3N1MC 3HZMB 1KN4H 4PRDB 4ODUB 5J0BA 1DBKL 1K9TA 4AENB 2WZPD 1KCUH 2NX5A 1NGPL 3W2DH 1DQLL 4F33A 2MSPA 2ERJB 3HRZA 2CGRL 2Y6SC 4YHOL 5JMRA 4JFFE 5BQ7B 1KEML 2N4IA 1OPGH 1FN4A 2OL3A 3LHPH 1ZLUK 3HNSH 4YO0B 1MLCA 3RWGB 3ARXA 3RI5F 4ZNEA 3EO1B 3RGVB 2XN9D 4F3FA 4NQXB 1N5AB 2DQJH 4HW6A 3OPZH 4YDKL 3PL6B 3SPVB 1OY3B 2ZCLH 3L5WA 1ZAGA 3MUJA 1CLOL 3O11B 2HTLC 4KJYB 3U9UB 5KJRL 3CDFA 2DQUH 4LCWA 3ZT7A 1UADC 3X12A 3CLEL 1R5WA 5FECA 4P4RA 3ZE0E 3QNZB 2Q6WB 3L7FA 1TZHB 3T09A 3TC9A 4XVTL 4PTUB 3D3VD 1F6AB 3DX6A 5FYLL 1EO5A 2H3NA 2O5ZH 1S7QB 1C08A 43CAB 1O0VA 5E2TH 4FQ2H 1VEOA 4TUJA 1MHEB 1KJMB 3QA3A 1R3HA 1HHGB 1P4IL 1A2YA 3W39B 1A7NL 4R4FH 43C9B 3OJ2C 4PFEA 4MAUL 1G7QA 1JL8A 3UDWC 1UVQA 2Q8BH 3UEZA 1FH5L 4NQEE 4FXKA 4JRYD 5ALCH 1TDQA 4X6EB 1JV5A 3SKJH 5DJYB 2OTPA 3D87B 4NZUL 4QRRA 1EERB 4F2MB 3EKCA 4NOFA 5D1XC 3I6LE 1ORQB 2RCSH 1II4E 1QSFB 1I8KA 4Z0XB 3ARRA 3GUTB 3RUGB 4YHIA 1IAKB 4MMZC 3KDMB 4P5KB 1RURL 3KR3H 4RMUA 4K7PL 3G5VA 5KG9B 3LKPA 1XGTB 4NO2A 5EZOH 3NIFF 1VGEL 3EJJX 1YUHB 4ENED 2XZCL 8FABA 5CSZA 4MX7A 2IAMA 4X6CF 5E5UB 1RZ8B 4HEME 4KXZH 3L3HB 3Q6FB 5H94A 2DQDH 1GZQA 1N7MH 4K3DH 1D5ZB 2FB4H 2I9TA 3CIQA 3LS5H 2R1WB 1XR8B 2XTJC 2NPLX 5EPMB 1HIML 3P2TA 2GYSA 5DQJA 2GTZB 2FJFB 4PRHB 1KG0B 4U6HA 4JFFD 3X13A 2C1OB 3B2UC 4MCZA 4HFWB 4M4RA 4P2QE 2XNAB 2I60L 4MLSA 3O3EA 5BV7H 3JV4B 2P5EB 2V2TB 3E8UL 2VKWA 3H9SE 4PUBH 3EOBA 1U8QA 1IGIH 5HGHA 1BFTA 1MRFH 3L95A 4S1SL 1CTNA 5MI0B 3FONB 4RSVA 3WNMA 5TQ2H 5EUKA 2X7LB 4ZOEA 4UB0L 1QSZA 4NCC2 3ZE0F 3L9RA 5T5NF 3GO1H 3W81A 2B4CH 4LCWE 3WJJC 2X70B 4POZC 3V6FA 5DYOA 3LKNB 4UINH 4GT7A 3VXNA 5JOFA 3C6LB 2YPKA 1FGVH 4QRUB 4H1LH 1CQYA 4LLAA 1KCSL 2XWJB 2NY7H 1OLLA 5DF0A 3K2MC 3DURA 3VGGA 2XV6B 3QUMB 4ALAL 4H8WH 5L8JB 1MFAH 1T66C 4KK8C 2NY1C 5F89A 3BKMH 5IK3B 5DVLA 1QLRB 5DD3L 5I8EB 3WHE0 1MF2H 2F19H 5KVDH 4LLQB 4LK4A 4AEIL 3QPQD 3N85H 4L4VB 3DTXA 4NQED 3IGAA 2LU7A 5J1SC 3OV6A 1MCRA 3SE8L 3FRPG 5KSBA 1OSZB 5JUEH 2Q76B 3OKLB 3MR9B 4X6DA 3JWNC 1NL0H 2FIRT 1YJDC 4Y1AB 5DUBB 4QGYA 5DZNA 4G8FB 1EIBA 1L9NA 5HTSA 4HS3B 3MOBL 2C4FU 2HJKB 2PR4L 4GXVH 4Z7UB 4AT6B 2CMRH 5FYKD 4M61A 4YQXH 2Z8SA 2DQEH 3MLWL 4YFLI 3IB4A 2GEEA 4PJFA 2JLLA 2XZQH 3PGCA 3HG1A 1IILE 3ZT6A 4HJ0D 3WNPA 4LKCA 4ZSOB 5E94B 5I8OL 2AV7A 3IJHA 4RGOL 4JGMA 3UTPE 2YXMA 1KTDB 1KJ2A 3GBML 1AXSA 4NNXB 4EI5D 5CILH 4XTRC 3QCTH 4KHTH 5HDQL 1MEXH 1Q72H 3RVTD 1CS6A 1NEZB 4U1JB 3T0BA 4BKLB 1U8IB 4L8CA 3FRPA 1YPZB 1ZLWH 4BSVA 2ICWB 4XP1L 2AI0L 4Y16C 3D1MC 3S96A 1R3KB 2BHZA 5I1HH 4P2QD 4LOUC 4EBQL 1VGKB 3T04D 4R6UA 2HWZH 5CMAA 3R1GH 1LEGB 5IMKB 1NC4A 4EIGB 2BXZA 3H9SD 3VCLA 1AGEB 1KCLA 3SGJC 3HI5H 2O93L 4NRYA 3ROLA 2WIMA 5L6YL 2FYYA 4YDVB 1RIHL 3AS2A 3ARBB 3S3SA 1A64A 4PJGA 4TSAL 1W0VB 5JIHA 4LCWD 1UQSA 5EB9A 2Y1VA 4O00A 4UTAH 5E8OB 3MRKA 3QCVH 5EU7C 1IC7L 2J4WL 2PO6B 1HI6A 5I9QC 2YD1A 4FFVD 3W11C 5HYSB 4KI5E 1OT2A 4L8SB 3NPSC 3EJYC 5AZ2L 4XBEL 3S36H 4WW1A 1D5MB 3SCMC 4EOWL 3ZZ1A 3ARDB 3FFDB 4GRMA 2VDML 3TZVC 3P0YH 4YAQB 4D0BA 4J3WA 2EEDA 4NQCB 1E6JL 3PHOB 4G9FB 2BNUB 3TWCH 1P69B 3EJZD 4GAGH 1IGMH 2P45B 1SM3H 4JFPA 1LHZA 1NCBH 1HOCA 4G7YH 3GSRA 2FZ3A 3LIZH 3SKMA 3CD4A 4XPTL 4JG1L 1XF5A 2CIIB 2BHUA 2R9HC 4QRRD 2QQNH 4AY0A 1F58H 3FT2A 5E7BA 1HXYB 4G7VH 4NKMA 2A73B 4ODTL 5HVGB 4KWUA 3L3GB 4FXLA 3MRBB 2GY5A 2YPVH 4KU1A 5IVZA 5JQHC 1WWWX 3V7AE 1RJLB 4XBGB 2DYPB 1AIFA 4Y2DD 2ICWI 2HKHL 3IDIA 4IOFD 4U0QB 4ZFFA 1I8MB 4LHUB 1YEIH 4TPRL 3FTGB 3CFEB 4NP4L 2IAMD 1ZKAA 1UA6H 6FABL 3VDCA 3HS0B 5GRVL 1OCWL 5GRUH 3HFML 4JFDE 4A6YH 3UPCA 5EO0B 1T1XB 4HXBL 2VO5A 1I7TB 3INUH 1PZ5B 1IQWH 1NGYA 1XCQA 1X5ZA 3IFOB 3QI9A 4JFYA 3MV9E 3KPSA 2V9QA 1SY6H 4NC2B 5F7EH 1LDSA 3GMLA 2IADA 4LDEB 2CIKA 1JTOA 2QJDA 3O9WC 2FATL 3QDMA 5JXAL 2GCYA 4YXKL 4WJ5B 1X9QA 3MBEA 3SGKA 2JJTC 3CJJA 3QG7L 4HGWB 4Z77B 1S3KL 2Z92B 3IFLH 3MO1B 2BSED 3LN4A 5D2LA 1KPRB 3HUJE 1JCKA 3RL2B 2W0LA 2X1WL 2VL5A 4M1CD 4OSUL 5HHQA 1XF3B 5JW3H 3GSXB 4JY5L 3PIQA 3VA2C 4C56A 4QT5B 5D1ZA 5ACZB 4HKXB 2HRPH 4LSVL 3BVNB 3W0WA 3OL2A 5ADPH 4KK5D 4PJ8B 4PJGE 2X2YA 3H9HA 4XNYH 4Z95H 2CKBH 3TEUA 4KI5D 2ERJC 2NY2B 4KI5F 5E70A 3MMEA 2E7LC 1KC5H 1CFTB 3HLAB 1U8OA 1YNKL 4QOKA 4CN1A 1CXEA 2F9BT 1ZHLB 5SX5K 3ULVC 2DTML 5EOCL 1FO0H 5H2BA 5FK9A 4HWBH 4XXCC 3FB5A 5HHVL 3G04B 5K9KA 2HTKD 4LSPL 4AG4L 3PL6C 1VERA 4M1DL 3P4MA 1XCTB 3CMOL 4LRNH 4KV5E 5F9AC 1N8ZA 2E6JA 1IKFL 2WP3T 2ZNXA 1P4LA 3HN3A 3TBTA 3MA7A 3VFTA 4IMLA 1CDJA 1N26A 1C5DB 1DTUA 4EXKA 3V0WH 3K8MA 3IDNA 5J11B 2C9AA 2Y06L 1HH6A 2EYTA 4GUPB 3S88H 3SY0B 4FFZL 5I73B 1A9EA 4NJ9L 4X7SL 1CFSB 4PGBB 1QG3A 1R3LA 2YR3A 4KZEH 3HG1D 2W0FB 4GG8B 2W9LA 1CGYA 1DQML 2BRRH 4HUWA 3BWAB 1JPTH 1EZVY 1FCCA 1KCRH 1FSKB 4ORGA 1ZA3A 1JWSA 4HIIA 5C6WH 3PHQA 1JYXA 4JFFB 3VG9B 1BWMA 2MPAH 2FR4A 4M6MH 4LCUA 1T04B 5TQ0L 1DL7H 1XAUA 3SE3C 3FN0H 3O4OB 1X6LA 1LWRA 1XMWA 3GSWA 1QTYT 2ZUQB 15C8L 1G0YR 1CGSH 2OTUB 3AC0A 5CJBA 5EU5A 3WN5A 1NANI 5TE7L 1ZLUH 3U6RA 5T1MB 3SGEH 4ZFOL 4N0YH 3E6FB 1NC4D 3QG6A 1E4WH 1PKQA 3HUJF 1IBGL 2ITDA 4NJAH 4R97B 5IQ9A 3T4YB 2HJFA 1MHHA 2XZZA 2EIEA 2Z31A 3DUUA 2Q1EA 2RHEA 1UM6H 5IV2A 3IETA 5D2LE 4J6RH 5HGGS 5HHPB 4JO1L 1OAQH 3ETBF 4NOBA 4XPGH 4G6MH 1ZLSL 4YXHL 5IOPB 1TMCB 3LS4H 5E99L 4PJGF 2DQGL 1ZT7B 4BK5A 4URTB 4JQVA 2IG2H 2ZSVA 1KNOA 5SWSA 3WFCH 1RZIA 4NQEB 4K8RC 4G6AC 1MJUL 1DBAL 2E8ZA 5IFAH 1DQTA 4XVSL 3DMMC 4FZEL 3BHBB 2EC8A 3U7YH 4JDTH 3ESUF 3QHTC 1J87A 5MI0C 4KJWD 4WFGE 1SBSH 1TTFA 4KJPD 2EDOA 4BFIA 5TF1H 5HGDA 3V7MA 2VITA 1VACA 4WTXA 5TDNA 2ZSWB 4JHWH 4NO0A 4J7RA 4I0KA 3GSOA 5IEHB 1NJ9B 3C6LC 3QEUB 5E4IA 3N1GC 1T5XB 3NTCL 3LKOB 5FKPB 5KVEL 5E2JA 4LASH 4MWFB 4I8DA 2GJ6A 3BJLA 1OW0A 3RU8L 2GI7A 4U7KA 4IS6A 3QP3A 1RUQL 4LVOB 2X40A 3I6GB 1WICA 3RJQB 1FPTH 2FO1A 4HC1L 4H26B 1IAII 3RNQA 3QXDA 2DQTL 4G6JH 2AK4A 1U3ZA 3VFUA 2EZ0D 1F8TL 5IBUB 4F33B 2HH0H 3AFLA 1U91A 1G9NL 3HRZB 4P2QB 5DT1H 3B3IA 5DQDL 1CZ8L 4QRSA 1D7FA 3NAAL 3IU4L 2AJSH 3MRQB 2F53E 3H9SB 3D69A 3VGFA 3RY5A 4OFDA 3LN9A 3BP5B 2IFFH 1HSAB 1ITCA 5EOTA 4JY4A 1AGDB 5F3BB 4ZUUA 2IBGA 2J6EA 3U0WH 4XCYB 2XY2A 3F7YB 3N1FC 5A2IH 3QI9D 3KPSD 4H88H 1B0WA 5JW5B 1OTTC 1W0YT 5BVJA 2EDRA 5IB2B 1JPGB 1LMKA 3L5WB 2C3XA 2HLAA 3QDMD 4HV8A 4QF1A 5GJSL 4YBHA 3GNMH 4X4XA 1WBYB 4KKAD 4LCWB 4M7LH 4APQD 7FABL 4NKOB 1R5WB 5FECB 2VJXA 5EUOA 2AEPH 3QCUL 3T2NH 4RMSA 3L7FB 2OP4L 1PZUB 4N9OB 5IB5A 2AJVH 3BUYA 5D1ZD 3HC3L 3NFPB 4DKFL 1GGIL 3C09B 5J89A 3LEYL 2GJZB 5A40E 1JGLH 5JLZA 4HJJL 3O6FB 4OM0L 1CXLA 3NZHL 3QIWA 4X7EC 2Z4QA 1ZGLA 1RD6A 1GVIA 1M4KA 2YK1L 2FDBP 2EE9A 2Q7YA 1J11A 4GQPH 3V52L 4TSBH 3F12B 4QOKD 5IEKA 1C7TA 4DZBA 4HSQA 5HYFA 4RA3A 1EA9C 3I2CL 1G7QB 5SWSE 1UVQB 3DSNA 4FXKB 2D7TL 5E5MA 4UT7H 1JGEA 2WK2A 1IM9A 4YHKH 4KKBC 4L9DA 5JORA 4XNXH 2P24B 4IMKA 5IB4B 4YHPA 3SO3B 3ARBC 2G5BA 3MOAH 3OBAA 3FRUA 4Q2ZA 1WAAA 3U7AA 3B6SA 1RSFA 3JWDL 3RBSA 4ZD3L 1CL7I 3OKNA 1CDHA 1HHJA 4OF7A 2Z91A 4TVSa 3BW9A 4NHCH 1T7WA 5B8CA 3J7HA 4K3GA 4Y2DB 2FL5B 2NYYD 3MACH 1F2QA 2E6QA 3DHMA 4L8SC 1OD9A 3U9PL 5C0BE 5GRYA 4R90H 3CVHB 2NY4D 4PGCA 3PDOB 3ARDC 1ZVHA 3MLYL 5CJXC 3SGDI 5TJWK 4PG2A 5T1DL 4LIQL 1GCFA 3DUSB 4AM0B 1FC2D 3MRLA 2I9TB 3BAEL 1QSEE 3U48A 4U1NA 4XRCA 4JFQB 5E2UL 4XVUD 5GGSY 3N9GH 1N5YL 3EZJB 1A3RH 4OLUL 4X6BA 2Y07L 3QEGL 4TRPL 3SJVA 3C9NA 1CCZA 2VXUH 2AS5M 3FO1B 4R2GD 1G7MA 1MFCH 1OM3H 5GS1B 1W0WA 3EOBB 3LKRA 3MJ7A 4OD1H 1U8QB 2B0SH 5HGHB 1LE9A 4HCRH 4NQDA 4JN2A 1PG7X 2WBJA 2PCPB 4HWZB 3GMQB 8CGTA 1K2DB 4QTIH 5FYJU 1KF9B 2GSGB 2R69H 4O51B 5HYQB 3THMH 3DNKA 4IJ3C 4P3DB 2BMKB 3V6FB 1X5HA 2Z31D 5FKAB 3V6OE 2OSLA 3FJTA 1QKZH 3VE0A 3WIFA 3B8SA 4LNRA 5IMMA 3TYFA 4PJAA 3IJYB 2CK0H 1YECH 3IXAB 1BJ8A 1FFOB 3ZKMC 1TVHA 2VUOA 4P4KA 4JZJA 4U7SA 1FFRA 3S34H 3JWOH 2BCKA 4V1DA 4OZ4B 1GHFH 2FEDD 4EVNB 1OAZH 3SDAC 4GH7B 5SWSD 2AXFB 4OZHA 1AGFB 3LY6A 5F3HA 3MV8A 1S9KC 4JVWA 4TTDD 2R0ZH 4WFFE 3TBSB 3B9KA 2XI9A 2APTA 2Y7QB 2QQLL 2APBA 4QWWD 1A3LH 1B90A 5DRZA 4HX1A 1XGRA 5IB1A 1UJ3B 1ZHKB 5I1AB 2QHRL 3L3JA 3DI2B 2F54E 2F74B 3OKMB 1UM4H 3KXFE 1NBQA 4LSQL 2DD8L 4R4ND 1CU4H 4J3VA 3CFKB 4KMQA 5C0AE 1TNNA 1U58B 5JPNA 4M61B 5DK0A 5FO9A 4JDZA 4PJ8C 1BFSA 5ICXB 3TIDA 1IMHC 3RNKA 4HUMB 3V5HB 4GBXB 5MENA 3ME0A 5IM7A 2VLJE 1ZA6A 3NGBC 4PV8A 2NY2C 5HVHC 2ZNWA 3ULVH 5DMJB 5C0BD 1JF6A 1O7SA 2VDQH 3P11H 4LPYA 1BZ9A 4PJIE 3KPQB 5L8KB 2EECA 2GJ6D 1A7QH 3BYTA 4K9EC 4M7LT 3IU3A 1KJ2B 4JFDB 1GIGL 4OUOA 2OQJA 5T3XH 2YEZA 1JF5A 1NGZA 4ZO7A 3MA9H 1A1NA 2EKSB 2IQ9L 1OWWA 4MJIE 1LNUA 4I2XE 5CLTA 3MV9B 3DVNA 4MDJB 4TUKL 4NUJB 4G42A 4PJCA 4AYFA 3I50L 3MCLL 4DVRL 4HQQH 1G7HA 3QXVA 3BRDA 4KGLA 2D0HA 1NC4B 1GGYA 2JB5L 2DWEA 3HUJB 4RGMC 2XZAL 5CAYB 3ARQA 1M05B 4HG4J 4MQXD 4OLYH 5J11C 1G0DA 3PDDA 4L9LA 3G5YA 5IMLA 1RAMA 5DVMA 5IW1A 1JZ6A 5DZLA 1RZGB 3VXTB 3SE4C 4DCQB 5F96H 4U1IB 2RFXA 1FVEB 4J4PC 4PJGB 3F5WA 5EBMA 1Z9MA 4MNHA 4KAQH 1N0XH 3D0LB 5EBLA 2BVYA 1DP0A 4XPFH 4S0TD 4HFUH 4MDIB 5AUMB 3T4AA 2EXYD 3QYCA 4ELKA 3I6KA 3RP1A 4KMTL 4CMMA 5LGHH 2HFGL 5JHLL 1NDMB 4P9HH 1PBYA 3MLVH 4NSKA 4U05A 4ZTOH 1K8IA 3OR7A 3VGEA 4XI5D 3ZTNL 5CIPB 2ZUQC 3QIWD 2OMNA 4D0BB 4PV9A 3D0VA 2C1PB 3VXUE 2BVQB 5JXEC 2L7UA 2ARJB 5FGCE 1MHPH 4GKSB 4ZAKA 5TDPA 4F7MB 1S9WB 1HOCB 4KROB 4R97C 5DJ8B 2FZ3B 3MRFB 4PJEA 1N4XH 5HDBE 4OGXL 3JTTA 3QQ9C 1XF5B 3H7BA 1IM9D 4HF5L 1AFVL 1AGCA 1UWXH 1G9ML 2Q87A 1T22B 1CD8A 3FCTB 2MCPH 3Q3GA 5CZXC 2RJMA 3VWJC 4WEMB 4AL8H 1UACL 2UVFA 5SV3A 4TNWF 4P5MA 1SEQH 5BS0A 2VC2L 1OARH 4AIZB 5IVZB 3ES6B 3MTRA 2EDFA 3QFDB 5DR5L 2VZTA 1C12A 1KFAH 1E6OL 1AIFB 1JZ7A 4Y5VA 4KTDL 4ZFFB 4PJIF 3QPQC 2CDEA 4Z7NE 3VG0H 4ISVA 1ZSDB 1JNLL 3QUXA 2P8PA 1T1ZA 4NGHL 4NKDA 5DO2C 5FCUL 3TPUA 4OFPA 4NIKB 3O81A 5E8DL 5B39G 1H3VA 3BP7A 3KPMA 4MJID 2A9NL 3KLHD 4KRMB 3ZKND 1J1XL 1HHKB 1IGFL 2OJZH 4I18A 3QI9B 1KT2B 4ZQKB 2EDBA 2JJVA 4ESKA 2EXWC 3SJVD 3BN3B 3TIEA 5E6YA 3MLUL 3IF1B 4HJ0C 1CGTA 3QUMH 1FFNB 4APQB 3GGWB 4YGVA 2A83A 1D3CA 2V9RA 5D2LB 4KVCL 1XZ0A 4UV7H 5I19H 4P2RA 4TQEH 1VA9A 3RPIB 5CGYC 2JB6A 2Y23A 1DANU 4KMLB 4NQDD 4GRLD 5F1OB 4WEUD 2WBJD 4FQJL 2HVKA 1JPSH 1WIPA 3ZLQC 2KKQA 4KKCC 1R5IA 4QRPA 1NLBH 4WV1A 1EBPA 4OTXH 3UYOD 4OZGA 3WHXA 4YXLL 4IOSD 4Y89A 3SQOH 3GSUA 1S7RB 5L2JA 1Q0YL 4NC1E 1FHGA 2ORBH 4OV5B 1ADQL 1BBDL 5B39A 4OZIA 1P7QA 2CRYA 5BZDA 3FB7B 1PY9A 4U0RC 3JUZA 2OI9B 3CC5B 5T1LA 3UCRA 1KN4L 4Z7QE 1EHAA 1ZTXL 3VXUD 1KCUL 4RDQG 1KIQB 5D7SH 4I48A 5FFLA 5IFHL 3MNZB 4V1DD 2VDNH 5DUMH 3MZGB 2DQCH 2NY5H 1CD1A 2NY0B 1P2CB 5HHNA 5DMGD 1MCPH 2MTPA 3MV8D 5HDBF 3BH8A 1CBVH 1FV1A 3LHPL 3GSNB 1LILA 3TBTB 3MA7B 4F37F 4YLQT 4IMLB 3MJ9A 5T1KA 4FFVC 2IPTH 4GW1B 5ESVA 4L5FH 1DLFH 2DQJL 4OKVA 3OPZL 2ZCLL 3U1SL 3IDNB 5C6PB 2FJGA 1MY5A 3BGMB 2EYTB 4P49A 3TO2A 4M43H 2DQUL 3O6FC 4M62H 5MEND 2H9GB 4KDVA 1J05A 3KG5A 4YR6B 1S7UB 4Z7NF 3BEVB 5D2NA 1VDGA 3ABZA 5J9PA 3HNTH 1B0GB 1MCCA 1YEFH 2RR3A 3DRQB 4UQ3B 1QVOA 2AABL 2F53B 3HPJA 5ECJE 1RJZB 3L3DA 4L4TA 5GS2D 2O5ZL 4U1KA 2DMCA 3DXAE 1HEZB 4LCUB 2XWTB 4R2GB 4BZ1H 1YMHA 4FQ2L 2H41A 4LKXA 5DD0H 4OCRL 5J6GA 5FA4A 5EU5B 2AGJH 3KNBB 5LJYH 2H26B 1QPXA 3DBXA 5AWNH 5EO1B 2R8SH 1L7TH 3MLZL 5LGJB 5ALCL 3C6SA 1KB5B 3BGFB 1S7TB 1CVRA 3RWFA 3SKJL 1U8HA 3VI4E 3QG6B 1QEWA 1QBAA 3EFDH 1IJ9A 5C9KA 3GM0A 5MEQB 4OD2A 1MOEA 2YRLA 1I3GH 4OCYL 3PXJA 5ICYB 3X14B 5CBEB 2Z31B 3JV0A 2UZYB 32C2A 4EQ2A 2CO6B 3L6FA 5HHXL 1EGJA 1QZ1A 4HKJA 3WBDA 3RZCB 1MRCL 5GGQH 4UMGA 3AREC 4YHYB 3RVWC 4RBPK 1AE6H 4UU9B 5EZOL 3FO2B 4OZGE 1T4KA 3GMNB 3X3FH 1IC4L 2IC2A 5SWSB 2X6MA 4PD4K 2X4OA 2KBGA 1A5FH 1WBXA 2KZ1B 3HHRB 4L4JA 4Z7QF 5IHUH 2V6HA 3OQ3B 2E5EA 1WC7A 1WIOA 4EZMA 2G9HA 4K3DL 3QXTA 2OR9L 5GS1C 3UBXI 1HDMB 3LS5L 4OLWH 4C59B 4X4ME 5TFSL 3F7PC 3S35H 4Z0BH 4WHYH 1NUDA 1G6RL 4PTTA 3O6MH 4W6YB 2AQ3A 3CSPA 4TVPH 3DVGA 1JN6A 4ZAKD 4M02A 5J12B 5BV7L 5E1AA 1FZOA 5BMFL 4ONHA 3BZEB 4X6FB 2YUVA 2NY6B 3MNWA 5C0BB 2V17H 3SE9L 4JKPH 4BQ8A 2EYRA 4QY8A 1IGIL 3TBWA 5SWZA 4LLVB 1MRFL 1NPUA 3RWIA 2QKIA 3OAZH 1TNMA 3HI1B 5BS0D 2VISB 1U3HA 3MCG1 5IKCB 1QSEB 4NRZA 1YEGH 2AXGA 2XQYK 5I30H 3GO1L 3I02B 4FTVA 2B4CL 4XX1E 1DE4A 5IB3A 1FVCA 3BQUB 4UINL 3QXDB 2D31A 3DARA 1JPST 5I1KL 2LU4A 3QUXD 5D7IE 2G75B 2NY7L 5E9DA 5EIIA 3UP1A 1F42A 2BSTA 4QTHA 3Q0HA 4QRSB 4H8WL 4KI1A 4PLNC 3VFMB 1UJ3C 2P47B 3D69B 3QRFM 4JM2A 1ES0B 1DSFL 1MF2L 3IDGA 3OG4B 2XACC 4L8BA 1LQSR 5D1QA 3N85L 4WNQA 1OSPH 3JV6B 5JUEL 4GBXC 4PRNA 5C7XL 3HMXA 1JK8A 4P0DA 4KTEH 5C0NC 1S9VB 5DMKB 1BPVA 4LCYB 1NL0L 2PYEA 3OF6D 4CL7A 3HC0B 4X4XB 5L88L 3KYMA 4E0RB 4XPBL 4ZOCA 1QRNE 1JJUA 1GZPA 4TYUA 1HINL 5I1DB 2YRPA 3QUYC 5KN5B 1I1AA 4R96A 4YQXL 4AQ1B 1S7VA 3C60C 2DQEL 4FP8H 3RWCB 1IZKA 3FZUD 1IFHH 3M45A 2Z93B 1JGDA 1X5AA 3CX5K 4BZYA 1D5BA 4H1LG 1UG9A 2F8OA 5F7MC 4Y4FC 2R2HA 2P8LA 1J1OH 1AHWA 4PY7B 3HTLX 4X99A 5IEKB 2V2WA 5I16A 3KYNA 5CILL 4PP1D 4KHTL 1HCVA 1MEXL 1Q72L 3AS3A 4M00A 5F93C 5GS0C 1I4FA 4ELMA 1LDPH 2X1QA 4JCMA 1MCSA 4BFGA 4OAWB 2ZUTA 3KXFB 1ZVYA 5C0AB 3E1F1 2YWYA 2JK5B 4X4YA 2HWZL 4HMDA 3R1GL 4MNQE 4ZUVA 2VLJB 4J1UA 3CSYA 4F9LC 1KN2H 4FXGB 4JFHE 4P46D 1RIUH 2MQCA 5BRZE 2DQHL 1JPFB 4YE4L 1WFOA 5T1KD 3LQAC 3HI5L 1DFBH 4PJIB 5TPWH 3TNNA 3TO4B 1CDCA 2BJMH 4DW2H 4DAGL 4F58H 5SWZE 3NA9L 1MFDH 2EIDA 3KPRA 4XMPL 4H1LA 4I2XB 4MJIB 4TSCL 1YY8A 3ULSA 2CDFA 1D5XA 4UTAL 1E28A 4GSDH 1TLKA 2YD7A 5D7IF 2BFVH 4XRCB 3T3ME 4QRTA 5J8OA 4JR9L 4CVZB 4OGAC 2HT4D 4KROC 3S36L 2F5BH 3NCEB 5E00A 5GHWL 4HS8L 3PP3K 1MCOH 3QWRD 3P0YL 1QA9A 1SJVA 3BE1L 4NZJA 4NN7B 3T2QA 4GAGL 2HFEB 4HBQA 1IGML 2VWEC 2BSSA 3V6ZA 3MJ7B 5I6XC 4G7YL 4GRLB 5CP7B 3OWEA 2WBJB 2EICA 3LIZL 3O41B 1QRND 5I1EH 5GGRB 4X5LA 3OKOA 2QQNL 1IC5H 1FC1A 3M1BB 4QXWA 4NKIL 4FOMA 1F58L 5ILTH 5I66A 5EN2A 4G7VL 4PJ7E 2JCCA 4S1DC 1J5OL 5DJ0A 5A2LH 4NQSA 5C2UB 2OSLB 2NLJB 3EO9H 1YN6B 4Q6IB 2UUDK 4NNPH 3WIFB 4YK4B 4G3YH 5I18H 1FNAA 5FYKH 3QIUD 2SEBA 3DROB 4NWUH 2M26A 3L3KA 2CLVB 5IJKC 3VXUB 1DQJB 1CTOA 1FFPA 5FGCB 5J7CC 1KELL 1Z9OA 1FNHA 4XP5H 2VDLH 4LVNB 2YKLH 3M07A 1UA6L 4N1EA 4PLKD 3UPRA 1NAML 5F3HB 2A74A 5GRUL 2HLFD 4APQC 5JPMA 2DBLH 2H32B 4A6YL 3M17A 1Q9OA 1MVUB 1Q9WA 1IQWL 4GG6A 4QO1A 2X4QB 4ELME 5DFWH 5F7EL 3TP4A 3N1PC 4UAOB 5GGUA 5D9SA 5BRZD 1E4KA 5EIQA 5F70A 4JDZB 3STLB 1U36A 2Y5TB 4A2LA 3IFLL 5FF6B 2OL3H 3RTQD 1X44A 4NBXB 1MSPA 4MJ5A 5SWZD 5JW3L 2IPUG 4XC3H 4GKZA 3T77B 4K7FB 4NQVA 3V95A 5IHBA 4UZGA 2HRPL 3IKCA 4G43A 5ADPL 1DVFD 3IU3B 3CXDH 4KK9C 1U3HD 4NM4H 4HD9A 3MJ8B 4HWNA 2YRZA 5KS9E 1N64L 2X41A 4HK0A 2CKBL 3T3MF 3HB3D 4LPCA 3G6DL 5H37H 5C0CA 3NCBB 2NY0C 1KC5L 3CPLB 4B5EA 5HYIA 5E9DD 2JELL 2AKRB 4G6KH 1G7HB 5IW3A 5CGMA 4GW4A 2K9UA 4HWBL 2WINA 4I0PA 5LAXA 4LLYA 2VQ1B 2YS4A 5GSRA 1UH3A 5I0ZA 1AI1H 1QR1B 2CJUH 4LMQE 9CGTA 4HWEH 2CLRA 1YC7A 2D7MA 2YSSB 1J86A 5D1QD 3HPLA 1OD7A 4L9LB 3FQRA 2QSTA 1AKJA 2ATKA 2W0PA 4P59H 4LRNL 3F5WB 4NRXA 3RWEA 2PYED 4ONOA 2GY7B 3SKNB 3FB8A 2UYLB 3BZ4B 4YWGH 3NFSL 4K7PX 1JMXA 4LARL 4PJXA 3CUPA 1FDLH 4PJ7F 3ARGA 4XVUC 3BP4B 3SKOB 4C4KT 4BQ6A 5ACLA 3GI9L 4XPHL 3VWKB 4NZDA 1WWAX 1I1AD 2C7UA 4FQHA 5JNYB 2R2BB 4MHHI 1N59A 3S88L 3DX8A 4KRPB 3VGHA 5CWSB 5CD5C 1DUYA 5ETUB 5KSAA 2XA8H 1K8IB 4NYLB 4KZEL 2DQFB 2VXQH 4HLJA 2L4OA 4YGAB 2BRRL 1BZ7B 1CLYH 2E7MA 4ODWB 1RFDH 3IDYB 1KLUB 3CFCH 4UILH 5HPMB 1KCRL 3FT4B 3BIAX 1RZKH 3MRCA 3MC0A 3D0VB 2VNCA 3WLWD 4A6YA 1RZFH 4XNZB 3WUWG 3BGFC 4XZUA 4ZAKB 1FVDA 3CVHH 3MUGB 5CKAA 2MPAL 1EK3A 2W07A 1LEIA 4M6ML 1S5HA 1SY6A 3P0VL 4HUKB 3SDYH 1DL7L 3FN0L 2PTTA 1NDGB 2FECI 3IS0X 3HA0A 3H7BB 1VFAB 5EO9A 1RUKL 1CGSL 5I74C 5F9WB 2ZUVA 3QULB 3FOMA 1NCUA 1CFVH 4OF3A 4PIRF 4GG6E 2H2PD 2VXVL 4W6WB 3RZCC 3EUUA 5IFJA 2CH8A 2H45A 1T7XA 3VFVB 4YHYC 1IQDA 5JR1L 4F57H 4G8IA 1E4WL 2UZIH 1FFQA 1L6ZA 5C71A 2MMXA 4NN6C 5EZIH 3P77B 3ET9F 3RHWK 3TFKD 5HYJA 4GQ9H 2W59A 4ERSH 4JPVH 1UM6L 4WI6A 1ZHBA 1S5IL 4J6RL 4HKZB 1BBJA 1OAQL 1Z5LA 2P8PB 2R0WH 4XPGL 2J2ZA 1GGCH 4TTDC 4HUUB 3DXAB 4NKDB 2GFBB 1MREH 5KS9F 4MZ3A 5DQ9A 2R29L 3FQUB 4GKNA 5EU6E 4BSWA 1SHMA 3ORJA 4DGVH 1OT1A 3L1OL 1FNEB 1EEYA 2CSPA 2H6PA 1ETZA 2IG2L 4JE4B 3WUWA 1FO0A 1QBLH 1K8DA 3WFCL 4HWBA 2K3TA 5J12C 1YYLH 4BA8A 1RUAH 5IFAL 4XNUH 4X7TB 3LCYA 2NY6C 5DS8B 1CICB 5DSCA 4HDIA 4JDTL 3U7YL 5DFTA 1J0KA 2A6KB 3MNVA 1NC2D 1LO4H 4YFEA 1LP9E 2WQRA 2GTWB 4KC3B 4FFWC 5C0EA 4X5WB 5TF1L 3CDGA 1T21A 4D9LH 4RAVB 1L6XA 5ICZB 4Y0GA 2HVKB 3QJHA 5HGAB 4PJBE 3LZFH 1I9IH 4NFBA 3OTTA 5C0DA 3BQUC 3VMOA 4OZGB 2KL6A 2BVPA 4WI3A 5IG7A 3E3QE 5L2JB 3CZFA 4OT1H 3UDWA 5IUSA 2NY3D 2FX8H 4OCXH 4CVXA 5TGBA 3U46B 5CHNA 1EXUB 1PGRB 3K80A 5ESQA 3DRTA 2A0LD 3VFNA 4Q97A 5D1XA 3F58H 3RVXD 1B9ZA 1FPTL 2DLFL 5FOJA 3ARFC 4XVJH 4PRBA 2D7PA 5DJAA 3ROOA 2P8MA 5DJZB 1IEBB 1P7KA 2HH0L 5I1IH 1L7IH 4UDUB 5DT1L 1U8PA 3AXLA 2GSIB 4Y5XC 4QRQA 3SKUD 3MFFB 5IIEA 4DK6A 3H3PH 1I8LC 1KJ2H 1P1ZB 4B7LA 2W91A 4XCNA 2OJEB 5F6IB 4P46B 2BZDA 2KDGA 4IDJL 2C3VA 3V6OC 4PG9B 3ZL4H 3UTTA 3MRDA 3U0WL 5T1KB 2ICEA 5ADOL 1CF8L 4H88L 1GOGA 1IAOB 4Z7OE 4XCFH 3T08A 4JB9L 3FQXB 4HJGA 1GC1H 4P2OA 5F7LB 1FLRL 3UYRH 2FJGB 4U6XA 3GNML 4ZODA 4M7LL 4ETYA 4NDMA 4QKXB 1ROWA 5EC2A 2AEPL 3TM6A 3CSGA 1A6UH 2BY3A 3HCVA 1D6VH 4ORZC 3T2NL 5D7IB 5AG9A 1F90L 1E4XI 3VRJA 1JTTA 2AJVL 1BFVH 4MD0B 5KANG 4KVNH 1W72A 1S78D 4U1KB 4POYA 1JGLL 1T20A 4I4WA 1H5BB 3ALPA 3GMMB 1LE5B 4M9PA 2E9WA 4LKXB 4MAYC 1I1YA 2HVJB 3A6BH 3QEQE 1WCBA 2GAZA 2XIDA 2DJSA 5J6GB 5FA4B 4TSBL 4S2SB 2HMIC 1ITBB 5I75B 1IGJA 3C6SB 3GKWH 4OF0A 3RWFB 2Q3ZA 4LLMA 3WJJA 3BXNA 1AQDA 1QRNB 1ZE3C 3EHBC 5HI5D 1MJJB 4HK3J 3TO4C 5A16B 5CEYA 1LP9F 4P9MH 1GAFH 4TULL 3MOAL 3BZDA 4KTYA 3BRGC 4K94C 1AKJD 5DK3A 4ETQA 3QO0B 32C2B 1IARB 4IRZH 3U83A 4PJBF 4UIMA 1M7DB 1F4YH 3QIUB 4HKJB 3ZKNC 4NHCL 5KVMC 4HMCA 4K71B 5C0FA 2F15A 2QHLA 4NO5B 4ZTPH 2A6IA 3VFGH 3MACL 5J1AB 1U2CA 5IT2H 3ARGD 1F02I 3MGOA 3WFHA 3MQIA 4R90L 3WFDH 1MLBB 1SYVB 1MH5A 4RA0C 3RAJH 4MZ2A 3UTZB 1WBXB 4KKLD 1UEMA 3KWWA 1L0YA 4MVBC 1KCVH 3FOLA 5KSAD 2C4XA 4JGJA 3SDXE 2MQ3A 4NN7C 4XCEA 3S37H 5FAAA 5CEZL 4ZPTA 3VFRA 3BSZL 1TIUA 2HT2D 4R0LC 4XGZB 4MNQB 1LEKB 1A3RL 3WJLC 1T5WA 3DVGB 5CD3A 1RU9H 2AXHA 2VXTH 5BRZB 3A6OA 2EDYA 2VXUL 5MEOB 1MFCL 1OM3L 1CGUA 4U7MA 3RTQB 1ACYH 4Z7OF 1JWUB 1U3JA 4OD1L 4JN1H 4Q6IC 5SWZB 3TBWB 2EO9A 4I9WE 2BNRA 4YK4C 3UTTE 4M6OH 4QHNB 3RWIB 4Y4KD 3N1QC 2YPLE 1NBZA 4OFYA 2X4TB 1S7XB 2NQCA 3O4LE 3QJFA 2R69L 1DVFB 4RISH 5EFIB 2VLLA 1DN2A 2BSRA 3PHSA 5ANME 1DQDH 3VFOA 4Y16A 4I5BA 1DE4B 3MGTB 1FVCB 4LVNC 2Y6SD 5DMGC 4Y7MA 4YDLC 4OQTA 3MLXH 2PETA 2XKNB 1A9BA 1I7ZB 1T0MA 2CK0L 1YECL 3B83A 3T65A 3WO4B 4U1HB 3SGJA 2X4RA 3HNVL 3MUZ1 3HZKA 3S34L 2V5TA 1OGAA 3JWOL 3V79C 1LO5A 2OM5A 1MJ7H 4Y4HA 1GHFL 2VUYA 5DDHA 1OAZL 2AEQL 1A22B 4UAOC 3AU1B 4C54A 5GIRB 2ZG2A 2VXSL 1F97A 2DWDB 2ZG1A 4WNQB 2HTLD 5KVGH 3OAUH 4AIXA 4P3CH 3W5MA 1HHIA 2R0ZL 3EGSA 4N0FA 4DQOH 1F4AA 1A3LL 3BESR 3EYOB 4YC2B 4L3EA 1CD9B 2XXMB 5FHBH 4PJ7B 2DF3A 2OYPA 4BELD 4L3AA 3TN0C 4F80A 3ZO0A 1ZVSA 3OGOE 4HMEA 1UM4L 3MODH 1U8KA 2QR0B 3SCMA 2R1YA 2CUHA 3TZVA 1IT9L 2VZVA 3VJ6B 1TCMA 3OB0K 2IPKB 1I1CA 4PRIE 1CFNB 1S9XB 4P23D 3GSNH 4HUXA 1XGUB 2UUDH 3GKZA 4YBQC 2VDQL 5B3JE 4Z7WE 1D6EA 3TA3A 1AXIB 2R2HB 5TH2A 4PRAA 3V4UL 4YFDB 4JFOA 2W1NA 4F8QA 2VAAB 3SDXF 5T3XL 4WUUA 4EN3A 2X4PB 5D1XD 3D85A 2AJYH 3IVKB 4S1QH 1H3WM 4Y5YB 1I4FB 4ELMB 3T1WA 4K2UH 3DIFA 5LWYH 3TJEH 4EKXA 3ZHDA 5F21B 5FUOH 4X4YB 1UZ8A 3ARUA 5GXBB 2FJHB 3ALWA 1F3JB 5E6ZA 2WBWB 3ZYJA 3U0TB 1PG7H 1BVLB 2LVEA 4NC1C 1G0XA 4HCRA 4PGEB 1PW3A 3OKEA 4XNQA 2DN7A 3VXOB 3R8QA 4MD4A 1NCNA 4Y2OA 4PR5A 3UTTD 3VWKC 4YDJA 4OLYL 2DKMA 4OLEA 1G7IB 1GOFA 4KRPC 3HAEB 3O45A 3LPFA 5F96L 4K23H 4FA8A 1RUPH 1Z2KA 3ALXA 3V5DA 5MHSD 2WWMC 5KSUA 5KS9B 1ORSB 2XTJD 4KAQL 5SV4A 2JIXB 1JGVH 3RX8A 4HFUL 3OJMB 1D5XB 4E5XB 1RPQA 1AQKH 1F45A 4PB9H 1TJGH 5EC1B 1EFXA 5LGHL 1QFWH 1QFWM 3LEVH 3QQ4B 1WZKA 1Q94B 3B2UD 3O9WA 1RZJC 1JHTB 1MWAL 4OGZA 4P9HL 3MLVL 1A1MA 4WHDA 1KBGL 2DAVA 4ZTOL 3O2DH 3U36B 5E00B 4XP4H 5F9WC 4G9DA 5I2IB 1MHCB 4LLDA 1DJSA 2DIJA 1JI1A 1NC2B 1MHPL 3HZMA 1B88A 1XIWC 5E8EB 1LK3H 4ODUA 3JV5A 4AENA 4XCCH 1BLNB 3ZYZA 1K4CB 1CVSC 1N4XL 1UGNA 1HCFX 4IIQB 3GRWL 5JW4M 3QO1B 1FBIH 4LIQE 5BQ7A 4U31A 5EN2B 2X05A 3GBNL 1LGVA 4AL8L 1BGXH 2NY3B 4W70A 1T66D 4PRID 4KK8D 2NY1D 3RWGA 1NCCH 4F7TB 3ILPB 3EO1A 4Q9CA 4ZS7H 1QP1A 5B3JF 1AJ7L 1KFAL 1N5AA 4JPWH 4LPTA 2VZOA 4Z7WF 3JTSB 4RMQA 1WK0A 3PL6A 3SPVA 1PYWB 1U42A 1J1PL 4RIRB 3O11A 4KJYA 3R0NA 3U9UA 4MCYB 1UCBH 5JTWA 4XWGH 5F9OH 5EORL 1DBBH 2BRQA 3QBTB 5I1LA 3QNZA 1CICC 2Q6WA 3UTSE 3PQYE 1TZHA 3EYUL 3VFSB 4PTUA 1EDQA 1F6AA 3EFFB 1F4WL 1HWHB 2OJZL 4I1NB 1Q9WB 2BDNH 2Y36H 4GG6B 3RY6C 4F15B 1S7QA 4JO2H 5CSBA 43CAA 3WFBH 5GGUB 1MHEA 1G7PB 1KJMA 3PWVA 4DFIA 1HHGA 2VLRA 3EYQC 3W39A 3LQZB 1B0RB 4WWKB 43C9A 4E41E 5I19L 4P5TB 4TQEL 4MJ5B 4Z18A 3ZE2E 2J6EH 2BNRD 1CWVA 4U1MB 3P9LB 3PGFH 4F2MA 2VN4A 1JPSL 1ORQA 5EU6B 1K4DB 3SE3A 5D8JL 4C58B 1QSFA 1BMGA 1L0QA 1NLBL 2Z35B 4X5XB 1WISA 1FG2B 1NFDA 3SQOL 4N8CH 3O2WH 4Z0XA 4HK0B 4LAQH 2WWKO 4Y16D 3VGBA 3GUTA 1MFEL 2A38A 3RUGA 2BVTA 4LOUD 5C09E 5ID1B 2FBOJ 1IAKA 3KDMA 4P5KA 5L0QB 1IL1B 2F58L 5KG9A 3QDGA 1OAKH 1XGTA 1ZHNB 1CLZL 1YUHA 4OUUB 4LVHB 1SJXA 4AEHL 1X4ZA 2Z8RA 3E2HB 1PKOA 1RZ8A 4WI2A 1QFPA 5DUML 2VDNL 5D7LE 2DQCL 1LP9B 4FMKA 3L3HA 2NY5L 4IOIB 4OCLC 3Q6FA 5K9JH 2RAMA 5FA3B 3HC4H 3KLAA 1QO3B 5L9DL 5FB8B 1T83C 1D5ZA 1KB9K 2R1WA 1MCPL 2YN3A 1XR8A 1AKJB 2ATKB 4PJBB 5EPMA 1RK0B 4PD4J 1CBVL 2GTZA 4AJ0A 4PRHA 2O61B 2E9JA 2C1OA 2AXJA 3W11D 5K9OB 4HFWA 2IPTL 2XNAA 1DN0B 3ARGB 4L5FL 5FYJD 3EJYD 1JF1A 4PREB 2YD2A 4Q58C 5EH1A 3S97C 3JV4A 2P5EA 2D03H 2V2TA 4LCCC 5CJ5A 3SCMD 3DMMA 1GL4B 3TZVD 2VDKL 5TDOA 1AD0B 1H5BC 3DX9B 3OJDA 2X4UA 5DJCB 1N6QH 5KSAB 5DTFB 1Z0NA 4H0IA 3FONA 5E03A 3GHBH 2X7LA 2AP2A 2AJZB 2UV3A 2FO4B 3HNTL 5IR1B 1YEFL 4LSUH 5I75C 5BW7C 3O3UN 4XZUB 1Q1JH 3WD5H 4QHMB 2X70A 2PUQT 2R9HD 1TETL 3LKNA 4WUUD 1LEIB 3C6LA 1NBYB 3MX0A 4QRUA 2V2XA 1I3UA 2PTVA 5DD0L 1CK0H 3QUMA 2AGJL 3MPCA 1MCIA 1QSVA 5AWNL 1RZ7L 4Y4KB 3QIUC 1EAPB 2HJLB 3LRSB 1QLRA 5I8EA 3PXHA 4K71C 1NMBL 1NEZG 4OB5L 4LLQA 5E1HB 2R56H 4GRWH 1NUFA 2Z0BA 2UY7A 4L4VA 4JVPA 1I3GL 1S7WB 2XQBH 1R5VB 4JZNB 3ZHKA 1OSZA 2VLRE 4R8WH 2IBBA 3TT3H 3QH3B 4NM8H 4U3XA 1QQDB 3RQ3A 1ND0B 3MR9A 1FRGH 4HKBA 1BBJB 1Z5LB 4HIXH 1OGTB 4PGDB 5CZVH 4Y1AA 2BC4B 5DUBA 3AGVA 1XGYL 3BFOA 5SWQB 4G8FA 5GGQL 4HS3A 2HJKA 4LU5H 3TCLB 2XICA 4Z7UA 4AT6A 3QEQB 5JIKA 4OZFB 1OTUC 3DLQR 4I3GA 5L8LB 3X3FL 1NFDE 1EFXD 1AP2B 3O9WD 1AC0A 4L3CB 4WHTA 3PG2A 3QQ3B 1HHHB 3PWLA 1GXEA 1KPVA 3T0EE 3V4VH 3NACH 3QDGE 5E94A 4F9PA 2ZZUT 4OLWL 5JHDA 5E08H 3KAAA 3S35L 4HDIB 1KTDA 4Z0BL 4NNXA 5HYSG 3OXSA 3CX5J 3DV6B 3O6ML 1EJOH 4X98B 4YPGB 3I3EA 2KZWA 5C0GB 1NEZA 4U1JA 4BKLA 1PVHA 1U8IA 1NLDL 1U8LB 1LK2A 1Q0XL 1SYSB 5F44A 1KJ3L 1YPZA 3QJHB 2ICWA 4JLRB 4X7DC 3NABH 5DC0A 4X7CC 2H32H 4P23B 1J12A 1VGKA 2V17L 3QIBB 4JKPL 1LEGA 2YA1A 1R0AH 2GHWB 5IMKA 3KPNA 3L5JA 1UB5B 4JKKA 2QLVB 1AGEA 3B9DA 3WO4C 1DUZB 5TGBB 4WUKH 3SDXB 5I8CB 2FD6H 4U2ZA 5INCB 3DRTB 1YEGL 4ZFOB 4CU7A 5I30L 3LSOB 4Z7VE 4YDVA 5F88B 3PL6D 2P42B 4OI7A 3ARBA 4TUOB 4PRBB 4ZUWB 4JKMA 1W0VA 2HA1A 5HSFA 4XH2A 1MCWM 5E8OA 4QRQB 5GJTH 5BJTA 3RDTB 5GS2H 2YBRB 5HYSA 4L8SA 4LHUG 2C3VB 1KGCE 3UTTB 3WO3B 3OZ9H 2ADGB 4QCIB 3LQMA 1D5MA 4YIQB 2GK2A 2YPLB 1OSPL 5C08E 1K5NB 3ARDA 3FFDA 1GOHA 4YAQA 2RIKA 3BKJL 5L2KE 4KTEL 4NQCA 1S8DB 3PHOA 3VFPB 4LBEB 5ANMB 1U9KA 1EH9A 2VLRD 4G8GE 1XEDA 4ZOBA 1WZLA 4YH6A 5D7KD 3MROB 3WE6B 2FLRT 3F7VA 3SEPA 3GMRB 1C5BH 1TXKA 2CIIA 1D9KC 3ZSTA 3O6LL 4LSSH 2QSCH 4UTBH 3G08B 1IFHL 2XYCA 3FQWB 4Y5YC 4PBWD 5EULV 1W72B 2VE6A 3QAZC 1M7IB 1NFDF 2A73A 1IEAB 3L3GA 3MRBA 5DD1H 3TYGH 2IBZY 2NNAB 2A6JB 1SEBB 4LPWA 5F9JB 1J1OL 1Q9KB 1RJLA 4XBGA 2DYPA 3QDGD 3X3GH 5DLML 4L1DA 2XTLA 2O5YL 1O7VA 4LHUA 4EDXB 4ZXBB 3FTGA 3CFEA 2MNUA 1LDPL 3VXSE 4BYHA 1RHHB 2NW2A 2B5IB 5JHDE 3BI9X 1KIRB 1WBZB 5EO0A 1KTLB 3NOIA 4JREC 1JZ3A 1I7TA 3PJSB 1KN2L 4PRIB 1PZ5A 2FX9H 4X9IA 3IFOA 4S1RH 3EDKA 1RIUL 3AS1A 1DDHB 4Z7WB 4PRHD 1GSMA 1DFBL 4M3KB 5TPWL 2BJML 4JHAH 3QUZD 4K8RD 5JOEA 4G6AD 3OB0H 4WJ5A 2R0LH 5C6TH 2ITCB 1NGWB 4DW2L 4HGWA 4Z77A 2X1PA 5IBTL 3Q5YA 2Z92A 2HFFB 3MO1A 1I1FA 4I3SL 3QZWB 1FE8H 3DMMD 1KPRA 4M1GH 4Z7VF 3RL2A 3KS0J 1H3PH 4XC1H 1MAJA 1NCWL 1XF3A 5EZJB 3FOLB 3GSXA 5ALBH 4QT5A 4GSDL 5E24E 2EH7L 3BVNA 5DD6B 1XR9B 5JDJA 3AVEA 1PY4A 3CU1A 3EO0B 2XA3A 4PJ8A 2IGFH 1WFNA 2I25N 3T1FB 3C2SA 3VD3A 4YHZH 2F5BL 5DMIH 4IIQC 2VR4A 2EDDA 4YHNB 1MCOL 1CFTA 3HLAA 3IFPB 4OF8A 3GIZH 4O02L 1ZHLA 1AGBA 3ZKSD 4DN3H 1KXQE 4G6FD 4XB7A 4RFOH 2XKSA 3KPOB 4CRPA 1HZHL 1OHQA 2I24N 5D4QA 3G04A 3BJ91 4KY1H 3K1KC 4ZYKB 2D3VA 3UTQB 1MVFA 2PYFB 5EU3B 5GQBA 3L7EB 3UO1H 1XCTA 5ILTL 1J10A 1R3JB 1AY1H 3ILQC 2WQ8A 2Y9RT 3MBEC 4DUXA 3EO9L 4NNPL 1IGYB 2FBJL 4G3YL 1C5DA 4Y1AD 5FYKL 2NR6C 1A9BB 1ZEAH 3C08L 3QXAA 1I85C 3A0OA 3CH1B 5T5NG 1JFQH 3RBGA 1AO7E 3Q6GH 4X6CA 4ZFGH 3T3PE 3L5XH 3LV3A 1OF2B 4GUPA 4F15C 3SY0A 2BOBB 3SE4A 2G2RA 3BPCB 5D6CB 1CFSA 3NMEA 4J4PA 4JDVB 4PGBA 2AQ2A 4GG8A 2W0FA 2ZOLB 4UV4H 3A67H 1HHIB 3BWAA 5C3LD 3IRPX 4WWKC 3EGSB 2DBLL 4X9FA 4H20L 2MJWA 5JHDD 2VQTA 1YEDB 2CRMA 3LKSA 4JFFA 35C8H 1IGTA 4P5TC 5T5FL 5CINL 1T89A 5DRXA 4QYOB 1T04A 3O3AA 1MAMH 4M5YH 1U8KB 3ARYA 2ZUUA 4YBLB 3KYAA 5HD8D 3TZVB 1MY7A 2OTUA 5FM4A 2OL3L 2OK0H 5JXEA 4D9RE 5T1MA 2DLHA 1BEYH 2B2XL 3E6FA 3MJ9H 4XC3L 2M8XA 3D2UD 3PQYB 1KJVB 3UTSB 1ZXQA 1MFBH 4NM4L 4YUEH 3E2HC 4KKBD 5CP3A 4Q9RH 5HHPA 3ARBD 3PE9A 5IOPA 3AAZA 3ZT5A 1WJ3A 2AAVA 4B0MM 4FQ1L 5IVOA 1ZT7A 1INEH 5D71H 1UZ8B 4NUGL 3WL9B 5CFHA 4S10A 3E3QC 3Q2CA 4E41B 3CVIH 4DGYH 3IXTB 4NQEA 1A14H 4MA3B 3FO0H 1QHPA 4MD4B 5IBUG 5F7YC 2CJUL 5HYEA 4HWEL 3C8DA 2V5SA 1BJ1J 2FH6A 1MELA 3ARDD 3V5KB 3BHBA 3LKQB 1IRAY 3R4DA 4M4PA 3MLTB 3WN5C 2KUTA 1R24B 5GRJH 1C7SA 4XAWL 4YWGL 5C09B 1FDLL 1CT8B 5HI4C 3MSPA 2ZSWA 5JDSB 4X4ZA 2P43B 1DQLH 5IEHA 1NJ9A 3QEUA 5T33L 4N5EC 1T5XA 3LKOA 5H37G 3FQNB 2W0KA 5FKPA 2NZIA 3WS3A 3T3PF 4MWFA 5JZ7C 2VXQL 1X4XA 2OTWB 3PABB 3QFJE 5D7LB 4YX2L 1CLYL 1O5DT 4UILL 1RFDL 3CFCL 2Q3AA 1RZKL 4F7EB 4X6CE 1TJHH 1GJIA 4LCIL 2FIKA 3I6GA 4ZMAT 2DYPD 4H26A 1SJHB 3G5ZA 2FGWH 1CE6B 4LHUD 2X1OA 2BY0A 1XFPA 4TVPD 2VDRL 1CLOH 4P2QA 3PUCA 1YA5A 3ZYOA 5KJRH 3MRQA 3CLEH 1J8KA 1CFVL 3H9SA 3BP5A 1HSAA 3FMGH 3ZKMD 1AGDA 4O9HH 5F3BA 4F57L 1X5LA 4NKQB 4O4YH 4XCYA 1HQRB 3F7YA 3ULUL 2UZIL 5JW5A 5EZIL 2CDGB 2XFXB 2DMKA 2I27N 5IB2A 4GQ9L 1JPGA 3SDAD 4ERSL 3C2AH 2CO7B 3QRGH 2I26N 5T3ZE 1FP5A 1WBYA 1HKLH 1LVEA 1DBML 3EYSH 3VW3L 4NKOA 2NZ9C 2W9EH 3TV3H 2DI9A 1P4IH 5I1LB 5TF0A 5J56B 1KTRL 4DGVL 5B3NA 1JRHH 1L9MA 4HH9B 3HE6C 3NFPA 1DR9A 3C5ZB 4U1LB 2EC9U 1A7PH 1CIUA 5D6DC 2GJZA 2PW1B 2P48B 4Z78B 4PJ8D 3RIAF 4IRSB 1YYLL 3DVFA 3O6FA 4I3RH 1PX3A 1RUAL 4XNUL 1FNSH 2NY2D 4P23C 3QIBC 3PWVB 1KYOK 2VLRB 3F12A 1I3VA 2R0KL 4H5SB 3T0XA 4K7PH 5E4EB 4J2XA 1VGEH 3F7QA 4D94A 3WS6C 4UUJB 5DEGB 3MBXL 2DJUA 2P24A 5IB4A 3HMXH 1CE1L 2YZ1A 1NFDB 4OT1L 3QUKA 3RJDA 5GGSB 2AERT 4OCXL 3MRNA 3RDTC 3T0EB 4Y2DA 3QDGB 2FL5A 3B5GA 1QR4A 4WTWA 3F58L 3LDBB 3V0VB 3RWJA 3CVHA 2FSEA 4XVJL 1Y18B 2V7HB 2P7TB 5DJDB 4ZS6C 1U92B 3PDOA 4MQ7B 5SX4H 4NWTL 1ULVA 5I1IL 1HYSC 3E8UH 3D18B 3LEXB 3KLAB 3BT2L 4J4PD 3DUSA 4FHBD 2E9IA 4AM0A 1TQBB 4KHXH 4LSRL 3GMPB 1IKNC 3VMNA 1KJ2L 4JFQA 4S1SH 1BECA 4UB0H 5C0IB 2DRUA 4OLVH 2AEIT 4EIZC 2VLKE 3QUZB 4XCFL 4AH2B 1JF1B 2NXZC 3FO1A 1YY9C 3W9DB 1GC1L 1GPOH 2OXHA 5E8PB 3UYRL 5GS1A 1NCAH 3WNLA 5EBWB 3DMMB 4Z7VB 4OCMC 5TDOB 4RMRA 1KCSH 3OJDB 2X4UB 1T03L 1EHLH 4V2BA 4OBRA 4OIIL 1A6UL 2PCPA 4HWZA 1D6VL 3GMQA 4ALAH 5T3ZD 5JXED 1K2DA 4NBZB 4O58L 1E27B 2VAJA 2GSGA 4O51A 4AEFA 5BZWB 1BFVL 3V7AG 5DD3H 2HN7B 4NPYB 4KVNL 3RKDC 3HAEH 4ZXBC 5HYQA 4P3DA 3QQ9D 3S36X 2BMKA 5IJVA 5FKAA 3ZDYE 3V8CA 4N1CA 2B5IC 2V2XB 1CD0A 1A0QL 1BFOB 1ZV5A 5C08B 5CZXD 3IJYA 3NFNB 3VWJD 3IXAA 1NBVH 2H8PB 3GSQB 4M03A 1FFOA 5JIIA 4G6FB 1G9NC 1X5IA 5L2KB 2FNBA 4R7NB 2VZSA 4PB0H 1IGCL 5IW6B 2ZCKL 3GKWL 4G8GB 4OZ4A 1WFUA 2MFNA 2XRAH 4EVNA 2GT9B 3MLWH 2AXFA 4CBPA 1CGWA 5HHME 1AGFA 4P9ML 4KFZC 1GAFL 3QPXH 4ZO9A 1QLFA 3PWNB 5DO2D 4JFXB 3TBSA 2IH1A 2IWGA 3NN8B 2Y7QA 3I6LD 5FOBB 4IRZL 4HKBB 4C4KO 3ECBB 1UJ3A 2ZOKB 1ZHKA 5I1AA 1I9RH 4RGOH 1S7SB 1GYAA 2B8OT 3IS1X 2F74A 3GBMH 3OKMA 3N06B 4ZTPL 3VFGL 3CFKA 1U58A 2XQYG 5IT2L 5ICXA 1A4KB 1VADB 3V5HA 3WFDL 4GBXA 2NXYC 5H8DA 2EXWD 1B4JL 5BOPA 2E3VA 3RAJL 4WHTB 2IH3B 2AI0H 3PWLB 1KPVB 3VXSB 4EBQH 4LP4A 4M6NH 3S37L 4U6TA 5DJXB 3KPQA 5JHDB 5DA4A 3K1DA 1HSBB 1QPPA 1YEEH 4DZ8B 3QUYA 5CGYD 4FQQA 1TZGL 4JFDA 5DFVC 3OXSB 4XWOC 1UKTA 3QR2A 2EKSA 4P4KC 4JZJC 4KKCD 4WFEE 1IC1A 3MV9A 2VXTL 1DCLA 2X42A 4MDJA 1IEHA 1LK2B 4NUJA 4EI6B 1YEKL 4ZUSB 2VLKD 4U3HA 4OD3L 4N0CC 1P5VA 4DVBB 3KPNB 2EKJA 1ODAA 3B9KC 1EEQA 4M6OL 5HI3C 3HUJA 2J4WH 3JWDC 4CGTA 3D2UB 4X83A 2LE9A 1T7VA 5CEXB 3QDHA 1PSKH 1M05A 3HKFA 3KHQA 5I8KL 2FGZA 4JRXE 1RZGA 3VXTA 4DCQA 1A3QA 4J3TA 4U1IA 1GGBH 1FVEA 2VDMH 5I15L 3NA4A 3MLXL 5JW4R 5LBSH 3D0LA 4K3EH 5AUMA 4MDIA 3ZDYF 4XH2B 5BJTB 2D4DA 2QSVA 1XGQB 1NDMA 2UWEE 1CFQA 4AQOA 3UJIH 1BOYA 4JG1H 4JG0L 4YBLC 2W9DH 4N8PA 3KJ6H 2R4SH 3OAUL 1CGVA 5CIPA 3O6FD 1T0NB 1TVBB 3P30H 3F6LA 5F8QC 2C1PA 4DQOL 3BD3A 3DX7B 4ODTH 2BVQA 2ARJA 4NCC1 4GKSA 1EVUA 5FHBL 4RCAA 4F7MA 2YD5A 1VPOH 5GISL 1S9WA 3BIKB 3C5JB 3QHZL 3MODL 5DJ8A 4ACPA 4NZTH 3MRFA 2X9XA 1G6RB 2X9YA