1B4TA

H48c yeast cu(ii)/zn superoxide dismutase room temperature (298k) structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
b'VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHICEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CU/ZN SUPEROXIDE DISMUTASE)
publication title A structure-based mechanism for copper-zinc superoxide dismutase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 37
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1b4tA00
3CQQA 1JK9A 2C9SA 1EQWA 3LTVA 4A7TA 3H2PA 4A7UA 2NNXA 2WYTA 2WZ5A 1E9OB 1HL5A 4MCMA 1DSWA 1L3NA 2ZKYA 2XJLA 3GTTA 1XTLA 1PU0A 2GBVA 3RE0A 1EJ8A 1TO4A 1OEZW 1CBJA 3MNDA 2C9VA 1P1VA 4BCZA 1U3NA 1E9QB 2WWNA 4A7QA 3QQDA 1F1DA 4MCNA 2AEOA 3PU7A 1S4IA 5KBKA 1SPDA 2V0AA 1B4TA 3GZOA 2AQSA 1B4LA 1SXBA 1UXMA 1CB4A 2AQPA 2VR7A 1JK9B 1TO5A 2Z7YA 3ECUA 1N19A 2XJKA 5KBMA 2SODB 2GBUA 2Q2LA 3S0PA 4A7SA 2WWOA 2Z7UA 3ECVA 3MKGA 2E47A 3CQPA 1PZSA 1JCVA 4L05A 1Q0EA 1F18A 1OAJA 3KM1A 3H2QA 2JCWA 3GZQA 3GZPA 3GTVA 5CU9A 1SDYA 1SXCA 3KBFA 1SDAB 2ZKWA 1Z9PA 3K91A 4N3UA 1SOSA 1RK7A 1YSOA 2APSA 1COBA 3HFFA 2C9UA 4U4IA 1KMGA 3L9YA 1E9PA 3ECWA 3L9EA 3QQDB 4BD4A 1SXAA 2GBTA 3GQFA 1Z9NA 1OALA 1E9PB 1FUNA 3HW7A 3HOGA 3KBEA 3KH4A 1IB5A 2K4WA 4A7GF 1F1GA 3F7KA 1IBDA 2WKOF 2AF2A 1IBBA 3SODB 2AQNA 2R27A 2Z7ZA 1MFMA 2WKOA 2WZ6A 1DO5A 1HL4A 1AZVA 1YAIA 2AQQA 3CE1A 3T5WA 2WZ0A 2ZKXA 2AQTA 4OH2A 1E9OA 2VR6A 1BZOA 1OZUA 1BA9A 1IBHA 4N3TA 4BCYA 1UXLA 1IBFA 1F1AA 1YAZA 3KH3A 2VR8A 1SXSA 2WYZA 4B3EA 4FF9A 2Z7WA 2E46A 1ESOA 1N18A 4A7VA 5KBLA 1SRDA 1E9QA 1QUPA 1PTZA 1SXNA 4OJAA 1XTMA 2ZOWA 4A7GA 2LU5A 2AQRA 1OZTG 1SXZA 1XSOA 2JLPA 3KM2A 3F7LA
chains in the Genus database with same CATH superfamily
4Z95L 1B0GB 3LRSB 2HT2C 2MKWA 2G2RB 4FZ8H 1FPTL 3H9YA 3NZ8B 2KERA 4GRWH 4BHUI 4E5XB 3TH3T 3WNLA 5DRZA 2F1AA 3DGDA 1YQVL 4G42B 3AB0C 4PJIE 4K9JA 1ND0B 1KENH 1UVQB 2A0LD 4FNTA 5L0QB 1CGVA 2DLFL 4LP4A 3L5XH 4ZAKB 3IMTA 3PAUA 1FQ9C 1BQUA 3U6XS 4HMCA 3V0DA 3FTVA 2G60H 4X5WB 1KCRL 2MOVA 2NY3D 1E43A 3HI6H 4YDVA 3WJLA 4ABQA 5T3XH 3NDZE 3S2AA 3KJ6H 4WGVB 3RDTA 3MCYA 1OB1A 1QTYT 3HUJA 2BP3A 3OPZH 1XIWD 3ZTEA 1A6WL 2CHNA 1V7MH 1BQHA 2D03L 1GKEA 3LB6D 4M4RA 5EB9A 3N55A 4UI2A 3TEWA 5DZAA 1D7BA 2EJ1A 1IC4H 3ATEA 4WWNA 4JFFA 4EXPX 3T6ZA 4XP1L 1N4XH 2DIEA 2Y7MA 1JXJA 5IF0A 4KKZA 4ODXA 4WFGE 1M05B 1YMMB 2FO4A 5FYJD 3VX0A 2X4TB 5TF1H 2BY2A 3LV3B 1EAJA 3KWTA 2VXVL 1KV3A 2E6JA 2L7QA 1BMZA 1QD0A 4N2EA 1PLGL 4BFKA 1G87A 3NCYS 1FF5A 3VG0H 3TFKD 5ABDE 4N3UA 5I6MA 3MRKB 1XGUB 3VI4A 4QNPE 2WNWA 4ZMAT 2JQMA 3BKJH 2XVLA 5GJTL 5D7IB 1SBBA 2FECI 2WSDA 3IDYC 5B39G 1S5IL 2DLTA 5IGXL 1AS6A 1MDAA 2ZAIA 4NGHL 1KCVH 2YRZA 2R56H 1KN2L 4C4KO 5BUPA 1YUKB 5KSAB 2BLFA 1HSAB 3LPPA 3IS1X 4NDMB 2NY4B 3DTXB 2AQNA 4A2GA 3SDAA 4ANKA 1MFMA 2K6WA 1T03H 2GT9B 1NANI 1AIFA 5PCYA 4K8RH 1HL4A 2WMPB 4WHDA 3DDFA 2W9EL 3IDNA 3WEBA 2YD5A 1ULVA 4KH9A 1PD6A 1ADWA 1QBAA 3BQUB 2OA9A 5JIPA 1IGFL 4YK4C 2CLRA 1WHOA 1U41A 5HHOA 4OM1L 2BIHA 2YPLD 4ZNEE 3BWAB 1VGEL 3GK8H 2V3EA 1DQJB 3NJHA 2A1WL 2BNRB 2YXWA 1E4HA 3HLKA 4GG8B 5DZ9A 1E5YA 1DBAL 3ALXA 5DS8B 4ZMTA 3H54A 3KHOA 3GPEA 3U82B 5E2JA 4Z8FL 3RIFF 1B3JA 5GQBA 5HTSA 4TVPL 4PLNC 3UEQA 4NNYB 2QQKL 2IIJA 3T09A 2FGZA 3F7LA 3FPYA 2BRRL 3FQ2A 4P2YA 1YCSA 4DVBA 4YSEA 1T83A 2QR0A 3RVVC 5DK3A 2WOYA 3PXJA 1B88A 1A9EB 1YDPA 2DQIL 4W6XB 5EC1B 5F7AA 3VNYA 5I9QB 1I53A 2VSCA 4OVVA 1YYLL 4KTGA 4KMLB 4I9WD 1QACA 3Q6FB 4H8WC 4TUJA 1AS8A 1PKQA 2CXGA 2R4SH 3E9UA 5I5JA 5JQ6L 5CKGA 3BXNA 1W72B 3PFQA 1ADQL 4M1GL 2O30A 1AO7A 3ZX1A 2VDKB 2Q8AL 2BVOA 1C5CH 4UT6L 1C12A 1O0VA 2PR9A 3C5XA 1NCDH 3D85B 4M9OA 1R3JB 2GCYB 3IETB 5EF3A 5AB0A 4N0UB 1RZ7L 3PGFL 2XRAL 4FMKA 1U8MB 3HZMA 5C0RL 1I7ZB 4N0FA 5FHAL 5CAYB 3QHFH 4LL1A 1HXMA 4KMTH 3I02A 3CIQA 1HNGA 3MACL 1IIIA 1L7TL 1GGIL 1M7DA 4ZNCD 3AC0A 1F86A 1N8ZB 1KELL 1CQYA 4GEJA 3UPRB 1UZ6E 3W5NA 1YC8A 3GDBA 5TD4A 4FNLH 2P24B 1D9KC 3MV8D 4X7SL 5CZXC 5IMLB 3P2BA 4K3JL 3NK3A 2ZWLT 3IMBA 5EH1A 2ITDA 1M1XA 4DGYL 1E4XL 2ILLA 2WLNA 4NYLB 5I8CA 4FHBD 4CILA 5FGBC 4A7GF 1SJEA 5AW3B 2WKOF 4FX5A 3RVWD 1MHHB 2F5BH 4IHOA 2XZQL 5FUCC 5D6CA 1DCLA 3K2UL 3D4GA 3WIFA 4B9KC 3NSJA 2G3NA 5L0QC 2RIKA 4GYBA 4O2FA 2O6FA 5C3TA 5AALA 4LL4A 4APXB 1XGPB 1BHGA 4F8OA 3UBXB 2FNWA 2VR9A 5BNXD 4JO4H 1DVXA 1O7VA 1KIQA 4NBXB 3FXIC 3WSQH 1JXDA 4OCXH 2AQ1A 4HWBL 1TYRA 3ARRA 4I77H 2E46A 5I1KL 4Z1PA 1MI5E 1MFEH 2EVHA 1LK3H 1I9JL 2CK0L 4WO4B 2H6UA 4KQ0A 5DJZA 4XGZA 4OCWL 5F6IC 2QVTA 2HLFC 5GGVH 4XMKL 5EU5A 1GGBH 3IJSB 1QSFD 2B08A 3MXWH 4KKPA 4W9JC 3JYBA 4Y5YA 4TXVB 5E2UL 1MXDA 1OIOA 1PD1A 1HWHB 4KRPD 4XPTL 4CC4C 4ESKA 5C0NC 1U8NA 3ESPA 1A4BA 1FI8C 4MNHA 1BBJB 3W2DL 2JKSA 1DVSA 5IBLC 5FGCE 1ZXQA 3H7BB 1JP5A 3SBPA 1LEGB 3EGSB 3LQAL 5IUSA 2J72A 4PVBA 5L9DL 1DJWA 3L95B 4WTZG 1JGLH 1YNKH 1PLBA 2HVJB 4PV1C 3U46A 3GRWH 3LQAC 1S7SA 2YUVA 2IPKB 2IPTL 3DETC 3HB3D 3OKKA 4GS7B 4M3JA 1X5LA 3HAEG 4YHML 5BS0D 3EO9H 4ZMPA 4NKIL 2FX7L 4BCZA 2CUMA 2IXQB 3DA0A 2Y36H 2FECL 2EXYD 3IBOA 4EPSA 1U4EA 2NY4C 4MHHI 3TJEL 2WB7A 1E28A 3TONA 1AXTH 2VDRH 3DKHA 2F54E 3PWLA 1JPFA 1NSNH 1DVFB 2YHGA 4XI5D 1A8JH 2VKXA 1KIRB 1ZXKA 3DXAE 5F9WB 5FUOH 3GIVB 3RX8A 2FJFB 4R26L 3BQUC 4Y2DD 3TZVD 5EU4B 1IM9D 2BP0A 1XFPA 3JZYA 1ED3B 1KV7A 4IRJD 4MJIB 4GO8A 5J1SC 4S0HA 1V7NH 3OB8A 1KT2B 4NJ9H 3X14B 3O3AA 1ODAA 1ADQA 1WP6A 4LGRB 3CX5K 4HUXB 5AW4B 3RTQD 1JZ5A 1JYNA 4V2BA 4LEEA 1MW2A 2XQBH 4QRPA 4YDLC 1TCMA 1JHLH 2H9GA 3GSUB 4G3YH 4MWFB 4JFDD 2WXNA 3JWNH 3X1BA 1OGAE 1JPSL 5TDPA 2PYED 1IO4C 3PP3H 3X2QB 4OCMC 1OOWA 3QNXB 5DJ8A 2J57A 3M1CA 3P9LA 4LHUB 1FUNA 5TE4L 2OYLA 2QVMA 3S5LA 3MRHB 1UM5H 4G5ZL 4DO6A 1IB5A 2A7BA 4PQXA 5FKPB 5TGBB 4WTXA 1YPZB 3TN0B 4BDVB 4QT5B 2XQYG 1MVUA 3BHBA 4JQXC 1W72L 1B0GA 2G2RA 4U3HA 3NZ8A 5CSZA 3H4HA 3MUY1 2VDKL 2I9TB 5IESH 4E5XA 5GGTL 2XXCB 4K07A 3MRJB 4Y1TA 1W9XA 1ND0A 1UVQA 3DIVA 4P59H 1AR1D 4QRRE 2UV3A 4ZAKA 5AZEL 4P3CL 4FABL 2ZNXA 3KDPB 4X5WA 1MCEA 1VFMA 2K4AA 3A4AA 3CSGA 3D4ZA 4PUBL 2Y6SC 5E6ID 4RNRB 2PMZA 1SJVA 2MEJB 3EJYD 1MRCH 4ONGL 5E2TH 5BRZB 3AQXA 4NQEB 1JYVA 5ITBH 5I6LA 2MTPA 3DJTA 4HCGA 1JF5A 3PP4H 3QEQB 3T4YB 4CJ0A 3MGTB 4HWBA 1SYVB 2QSCH 2E5EA 3NSFA 4M6ML 1X5ZA 3B2UD 3T2OA 5CKAA 2NCMA 2KHAA 4QUOA 1YMMA 3O6FB 4TQIA 2X4TA 3HMWH 1S78C 3LV3A 1UCBH 4U05A 3UTTE 1BXAA 5I30L 2C3XA 4BH7B 4OZHE 1B0RB 1EXGA 2C7FA 4KHXL 1KC5L 5IEKB 3ZKMD 3MRKA 1XGUA 2EH8H 3H6JA 4QRSB 1ZLVH 1CFVL 4N1CA 2WWNA 4WJKB 2VLMD 4AQ8C 5IB2B 3IFNH 3ULUL 4W9FC 4H20H 3FSWA 3PPEA 2YWYA 4MA3B 3UJIH 4ZFGH 2VYRE 4ENEC 3KPRB 3FQTB 5AVWB 5AUMB 3NACL 3FN3A 5KSAA 2AXGB 4NDMA 1CCZA 3DTXA 1L9OA 2H45A 3QQXA 1JS4A 4P04A 5IG7B 1LILA 4U1LB 2GT9A 3LZLA 2WMPA 2Y3NA 4NRYB 3ZO9A 3VRJB 2AJVH 1OSEA 3E3QE 5E1IA 3W3BA 1V55B 3H42L 4RBPH 2EIEA 3BQUA 4WO4C 5K9QI 1KB5A 2ZX7A 3K74B 4FERA 1FYTB 2VDMH 4ZOBA 3BWAA 4HKBA 1DQJA 4GG8A 3WV0A 1Q8MA 2BNRA 4WFFE 1JPGB 4DVRH 1T2QL 4XPAL 5DS8A 4O51B 3ZDXE 4Z3FA 4FG4A 3WGVB 4ZMVA 2PKDA 4FHKA 5D7KD 2PR4H 5KBPA 1YN6B 5TE7L 2YQGA 2B0SH 4LCIH 4NNYA 3ZW3A 2R2BB 4YHOL 2JE8A 3GMQB 2BY3A 3DUSB 3K0YA 3JTSB 3O9WB 1NCWH 1T0NB 1WZMA 4JFED 4Q6IC 3RFZC 1I1FB 3TESA 1A9EA 2LTQB 3MNMA 1RZGB 1N0LB 1OSPL 3D3VB 5EC1A 5EO1B 1P4BH 1YUHB 3OD3A 3FO0H 2NQ3A 4FCAA 3MRFB 3IFOB 5KS9E 12E8H 4OSUL 1I9IL 2JK5B 2K9UA 1BPVA 4JMNA 1JG9A 1P84J 3Q6FA 4QHPA 3RGVB 4QJ5B 5T5NG 1W72A 2EEAA 5D7LE 4JDVB 4PSPA 5ILTL 2OP4L 1JVKA 2WY3B 3CFBB 1U21A 4F7PB 3BHBB 1BOYA 5GGTA 3D85A 3T0BA 3T0ED 1DJXA 3UBGA 1R3JA 2GCYA 5IQNA 2QFRA 1XB6A 3CLEL 4FN0A 4N0UA 2O6DA 2D0HA 1U8MA 1AZCA 4JM2B 3NOIA 2VLKD 1UFUA 1I7ZA 4KKNA 5AWNL 2G5RA 6PCYA 1FRGH 1OCWH 4I13B 1UWGL 4TLUA 5F7EH 3U1SL 2A6JB 4KO9A 4L9LB 5IW3A 3LMJH 3MLYL 2HRPH 1MUJB 3QZBA 3ETSA 4NO0B 1H8LA 1N8ZA 3U30B 4ZS6C 4BUQA 3K6OA 5C86A 1CK0L 2ZYSA 3AAZB 3UPRA 2VLJE 3EYVB 2I60H 3TN0C 5IMLA 2P24A 2PCFB 3QIUD 1CDYA 1D5IL 3CSYB 5C0BE 3L1OH 3LIUA 3LS4H 4JK0D 4J8RB 3M07A 4GIPD 4NYLA 3SCMB 3AT8A 3QG7H 3RA7H 3T77B 4OLWL 3H9SE 1MHHA 4GH7B 1P4UA 4AQ8A 4ZOEA 1TJIL 2FBRA 2EDEA 5LXVA 1M57B 1YVLA 2E47A 2EECA 2QBWA 4NN7C 4EOWH 3RKDD 2A6IB 4APXA 1XGPA 4PJDB 5E2VL 2GC7C 1U30A 3UBXA 2VOTA 4WGWB 2O5XL 2CGRH 4Y5XC 1NICA 1THAA 3GIZH 4Z7AA 3MRBB 5C0FB 1SDAB 3V0HA 5SWSE 3N9GH 5D2LB 4FKKA 2APSA 2IF7A 2E8ZA 5LNGA 2MPAH 5IROD 3T6XA 5FKAB 1HI6B 1AKJD 2QQQA 1XGYL 4WO4A 3SDXB 4DP1X 1U2CA 4W9EC 3LH2H 1R3KB 3QJRB 2MCMA 3WJMB 3TCXA 3IJSA 3PUCA 3IVKB 4KJYB 5JUEH 3QW9A 4QD2E 5GRJL 2EDRA 5AW7B 5D7JB 2GJRA 2HLEB 5HHME 1ZA3B 1BBJA 2VISB 2ZOLB 4KDTC 3VGFA 4Z7WF 2OMYB 1BYNA 3GBNH 3AG3B 3H7BA 1LEGA 4L1BA 3EGSA 1WFIA 3L95A 2J55A 4O02B 2ROYA 3FUKA 3O3UN 4L3AA 5I0XA 3QWQB 2HVJA 4Q6IA 3RFZA 1JMZA 4UWQB 4Q6IB 5HDWA 2WXIA 1LDPL 1VB9A 5D1ZD 2IXQA 2WHVA 2YGPA 5JZ7C 3TV8A 4OQ1A 1N64L 4JRYE 5GS0H 1DVFA 4OUOA 1OB0A 1NWOA 4LKXB 1KIRA 3GIVA 2FJFA 1EZUA 1U6AL 2XWTB 3QXVA 5EU4A 3SE4C 4FQCH 4KJPC 1EAPB 1ED3A 3E6HB 3TNNB 4MJIA 1GHFH 1KT2A 1DQDL 4DGVH 3X14A 1OGSA 2Y7QA 5HHPA 1G1YA 4KZEL 5JHLL 1JNJA 2N1KA 2VZOA 3JTBA 1PY0A 3EJJX 3MNVA 1OF2B 4ZMNA 4IKNA 1QSED 3GSUA 4MWFA 5B39B 3PCYA 4XPGL 2LVEA 3SPIA 4ECNA 5C2BL 1PJWA 1NEZG 4WU5B 5BMFH 1TZ8A 4XP5H 3WFBH 2YC1B 3QNXA 1GYWA 1BYOA 2QVIA 3O9WC 4LHUA 4WSJA 2X3BA 1H8NA 4DSYA 1KBBA 3MRHA 4G6JH 4N90D 5FKPA 5TGBA 1YPZA 3TN0A 1ORSA 4K7PX 1BFSA 4YBQD 4UQAA 4QT5A 4BDVA 4HBQA 3ATAA 3H3PH 3U25A 4OUUB 4NPKA 4NUPA 4LARL 3PUUA 3P3RA 4KNSA 4M9PA 2GJ6E 1F18A 4OF3A 1BVZA 2I9TA 1Z5HA 4Y4FB 4MS8D 4CVXB 1V10A 2JB5H 5DFVC 4XMLH 3OWRA 4BFNA 2YD9A 3MRJA 5JIHA 3VD0A 3GGWB 3BW9B 4PMFA 4RGNB 4RFOH 1HL9A 3C6EA 3T6VA 2TAAA 3TS8A 5FEBA 1YEGL 1QPPA 5FCUH 2EACA 2B9BA 4P23C 3ZIYA 4OCNC 4AJVA 5CGTA 1JJUA 1CFNB 4AH2A 4L4TE 1OTTC 4RNRA 1ZVYA 1H19A 3FAXA 3KH4A 4HW6A 5E08L 2BK8A 4KXCA 5BRZA 3MYJB 1X9LA 3IGFA 3L4UA 3RB7A 2CKBH 3SJVD 4NQEA 4AE1A 4M03A 3CUPB 5C0IA 4QKXB 4RESB 3OJ2C 3T4YA 4GW5B 3QEQA 1I7TB 5JMRA 3DHMA 3MGTA 1SYVA 1VCAA 3JWNC 1LXMA 5DEFB 2YRBA 4HDIB 1AOHA 1KTDA 5KYUB 3O6FA 1L9SA 2ZWNA 2D8KA 5F6HI 1ZDSA 2BXYA 4OLYH 2A0LC 4OD3H 4FTVD 2CO1A 1B0RA 4KDTA 4QGYA 3SCMC 1MVFA 2YD1A 5IEKA 4GBXD 4QRSA 3HJ0A 3HUJF 2NY5L 1D7DA 2RJMA 1NKOA 5IB2A 5KVGE 4PRHB 2AQRA 3SKMB 1WK0A 1XIWC 4XVJH 2J73A 3L2MA 5J56B 3KPRA 1BSIA 1LO0H 3FQTA 3BMWA 3LB6C 5AUMA 2AXGA 3OQ3B 5CP3H 2ZOUA 1EQWA 1UM4L 3CN3A 1WA2X 4LAQH 4F57H 1R17A 1FNAA 4OFQA 2X7LB 5IG7A 2IG2L 1QZNA 4U1LA 5GGSY 2E7BA 4B0MM 2PP7A 2BIMA 4NRYA 3VRJA 4XBEL 4JCLA 4GMTH 1FIGH 4P9ML 4NB7A 3CN1A 5EN3A 1FYTA 1P9MC 3VXOB 2NTFB 4PR5B 1S9WB 4K9EL 1N3NB 1JPGA 3MJ9A 3CD4A 2PTTB 2AEOA 2R0LH 4OLXL 4YHZL 4O51A 1JVOA 3B8SA 4U6XB 5E8NB 3BAXA 3SDDD 3U48A 1OAYL 4FL4B 1B2WL 4O02L 4KU1A 1C9SA 5JHLA 3HB3B 4FDWA 2VR7A 4QWWD 4N8PA 5ABZA 1MN4A 1YN6A 5C0GB 4N20A 2R2BA 3GMQA 1LE5B 3MLTB 4FEMA 4IDJH 3DUSA 3H2WA 1XV8A 4GSDH 1XMEB 3O9WA 3HN8A 1P2CB 1T0NA 3P40A 1I1FA 1EHAA 3DX4A 4CAGA 1J7VR 3NIGB 5EO1A 1RZGA 1N0LA 3DGGB 3HG2A 5E9DD 3RWDB 3EFDL 5IOPB 1YUHA 3MRFA 4Y2DB 3IFOA 1IM9B 1FNFA 4CSTA 1ILUA 3QJZA 2ZUQB 1RZFH 5I26A 3RGVA 2VZ1A 5EUKB 5D1XB 3UO1L 3RTQB 4JDVA 3TT1H 4X7DC 2DQTL 2E6QA 3H3KA 1EZSA 1A6VH 2I07B 3G6JB 3UH8A 2WWMD 3CFBA 2WN2A 4F7PA 2ZCLH 4FQLH 1TJGL 2CO6B 3GXNA 2ADFH 2EDMA 5C07E 2P5EE 4HIXH 5LHDA 1IGIH 2ZXBA 2VTFA 3K2MC 3L08A 4JM2A 1U92B 3QULB 3T5WA 1ERNA 1JZHA 4JRXB 3UTZB 2BVYA 5BUAA 1OZUA 2WCPA 2A6JA 1A5FL 4LAJH 4QYOA 2H32B 1MUJA 2AK4E 5LB1A 1ET5A 1UXWB 4NO0A 3VFUB 3OHMB 1EBPA 1NBVL 4GG6F 3AAZA 9CGTA 2WCSA 4ORGB 3EYVA 1FZOB 2PCFA 4FTDA 1S7WB 5EU7C 4UIKH 3CSYA 2UWEE 1PZAA 4H26B 3MODH 1AC0A 1OTSC 2E56A 4J8RA 2F15A 5AAMA 1DJGA 3INOA 3SCMA 3VI3B 4GRLD 3QQNA 5JIMA 5HGBB 4FLQA 3NJGA 4HP5A 3T77A 3EYFB 5G5DB 4M7JL 3UGXA 4JPVL 5CJQH 5G4NA 1SN0A 2FJGA 2Z34A 4YC2C 2R15A 4YPGB 5ANHA 1L3NA 4LOEA 2A6IA 3Q1SH 4TM9A 3GJEB 4RMWA 5HHNB 2HX7A 1USQA 5C0FA 1FNEB 2E9BA 3MRIB 3F7QA 4YHNB 1BREA 2KDYA 3WCYA 3NJFA 1J1OH 5FKAA 2N0MA 1N70A 1UWEL 2KT6A 3SDXA 4Z7OF 4W9CC 4KI5E 3KJ4B 4UTAL 3KWXA 1S8DB 1XEDA 1UXMA 3VFWB 5TTRA 1QQDB 1R3KA 3WJMA 1AH1A 3IVKA 2Z31B 1GAFH 4KJYA 1MJUL 1R33A 5D7JA 3RVWC 3HNVL 1AVAA 4JY5H 4Z95H 2D73A 1HH6B 2AERT 2AXHA 1ZA3A 1LTXA 1FPTH 2VISA 2ZOLA 4KY1L 2OMYA 3S37X 5FK9B 4AL8L 2P43B 1YNTA 3WDJA 1FAKT 1YQVH 3EO1B 1DSFH 1QG3A 4IU2B 3D9AL 3MV9B 4O02A 2Q76B 3QVAA 4GUPB 3QIBD 5E6ZA 3B9KD 4WK4B 4AL8C 1BD2D 2VDLH 1KCRH 1OK8A 3M7OA 3I6KB 4LCCB 2PABA 2ZIDA 2V3DA 3LNIA 4G8IB 2GFBB 4HH9B 4K3EL 2PNDA 1A6WH 3P4NB 3GNML 5CLTA 4O5LH 3LXAA 5ERWB 2D03H 2M2DA 4LKXA 3KYAA 3MJ8A 4KRPC 4LESA 1K4DB 3LXCA 2RBLA 2XWTA 2NNCA 1JHTB 3MZGB 4HPYL 1EAPA 3E6HA 2GUYA 3TNNA 1PL3A 3KMDA 4XP1H 1KB3A 4GPVA 4Q9RL 1YLBB 4CGUB 2WANA 4QRTB 4J23A 1MXGA 1KXQE 1Z6JT 2LOEA 4KOBA 1F1AA 1DUYB 4N2HA 1CVRA 1SVZA 3KH3A 5F9DC 4P07A 2RB8A 1OF2A 2AAAA 3GS0A 3WN5B 5J6GB 3DVIA 4TNGA 2H47C 3UADA 5GXBB 2RQEA 1UT1A 4GP5B 2ZYHA 3HB3C 5B39A 2WXRA 2ENSA 1J8RA 4CNIB 1RZKL 4NBYB 5GJTH 4WU5A 2EXYC 1UD8A 2YC1A 1S5IH 5IGXH 1Z32X 3T2NL 2AXFB 1KN2H 4PGEB 5F7WC 5BV7H 3VYPA 1E5UI 4U7MA 3BUBA 3OZKA 3HKFA 4N24A 4OM0L 2I26N 3QZWG 2Y1AA 3MTXA 4TN9A 3QXUA 4Y2DC 2C9RA 3I3BA 4PV9B 3GLZA 4FLHA 4OUUA 5EDXA 2ZUQC 2OJZL 4PJ8B 4PJAE 5CN1A 3K4ZA 3DTUB 4Y4FA 4CVXA 3RTQC 1NDTA 2W60B 3LHAA 2V9RA 3GGWA 5TK4A 4OM1H 3BW9A 3ISYA 5LGHH 1U3ZA 4LPUA 1NOFA 1E2VA 1VGEH 2WVVB 4NQQA 4HZ1A 1VF5C 2A1WH 2NNRA 2ZWKA 4NLAA 4ZRGA 3QAZB 2Q8BL 5E4EB 3FUNA 2AMUA 3F3HA 1CFNA 3LNDA 4KZCA 3CSFA 1KFGA 1JK9B 4RA3A 3MYJA 3T8VA 2VMFA 3AT0A 4NAQA 2KKQA 4J4PD 4UQCA 1WS8A 2QQKH 3NJKA 3OR7B 2P42B 3CUPA 2BRRH 4GW5A 1OVZA 1I7TA 3I50H 4U6TA 4Y19D 3WTWA 5DD0L 5DEFA 1I9RL 4KGLA 5D70L 4HXAH 5D7SL 3PHQA 4UTAA 2HT3D 1Q0YL 2IFGA 2X6UA 5CU5A 5LWYL 4PSRA 1Z9PA 3KHQA 1SOSA 2W88A 5DD3L 2JELH 1MFVA 1AR1C 5EO0B 3LRMA 1G94A 3QGVA 3KPNB 3U0PB 3GUTB 2YMXL 4BA8A 3CN0A 1Z9NA 1ADQH 1VERA 4M1GH 2OFQA 1S7QB 3T3MB 1MFDL 2Q8AH 2K4WA 3VH8G 4PRHA 3AITA 4UT6H 5F96H 3NCJL 1M3IA 4JFQB 3Q48A 5SWZD 3SKMA 4P2QE 4DP8X 1U8CB 3EJYC 4XNYL 3Q44A 1RZ7H 3PGFH 2AEPL 4PJ5E 1X6NA 2XRAH 4PBDA 2EC9T 5C0RH 4FFYH 1KCSH 2CZNA 5GHWL 4YLCA 2ZYIA 5FLVA 3I9GH 2X7LA 3S3JA 2BIOA 2DBLL 2ZXGA 2KMWA 3BPNC 3GXIA 2WWKT 1L7TH 1LNUA 2DYPB 1GKOA 1FO0B 3VRLE 4N2MA 2WB1A 1FNGB 1KELH 1E5ZA 5I73B 3QJXA 3VXOA 2NTFA 4PR5A 2Z31C 1S9WA 1OO2A 2EQDA 3GD1C 1F6AB 3BPLB 5KVDL 1GRWA 5IMMB 4M62L 5ISZE 1N3NA 5T1JA 2PTTA 4K3JH 2J3SA 2NY7L 3VGBA 5E8NA 4U6XA 2YEQA 5DRNB 4HIIB 1E4XH 3FT9A 5E1GA 3HCVA 2B14A 5AOKA 4BKSC 4RDQF 5BS0A 5C0GA 1OKEA 2GY7B 2IGFL 2DW5A 1HNFA 2XZQH 3GS4A 4R0LB 3K2UH 3RFRA 3RHWK 4CU8A 1CWVA 1ZHLB 1ASQA 1P2CA 4YO0B 2V7HB 2HVBA 2XZZA 1RZJL 4ONFH 3DGGA 3NIFE 4MNGA 3RWDA 3D0VB 4LCCC 5IOPA 3GTNA 1IKOP 2BNUB 4EUPG 4Y2DA 2EICA 3OZLA 4PJCA 1IM9A 1RZJC 3QCTL 4ERSH 1R5VB 4JDTL 4HWBH 1Y6KR 4JKLA 3QS2A 4XO9A 3CLWA 3WUZA 1ZTXH 2BY0A 2W0FB 5EUKA 5FHBL 4QTFA 4GFXA 3RTQA 4JKMA 2W81C 1CICD 2DMBA 4HKZB 2I07A 3G6JA 5LBSL 1MCIA 4ORZC 4F7MB 4XNUH 5IJKA 5D5MB 4PI2A 2CO6A 1DVYA 4TOYL 4XPTH 4WUKL 2QTVA 4A7SA 4BV1A 5FS5A 3MKGA 2NMSA 2OL3B 4QRFA 3WN5C 3HBPA 3IMSA 4WTZA 1U92A 1ZLWK 2OYPA 5JPNC 3QULA 1F11B 2X44D 3GZKA 3OC5A 1QWNA 5EZLB 4JRXA 4WAFA 3MMEB 1CFMA 3RUGB 3KYOA 1L0PA 1DLHA 2G0KA 2H32A 2UXGA 1UXWA 3VFUA 1CU4H 5B21A 4YHMH 1U95B 1F3DJ 4L5FL 4ORGA 5LJYH 2FX7H 2IAMD 5B1AB 4DOHB 4HXBL 1BQ5A 2F53E 5EWIL 2ZUTA 1S7WA 3K4DA 3U2SB 1ZLUK 5A7BA 3LDBC 4N4YB 5C09E 1GCFA 1QFWI 4H26A 2X0UA 3CFTA 5IHLB 3VI3A 4NOBA 5HGBA 3T0EC 3B9AA 3OAUH 4XNQA 2YA2A 3KPSB 4R26H 4TQHA 4XPFH 4CVUA 5G5DA 3SPVB 3H9ZA 3FCGA 2NYYD 2H8PB 2N0KA 1NANH 3KYNB 2DWXA 2DQDH 3QXDB 2RFXB 2V2XA 4HS6B 4YPGA 4ALAH 5HP5A 5KOMC 3ZE0F 2V5MA 3TA4D 3GJEA 5CILL 5E4EC 3BESR 1DBML 5HHNA 4S1RH 5ICYB 4MQXD 5LBVA 1FNEA 2XT1B 3DIDA 5JHDD 1NEZB 2ZX5A 5FOJA 3II2A 4YHNA 2OW7A 1JFQL 2QPDB 4YDJB 4JE0A 1F42A 5L7XH 2WLYA 1RK0B 4U33A 4AVJA 5ICZB 1S8DA 2WJ7A 5TE4H 5BXFB 5GJSL 3VFWA 1PEWA 3B5TA 1QQDA 3BKMH 2JMRA 3T08A 3ARQA 2B4CL 1W6LA 3ARZA 4AYBA 2Z31A 4GY4A 2D7QA 1U4FA 2EC8A 3SO3B 4BKTC 4GBXB 4G9FE 1Q72L 2BINA 2NNXA 1HH6A 2Y9RT 4TKWA 2YGVA 3KYKL 1NGQL 5D4IA 4LIQL 4IMLB 5FK9A 5L4MA 1V05A 1OP9A 2AV7B 2B39A 3RKDC 2P8LB 2QL1A 1UQSB 3MCLL 4IU2A 4XX1E 4IRZL 2Q76A 4E9QA 4GUPA 1H6EA 1SLVA 5MI0C 2J8UE 4P3CH 5AW6B 5HYSA 2OQJB 3TC9A 3KLHD 3S6CA 4YHLL 5DA4A 5DVLA 1YEIH 4PUBH 5IROC 5JR1L 5DZLA 3V95A 3I6KA 4LCCA 3F6JA 4IBSA 2FBJH 3JUYA 4NIKB 4WRLA 1SXBA 5MEND 3R06B 4G8IA 2GFBA 4HH9A 3D52A 1FO0L 5I15H 3P4NA 4C83B 1P84K 8FABB 3QYMA 1JXFA 5ERWA 2VAAB 3O3EB 4OVUA 4OD1H 1DYZA 3PE9A 4KDWA 4OJEH 4EZJA 1A7RL 1K4DA 4QKTA 2J6EL 4ZK8A 1JHTA 3SBWA 2CPCA 2DWSA 4D8PB 4M6MH 2NNAB 4IBVA 4V1DE 4QRTA 1SXCA 1PG7X 2BP5M 3BPLC 4CGTA 1DZBA 3HIZA 4GXUM 4J39A 3BSZA 5I30H 5LBSA 1DUYA 2P46B 2DMHA 1A6AB 1SF5A 4NKDB 4YUEL 5K1JA 3WN5A 5J6GA 1EANA 2FATL 3L3IB 1KC5H 1WCBA 5DZNA 2WVTA 3MRMB 2GBAA 3MA9L 5F7HA 4JFEA 2E9GA 2H2PD 4FMVA 4LSRL 1CFVH 4CNIA 3EOTL 4MJHA 5D1ZC 4XAWL 4JL1A 3O2DL 5C0CE 3ULUH 1LQSR 1WAAE 3K6IA 3GSOB 4EQ3A 1ZLSH 4AUYA 3VXMD 2AXFA 4PGEA 2R8SL 1RIVL 4HK3J 3AQZA 4I2XE 2VMCA 5F3HB 1UTDA 1G4RA 3IXAB 4PV9A 2J8HA 3DO7B 1T1YB 4L4VE 4NZUH 1I8KB 2D7MA 3R7RA 5F72S 1TQWA 1DEEB 2W60A 1SY6L 4M29A 2Q2EB 2PTUA 3BVTA 2OL3L 2P8PB 4CC1A 2WVVA 1QNZL 4AYID 1FVEA 5E7FA 1JZ2A 1T2QH 3MX0B 4G7SB 4XPAH 2VZSA 2YSTA 5EA0L 2MNUA 1RJLB 5FCSH 1KZYA 3UZVB 4FE9A 4LLQB 1BVLB 1JK9A 1YPZF 3QP3A 3SQRA 1T2XA 4UU9B 1UD4A 3UERA 4YHOH 4DK3A 3OR7A 5DYOB 3EH5B 4YBQC 1H5BB 3PRZA 1IV8A 1J0ZA 3ZZSA 3EFFB 3SHSA 2JJVA 2Q7NA 4GUQA 5CF3A 1F3JB 2V9TA 4O9HL 1RHFA 4JFVA 2XBDA 1X9RA 4MS8C 4PRNB 5F93C 2OM5A 4OSUH 3T2QA 5EO0A 5BV7C 3DX6B 1GXEA 5E95B 3KPNA 1A7OL 3GUTA 2WLJA 4AVKA 2FLRT 5AKVA 2O93L 5ILTH 2A4EA 1MOEA 2OP4H 3IKKA 4E9LA 1CF1A 1TO5A 2VN6A 2GJZA 3RGBA 4JFQA 3QHZL 2DLHA 1PZ2A 1U8CA 1GZQB 5GPRA 3TFBA 1TETL 4V2CB 4IRZA 3QYCA 4UM9B 2VERN 4BM7A 3CLEH 1XAKA 1S7UB 2NR6D 2C26A 4BGLA 4QI3A 1ETZB 2BHYA 1SJHB 5AWNH 2D7PA 4NQDD 2HFGL 1NL0H 1BMWA 1D2PA 3B7UX 3U1SH 5I0YA 4OIFA 3UMNA 2ZNWA 2DYPA 5CN3A 1JK8B 4B9YA 4JUTA 4AUUA 4ZX5A 4NZTL 4XCYB 4KKLD 4RIRB 1FNGA 5HGDB 3WL9B 1SQMA 1CK0H 2G9HB 4LDOB 2WXMA 2MH4A 3HC4L 5IMMA 4Q74A 1E9PB 1F6AA 4K5NA 3KPMB 4LK4A 2CDGB 2JXMB 4NM4H 4OZIF 3SO3C 4GBXC 3LVEA 5GRYA 2IQ9L 3CFDB 2UZIL 2F19H 3QIBB 1UD2A 4HIIA 3TO4B 1IBBA 3B9KB 5F0LB 4WWOA 5K9KB 3OJVC 1PYWB 4EN3D 2NPLX 2W0LA 4M48H 3WLWD 3U9PL 2CMRH 4AV5A 1ZT4A 3LQZB 2ZONA 4D9QD 4R0LA 2IGLA 3AQYA 1HTYA 3N43B 4TSAH 4M5TA 1FZJB 3V6ZB 1ZHLA 1TTAA 4YO0A 4CU7A 2V7HA 5E2VH 3GBEA 4Q8BA 1MH5B 3O2DA 4I1PA 3LCYA 1JE6A 4R97B 4AQAB 2BNUA 3QRGL 1R5VA 1TU2B 4IOFD 2EDFA 3UZEC 4LCWD 3DVGB 4GSQA 2W0FA 1IC5L 4LSQL 3QC6X 4ZSOE 5C08E 3RWJA 5I6NA 2PN5A 1XGYH 3QWRD 4G6KL 1H8SA 5DJXB 3SDDC 4HKZA 1A65A 3UMTA 4F7MA 5D5MA 4QWWC 2L7UA 4WV1B 5GRJH 3IB4A 5E56A 5DJYB 2XTJB 2XA8H 1HL5A 2OL3A 3BI9X 4Y7OC 5LCVL 3O6MH 2XYBA 4LCYA 3X1NA 5CCHE 1F11A 2R69L 3N1FC 2VN3A 5EZLA 3NJMA 1PS3A 3MMEA 3QJFB 3RUGA 2J8OA 3P0GB 5DF0A 4PCKA 4XB3A 1KF9B 4GIAA 4OCSL 1BDYA 3BAJA 4MB1A 4PRID 3LIZL 3VFGH 3BKYL 2L7JA 1U95A 1JTOA 4DCQB 4P2OD 1LDPH 3FFCE 2I32A 2EYTB 3QSKB 1AY1L 4WHCA 2YQ3A 1EGJL 3U2SA 2AQPA 1IEAB 2XTLA 2BNQB 3V79C 2EEDA 3PYCA 4HKXB 3N44B 1NC2D 1N64H 4FGMA 5E70A 4IKLA 4ELMB 3VQ2C 5HI4D 3SGJA 3KPSA 1FL5B 1U6AH 2V9UA 2VL5B 2EO9A 3QUKB 3SPVA 2H8PA 2EIKB 2A3TA 4G43A 4PJ7B 2OKMA 4KXDA 3KYNA 1DQDH 4PCYA 3QXDA 4HS6A 2A2QT 2RFXA 1YYMH 5CMAB 4KZEH 5JHLH 1GZHA 1JRHI 4MS6A 2C4XA 4H1LG 1SEQL 2BJML 5ICYA 3INUL 3QXAB 1NEZA 3WIAA 1SXAA 2ZJSH 3DUHA 3GQFA 4Y19B 2E76C 4KPHL 3QQ9D 3L17A 1NAML 1NDMB 4XPGH 1Q90A 1A7NL 2CNYA 5C2BH 1PPIA 4YDJA 3ZHNA 2NXYD 4M6OL 4WEBH 1DQLH 1FJ1B 1RK0A 5G4OA 1EWHA 3QZWB 5ICZA 4L3EE 5BXFA 3HE7B 4WUUD 2BVEA 4GRLC 1AS7A 2DQ6A 4ICWA 4PJBE 4GBXA 3ZY7A 2ICES 3BGFC 2E4FA 3UTPE 4Y4HD 3IU4L 4LARH 2IO5A 3CVBA 4IMLA 2Y07L 1B0IA 4GINA 2AV7A 2F7RA 3KAAA 4JHAL 2P8LA 4FRWA 4FF9A 1UQSA 4KVPA 4N5UA 3RWGB 4JGMA 1G7LB 4JRLA 3P9MB 3WMPA 5TF0A 1K85A 1OCZB 2OQJA 5DYFA 2YKLL 5F21B 3HS0B 1YEGH 4UT9L 4E42B 3R1GL 4Y0GA 3CVDA 2ADIB 1QO3B 5EHFA 3R06A 2DAVA 3PJNA 5E08H 4E0RB 4TSCL 4C83A 4D2NA 4XP9H 4N1HB 1CLZL 1XDTT 2ICEB 3WKPA 3WNPA 2VAAA 8FABA 3O3EA 3X3FL 5CEYA 3W0WD 2Q9OA 3C12A 4Z77A 1FP5A 2LABA 4IMKC 1D5ZB 2C3WA 3ASNB 1YNTF 3OAZH 4MVBD 1F4WL 1NIFA 2EIJB 3A5VA 5JO5A 4H8VA 1VLXA 1IGJB 2CA3A 4RH4A 1XD1A 3RWCB 3ZRFC 3QJQB 5I8KH 1A6AA 2FLBT 2WAQA 3AJ7A 3QIBC 4NKDA 4QYAA 4X4KA 3L3IA 3B9KC 4HPHA 2OYKA 1J8KA 3VH8B 2VN7A 3B9VA 3S5YA 3GJFK 3TWCL 2FL5B 4H88L 1T7WA 1WCQA 2A74C 5JORB 4YBLC 2DZEA 2QMKA 2R69A 2VABB 1HK6A 1J8HD 3GSOA 1A3LL 1WISA 1H15B 2XN9D 3H0TB 3KLAB 4LLVB 3LIZA 4HUVB 3I3EA 5F3HA 3CHQA 4E41E 3T1WA 3IXAA 3H1ZA 5AW0B 3BPCB 3EGDB 3DO7A 5IT2H 1T1YA 4Y9GA 1I8KA 1GR7A 1EGJA 3LKOB 4XBEH 2IANE 1KULA 1DEEA 4P9MH 3S37H 2PO6D 1M9SA 3RI5K 4NZFA 3NZUA 1KTRL 4MB5A 4K2UH 2P8PA 5LUMA 5FO2A 1OGTB 3NG5A 4Z0XB 5BO0D 2VZVA 4ISVB 2VSKB 3NCFB 3MUGB 5K9OA 1BVOA 1OAKH 2B20A 2WQ8A 3MX0A 3O4LD 4FQ2H 4N22A 3WTUA 1S9YB 4WJ5B 4YSQA 4JG0H 2P49B 3QUZD 1LD9B 25C8H 3UZVA 1ACXA 4LLQA 3ZMRA 1BVLA 4K7FB 1KPRB 2ZX9A 1JZ3A 4HJ1A 4UU9A 5LNEA 5CZRA 4P2RE 4JQIA 1UJTA 5DYOA 4G71B 3AG4B 3BAEL 1H5BA 5IHUL 4QAWA 3EFFA 4EUPB 4NC1E 4BQCA 1P7QB 1GVIA 2BSRB 4GRLA 4ADIA 3EFDH 3BZ5A 4K94L 1EHKB 2DQGL 1XF1A 5TH2B 4PRNA 2BFVL 4XOAA 1S6NA 3GI8H 4QIRA 1RUKL 1E5CA 3FH5A 1KYAA 3TBWB 3DX6A 3F01A 2G30A 5DTFB 4KK9D 1S2EA 4AW7A 2OXHA 1OQOA 3UO1H 4MD4B 4PW4A 3V5HB 3UJTL 3IGKA 2DQTH 4PJ9D 1B9KA 2CH8A 5LAXB 5J3HD 4QXWA 4G1MB 5FWRA 7FABH 3C87A 3F7YB 3NPSC 2WNXA 4KKRA 3CXHJ 1GPOL 1GZQA 1TJGH 3FU7B 3KXFD 3FPXA 4UM9A 4HZLA 5AAPA 4J4PC 2GEEA 3WI9A 3C60D 1S7UA 3ESMA 1MWAH 1ETZA 4UT9A 1SJHA 3NJXA 2DEYX 3QZPA 4XN5A 1EJ8A 1M71B 2DV6A 5FAAA 3AS2A 2YD6A 2MTAA 4FOMA 2HT3C 1JK8A 2YGNA 4MRBA 4QEGA 4G8EB 4ADGA 5AFAA 4XCYA 3OB0K 4RIRA 5E8EB 3WL9A 1EH9A 1RJZB 3HE7C 4IMKA 1W2KT 4JR9L 5ANME 2VW6A 3KZ8A 5DD6B 1KJMB 3HVDA 5C0AD 2DY2A 3KPMA 2CDGA 4LEXH 2Z91B 3SKOB 1XH1A 4RMRA 2MKLC 2LFGA 3CFDA 1MCFA 4R2GB 3QIBA 1DFBL 3B9KA 5TDOB 4LRNH 5K9KA 2DQJL 1PYWA 3OKOB 1BD2A 1IJ9A 3K3QA 4NO2B 5JIIA 3P30L 5HVGB 3LQZA 2IBGA 3GMPB 2EYRA 4L37B 1A6UL 3F62A 5DHMC 1FZJA 4LVOB 3V6ZA 4UUJB 4ZFOB 3HS0C 5CSBA 3VXSE 4PB0L 1MH5A 3QAQA 5HJDA 3S97C 1DR9A 4LSPH 4HULB 2VITB 4S1SL 2ATAA 1RXLA 4RVBA 2VXQL 4AQAA 1CVSC 5K33A 2CWRA 1BPLB 4DHLA 1ZHKB 3FFDB 2ZCKL 2ALAA 2PCPB 4Q9BA 3RTLA 3JWDH 4LPXA 3C8DA 3L3OB 5LQBL 1QWHA 1EO7A 2ICEC 3CH8A 4ABVA 4L0YA 1UWEH 2DJUA 3O11A 1LLAA 3U4BH 5LGYA 4G2AA 5I66B 1CDIA 2YUZA 2BVUA 5DJXA 3D0AA 1R34A 2N7SA 2GC4C 4JCMA 5CR8A 2CRZA 1MJUH 4WV1A 3PV7A 3NCEB 4CU6A 1URZA 1CDBA 5DJYA 3HG1E 5BRQA 3V4LA 2Q3XA 3G08B 4YXKL 1F4YL 3NIGF 4KY1H 2CU9A 4TVUA 2BPBA 5HVWA 2IC2A 3O6LL 4NEHB 1MCPL 4HEME 4MNQE 2HCZX 3RP1A 3VXMB 4XMTA 5A16B 2YO3A 4UQDA 1GS7A 4PJCF 4P3WA 3VD1A 4GT7A 1PF3A 4PJXE 5FYLE 4WFGD 4DCQA 3HPLB 3M1OA 3B9EA 3BZDA 4Z7WE 3TV3H 2EYTA 3NFSH 2YK1H 4FG6D 5FYKL 3ZKND 1U93B 2P4AB 3CFCH 4TNVK 3G6JF 5T33L 4PJEF 1IEAA 2Z4QB 5D4HA 2BNQA 1HZLA 4HKXA 4NFDA 3LEVL 2GEQA 4HWZB 5GISH 3K0WA 1BOGB 5I75C 4ELMA 1FWXA 3HTLX 5IZ7A 2QADD 4F92B 1FL5A 1TZGH 2Q1EA 2VL5A 3MGAA 3QUKA 4HPYH 4NIYE 4PJ7A 4Y2OB 4Q9RH 3EYSL 4LHQB 2IAAC 3OKDB 5CMAA 3BH8B 1NM9A 3MLUL 3OSVA 4OZFG 2PWGA 1ASOA 2J43A 2CQVA 3VXRB 1NUNB 1PCSA 1BFOB 2A9DA 3QXAA 4WWKB 3L16A 4UQ3B 4Y19A 5DT1H 5ESVB 4LRIC 4JL2A 1NDMA 1GOHA 4OF0A 2IAMC 1TQUA 1RZKH 5EZIH 2CM6A 5F7MC 2UUDK 4G1EB 1FJ1A 4EQ2A 3GHEH 3AT9A 1GS8A 3VI3F 3HE7A 2HJKB 5F7DB 3FCTA 1CG9B 4MAZA 3SQBB 2ZXWB 4Z7QB 2BP8B 3C08L 4OM0H 4W81A 4Q9CA 4Z3JA 4I87A 3MLPA 4RMBA 3NCYP 2YOCA 2NYYC 5DVPA 3FN0L 2ARJQ 2ZKWA 2VWEC 2OJZH 3QZLA 1RHHB 4WCYL 1D5XB 5IK3B 3RWGA 5L4JA 4MQXC 1G7LA 3P9MA 2D4FA 4S0TD 3RKPA 3FN9A 3GMNB 4U3CA 1MAKA 4G6ML 1JZEA 3HS0A 1A1MB 4E42A 5I1JL 3IN0A 4B5EA 2Q8BH 1FVCB 5E8OB 2Z93B 4R4FL 2QPFA 3HAEH 1QO3A 1IILE 2BZ7A 2CBOA 4BK8A 3HZYB 4A1RA 4E0RA 1JMXA 4FXKB 4YLBA 2ICEA 4IIQB 3S34H 4GP8B 2KZKA 2O5ZH 3BP4B 4C56E 4ZXBD 1BZQK 5DD0H 5E00B 1D5ZA 1I9RH 1IKFL 4HCIA 5D70H 5LWYH 5IHBA 2IJ0C 1ICTA 2X4UB 2PW1B 1RERA 3HG5A 2EDHA 2FE0A 1T04B 4P57B 3X3GL 3UPCA 1XT5A 3CVHB 3VH8A 2YMXH 5IMKB 5JIDA 5CBAB 3KLHC 4DP9X 4ZFOL 4FFZL 5JORA 1MFDH 2VABA 3CQQA 4DNLA 2D0FA 3NSYA 4PD4K 2WO3B 3AW5A 4XNYH 3D87B 4HC1L 1H15A 4XN9A 4BFBD 3VGAB 2DQEH 4GKLA 5I19L 3BVNB 3KLAA 2OTPA 4LLVA 4HUVA 4XXCC 2OYMA 1NFDF 5DUPL 2O61B 3G5VB 2BSTB 3HUJE 2DQFB 3BPCA 3EGDA 4D94A 1ZRUA 1I3GH 2DBLH 2QGCA 3L3OC 3NCMA 3TF4A 3LKOA 2I5YH 3E1ZA 2ISDA 5EF2A 2C1PB 1GSKA 4IDLA 4WI2A 4JZJC 1J10A 1A7BA 1ODUA 2A73B 2BH0A 2HG5B 3PU7A 1INEL 1QYGL 1EMTL 4UZUA 3BH4A 2CR3A 4JFFE 1E3XA 2WZAA 1OGTA 3AACA 4Z0XA 3VG9C 4ISVA 3VTTA 3MUGA 2H2PC 3PREA 4KMQA 5HYQB 5J89A 1S9YA 4WJ5A 5IKCB 3HN5A 4M3HA 1LD9A 4ONHA 3OVUB 1VZGA 4WI0A 4ETQB 1MI5D 3L3JB 4LRIA 1H8OA 1B4JL 1P53A 3DPDA 4G6FD 1KPRA 1I82A 4XN2A 3VI4E 4RISL 4AEHH 3NIDE 2QQNL 1OF0A 3VVWA 4EUPA 1F5WA 3NCBB 3U2IA 1G43A 2D9CA 1I9EA 1QHQA 2BSRA 1WIPA 1NCOA 1UGNA 1AGEB 5TH2A 3SDCD 1DBKL 1IU1A 1PG7H 2K70A 4NZJA 5DTFA 3SPJA 3KBEA 2MCPL 3NK4A 5FHBH 3QFGA 2VRKA 4MD4A 5AOLA 3V5HA 1SFHA 3T4AB 4X8GA 5E5MB 1KACB 3SPGA 4XMPH 1IC7L 4NCDA 5LAXA 5HHOE 1IL1B 3F7YA 3V52L 3V7AG 3PAYA 15C8L 4FNRA 3FU7A 3KCPB 2D7TL 3CAFA 2EDBA 4TOYH 5KZCD 4WUKH 1E67A 1NAKL 5JW4Q 5E24E 5DVMA 2NXYB 4LFHG 4YFEA 3UCQA 3MLZH 4N9OB 4AJYV 4L48A 4WWKC 3EOYG 3TVMD 3DXAD 3IPBA 2PP8A 3ILEA 2OSWA 1M71A 3SYOA 2OULB 4FQ1L 3U4EB 4Y16D 2PXYB 4G8EA 5E8EA 4AIOA 5B8CC 1RJZA 1EJ6A 3VAEA 3E7JA 4WO0A 4L5FH 5DD6A 1KJMA 3CPUA 1RZIA 3GJFB 4HXBH 5BUGA 4KO6A 1I1CA 3T3MF 2Z91A 3SKOA 5K93A 4FXGC 2MQ3A 1OGAD 3B8YA 4NKOB 4TQ8A 1YEJH 5DJDA 2K9FB 2BM3A 3OKOA 2WYTA 2G9KA 1E27B 1PKQE 4NO2A 1AJ7L 2JCCB 3GMPA 1NC4B 3OAYH 4L37A 1V3MA 2NR6C 2VQTA 4H1LB 3ZTJG 1HSBB 4UUJA 1AO7E 4ZFOA 3LRHA 5FW7A 4FFZA 3IFLL 5CILH 2D2OA 2AC0A 1DBMH 4PS8A 3Q05A 2VITA 4QHUB 4GRMB 4WW1B 4X6EB 4JO3H 2IWEA 4KGJA 4ODTL 4XXCA 2LAGB 2AANA 4YWGH 1ZHKA 3FFDA 5A2BA 4U1JB 2PCPA 3ALWA 4KKLC 1TTUA 4HC1A 2UXVA 1JFQH 3L3OA 4FXKC 4U0QB 1QVOB 2BHZA 4QRRD 4JZJA 3F85A 1IE5A 2Q86B 5I66A 2Q2LA 4DO5A 5GJSH 3UTOA 2E7MA 2IGTA 5SV4A 5T1KB 2B4CH 2O6EA 5AG8A 4WNJA 4EN3C 3ECQA 3FAWA 3CVHL 3WLWC 2VDNH 1Q72H 2F7OA 2WTOA 5E4OA 4NHCL 5JYLA 3G08A 4MBRA 1NGQH 5MEOB 1N12A 2VE6B 3ARYA 3VXMA 2F74B 4FYSA 4P5TD 4DFHA 3U0WH 1WAEA 4HCRA 3MCLH 2XN9B 4GI6A 4HV8B 3EXLA 5ICXB 4LQ1A 4D7PA 1N26A 1OARL 4NM8L 4IOFC 4MRCA 3S36L 1MQKH 4YHLH 3WMSA 3VXNB 5DWUH 3UTTD 3HPLA 3HRZB 5B7FA 3ZE2B 1NUFA 1U93A 1ETA1 3UTQB 3EJUA 2DQHL 2PO6B 1FO0H 1IZKA 2Z4QA 3T0DA 4U3XA 5D5MF 3DARA 1M4KA 4XVTH 4Y9EA 4HHAB 1C5BH 1XBDA 4HWZA 3DJRA 5GZND 5ACMA 5I5RA 1BOGA 4PM1A 1UJ3B 2FWSA 3II1A 1H3GA 1A7RH 5D2NC 3V0EA 3QG6B 2X1QA 2J6EH 2A99A 2CDEB 1UM6L 2KZBA 3TBSB 3F58L 3HC3L 1QBLL 4AZUA 3RUGF 2B8OT 3OKDA 1WFUA 3BH8A 4LVHB 5KTEL 4TLSA 5CCKL 4YFLI 4I0PB 2ZCHL 4YUEH 3VXRA 4UTBL 1BFOA 3ZHKA 2FATH 1PTZA 1XGZA 4WWKA 5ESVA 4UQ3A 4FYRA 4X5XB 1JPTH 1IEBB 1R75A 3EG9B 3MV7D 1KGUA 1XGQB 1F97A 3RJQB 2Q20A 4KROD 4LSRH 3EOTH 4JFSA 3O2DH 3GSNB 4G1EA 4JVWA 4TV3A 3OLIA 4FNQA 3OLGA 4FA6A 4LLMB 2ENJA 4OCYH 4WFFD 2IDFA 4TVPE 3RZCD 1OK0A 2HJKA 4XCFH 5F7DA 1CG9A 1DVQA 3ARBD 3SQBA 2R8SH 4D9RD 5J11C 1LVEA 2BP8A 1RIVH 1JPST 3FU9A 4ZFZB 4XB8A 5DEGB 4ZBJA 5FUZH 4F2FA 3GF8A 1CFQB 5ACLA 2CHXA 3MBEB 2IBZX 5DC2A 4A2MA 1MCWM 1RHHA 2AQ2A 2K6YA 3DECA 1W0WB 3KXFB 1HE7A 1BJ8A 1UD3A 2HB0A 2IBZY 4WSKA 4XXDB 3C60B 5IK3A 1KWGA 1F02I 1SY6H 2NR6A 4KX7A 5F70A 3PV6B 4Y88A 3GMNA 1QNZH 2VMJA 2BX5A 3QQ9C 4OLZL 1G9EA 1A1MA 3HFML 1N5YL 2V2TB 2EKSB 4GQPH 1O9VA 5DK0B 2HUEA 3FRUB 3ZR6A 3U7YH 3ZT7A 4BZ1H 5KUMA 3IRZA 4J3VA 5E8OA 2HTKD 2OJ1A 2NXYC 2MQ0A 2Z93A 1A25A 3QUMB 3VD2A 4HJUA 1RK1B 3CJJA 3U2JA 3IBEA 3HZYA 4QRPE 5L6YL 3BP5A 3ZKXB 1Y0LB 1P5VB 5F7UA 1L3WA 5D7LD 3L3HB 4KZDL 4FXKA 1TXKA 1JCVA 5I82A 3NFPB 1UD6A 3DX2A 4IIQA 3U4AA 5C0AB 3QJHB 3AM8C 2OCFD 3BP4A 3TCLB 1RV6X 5LG1A 1UENA 1G9NL 4Y4HC 1HAUA 3K91A 4X6DF 4WWPA 5E00A 4JGJA 4PWGA 5E8DL 3RJOA 4LPTA 1MREL 3P0VL 3V9CA 1X5KA 3ULVL 2O5YH 1LGVA 4FNSA 1PAMA 1KY6A 4F91B 3QDGB 4CJ1A 2X12A 1T04A 4P57A 4HOMA 3OMAB 4KRLB 3OLDA 3CVHA 5IMKA 1CLVA 1A14L 1P4LB 5CBAA 4C8XA 3JVGA 4XMVA 5LDUA 3AS3A 1QFWH 4AGMA 5FUCE 2VQ4A 5HJ3B 1OQXA 2VH5H 1BYPA 1IGCL 1DLFL 1TETH 5K59E 5C0BD 4UANA 3BVVA 4ICXA 3OR6B 4LCWA 1LE9B 3BVNA 1L9TA 3D33A 1AQMA 4BK5A 3LPGA 1RZQA 3BZ4B 2BSTA 4OGXH 2DQFA 4DH2A 2WOBA 2B1AH 4Q6KA 1F45A 4D0BB 3H9SD 2RQ8A 4MVBC 1AIZA 4JFUA 3S36X 1YY8B 2C1PA 4ZG1A 5D2NA 1HYRC 2A73A 4NZTH 2WAHA 1Y7VA 5EBWB 2HG5A 4ZO7A 2ZOWA 3DYOA 3HC4H 5IJBC 1WZ1L 3S9DB 1AE6H 3NP3A 3QDAA 2DMKA 2ITCB 5F1IB 1N9PA 2KS0A 1FL6B 2XNAB 5SWSD 1YMME 2IQ9H 5HYQA 2UZIH 1NEPA 5BZWB 2DLGA 4OF5A 5BZZA 1FNSL 3NDYE 3V8OA 5I6XB 5LG6A 1ITBB 4GW4A 3L3JA 1T20B 2J1YA 1INQB 4B5ZA 4DQOL 3U9PH 1L5GB 4UTBA 5IFJA 4PW3A 2I7OA 2Q7YB 3TIEB 3AADB 1VHPA 5D7IE 1HKFA 3Q2WA 5AVZB 2EAEA 4X9IA 5HHMD 2MMXA 1V54B 3ZL4H 3HRZC 3EDEA 1ZS8B 3AABA 3CVCA 4MCNA 5EUOF 1INDL 3OZ9L 1IAMA 3FQ1A 3SN6N 2PO6C 5AZ2L 2AQSA 5DDHB 3FOLB 2FO8A 2C9XA 1CB4A 1X5IA 1ZWIB 1IC5H 3QK0A 2GI0A 4LSQH 3IK2A 2C3VB 3MRLB 3OGOE 5CCJA 4P9HL 4G6KH 1RLBA 1D6VL 5E5MA 5I8OL 3H9HB 3QJSB 4YNYB 3QUZC 4OJDH 3L4XA 1OAXL 5J4MA 1IL1A 4NC2B 3NSDA 4L23A 1I7UB 3KCPA 2EZ0D 4LVHC 2BNRE 3LN4B 4IJTA 2IADB 4I0PC 4N2AA 4GQZA 1CL7I 5M94B 3PWUB 1D6EB 5CZKA 5LCVH 5JHAA 4RGOH 1C1EH 3FQXB 3GSNL 4WUUA 5LVEA 4BD4A 3AM8A 3U4EA 5DJ0B 3HA0A 1W8OA 1SVBA 2HSIA 4G7VL 5AYUL 4OCSH 1G6VK 2P3YA 2PXYA 2KC0A 3Q13A 4R5TA 4YGVB 1CF8H 3EDDA 3BJ91 3LRLA 4KK9C 3GJFA 1CDJA 3E2HC 4JFTA 3IGLA 5IFAL 3CLFL 1QATA 1E65A 1I8LC 2FX8L 4MZ2A 4UV4L 3ZHDA 4TNWF 5J3HC 4MTMA 5EBGA 1IAIM 1MEXH 1PX3A 4NKOA 4CN4A 2JKJA 3RWHB 3VA6A 1UOLA 3TPUB 2K45A 4JUSA 1E27A 4D0CA 4OGQC 1P6FA 2F5AH 3LKPB 1C5DB 3C60C 2JCCA 1NC4A 4R4BB 4OZFB 2WBJD 4N2DA 4H1LA 3VQ1C 1G7IB 4B3EA 1HSBA 3QJOA 4EMZA 1TQCC 2HFFB 3LNGA 5C6WH 2PP9A 1SEQH 2BJMH 3ATDA 4QHUA 4GRMA 4WW1A 3INUH 4N0UE 4X6EA 2CIIB 5CUSL 5B7EA 1YMHB 4JFYB 5DMKB 3AG1B 4U1JA 3DVNB 3PIQB 5HY9B 1TNMA 1NAMH 3ZKXC 1A7NH 3O8XB 4DO4A 2W1NA 3KS0H 1QVOA 3WEMA 1NIBA 3D0LB 3AWEA 5DFTA 1HHJA 2JQAA 1R3IH 1QRKA 2Q86A 4PTUA 5ADOL 3ROOB 2PUQT 5HHXL 5T1KA 2X6MA 1XX9C 5DC9B 4G5AA 4L4TD 4MMXB 3BQVA 4JHVA 1J9CT 2QJDA 2ORBH 3N43F 5EEXA 1X9QA 3IPEA 1HHIB 2DYSB 2ADYA 3IU4H 2HKFL 3LEYL 5MEOA 2VE6A 5D1QD 3ML9A 4JHAH 2F74A 4KY2A 5T5FA 1GTNA 2CRYA 2XN9A 5ALBH 4HV8A 1LO2L 2N3JA 5D71L 3U6RB 3CHXA 4HBCH 5ICXA 4X6BA 3MCKB 3BUDA 2JNZA 1UFGA 3VXNA 4UZGA 3R1GH 1K3ZA 1KCLA 4MMYB 3HRZA 1LEIB 3ULUE 1QAWA 4BWTA 1EX0A 3UTQA 2XWBB 2XLLA 1WGOA 4XODA 2PO6A 4UDUB 1EFXB 1KXVC 3E8UL 4TSCH 3ZZLA 2C5DC 1PAZA 1WFMA 1HESA 1SMAA 3V4PB 1RMFH 3QQ4B 2IH9A 4QHKI 1U0QA 2CDEA 1BZDA 2OMUB 5IOKA 2VL4A 4CMHB 1OPOA 3TO2B 2EDOA 1T4KB 4GFTB 3IN2A 1F4WH 4G6FB 5B38G 8PAZA 4UCFA 4PRDB 4I0PA 2IH8A 1GMIA 3EUDA 3IEAA 5C3LD 1M7UA 4YSCA 5I6XC 4X8JB 1YEEH 4X5XA 5DJCB 1IEBA 4YXLL 3EG9A 4M93B 2GI7A 2GW5A 32C2A 1XGQA 3TWCH 2P45B 3HE6D 2HTLD 3BYYA 1JERA 1LP9F 4FG6C 3ZKNC 2AXWA 3VACA 2F7IA 4LLMA 1A3LH 4XBPB 2FYYB 4A6YH 4ELMF 5D93C 4H0IA 3BVDB 4NUGH 2DLIA 5BO1L 4ZFZA 5DEGA 1ET7A 1KLUB 2AJ3B 5DI8B 1OOAA 2N56A 1CFQA 3FDWA 1A22B 4B3VA 2WPGA 3MBEA 2XWCA 1GGCL 4PCSA 3U9WA 1IVTA 1W0WA 1DO6A 3KXFA 1BQLL 4GAAA 3DX7B 4XXDA 3C60A 3CFMA 5DUML 3PV6A 4MJIE 2HLAB 4ODUA 2COVD 1WH0A 3C5ZB 1XSOA 2JFCA 2V2TA 2EKSA 4M6AA 3FRUA 4Y1AB 3RGHA 4G80B 4AQEB 1HQRB 3ORJA 4A55A 3SPHA 3QUMA 1CZ8L 4N26A 4XNXL 4B50A 1RK1A 2KPNA 3L54A 4PREB 3DVFA 2MRYA 1YEKL 3PWPD 1Y0LA 5KVFE 1P5VA 3L3HA 4N2OA 2WLMA 3NFPA 1CL7L 3RHWF 5C0AA 3QJHA 2YRLA 3B7YA 3EYUH 3TCLA 4DP4X 1UCTA 4OZGA 4BRJA 3FONB 5IHUH 3V6BR 1PJ9A 2C4FU 2E59A 3BDYH 5C07D 4OJCA 2EVGA 3VXUD 3F7RA 2J88H 4IIZA 4LP8A 2XUWA 2DQGH 4MQSB 3FTSA 4RQQB 3HHSB 4W9HC 2BFVH 3FTWA 3QDGA 1RUKH 5HJGA 4OU3A 1R46A 2QEJA 4BWUA 1U3JA 1P4LA 2AK4D 1H3VA 3IXTA 4PU2A 1WWBX 3UJTH 4Y8DC 4KNQA 4MJ2A 3LH9A 1DQVA 1W8NA 4G6AD 4I18C 4ES8A 1NIDA 5IWLC 1DQTA 2Z7UA 5ECJE 5HJ3A 5BQ7B 4GKSB 5I1IH 4GAJH 3BFWA 3KE0A 3OR6A 3S98A 1LE9A 4AMKL 5DLML 5EU3B 5KVEL 4ZXBC 4J3SA 3BZ4A 3O0LA 1EVTC 1KXVA 2QV4A 4OF7A 4BUHA 3I6SA 3GXMA 4D0BA 1JRHH 4NXSA 5BRZE 3RNKB 4XCCL 1OALA 4NQEE 3C6SB 3L1GA 1E8ZA 3LZFL 3CVIL 3K6NA 5EBWA 3QEQE 5IB1A 3N85L 3HBQA 4JR9H 3REVB 1PVHA 3QZNA 1UWXK 4JFPB 2ITCA 4P5TB 5INDB 3FTZA 5F1IA 2XNAA 1FL6A 3AUWB 4Y5VB 2FQGA 2WXHA 5BZWA 1DFBH 1CS6A 1JYWA 4HQQH 1UT2A 1G6RL 1T20A 4MXVF 4HJ0D 4KI5D 1INQA 1ZGLP 3SGKA 1PLCA 1L5GA 4NXKA 1QSVA 1E2ZA 3L3DB 3P30H 4LP5A 2EIMB 4NENB 5GS2D 3X11B 2Q7YA 2WXJA 5AENA 3TIEA 4YZFF 1CYXA 4FD0A 1IFGA 1GCYA 2XDHA 4X0KA 5EULV 4FNPA 4A7VA 4Z3HA 2YBRA 4S1SH 2XC8A 2PPDA 2VXQH 1ZS8A 1L9NA 1QUPA 3KPRE 4ODWB 5FC9A 4CW1B 1DCEA 1XTMA 3V4PL 1DBJL 1OD7A 3QUXD 3VWJD 3EHBD 4AGLA 5DDHA 3AUVA 3FOLA 4JPWL 3GHPA 2JLPA 3R8QA 1ZWIA 2C3VA 3MRLA 1G9MC 5BOPA 1KBPA 1FGNL 1X7QB 4G8GB 2FK9A 4GIOA 3GBDA 3T65B 3FF7A 1KGXA 4PGCB 5DWPA 4YNYA 4NWTL 4HG4K 2E9WA 3UO8B 4FP8H 4R5XA 1FYTE 4KXAA 4DW2H 1A0QL 2MNWA 3TP4A 3EFOA 3MV7B 4GEIA 3ARED 3C09C 4KK8D 3LN4A 1FN4B 2X6AA 3EBHA 4FYTA 5F9JB 3GBML 1D6EA 1LYQA 4YXKH 1QI5A 4OY9A 3BPOC 1NQBA 5EFIB 3EDFA 4AENB 2V5TA 4QHNB 3FQXA 3ZSSA 5J1TC 1MCPH 4M93C 2WSPA 4GLRI 3QO1B 2Q7AA 3ARBB 2WZPD 4WHYH 5DJ0A 5IBUG 1F6LL 5KW9L 2V0AA 1XF3B 1JAEA 1QRND 4AWJC 3J2PA 2IH3B 2YQBA 5KUKA 4Z7NB 5DRWA 4YGVA 2NYKA 3RAJL 2VR3A 2SODB 1PX4A 4P4KB 3L4VA 3D3VE 4QR7A 1YEHL 3L9RB 1JXGA 2WBWB 2JJTA 2LAAA 3EJZD 5A6IA 1SUHA 2NX5B 1G7HB 3LEVH 4ZTOH 2VDOH 1TZOA 3GKWL 2JCWA 3RWHA 3TPUA 1MCJA 1CGSH 1E8XA 4XXWC 1OAQL 5JXED 3LKPA 1EV2E 4MAYB 1C5DA 4U1MB 4FFWC 2FUQA 1JTPA 2X0WA 4R4BA 5E2WL 4OZFA 1G7IA 1U3YA 4PN6A 2R9HD 3EYSH 3T0WA 4HD9A 5GZOA 4XC1H 3TVMC 1JDAA 1ECZA 2DI8A 3EH3B 1FORL 1X6LA 3C6LD 4NN5B 1BFVL 4P3DA 4ZS7H 1TZIB 1RU9L 5GGVY 5L8KB 1KEGL 4NZRH 1MCCA 1MJ7H 2HFFA 2PTVA 1BJ1H 4QHMB 4XB7A 4Y16C 2QPEB 4ZUTB 1A4AA 1YMHA 3FH8A 4JFYA 4NUJB 5DMKA 3UEZA 3ZUCA 3DVNA 3PIQA 4XR8C 5A2AA 5I0ZA 2Y06L 3O8XA 4KRMB 4FKHA 1WD8A 3D0LA 2WKOA 3VWKD 4HLZH 5DHEA 4J2XA 3CFIC 4UDTB 4X8CA 5TQ2L 4NQXB 3S8WA 5KSUB 3CE1A 2WZ0A 2R0WH 3DK2A 4RDQG 3VU1A 3GM8A 1NLDL 2P1YA 1BZOA 2VLRD 1KGCE 3PQYB 4LVNB 4MMXA 4PS3A 1U3HB 3UYRL 2XG5B 35C8L 4WI7A 1HHIA 3FN0H 5CO1A 2CAKA 5JLZB 1E7VA 2HT4D 2LU3A 3GLDA 4HLJA 2GIXA 2ICWI 3B1UA 2IEPA 4JHWL 4WCYH 2HVKB 3F2LA 5FGSA 4JCWA 4YS4A 3BSHA 1OT4A 4HUMB 4HD5A 3G9AB 1X4ZA 2MPVA 4V33A 3WLBB 3U6RA 3MCKA 4G6MH 1CI3M 4R90L 5C7ZA 3WD5H 3MV11 5I1JH 3GUFA 3AXHA 4JJOA 4PJDE 1GOFA 4MMYA 2EDKA 1LEIA 4R4FH 2BSSB 3ARFB 3IWVA 3SBRA 1ZHBB 2XWBA 3CHOA 4AM0Q 4UDUA 1EFXA 4QGTA 3NTCL 4IU3B 5AYQA 5J06A 1O5PA 5D2LE 3VW3L 1JZJA 1P1ZA 4HWEL 1PZBA 1A8ZA 1ZD6A 2ED7A 3V4PA 3QQ4A 4BCXA 3HZ3A 4P2QD 5FYJE 1GYCA 2OMUA 3SDXE 3US9A 4ABUA 3NSCA 1AAJA 4UOZA 4R96B 4JY6B 4DGIL 4EI5B 5DSCB 2HX8A 1RVFL 4P5TC 1YC7A 2O72A 4PRDA 5E9NA 5DC0A 1EO8L 1A4CA 2X89A 3F5WB 4DFIA 3X3GH 4X8JA 1TNNA 3WFZA 2JSFA 4YBHA 5DJCA 5JDSB 4K5LA 3SD5A 1TVDA 1G1CA 3DX0A 4MDJB 5HHMB 2OR7A 1MFAL 4ZMOA 5CLXA 1UXSB 3PJSB 2BC4B 3LPWA 5IQ9B 1Y1UA 2DQUL 5HYJE 4XBMA 5ISZD 1QPKA 3FUEA 3KL0A 4XBPA 1O6SB 2VGLM 2XBZA 3DUUB 1CN4A 2EIBA 4HC1H 5ALCL 5J5EA 5GZNC 4HWUA 5I19H 2QKIC 1OP3K 5DUPH 1KLUA 5DI8A 2CJTA 1FE8L 4MD5B 3R4DA 4QRQB 3GXTA 4XXWA 1XBRA 3DX7A 1IFRA 1AFVL 2CJUL 2M83A 2V5SA 3WO4C 2L04A 3E3QC 4OQTA 2Z4TA 1MELA 3C5ZA 3D30A 4J7RA 2W91A 4WQOA 4B96A 4YXHH 4UQ9A 3BAWA 4KROC 4HOZA 2NOYA 4G80A 4AQEA 1HQRA 1ZAGA 2BHUA 3Q2CA 3RBGA 5FFGA 4PREA 3NJVA 2XKUA 1B4JH 2W94A 3CFJB 3RZCC 1T7XA 4QMEA 3ARBC 4XNDA 4JG1H 4RISH 3H4FA 5GRVK 4A68A 2W80C 3FONA 2D3NA 1AZRA 1NIEA 1II4E 1S7XB 1IIKA 1THCA 3RRQA 5GRXG 4K23L 1ZCRA 3TLRA 5D6DC 1CD9B 4I9WE 1TJHL 3F6LA 3VRIB 4RQQA 3FHQA 4RAVB 3HHSA 3WIHL 3OG4B 1DBKH 1D5RA 5EU7E 1J0IA 4E9SA 1P4IL 3ZXAC 2XG4B 3N1MC 1N6QH 5AVVB 4RDBA 2MCPH 1E6OL 3WELA 4UINL 5IQ7L 2ZUVA 2ESVB 3H6AA 1K5WA 3FHEA 2XV3A 4AG4H 2HTKC 4M7LL 1QASA 1S7VB 1A4JB 1IC7H 3R19A 1FH5L 1JWUB 4MMZB 1BVNP 5IIEB 2AMGA 3V52H 2F53D 5BQ7A 4RGNE 4N2KA 4GKSA 4NN5C 3K6DA 3TBYB 3VD5A 4FULA 4BINA 3LZRA 2Y7SA 1NAKH 3VGEA 5B22A 4DP5X 2X3AA 1G9HA 1D5BB 5EU3A 1KYFA 2NLJB 3NABH 4E9TA 1TIUA 5F0MB 2EIZB 3UOAB 2D2CC 2X0VA 1LO3L 3RNKA 4KUCD 4DKEL 3C6SA 1PBYA 2HH0L 2X9XA 1DDHB 1JGVL 4N86A 3WKML 2HWZH 4HYTB 4IGBB 4U6VL 3OV6A 1FFQA 5CS7A 3REVA 4HK0B 5D1QB 1BG1A 4JFPA 2K0RA 4P5TA 5INDA 2WQRA 4OI7A 4MFHA 5T3ZL 1Q9OB 2Z64C 3MOAL 1NBCA 4CN1A 3DYMA 3VE0B 3DHJA 3KW8A 3MSPA 3PY9A 1CGTA 3F04A 3GSXB 4HJGB 4JNXA 2WXPA 1AJ7H 3X11A 3L3DA 4NENA 1QMUA 4OLVL 3ARUA 3ELQA 3REWB 1KGJA 3WEAA 4PRHE 3UXFA 2O6PA 4G9FD 5CN2A 2JJSC 5GZNA 4CDHA 4XVUC 1TQSA 4ODWA 3QJTB 4CW1A 2A77L 3QH3B 5TFSH 1IFHH 1QSZA 3RVTD 4DP6X 2CPUA 1EUUA 3CFQA 3WY3A 2DD8H 1A7PL 3C75A 2HMID 4Z7UB 1X7QA 4G8GA 4MYWB 3TM6A 1TYJA 4XWGL 3T65A 3TBCA 2X87A 3K6FA 4OGYL 2X1PA 4TPRL 4LDCA 3MV7A 1B3IA 4RCAA 2ATPB 4HAGA 1RULL 3ABGA 1CLYL 3HE6B 2FJUB 4P99A 3KBHE 1FN4A 4NHCH 2NY2D 2JI2A 5F9JA 3N0PB 2FGWL 5EFIA 1B9ZA 4AENA 3B34A 2WUCL 4JPQA 4TRPL 1WZAA 4WU7B 3SSGA 2OK0H 3ARBA 2H1XA 1TLKA 3T1FB 4U2ZA 3V0FA 1NLBL 3C9NB 1C8QA 3SGDI 1XF3A 3B5HA 5AOIA 1J5OL 1OARH 2IH3A 4NM8H 3FKUS 4R7DB 3S36H 4X4YB 5DHVB 4LSVL 5D6DA 4ZW7A 5CJXA 3NIGE 2R0KL 2J1XA 4X6FB 4LPVA 3OJDB 1YO4A 3M7FB 4QOKB 3POHA 3IAGC 1MQ8A 1V3LA 1X5HA 3RQ3A 1E3FA 2NY0D 2NX5A 5FLUA 1G7HA 2Z8SA 1MY5A 3CFKB 4L8CB 1DVUA 3WIHA 5C0CD 2EDWA 2WSKA 4C47A 2EZ0C 3KGTA 2PPEA 5D1XE 4RZCB 4MAYA 5B38B 2WXQA 1UM6H 3DV4B 4U1MA 1XR9B 1X5GA 5DHXB 3QNYB 4NN6B 3HC3H 4Y9CA 3G6JE 4GG6B 3PWPB 4NO5B 4J3BA 5BW7C 1TZIA 2VDPL 5CCKH 3AB0B 5KTEH 2XVGA 3MGOA 1F0LA 2ZCHH 4QHMA 3KL5A 1EXUB 5I28A 1PG7W 4L4VD 4ZUTA 4NUJA 4NOFA 2CE6A 1URIA 4PWKA 2XJKA 1TITA 4LO9A 3ZIMA 1OD9A 3PJLA 3VXUB 3GM0A 4JRXE 1PIFA 2Z9TA 3FRPG 4N0FB 4NQXA 2FT6A 4GT0A 5KSUA 4E9VA 1SUJA 5C6TH 3I02B 5C70A 3M88A 2JCCF 1M7DB 2WXFA 2H0FA 2XG5A 1RUPL 4HIQA 3QEHB 4PRPB 3D39B 4LSDA 2WBJC 3ZDYF 5JLZA 2BERA 2A4CA 2FZ3B 3VI3E 1UACL 1ZSHA 5C0BA 4Z7VF 2HVKA 4DIXA 4ANUA 4TQPA 3RI5F 4Z7OB 3B2VL 5AVUB 2LLNA 3WLBA 1L9RA 5JYMA 5L4IA 3V2AR 3WOVA 4OLZH 1G7MB 5F89B 1N5YH 1BJMA 1LK2B 1IAOB 1XF5B 3PXLA 3FYEB 3AU1B 3CMGA 2QQLL 2BSSA 3ARFA 3IDYB 1NFAA 2VO8A 1ZHBA 5AVRB 5L6YH 3QARA 1ZIAA 4AEIL 5IV2B 5F1KC 2B3RA 4IU3A 4KZDH 3VSUA 1UXLA 2J5LC 1V3JA 2OR9L 3OMZA 4UILL 5MP6H 4MB4A 2R2CA 3ZE1F 2YUXA 1EDQA 4L8SB 3VJ6B 3OGCB 3K81A 1MHPL 3Q9QA 4R96A 4JY6A 5DSCA 5D1QC 5E8DH 4AK2A 4MCZB 1U33A 1E8YA 1BQSA 1AG6A 4W9IC 5EOCJ 4YK4B 3ULVH 1XL4A 3F5WA 3OKYA 5DUBB 3VD3A 3ZO0A 1DN2A 3OLEA 3GINA 5KVDE 4RMQA 4H1LH 1A14H 1S3KL 3ABMB 4DP2X 4F93B 4OCRL 1KLFA 3ZE2F 5JOEA 4MDJA 1TQTA 3CWGA 4FQJL 4PY8J 4M43L 4QHLB 1UXSA 3PJSA 4U4BA 5IQ9A 3MV9E 1VFOA 4QRBA 2F0CA 4AUJA 5J12C 5A2LH 2XJLA 1IGCH 1OW0C 1O6SA 2JWYA 3EHBB 2GIYA 1QUNB 4Q4IA 3DUUA 1GY2A 1UZ8B 2VIRB 1P7KB 5H37G 2OI9C 1S7SB 2Y7OA 1LWRA 2UX7A 1JTTA 4QRQA 5HDQL 4EI0A 2P5WB 3JWNG 4HZAA 3PABB 2ZOTA 1S5HB 2LHAA 3HPJB 3LRGA 1FA4A 2YAOA 1NBQA 1KB9J 1GGUA 1WZ1H 1A47A 4UM8B 5BW7A 1KEMH 3HE6C 2HTLC 5TPWH 3WFCL 4HU8A 5FPIA 2PWFA 1FNSH 3ME0B 1QRNB 2NT0A 5C08D 1ET8A 4PY7B 4OKDA 3CFJA 3QNZB 4OTXL 1ETB1 1AQDB 5G4MA 5CZVL 4JPIB 4RGMB 2AJSL 1U8PA 2HPOA 4NERA 1I85A 3V4UL 1BEYL 1QTPA 3AMKA 5BRPA 1QFUH 4B7IA 1N7MH 1S7XA 4PBXA 3V4VH 1YJDL 2X4OB 3ZQ9A 3H55A 2ZSWB 1I1YB 1E6JL 1QLRB 3VRIA 5JTWA 5DJ8B 4RAVA 4XC3H 3L9BA 1INDH 2YN5A 3OZ9H 1ZE3H 3GRBA 1J1XH 5AZ2H 3U36B 4WVRA 1GJWA 4L5FE 5F7FA 2XG4A 4LL9A 3SE3C 3T2LA 1K6QL 3DWTA 1OY3B 2ZQKA 1YEFL 1D9KB 3C6LB 4JN2B 4P9HH 1M53A 2ESVA 5HDBF 3LKRB 3TYFB 4MXWL 1D6VH 5EEZA 5I8OH 4XP6H 3UAJC 3B3IB 1S7VA 1A4JA 3DJSA 3LZNA 4MMZA 1JWUA 1OAXH 3FFCD 4NN6C 5CSZB 5AEAA 1JZIA 3FUHA 1GC1C 3TBYA 4PS4L 5DK2B 3ZMNA 1IT9H 4OZGF 2Y5QA 2Z7WA 1KCBA 1OE1A 3FTGB 3K8KA 3H8NA 4X2UA 4G83A 2EUXA 1D5BA 4H0LC 1ZVHA 5IBUB 5DD1L 2NLJA 1SMOA 2D31B 3GSNH 1NPJA 2EIZA 3FYIB 5C3IA 3D08A 5I1GL 2VLRB 4EE2A 2MHAB 2DTML 2VN4A 1U8OB 3O6KL 1ITCA 4G7VH 4N0CD 4UOW0 5AYUH 2ZUWA 3KG5A 3FUJA 3BCDA 1DDHA 4IGBA 5B3SB 1AQKL 2YGOA 1WVZA 4LQFH 4ONOA 2A4ZA 4HK0A 4N5ED 5D1QA 4WTQA 2EXSA 3NQIA 4TNVF 3WTTA 5IFAH 4A67A 1WZKA 1J12A 5F6IB 3CLFH 4G6AC 2FX8H 4UV4H 1Q9OA 1SJMA 1VEMA 4ZODA 5J9PB 2V2WB 4JVUA 1HINL 3UYOD 4JVPA 3CXDL 3VE0A 1H3XA 3MV01 3GSXA 4HJGA 2C3GA 3RVUD 2IFFH 2B1HH 1A1NA 1ONQB 1WA1X 3T3ME 4N68A 4O4YL 3REWA 4LIQE 1KTCA 3EZJB 5T1DL 4KV5F 1OW0A 3AS0A 3PP3K 2E7CA 5TQ0L 3UTPD 1XHHA 2G2PA 3V0WL 4YSUA 5FECB 1UKTA 3CHPA 2MJWA 4DK5A 5C6PB 5AVSB 3QH3A 4Q2ZB 2X4RA 2Z7YA 4NBZB 1Z0NA 2YIHA 3JV0A 2X9WA 5DMIL 3ARDD 2RA1A 5ADPL 1U36A 5BVJB 4Z78B 4Z7UA 3ETBF 5CJOL 5ADOH 5IUCA 4L8SC 1YQ2A 3UGEA 2ED9A 5A6MA 5HHXH 3GSQB 2UY7B 4HJ0C 4KI5C 2ATPA 2LLGA 1IQDB 3HE6A 1ROWA 3L7EA 1OM3H 1KB5B 4XHQA 5AAWC 1NPUA 4CSPA 3SD2A 4HKBB 4KZ0A 2HKFH 2GBTA 3LEYH 2BO0A 4UNVA 1RPQA 3HW7A 1M1SA 1WEJL 5EC2B 4WU7A 4TYUA 5ENWB 3W9DB 4D9LL 3MO1B 4OR1A 1CD1B 4LSSL 4HAFA 4JN1L 3T1FA 4YDLB 2ZUSA 2CCWA 3C9NA 3J07A 5D71H 4A66A 4MJ6B 3L3GB 1HKLH 3QUXC 4R7DA 3VWJC 3EHBC 1HIML 2JKWA 3NN8B 4X4YA 5DHVA 3GRGA 3R0NA 1CXFA 4QY8B 3SB3A 1AZVA 4X6FA 4HGKC 2AQQA 1BP3B 2OSXA 3OJDA 4QOKA 4F9PC 2ZXAA 4B97A 3E8UH 2QSTA 3VSVA 5HSFA 1BGXL 3LN5B 4FS0A 3CFKA 4L8CA 4JM4L 4P5KB 4H8WL 2B7DT 3AREC 2VXTL 4KK8C 3S35L 2R29L 2LE9A 3DHPA 3IWUA 4ANVA 4NQCB