1B4TA

H48c yeast cu(ii)/zn superoxide dismutase room temperature (298k) structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHICEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structure-based mechanism for copper-zinc superoxide dismutase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords PROTEIN (CU/ZN SUPEROXIDE DISMUTASE)
total genus 37
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1b4tA00
2R27A 2WZ6A 1E9PA 1SXCA 4A7UA 1YAZA 3QQDB 2E47A 3SODB 2WYZA 2Z7UA 2VR6A 3GQFA 2GBVA 5CU9A 1CBJA 3CE1A 1F1GA 2WWOA 2ZKYA 3HOGA 4MCNA 5KBLA 1OALA 2XJKA 1E9OB 2C9VA 1JK9A 2AQPA 3CQPA 1EJ8A 1IBDA 1YAIA 4OH2A 2SODB 2WZ0A 1IB5A 3GZOA 1TO5A 1YSOA 1S4IA 3GTVA 2C9SA 3K91A 1SXSA 2WWNA 2NNXA 2JCWA 5KBMA 1E9OA 3T5WA 2VR8A 4N3UA 1HL4A 2AEOA 1AZVA 2WZ5A 3KH4A 2AQSA 1U3NA 1KMGA 1Z9PA 4MCMA 2APSA 1N18A 3CQQA 3HFFA 2WKOF 3KBEA 1SXBA 3KBFA 3ECVA 4A7VA 1F1AA 1SXAA 2LU5A 1DSWA 1B4LA 1P1VA 4BCYA 3S0PA 1QUPA 5KBKA 2WYTA 1MFMA 2AQNA 1XTLA 4BCZA 3GZQA 1BZOA 4OJAA 1JK9B 2XJLA 1PU0A 2K4WA 1SDAB 1SPDA 4U4IA 4A7QA 4A7SA 2C9UA 2AQQA 3ECUA 1B4TA 1UXLA 2ZOWA 3KM1A 3L9YA 1HL5A 3LTVA 1OZUA 3PU7A 2GBUA 1IBBA 1OZTG 1EQWA 1Q0EA 2ZKWA 2Z7WA 1OEZW 1E9QA 3MKGA 1IBHA 4FF9A 2V0AA 2Z7YA 2Z7ZA 1ESOA 3KH3A 1F1DA 3L9EA 4A7GA 1UXMA 1PZSA 2AQTA 1L3NA 1SOSA 3GZPA 2VR7A 1SDYA 4B3EA 3F7KA 1TO4A 1IBFA 1DO5A 1SXZA 2AF2A 1E9PB 2ZKXA 2AQRA 1CB4A 3GTTA 3MNDA 1E9QB 1COBA 1Z9NA 3QQDA 4L05A 3RE0A 1XSOA 1FUNA 3H2PA 3HW7A 1JCVA 2GBTA 1SRDA 1RK7A 3H2QA 3KM2A 4N3TA 2E46A 1F18A 4BD4A 2WKOA 4A7TA 4A7GF 1N19A 1SXNA 3F7LA 3ECWA 1BA9A 1OAJA 1XTMA 2JLPA 2Q2LA 1PTZA
chains in the Genus database with same CATH superfamily
3IDGA 4BQBA 3ZZLA 1FORL 1L7TL 1P7KA 3ELAT 3ZHDA 2ZYIA 1KIPA 1PZ5B 5JHLA 1CGSH 1KB5B 3Q9QA 4K5MA 3KVQA 2R7EB 2WYZA 3BAWA 2XSKA 1EDHA 3KR3L 3J7HA 5H37A 1FGNL 4XTRC 1NFIB 2IGLA 4HKBB 1YJDL 2VDRH 4JRYB 3TNNA 4U1HA 2B9BA 2BO0A 2NW2A 3P73B 4LVOC 3V0HA 3GF8A 3IN0A 2BWQA 3S36L 4DF9A 4OAWB 4AV4A 3FYIB 4M56A 4LOUC 1J5CA 3B5HA 3AMKA 2NT0A 3PS6A 1XL6A 2H26A 1CLZL 1DUYB 2FRGP 3PHAA 1NBQA 4GMSL 4I0KA 1N64L 4POZD 3PGDA 3QA3B 1E5AA 4Q9RL 1F45A 3GTVA 4WY7L 5DHYB 1JXJA 1PZDA 1IKFH 2AJSL 4HJIA 3MLYL 3L1FA 3L5WB 5D2NA 1ONQA 2X38A 4GH7B 1KJVB 4CW1A 3M8OH 1UACH 5GRJL 3WY4A 1FJ1A 4Z9KB 5BO1L 5D2LE 2JKXA 1UFGA 1U30A 5DWPA 4U6HA 1INDL 3FUEA 5J11B 2F9BT 2N0MA 3EYUH 2RTTA 3NCBB 3ZIYA 1NFDE 1T66C 3IDXL 3WIFB 4FKKA 4OJAA 5DZLA 5BXFA 2OMWA 3SY0B 2RGSA 3SJVB 3P3YA 5F1NA 4W9EC 5I5MA 1VZIA 3DUUB 4HLJA 4PP1C 3CH1B 1T2QH 4U1IA 1E27A 2F5AL 3SHSA 3QHFL 4PLNC 4PGBB 1EERB 5E2JA 2X4RA 4PGDB 3KLHD 5I6MA 1UM5H 4ZUTA 3PGCA 3AXIA 1Z0NA 3EJSA 4P2OB 1UM4L 4MB5A 4UOW1 3LNIA 1TZIA 5I0ZA 2OCCB 1EEUA 1TZAA 2XVGA 3DPDA 5AW4B 1MFEL 1SDYA 2VL5A 3FQXA 1TO4A 2HX7A 3N6YA 1WAEA 3K71A 1J9RA 4HJ1A 4NP4L 4BKSC 1AQMA 3RYMA 4Z7QF 2GJZB 3MJ9L 1ROCA 4X4ZA 1IGIL 1MCRA 1NJ9B 4MMZC 3QQ9D 3IJ7A 3QJQB 4BFRA 1LWHA 3BD4A 1D9KD 3G08A 5DD3L 4ZUTB 5DRNB 6TAAA 3NA9L 3VI3F 4LPYA 3T2LA 3VWKA 4CMMB 2AK4B 2IDCA 1VDGA 4YBQC 4U1SB 2UY6A 3S3DB 1Y6MR 2DKUA 3FUHA 4BJLA 3TBSA 2ICES 3B7SA 3P30H 3QEQA 4FA7B 1QZ1A 3HS9A 2Y23A 1TZHB 1PMYA 4KK8C 2E9BA 4RGMB 1JZDC 2MHAB 5JO5A 4JAMA 5JQIB 1U4EA 4LIQH 4A6YH 5A2FA 1EMTL 1BYPA 1KGUA 4QPEA 1Q72H 4B9GA 1W72A 2FB4L 2HH0H 2NY2C 3ABGA 4Z7WF 1OALA 3GSWA 5F3HB 4TPRH 2DQEH 1AZCA 1X5ZA 3BQUB 4Y2DC 3GO1H 1IGYB 4G83A 2WUBL 3IJHB 2B1HL 5FK9B 2ESVB 3MLXL 3VFUB 2O5ZL 3VCLA 3MOBL 1KJVA 4QHLB 1RUPH 1TTAA 3H9SE 2PWHA 3TNMB 3HS8A 4S1SL 1A9EA 3PV7A 4HWBH 4OCRH 1PVHA 4W6XB 3U46A 2E8YA 1IC4L 3BEWB 1AZVA 5DR5H 2QFPA 1CYXA 1NGPL 4MS6A 5LO7A 4WEBL 1GSKA 2X4TA 3DSNA 5GGVH 5DRWB 5AFAA 4L8DB 5IF0B 4APQC 3EYSH 4HSAC 4QHKJ 5C09D 5D9SA 3HHSA 2X89D 3FKUS 3GMMA 1L7IL 3QIBC 4LF3A 4KHTL 2D3JA 5ITBH 3GIVB 1GY1A 4QHUA 3A3YB 1DVYA 1X4YA 3QR2A 3EXLA 4R26L 4XT1C 2WP3T 4TMPA 3LH2H 4M5YH 4YGVB 3TXAA 2Y72A 2CMRH 4KKCD 4G7YH 4Z95L 1HH6A 2HX8A 1AYRA 3HZMB 2MOQA 1W0VA 1OZUA 4RDQF 2K70A 2EC9T 3HBPA 4W9FC 1U8KA 5F0JB 3U7AA 1FZJA 3KPSA 4L4TA 1BF5A 5I1LB 3CG8A 3FUDA 3ZQWA 3C5JA 4J3OG 4UT9A 2FYYA 4JG5A 5HHOE 1P84K 1C08B 4UT7L 4KKAC 1GIGH 1EA9C 1N4XH 3US0A 2O93L 3BEVA 1J0JA 1A6VL 2BIIA 4KJYB 4PWFA 2ZF9A 2E0PA 1JHLL 4U6YA 4CRPA 1IAIL 3HG1D 2B0SH 5E4EC 1ASPA 4MQXC 3ZO9A 5AAMC 3QZPA 1FUNA 4H2CA 1WAPA 4LLUB 2VXUH 2ICCA 1NCOA 4GJTB 4UZUA 5F93C 1SXNA 2DQCH 2XQ0A 4DQOH 4FNTA 4OZIF 3O3AA 1S7SA 1FNGA 1N8ZA 2ADGB 1E42A 2JFCA 2YXVA 3QJHB 4NC1C 5BVJB 1JPTH 1E9PA 1MFCL 4MXQD 4OLZL 5AYUL 5DDHB 2X4UA 3D69B 3BWUC 3BUPA 1OTUD 2Z1KA 2BP8B 2HWZH 3VACA 1HC1A 2BY2A 1R3HB 1LQBC 3LEVL 4XCNA 3B3IB 5ID0A 4Y88A 5KYYB 2HT3C 3N2JA 4HP5A 2TSBA 4LLVA 4N90D 4WUUB 4DO6A 1H3TA 2ARWA 3DYPA 5FHBL 4AI7A 2WYIA 4S1RH 3IDYB 3OKNB 5I71B 2XWZA 1NIDA 3ZZ1A 3QZWA 3T65A 1LK2B 4HX1A 3AQXA 3C2AL 2VQUA 1U3YA 2NX5E 2CO6A 3QFJA 2GW5A 2VXQH 3IFOA 2QDVA 1S7XA 1S7TB 4N9GA 4B50A 1AG0A 4PREA 3QNYB 1QFOA 3SZKC 2DQJH 1E28B 3SYQA 2F6AA 2P8LA 1U8IB 1Z9PA 2NY3B 2XWDA 3SE4A 5D93C 4UIMB 1FAKT 3E38A 1RJZB 3CWGA 2DKMA 2FQEA 3GI9H 5BRZA 4M00A 2HFGH 3F58H 4WW2C 5KS9B 3S3PA 1R9FA 3O81A 4FI8A 4HCGA 1JV5B 5ADOL 4FMKA 2IC2A 4ZQKB 2ORBH 1CUOA 3VDBA 4MMXA 2JNZA 3PWJB 5GGUA 4BKLB 3MRQA 2WM0A 2BIHA 1PLGH 2YD5A 3FT2A 2Y7NA 1LK3H 2E9GA 3AG2B 3IJSB 3NUKA 4L4TD 4MJIB 1W72B 1BM3L 2Z9TA 5DHVH 4UTBA 1IQWL 2BERA 3GHEH 3KPRA 5EN3A 4JJ5B 5AVRB 4YEFA 2I5YH 1WBXA 2CRIA 4ZW3A 2F5BH 4MA8L 3FU5A 4MAUH 4Y8AA 4ETYA 2KLRA 2NYKA 3QZLA 3BP6B 4D9LL 4FNUA 1X5YA 3QDHA 2WGNB 3BVVA 4UYPA 4XMZA 4M62H 2ZWZA 4RISL 3V10A 2DI7A 1CMOA 2KZKA 5IEHB 2DQIH 1BAFH 4YE0A 4YDKH 3FCSB 5CN1A 5HGHA 3X13A 1D5XB 1JZIA 4WCYL 4F57H 4RSYA 1WRFA 4H44C 4G7VL 4JX0A 1HEJC 1HCZA 3PP4H 1RK0A 3IM1A 4D9RE 2WZAA 1BIIB 4P2RE 4BSWA 4NWUL 3QFGA 1I8KB 4RQQB 3U0WH 5B7EA 2UXVA 2VDQH 5IFAH 1KCSL 3Q2VA 4F2EA 1JZ2A 3QCUL 4U1KA 3GQFA 1WO2A 3RI5F 3VXSD 3PHQA 1T6VN 5JHBA 1F13A 2PO6D 3CE1A 4XN4A 4B96A 1J86A 3CH1A 4U1IB 2GITA 2J8HA 1Q0YH 4Z7NF 4ZRGA 4N85A 2FECI 4PRAB 2AC0A 1E9OB 4H8WC 1IGMH 4GG8B 1RZKH 2NY7L 1HCYA 3A4AA 3Q01A 5DJ6A 5C07E 3HN5A 3FOLA 1MY5A 5C0BE 1QSFB 3AB0B 1SHWA 3CDGB 3CX5K 3QW9A 4IBYA 2DMKA 4DP0X 4PJDA 1KBVA 1S4IA 2Y36H 3C8DA 3RY4A 1G7HA 2QL1A 3MNVA 3X12A 1D9KA 4W93A 3SKMA 2CH8A 4XO5A 2SEBA 1E4KC 3BP7A 4IKIA 2XIIA 3BW9B 5GSVA 4IBTA 1H8OA 3KS0H 4AM0B 3TA4D 1Y18B 4TUOB 4X5XB 5CJXA 2PPFA 2YLHA 3DV4A 5GXBB 1FFPB 1A7OH 1SEQL 1MJ7H 4QRQB 3RWEB 1OCRB 2H0PA 2F61A 4AEIH 4KMTL 2UZYB 3MYZA 3UTQB 1C5CH 1MW2A 1LP9B 1ND0A 1XGPB 5E08H 3I3BA 4GRWE 4N20A 3QVAA 2QZ5A 5KVGL 2Y24A 3LHPH 1GYCA 1K4CB 1CTMA 5DFVD 1EHLH 2FX9H 4KH2A 2WQSA 4HKBA 3QIBB 3FQ1A 2CBQA 1DE4A 3M1BB 3HIZA 4N0UE 4NENA 4PFEA 5TGBA 1E40A 5DMKB 2HVBA 4GI9A 2VC2B 2YPKA 1GXEA 1KIPB 1MSPA 1PZ5A 3MBEB 2X7LA 2XZAH 2R83A 4BFKA 5EU7C 1PZSA 2NY6C 5EHFA 4PJAA 3VB8A 1Q9LA 4M93B 5EZPA 5GRVL 1IGFL 2OTUA 2CKBB 2NZ1A 2OMBA 3V0GA 1E65A 1VEOA 3U6RA 5AAMA 2F0CA 4QNPE 3CN3A 2UUDK 3H0TB 4YGAB 3MNDA 3LZRA 5L8LB 1J8KA 5BUGA 5DJ8B 2EIKB 3OSVA 3FONA 2BNRA 1CD0A 5K59F 1KIQB 4P5MB 2EC8A 2A83B 3KYKH 3RJQB 3ZDZF 3I3DA 1QLFA 2NNFA 3N44B 4TUJA 2OTPA 3S3BB 3K4DA 4YHZL 4K5NA 5PCYA 4HIQA 1BA9A 2IGTA 1P5VB 4Z3TA 3ZT5A 3L3DA 3P9MB 1QSED 2MEJB 2XFGB 5I1DA 5AZ2H 4YC2B 4RSVA 5AYQA 5JLZA 3PWLA 1QNZH 2EIZA 4HUUB 2HPTA 2CKBA 1T1YB 3S35L 1QWUA 4YHOL 1SMAA 4NCC1 1T1WB 4G80A 2VJ8A 5FUZL 3QDMD 4PH8A 1UURA 4TNWF 5C8JA 3EJUA 4IMLB 1JPGB 2CIKB 2FSDA 1NCNA 4OKVB 5D7IA 3SQBB 4FA6A 2ARJQ 5I19L 1NSNL 3V6ZB 1PF3A 1WBYB 2C9VA 4YEEA 3PXHA 5GZNC 3VMOA 3WTWA 1TTGA 4U1GC 4MWFA 3ZKXC 1HILA 4PJBB 3LYRA 4CDGC 1IGJB 2ZSVA 3D4GA 5KJRL 3TASA 3D25B 3F6IA 5DRXB 2FR4A 4AQ8A 1RIUL 1NKOA 3E1ZA 4WU7B 5D5ME 3RL1B 2CHXA 1AANA 3MMEB 1A4JB 4X5QA 3CLFL 1G7IA 3Q8EA 2NTFA 2Z35B 1I1RA 3W82A 2OL3B 4YFLF 4R9HA 4MXQC 1CT8B 5T8IA 5JQ6H 1SJEB 4ZUUA 2AEPL 3L95B 1UOKA 3EH1A 3NIDE 3I9GH 3LZLA 4OZFG 1XIWB 5E0QA 3SE3A 3IGLA 3ARVA 3PGFL 1LTXA 4HJJL 1DVUA 5LBSA 2OCJA 4XC3H 3ROOA 5M94B 1KJ2A 4M6AA 4Y2DA 3PQYD 3VD1A 5B8CA 3FTZA 2OL3A 5HGDB 4ZFOA 3DOSA 4Z7QB 1AIFB 1E3XA 4L2LA 2IPKA 3OJMB 1XV8A 2VR3A 1DBAL 3RL1A 3L81A 2XN9A 3NCCB 4QI3A 2J73A 3F85A 1CFMA 4Y4HC 4Y9BA 1N5YH 3BX7C 5DJ6B 2YRLA 2VDMB 3NRQA 8CGTA 1ZGLB 3MKGA 5DGRA 2O5XL 4BE6A 3KCPB 2WXKA 5DEFB 5IW6A 4YDIH 4HKJA 1K6QH 3H9ZA 1SEBB 4FI6A 3C2SA 1NUFA 4OIAA 2EE2A 3HZVB 4DZBB 3UZVB 5DZPA 2DQDL 3PAUA 4YSAA 2MNJB 2FJFB 1JRHI 5JW4M 3PQYA 5AQ0A 3ENEA 4L4VB 3V9CA 5I75B 2FT8A 4TKWA 1SQ2N 3SBWA 1DVZA 5GIRB 2BINA 2H4EA 1YCSA 2C4XA 4GQ9L 4LE8A 2D3VA 5GS1B 3VNZA 3FU6A 3U46B 3QEUA 3A23A 4FFYL 4QTHB 3BWSA 3PABB 5HDRA 1BREA 3Q6GL 3OM3B 1FG2A 4WFHD 3GXFA 3IJHA 1BFSA 2LU3A 3MV8A 4KV5E 4OLXH 3MTXA 5CHNB 1QLRB 2RA1A 4FZ8H 4ZTEA 5B39A 4EIUA 4BV1A 1HL8A 3SKOA 4HK3J 1I7ZB 5F3HA 2IIJA 2AK1L 3LQAH 2PN5A 3KL0A 4QXGL 1TNMA 1NTDA 3LRHA 3MZGB 5FKAA 5A16B 4PYHA 3EHBC 3P1VA 2XLLA 1KENL 3H42L 4YN3A 2E27H 5H4ZA 4YLCA 1I7RB 2B1OA 2WWKO 4NUQA 4R4BA 1CJYA 1V54B 2CGRH 2YA1A 4L2YA 3HEIB 2YXMA 4AYBA 4IYKA 1AS7A 1GYUA 3KPRB 3IJEB 4IOFC 3N9GL 3G9AB 3VB9A 1H0DA 5GGTA 3D7PA 1D3CA 1PSKL 1RY7B 1FE8L 2FX8H 2XWTA 5G55A 1UD8A 4BKLA 4Z76A 3ME0B 3PWPA 1FZMB 1J8HB 4AV5A 4ANUA 2D9QB 4K23H 4JRLA 2VR4A 1REIA 4YHML 3CFCH 1AGDB 3JQOB 5FIEA 3SE8L 1KPVB 3F64A 2GI7A 4O02H 4XMPH 5KN5A 2P3YA 3ARGA 3L8QA 4HDIB 5J12B 4QRUA 5IT2H 1ZWIA 1FNSH 3FT4A 4PS8A 2VNCA 4Z7VF 4CC1A 2OCFD 2D7QA 5BV7B 3L17A 3IAPA 3D9AH 2A6JB 2DQHH 2R2CA 5DHVA 2XACC 4ZS7L 4ZAKC 1QQDB 3D50A 4IOIA 4JS7A 3KL3A 1PX4A 1BIHA 2X4QA 1BD2B 1ITBB 5HTSA 1BM7A 4EI5B 2R1WB 3KPSE 2GSGA 4OBRA 2DQTL 4HX1B 4M1DH 3LVEA 4R7DB 1R4XA 3OTTA 1FNHA 2LFGA 1NBVH 2J2ZA 1TQTA 5FFGA 4ZNEA 5GRYA 5DXWA 1XO8A 2EZ0D 3EO0A 3GSOB 4FFVD 3VXUB 2VC2L 1XEDA 5B38B 4N2CA 2K3TA 1U8LB 4PHXA 4GUCA 4H0IA 5EO0B 5A2BA 5DD5H 4PBDA 2VR7A 5K9QG 4DGVL 2JH2A 4PJGA 2H1XA 4UBDC 4JFZL 1IBZA 1MLBA 4PRBA 5E7FA 3S9DB 2W07A 2Y2YA 1JNLL 1T80A 2CSPA 4U1KB 1XF3B 3UGUA 4R2GB 3VXNA 1U58A 1QRNA 3FSVA 1A9BB 5DEGA 3FH5A 2X0VA 2F18A 4M29A 5F7NC 1P7QB 5HY9B 4HHGA 2W8CA 2EVJA 3CXHK 2GCYB 3MDJA 3U4EA 3ZKMC 5T1KB 4A7GF 3FB6A 4RMQA 1II4E 4R5XA 3HLAA 5BQDA 4CU8A 1CDJA 2DMBA 1J87A 2B20A 3N50A 4RWYH 1AD9B 2EDKA 3MC0A 5C0BB 2FBOJ 3L3IB 2FQDA 5JOFB 5F9AC 5K9KB 2WBJC 5CUSH 5ABDE 3H1ZA 1TTCA 2VLKE 3H9SA 4QHKI 3V95A 3QRBA 1GMEA 3S3JA 3WFEH 4XNUL 2CALA 3TNNB 4QUOA 4BM7A 3VXRD 4JM2A 4K2UH 5DUBA 5T3ZL 4LL1A 3QC6X 1NGXB 3OV6A 1MJ8H 2ADIB 2X87A 7PAZA 5JYLA 3E8VA 3TBTA 4FQLL 3TVMA 3TVMB 1F90H 3HG3A 3KLDA 4QRPE 1KLGA 3H6JA 2R69H 1WBXB 4NKIH 4K73A 1S9YB 4KKBC 5ACZA 4JJ5A 1LO4H 1FG9C 3IRCA 3KPRD 4LDOB 1FL6A 4OM1L 3KHQA 4NNPL 4D0CA 4HC1L 4NUGH 4X5LA 3LD8C 4HAGA 4I13B 5DQDL 1EDYA 3QUGA 5D6CB 5IQ7L 1RXLA 1CICC 1A22B 4XAKE 1GJWA 3DGCR 3EZJB 4KUCD 5GGRB 3IFLL 3MRCB 3GRWL 3CZGA 1AGEA 4HJEA 4KGLA 2VDMH 1RZIA 4NO0D 4ODTL 1RJZA 1CXIA 4YFEA 3CK0L 4KKZA 1P4IL 1YEGH 3ARDC 4EKXA 5CEZL 2VLRD 1ZSHA 4P2QD 2WLIA 5EU4B 4GPVA 4UMGA 2I60L 4M6MH 1AE6L 5K5YA 1E28A 4FHJA 1OTSD 1U58B 2YK1H 2ZWYA 4YHNB 3GPSA 4PB9L 1OGAB 4YDZA 4G9FB 1IBBA 4N2KA 1T04B 2D3NA 3KWWB 1RZPA 4XMTA 1TNNA 2ADFH 1BOGB 1F3JA 4NNYB 5E5LA 5EF0A 1KLUB 3QWRA 1LEIB 3UTTB 4OF3A 5FKPB 2WLHA 1T3FA 3P02A 5EIVA 4ZFZB 3ULUH 5EF3A 1NUNB 5K9QI 1AOZA 5I8OH 4PIBA 3AABA 3A6CH 2ZXCA 3I9PA 4JBSA 5HDOA 1SXZA 4Y5YA 1BEYL 1VGKB 3AUWB 1T1ZB 1I1AA 4OIFA 1SHSA 4IRZA 1GGIL 3D39D 3FULA 4NQEE 4LRNH 1OT2A 1YEHH 4JQIH 1KCUH 2FUQA 1HIMH 4MX7A 4UM8B 4G8FA 3VFGH 2VQ1B 2VXSL 3MRKA 3DROB 4DAGH 3DVIA 4NJ9L 1AOHA 4PI2A 4ZAKD 1EH9A 5H2BA 2DMHA 4XMVA 3DUSB 4P4KD 3S8GB 1EJ8A 2Z0UA 1S7UB 2A5UA 5CLZA 2NLJB 3LH8A 4WWKB 4BA8A 4NKQB 2XQYK 5EH1A 4N0RA 2OMUB 2F74A 1V7NL 1X9RA 2BVEA 2V9QA 5F0PB 1RZJH 4RNRB 1D5MA 5CIPH 2NX5A 3V79C 1A8JH 4UANA 1W0WA 4CAGA 1TJHH 3B83A 2C1OA 4NO2B 1ZJBA 4TSBH 3HI5L 3RWGB 3APFA 3PWPE 5DJYB 5FLUA 1CI5A 1BJ8A 4JVWA 1OCZB 3IMRA 1NZRA 1YN6A 2BNRE 4HIHB 4WI8A 3CFKA 2O61A 1B3IA 6FABH 1SBSL 4XNYL 4LLWB 2A9NH 3VD7A 2ZYSA 4I77H 4N2EA 3ET9F 4I3RL 3MA9L 3JZYA 2QADC 1Z6JT 3NQIA 1HESA 4ZW6A 2NNXA 2EDTA 3F01A 4L3FA 1SJXA 2EAEA 4HIIB 4YIQA 5D2NE 3QNXB 3U4BH 3EG9A 3OKEA 1S9WB 5HD8D 1KEMH 2V3DA 1A7PH 2BHYA 2EO7A 1EJFA 4YGVA 2A77L 4CSPA 2GAZB 5T33L 4R3SB 5L4MA 2OK0H 3VXTA 3RWHA 5E2TH 3WV0A 5KZCD 3MRHB 3I3EA 3MRPA 4L1BA 3SCMB 1EBAA 3HC3H 5I73C 4OV5A 5F0MB 1NBCA 2Y3AA 3EJZC 5DLLA 4FXGC 2ZKHH 3L7EB 2EZ0C 5DRWA 1NCAH 1D5IL 2APWA 12E8H 2R56H 4KTGA 1CC3A 4X7SL 3EYFA 3HLAB 1JYXA 3GD1C 3NIFB 4NPYA 1OE2A 3RP1A 5B3JF 4QXTA 1HL5A 2NDGA 4DVRL 3TH2T 4KKPA 1IC5L 2E9IA 3BPLB 1SYVB 4WQOA 3QUZB 3I6SA 5DEGB 2GEEA 1Q0EA 2V8LA 5MEOB 5A43C 4GB9A 4R3SA 2BJML 3NCYP 4PRIA 2YD4A 3PV6A 1MLBB 3NH7H 4JFYA 3WNJA 3UMNA 4XPTL 4S1DD 2HMIC 4YDJB 5T3XH 3BRGC 4HBCH 2VERN 4EXPX 2XIDA 1NC2D 1R47A 5T5FH 3EG9B 3BT2H 3BKYL 1M42A 2I7SA 5BZWA 1X44A 5B4MD 3Q1SL 1WAAE 3L4UA 1JHLH 1ZANL 2ITCA 2DQUL 1PY4A 5LAXA 1OPGH 2HRPH 5AOLA 2XZZA 3EFDH 4XNMB 4ZZKA 3QORC 3RY6A 1EAOA 4AJWA 5HGDA 4ZFOB 1QEWA 1OQXA 3DRQA 4JG1H 5CBEA 2PKDA 3NDYE 2EDDA 5CGBA 4Q56A 4S0HA 3E3QE 2FWUA 3JXAA 5D1XD 5FYJU 1Z1WA 2Z4TA 1FHNA 4XOCA 5E8EA 4LKXA 2CLVA 2ED8A 5CP7B 5CAYB 2WUCL 1FP5A 2CHWA 3FOMB 4OLZH 3CFJA 4FG6C 3U82B 1OARH 1PFCA 1HE8A 4JLRA 4LBEA 3ESMA 1BBDL 4HDIA 4QRUB 3DK2A 1FZOA 4U2ZA 3UMTA 5SV3A 2ZUUA 4HWEH 3BVXA 4L48A 3FQXB 4B9ZA 2IANE 1E5YA 4GMTL 1P6FA 4DPRA 1DBKH 2EDLA 4GEIA 4F58L 4MHHI 4TQHA 5G2NA 1FN4A 4I18A 3WLBA 3LNEA 5C08A 5JW5B 4OGXL 3ZK0A 1EFXB 1MIEL 3MLUL 2ZE0A 1ZMYA 3LS4L 1EV2E 2EH8L 4JREB 2Q7NA 3UBGA 3ZBMA 2P42B 4HS6B 3CHXA 3SJVA 5L9DL 4AYMC 1KMGA 1RI8A 1E3ZA 3K1DA 1LO5A 3MHZA 1JYNA 5TTRA 4KNSA 1WC7B 4JFEB 1D9KC 5AOKA 3ROLA 4OU3A 5KVEL 5JLZB 1ZHLB 4OZFA 4ZTPH 3DGGB 3QRFM 4LU5L 43C9A 4FABL 1SZNA 2WVVB 4X83A 4GAGH 1J8HD 1FYTE 4NP9A 4Z7WE 5C3LD 1RJLA 4DO5A 3OHXB 2GJ6A 2NY3D 1WBZB 3C5ZC 4BH8A 5J4MA 3QI9A 3AQDA 5D7SL 4JO2H 1NLDL 1B3JA 2DL9A 2EDJA 3DXAB 4GUPA 4XBPA 3H6AA 1OZTG 2VDPH 5FGSA 2PCFA 3O3BB 2H2PD 3CFNA 1CVSC 3WXVH 1AKPA 4M61A 2H1PL 4B5ZA 4UI2A 5MP6H 4ZMVA 1XGQB 3P4OA 4B9PA 4IMKC 4X6BA 4FD0A 1YEKH 4JDEA 2BIOA 4TUUA 2GKIA 4ISVB 4CJ1A 1INEH 5DD1L 2DM3A 5J6SA 4PGEB 2AQ1A 3OWEA 1ETA1 1ITCA 3U2IA 1QX1A 3P9WB 3KLQA 3IB4A 2BOCA 3W39A 3L4TA 1T66D 4PJIB 2COVD 3MJGX 4AZ8B 5L2KB 1KELH 1U8PB 3DX8A 4JW3A 5IHZB 4ZMQA 3JZ7A 2YD0A 5DUBB 4J3BA 1F3DH 3QUHA 5INDB 4MLSA 4PJXB 3ULUE 1ILUA 1AIFA 2J8UE 1PX8A 4Z7UE 3ML9A 4U0RB 1WJ3A 1IGTA 4NM8H 5GRXG 4HWUA 1DLFL 1IKNA 2P5ED 4X5RA 2YWYA 4NZJA 1N0XH 2EDMA 4GO8A 3WKML 4QTIH 2AJUL 4DEPB 3BVWA 3IFNH 2Q3AA 3M7FB 5C0CD 3QCUH 2CUIA 2ROYA 5EC2A 1BVOA 4J27A 2XDHA 1UB6A 5T1LA 3EJYD 3AS1A 2B4CH 3RVUC 1U8HB 2MQGA 3T4AC 1ZT7A 3VTTA 4NRXA 2R8SL 1KSRA 4OGAD 2APVA 4Z7VB 1LL1A 1RZKL 2NY7H 3QR0A 4KOCA 5DMIL 1C12A 1OAYL 3B2VH 3RX8A 2OX5A 4TULH 4EVNB 3CDGA 3VXNB 5JHLH 3EO1A 1JAEA 2OXHA 3BHBA 1KBGL 3PLYA 5IB3B 3PL6C 3S3CB 1S7VA 1WUNT 3RDTC 5CLYA 1E9OA 5B1JC 3SE4C 3RVWC 2JKNA 3WY1A 4BWWA 4KDWA 2AJVH 4TLTA 5I8EB 2CWRA 2WXLA 1E0OB 4TLKA 2CR0A 1THCA 3UTZA 3VXUA 4E9XA 4FAAB 4KTDH 1I31A 3HB3D 4LKCB 2FO1A 3VRIB 1H3PL 4P05A 1RHHA 5ESVB 3SKNA 3ZL2A 4IBSA 5D1ZD 1AO7A 1S7QB 3RURA 3F7PC 5IVNA 2D31A 3IDNB 3KBHE 2CG9X 5GS0D 1PL3A 2YSSA 5J9PA 3KPLA 1S9XA 1VFOA 3VMNA 1NPNA 4HLEA 1IV8A 3BPNC 4UOQA 4ILDA 3S6CA 4YHPA 1FVDB 1EO5A 3BP4B 3BUTA 1FNEB 3KHOA 1OT1A 1J5DA 2H2SC 2OMZB 3QCVH 3ARGB 3D4YA 4L8SC 4LFHD 3WJLC 3UBXI 5I1HH 3WLWC 1TITA 4FE9A 1JDCA 2EH7H 3HE7D 3UERA 4HJ0C 4L5FH 1OIOA 5DVKA 2AJZB 4XPFH 3RWIB 4URKA 3GMNA 5DLMH 2CM6A 4AQOA 4FLOA 1KXQE 4JRXB 3KWTA 4B3EA 2J1KA 4EN3B 2X7LB 4JVUA 2GTZB 4J6IA 4FQXC 4XCCL 3D34A 3CZFB 3BIBX 5I76A 1KV7A 2A38A 2BVUA 3IJSA 3LNHA 5E03A 2YPLB 1YN7B 2KH2B 3TV8A 1F18A 1QPXA 3Q9PA 4GO9A 3IDMA 1HEHC 2HB0A 1XCQA 2WD0A 5A6IA 1R24B 1U4FA 1SM3L 3NEEA 1MCHA 4RFOL 3C5SB 4X8JA 2XKNB 2EICA 1Q1JH 4J3OF 5IQMA 2Z8VC 3HC4H 5INCA 2OQJB 2X9XA 5BRZB 4KFZC 5ABAA 4NUJB 1VB9A 4A7UA 4K8RL 3QORB 2FECL 2V2WA 1GOFA 3CDZA 4L0YA 1X4ZA 4NPYB 1H5BB 4ODHH 3ZSTA 1V7MH 1QBMH 1AKJD 3T8VA 2C1PB 4XVTL 5KVDH 2PP7A 3RQ3A 1ZEAL 2AEQH 3KYOB 4N4YB 5JMRA 4YK4B 1F0LA 1BFTA 1Z0MA 4LASH 5JNYA 3GHBH 1VCBC 3HZYB 3GKWH 4K4KA 2VB5A 3VM7A 4PJ9D 5HHQA 2GB2A 1RIHH 5DO8A 3B9KD 5FV2A 1CICB 1GH7A 4KQ4L 1TKWA 3NFSL 2NXZC 2FVNA 3NZ8B 2AJYH 1F56A 2VDRB 4GRWB 3CX5J 1LP9E 5EEWA 4M7ZB 4DZBA 3DXAE 4KOBA 2HT4C 4BXSV 1AQKL 3GZKA 2CDFB 1AXIB 1XDTT 2ENYA 5AL8A 3CBKB 4WFFD 2B8OT 3QAZC 5E95B 4WWOA 3ARXA 2BSSB 1LDPH 1YPZF 2IADA 2KMWA 2KZWA 1FRGL 3HFML 3ECVA 1VGEH 2YAOA 3QHZL 4LLWA 2VSMB 4NWTL 4PY8J 4GEJA 5F7WC 3KXFB 1OAXH 4PGCB 4OIIH 3WE1A 1SLWA 1MLCB 2ITEA 4JJOA 5JXED 1M2VB 2JK5A 4DP6X 5CFAA 1PU0A 2FHCA 4V2CB 5FYKL 3WIIL 4TL5A 1RK0B 4OCSL 1MCPH 1RZGA 3QIUB 4JQVA 5DS8A 3H56A 5IBUB 2R39A 4OM0L 5JIQA 3MV9B 1HX0A 1K8DB 3FCSA 4B95C 1I3GH 3SCMD 5E24E 2PWEA 3DUSA 4UM9A 3S2CA 2W92A 4R96B 3K81A 2YPVL 4RGOH 1NGQH 4FF9A 1T22A 5E1QA 4N0UB 3RZWA 2WQWA 5AVWB 3WTXA 1KNOB 3C60D 4UM8A 5TE6H 4K8RD 3S5LG 1ES0B 2V9RA 5DQJA 4M5SA 1GGYA 4MA1C 4MMZA 5LBGA 5C0AE 1XH3A 4G8EB 4BE5A 5AVQB 1WTLA 1RFDH 3ALPA 3ORJA 1XGUB 1I8MA 4JFFB 4M3KB 5FGRA 5DSCB 2KPNA 5HI3D 4MRBA 2AQ3A 4AEEA 4HOXA 4JRXD 1CDGA 3L9RA 5EEYA 2YQBA 3MBWA 2EADA 3S88L 1DSFH 2B5IC 2DJUA 2EXWC 3QDMA 5DK3A 2FATL 2M1KA 2EABA 4HS3B 4DUXA 1IAII 1FFRA 1HHGA 3L3HB 2QVTA 3ZKXB 3UTSB 2F1EA 3T6VA 3TCLB 4MMXB 1G0XA 5J57B 4G9FA 3SDAD 4WDIA 2BCMA 4G8GD 3BJ91 4Y4HA 2BFVL 4PRDA 2BNQB 1BECA 1JF1A 1T6WA 3OJDA 4TOYL 3X17A 4DKDC 3GXUB 1SUHA 3TJHC 2WINA 5IW1A 4WI4A 1EHNA 4O58H 4LSSL 5DZOA 2Q9OA 3ERXA 4XNXH 5AG8A 3BCDA 3LQAL 4QXGH 3UTPE 4IRZH 1EZUA 5LAPA 4XHJC 3TN0A 4Z77A 5JXEC 2NNCA 3D1MC 4PJEB 4UQDA 1MQ8A 1YEFL 2JTYA 3DHJA 3SPGA 4KUZL 5JIIA 2NYYD 4NM4L 4R8WH 4XMLH 3DURA 3GMPA 5E9DB 2UWEA 5EU3A 4JHBA 3CFIC 1VA9A 3KNBB 4FG6D 5FO9A 2IDTA 2ZCLL 2FUTA 4PRNA 4U3XA 3ZL4H 1WFIA 1E5BA 5KYUA 2C3GA 5MEQB 3KPMB 5IWLC 3MROA 3OLEA 4FXGB 1KFGA 5JO5B 1D6VH 3N55A 3SDCA 3LB6C 4GQZA 1UZ8A 2HTLC 3WJMB 3G5VA 3N41B 3GI8H 2BP8A 5MEND 1UWGL 1JXDA 1DR9A 1SLVA 2VJXA 4ONOA 1EFXA 5E99H 1L0YA 5F70A 4JY5L 1EHXA 4WTZG 3DJ9A 4FZEH 2L04A 4FG2A 4MMZB 4PBVC 4UAOC 3O6FC 3UCRA 3BZEA 2XHNA 2P24A 2ZJSL 1FN4B 4HPYL 4P23C 5E2VH 2EXWD 3K80A 4I9WD 4P9HL 4JANB 1C8PA 3ZY7A 1UYWL 2WXQA 2ZT9C 1YQVL 3LTVA 4JFED 5ANME 1YG9A 3VI3E 3FT3B 4M1GL 3PJSA 3Q3GA 4NO5A 4XCEB 4JZJC 2HRLA 4HIJA 1J18A 3UAJA 4JGMA 3IFPA 2JSFA 1KB5H 3B4NA 2YBRA 2GK0A 3B1UA 4FQ1L 1RUQL 1AXTL 3SD2A 2OS7A 4UQEA 4TTGA 1L3NA 5F71A 3WFHA 1P7QA 2NPLX 4EDXA 3BQUC 4G5ZL 4BYHA 1I9IL 3QC5X 4I89A 1G43A 4LSTH 3SBPA 4HD5A 3ILQD 2H3NA 4UNTA 5BS0E 1U8CB 4OZGE 3DX1A 2MPAH 3DUUA 5LQBH 3ZTCC 3F6LA 3W0WE 1NEZG 3VD3A 1XSOA 2Q0ZX 3H2PA 3SDXE 5CP3H 1G0YR 2WV3A 2HAZA 5ANMA 3P0YL 4HFUH 3DJRA 1F6FB 1A1NA 1DL7H 4RZCB 3EO9L 3ALXA 1VJSA 1IEAB 5FS5A 3GBNL 2R29L 4LOVA 3RA7L 3RU8H 4MYWB 5CKGA 1OWWA 2WJ5A 4DGWC 5HSFA 2QBWA 2GBVA 1S5IH 3H9YA 1WISA 1ZT1A 1QP1A 1B2YA 1XGTB 1YJDH 4O2EB 2APTA 3G04B 1P4LB 1TJGH 3CTTA 1EAPA 2CK0H 3T6WA 4IRJA 1N12A 3FTUA 2CA4A 1IBGH 4LL4A 4OH2A 2XWXA 3IDJA 2KPWA 1DUYA 1TO5A 1CLZH 5DJAB 1EZSA 4AENB 1GC1L 3X3FH 4JN2B 2OYKA 4DZ8B 5CIPA 4WHTA 2W0FB 5E1AB 5ITFA 2QR0A 4LFHG 4HPOL 5DWUH 1TQSA 3F62A 4ZO8A 2A6IB 5E6SB 2CO7B 3NIFE 1MVFA 4P57A 3RGVD 4J23A 4C4UA 4HZAA 3T77B 1E4KA 1GGCL 4P2AA 4JZJB 2APBA 3CHPA 5E4EB 4P3DB 1HI6A 4DPBX 3IDGB 4EDWH 4DGYH 5SX5H 5TFSH 2AJ3A 1LVEA 5KANG 3BIKA 5BZZA 2X4PA 5MEQA 4AJYV 3CK0H 3NIGE 5EF2A 2G4GA 4BUQA 5FDYA 4PLJC 3INUH 2P45B 1EVTC 5AB9A 3GMPB 3HRZB 4FI7A 4G1MA 2R23B 3IJYB 5HYJE 2YEQA 3EF7A 5I1EL 1EQWA 2BVYA 3NFNB 1I8IA 4YLQT 3O3DA 5ANHA 2AXFA 1S7WA 1TTRA 2LHAA 3K71B 1CD1A 2ZG3A 5GS1A 1CDBA 2FX7H 5IW1B 1Z9MA 3LZOA 4YSSA 4XMKH 3K6FA 4KQ3L 5JOPE 4XGZB 4IOFD 4KI5E 2RR3A 3EBGA 3U7YL 5IQLA 2BCKA 1KLFB 3NJXA 3F05A 2CO6B 3QFJB 1KB9J 2ZAHA 4ICWA 1UM6H 2H32H 2BZCA 4KBPA 4WK0B 1IFGA 3TBWA 4B97A 4HXAH 5GGVY 3J8F7 4FEIA 1F00I 1YYLL 4Y16A 1ET8A 1GTNA 3PIQA 3L2MA 1SLXA 3X1GA 3B3IA 3LS5L 1QWHA 2LQRA 3VWKD 4KRPB 4P59L 2NXYB 3J2PA 2YA2A 3RIKA 4ZS6D 4PRPA 1KG0B 5IG7B 4Z78B 5IJBC 5I75C 1YMHA 1EZLA 3V0WL 4U6HB 1QFWH 1V7NH 4BRJA 4AC2A 1T5KA 3BAKA 1IL1A 1MJUL 2RBLA 3QJSB 1N8ZB 2ADGA 1UXSA 5EU7E 5B8CB 1WD9A 2WVUA 5JW3L 4UM9B 3V0AC 2HKFH 4PS4L 5C2BH 4HU8A 2DQEL 1TOXA 3NVQA 4K7PH 4PUBH 4Q9BA 5EZIH 1QUNA 5I5RA 3CXDH 3BKMH 1RZIB 1K3IA 2OP4H 1XF4A 2BVQB 3CFQA 3LKQA 3NG5A 2WMPA 1WAAA 5FM8A 3TZVB 4AMXA 1J0YA 2A0LC 4J5VA 4NN6C 4HMEA 3O2DH 3S3SA 5E4OA 2MMXA 5LG1A 4JANA 2DYRB 4OAWA 5DR5L 4XN1A 3QG6A 2VR9A 3VXQA 3K8LA 5F3BB 5EN2A 2FHFA 4HV8A 4Q4EA 3V52H 1KWKA 4BWTA 3C5JB 4GT0A 4I3SL 2FJHB 4IU2A 1NBYA 1XR8A 1BX2B 2NY5H 3SD5A 5HXMA 3FRPB 4RFEB 1CDHA 5I1KH 2N59A 1FVEA 1Z9OA 4QOKB 5D7IB 2D3LA 1BXXA 1NDTA 2ADIA 2CIKA 4KJPC 4C47A 1XF2A 4JRYD 5E8NA 3BUIA 2X4OB 1NDGA 1JSYA 4C56D 2CXGA 1G7MA 4G6JH 5CD5D 1BAWA 4NOBA 4PG9A 4I3GA 5EU3B 4GUPB 4ZFFA 4H26B 4DN4L 5KANI 1ZCRA 1G87A 3EJJX 3R19A 3BI9X 5JNYB 3JUYA 3TPUB 2IG2H 4FQ2L 1WGOA 2UZPA 3A4FA 3TJPA 1JZJA 4AJVA 3MLTA 1L0XA 5DJDB 1BXUA 2BVTA 3IPBA 3QQXA 2X6BA 3QS2A 4AQZA 5DJ8A 5HY9A 3BLBA 4W70A 4C55A 1E9QB 2WO2B 3OJDB 4M6OL 1JF1B 5J7CC 4UV7L 4JNXA 4ZFGL 1BVNP 3DSFL 3FO1B 2H6OA 2VXVH 2TAAA 1UG9A 2IF7A 3RNKB 2ZSWA 3OL2A 2VSDA 5JA8B 1L4IA 1F02I 1VERA 5DZAA 5B7FA 2WKOA 4NQDA 2CKBH 1F42A 5KOVC 3QXDB 3TV3L 1YO4A 3DPBB 3SYCA 3ULVD 5J89A 4UTCA 3V0VB 3W11C 1HHJA 2J2ZB 3LIZH 4UQ2A 2UUDH 4WJKB 2XZQL 2OSYA 4R4FH 4LLDB 5JW5A 4JFPB 5I18L 2VWEC 2GT9A 4FKEA 1UXWA 5F9DC 2X6AA 4HUXA 2QSTA 4NJAH 4LXFA 5EIIB 1TYRA 2VMEA 3G08B 1KTRL 2E7LC 5LGHH 4GRWF 4OGZA 4ZUSB 4GSUA 4BKTC 1M05B 3T2NL 4IOIB 4OVVA 1IGCH 2H1LM 1Y0LB 1DUZB 1BGXL 1U33A 1V3KA 1PZUB 3B8YA 4JHUA 1IFHL 5KVMC 3PNRB 2F58H 4ZZFA 2J21A 4WW2F 2X9YA 3GWJA 4MJ2A 1DBJL 4IDJL 1H6TA 1RZFH 3SDCC 2EYTB 4ZUSA 2O4EA 2WLNA 2AABH 1PAMA 1AGDA 4MA7H 1KBPA 2W60B 1EJ6A 4NNXB 2D4FA 5ICUA 5EEUA 1QEWB 3DRQB 3Q44A 4XBMA 2GT9B 1UH4A 2WKOF 5EOQH 1D9KB 1G7HB 2EIMB 1E5ZA 3P54A 1I9EA 4PJ5A 3T8XB 5CCJA 4RX4A 3VG0H 3STBA 2NR6C 4PGBA 2I24N 1B4LA 3L5XH 5GRZA 3TEYA 3GMRB 3V4VL 3IJEA 2YAMA 1NWOA 3JWOH 3U2JA 5I8EA 1SY6L 5BRZE 5E8PB 2XXCB 4GAGL 3UTPD 1RV6X 1T20B 2VLKA 2JF1A 4JMXA 4Y4FB 4H7VA 1HEZA 4PCYA 4UZGA 1A1MA 2I32A 3V9EA 2G9KA 4OCMC 1I7ZA 1QVOB 5E5MB 5D7SH 4WNQB 4EVNA 3P2BA 3U9PL 5ICZA 1JFQH 3IWUA 4Y5VB 1RMFH 2P8PB 3QIUD 1SFDA 2NQ3A 2VDPL 3LXUX 5D71H 1BFOB 1CD8A 1OCWL 3QQNA 3OAYH 3THML 1J1XL 5I1IH 1BIIA 4CMHC 1ZT7B 2E59A 5DU7A 3FFCA 1A7RL 4G70B 4KHXH 2B5IB 5FM5O 2PWDA 3KD4A 3QQ9C 1CGXA 2QQKH 1Q94B 4F9LA 3GB7A 5J06A 1HYRC 4M5ZL 3GLDA 3S5ZA 2VCOA 2IH9A 2K4AA 3LIZA 4XPGL 5F0LB 4NHCH 2XY1A 2TSAA 3UDWA 2Y9RT 3REVB 2F54D 1J5IA 5DZJA 2JI3A 4RIRA 3CLEL 4EXKA 1NMBL 4WNQA 5I30L 1AY1L 2DDQH 3LV3B 4KGJA 3VGBA 4F8PA 4MYPA 4Q2ZB 5D8JL 4OUUA 2VMCA 1L6ZA 5I1CL 1XTMA 3RAJH 5IOPA 3KZ8A 1XR8B 3ZUNC 3JWNH 1I7UA 5KVFE 1V3JA 1WWBX 2VDQL 4LCWA 1CF8H 1KCSH 4PJCB 4JREC 1H19A 1CLYH 1U92B 2R0ZH 2Z65C 3ABZA 3KS0J 3VQ2C 4JQVC 1RULL 1LHZA 5DJ0B 1L9TA 4TN9A 5GGUB 4JVPA 3H7BA 2Y06L 2QVIA 3QBTB 5TE4H 5D93B 3DIFA 1RZQA 5I6XB 2XA3A 2HLFC 3OXSB 1QFWM 4PJ8C 5CLWA 2Y0SA 1IB5A 1AR1D 1RPUA 3WEMA 3Q06A 2HRHA 4DGIH 1P5UC 1JS4A 3WNNA 4H20L 2JELL 5GS0H 5CGMA 4Z3GA 3AM8A 1EUUA 1I8LA 4Y4FC 4JGUA 4XNQA 2DM4A 5CNHA 2AEOA 1M05A 4UAOB 1A4JA 3TURA 4MJ6B 4QDGA 4F7CA 4JM4H 1KGCE 2DLHA 4X8GA 1AZNA 3HNSL 3BESR 1MEXH 4KTDL 4LVNC 5ILTL 3TZVC 2FR4B 3D85D 5BO0D 1FL5B 1J0ZA 2Z64C 1IAKB 2D2CC 1YRKA 2NYZA 1NAKL 1BFVL 4GMSH 5D72H 4IRJC 2E9JA 5CZXC 3A67H 1T89C 3R8QA 3UYOD 3V4UL 2ATAA 5E08L 5CWSB 3PIQB 2BMKB 1PGRB 4BQ6A 3AADB 2OL3L 1R3LB 4NRZB 1ZAGA 3CHSA 4F9PA 5L4FA 1A47A 5DFAA 3DX3A 4L8SB 1Z32X 2EKJA 2W1NA 1L6XA 1A3ZA 3VGHA 2Q2EB 2BHZA 1ZPLA 2HT2C 3R8BB 3RY5A 2DICA 3QG7H 1F3DJ 3ECBA 2F7OA 4ZFQA 3O2WL 5ESQA 3FUIA 3WTTA 3JV6A 4Z3JA 4XWOC 3IDXH 5EF1A 4NRXB 3GS7A 1NUDA 4RAVA 1PLCA 3OSKA 1VACA 4TUJB 2XRAH 1IBFA 1U8JB 2B2XH 4AYFA 4FQXA 5I74C 4CADB 5KTEL 1BZ9A 1MXDA 2FK9A 1JV2A 2WQAA 4LHUB 1BZ7B 4HWNA 3RWCA 3VA2C 2QKIB 5HBBA 3OAUL 4MNQA 2X4OA 1MREL 3UG4A 1OP5K 4YHZH 3RHWK 2PLTA 3EOTH 2AJ3B 2AAVA 1EANA 3O8XB 2Q86A 3MOAL 1FZJB 3D06A 3I74A 2R27A 3EJCA 4L4TB 2F15A 1RJYA 2QSCH 4K8RH 4Q9QL 3H9HA 5DI8B 3UJTH 4JPKH 5KAQF 3LKOA 2Z31B 3S5YA 3DBXA 2L7EA 3H7LA 4JFEE 2KZ1B 4JM2B 1ASQA 5EU5A 1WVZA 3QJVB 3B34A 3QQ4B 3VW3L 2JWYA 2QPFA 3GSVA 4PRID 2CUMA 2V9TA 5K39A 1HHIA 1M56B 4MBRA 4MBOA 4Y4KD 4B0MB 4HCRL 2XBZA 1HWGB 4JY6B 3VTMA 2ZG1A 3D39E 2PCFB 5E2WL 1A6ZA 1K2DB 4XBPB 4WO4D 1AZRA 3Q2CA 1OSPL 4IRJB 1T03L 1MFBL 2QSQA 3KPOB 2ZF8A 3KGUA 3NACL 3U4EB 2UV3A 2CLRA 5AWNL 3WDJA 4BDVA 4C56A 2ZG2A 3FCTB 2V5YA 3G6AA 1LD9B 4TF4A 1GYVA 2EKSB 4EPSA 1E43A 3VYPA 1H6EA 2X3CA 4JPVH 1CURA 3FO0L 3Q5YA 4ACTA 4MDIA 1QSEE 2DJ4A 1RZ7L 5E6IB 3T71A 2LV4A 1DBBH 2P49B 1THAA 3FSZA 3VFRA 1CZ8L 3GMQB 1ZLSL 2J72A 5AW6B 2YO3A 4QTFA 3MLVL 4YIQB 2P46B 3KEHA 2Q7YB 4YHIB 3QYNA 4D2NA 1AACA 3RJDA 1P9MC 3MR9B 4N1HB 1JERA 4U3CA 2WVTA 4MD4A 4OF0A 1VFAA 2ZAIA 5I74B 3GSNH 4ODBD 3SDCD 4Z7OB 5IW3A 1AZBA 1N2RB 4OM0H 1Z7JA 4XVJL 4XP5L 3TH3T 1TTUA 1Q9WB 1M7IA 3C6SB 4XAKD 4CMMA 2CR6A 1YN6B 2V17H 3ZDXB 1KXVC 3ZKQD 3TBVB 3PDOB 5GZOA 4RWHA 4O2CB 4E5XG 3VUAA 2UVFA 4WU5B 1K6QL 1DYZA 4PRIE 3ZE1B 2A6JA 2XZCH 3FF7A 2FEEI 2DD8L 2MTPA 2Y22A 1TLMA 4JG0L 3A22A 3CVIL 2OI9B 3N06B 4ZO7A 4XZ4A 2J6EH 2Y7QA 1QBBA 1R3JA 4KKAD 4NDMA 1RVFH 2EO9A 2QPUA 4EI5D 4ZMYA 2G3XA 3D09A 5DC4B 3AWEA 1AFVL 2FATH 2YD8A 3WO3B 2JJTC 3T3MB 1YUHB 4B7IA 4RZKA 1J1OH 1XH1A 3E1F1 3PGCB 3N91A 1JWUB 2KLTA 3R4RA 1D5RA 5H35A 1CGVA 2WOYA 3HR5B 3LEYL 4O4YH 2YUZA 4P04A 4PRPD 4WV1C 3MA7A 4N8CL 2IAMB 3BO8B 1AQDA 1QABA 4MD4B 2LFEA 1AHMA 2ITCB 2HJFB 3M6DA 1N9PA 1D5ZB 4TOYH 1XZWA 5LJYH 5AOMA 3SY0A 2O1AA 3QISA 3D87B 1N6QH 1FC2D 2OV0A 3EHBB 4O58L 1JZ3A 4RH4A 3C09C 5KBLA 3LAFA 1FFNB 2ZYHA 3UYRL 5GPRA 3MRQB 5I0DA 4IRZL 1BJMA 1NH6A 5CHNA 2V33A 4KKCC 3BWAB 1NCWL 5EPMB 2H7WA 5GQBA 4YVNA 4KUZH 2AAAA 2MWCA 2NR6A 5C07D 5T1KD 5L6YL 4NO3B 4OI8A 3RPIB 4E0RB 3QHTC 1MWAH 1FE8H 2FX8L 5K69A 3E8UH 3AU1A 1KYDA 2LOEA 2Y1VA 1CXLA 1R17A 4H4NA 2ZQKA 2ZCKL 1FZKA 5JHAA 3P4MB 4FQXD 5DHYA 4O2EA 2QVFB 4IIZA 4N9GB 5E0FA 3HC0B 4KJWC 1Y1UA 3H2WA 4N2FA 2MOVA 5I26A 4ZFFB 4QLRA 3G5XA 1FPTL 4GP8B 2YFOA 4JKKA 5J5EA 3MRIA 5C0ND 4G7SB 4KK6C 2DQHL 2PR9A 2GPZA 3FO2B 4P23B 2R0KH 2IAND 3EOBA 3SPJA 1CLOL 4LLVB 4PJDF 3DBXB 5EU5B 3PDDA 4NZTH 3QULB 3ZTJG 3MQIA 4YWGH 5E6YA 1JGUL 3QNXA 3V6BR 4QOKA 4QWWD 4OZ4A 5EUKB 1W91A 2DQTH 5ALBH 1WH0A 1HZKA 3BAEH 3P4NA 3VFMA 1HT6A 1WA0X 4PJCF 2CDEB 2P8MA 1ZVYA 1MUJB 2F8VA 35C8L 3D4ZA 3VXRA 4F33B 3MGOB 5IBLC 4ZD3H 1Z9LA 2HPOA 2KI6A 2NY2B 2ENQA 3WS6A 1A4KB 1MH5A 1E7UA 5DA0B 3WFHB 4J2QA 5CEYB 1NOLA 5ICYB 1HHKB 1JV2B 4LHUA 1PLGL 3V8CA 5B3SB 2OTWA 4NO0B 3UP6A 1HKFA 1K8DA 3PHOA 3IXAB 1E2WA 3R0NA 4NOFA 4ZDHB 5JHDE 2YBRB 3SQRA 3U0TB 1QR4A 3WFBH 4DUWA 1SVCP 2EIJB 3P3RA 4MTMA 5F7EL 4LVEA 2PCPA 1LO0L 2X1OA 1KGYE 2GK2A 3QWNA 2DQ6A 3QXAB 1OD7A 4M7LL 2TRYA 3W2DH 4H40A 3MXWL 3BDXA 5I15L 5DMJB 4NKOB 3VSTA 4MHHG 4CDHA 5LXGH 2P24B 1C08A 2GUOB 2OXGB 4LP4A 3OMNB 4P5KA 4GW1B 3GBNH 4XP4L 5HPMB 3UEZA 1IARB 3KPSB 1TEYA 4E9VA 1F11B 3ZMNA 1VGKA 3LDBC 3LKPA 3VD4A 1JGLL 1G94A 2ZP0T 4HKZA 4ODXA 4XNUH 5EMYA 3VGAC 4Y16B 2KYIA 2XTLA 5E6RB 4DO4A 2WWKT 1SOKA 3UPCA 2OSLB 2DY2A 4F8LA 5TK4A 1FL5A 4IW4C 3JVGA 4P9ML 4X9FA 4PJ9A 2QVMA 4OFVA 1F90L 2JKTM 1S3KL 1JGVH 4ZAKB 1XFPA 5D9SB 3BN9D 1CGYA 1YNKH 5C97A 3MODL 1LO4L 4XGZA 3ZR6A 1GGUA 1X5HA 3C9NB 3G5ZA 3ZYJA 2FL5A 4AWJC 4RETB 4F37F 4A66A 4IEFB 2A83A 4V1DB 4E9RA 1TJIL 4JHWL 2AXFB 3FDWA 1H6FA 5MEPB 3TNMA 2M2DA 2WO3B 1ZS2A 4NO3A 4G3YL 1BMZA 5B39G 2E7CA 5J11C 4FNLL 3ZKSD 1L9SA 1INDH 3S35X 4YQXL 2A1WH 2YC1B 4PW3A 5E1IA 4GBXA 4Z7NE 3GIZH 1NFDB 3C5XA 4PJAB 5AAPA 3PWPD 4F20A 4NQCA 2IPUK 4G9DB 5TQ0H 3OPZL 3AY4C 3FHAA 4LOFA 3T0EA 1AE6H 3RGVC 5C9KA 4Y9FA 1OO2A 4GP5B 4U1MB 5E9NA 1WP6A 2D7OA 4WF7A 2WSKA 1J0KA 2CIIA 4UCFA 4CBPA 4K0OA 2F7RA 3GJEB 1P4BH 1UEMA 1HOCB 2IAMA 2ZXWB 4LSVH 3OB0H 1MRFL 4PY7B 1FIGH 3GMNB 4J1UA 1XGUA 3CVDA 2AK4A 1I8MB 4M6NL 1KY6A 1MF2L 4ENZA 2H45A 1QI4A 3SB3A 1QO3A 1LP9A 1ND0B 1XGPA 5G4NA 3SPVB 2V5RA 1KFAH 4PM1A 2CGYA 4ZTOH 4AE1A 4MSWA 5E1HB 1BF2A 4WFGE 4MFHA 3VXOB 1W80A 2NZIA 2A74C 3NJFA 1WSST 4AENA 5LBSL 5EEZA 1O6TA 1Z9NA 2JXMA 1CL7I 3VDAA 1MFDL 4FFZH 4X80H 3T0WA 1PS3A 2MPVA 2NDFA 4N2IA 5C0BA 3ZDYB 2YSSB 4X9IA 5L88L 4BZ2L 4F8NA 1NMCB 4D8PA 3G6DL 1JOIA 1E50A 2FSEA 5IMLB 1OAJA 2FT6A 1AO7B 1S7QA 2GCYA 3BQVA 4HZLA 1DQJB 5JIKA 1AGCA 3NK3A 3RI5K 2IV9A 1MLCA 1IGFH 1PZBA 2EDBA 3ZDZB 3NFPA 3CSYA 4LESA 4BH7B 4AMWA 5IMOB 5JPNA 2WXOA 1BZQK 3EOAB 1EAJA 4Z8FL 3MV9E 5BOPA 1ACYH 2DWXA 4GG8A 3RX9A 4LIQL 1YNTB 3ZZQA 4A6YL 3QFDA 1EMTH 5IEKB 3OHXC 3BZDA 4AVIA 3OMZA 5EO1A 3C5ZB 3VI3A 7FABL 3L5JA 2CUAA 4MMXC 4DJMA 4QRRA 2AGJL 2NXYD 1P7BA 5BJTB 1BMGA 3MX0A 4N0YL 3PPEA 4RMUA 3BRFA 1HK6A 4MAZA 3DTXB 4PVMA 4WUKH 2B1HH 2QADB 5BMFL 3MJ9A 4PWJA 5EO9A 5TF1H 4MB1A 5DHDA 4R7DA 4LPUA 1DQJA 3QDJD 1RUPL 5A2AA 4ODVH 3TIEB 3GSQB 1UH3A 4RMRA 2IH3A 4BWUA 3PF2A 4IDLA 2B59B 3U4BL 1N26A 2QGDA 1F8TL 4L1HA 1CXFA 4CVZB 4UQAA 1NSNH 2KC0A 3V52L 2XA8H 4Z7AA 2BIQA 3NSDA 4I3SH 3IFPB 3VXOA 2HRGA 1CFNA 3QEHB 2R0LH 4ZUVB 1DQDL 5KN5B 2HYMA 5EBLA 2JIXA 1HAUA 4TTDD 1MQKL 3RGBA 3SGDH 1NMAH 2ZKHL 4WTQA 3RTQD 2Q1EA 3NZSA 3O11A 4AK2A 1V3MA 4XAWH 5KVEE 1QZNA 4AZ8A 4PY7A 4NSKB 3FQ4A 4TVPL 4CVWA 3TO2B 5FEBA 1WWCA 3QJOA 5CXPA 5DYOB 3VFNB 4U7SA 1G7PA 4QYAA 25C8L 4G6JL 4G6FB 3DYOA 2WBJA 3KGRA 1J88A 2XWTB 3RUGB 1XVSA 4XP9L 1XGRA 5DVNA 1KB5A 4H2AA 3QXDA 3WUZA 2FEEL 4RMTA 5GSRB 4DUVA 2ZCHH 1WA1X 4UYQA 1BQLL 3O9WB 2VMFA 1CQYA 1RQ5A 4WSGA 1QFUH 4AKPA 1BWWA 1NGWA 2R1YB 4PRNB 3BKYH 5CSZA 1HDMB 4BBWA 3PE9A 4OFYD 4NBZB 5F6HI 1QLRA 5ISZB 1M1XB 4C83A 1SYSA 3GXDA 2TRHA 4I1NB 3MLSL 4U3HA 2J8UB 1GS7A 1J05B 4PJHA 3HJ0A 3N04A 4AUYA 3DSFH 4ZJ9A 4ESKA 3TEWA 2WHVA 4ODWA 3GSRA 3S37X 3WXWL 4LDCA 1RUAH 3OJ2C 4JHAL 5EIQA 1C8QA 1F2XK 4YAQA 1I3RA 4WKZA 4XO3A 1UD3A 1LNUA 1SYSB 4WIQA 1C5DA 4XWGL 2G3MA 4XRCA 2XT1B 3GM8A 3SDDD 4ANWA 4JFXB 3UAJC 3U9WA 1G7MB 1NGWB 2HN7A 2FCBA 3PQYB 4AW4A 3IETB 1KJ3H 3HLKA 1T0PB 4LKCA 1U2YA 4KI5D 5ID0B 3UH8A 1KC5L 4ORGB 1FF5A 3VO0A 1ACCA 1F58H 2AQPA 2P43B 4YO0A 3WDHA 4RFEA 5KBDA 5M7QA 5I9QC 4WKXA 3RUGA 1O6VA 1PG7L 1GZQB 1J7VR 2X4SB 3ARGC 4OLUL 1XGYL 4OLVH 1BVKB 4D94A 1E4XH 2NY0C 3LS4H 4Q52A 2XN9B 1FNGB 3QJHA 1QHOA 2A9AA 1Z5HA 2IAAC 3SE9H 1S8DB 3K6NA 3L1EA 1EGJA 1QMUA 3ARBC 4ZW5A 5CLXA 1HTYA 3DV6B 1L5GA 4XN9A 5FPIA 1UB6B 4NT6A 5T1LB 2N3JA 1WCBB 5K9JH 4LOEA 1OAZL 2WB1A 1UATA 4OD3H 5C07B 1AGFA 3IXAA 1N59A 5C0JA 1N59B 1I9RL 1BYNA 1RIVL 1PKQE 3MUHL 5D6DC 3B56A 1MFMA 4KROC 2ORBL 4AGMA 1MH5B 1A4KA 2W9DL 1MELA 1UJ3B 4LL9A 5I23A 1LJMA 3BP7B 4NB7A 2ENSA 4YE4H 2CPCA 2G75B 4HUWA 1U8PA 1NANH 3M1OA 3UCQA 5AZEH 1KPRB 2F5BL 4NQQA 4XMPL 1FFTB 4H0GA 1JK8A 4L4JA 1XZ0B 4LPXA 4DP7X 3KPPB 1J8RA 3V0DA 2O30A 3PUCA 1MPAL 2PO6A 2Y6SC 4ISVA 1BV8A 3VM5A 2PP8A 3GPEA 1E7VA 3NCXA 5T3XD 1S9KC 4F5CA 3TBBA 5HHXL 3BZFA 2VDQB 5IB1A 3ZLQC 1PNCA 1AXSB 4J4PD 1NFKA 2BCKB 3FAWA 4L9LC 3EYOA 4F8OA 2DQIL 1HJCA 2Y07H 3WNOA 4L8DA 3U1PA 4NC1E 4LSUL 2HG5B 1HZHL 4G6KL 5DJ2B 4JZOB 5I30H 3KAAA 2H5UA 4G7VH 2VTFA 1XB3A 4AW7A 3KYMB 4U0RC 3RIAK 2W9LA 5CJOL 2CBPA 2VKWA 5DVLA 4NN5C 3I75A 3ZHKA 1CK0L 1L9NA 4GG6F 2Q10A 1MW0A 1PTZA 3BKJL 4PV9A 1AIZA 4K9EH 3VCLB 5HVWA 5HHMB 1N0XL 4J6RH 3VXTB 1IC0A 5EU6D 3RG1C 2CJUL 4LNVA 4WI5A 5DFTA 3ZTDC 3U6RB 3UO8B 1MIML 1FFNA 3C5SA 4GQRA 4X8JB 5HGGS 5KSUA 4NFDA 1AJ7H 3T6XA 2XXFA 3F7QA 3Q48A 4JUTA 2N1TE 4P2QE 3D2TA 1HOCA 4JO1L 1YN7A 1MI5A 4GKNB 5C0CE 2RALA 1BVNT 4RRPG 4WEEA 1HI6B 1QA9A 4FXKB 4P5TA 3RDTB 4IOSA 2OJ1A 2J4WH 4L4VD 2FTAA 4IGBC 4G9DA 3IDIA 4NQCB 2XQBH 3O2VH 4W81A 5SWZE 5DD0H 4I9WE 4X2UA 4DPAX 3L3KA 4ZMZA 4F7TA 3JWNC 4ERSH 4ACPA 1IEBA 4E9TA 1WCQA 3K7UA 2F74B 4LRIA 4NUMA 1FC1A 3FHQA 4MDJB 1P7QD 4QRPD 1BVLB 3GK8L 3ZYZA 3O4LA 4H8WL 2W5PA 1CXKA 2CHDA 2ATKA 4L37A 3QRGH 4JO3H 2ZIDA 5J9PB 3KGSA 3LHPL 5FGBA 1CICD 3FTSA 5MERB 5F9JB 3QFJE 4RDBA 4FFZA 4Y1TA 5TK2A 4AIOA 4Z1PA 3TF7C 1T1ZA 3RIAF 4LDEB 3X14A 2BM3A 3K72A 4PD4K 3PXLA 3M17B 1MHEB 3QCVL 3TS8A 3IFLH 1H15A 2BS71 2OMVB 5FA3B 2XUWA 3QG7L 3LZQA 3WL9A 2OMTB 1SFHA 1K9TA 2VDML 4FG4A 4ONGL 2XTSA 3H4HA 3VVVA 3W81A 3OVUB 2ZXAA 2DKSA 1ACXA 4UINL 5DZ9A 3UTTA 4D7BA 4KMQA 5GGSB 1U8CA 1E9PB 1J5OH 5EOCJ 3PXJA 3BPOB 3PWVA 3F7YA 5D96C 3GJFK 3EOAA 1OGAA 2X40A 5D55A 4OFKA 1N67A 2BXZA 5FYKD 3QQDA 5BUAA 3S97C 3KYKL 2X89A 1I8KA 1SRDA 1ZVHA 1ZJAA 2UZIH 5EWIH 1O7DC 4C56B 4GQPH 4YHLH 3MRBB 1SHMA 4BD4A 1QI3A 2QVKA 3SOBH 4ONHB 2GK0B 3ZE1F 5EA0L 3W57A 4BFEA 3KJ4B 1XF5A 3NABH 4XOEA 5MI0B 3IAGC 3FFOA 2YGOA 1IJNA 3D8MA 5DC9B 4TNWK 2Z92A 2VXTH 4LSDA 3HBZA 5BV7C 1G6VK 1RURH 4NP4H 5KVDE 4Q9QH 4NGHL 3NP4A 2MSPA 2JJWA 5DVMA 3SDAA 4YHYC 1IGIH 1FNAA 4XVTH 2YS4A 5HYEA 5I66B 5CMAB 5AVXB 2VXSH 5AW8B 1GSMA 2R1XB 5C0FA 4BZ1L 1JG9A 1KN4H 3VFMB 3H9HB 5DI8A 5DUML 5FDWA 3G5VB 3UTTD 4I48A 3T1WA 1T0NB 2K6WA 1VSCA 3TC9A 4Z0BL 1KYOK 5KG9A 1OSPH 4ZMLA 4QY8A 1RIUH 2IANA 4OW6A 3OAYK 3WIHA 2VR8A 3NSXA 5C0DB 5L2KD 3FQWA 3MLRL 5FYLH 4HGKC 3C5ZD 3FS9A 5HI4D 1E4XI 4D9QE 3H9SB 3WFDH 3KBEA 2YZ8A 5HHVL 5BQ7A 4LB8A 3C60A 4RAUA 1MCBA 2F7IA 3O3BA 3ARPA 1K72A 2QQQA 3PWNA 1XF5B 1N5AB 4PJEA 4WO4B 5F9WB 1QR1B 3DSNB 3AG1B 1BLIA 3MA9H 4HJJH 3T08A 1KYUA 4DGUA 1CZ8H 1ZLSH 3SDXF 3U1SL 4TUKH 5CZKA 3MRBA 5TDOB 3WUWB 2PF6A 5C0EA 5DFVC 4RMSA 5D1QE 5FYKH 5I28A 2ZOWA 1FBIH 2F1BA 2N56A 2WTRA 3AG3B 4G8FB 1IL1B 3VRJA 2VH5H 5EPMA 3SGJC 4AGPA 4ZI8A 2OK0L 4AVJA 3MN8A 1ZHLA 1JRHL 1MHHB 5GGSA 3ZUCA 2XWCA 3B9AA 2PTUA 4WLCA 5LGKA 3CXHJ 2Z7YA 4GI6A 1HSAA 3GXIA 2HCZX 4ZPTB 3HUJB 2YUXA 2JQZA 5B38A 3QO0B 2EYSA 4L0ZA 4NI3A 3WDIA 4DW2H 5AW5B 3BLPX 3FQTA 3FQTB 1TYEB 1V05A 5IHUL 1GGBL 3BIAX 3MRGA 4ZMWA 2DQDH 3RHWF 4ZFZA 5IB4B 2H3KA 4JG0H 1RZKC 2AERT 1PLBA 2A74A 3P69A 1PQZA 4FYSA 3HR5A 4NQEB 3QRLA 2GSGB 2R1WA 5GJTL 1YYMH 1KLFA 3FNKA 3N5AA 1HOEA 3ZJAA 4XNQB 3V2AR 4XPTH 2RQEA 4Z0XB 4JCMA 1EJOL 2VLRB 4P2QA 2GJZA 3FN3A 1M3JA 4FFYH 4LLUA 5CINH 3JV4A 5F96L 5TF0A 2IAMC 4P4RA 2ZYRA 5I8CB 3BMWA 4OCXL 2B3IA 1IX2A 1CN4A 2DPKA 3U2SB 1CGUA 5ESAA 3NFNA 1N5AA 4WO4A 3GSXB 3R18A 3QWQB 3VA6A 1QR1A 2ETWA 2DYPB 1CLVA 1ZANH 2UZXB 2VW7A 4M1CC 4OF5A 3PHOB 5B1KA 4G9FE 1XH2A 4LKXB 4O9HH 3ARGD 1W9XA 4ZDHA 3GUTB 1ZS8B 1ZTXH 1NEZB 1OE3A 3AY4A 4U49A 1OK8A 2C7UB 2HA1A 1WS7A 2BW5A 1JPEA 3PDOA 3V6FB 3PFQA 1W0YT 1R3IH 3D39A 4LHJB 3H42H 4NLHA 3RZCB 1VFUA 2QHRL 3SDDB 3U36B 5DGQA 1A0QL 3Q6FB 5AAWC 5AB2A 3GMOA 1ZV2A 1RSFA 3GRBA 3NGBB 1PSKH 2PABA 3NIGF 1UOWA 1CTOA 5AOZA 5F7AA 3QPXH 4LAQH 2KQNA 2YR3A 3EHBD 2ZZUT 3G3LA 3LKSB 5FWRA 4F92B 2P5WD 1CFTB 2H6UA 2VUKA 3QDJB 1BQ5A 4UOW0 1R33A 1LYQA 1D6VL 1DBKL 4RIRB 3PV6B 4YHMH 5B39B 3DYMA 1S3RA 5IK3B 5C09A 3TLRA 5ITFB 3LRLA 4BFNA 3FXIC 3OAZK 1P1VA 5D7LB 7CGTA 1Z3GL 1JMXA 4KRMB 3EGDA 1UWXH 4QXUH 4UDTB 5E99L 3MLUH 2L7JA 3B8SA 1QWNA 4XBEL 4OB5L 4KZCA 4EUPH 1LLAA 3HNVL 3O6ML 1KEGL 2RHEA 3ULVE 5GGRY 1ETZA 5DJ2A 4E41A 3KPNA 2FLMA 4FL4B 2DTSA 3HVDA 4IBWA 2N7SA 3MGTA 3PU7A 4J4PA 5HYSB 3KYAA 4GXVH 5ALBL 2OMYA 2YEZA 5C7XL 4TXVB 5JR1H 1BZ8A 1PYWB 1PLAA 3NP3A 1FV1A 1K5NB 4FQHB 4E9SA 4ETQB 4U1LA 3UADA 3W11D 1A1MB 3I2CH 4PJFE 7TAAA 1R34A 3WKYA 4XOBA 4CSSA 3WIHL 5KSBA 4KPHH 2NZ9C 4FABH 4UU9B 1U3HC 4QJ4B 1CR9L 2IBZY 4NYLB 1QTSA 3LKSA 2YHGA 4KVNH 2R7EA 4HH8A 1CE6B 3JWDH 5TE7L 1ZA6A 2CBTA 2JKLA 4F2FA 1CB4A 4TRPL 1AMYA 3SPIA 5B4MC 1G84A 4OZGF 2G0KA 3TBSB 2YXFA 2B1AH 3D85A 4FDWA 4NHUA 2P5EE 3WEOA 1M7UA 3B2PA 3RZCA 1ERNA 1MN4A 5DJXA 5F9JA 3DDFA 3ZR5A 1QPKA 4YMPA 3WFCL 2C34A 5AD0B 1LXMA 2EYTA 3RWGA 3SDDC 1VIWA 1ZS8A 3IMWA 3BC9A 2CHZA 3HPLB 4H8VA 2EVIA 2EQDA 5IUSA 3DBSA 1QSEA 2VDOH 3MXVL 2Y7QB 1SJEA 4XP4H 4JDTL 4MJ5B 4TV3A 5D4JA 4XCEA 4ABVA 2GC4C 3D2UB 4DETA 2WIIB 1FGNH 4WTWA 2WWOA 1RK1A 2KL6A 4BUGA 2XWJB 1KPVA 1LE9B 2ICWJ 5FLVA 4XMWA 4KRLB 3TYFB 2PYFA 2BSTB 3I50H 3QDGA 4MRCA 1G6RL 4AC4A 4Z5RB 6PAZA 1OF0A 4MX7B 4GAYA 4Z76B 2OSXA 5ESVA 4XXCA 2OKMA 1L6PA 4Y2NA 1N64H 2N0KA 3VI4A 2Y7LA 3X1NA 2K8MA 4OF8A 1XCWA 2E6QA 4A2MA 5CWSA 2AJSH 1NCBH 5AB0A 1MZZA 3WLWD 1HL4A 2L8AA 3MR9A 4NNPH 1KCLA 1QBLL 2GABA 5HP5A 4FYQA 3MLYH 4UIKL 2EEXA 5IFHH 5H37H 4Z3HA 1IAKA 3M8OL 3AUVA 5IP4A 5GRJH 1A66A 2UWEB 5AAWA 2XVKA 3VXMB 3CIAA 3VXME 1QUPA 3QQ3A 4JQIA 5FF6B 2B7DT 4PB0H 4YHNA 1DQVA 4Z7UB 2WTRB 3S34H 3WTUA 4PJXE 4ODTH 1WDAA 5IJVA 3GIZL 4YZWA 1ZSDB 2WNKA 3V5DB 3QAZB 4BFIA 3KMDA 2WLIB 3C75A 4A7QA 3DECA 3OX8A 2VMJA 3ARYA 4PJIE 1UXLA 3Q8FA 4LSRL 4W4OA 3X11A 2YK1L 5DJZA 1T2QL 4ZK8A 1C7TA 4WO4C 5F9WC 3MRCA 1MHCB 4JFTA 2X53A 2CO1A 2ADFL 3FTWA 1AXSA 2I9TB 1RU9L 1SEQH 1UM5L 5E9DD 5BOJA 4X6CF 1XMEB 4IK6A 2PR4L 1J1PL 1F2QA 1BOYA 2EDFA 3CPLB 2G0LA 2J6EA 4Q74A 5ABZA 4GKLA 4KXZH 4ZTOL 3S96B 3QDMB 3V7AE 1BEYH 2FDBP 1J48A 4M48H 1KLGB 2FQGA 3AMLA 4LQFL 3GJFA 1AD0A 1I8UA 4V1DA 3KLAB 5F44A 5FDWB 4HXAL 5MENB 4PGEA 3U1QA 2K6YA 2Y5TA 5KOMC 4Q2ZA 5DF0A 1JTOA 4QCIA 4YR6B 5T5NF 4AGQA 4EE2A 3EJTA 5IIEA 2IOMA 5CMAA 3VFGL 2QT6A 5D1XE 2LVEA 1B4RA 5F89A 2GEQA 3I6GB 2DN7A 5DEZA 4LGPB 4XPFL 4B6ZA 3UXFA 5PAZA 32C2B 3FN9A 4BIKA 4ONFH 3RWCB 2G60L 1I75A 4HLZG 1X5IA 3FRUB 2Y1ZA 2Z4QA 4I88A 3SODB 1WLHA 1QUNB 4CADA 3L3IA 4MAYC 3UGEA 4YS4A 2E7DA 3TBYA 4KXZI 1ZOXA 4UUJB 4F1ZA 2FWOA 3VFPB 3RVVC 2MCG1 2VT0A 2K9UA 1VACB 3TJEL 1JZGA 2X1XR 4QIRA 1G0DA 3LRGA 1AO7D 4QD2E 4P48A 3QQ3B 4K7FA 2Q8BH 5J3HD 1QW8A 3KLSA 1OCCB 5AALA 3GO1L 1OXYA 3BKML 3CV5A 3RX5A 5DRXA 1IM9D 1F4WH 1URIA 2IGFL 4E5XA 1LO5B 1AZZC 3KVDD 4OJEH 4B3VA 3WN6A 3CVHA 4OLYL 5L7XH 3C09B 3VMPA 1QD0A 1BCIA 3RDTD 5C0GB 4HS6A 4YHOH 5CCHE 4GIOA 1N0LB 5DVOA 3WYRA 3L48A 1F6AB 1B4JH 1HJBC 1F8TH 2AVGA 2GTWB 2ZUYA 3LN4B 2HJLA 1HCVA 4Y5XA 3UL4A 2P5EB 2Q8AH 1NC2A 2RACA 5D7LE 5I73B 1KBBA 5JZ7D 1WITA 2JKIS 1LQSR 4FQCL 2A99A 4WI2A 4ZFOL 4XZUA 3H4FA 3S5LB 4RMBA 4UQ3A 5B1CA 3TIDA 3KLLA 1OM3L 1BZOA 4OVUA 3LH2L 3JWNG 4M5YL 2MTAA 1X7TA 1U0QA 3OQ3B 2PCYA 3Q43A 2LR4A 1AP2A 2C9UA 4X7SH 2D2OA 4OZFH 4X7TB 5CILL 3SN6N 5I17A 3ECUA 3QK0A 4WWKD 5AVVB 3N0AA 1XF1A 3DI2B 4PI0A 5CFHA 3QUXC 3QUML 3TCXA 3W0WD 3DO3A 4DN4H 3ULVH 4QKTA 3I9GL 2H2SD 2IDQA 2F7QA 3N0PB 5K9OB 4MD5A 4AIZB 1IQDA 1YECH 5AYTA 4HF5L 4FC3E 4XXDA 5ELIA 4ZMTA 3VQ1C 4LLDA 2EE9A 1X5LA 1DP0A 2VZUA 4KZEH 3CZFA 4MJ4A 1ZA6B 1ZVNA 3ZPDA 4UWQB 4XXWA 5HVHB 2X6MA 4UV7H 4GINA 3MLSH 1Q90A 2YLKA 3EFDL 4JGJA 4M8QB 1A6UH 2VXUL 4DWHA 3D30A 1GZPA 2FEDC 1OLZA 3EUDA 3WTVA 4YDIL 2OZ4H 2UXFA 4AKOA 4JN1L 2C4FU 2EP6A 4LPCA 4XWGH 4L3EE 3AROA 4JPQA 2C9RA 4NQED 4OLWL 3DETC 4RAHA 4NX0A 3CH8A 5AUMA 3RVXC 5IESH 5MEPA 1DTUA 5AYUH 2VO5A 1CFBA 3TWYA 1CBJA 5I18H 3LKNA 2DTML 3G5ZB 3B7RL 3QI9D 4FLQA 5KW9L 1DJSA 1S7TA 2JI2A 2IPTH 4XB7A 4ZAKA 4ZXBD 1T83A 4N87A 3BPNB 3KGTA 3IRPX 3B9KC 4XZUB 4PG9B 3WUWG 4P4KA 3T65B 3L4VA 1JHKL 1ML0A 2F58L 3QFJD 3MNVB 3X12B 1RHHB 3FQNB 2A6DB 4ADIA 2F53D 4APQA 5F6IB 1O7SA 4FFTA 4LMQE 1IM9B 1B0WA 4PCKA 5KYYA 3N85H 4ODSH 5C0RL 3RL2A 5IROD 3KH4A 2JQMA 2AQSA 2L3BA 2J25A 5L8JB 4XNXL 3DARA 1DLHA 2J5LC 2W80C 5IVXB 1G9NL 1RKRA 1JK8B 1E6JL 4YFDB 4KRPD 2OMXB 3FB7B 2CGRL 3BSHA 2K45A 5EN2B 3PNWA 1A3QA 4ZX3A 3F2LA 3K2IA 4U05A 4JKWA 2OX5B 5BV7L 5CEXB 1NL0L 4K3GA 2C7UA 1JVKA 3V6FA 4CU7A 1NICA 3O9WC 3ZL4L 4Y19B 1UJ3A 2W9DH 2DBJA 3SGEH 2NX5B 4MXWL 2UZXA 2WMPB 1TU2A 5EU6A 2D7NA 1TVBB 3EGSA 1ZV9A 4L3AA 3QO1A 2HVJB 3DO4A 5D7KE 1S7UA 4KRNA 1ZLWH 4LEOA 2PXYD 4FA8A 3NK4A 2JMRA 2IFFL 3MV7B 5FGCB 4X9YA 3F7RA 5AG9A 3KH3A 2BZ7A 4EBQH 4RVBA 1A7RH 5F89B 1FLRL 1MCOH 3FU7B 2IOOA 2EACA 3VXSB 2ZP9A 4F2ME 3HN3A 5AVYB 3WHXA 4NQEA 4P9HH 5A2CA 1G6RB 2R9HD 2NSQA 3W39B 4XVUD 4ZX4A 3B3BA 4M1DL 3HMXH 1BAFL 3S37H 1HHJB 2WPGA 2VYRE 3CLEH 1IILE 3KXFD 1DVXA 1WZLA 5C9JB 1ZHKA 4A2HA 1F4YL 4G6MH 1RAMA 1AXTH 1XSIA 2Q87A 2UY7A 1BJ1J 1EO8H 4JO4H 5ADPL 3UYPB 5JZ7C 4GBXB 4DGVH 1CFVH 4Y4KC 1E4HA 1DVTA 1NC4A 3LQZA 4PW9A 4KFMA 5BZXA 4UV4H 5I24A 1KZYA 3X11B 5BOZG 1T7XA 1SLUA 1P5VA 2EXSA 3LPPA 4HK0A 4JY4A 4HK0B 4JY4B 5IREA 4Q89A 2XJKA 4AYGA 3P0YH 4N8VG 5H4YA 2K8QA 1VPOL 1ZSDA 4GRMA 1UKQA 2YJLA 3CVHH 3V5DA 3ZE0E 4BFIB 2HFFB 4ZSOB 3DXAD 5LCVL 3VXSE 1XR9A 3BSZA 1J05A 2JB6B 2WVVA 4M02A 2BK8A 1HWHB 2ICEC 4AUUA 2R23A 5FF6A 1D7DA 3QUMA 4F2MB 1MWOA 1FORH 1L7TH 1KTDB 4H26A 3UJIL 3H0TA 3RU8L 3DK0A 3EKCA 3B6SB 3L1GA 3ARFB 4F8TA 2IALA 1KPUA 4MA3B 3CZNA 1ZGLM 1ORQB 2HLAB 4Z6AT 5E8NB 3C6EA 2Q3ZA 1G5AA 4WUUA 3MBXL 3IGAA 2V7HA 2I25N 2X2UA 3COOA 4KJPD 3HFFA 1ULVA 4PMFA 5JW4Q 1OP4A 4QYOB 1XBDA 4WW1B 4GUOA 1TZ8A 2ID5A 1XGRB 1F11A 4KDTA 4PRHD 4NN6B 4FG0A 3ZDXE 1WIOA 5DQ9A 4H88L 1NBYB 3QB7C 1BFVH 4DSYA 5DYOA 4N68A 4BZYA 5IJKC 4NKIL 4FFWD 4GSXA 3HPJA 4OZGA 1BZDA 1BG9A 2ADYA 5SWSD 4C59B 1I9JH 1KCVL 3MV7A 5AKSA 1FCGA 5H94A 3KM1A 2JE8A 2WXPA 3BXNB 3AAZA 3B9DA 2WNWA 5BVPL 3BRDA 4N86A 1L9RA 4W9ZA 1FYHB 1QSEB 1T7YA 4H1LH 5AKVA 3BJLA 1XBRA 4XVSL 4P0DA 3LRSB 2ENPA 2KLSA 5B38G 1DQLH 4ONGH 3RIFK 3MFFA 1FGVH 4YPGA 3TT1L 3HTLX 4IK7A 4GRLC 3R1GH 3TIEA 1J0HA 1SDDB 4KAQL 3PWVB 1E27B 4PS3A 3EJZD 3D5OF 1FDLH 4WFHE 3WHE0 4UTAL 1TVDA 1EEQA 4E42A 1CBVH 4KY1L 4YBHA 3VI3B 5EO1B 3HZMA 4X4MA 1HH6B 1CI3M 1A3LL 3IMTA 1OSYA 1AGBB 1U36A 3P0GB 2ZUTA 3ZYIA 5BW7C 4KI5F 5HHOB 4F80A 3U7YH 3UPRB 4GP4B 5IHWA 5DK0A 4CW1B 2EDYA 4XVOA 3EJYC 4NLAA 3FCTA