1B4TA

H48c yeast cu(ii)/zn superoxide dismutase room temperature (298k) structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHICEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROTEIN (CU/ZN SUPEROXIDE DISMUTASE)
publication title A structure-based mechanism for copper-zinc superoxide dismutase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 37
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1b4tA00
1SXSA 1TO5A 3MNDA 1EJ8A 1XTMA 4BCYA 1IBHA 1E9QB 3KM2A 2V0AA 1OEZW 3HOGA 2AQQA 1SXCA 3PU7A 2WKOA 3CE1A 1SRDA 2VR8A 4OH2A 2LU5A 3QQDB 2Z7WA 1B4TA 1B4LA 1MFMA 2JCWA 1S4IA 1UXLA 2GBUA 2C9SA 1DO5A 2ZOWA 2Z7ZA 1JK9B 1YAIA 1Z9NA 1E9QA 2AQSA 2XJKA 2SODB 3GZOA 1HL5A 2AEOA 3H2PA 1OAJA 1TO4A 4BCZA 2E46A 2NNXA 2Z7UA 2C9VA 2WWNA 3KBFA 3LTVA 1BA9A 4A7GA 4A7SA 1F18A 1SXZA 1N19A 1JK9A 1U3NA 2WZ5A 2WZ0A 1EQWA 1HL4A 2Z7YA 3ECVA 1KMGA 4N3UA 5KBMA 5KBLA 3L9YA 4U4IA 3GZPA 1F1DA 3HFFA 1SPDA 2GBVA 2WWOA 4A7VA 2AQRA 2WKOF 2WYZA 2Q2LA 2VR7A 2WZ6A 3KBEA 4A7UA 1QUPA 1E9OA 4A7QA 3CQPA 3GQFA 4B3EA 1FUNA 1N18A 2K4WA 1OZUA 1XTLA 1YAZA 4MCNA 2R27A 2ZKYA 2WYTA 3H2QA 1CB4A 1PZSA 1XSOA 1CBJA 2AF2A 1E9OB 1SDAB 1SDYA 1OZTG 1YSOA 5CU9A 2GBTA 3ECUA 1SXNA 1IBFA 1P1VA 4A7GF 1BZOA 1RK7A 4BD4A 1Q0EA 1ESOA 1E9PA 3GZQA 3F7KA 1Z9PA 4A7TA 3L9EA 1F1GA 3GTTA 3K91A 3KH4A 2E47A 1PTZA 2C9UA 1IBDA 2ZKXA 2ZKWA 1DSWA 1SXAA 2XJLA 1UXMA 4L05A 3S0PA 1F1AA 1E9PB 1L3NA 2AQPA 3T5WA 4FF9A 1OALA 1COBA 5KBKA 2VR6A 3ECWA 3RE0A 2APSA 2AQTA 3GTVA 3KH3A 1IB5A 2JLPA 1JCVA 1SXBA 1AZVA 3F7LA 4N3TA 1IBBA 1SOSA 2AQNA 3CQQA 3MKGA 1PU0A 3QQDA 3SODB 3KM1A 4MCMA 4OJAA 3HW7A
chains in the Genus database with same CATH superfamily
1LO2L 3BEWB 3MBWB 4MD4B 4MX7A 3BPNB 2CLZB 4W9JC 1ZLDA 3U30C 1IAIH 4J4PD 3ZDYF 5D96C 2FEJA 4Z5RA 1M7IB 2GC7C 1SUHA 1MFDH 3WFHB 2WBJD 4Y5XA 3STZA 4NKDB 9CGTA 2QQNL 2A83B 1P1ZB 1T5WB 4X6CA 1E5AA 5IR1A 3RTQB 5HJBA 4EUPG 3R0NA 5AYUH 1M42A 1D5MA 5C0JA 3D18B 3QULA 4LEBA 1BBDH 5DRZA 5ID1A 3EO0B 3TLRA 4ANWA 4WUUE 1YEDB 2BRRL 1UUSA 2YRBA 3QNZB 1TSHA 1OGAE 3ESVF 4U3HA 1R5VA 3DX9B 5D7JB 1K6QL 3AGWA 2B1HH 4PV9B 1OCWL 3OKLA 2AC0A 4DN4H 1ITCA 4OLWL 1HI6A 5IEHA 2AVFA 5C0IB 3QEQB 1KUMA 4JGNA 3C8HA 3H4FA 3TASA 3QIBD 5HI4D 2VL4A 4JPSA 2YLKA 5AAWA 4KY1H 1JPSL 4NN5C 1KGWA 1X9LA 4UAOC 5ICZA 1I1AD 4PJ5D 4R3SB 4WWKB 3IU4H 3A24A 1AE6H 3FFDB 5J11C 3BYYA 2GUYA 3KXFD 1C5CH 2BSTB 4GPVA 1JGLH 3T6XA 1K3ZA 3ILPA 2WXQA 4OLZH 1NMBH 4LBEA 4U1GC 4Y2DC 5F89B 4ZUVA 2B3RA 3SJVE 2UZIH 3FOMB 1SMAA 5D7LB 3GEFA 4M8QA 5JOFB 3QDJB 5AOMA 3UZQA 1JGVH 4AQAA 2JXMA 1OZTG 1G5AA 3B9VA 5T1LD 4H4NA 1JHLH 4QJ3B 4PJGE 4TKWA 3UAJA 2G4EA 4PBXA 3KLHC 3FMGH 4TSCL 3PWPD 4G6FB 1I31A 1FIGH 3S37X 4IHOB 2VMCA 1NJ9A 3B1UA 1IT9H 2QELA 3IF1B 4GI9A 4IGBC 2F8VA 3II3A 4OZGA 3LRLA 4DP5X 1QSFD 3ZE2E 2R7EA 3IDIB 5CILL 1F2QA 4OZIA 1OHQA 2YAFA 1AGFB 1ZLSH 4D3CH 4PY8I 3B34A 1BFVL 3UTSD 4G6JH 2OSWA 2R2HB 1SJHB 1J10A 4PJ7F 2IQAA 1U8HA 2HG5B 1ZTXE 3MLYH 5HGAA 5HY9A 5T33H 1G1CA 4F3FB 3MV7D 4I85A 3BP4A 3D85D 4HLJA 3NZSA 4X6BB 1A6ZA 2YMXH 1DQQB 3NACH 1VEPA 2N0KA 3DBSA 3L7FB 4QD2E 3LS5H 4XT1C 4AYEC 2YD1A 4GY4A 3GBDA 4AZ8B 2AK1H 4KKLD 4KVCH 3F12A 5BNXD 2ZUUA 1W0WA 2GJZB 5BRPA 4O2EB 5HYJE 1L9SA 2FL5A 1QTYT 3UJIH 5EOQH 1L6PA 1YVLA 5IB2B 4OLYH 4QRAA 2BOLA 5FGCB 4JQIA 5I0XA 4Y19D 4UCFA 1C1EH 1IAIL 3PWUB 2NLJB 4PVMA 1F6AB 4NGHH 4FA8A 2Y7QA 1FNEA 2IADA 1WT5A 1MFDL 1X9QA 2LTQB 1NCIA 2VDKB 3FO9A 2GUOB 2XDHA 3IJEA 4QAWA 4QXWA 2O6PA 3IJHB 2NW2A 3JUZA 4FL4C 4AKOA 1L9QA 4DK6A 2NY6C 3QEUB 5HGBA 1MFBH 5AYUL 3GPSA 4NZFA 5IM7B 3VXNB 4M48H 4GKNB 4YNYA 1R47A 2HTLC 4R7XA 3QUHA 1MREH 4MYPA 1CL7I 2HJLA 3K71A 1FNFA 1L7TH 4OD3H 3VSTA 3MROA 5IEKB 4XTRC 4FLRA 2B1HL 4JM2C 5LB1A 3D12B 4DN4L 5BV7B 4Z7WE 2M83A 3ZO9A 4ZUUB 4F1SA 5F1KC 3KPRE 5IMOB 2DQHH 2VDLB 2EYTB 3HG1D 1UB6B 3ULUF 3GMLA 4KY1L 2IANB 4MXVE 3EJYD 3U2SA 1OZUA 3Q2NA 4YHNB 5I2IB 3IU4L 1JXFA 1AE6L 4OCSH 3ZTJH 4NFCA 1QBAA 4M6MH 4L9DA 1WZKA 3PDOA 1I53A 3MHZA 1LGVA 4PJHE 1C5CL 2YD7A 3DO4A 1ID5I 1JGLL 3ARFB 3TO4A 2PP9A 2GW5A 3MYJA 4OLZL 4CC4A 4KITB 1NMBL 1MQKH 4PWGA 2IH1B 5J6HA 5C0EA 3KJ4C 4KK8C 2DYPD 2IAMB 2IF7A 4HUVB 2UZIL 4JFEB 5A2AA 3JVGA 3K91A 1FL5B 5D72H 1JGVL 1K5NB 2XTJC 3C60C 5AENA 3M46A 4B9JA 4DFHA 3PXHA 4I3RH 1JHLL 3BSGA 3CN2A 1DSWA 2OMBA 3FMGL 3A4FA 4GJTB 4U1IA 2QPFA 1VDGA 1FIGL 2CUAA 6PAZA 5E94B 1IT9L 4FG2A 4N2FA 4XC1H 5E9DD 1T7ZA 1HL8A 2Z8RA 4IIQB 2BIIA 5HGGS 2ZX6A 2NDFA 4P2OD 1H6FA 3AADB 3WO3B 4ISVB 4JO4H 1H3GA 3MNWA 4JZJA 1TZAA 2VWEC 3N1FC 4D3CL 1FVDA 5C0DA 1J05B 1FYTB 2VMFA 4G6JL 4IW4C 5C07E 5IT2H 4WO4B 3GMPB 1LO5B 3BT2H 3V6OA 3ZZSA 5IKCA 3RY6C 3KM2A 4MYWB 4NI6A 4EBQH 5T33L 3MLYL 4PJAB 2GJ6D 1KJ3H 2PPFA 3RFZA 2YMXL 4MDJA 3NACL 4NKMA 4QF1B 1RPKA 3AZUA 4DERA 3LS5L 3KYMB 4ZFOA 5E8EA 2ZOWA 3BN3B 3KW8A 5E5MB 4JY5H 2AK1L 1T4KB 2J3SA 3QPQC 4KI5E 4X0NA 1PX3A 2KDYA 4APQB 1AR1B 3O3BB 4U6HB 3HFMH 1XIWC 3DYOA 4K7FA 3UJIL 4OIIH 3WN5C 3ARGD 2I25N 4G8GA 1KGXA 2CO2A 2FYVA 3N44B 4ONHB 1WFMA 4HS3A 4JANB 4OLYL 1BA9A 4D9QE 5JPNB 2WO3B 1YMMB 1C1EL 2BVYA 3EG9B 4NGHL 1FYHB 2N7SA 3GSRA 3RB7A 1MI5B 3BJ91 3FO1B 3Q8AA 1BPLB 1J0YA 1DLHB 4O51A 5AW2B 4QY8B 3T77B 3MPCA 4KDTA 3QUYD 3RHWK 3N2JA 3OWRA 1ACZA 4F92B 1WZLA 4W9DC 4YHIB 2J56A 1A14H 4ICXA 2DKMA 4M48L 3VYNA 3DWTA 3BRFA 1K3IA 3EOAB 2HN7B 2EABA 1MREL 3IMTA 4NQCB 5IW1B 2Y5TA 3MGAA 1ORQB 1ANUA 1L7TL 4OD3L 1AO7E 4W9EC 1R1CA 4OF3A 3B7SA 3TP4A 2XLLA 1AGCA 2ZXWB 3SE6A 4ZG1A 3BUBA 3GF8A 3FU6A 1WF5A 5C1MB 1MWAB 2D0HA 2DQHL 3BDBA 5TGBB 2W0LA 1QQDB 3S37H 1BQ5A 3BH8A 3RUGF 3SPJA 2J2ZB 5GHWH 3RP1A 4OCSL 4YSUA 3FQRB 4M6ML 3VQMA 1F58L 3RILA 3HNSL 4HU8A 4Y1AB 1S9KC 1QSZA 4XGZB 4BQ8A 1MQKL 3SKMB 1KBWA 5F7HA 2FQFA 2QKIA 3L48A 1WE5A 4M9PA 4GRWH 2FO8A 2V3DA 2YEVB 2GVYA 4CUCA 4H88H 1WD8A 1IFHH 2JKSA 5D72L 5LCVA 1OPOA 1I1CA 4L9LC 4MQTB 4P04A 4PJDA 2ICEB 2XQYG 2C9XA 3ZOAA 1RZGA 2K3TA 3LDBC 2VXUH 1AI1H 2DAVA 1UKQA 4WV1B 4XC1L 2VXSH 2AHIA 1O6TA 5E51A 4JFDD 5T1JA 4YFEA 4QOKB 2WKOA 5L2KE 2BPBA 2BX5A 5JIHA 4JO4L 3DPBA 4PV8B 1LE9B 3ARBA 4MJ6A 1A65A 2AXGB 3DYMA 3SDDA 5CFAA 3CLEH 2AMUA 4LIQH 2L7QA 5IT2L 3BT2L 5J4MA 2UV3A 2Z7ZA 4WKXA 4TVPH 4EBQL 5ADOH 4TS6A 2EICA 4P46A 1KJ3L 4KXAA 1URLA 4KJPC 3VGAC 2Y3AA 2WWMD 1GR7A 5E99H 3DGGB 2VZ1A 2FT6A 4YHMH 2XG5B 1S78D 1CE1H 5KVFE 4XO3A 3VRJA 3CUPA 4TUJA 1IGJA 2G3ZA 2N7BA 3DVNA 3HFML 3K7UA 1HFUA 4UTBH 4XMWA 5EG6C 4QRQA 3OG4B 5A3ID 3AWGA 1J11A 1H6EA 1U8QA 3BP7A 3GMMB 1MXGA 3L3KB 3GTNA 1P84K 2OXGB 3UXFA 4U1LA 4QTFA 5LGYA 5LAXB 3L5WB 3EHBD 2WCPA 4PLNC 3CH1B 3WNOA 4ZYKA 2MQ0A 3ULVE 3RZCA 1QR1A 1NC2B 1BZ9B 1LDSA 5GS0C 2PCPB 1GSMA 2Q2LA 1IGFH 3FCBA 2KZKA 3ZTEA 1FH2A 4RAUA 3CVHH 3RTQC 2W65B 2Y6SD 2X6MA 4HU2A 4RZKA 4CVXA 1NKOA 2HB0A 2J8UB 2ZG1A 3DOSA 4M6OH 3WEMA 5LG6A 2BXZA 4R5TA 5F0MB 1GJIA 1A14L 2AQ2A 3O2WH 2R27A 1IBZA 1BZ7B 5DQDH 2H32A 4GS7B 4XPTH 5J12B 1JZEA 2PPDA 5CP3A 4NWUH 1FDLH 2CPUA 5DJZA 5AW6B 4OB5H 1OHZA 4D94A 1N7MH 5D7JC 4LU5H 2I85A 4JVPA 3UTPD 4K8RH 2YN5A 5D2NE 2ZUTA 1B88A 4DZ8B 3D2UD 3PHOB 1Y7VA 1K8IA 2WWKT 4QXTB 4HJ0C 4ELMA 1YMHA 7PCYA 1VZHA 4G6AD 3S37L 5I1LA 1H8SA 4IBTA 4WWKC 5FKPA 5GHWL 1A7NH 3HKFA 3T5WA 1T7VA 1S7QA 3VI3A 2P8MB 4XN9A 5ITBL 3NSDA 5I1HH 2FJUB 4RRPG 3V5HB 2H1LM 1J18A 2AQNA 3QI9C 3U9UA 1I9RL 3ESPA 2PMZA 2YPLE 3K4ZA 2JJSA 4PGDA 1EZVY 4BKLA 2JWYA 4RA3A 4H88L 1XZ0B 2GCYA 5AL0A 3IBOA 5EORH 5DVNA 4LOFA 4KY2A 4Y5VC 5DUMH 2VXUL 1UXLA 3FT2A 1AI1L 1JZ6A 5F7YC 3K6IA 3JV6B 1JZ8A 3O6FC 2VXSL 4FADA 4GAGH 3WD5H 4CSZA 4FQQA 4Z3TA 4OQ1A 3PGDA 4ONGH 1IBGH 1OD9A 2DWXA 2YMOA 3K0YA 4Z3GA 2ADJA 3BW9B 4ZPVA 1PY4A 4F33A 3MJ7B 3CLEL 4LIQL 2VDLH 2ZSVA 4LARH 4ZI8A 3VFPA 1UATA 3WO4B 3B8SA 4TVPL 3UG4A 5ADOL 2E9WA 4JN2B 5KS9B 4X9IA 4BSWA 1PJ9A 4BA8A 1RKRA 4JDEB 4AEHH 4U1SA 2VR4A 4XVUD 3F62A 5E99L 4LEXH 1IV8A 4RDBA 3RG1C 2WMPB 4EZMA 4F8TA 4QRPA 2Z7YA 3SDXB 3M45A 4Z1PA 1IGYA 4PR5B 1CE1L 3WS3A 2APXA 5D7IB 1MLBB 1F3DH 4UTBL 4YE0A 1E5BA 4NJ9H 1WA1X 1E27B 4WFFD 1QFPA 1BREA 2F68X 3WIFA 4HPHA 4OCXH 4QHUA 4PTUB 1TQVA 4RFEA 2AW2A 4UNTA 2P80A 2Z1PA 3LPFA 2TSAA 3WU1A 1CI5A 5FK9B 1D5BB 2LTQC 2A99A 3L3DA 3N42B 3OHXB 2K78A 4YZFE 2YAHA 1SUJA 1UZ8B 1IGFL 2CALA 3KPOA 3M7FB 4PS8A 5F9JB 5FO9A 3CVHL 3RIKA 3CLWA 4EUPH 1URIA 1A9BA 3NJNA 4RFNC 2YWYA 3FQTA 1EDHA 4LL4A 4M6OL 1WZMA 4NPYB 1KGJA 3O2WL 3PG2A 3LXBA 3I85A 2O26U 3K2MC 5DQDL 3BAJA 4XPTL 1D5ZB 1R0AH 4NO0B 1V3LA 4K3HA 1F42A 4XCEB 1HHJA 3SBRA 4XNQA 2YA0A 4NWUL 1FDLL 4OB5L 2PXYA 1N7ML 2MNWA 4LU5L 4N0UB 3F7YB 3GPEA 4W9CC 2YMTA 1M2VB 4K8RL 2DQFA 1UXSA 2X6BA 1F41A 3BGFB 4P23A 3L4CA 4HJJH 3LXCA 5CZXC 1T7XA 2EE9A 4F2MA 2O6FA 2QV2A 4TF4A 4JFXB 3I9IA 3AABA 4PJ6A 3D30A 4Q6KA 4MCMA 5DRWB 1A7NL 5MENB 4NB7A 4OV6F 3HUJA 3FZUD 5EC2B 1FI8C 2WJ5A 2VISB 1HYSD 4FULA 4K5LA 4H25B 3L3IA 5E6ID 4H8QA 4KTYA 3GMRA 4PG9B 2Z34A 3BQUD 3QFDB 1JJUA 1NUNB 2GJPA 4KVNH 3PHQA 2IAMC 2V5SA 4Z7OF 3QQXA 2J25A 3D39B 3FB7A 3QHTC 3OAYK 4M8VA 2X4OA 1JAEA 5EORL 3TPUA 3CLFH 1LK2B 4WU7B 3ZE0E 1T4WA 2ZOOA 5DUML 2FD6H 1CTMA 3II1A 3V4VA 1A9EA 2ICCA 1E4XH 2HVBA 3GRWH 5SV3A 1UH3A 4K4KA 4AYID 4A7GA 1F86A 2DWDA 4GAGL 1XH0A 4XN5A 3WD5L 4EN3A 1DE4A 1XGYL 4A7SA 3TM6A 5F9DC 4L48A 3B2VH 2B7DT 4I0KA 4X98B 4TUOA 4ONGL 1IBGL 3QBTB 4ELDA 3NCEB 1BLIA 4KO5A 4WO4C 4PJIE 4LARL 3MX0B 3K5SA 1BBJA 3VMNA 3BWUC 5FGBA 1IEHA 4AMWA 1CTOA 4RNRB 3MRDA 5KANI 4AEHL 4XPBH 4X7CC 4QPEA 1NM4A 1XMEB 1HT6A 2YBRA 4LEXL 5H94A 2WWKO 5HDWA 1EJOH 1QLRB 3F00A 5IOKA 3D33A 4APQC 1AR1C 4LP4A 2NSQA 2WB7A 3UAEA 4NJ9L 3ULUL 3FQ2A 2FT8A 5EOTB 2E3VA 1ETZA 4Z7UF 3MRGA 2G2PA 1XCTA 4FABH 4C56D 3NJLA 4EDWH 3VGBA 4LOUC 4QRUA 5CWSB 2XWBB 5IB4B 3VXTB 5HGHB 2W8CA 3MBED 4JG9A 5ETUB 4A39A 3CDGA 1WA0X 1GGIH 2Q3ZA 4GO6B 5AAMC 3F2LA 3N3EA 2WN3A 4RBPH 3TCLB 4N8VA 1E50A 3OB0K 2D3LA 2R1XB 3QZPA 3O41A 5BMFH 2WVSA 3O4OC 4GINA 5BO1L 1R0AL 2NUPB 3SKJH 1JCVA 3WS6C 3SBWA 4NZDA 3D8MA 1KIQB 2UY7B 4ZTEA 2QTEA 1L9NA 1MKFA 1A3LL 3D3VE 4HJJL 3E9UA 1E9QB 1YN6B 5C0AE 2VMJA 5EZPA 3FQXA 4K07A 4L8SB 5HHOE 3UERA 3T1FA 3CE1A 5BRZA 5DSCA 1OP5H 4LCCB 1UB5A 4OFKA 4P2QD 5GISH 4PGZA 3S4SB 3V52H 1C5DA 1HWHB 3GMNB 2OP4H 5AB2A 3IDXH 1G7PB 3ZIMA 3W0WB 2XG4A 1A1OA 1I7RA 5BCAA 2XV6B 1J9RA 4TQPA 5C8JA 1E2ZA 4QI3A 1ZT1A 4M1GH 4IRJA 2DQDL 4G8AC 5EZLA 3POCA 4Q52A 4MCYA 3QQ3B 1MG2C 4KVNL 4PP1C 2CA4A 4POYA 4HQQH 3H3KA 3OKKB 1I9IH 5D1ZA 5SX4I 1YPZB 5AKSA 3RL1B 1Y6MR 3CZKA 2ICEC 5BQ7A 3CLFL 1D6EB 1ZHKA 4PRHD 2L7EA 2FD6L 3NJGA 4Z7NE 4D0BA 1HSBB 1E4HA 2JI2A 2Q3AA 3DETD 3GRWL 2HKHH 5FYKH 3RY5A 2HLAB 2VLKD 2BSRB 3FAXA 3WJJC 5JDSB 5KYUB 1J8HB 2P52A 4N25A 2Z31D 1KJMA 4WU5A 3B2VL 1Q9LB 4KXZH 3V7MA 3M07A 3J27A 3KHOA 2FHCA 2K8QA 4E42A 4N2NA 1AGBA 3RPKA 3VCLA 3NIDE 3GK8H 4JZOB 5MEQA 4JFFA 3ZX1A 1Q0YH 2DMBA 2CLVA 2CO6B 3P4MB 1GZPA 4K2UH 4XPBL 4X9GA 4YIQB 3IGLA 1MEXH 4PTTB 3K4DA 1UWFA 3HE7D 5HYQB 3ECUA 3JWDC 1OTTD 4CILA 5B4MC 1UM4H 4PJXA 2FNBA 2WXGA 2XQYK 2OSLA 2MOQA 4R97B 4HH9B 1JNLH 1JN6A 4RGOH 4ZUWA 5HI3C 3NSYA 2YKLH 3TH4T 1JWUB 3DTDA 3OKNB 3EZ8A 1NAMA 1PTZA 4FABL 1VJSA 4EDWL 2WTOA 1DZBA 3BVUA 4HXBH 4PW3A 5B8CA 1JPGB 5CUSH 1E9PB 1L3NA 3ETBF 2XFGB 5E00A 1T2QH 1PDKB 1Z0MA 2F5AH 3VXUB 3T3ME 3W9EB 5LBGA 4Z77A 2GK2A 1GGIL 3LKRB 2BVQB 1A4BA 3NGBC 4JFPA 5J1SC 3U6RA 1UCTA 1KB5A 3JTSB 2DYSB 2RQEA 4N24A 4W9ZA 1FWXA 4HYTB 4LF3A 4FTVE 5FA4B 4GS7C 3DO7A 3ULAB 3O8XA 4EMZA 2G2RA 1JPEA 2NMSA 3GBNH 4J6IA 2AQQA 1RPQA 2MHAA 5E9AA 1UVQB 3QULB 4HKJA 2X4SA 4KNTA 4L4VA 4NZ8A 2Z7WA 4PVBA 2X1XR 3KPSA 2MKWA 5JPMC 1QVOB 5D5MB 5ABAA 4HEME 1UHVA 2VYRE 1SVCP 4DH2A 4P4RA 3S5LA 3F6IA 3BPOB 1HESA 3ETSA 1XF5A 3TBSA 1MIMH 3G6JE 2AJ3B 2DIBA 1G7IA 2AI0H 1P5UA 4X6DE 1AAJA 4NZTH 1DQVA 3V52L 4TM9A 2OP4L 3IDXL 1OSEA 4XVTH 2ICES 3IJ9A 4ZODA 3IGAB 1MFAH 1E6JH 5IBLD 4NQEA 4PJ8A 2LT9A 2W88A 2F53E 4M1GL 4Y8AA 1JK9A 2EKJA 5DC4B 4BQBA 5CGYD 5A7BA 3OKDB 2H2SC 4NXKA 2C8NA 4GUQA 4L37B 1PZBA 4AGLA 2EDXA 1TYJA 3WSQL 3DIFA 4HFWA 2CUIA 1F4AA 4HQQL 4A6YA 5J3HC 1N6UA 2ADGB 1UOLA 1I9IL 3HHSA 1DJGA 3T0DA 2NYYD 2Y7NA 3HG5A 3L1GA 2DW5A 4IBUA 4NEHB 1QMUA 1GCYA 3ZT5A 1CIDA 3H7BB 3QNYB 4FLSA 3GDCA 3Q01A 4MJIB 2WUBH 5IREA 3VI4A 4W9LC 2HKHL 2BIMA 5FYKL 3R06B 1WV7T 5B21A 4OTXH 4NQDA 2WLIB 4A7UA 3U0WH 1EJ6A 2NNCA 3RVUD 5GS1C 4MBOA 1YYCA 3D0AA 1HXMA 2YD2A 2DDQL 2WXOA 3BDXA 3I6LD 1UQSB 3BXNA 1Q1JH 5F3BA 2J5LC 1AC0A 5T3XE 3UPRB 3GK8L 4GXUM 3WO4C 2VC2H 4C57C 5I8EA 1Q0YL 3IJSB 4UBDD 2GITB 4KZEH 2H3KA 3GKWL 1XXFC 4WIQA 2AK4E 2YD6A 4K2UL 2LQRA 3CSYB 2DEYX 5G4OA 5EIIA 3PNWA 3K74B 3I75A 1MEXL 3VFUA 3N1PC 4JDTH 3TVMB 4XXWA 4Z8FH 1S7XA 5JHDA 1IM3A 4YS4A 4GAYB 2IGLA 35C8H 4F8PA 3T2PA 5DK2B 4ODSH 1BECA 1UM4L 1NZRA 2C1PA 4BQ6A 2Y7LA 4YFDB 1E65A 2YPVH 3NOIA 1HEJC 2RR3A 1II4E 2VDPB 5EO9B 2X38A 1JNLL 3ECBB 4RGOL 5H2BA 1CF8H 3U0PB 3ZDZF 2YKLL 2F8OA 4J4PA 3R8QA 4AUJA 3MRPB 4HS6B 3KL3A 1F5WA 3L3GA 4HXBL 2WBJA 2WLZA 4B27A 5CUSL 1SXSA 4WJ5A 3QZNA 2F5AL 5ITFA 3VWJD 1FNGA 1YO4A 5T8IA 5FOBB 3AW5A 2NOYA 1M7DA 3WTYA 4O2FA 2OJEB 5I5MA 2CJSA 4NKQB 5C08D 1ECYA 2GSGB 2NUTB 4F20A 1BSIA 3U9PH 1PEWA 5D6CB 5DTFA 3WE6B 2BHFA 1AP2A 3MZGB 4KJQC 1RZ8B 3K8MA 5EU6B 5EU7E 5KSUA 4WLCA 2PR9A 3FU7A 3GBNL 5D1ZI 3UBHA 3NJMA 5DI8B 3WTVA 4WI7A 2OMWB 1TJGH 4YHZH 2DKSA 2G5RA 3RWDB 3ZZLA 5BS0E 1G1OA 2PLTA 5E8NA 2JNZA 4ZS6C 2PR4L 3BGFC 3K72A 4LNRB 3ZKQD 5HYFA 1UUNA 4KFMA 4PLKC 3V95A 4JKWA 4HALA 5IJDC 2ICWJ 1DUZB 3CNKA 4JHUA 1MIML 1CYGA 1I1AA 2ZWYA 4PJ5A 2OTUB 3EW3B 4JPIB 1O0VA 5C3IA 5I73B 1EQWA 5ELIA 1BDYA 1AG0A 2EP6A 2WSDA 1QBMH 3EYSH 4YPJA 3KXFA 4PCYA 5LHDA 1ZRUA 4FN0A 3JV4B 4JM2F 2EEAA 1MFAL 1E6JL 3F58L 5KBLA 1KCUH 2ZXAA 4NOFA 1H3XA 3NIGF 5HDLA 4J2XA 5CMAB 2CJTA 3DHJA 3PREA 3X1FA 4DOHE 5AW1B 5JNYB 4G5ZH 3TO4B 4BDVA 3ABZA 3MYJB 2CRYA 2IWFA 5DMKA 1ADQL 1FGNH 2VDOB 1V10A 2Z6FA 3PWPA 3GSOB 3SE3C 4KNSA 1BXAA 3U1SH 2WUBL 3BPLC 1QSFA 2F5BH 1WCQA 1ZCRA 5ICYB 4KKBC 1NGQH 4OTXL 5AOZA 2G3XA 3U0WL 5MP6H 4IRSD 1HH9A 1S3RA 5ACZB 3IVKB 4RMQA 1VFAA 3PAVA 1RURH 2VJ0A 3UTSA 3Q06A 4FMVA 5F9OH 1N8OE 1IVLA 3GINA 2YUWA 5A2KH 1Q1JL 3DSNA 4EOWH 2X4RA 2ZOKA 4MNQE 5T1MA 3IJYB 2W9DL 4LLMB 3Q05A 3QUXB 1MJUH 4WW2F 5B3NA 2VC2L 3TA3D 3MV7A 3D85A 4PEEA 3D0VA 4FXGB 4KZEL 5CN2A 1KZYA 1TFHA 3P3YA 1ZE3C 2UYLA 2ZX5A 4FF9A 1NCBH 1WWWX 2NY4B 4AYGA 5E0FA 5KJRH 3B2DC 3E6FB 3QFJE 4AV5A 4ORGB 1WBZB 4JCMA 2O5NA 1EXUA 4JDTL 1OM3H 4Z8FL 1G7HA 1NBVH 5EHFA 35C8L 5KSBB 1ZY9A 4BFGA 2TSBA 3TN0B 4ODSL 2JV6A 4FFZA 4ZQKB 3P2BA 2YPVL 3DUUA 3RWIB 1XTMA 4LCWB 4G6MH 3CDZA 4UTCA 3WE1A 5CIPB 4DGIH 5IJKA 1CF8L 4Y19A 5E1IA 3KEHA 3PGFH 4OZIE 3SGKA 1SRDA 2QPDB 2XOTA 4MJ2A 4BFKA 4HZLB 4HJGA 1JTOA 1TR7A 4AIEA 2MNJB 2VXTH 4XXCA 4Q9RH 4MMZC 3WEXA 2SODB 1WAAA 4RCAA 5F3HA 4PRID 4Y2DD 2OQJA 2W9EH 1CDYA 1NDTA 3FU8A 2FH6A 3LMJH 3U9PL 2DM4A 3GBEA 4YDVA 1SOKA 3ETBJ 1W80A 3ZZ1A 4ODXA 2XWXA 3X13A 4Z7VA 3KE0A 1RJYA 3QDMD 4PWFA 5DJ2B 2CR6A 4LSDA 3QUMB 4XWOD 1TJGL 1O5DT 1GZHC 4YBQC 5ESQA 3HAEB 5A40E 1JDAA 3L08A 3IGUA 3LNIA 3MO1A 2FBOJ 4RGNC 5L4MA 2D7TL 2W59A 3HG1A 4AQZA 1AQDB 4HHWA 2B4CC 3Q1EA 1KJVB 4N1HB 2XWDA 1I7UA 3CD4A 3LKOA 4LCCC 4LRNH 1F11A 2VABB 1SHMA 1LJMA 5LNGA 1G9NC 1QBML 3EYSL 3EXJA 2QT6A 1K8DA 1KTBA 5DHYB 2QGCA 1EBPA 4IOIB 3GQFA 3LN5A 1KCUL 3AXLA 1JF6A 1QFWI 2GIXA 3FT0A 4WNQA 2FYYB 5CCKL 2KUTA 2ZKYA 3CSTA 2DYPA 1KPUA 4WFED 1JYWA 5C0BE 3KEDA 4FHKA 2XHNA 3HR5A 1DVYA 1KCSL 3NEEA 1ASOA 4RQQA 4LLYA 3QQ9C 1FGNL 3MA9H 1FIEA 1TZ8A 1NICA 2BY2A 5BZDB 4X8CA 2NZ9D 2VW4A 4YHYB 3BHBA 1JMXA 3U1SL 2QPUA 3O2DH 2IH8A 2F5BL 1NGQL 2MEJB 3MOBH 4P2OA 5MP6L 4PJFE 15C8H 3I9AA 3LS4H 1RZQA 3CZFB 4PJGB 4WKZB 1VKXB 5DD6A 1QG3A 1BQHB 1RURL 4ZMOA 1F1AA 4KTDH 1YN7A 4H8HA 1LXMA 1NGXA 1NINA 4XNAA 3OSKA 1TYEB 1ED3B 3HLAA 4YC2B 5D6DC 3ZE2B 4ZMXA 5JW5A 5AVQB 1BIIB 4E9TA 5E70A 3MYZA 2GJ6A 2QR0A 4MJ6B 2EUVA 2Q87A 2J21A 3N9GH 4MA1C 4M8RA 5IFJB 3PS6A 5BW7C 1CN4A 5CEZH 4FHJA 2NYKA 4G71B 3UEQA 5KJRL 4ETQB 3LZPA 2IDQA 3CFBB 3NCXA 4NO2A 3GNMH 1OM3L 1PZ2A 3NK3A 2H26A 1NBVL 3MBXH 1CO1A 1H9DA 3ZGIA 1R3KB 1J5OH 1EEZB 2OZ4A 2BP5M 3EH2A 3ARGA 2WY3B 5EPMB 4E41E 4R97C 4R4BB 4DGIL 4G6ML 3DTXB 3RX9A 2X5PA 5IV2B 2OMUA 1Z7JA 2EKSA 1MW0A 4PQXA 4TUJB 5I9QC 2XY2A 3BWZA 1HHIA 4WI0A 4G5AA 4QRQB 1U8QB 3BP7B 3S98A 3QXAB 1X7TA 1ES0B 2YUVA 2WLHA 2VR9A 5AW5B 4U6XB 4OGAC 4BKTC 3ZBMA 2ADIA 2OKMA 2VSMB 3NEOA 2UXTA 2YJQA 3OQRA 4ZDHA 5T5NF 3QUYA 3NN8A 4XZUA 4Q9RL 1W0VB 1P2CB 4N68A 3M7OA 4ZMNA 4AIZA 1LL1A 2EDYA 4K3EH 3KVDD 2R39A 4UI2A 4LHUG 2I60H 2EYRB 2W9EL 4GW1A 2O6EA 4MNHA 5FYJH 1T0MB 1XGUA 1PMYA 3AS2A 4KK8D 4KROB 4PWJA 3TBBA 2HFEB 4NX0A 4M7LH 1LVEA 3B37A 3L3JB 1QEWB 1ZDSA 2BCMA 3C60D 2QVMA 5KBDA 3LKQA 3PWVA 1MSPA 4PJ7A 3UGEA 4I1PA 2H32B 1XAUA 5AVVB 3S3SA 3F7QA 1Z9MA 1Z5HA 2O30A 1XEDA 4G8GE 2PKDA 3DX6B 5F96H 4IU2A 3BVNA 5L9DH 1S9VB 5J13B 2RIKA 3BPOC 5IW3A 4OV5B 4HGWA 4M1CC 3QJFA 1SYVA 3L95A 5SWZD 3MR9A 4HOWA 1QFUH 4M02A 5IQ9A 3ZR6A 2XWZA 4XBPA 3APMA 4LRNL 4Z7WB 1L5GA 4NC0B 3FUJA 1K8IB 1CFTB 4CVUA 3ZKXB 4JNXA 1XH2A 5DS8B 4JM0A 3HG4A 3P73A 3KPRB 2R29H 4XNMB 1SDAB 5L4JA 1YSOA 5DJAA 1KXVA 2IALA 4LLVB 4IRZH 4OQTH 5FKPB 4J3XA 4OGXH 4P9HH 3MRMA 2YSSB 4Y8DC 3DLQR 5FW8A 5AOLA 2I07A 4H13C 1HEHC 3QPQD 1EJFA 1FP5A 2ZUVA 3MA9L 4DK3A 4WUKH 4HCIA 5IJBC 1U8CA 4DUVA 4R7NB 2E5EA 5GGTH 3MODH 5DMYA 2X7LA 1PX8A 1XIWD 4XN2A 1OALA 3O2DL 3AWEA 5ID0B 1R3IH 2Y22A 4JFDA 5L4FA 2B59A 3MOBL 4ZPTA 1H3WM 1TCRB 3IDMA 15C8L 2FECI 2ZIDA 3UAJC 4PGBA 5I71B 3LS4L 1DDHA 2WLLA 1X5XA 1MZYA 4JJOA 3X17A 4DHLA 3E38A 3SY6A 5I16B 3T0VA 1EJ8A 4MSWA 3HLKA 4JFOB 5KVGL 1HOCA 1P7BA 1KIRB 5GRYA 6CGTA 1H15A 3I02A 4D9RE 3CFCL 3RI5K 3GO1H 3N9GL 1RZFH 4ZPVB 4YDZA 1CR9H 1G1YA 1MHPH 3LV3B 2APFA 1YEKH 4Y5YB 4BHUA 1TSRA 2ZG3A 4IBQA 1LQSR 1I8MB 4AENB 3APDA 3VFSB 4UM8B 4PRDB 3L3HB 1R75A 3GNML 1TTCA 5DEGA 3I6KA 3VRIA 4PJDE 3MBXL 5DU7A 4FFWC 5HGDA 1J5OL 3FTYA 5CEYB 1JGEA 1BAFH 3ES6A 5DRXA 4XCFL 2YC1A 1J1PH 3FHAA 3J7HA 1UD3A 2BY3A 3RJDA 5IJVB 2DWEA 3HZYB 2IOMA 4CBPA 2C7FA 3DXAE 3UTTD 3OD3A 4PI0A 4HDIA 2NY3D 2DM7A 4Z23A 3PAUA 4LPCA 1YDPB 4HUMB 1IGMH 2K3HA 3QIWD 1HSAA 1S7VB 5KYYA 3FT4A 4YO0A 4K3EL 4FZEH 4YDKH 2I60L 5FYJL 3CXHK 2BP8B 1OCRB 1E4KA 1NIBA 3FN3A 5KOMC 2YPKA 1X5AA 4M7LL 3VXRB 4PMFA 5EUKB 5J9PB 1DVFB 2GY7B 3O3EB 3BSZA 4F7CA 1ET5A 3TBWA 3D2UA 3MFGB 1E8ZA 8CGTA 3SPVB 1EAJA 1FAIL 5F96L 2Y5QA 1H9VA 4J7RA 3FSAA 3TH2T 2DH3A 1MLCB 1D7CA 4HGKC 4KKZA 5LNDA 4G9FD 4HEPA 1QFUL 3RB5A 1RPUA 1AGEA 2NXYC 5I73C 4LDEB 5CIPH 5D7EA 3HPLA 5K5YA 2HRGA 1ZKAA 2R29L 5I74C 2B8OT 3FH8A 5AZEH 4YXKH 4X7SH 3CMGA 4HIEB 2P1YA 4IRZL 4OQTL 3LEXB 2XWTB 4OGXL 4P9HL 4KJPD 3IAGC 3ECWA 1CD1A 1U8MA 2JKWA 3TO4C 2VLLA 4ZFGH 5DFTA 1EFXB 4CC4C 1U3HB 1MCJA 3PDGA 4M29A 4WUKL 3ZDXE 4Y0GA 3LNHA 1HJCA 3AT0A 4CDGC 1YEFL 3FTZA 1Z5LA 3MODL 2KKQA 5FFGA 2X4OB 4G8EA 2FWUA 4JRLA 3HOGA 3QUGA 1DANT 3WFEH 3QUMH 4EDXB 4PLOB 2HRLA 3ZKMD 3BKCH 1Y0LB 2OL3A 3Q3GA 3LXUX 3BVTA 5GS0D 3QK0A 3QIUB 2BCKA 3ROLB 5GGSA 3TNNB 5J7CC 3MTXA 1WIOA 1XDTT 1YAIA 3S35L 4JZJC 1QA9A 2NCMA 4XO8A 3PGCA 3GO1L 1N5AB 1RZFL 4FXGC 5ENWB 5CHNB 1CR9L 3WTUA 1MAKA 5D71H 2ZAHA 2N4IA 2X4QA 3V6OC 3C5JB 1NDMB 3RUGA 1HOEA 2DN7A 1DSYA 1FFPB 3MRNA 2XKNB 2IDUA 4F1ZA 2IO5A 5D7JD 1JYNA 3GSXA 4DO5A 3UZVB 1WWCA 2BOCB 3TN0C 4PJCE 1VLXA 5KAQF 1BAFL 2J1YA 3BWUF 4ZMPA 3QZWA 4PJAF 2G5BA 1EA9C 2X9WA 1KT2B 1J1PL 1DJHA 3QEQD 4MD0A 1C7SA 5FUCE 1R24A 1MFVA 2Y7MA 5ISZE 1CC3A 2VSKB 1RZKH 4IHBA 1F1DA 1S3KH 4OM0H 4NHUA 4WWKD 4AE0A 2NTFA 1CGTA 4DP4X 2COQA 1EX0A 1AD9A 1X4YA 5IG7A 3ARDB 3P9LA 5IVOA 2CDFA 3T3PE 1PD0A 1HNYA 5KW9H 4PM1A 4N5EC 4FZEL 3QJHA 3N44F 4YDKL 1FLTX 3ESOA 1QWHA 3MNZA 3VXOB 4TLTA 2UWEA 3Q6GH 2D9QB 5D7LD 4KDTC 4QRPE 3V8CA 2QPEB 2VN6A 3QDJD 5DJ0A 4LPWA 3VFOA 1L7IH 1X44A 1D7FA 1A02N 5FA3A 2B9AA 2UX7A 3K6FA 1AS6A 2QVFB 4FLQA 4NUJB 3TYFA 1BZOA 4G6KH 4A67A 4G6FD 4WTZG 4NAJA 3RIAF 4YDLB 1TEGA 1A4JB 3PV6B 4NQSB 1ZHNA 2F9BT 3ZMRA 2HT4C 3AT8A 2N59A 3E7JA 2FIKA 2H45A 4I18B 4LPVA 2EIZB 2XUWA 5D2NB 1Y1UA 5J0BA 3IK2A 3PABB 4HHAB 1I8LC 3OGOE 3DUSA 1MAJA 1CGYA 2VR6A 2F1BA 3IDYB 2P5WE 4GSUA 3OKMB 5E6IA 4AVJA 3OG6B 2QHRH 5DYOA 5AZEL 4X7SL 1HXYA 2YGNA 3BQUA 5KBNC 1ID2A 3PJSA 3QQDA 4XE5B 3WJLA 4I1RA 4BHUI 1AHWA 2XG4B 1I7RB 4HKBB 2HCZX 2ZSWB 3X1GA 4ALAC 4GSRA 1SY6H 2MQ3A 4ZFGL 1TUPA 3HI6H 1TKWB 5JHLA 4LCUA 3FQWA 2QKIC 2AANA 3JWNE 1MFMA 2YPLB 4YHYC 4C8XA 1J5IA 1Y18B 1M1XB 3FT1A 1IZJA 1KBVA 2D03H 4DP6X 3K6DA 1H5BB 3EFFA 2LU4A 4ZX6A 1X4ZA 4L1BA 3WFEL 1UKSA 3V7AE 1RJCA 5C0NC 1DQLH 2Z91A 2R69H 3BCFA 3BKCL 3MRRB 2XXMB 2QLYA 3NJJA 2PO6D 4Q74A 1TQBB 4IKIA 2UVFA 3CIQA 4YC2C 4NLHA 3H42H 2Q7YA 4LKCB 5B39A 4G82A 3QUKB 4L3EE 2V2TA 1KBPA 2VAAB 5D71L 1JZDC 1KG0A 5MEQB 2RCSH 1W15A 3OV6A 3CFUA 3AY2A 4OIFA 2A9CA 4M7ZB 2X4PB 2ZF8A 3EIFA 4WAFA 1IKOP 2JB6A 1X6LA 3QJQB 4H0IA 3AG1B 2ZUQC 5F7AA 3DROB 3N91A 5L2JB 1USQA 43CAA 3EBIA 5B1BB 4C56A 5LDSA 3TGXA 1QABA 4P3CL 1RZKL 2DLGA 5I18H 3T6ZA 2ZOLA 1S3KL 5DD3H 4OM0L 3MBEA 4D0DB 1PKQB 4UU9B 4HULB 3RBSA 5I6XB 2EDMA 4GEIA 1E9OB 7FABH 3CAFA 1V5JA 5M7QA 4LVHB 3E6HB 3ARFD 3GS0A 5E00B 1YEHH 3P30H 5TDOB 3FQYA 5BVJA 5E8PB 2VDMH 3MLUH 4KROC 1F6FB 2IAMD 2OMYB 3FO0H 3WCYA 3C5ZB 3Q6GL 1OCZB 4JFED 3HCVA 3L17A 1C12A 3ATDA 1E40A 3OGCB 2Y23A 5GGRA 2WV3A 3TU6A 1IGIH 1I1FB 4J27A 5E1AB 5FECA 4GG6A 4NO5A 4G6KL 4AYMC 1EAQA 3LRKA 1MW2A 4X7EC 4Z7QE 4BQ9A 1UCBH 2J8UF 1XGRB 4OFPA 5J13C 2YQ2A 1KYOJ 4DP7X 4LVNB 4QRRE 4DWHA 4KOBA 4MWFB 3FB8B 4RDQG 1FGVL 4P2QA 3STLA 3IS1X 1FYTD 4G7RB 4XE0A 5KJ4A 3ZKXC 5HHMD 3MRBA 3G6AA 3B5HA 4WO4D 4XHQA 3SO3B 3TBSB 5HDRA 2QHRL 3OR7B 1DEDA 2HFFA 3CN3A 4NZUH 3UO8B 4AK1A 5ILTH 2VQ4A 1VRSA 4RVBA 1XXDC 4YH6A 2K6ZA 2HPTA 4DNLA 2R1WA 5LUMA 1SY6L 3JTTB 2P5EE 2ESVE 3W11C 1JK9B 1GS8A 3CVCA 4GAJH 3M1BA 3HI6L 2I26N 2G9HA 4PBWD 4APQD 2JJSC 3QJZA 1F3JA 4PRHA 4NC1E 3S48A 1MCPH 5KG9A 4OGQC 2PN5A 1EVTC 1IE4A 1R3JA 3B6SB 3FRPA 2VLKA 2D03L 1TNMA 1HEZA 1S7WA 2Z9TA 2VDRH 3PWJA 2I5YH 1HIMH 2Z31A 2VSCA 1SXZA 5I71C 1YMMD 2VUOA 4KO6A 2NW3B 2V9RA 4LOUD 2VZUA 5K39A 2Y06H 2F19H 2YD0A 3DRTA 2ZXEB 4XAKD 3OAUH 1DQLL 2R69L 1M9WA 5DF0A 2V17H 5EV7A 4NNYB 3C6EA 1KC5L 2V3FA 1P53A 1NANI 4DIXA 1LE5B 4KK5D 2WBWB 1N70A 1WS7A 3H42L 5E1HB 5E1QA 4WHTB 3RVWC 1GVIA 3RWHA 2VDNL 2NY0B 1IX2A 4Y5YC 3ZLQC 1DN0A 4ZXBB 1OB1A 3MJ9H 2EO1A 4PJIB 3GSNH 2RCSL 3L3OB 4NQCD 5F7LB 4HSCX 3S3BB 4LSVH 3HE7A 4GUCA 5C0GB 1U3JA 2DJSA 3QWQB 2VLJD 5LBSA 1CFQA 3GLZA 3LIZA 3IKCA 5EO1A 2WINB 3SHSA 4FI7A 1DJWA 5JXAH 4X0KA 5KS9F 5JHDB 3GMOB 3T4YA 4FAAB 4ODUB 1G7QA 1NEZA 5I18L 3CFKA 5DD3L 4BRVA 3SDXF 5H2BB 1PL3A 5IMKB 1WUNT 5D7IF 4KK9C 7FABL 4FQCH 3BKJH 1KPRA 3L3GB 1IBDA 4Y1AD 1YNLH 2WBJB 4L8DB 2TRHA 3NRPA 1IAMA 2JFCA 1YEHL 2XRAH 3P30L 6PCYA 5JXED 1V3JA 5CGTA 5HSFA 1TENA 2VDML 3MLUL 3FO0L 4HHGA 4YBLB 1E3FA 3RWFA 3N6YA 2XBTA 4CGUB 2BMKA 4QNPE 4UQ3B 3SE9H 4F7MA 3N42F 1E28B 3NCYP 3FFCB 1IGIL 5DHDA 1NIFA 4F9LA 1JWSB 2EDDA 2FEEI 4PJXE 4P5MA 5DTFB 4DF9A 2VN3A 1GS6X 2XN9E 2EZ0D 3C9NB 3TIEA 4HKZB 1KXTB 1UCBL 3K0WA 2PXYC 2J6WA 1U30A 5E8NB 4WDIB 3RY4A 4P23C 4OD2B 5I19L 1JWMA 4H2AA 1UT2A 3KPQA 1JERA 1FV1B 3DX7A 3QIBB 3FYIB 4PJBE 1OB0A 2Y1ZA 4P2RE 5C0AB 4HIIA 3EDEA 1T20B 1CXEA 4PGEB 4DEPC 1A6WH 3LVEA 2ZCZA 1ND0A 5BJTB 4Z7UA 3MRIA 4NZUL 3E8UH 5EC1B 5ILTL 1IVTA 2D73A 1ZLUK 4PJ9B 4GKZA 3Q7JA 1UOKA 3H0TB 2MOVA 2OYMA 2WXHA 2CDGA 4GAJL 1U3HC 4Q9QH 5GGVY 3ULVH 3QEHA 1FZMA 5I30L 2ERJC 3WDHA 1MCPL 5L7XH 4BK5C 1ZLVK 5T1LB 3T2OA 3QDGB 3WYRA 1KMGA 3MNVA 2VDRL 2I5YL 1HIML 4MB1A 4X4MA 5LXGH 3DECA 4S0HA 4XHJC 2BVOA 2HTKC 2Y06L 2F19L 1T89C 3T8VA 4NUQA 4WF7A 2V17L 1NC2D 3WJMB 5E2TH 4EN3C 1YC7A 3KBEA 3LKSA 5CKAA 4MQSB 4NQEE 2PETA 5B1CA 4IEFA 5JW4M 4L3AA 2WGXA 5TF0A 1OP3H 4CMMB 1G6RH 1ZSDA 2ZOKB 3WUWA 3EH1A 3IMVA 3MJ9L 1WCBB 4UT7L 3NIDB 2XPYA 1UFUA 3GSNL 4HX1A 3HZVB 4LSVL 4JPVH 4Y4KD 4FYSA 4I4WA 3L8QA 5I5RA 2Y24A 3CDYA 2EH8H 4QKTA 2APVA 2DICA 2E76C 4M56A 2LLLA 3G5YA 4I48B 4TL5A 5BUAA 1XF3B 2YWZA 4GB9A 5JXAL 1OPGH 1QHQA 5AVXB 3G9AB 4A2EA 2EADA 3NZUA 2QJDA 3U9WA 3LQZB 3BRDA 2GIYA 1J8KA 3FCGA 1NFDE 3GSUA 4QIRA 1FO0A 3U6XA 3CDZB 1A6AA 4JFQA 4U33A 4MQ7B 3VWJA 2AKRB 3KYKH 1GH7A 4IK6A 3M1CA 4E2OA 3ARDC 5JQIB 3BKJL 5GRUH 3I9GH 1YNLL 5C08A 2Z93B 2JTDA 4DP2X 2EECA 5HHXL 2Y9RT 2XRAL 1FRGH 2XN2A 1TO5A 1R46A 4JL2A 3X12B 1ORSB 3TWYA 4RH4A 1TTUA 1KCLA 4HW6A 4UNVA 5AW7B 1VB9A 3UYPB 5DJDA 3GJEA 3SE9L 2QPSA 3VB9A 3DI3B 2EEDA 4FTVB 3X13B 3UTQB 3H9SB 5GJSL 5HPMA 4F7KA 2WBKA 3OJDA 4MHHI 3Q8EA 4YDLC 3SBWC 1HZHH 1I8MA 4HOZA 4GG8A 5CP7B 1DQJB 1N0LB 1CQYA 5ESQB 2XJKA 1DVTA 4IBSA 2A6JB 4AL8H 4OKVA 3MO1B 2IAAC 1CFVH 4JUSA 4Y7OC 5I1EH 1P7KB 4N0YH 1U95A 4XPHH 5JLZB 3GB7B 3VFVB 5HHPA 3FSZA 4AYBA 3FAWA 1A6WL 1N19A 3G6JB 1HILA 5HJ3B 1CD9B 4JAMB 2QMJA 5KYXA 1FAKT 4C83B 4X6DB 1T1XA 2NSMA 3E8UL 1XMWA 4NQXB 3OWEA 3S2AA 1KXHA 3KYOB 2OMZA 1QFOA 4P05A 2WNKA 4YSOA 2E27H 3GWJA 2YOAA 2F53B 1OSPH 3G5VB 4Q9QL 5GSVB 3HBPA 1E5YA 4OD1H 1RHHA 3KLLA 1QPKA 3QJOA 1DVQA 5CJXA 2VGLM 5I1AB 5L7XL 3M17A 4R7DA 5LJYH 1T5XA 3FTGB 2D31A 2HA1A 1H5BC 4IRSA 4E68A 5LXGL 3O11B 2DOCA 3JWDH 4C54A 2J4WH 4PJ5E 5E9DB 2BW4A 3E1F1 4DO6A 1HQ4B 2OPCA 3WMQA 5J89A 1KFGA 3FUMA 1TQBC 1YPZF 4P2OB 2FJFA 4BZ2A 2ZUYA 3N0PB 1U8PA 2BNQD 4GKOA 2E6QA 3UG3A 1SXNA 1YN7B 4OJCA 3DJTA 4Z76B 2BSSA 2V2XA 1G7JA 1G6RL 3V2AR 4AW4A 4TVSa 4H44C 4KJQD 4NO0D 4M7ZC 4IKKA 4M7KL 4JPVL 1MDTA 1P69B 1BWMA 1RV6X 4TUKH 4DGUA 1E5UI 3BX7C 3LOWA 4L0YA 2EH8L 1KTLA 3PWPE 3DURA 1TZHA 1MCCA 3IGKA 3P3RA 2WTRA 2FR4B 1N3NA 3DGDA 2EC9T 2YRPA 1OPGL 4X2UA 5CF3A 4D7PA 3IU3A 3RWEA 3L16A 2HVJA 1OW0C 2WSPA 2BVPA 4J8QA 3CQQA 3CBJB 1B2YA 1WIPA 3DVFA 4U1NB 1J12A 3KM1A 4ZSOA 3OJ2C 4CW1A 3UTSE 5DURD 4ICWA 4YHPB 3F7RA 4XI5C 4Y9CA 1QD0A 4QT5A 2ZAGA 3KYKL 5I6XC 3V6FA 4XWGH 1B6UA 4X4YB 1LTXA 4NKOB 3I9GL 5B8CC 4LVHC 2JK5A 4PRIA 4Y2DA 4HIQA 2GFBB 4NDMA 3EBHA 1FRGL 1WFNA 2UZXB 4FFYA 2AERT 4ZDHB 4R5VA 3NN8B 5F6HJ 3C5ZC 3D39D 4X5RA 4K94H 3WXVH 1QWUA 2ITCB 1FE8L 1JI1A 2WO4A 5DT1L 5J8OA 3DUHA 4GQ9H 4MD5B 3L1EA 4PMEA 4G1EA 4J8RA 4G9DA 1PIGA 2X1QA 1XX9C 2VITB 2FRGP 4OF5A 3CZNA 2DTSA 1PF3A 1PX4A 4HUKB 4OCNC 4WNSA 3UO1L 1QSEE 4GT7A 1O7SA 4KKBD 3OXRB 4Y19E 1HZHL 1RLBA 1WFTA 1K4CA 3UZEC 3UABA 4LVNC 2EIJB 3AGVA 3NDYE 3QAZB 3ZYIA 4AL8L 1AGDB 5BS0B 3M88A 3SD2A 2QGDA 1CFVL 1XGQB 5FDWB 2NY1C 4DZBA 3RKDC 1LLAA 5I1EL 4N0YL 5DEJA 1IQDB 3HN5A 4RZCA 2JSFA 4F58H 3QJFB 3SO3C 3C6LD 1H8LA 3MR9B 1S8DB 4HC1H 1Z32X 2KT6A 4XBPB 5D5MF 5IQOA 5AG8A 1WAAE 1CBVH 5SWQB 1SF5A 2H7WA 3PCYA 2AQRA 3BUYB 4BSVA 4XNXH 4PJ8C 3CIAA 1M9SA 2E27L 3CWGA 2EIKB 3WDJA 5F72S 2AP2A 5MHSE 1B0GB 4OD1L 3D69A 3HRZA 2X4NA 3CPLA 3MRMB 4MCNA 3GFUA 3JZ7A 4M9OA 5B7MA 4AT6A 5DO2D 1SEQH 3D0LA 4DOHB 5AAPA 1XR9A 2I07B 2PW1A 1N0XH 2CM5A 3GHBH 4ZW6A 4F8OA 4XP1H 2DQTH 5T3ZH 1A21A 4PRNB 2FWOA 2IDFA 1Z9SA 3HRPA 3JWDL 1W91A 5IF0A 1JSYA 1RUKH 4HGMA 4JKMA 3CH8A 1A7QL 1TTFA 4XMVA 1BF8A 3JUYA 4GRWE 5ANME 4PGBB 1EK3A 4U3CA 3DV6B 3RQ3A 4BELD 5AVWB 2AEPH 2C9UA 1LEGB 3RDJA 3MLTA 4MRCA 4XMLH 3RGBA 4EXPX 5KN5B 5F7FA 5HDQH 1YYLH 2DEWX 3CHOA 1YEGH 2NY0C 3T8XA 3O0LA 3QNXA 5EN3A 1VFOA 1PYWA 4FCAA 1BQSA 2UUDH 1JZ5A 2E9BA 4QWWC 3HS8A 1IBBA 4LLDA 4G42A 3MA7B 3PFUA 5CR8A 4TUKL 1D5XA 3VH8B 4UUJB 1IAOB 5MI0B 2ARJB 4YBQD 2WKLA 4L23A 3JWOH 2R9HC 5EZJB 3QFJB 2IH3A 4LIQE 4MMYA 1S7UB 1E5CA 1KDJA 2ADFL 2KC0A 1T66C 3OJMB 5F7DB 4N2DA 1U58A 3S96B 4J3OF 4BCXA 3V9CA 1AOZA 4X6EB 1I7ZB 5FR3A 2YXVA 2DIAA 3EHBB 4YGVB 1Q4NX 4J4PC 4KOCA 2DWEB 4XWGL 3W0WD 3GHPA 2ZKHH 3QO1A 3VFWA 2WBJC 4OGYH 3MGOB 3S6CA 3AACA 3HVDA 4N6QA 2HWZH 2JKRM 4I87A 1PLGH 4IBLT 4Z0BH 3VX0A 4YBLC 4BH7B 3V4PH 2D3JA 5IVNA 4K94L 3K2KA 3WXVL 2NR6D 3C60A 1ZVSB 3QQ9D 2BFGA 3QW9A 4N26A 2JCCE 4GQ9L 4WW2A 1SBBA 3NQIA 3MXWH 5IVXB 4MDIA 4P07A 1JDDA 5SWZA 1J8HD 4KQ3L 3BFOA 3LY6A 4OBSA 2CCVA 1WP6A 4ZMQA 4XBGA 2J6EA 1WTGT 3CFMA 1U3YA 3KPPB 3QIBC 5HI4C 2DH2A 3HG3A 4F58L 1V3MA 2E86A 4PY8J 3RY6A 3R7QA 3LCYA 4UILH 3CQPA 4HC1L 2CK2A 2GK0A 2VUYA 1WBXB 1F3RB 5PCYA 3I3EA 2W07B 2P44B 1CBVL 2MNUA 3L7EB 2DQCH 3D25A 1RJLB 4PH8A 4PCKA 3TNMB 4H8WC 3T0EB 5DD5H 2L7UA 3M8OL 4L2LA 4J3WA 2A9AA 1DBBH 3BZ4B 2WVVA 3PF2A 5FV1L 1JF5A 1ZT7A 2YAEA 4IJ3B 2VRKA 3BO8A 3WNNA 4QYOA 3WMPA 1UURA 4PJ7E 2XBZA 1XIWA 5FHAH 4DSYA 3ULSB 1ZE3H 3WN5A 1SEQL 1EEYA 3FB5A 3BIKA 4NC2B 5DD1H 3KPMB 1N0XL 1UYWL 1WQVT 3GHBL 5EF1A 2O5XL 1XL4A 1NA8A 4XP1L 5EMYA 2D7OA 4ZFQA 2DQTL 5T3ZL 3DJZA 5TE6H 2EC9U 4XN4A 1AKJB 1KIUB 3P9MB 1RUKL 3MJWA 5IB3B 2RJMA 4WI8A 1K85A 3VXUD 4OGAD 2AQTA 2XZQH 3H54A 2KMWA 4S1DD 3A0OA 4PJFB 1RMFH 3ZQXA 1BEXA 2AEPL 4XMLL 1I1RA 2M26A 5HDQL 1T22B 1U41A 1YYLL 1YEGL 1ZGLM 4O2CB 5EZOL 5GGSB 4XOAA 3N1QC 3ESMA 1G7MB 2K0RA 3LZFH 3ZQ9A 4BUQA 2C9AA 2Q86A 1H3PH 5FKAA 1SXCA 3PGCB 3G04B 5JHBA 2WP3T 1HWGB 4X42A 1IAII 1FVEB 2ZX8A 2DQ6A 1JRHI 4J1UA 4UOW0 3MV11 4URKA 2MCPH 2EC8A 3JWOL 1MRFL 4M7LT 4ODWA 5HDBB 4DFIA 2WOYA 3VFRA 4GFTB 4R4NC 4AQ1A 5DLMH 3EJQA 4KO9A 1NPNA 3Q48A 4PY7A 4UT9A 1AZBA 1JGUH 3D50A 2BNUA 4JG1L 2IPTH 3UTTA 3DV4A 1V05A 2OM5A 3ILEA 4X8XA 4E41B 1CK0H 4GO9A 1R24B 2X4TA 5CEZD 4QCIB 3QIWA 5KSBF 1F18A 2EVFA 2ZKHL 3OKEA 4LQFH 4C47A 2B4CH 3C5XA 1O6SA 3IWVA 4OGYL 5INDB 4FYRA 1LNUB 1IGTA 1N59A 4Q0XH 2A6KA 4K23H 1JTTA 3GSQA 5EA0H 2PYEA 5IG7B 2YQ3A 4Z0BL 1PLGL 4XXCC 3D08A 5KVDH 2GI7A 3SGEI 3V4PL 1ITBB 3T71A 3TFKC 4ERSH 2OA9A 4LGSB 3RPIA 5JIIA 1X3DA 2VL5B 4O02H 4Y2LA 4WZ9A 5T3XH 4XX5A 4MJID 4MVBD 2ITDA 3MXWL 2HLFC 3P40A 4WW1B 3ZKSD 4RMRA 5K9JL 3GBMH 1SJEB 4FQXB 3V0IA 5AYQA 2ZP0T 3GI8H 1CICB 1CL7H 1MJ8H 2YEZB 5FYJD 4I2XA 3BUTA 5CBAA 5LGJA 1UD6A 1I8KA 3EJYC 4HIPA 4LT7A 4UILL 4Z3FA 1NCOA 4J2QA 3CFEB 2DQCL 3QJUB 4Z3JA 2EVHA 5CJOL 5DD5L 2WQAA 4J3OD 2HP4A 4GUOA 1DBBL 4MKTA 1H19A 3MRFA 1S5IH 5FXCH 3TVMD 3W81A 2YJLA 2P42B 3O3UN 2HKAA 3KCPA 3D6GA 1HC1A 1NBYA 3BGMA 2ADYA 5FHAL 3WNLA 5L6YH 3BEWA 3MBWA 1IIKA 2X70B 4MD4A 5DD1L 4EI0A 2CLZA 1QLFB 2ZUWA 3E3QC 2F54E 4L1DA 1CFNA 4X4XA 5SV4A 5A6IA 5D4IA 2C9QA 3KPTA 5F0PB 5TE6L 3PL6B 1J0IA 1M7XA 1M7IA 3X14A 4JFWA 3WFHA 4QXGH 1KXQA 5L8LB 1F02I 3NFSH 4NKDA 4P2OC 2A83A 1P1ZA 2XZQL 1T5WA 4UZSA 3QYCA 3Q5TA 1EHKB 1RMFL 3RTQA 4X6FB 4HLEA 1SOXA 4RWYH 1GXEA 2B39A 3MCG1 2RGSA 4N9GB 3D18A 4HA1A 3RRQA 2SEBB 1YNKL 5C7XH 3EO0A 4ZOEA 5FB8A 3HMWH 2ODIA 1YEDA 4PJGF 3QNZA 5INCA 3LZFL 2Q7YB 1H3PL 2JQZA 5EU6D 5ALCH 4YBHA 4TV3A 2R83A 2ZOUA 3DX9A 3MV9B 1M56B 5D7JA 3MUUA 1CT8B 4UDUB 5ECJE 3ZE2F 2MCPL 1L4IA 1FSKB 2AJXH 1BG9A 2WYIA 2JELL 2ENPA 5C0IA 3QEQA 4FNLH 4R0LB 1DZ0A 2FGZA 4GLRH 5CSGA 3T9WA 3VVVA 1ECZA 4DGVH 1U42A 1JGUL 2IPTL 1IILE 4R3SA 4UANA 4WWKA 3VFNB 3FFDA 1JV2A 1CK0L 4R26H 1G0DA 5IHHA 1MCNA 2BSTA 4CA4A 3OR6B 4WTWA 3FCTB 4LQFL 4ZNEA 3JWNG 2B4CL 3DXAB 1QYGH 3VXMB 1ICTA 2D2OA 1J1XL 5E5LA 5F89A 4DW2L 5JMOC 5JUEH 4Y4FD 1MHHB 1A9VA 5TH2B 3LSOB 1KGIA 4GKSB 1CI3M 3FOMA 1G9NL 5D7LA 3GHEH 3QUYC 4V2BA 1ZS8B 3QDJA 5JOFA 5KVDL 1AXTH 3P54A 4E9VA 1NCUA 5F0LB 3V7AG 4DPCX 4ERSL 4K5OA 4B6ZA 2BSED 1YY9D 5I1KH 2ZPKH 1G0YR 3CQFA 4O02L 4IHOA 1CTNA 1SLWA 3IF1A 4IMKA 3QE5A 2VZTA 4LFHG 5EU7C 1BFOB 3IDIA 1DR9A 2FZ3B 4ZBJA 3GBML 4GG6B 4ZUTA 3DYPA 2ROYA 1AGFA 1DBKH 2IOIA 2K9FB 3GI8L 3QAZC 2YSTA 4FC3E 2G60H 3OX8B 1CL7L 3GZQA 1MJ8L 2LLNA 3L9EA 2R2HA 1SJHA 2RAMA 4UIMB 4BK8A 1NIDA 3LAFA 1MCOH 2HG5A 3QUXD 4BZ1H 4F3FA 4J3SA 4L8CB 4S0TD 1LK3H 4GI6A 4X6BA 5DVLA 1DQQA 3MRBB 3L7FA 3OLIA 3NFNB 2NY4D 3SDCB 2X4UB 5D1QE 1KXVC 4AZ8A 1K2DB 2HFFB 1S5IL 4Z7WF 5K59F 2GJZA 1JCKA 1T7YA 2F1EA 2XX1A 5LGHH 1NCAH 4UMSA 2N0MA 5CZVH 3TN0D 1EERB 1HN1A 4R9HA 5L6YL 1A3QA 2W92A 4CSSA 5IB2A 5FYJU 2MQGA 4LCWD 3FQ1A 4MNGB 2EDQA 3HN3A 2P9RA 1A7PH 3KBHE 4KNUA 3UG5A 3VA6A 5C3LD 1IAIM 3IT8D 3PWUA 2NLJA 4EF3A 3ZDXB 4Z78B 1A0QL 5KG9B 1F6AA 2BY0A 2NPLX 1EIBA 3ZYOA 1R3JB 5IOPB 1VFUA 4W93A 4QXGL 5FWRA 2PO6A 1SYSB 2GBUA 3IETB 3NFSL 1NOFA 1MRDH 1S7WB 1T83A 3QR0A 1OE3A 4F2FA 3IPBA 2WAQA 1ACXA 3NCWA 4FZ8L 4W70A 2A74B 3PP3K 2HJKA 3IJHA 1RZJC 5K39B 3NT0A 4RWYL 4QXUH 3A47A 3QEUA 3GSVB 3RWGB 2NX5E 4IMLA 2W0KA 5L0QB 4N5ED 3VXNA 5IM7A 4GKNA 1BQRA 5C7XL 1UACH 1E8YA 3HMWL 5FYKE 3BKYH 4JQIH 2GIMA 2EIBA 3B7TA 5ALCL 1ILUA 2AQ1A 3QP3A 4I3SH 1GS7A 4H2CA 3KGRA 4LP5A 5MI0C 3FTWA 3RWJB 2X1OA 1OSYA 4HK0A 4WUUD 1JXJA 1S78C 2AJXL 3WEBA 4M5TA 4ZUUA 4GIPD 5IMOA 2FO1A 4FNLL 2EYTA 3EYQD 4LLWB 3UMNA 4L1SA 1UB6A 2HT4D 2QBWA 3LH2H 3MXVH 1BLNB 1T3FB 3MVSA 4PN6A 4DGVL 4N8VG 5A3IC 4PJCB 3SPCA 4YHNA 5IQ7H 5I2IA 3UP6A 4N0FB 1QW9A 4JHWH 1TTAA 3EHBC 3T4YB 3ETTA 4U2ZA 2JTYA 2GI0A 3ARFA 1G9MH 2A6DB 5CSBA 4GUPB 4MCZB 1QO3B 1QYGL 3CVIH 1CLVA 2IH1A 2WYTA 4F37K 3JZYA 4KI5F 2IAMA 4DN3H 4F24A 1QRNB 4HUVA 4KU1A 5CINH 4JFEA 2Y6SC 3OPUA 3GHEL 3VUAA 4W9IC 1EXHA 1MNNA 4W81A 1AXTL 3LKPB 1K5NA 3T3PB 5EZIH 2DLEA 2XZCL 4CADB 3ZHDA 1T1YB 2BINA 2ZPKL 3WIIH 4FERA 5FV2A 1GJWA 5HHQB 5E94A 5DA4A 3R4RA 1TJXA 2FEDD 4M3JA 1BIHA 1PW3A 4IIQA 4S11A 1VFMA 4V1DB 3VYOA 4C56E 1THCA 1NCGA 2ITEA 2FJSA 4G8FB 4ISVA 4P5MB 3FL7A 1DBKL 3PP3H 3EJZD 4GW4B 4BIKA 2G60L 1J05A 1FYTA 1MFCL 3MV8E 4LE8A 5TE7L 4HJEA 3AY4A 2VZOA 4WO4A 3GMPA 1LO5A 1LEIA 2XTSA 2QZ5A 4G6AC 1E4JA 1MCOL 4PJAA 1XH1A 1D7BA 1CU4H 1O7DE 2DTMH 3BVXA 3L1OH 3LB6C 3B5GA 4BUGA 1LK3L 2AS5M 1ML0A 4QF1A 1ADWA 1KGYE 3T0EC 3KYMA 2P5WB 1XHHA 5EIVA 1HQRB 4ZOAA 5E5MA 5E4AA 1W72B 1XWVA 4NO3A 3IPEA 4APQA 4IJ3C 3O3BA 2CKBB 1RZIB 4U6HA 5LGHL 1NCAL 5IROC 5CZVL 2YAMA 4ZMLA 2DF3A 1UWGH 2QDWA 4JEGB 1T6VN 4ONHA 1VZIA 4JANA 5ADPL 3VJ6B 5JPNA 4XBEH 1YMMA 2W95A 1MCQA 3CXHJ 2FJHA 3EG9A 3VQLA 1JZIA 4P2QE 1MI5A 3QQ4B 4P5KB 3FO1A 8PAZA 1MRDL 2F58H 1HHKA 1DLHA 1A3RH 3Q9PA 2M8XA 3ZIYA 3O3AB 3T77A 3TX4A 5AAMA 3NMEA 4WSKA 1WC7B 4U31A 1NCNA 1BMWA 3EOAA 3UAFA 3UIYA 2HN7A 4KROD 3BKYL 4JQIL 4NQCA 1DQMH 4F80A 1TMCB 5IW1A 2R0LH 2E4TA 1ORQA 4IEFB 3V0AC 3RTLA 1KV3A 2DQUH 4G8IB 2VLJA 4HUCA 4I3SL 3EOTH 2V5TA 4BINA 4LDCA 4QHNA 1BAWA 5DWPA 5AYTA 2FDBP 1KTRL 3DKHA 1LWHA 2VLKE 43C9B 2VDQB 1ZDQA 4PSRA 3OLDA 4CVZB 5B1AB 1H0DB 1MWAA 2V2WA 3VB8A 4A7QA 5HVHB 1GCFA 4RIRA 4G7SB 2WIIB 2AV7A 3TO2B 3TT1H 4QYAA 3K6SB 3LH2L 3MXVL 2ED6A 1QQDA 1NKGA 1JP5A 3U7YL 2G3NA 1KELH 2AZUA 2J2ZA 5IQ7L 3AMKA 4JHWL 1F90H 1CB4A 5HHVH 2IG2H 1ETJA 3FQRA 4FNUA 3WKQA 3KPRD 4RMUA 4F7PB 4Y1AA 4M5YH 4HPYH 4YHKL 1G9ML 2KQNA 4L1HA 5B7FA 1UD8A 2ENSA 4LKXB 3SKMA 3CVIL 1V7MH 5JXEA 5C0CE 4YHOH 5C09B 4DN3L 2C9PA 4YXLH 3GTTA 5CINL 1JGDB 3S5LG 5TD4A 2X05A 3BP5B 3W11D 2R4RH 5EZIL 5D93B 3X3GH 3GXIA 4JFSA 4D0CB 2EXWD 2WXLA 3WIIL 1CFSB 1DSFH 3MRHB 4WV1A 3TS8A 4ZFFA 1R9FA 3Q1SH 5F21B 3ULVF 2EILB 4L5FH 4Z7OE 4FQXC 4UQDA 4PV8A 1LE9A 4WO0A 1YNTB 1CICC 2AXGA 2ZUSA 5HPMB 3OJDB 4TNVK 4PP2A 2R15A 2XWRA 3L9RB 1FFOB 4QRRB 5IHBA 2VR8A 1IC0A 5CLXA 4DPBX 3LN9A 1CU4L 1X7QB 2DTML 3CCHB 3L1OL 3QCVH 4BFIB 3FZUC 1V8HA 1HYSC 4DGYH 2E8ZA 1X9UA 5C07D 5IUCA 3TCXA 4K5PA 3DGGA 5A2JH 1ZIAA 5KYWB 3BQUC 5KYXB 3WJLC 4PRAA 5HD8D 1SDDB 4KH2A 4MLIA 3VXSE 4PIBA 2C9VA 4NS0A 3GMMA 1NTDA 3L3KA 2P5EB 3CMOH 1NKRA 2ESVB 2OXGA 4U7SA 1WD9A 5LAXA 3L5WA 4KI5D 2QVTA 2Y2TA 4XBEL 2JH2A 4K7PY 2A4CA 3CH1A 3UX9B 5EIIG 4ZZKA 3ECQA 1WWBX 4R7DB 4ZFOL 1NC2A 1BZ9A 2H1XA 2R1YB 3MTRA 4O5LH 2PCPA 4HUXB 5F7UA 2F58L 2GEEA 3B2XA 4PRBB 1OO2A 4D9QD 4NM8H 2HSIA 2W65A 4DQAA 4LGRB 5MERB 1AIZA 2J8UA 1E3ZA 4PI2A 5IHUL 4NUMA 4FQHB 1AD0A 3BD4A 1BZ7A 1DFBH 4J6RL 3TA3B 4F9PA 1DQML 2XACC 3UGUA 1QUPA 4Y4KA 1YEJH 4HWUA 4N2KA 3VXRD 2DQUL 2BSSB 1DVFD 1OL0A 4RSVA 3EOTL 3H3BC 1BD2B 3QXVA 4KRMB 2DD8L 4B9GA 1FSKC 4DZ8A 1MW3A 3OJVC 3PHOA 4GXVH 2JF1A 2A0LD 1HKFA 4QXTA 4R0LC 5F1NA 1NGYB 4X4ME 2ISDA 1FL6B 2LABA 5JW3H 3TT1L 1HHHB 3H9HB 4LVOC 4PAZA 8FABB 1KELL 2UX6A 3D51A 1F90L 2C3WA 2P8MA 2BVPB 5CP3H 5DDHB 5JOEA 3T08A 1A25A 4M5YL 1ASQA 1ILSA 2C34A 3V5HA 1TU2B 1QLEH 3MBEC 3Q5OA 4FA6A 1V7ML 2W0FB 4BM7A 2A9NH 4YHOL 4YXLL 4GP5B 4P48A 1JD7A 3IFNH 2R4RL 3ARSA 1EFXD 4W6XB 1PU0A 1U3HD 2JKLA 4XMUA 5CJXC 3X3GL 2HH0H 1DSFL 2CRMA 3FUDA 3JV6A 2H3XC 1RP9A 3QDMB 4B9YA 2L3BA 3QRGH 3Q1SL 1B4RA 4GAAA 1DJZA 1MCSA 1DJYA 4L5FL 4G9DB 4P57B 4ES8A 1GMEA 2HTKD 3STBA 3IPFA 4LHUD 5JIPA 3VTTA 3BW9A 5I17B 3LQAC 3MJ7A 4MB4A 3QIUD 1AIFB 3QC5X 5TDNA 1MY7A 5LCVL 3UBXG 1G9EA 1FZOB 5KS9A 3Q2CA 3ZW3A 1HNGA 1B90A 1P7QB 4JDEA 5KTEH 5EBMB 1I4FB 1E42A 4PJBB 1CJYA 4ANXA 2D3NA 4P2RB 1Q9KB 2F1AA 4WHCA 1E4XI 2WMPA 4KO7A 2Q8BH 4GEJA 2RH0A 3RVVD 5D7IA 4BFRA 1MLBA 4N20A 5EEVA 1OT1A 3KPNB 3ZQWA 4K71C 5KYNA 4YE4L 1E27A 3ZJAA 3CMOL 2J55A 3FTSA 4PTUA 4KZDH 4OCYH 5F93C 3RNKB 5A2BA 4MZ3A 2F74B 3ATAA 1SPDA 3DETC 5FK9A 1D5BA 4LL1A 5EBWB 1R3LB 4LCVA 4O5LL 4AKPA 3OHXA 3WKMH 5I0WA 4PPTA 4ZTOH 1CXIA 4MAYB 2A74C 3ARDD 2BNQA 4NM8L 1NMCB 3LH8A 2K7PA 3U2JA 2XQYA 1DBAH 4NPYA 3ULVD 3GIVB 3O2VH 3VXQB 4X9YA 1BX2B 1FFQA 3MJ6A 3QXTA 1UT9A 2B5IB 2AF2A 1D5ZA 4NO0A 1SDYA 4XCEA 1L6ZA 3ZHFA 1YEJL 4HCFA 3T65B 4N0UA 4WK4B 3CSPA 1ODUA 1ET8A 3F7YA 3QNXB 1TZOA 1M2VA 2E6PA 1U93B 4E9YA 1Z9PA 5IB1B 1N8ZB 4QJ5B 4BGLA 5KVGE 3HE7C 4GXVL 2GTZB 5AOKA 2HT3D 3L4UA 2J57A 1FFRA 3DX3A 5EOCH 2EVGA 4U0RB 4JFXA 5JW3L 4PJIF 3FUNA 5I66B 2VERN 5DRWA 4WI5A 1ZT4A 2VR5A 5MENA 4FG6C 1RJZB 1S2EA 4XP9H 5EC2A 1JZFA 2VISA 4ABWA 1MFNA 1U58B 5F97E 4H25A 1HVXA 1R17A 1JOIA 3FK3A 3JWNH 1NFDB 4PJEE 3AUVA 3FS9A 4LOVA 4PG9A 1QLEL 1W9XA 3M1OA 3AU1A 1TJMA 3MNDA 4NLAA 2W9LA 1V55B 5DC9B 1DQIA 1OTSD 2YPVA 4UM9B 3D39A 1XR8B 3PHAA 1PGRB 3VFWB 3B9EA 3HC3H 3LQMA 4Z3HA 2YUXA 4D8PB 1LK2A 5CN1A 4WU7A 2HH0L 1Q1PA 2YPLD 5GGUB 3SE3A 4HIHB 1HU8A 1UGKA 3TZVB 3MUZ1 4FG4A 2UVEA 1BJ1H 3QRGL 4X5WB 3NBNA 1QOKA 2BZCA 3II2A 5DHXB 1BVKB 4NBYB 4MAUH 5ALBH 1KSRA 1KLFB 3ME0B 4WFGE 4ANVA 2YXMA 1KBGH 4OZFG 3ZHLA 3U46B 5MEOB 1TJHL 2YK1H 3C6LA 4H5SA 3MX0A 1CF1A 1KCVH 4HF5H 4XBGB 3BAIA 4KRPB 1D7DA 4ANUA 3V4VH 2PUQT 4PRIE 2BS71 4RNRA 4Z0XA 2VH5H 5KTEL 3U4BL 5J06A 3DSFH 4LASH 4ZW8A 3RWCB 3DX8B 2XXGA 5B1JA 1Z66A 5IBLC 1QLRA 1ZANH 4HZAA 4GRLB 2Q8BL 1TLKA 3UJTH 4UQCA 5ANHA 1MW1A 4KPHH 4KXZI 4LSSL 3CDFA 2PABA 2VR7A 3NJFA 5EOTA 5GSRB 4MJ5B 4RX4D 1SHWA 4O4YH 2WQUA 4KZDL 4OCYL 5D2LA 4MMXA 1WS8A 1XTLA 3SOBH 3D4ZA 2CGYA 2XWBA 3O4LB 5CWSA 5IB4A 1KCWA 5HGHA 3EH5B 5ETUA 2IPKB 3WKML 3KLKA 4ZTOL 4BXVA 3PJNA 3H4HA 2BM3A 2CA3A 1DBAL 1KPVB 4FNSA 3ZDZE 5CN3A 5GS3A 3A21A 3TCLA 4JRYE 3O2VL 2R1XA 5A16B 1AYRA 1SEBB 2XWJB 3C5ZD 1CD8A 4GQQA 3BISA 4UBDC 4AMKH 3ELQA 1X5LA 2NY5C 1AZZC 1KIQA 1GC1C 1DYZA 3V0JA 2UY7A 1GZHA 2LGNA 2YOCA 5GRJH 1NFIB 4ZJ9A 1S7SB 2X2YA 3AQXA 4XH2B 3NA4A 2Y07L 5FKAB 2EDKA 1PNDA 1YN6A 4LNVA 5HVHC 4L8SA 3TEWA 5EOCL 4XNZC 1OCWH 3S5ZA 3NIDF 2F8IA 4AQ1B 4EAEA 4FG0A 3S4SA 4LK4A 3JYCA 3RKDD 3WHE0 4RISH 4BCYA 3GMNA 4UOZA 1N4XH 1F2XK 4XP9L 1G7PA 3W0WA 4C4KT 4JRWA 3V0FA 2OMXB 1Z9LA 4HD5A 1G5GA 1T6BX 4I5BA 2NY3B 3HEIB 1T7WA 4J3UA 2RACA 1ONQA 4IBYA 1AHMA 3DDGA 4NN6B 3V6ZA 2VZ3A 3LKNB 4CU6A 4N22A 2A9DA 3OKKA 2NR6A 4BWUA 5F6HI 1KWKA 4XO4A 1WAPA 1YPZA 2KPWA 3HC3L 1VGKB 3NCFB 3RL1A 2DLTA 1N59B 4AYSA 3FOLB 1KACB 3MSPA 1HSBA 3GLAA 1MDAA 4AIXA 4JX0A 1VACB 2HLAA 3A5VA 3NIGE 2BSRA 5J6SA 5JDSA 1RUPH 1MH5B 4N2BA 5KYUA 1J8HA 5JQHC 2QFPA 3QG7L 4U1KA 5ALBL 4MAUL 3RA7H 4P5TB 2LFEA 5D7KE 5SX5K 1KBGL 3FTUA 4TQIA 1QSEB 4FXLA 4LMQI 5C9JB 5L8KB 2YK1L 5DA0B 3GXDA 4G9FB 4JZOA 5CAYB 4LL9A 1KCVL 4L2YA 2W1NA 4HF5L 1BPVA 5DVKA 3V4VL 4ZMZA 5I1IH 5JO5A 2CO6A 2VH5L 3P4MA 4Y9BA 5BW7A 3S9DB 2NY0D 3DSFL 4LASL 3L2MA 4YIQA 4ZXBD 5LGJB 2MRYA 4NRYB 4PTTA 2AJYH 1ZANL 2H4EA 3BCDA 2XTJE 4QWWD 1B9KA 4ETYA 5HYQA 5FM8A 3POHA 2X28A 2V4LA 1OT2A 2H8PB 1EAOA 3FBQA 4KPHL 3WDIA 2R9HD 3G6JF 4XP4H 4HH9A 4X5PA 4A68A 1KJ2H 3W37A 1D9KB 1JWUA 1JI2A 1WK0A 4O4YL 4X6DF 4YFLI 4MS8D 4NRZB 5SWZE 4ACPA 3PAYA 4KK6C 3EYUL 3C75A 4OFIA 3K3QA 3FW6A 2VWEE 4MASA 1JPGA 2KLRA 3SOBL 2KERA 1E9PA 4X4XB 1PDKA 3VXUA 1CFNB 4NHCH 1M6OB 4IRSC 4ODBD 4KGJA 3W9EA 4TQ8A 5L8JB 4OCRH 4K5NA 5K1VA 3MCYA 3LKRA 3SO5A 2BVQA 3X14B 1KYFA 1OAYL 5D9SB 4MFHA 2VQ1B 5FM4A 4KV5E 3JTSA 4GRWB 5EF2A 1COBA 2DMKA 3LRSA 5FA4A 3RBGA 3TA3C 3KH3A 4U1MB 4DP8X 1NAMH 5AVUB 1DVXA 3SCMB 1OGTB 4ZW3A 1BVNT 1H3VA 1UVQA 2ZCKL 3L5XL 4AMKL 4Z3IA 1IJ9A 1VHPA 1PQZB 3FFCD 5K9KA 5FB8B 5KVEL 2W81C 1FNHA 1QVOA 2C7UB 4OZFB 5D5MA 5GRJL 5INCB 3B43A 4XNYH 3W5NA 4WI9A 3IKKA 3KDMB 3U6XS 5CEXB 5SX5H 2P3YA 3QORD 1KB5H 2AJ3A 1LP9B 1J0HA 1ZJAA 4K15A 2CUHA 3T4AB 3B83A 4RISL 1N4XL 3FUFA 4LLUB 5C0AD 3IGAA 2DPKA 2KI6A 4U1HB 7TAAA 1JV2B 4HCGA 3OKDA 4FNQA 1ZXKA 4L37A 1A7OH 1U8IB 4PJ9D 1I9JH 2P45B 4ZOBA 3B2UD 2ADGA 2CUMA 4JRXE 1SVBA 4HEPG 3DBXA 3RL2B 2FAUA 5AB9A 1E8WA 3ARZA 3H7BA 3QNYA 4MJIA 1K4DB 2OSYA 32C2B 1M1SA 3R06A 1MFEH 2QVKA 2WLIA 1RUPL 3QDGD 4YDJB 1LO0H 4XWOC 4BUHA 4DO4A 4IKJA 2RA1A 2JCCB 3RA7L 1YUKB 1TZIB 1Z2KA 4GKLA 2X42A 1RIHH 1UQSA 2MWCA 2A4ZA 3ULUE 3CVHB 3UPRA 4ZUTB 3GI9H 4U1JB 2E7CA 3GEWB 2VXVH 1FQ9C 5E6RB 3QJRB 3IJSA 1AQ8A 2GITA 4NM4H 5I1IL 1RD6A 2WLNA 5AALA 5E2UL 4YDNA 3CSYA 2YXWA 2PYEE 4ONOA 2AJYL 3DTUB 3M86A 3TVMA 1DQTA 2VKWA 4AG4H 1G7LB 4ZRGA 1RSYA 2APBA 4GAYA 3WMSA 5ESAB 5H4ZA 5DK2A 3G5ZB 4B9KC 1S9WB 5C6WH 1QFHA 1NFAA 4XP4L 1BWWA 3AQYA 5EO9A 4R4ND 3ECBA 4C4KO 1KJ2L 3U0PA 1S46A 3KWVA 2NZ9C 3HRZC 1QFWH 3RYMA 1A7RH 3MRPA 4HS6A 4P2CG 3G7TA 2XJLA 4Y89A 4KFZC 1RXLA 1SBSH 1G9HA 3L5IA 3RE0A 4NHCL 4I2XE 5G5DB 1UJ3B 4I1NB 4MAYC 5FOBA 4A63A 4EI5B 3QG6B 4OCRL 3WUZA 2OJEA 4PW9A 3V5DB 2PO6B 2P46B 2ZAIA 5L4IA 2BSCA 3P9WB 2GSGA 2G9KA 5GGTA 1UEMA 2NUTA 4AV4A 2HJKB 5D6CA 3WE6A 2B5IC 1NAML 1RZ8A 5EU6A 3OL2A 3ESNA 4IMLB 4MAZA