1ZK5A

Escherichia coli f17fg lectin domain complex with n-acetylglucosamine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
175
structure length
172
Chain Sequence
AVSFIGSTENDVGPSQGSYSSTHNLPFVYNTGHNIGYQNANVWRISGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWCVGNYVSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords F17G adhesin subunit
publication title Impact of natural variation in bacterial F17G adhesins on crystallization behaviour.
pubmed doi rcsb
source organism Escherichia coli
total genus 41
structure length 172
sequence length 175
ec nomenclature
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1zk5A00
2BS8A 3F6JA 3FFOA 1O9ZA 4K0OA 1O9WA 1O9VA 1ZPLA 3F64A 1ZK5A 2BS71 2BSBA 1OIOA 2BSCA
chains in the Genus database with same CATH superfamily
2EYRB 5KS9A 2XU9A 3DDGA 1IAOA 3H6AA 4WJKB 4PEEA 4IGBB 4ZUUB 4HIEA 5F9JA 3UJTH 5E2VH 3TT1L 3C5SA 4BFBD 1DQLL 1LWHA 1A3ZA 2HLFC 2WLIA 2N1TE 2LU7A 3VFRA 3VAEA 4UT6A 3QEUB 5E1AA 5HGDB 1RZGB 3T5WA 4LSPH 2GC7C 1GA2A 3TVMD 5F0PB 1TTCA 3TCLB 1I1AA 1U0QA 4OCMC 3DBXB 1BA9A 2DQJL 4K73A 1YAZA 1ED3A 4ZAKD 3P0VH 4RLDA 3ZKSD 3OKLA 4F7TA 1ZXKA 5JPMC 2QQLL 2VAJA 1N67A 5B8CC 5K9JH 5ENWA 2WNKA 1BDYA 4C4BA 3IFNH 1Q9KB 2IWEA 1S2EA 3WTUA 5J57B 3DROB 4GQ9L 1MFBH 1BAFL 3FFDB 3L7FB 5H94B 1KYOJ 4LHJB 3RFZB 5SWZE 4GQZA 2FEEI 2IAMC 2ZG2A 4YGVA 3CU7A 3PY9A 1EAOA 2KKQA 4N0YL 5C09A 3W82A 5JLZB 3IKCB 5AALA 1J1PH 1J88A 1IQDB 1ZVSB 3BP4B 4DHLA 3H9YA 3WEBA 4OCXH 1AGDA 3RWGB 4WEMB 1OGAA 5IQOA 4C83B 2E9JA 1GGUA 3H3KA 3LHPH 3NCEB 1PZSA 3T71A 2PWGA 2MOGA 4S0HA 2G3NA 2MPAH 3GMOB 1YEEH 4Y2DC 2B59B 3RZCC 1E5CA 5E2WH 3FH7A 4OGQC 2A4ZA 1YC7A 4O51B 2R1YB 4IKNA 1UT1A 4APQB 3KLKA 1P5VB 4XNMB 5CAYB 4PJBF 2OTUB 3P4NB 3BKJL 4LL4A 3KEHA 5KBKA 2XCMC 3B9DA 4I9WE 3UERA 1F4WH 1T22A 1W9XA 1WFIA 3NP4A 3VGBA 1XFPA 3UAJA 3ZTDC 2DICA 4FEIA 2WVVA 2VLJA 4MNGB 3FB8A 5CS7A 5CD3B 4J3OH 4C4KT 3WOVA 7CGTA 3GSQB 5LAXA 4HKZA 4I13B 2X0WA 4PW3A 3TFKC 2JELL 3ALPA 5K93A 1JZ4A 5ABDE 3WHXA 3ARBA 2BVQB 1SOXA 2AK4E 3ZYJA 3DX9A 3E6FA 1U91B 5FDWB 1TU2A 1KLGB 4M3HA 3OKDB 4OFYD 3U30B 3SDAD 3A6BL 4M1DL 3TN0C 2HRHA 5J13B 2FATH 2L3BA 2UWEB 5TF1L 4ANKA 4GAJL 4D7BA 3S4SA 2BW5A 3OMIB 1MIEL 2A73A 2CMRH 4OCWH 4XGZA 2ETWA 5I19H 2HH0H 1CBJA 4RAUB 2J25A 5T1KB 4OLVL 1DANT 1RULH 5JORB 5EBGA 5DWUH 1V54B 2Y0SA 2OZ4H 4BE5A 1OSYA 4PGBA 4TKWA 3OPUA 4XAKD 3ZOAA 2MSPA 1YMHA 5BVPL 2H26B 2VE6A 4G72B 3QG6A 2VERA 5AAWA 1BEYL 1U3ZA 2PMZA 3NZUA 5AOLA 1F6LL 1XSJA 2VXTH 1XSIA 2FYYA 2PWFA 4FJZA 4BFIB 1MWAL 1Q0XL 3PWJB 3OJDB 2P52A 4Q97A 4JANA 3TL5A 3IN2A 1NGYB 5BJTA 2HRGA 4HBCH 3NCJH 4CSZA 1VZGA 3PDOB 2V5MA 4LDCA 4EI6A 4FQQB 1OO2A 4XRCA 4JMNA 3FT4B 3EOBA 1QSVA 5T33L 3B1TA 2R15A 2NX5E 1TIUA 3PPSA 4YHMH 4J4PC 1LP9F 1U8MB 3ZDZF 3ZDYF 4YDKH 3WFCH 5DMYA 3Q3GA 5DMKB 4HAKA 4PSPA 1WF5A 2P5EE 4YFDB 1KTBA 4AYID 3T4AC 4FTVE 2EIEA 3GMQA 3BW9B 1A6TA 2EO7A 5F7NC 1P6FA 2VGLM 2HLAA 4XP6H 5K1NA 3I3BA 1YJDC 1CFBA 4Z3FA 1H8LA 4KHTH 3LQAL 4Y5XB 2VITB 4G3YL 1QZNA 1SMAA 1VADB 1OSPL 5GRXG 4YUEL 3RBGA 3GI9H 3VFNA 5CMAA 2NY2C 4X83A 1UXWB 5DUBA 2FX9H 1RZIB 1CTNA 2PXYB 4N0CD 2YPLB 4X9BA 5KYUA 5DZLA 2DH3A 3RWHB 3UMTA 5I16A 1CE1L 4I89A 2W1NA 5DHYA 5A6LA 3EJCA 4LHUB 4QOKE 3TV3H 5J9PB 4ODXB 1MY7A 4XNBA 2JB5L 3R8QA 1XIWA 1AD0B 1SY6L 2NSXA 3MRNA 3QG7H 4QJ3B 3VACA 5LB1A 1T0PB 5HDBF 4NLAA 2APWA 1JGUL 1KXQA 2FZ3A 1E40A 1X9LA 2FYVA 2VDQB 4UBDD 4R7LA 1H3TA 2NR6C 1UXSB 5CJBA 3BE1L 3EYOA 3IPBA 1UJ3A 1RIHH 1CD1A 4CJ1A 1JMXA 3U0PA 3ZUCA 2F5BL 1A7NL 2OMYA 1JF5A 1FH2A 4XCCL 1EDYA 4Z7VA 1TCMA 2VZ3A 2WXJA 4BWWA 4ZQTA 4YAQB 3VXMD 2X3BA 5BZWA 1J0JA 4L8DB 5GGSB 2DMKA 4LCCA 5EBLA 3QZPA 2Z91A 5DS8A 2IH1A 1JZ2A 1WG3A 3EDEA 4ZFGL 4GG8B 2DWEA 2OK0L 3CMOH 3U46A 1ILUA 5AFAA 1XCXA 1ZTXL 1CF1A 5DLLA 4F37F 1HX0A 2ZCHL 4OZGB 1JNNH 4IMLA 3WIHL 1QUNA 4XBPB 4QTFA 5HYJB 5HJGA 1E27A 3BD3A 3FF8A 4N2KA 3VA6A 3IYLW 5AAPA 1IVLA 3BESR 3T2PA 1IILE 1WIUA 2O5NA 2UXVA 1OAQH 4GSDL 4NZTL 1NKGA 3TJHC 3KHOA 4L37A 3LIZH 5E9DA 1GZPA 5FKPB 1SYSB 5DI8A 3QIBC 5D7LA 3OHMB 1MHCB 3WAKA 1IKOP 1A2YA 3QI9D 4WJ5A 3QPQD 5D1XD 2W07A 2BNUB 3BHBB 2QDWA 2ED6A 1W8OA 3IBOA 3GB7B 4CVUA 4D9QD 1HCYA 1L4IA 3HG5A 2HZHA 4XXDA 5IJDC 2VXUL 3I75B 5JOEA 2EE3A 4GAGH 1DBBH 3FXIC 3JWOL 4JO3L 4MCMA 3QR1A 1VGEH 1G7MB 2PKDA 2ZWKA 3H7BB 3NIDF 1OGSA 3L8QA 3VWKB 5E6ID 4HOZA 1I9EA 2XKSA 1XGQA 5IUCA 5LDSA 1GHFL 2X1PA 3O6KL 3Q2NA 1MI5A 3JSSA 3IFPB 1BQKA 3LS5L 5ICYB 3F58H 3S97C 4S1QL 5L2JB 4WWKC 1I8KA 1IEAB 1B4JL 1QFWM 1XX9C 1RJLB 4LLUA 3A6CH 4G5AA 5LGYA 4JDEB 3T6XA 1D6EA 4DGYH 2HFFB 4KJYA 4BFGA 5LQBH 3E8UL 3P0YH 1VCBC 2WLNA 3HIZA 2X2UA 4TNVK 4XVTL 2WP3T 3HS0B 1R34A 3DRQB 5CZVH 3LZRA 3T3PB 2R59A 1ZVNA 2J71A 3CBRA 4Z3JA 4AQEA 2JXMA 4J3OD 1FNSH 4P46C 5AVWB 3SYCA 2J8UA 2GY5A 1ZGLP 3G7TA 1BLNA 3EJZD 4JUSA 1S4IA 5I1DA 1B3JA 3HHSB 1MNNA 3RGVC 1VKXB 4RGMB 4FNPA 3ROLB 4JRYA 3D25B 3SQOH 3JWDL 1NCBL 1CUOA 4PR5A 1II4E 5AG8A 5HY9B 1F41A 2GPZA 3KYOA 1M1XB 3OQRA 1GJUA 2DQCL 4LPXA 2VDKB 5FOJA 5IBTH 2Y1VA 4C59B 5TDOA 1D5MB 5BQ7B 1N2RA 1J05A 3DVNB 2EDLA 2R2CA 3D2UD 4NZRH 4UQ2B 1N4XH 2V0AA 4NCC1 4P3CL 1F13A 5F7BA 1XGUA 2APSA 4LCWE 2VDLH 4RGND 1IAII 2BC4A 2GFBA 3KWVA 1T0MB 4DCQB 1A6AA 5I1JH 3FN9A 3H2WA 1HE8A 4WW1A 5E94B 5INCB 3QHFH 3HCVA 4FQJL 4X7DC 5DHVH 1CGWA 1WC7B 3DX1A 5LWYH 1YN7A 3IU4H 3OC8A 4OCYH 3RB7A 1XV8A 4JW3A 3FCTB 3LMJH 3O6LH 1IC1A 3FT9A 1J5IA 1LO0H 2IPUK 1VPOL 2WKOF 3V4VB 2XBZA 3DXAA 43C9B 5FB8A 5JQ6L 3BUYB 3HE7A 3LOWA 4KKPA 4OKVA 5HHOB 5MP6L 4PYHA 1H3UA 1LNUA 1X5XA 1ZA3A 32C2A 1UOVA 2X4UA 3C6SB 3IDNA 4LLMA 3Q6FA 5DU7A 5F96L 2MKWA 3OAYH 4FFZL 4UQCA 3CK0L 4D0DA 3B6SB 5EN2A 1SN0A 2RD0A 2P24B 4PM1A 4ALAH 4JRXA 2WXRA 3U1SL 4CKQA 1AR1B 1X7TA 4FDWA 4GMTH 3RX7A 1FGNL 3R4DA 3SD2A 4PD4J 5EO1A 2JI2A 2YWZA 4UAHA 2A3TA 3R06B 4CILA 1IMHC 4BM7A 4ZYKA 3RGHA 5GGVY 2QQNH 2WGNB 1VFOA 3EBGA 3UADA 4P9MH 4BA8A 1FE8L 3PV6A 5IVXE 4DEPB 2OTPA 3ABGA 1R24B 4W93A 3HMXA 2DWXA 2AJUL 4I18A 1E9QA 3OTTA 4S2SA 2RFXA 4ONGL 1TO5A 3WL9A 25C8L 2CLZA 4JHBA 5IFAL 4OD1H 2FQFA 1TXKA 3HJEA 3HBGA 1X6LA 2BWQA 3LJ3A 4LLVB 5CEXA 1R46A 4L0ZA 1GIGL 1YMMD 2JVUA 4JDZB 4YDLC 3SOBL 3IAQA 3CFJA 4H25B 3LN9A 5K33A 3NIFE 1I4FA 1P4IL 3QPXH 4P4RB 5HI5C 3MRMB 1ZK5A 5F3HA 4PJ8D 4RWYL 4ADJA 2KH2B 4XCNB 3BZDA 2CPCA 4YXKL 1A6WL 2Z0BA 4BWTA 1P7QD 1FNHA 3P3YA 1KWGA 1WZ1H 2BP8B 1TPXC 2XQ0A 3F7KA 4FQXC 5EU4B 3GHEH 1IQWL 1FLTX 1N18A 3MRDA 1DZBA 1WTGT 3ASNB 4MNQA 3KPSA 3KLHC 4XX5A 2E7BA 1E8YA 1U2YA 1NOLA 4APXA 2IQAA 5D7KD 5C0JA 3FH8A 3FUDA 2XN9B 1BQHA 2KZ1B 2H47C 1JHKL 1TMCB 2J57A 2LHAA 2YGPA 4NOBA 1PBYA 3BAEL 5FYJE 2ICEB 4I9XA 3N40F 1YEFH 2CZNA 5TGBA 2R4RH 3OPZH 5DUML 4NO0D 2CUIA 2DAVA 4JY4B 4KY2A 1OAJA 3P73B 2FR4B 1ZAGA 4U1NB 2APBA 3GTTA 2VJXA 3ULVC 3EFOA 2LOEA 4FC3E 1KXVA 4QRRA 4X5LA 3MCKB 2WQSA 3GSOA 5JOFB 2CDEB 1PSKL 2BVPA 4R5TA 5GZNC 1DCLA 5DEGA 4ZO8A 3K6FA 5IW1B 1IFHH 3ECVA 4ZMZA 1D5IL 3SZ6A 2BOCA 3BWUC 4K5OA 3LX9A 1ASQA 1T89A 2DLFL 4K3JH 4NYLB 4WHCA 3NBNA 4YC2B 3MXWH 1MPAH 5I24A 4K7PY 1XGYL 2VQ1B 1A9EB 4F5CE 1KXTA 5C7XL 4OF6A 4K3DL 3TESA 4FMVA 2ZYHA 1AYRA 4AMKH 1N8ZB 4M48H 4HIXH 5EU5A 2FWLB 5FYKE 3D7PA 1EZVX 3FT0A 3HN8A 1BZEA 4FLRA 3IMUA 1BAWA 5G4OA 1MCCA 5CD5C 1PLGL 2OMNA 3DVGB 4PRDB 3QDGD 1CJYA 5IB2B 3HAEA 3DARA 4OUUA 4P05A 2DYRB 3EJTA 4DT2A 3ZBMA 3K71B 4OR1A 5BW7C 3SDXF 3QIUA 3BZEB 2HG5A 2KERA 2ZTBA 4X6DA 3TYGH 1XH0A 3ZIMA 4HJJL 1ML0A 3IK2A 4Y8AA 1EX0A 3FB5A 3VQ1C 3QUMH 3ULVF 3ETSA 4ERSL 4CC4C 5IV2B 3R8BB 4ZTPL 3W3BA 5LXGH 5AAMC 2X1WL 4P2QA 5ANMB 1S9WA 5JOPD 1QFWH 2DI9A 2XJLA 4XMVA 5D1QA 5D7SL 1YECL 1MWOA 3L3HB 4FA7B 2CCVA 4TULH 5J6HB 1JXDA 5EZPA 3N3EA 3EYQC 4KHXH 3A24A 2J8HA 3VD1A 4NDMB 1B4LA 4LEBA 4WI3A 1MFMA 5AVRB 4N0UE 2GYSA 3E6HA 5GISL 3CZUB 1CL7I 3DV6A 2HVKA 4PPTA 2VSKB 1E9OA 4N68A 3ZX1A 4N8VB 1QA9A 4L4VB 4OJAA 3POCA 3V6OA 1UM5H 5BVJA 3EGXA 2OMZA 1T21B 2WKGA 4BSVA 3D0VA 1AZBA 3T65A 1RVFL 4XO5A 1FO0B 3I6KB 3ZRSA 4CC0A 2H1PL 2VLLB 3G6DL 3EHBB 2NY3B 1O7DC 4K94L 1UOLA 2X87A 3SZKC 1FUNA 3QYMA 3VDAA 1B88A 4K5NA 1TTBA 3VFGL 2GEEA 3GMPB 3IETB 1F00I 1U8OA 2KZBA 4MJ2A 5CILL 2O61A 2AABH 4NQDB 2VH5H 5DJ8A 2GK0A 5MEQA 1ZT1B 1Y6NR 4A6YH 1TOXA 2Q6WA 1AH1A 2CXKA 5LLIC 1NEZA 4Y4KA 1AXTL 2HT2C 4WSJA 2P44B 3EOAB 4HD9A 5HPOA 2EXTA 3BUBA 1JHTB 4RSYA 3QORD 2FK9A 2V8MA 4YS4A 4Z95H 3SODB 4EBQL 1EZUA 2ZUUA 1RERA 1QEWA 3EJSA 4FF9A 1KGCE 4IMKA 3BAKA 4JPIA 2X9XA 3CLEL 2JCCE 2IANA 1JD9A 2VDQL 3L16A 1ONQB 3RQ3A 5IJKA 5FGBC 3SIKA 5IKCB 4J28A 1JAEA 5FFLA 1DVQA 3MOBL 1RZJC 2EDYA 4OGAD 3T3ME 3ZT7A 3SPVB 4RMWA 3GBLA 4Z7UA 1HQRB 2HN7A 4N8PA 3VUAA 2DZEA 1BX2A 1N3NA 3THML 2BSSB 3P11H 4I0PB 1D7CA 1FZKA 2AAAA 2DTMH 5FF6A 4OZ4A 3S5LG 4P57A 2IH3B 2W8CA 4XMUA 2F53E 2VNCA 5DHMC 4YXLH 3PABA 1JYVA 4ORGB 1YVLA 3OG4B 3N5AA 3O8XB 1BZ9B 3UPAA 5D9SA 3WD5H 1BJ1J 2K6ZA 2YKLL 4K8RH 1PVHA 1Z1WA 5J11B 3B9KC 5F7DA 2YHGA 4UILH 2XPGA 2VDOB 4GW4B 1CLYL 5D5MA 3UTQB 2HT4C 2OQJA 3ZY7A 4AV0A 4KZEL 4HHAB 2HB0A 5EC2B 1MCIA 2DLGA 1FNEA 3RUGB 1YN6B 3GXFA 1QRNE 1U8NB 1XR8B 1JUFB 4G70B 1FBIL 5TPWH 3FNKA 2QADB 4PTTA 3U9WA 4ELMB 2JK5B 1NINA 3P0GB 4LCVA 4NQVA 4FLSA 4KOBA 1TUPA 2XN0A 4MB5A 4RAVB 2PYED 4P2CG 1J5DA 4K23L 2VDNL 3UACA 1MJ8H 3B5GA 2JH2A 1GMEA 4L1BA 3TO4B 1FFQA 2W88A 5D4JA 3NEOA 1E8ZA 2OL3B 5J12C 4QXUL 1FV1B 1E5AA 3QJQB 2P49B 3BVNB 1DVYA 1OTTC 3EW3B 4NKMB 4PJHB 1T5XB 2P8MA 1R3IL 2GJ6D 3WXVL 1U8PA 5AZ2H 4AYFA 3PWNA 1A1MB 4WEEA 1A1NB 1UXMA 5DTFA 4N9GA 2BIIA 4E9RA 2NY7H 2ZNXA 1G9ML 2FX7H 5DHDA 4HOWA 4POZC 3S3DB 2A0LD 3K74B 5LCVL 3G6JB 1NBCA 1HILB 1UA6H 4EJ1C 3KPRB 1FJ1B 3HC3H 5I1CL 4R7DA 1YJDH 4HZLB 1BBDH 2BLFA 4DFIA 4JPVL 2CR3A 2YAPA 1QLEB 3K91A 4ONOA 5C0FB 2FWUA 3SGJC 1T80A 1K4DB 3U36A 3JV6B 3GLZA 2EXWC 5C07B 2X10A 3O3DB 4F7EB 4NNPL 2VW7A 3N43B 4LSSL 1WHOA 2F74B 4PRHE 4UM9D 4L8SA 4Y9FA 5IQ7L 1YO4A 4YBLB 1FVDB 4WLCA 5KVGH 5KW9H 2C1OA 2UV3A 4G59C 3ZTNL 4NQCD 2P43B 3OBAA 5CP3H 2YAQA 3TIEA 1NLBH 3MCG1 3CG8A 4DOHB 5C86A 3M8OH 3ZHLA 2WXGA 2D7QA 1OM9A 3D87B 4IOIB 3WY1A 2BNQA 1QOKA 2VQTA 4MDJA 2H5UA 2VLKE 1ET8A 4RGNE 4RRPG 5E4AA 4MCZA 3MKKA 1BFTA 4H1LG 3G5YA 2C4FU 3ZSTA 4ZXBC 2FX8L 1QR1B 3EJYC 2FECL 1PG7L 4EN3C 4JM0A 1F45A 1DHKA 4EO5A 4YVNA 4K3EL 4FULA 3OMAB 2XV3A 3MACH 3QULA 4XO9A 1M6UA 4PGEA 4EXPX 1N19A 2ENQA 3OSKA 5C0IB 5IWLC 1SJMA 5C08A 3CH1A 4UCFA 5I1AB 2IPKB 2YD2A 1XO8A 3HNVH 3IRPX 1P0SE 3RVVD 4QYOA 4TVUA 1MVUA 3GD1C 1PAMA 4HUKB 1OE2A 4AQAB 4R5XA 1EAPA 4JGUA 4HC1A 5FCUH 1QSFD 3AS2A 3NSDA 4NJAL 3JTSB 1EXGA 4G8EA 3K1KC 2CO7B 2OYPA 1I1YB 3BXNA 5KS9E 5I8EB 3QUYD 1JWSA 1QVOA 4R3SA 4WJG3 3RB5A 3UMNA 3VDBA 1FL3A 1MCSA 2P4AB 4BJLA 2ADYA 1TLMA 3BUTA 3LV3B 1MHEA 3O45A 4NNYB 4AEHL 3H9ZA 1Z5LA 5AVXB 3SE9H 1D5BA 1N64H 4JG1H 3U7YL 1M9SA 4DKFL 5GS1A 4NRXB 5LGHH 3EFDL 4XP9H 3ZRCC 1VFUA 1OT1A 3QJFA 3T2LA 1CZ8H 1GSMA 2BM3A 3NRFA 4MWFB 5DO2C 5CZXC 2EDEA 1Y1UA 4P04A 1TZGL 3AWFA 2D3LA 4CNIA 4WFGE 1LO4L 1UOKA 4X6FA 3QRFM 4J3XA 4OGYH 3W81A 3RY6C 5SWZB 1U4FA 5DR5H 3T0EA 2Z7ZA 2LTQC 2RCSL 4BFRA 1UENA 1D6VL 4DP2X 3QO0A 4LXFA 1P4LB 3OKMB 4P2OC 1DQDL 4OD2B 5DD6A 3TYFB 3S8FB 3ARGC 5AZEH 4KUZL 5MEOB 2DMCA 4FMFA 1A9VA 5C0EA 3P4MB 4P3WA 1QFUH 4NO2A 3O4LD 1AFVH 1X7SA 3GBEA 1UA7A 4HQQH 1OGAE 4QKXB 3D8MA 4WWPA 5HYQB 1TQTA 4KKLC 3O9WC 1S7RB 4XNXL 4L3FA 2EIJB 4BXSV 4YSAA 3QIWC 3QWNA 2VDPH 3HZVA 3QK0A 5A6IA 1TZIB 1YNTB 4QHMA 1WCBB 5C0AB 4AEIL 4JFUA 5JUEL 2J6WA 2X5PA 4KK5C 1QZ1A 2EC9U 2W5PA 3NSXA 1N8OE 4LAJH 3V9EA 3WDIA 1WAAF 4G5ZH 1EJOH 3B2MA 1NFIA 1R5VA 1MCOL 3IXTB 1LEKB 1IUZA 4XNZC 5A2BA 1ZHBB 2VLJE 4ZX6A 2AQNA 3FHQA 1S7VA 5D8JL 4Z6AT 3JV0A 5FR3A 2FO4B 4L29B 2A9BA 1A21A 2Q8AH 3MLSH 4K8RD 1RIUL 1CF8H 4AVIA 1TCRA 2F6AA 4P23D 5CU5A 3IWVA 4NB7A 2AK4B 5DFAA 1XB6A 4XCFL 1BVKA 2ARJQ 4NXSA 5BS0D 1G7PA 3W2DH 1Y07A 5DRXA 4D3CH 1I85A 3K72B 5FYLH 2ZCLH 5IIEB 4I77L 4X6CA 4J2XA 5CF3A 1W0VB 2MNJB 1CCZA 1TQCC 2FLMA 1QX1A 3HG1A 3CC5B 2Z31B 4GLRI 4ZZFA 3U0WH 3REVB 4J8RA 5HHXL 5BXFB 4YHIA 1M7DB 1KCRH 3SE8H 2VLME 4ZPVA 1PZ5B 2XUWA 3BKML 1S9VB 4U05A 4IBLT 5CBAB 2WYZA 2DQHL 5EZJA 5DEZA 4XO8A 2PR4L 2HTKD 3IU3B 4X4YB 3QZWG 3LQAC 1WIOA 5E8PB 3L3OC 3S37H 1G7QA 1M7IA 5F0MB 1I8LC 5F6IB 5JOPE 3BISA 2HYMA 3GSVA 3PWLB 3OXRB 5C0GA 2DI8A 1RUQL 2HVBA 3TA3B 4JFFA 4MS6A 3N85H 1G0YR 1OD7A 5E2UL 4NZ8A 3ILQD 5IFJB 2OBGA 2K4WA 1V5JA 2H2SD 4IYKA 3WEXA 3DURA 1DBKL 1H5BC 5IEKB 4N2BA 4P2QD 2NX5B 3EH5B 3L6FA 2DEYX 2E56A 1S7XB 1J1XH 1B9KA 1PY4A 2F5AH 2VDMB 2V4LA 3VI3F 1HKLH 5FOBB 5KSVA 2XBTA 3GKWL 2XWXA 4RISL 5L7XL 2GI0A 2P5EB 4OQTA 4ZFFA 1F2QA 1DO6A 3GSXA 4FTVB 2H8PA 1BPLB 1BGXL 1K6QH 1DDTA 1P5UA 1ZV2A 2LLGA 1SDYA 1HEJC 1ZS8B 3BAWA 2XWBB 4K5LA 3BP7A 4W9IC 5CBEA 5AENA 5I1EL 4N3TA 5DJAB 4FLOA 2F8XC 4R84A 4GIPD 4Y7OC 1WD9A 2PCPA 5EF1A 3RTQA 3BPLB 3MV7A 4XPAH 2NUPB 3CIAA 4R8WL 2VR7A 1YYML 5GJTH 2GJZB 4YE4L 1MCLA 3HG4A 1XVSA 1P4BL 4QOKB 4UAOB 4QY8A 5AVVB 2QQKL 2WLHA 1P84K 3BYYA 1JNHB 4Q6IC 3WLBA 3EO1A 1UCBH 4Q9CA 2LFEA 4DUVA 4N90D 4ODTL 4PWJA 4IRSB 4QHNB 5EC1B 3NGBB 1LE5B 1PG7W 2NYYD 4TSBH 4ZFQA 1KXQE 2WUCH 2F0CA 1KJ3H 2VAAA 1CC3A 4P48A 1XCQB 3ILPB 3QQDA 3KLDA 3TJEL 1U42A 2VYRE 5AW8B 3EYFA 3DSFL 4L3EA 1FAKT 1A0QL 3DK0A 4U1SA 3TZVC 1D2OA 4ZI8A 3ZE0F 4ODWA 4XODA 3V0HA 1SQMA 2FEDD 2OMVB 4Z7VE 2XT1B 4YBQC 1IC5H 1T5KA 4O02H 5IHUH 4HJSA 1USQA 4PG2C 4OZIF 4O2EB 1RU9L 3JWOC 1NC2D 4KZ0A 3HG0A 3F7VA 4WGWB 3VFPB 4FI8A 4PJ9D 2Y07L 5ESVA 5F9OL 1DJYA 4HJUA 4M4RB 4J1UA 1I8MA 2XZZA 4W6XB 1SEQH 2Y9RT 1B6DA 1J8SA 3S96A 1HZHL 4OSUH 3L3DB 1B4TA 1NJ9B 3FOLA 4FI6A 1C12A 2JKNA 1T6BX 5L4MA 2Q87A 3GRWH 3UBXB 1IEBB 1MW0A 1GCFA 4HKXB 4IKKA 2X41A 3O0RH 5E9DE 4XHQA 4GO9A 5D55A 2Q1EA 1RZ7H 5D7LE 2Z0UA 2PW2A 2Y7MA 3GJFA 5T5NG 3MRPB 2YEQA 1PG7X 2QKIA 3MJ7A 4FLQA 4LARH 1NEUA 5JYLA 4H8HA 1S5HA 4M62H 1XZ0A 4MB3A 4KKZA 3CZLA 4HCRA 2QSTA 1OLLA 1CK0H 4FQ2H 3RJOA 4C56A 5KVMC 1IL1B 4LCUA 4P49A 3RTLA 1JGEA 3BMWA 1E3ZA 1LWRA 4KNSA 1HHIA 2C34A 4O9HH 5D7JD 2EIKB 2QVTA 2CLRB 1KIUA 4U6XA 2UZPA 4NPYB 3MQIA 3MRFB 3QJSB 2IPUG 3CZFB 3MPCA 3MROA 3FO9A 3IFOB 4PUBL 1NCNA 4HK3J 2ZQKA 4ABQA 2P28B 3BH4A 4M1GL 3QWOB 3C5ZC 2EDNA 1V3MA 1N70A 1JPTL 1R5WA 2VZ1A 3NJGA 1CT8B 4ZUVA 5C1MB 3KCPA 2QSVA 4IHOA 4J3WA 5IJCC 4CUCA 1MW2A 4N2DA 4PLJD 2A74A 4N5EC 3PU7A 3ORJA 4HK0B 4I5BB 2RACA 4HKBB 4F57L 2QHLA 2J8UE 4NUJB 3GMNA 1I7RA 2ENJA 3P4OB 4QXVA 1TKWA 3I9PA 1XF3A 4NNXB 4YSDA 5ID1B 1NCWH 1MFEL 3LIUA 5J1TC 1QFWI 5T3XL 4U6HB 4NUPA 1EGJL 1N6QH 4GXVL 5GSRB 3QFDB 3OD3A 4IIQA 2CO4A 1UM4H 1BMGA 4HJ0C 4HGWB 5DVOA 2CIIA 1EFQA 4NWTL 4A2MA 4BQ8A 3HG2A 3F65A 2EE0A 4J7RA 4KKQA 2VN7A 3SOTA 4YNYA 2C8NA 1R1CA 5DRNB 1QO3B 4BK5C 4LCWB 1QQDB 1SLXA 2WLLB 4X5RA 5DJ2A 2DYPA 1J12A 1EBPA 4IGBC 4IJ3C 3ZKMC 3ZU8A 3W39B 1UQSB 1QEXA 2XN2A 4MAYA 2VWEE 3DUSB 5E99L 1F4YL 1R5IB 4LMQE 3WSQL 5E9NA 3MUJA 1RZJH 2OSWA 4EUPG 5HYSB 4UIKL 2BP5M 2QVIA 3UZVB 4Q2ZB 1U30A 2W65A 2J20A 5KSAB 2NY4D 2EKSB 3DXAE 4U4IA 1KDIA 4GRMA 2PO6B 5DZJA 5D1ZB 4S1SH 5C08D 3P3RA 3KYNA 3QUZC 5KBDA 4DUXA 3X17A 1U9KA 4N28A 5D7EA 1A6VL 3STLA 4X5WB 4CU6A 1JDCA 1T3FB 5KYXB 2VC2B 4M1CC 3FS9A 2E9GA 4JRXE 4NQXB 3Q1SL 2EDQA 4BZ1A 1AGEA 3PHQA 4EQ2A 3T77B 1GYVA 1B2WH 3E3QC 4P3DA 4LIQL 3RFZC 4L9LA 1FFPA 3RIFK 4XMKL 1XR9B 2AVGA 2A6KA 2YPVH 3L1EA 4Z3GA 5BV7L 3OKEB 4KUCD 3KJ4B 1Q94A 1WBXA 3QHZL 5IVXB 1B0IA 5F89B 1JDDA 3A67L 3GM0A 1OW0A 4ZAKB 3MLYL 2DWDA 2B0SH 3H42L 5F7UA 4MMYB 4NHUB 2ZP8A 1E5BA 1F90H 4TS6A 4WNSA 1D5RA 3PNWB 9PCYA 3FUIA 3JZ7A 4M9OA 5DQJA 1T66C 1TR7A 5C3TA 4Z7QE 4BZYA 1LYQA 1X5JA 4NJ9L 1T0OA 3SJVD 3CLFL 1GGCL 1QBBA 4Q9QH 4NN7B 2VMDA 2WQ8A 3NIFB 5BQDA 1J8KA 3JXAA 4Y5VA 3RDTC 3BGFC 4JM2B 5DWPA 5EOCJ 3D3VA 4Z7WA 4ELDA 4N6QA 3ZO0A 4LSQH 1GW0A 5GS0L 4WI5A 4QRPA 4G7VH 4KFZC 3OHXB 4ZUWA 5E4EC 5DJXB 5JXAH 2EUZA 3QXAB 1L6ZA 3O4LE 4Z9KB 4AC4A 3OAUH 5CSGA 4ZUTB 3HRZA 1G9EA 3AAZB 4OCRH 1UWGL 4M7JL 5I5JA 3TS8A 1DSWA 2XBDA 5DC4B 4KJQD 3IDUA 3KPSE 3UTTA 3WIFB 3TBVB 1KBGL 2F15A 4ODHL 3ZMEA 4JO2L 1UCTA 2BVOA 3A0OA 3FFCD 5IVNA 4DZBA 2AANA 1HHKA 4PB9L 4BKLA 3IDIA 1AQDB 4LKXA 2G5BA 1DDHB 4N0FB 1TVHB 2AXGB 2LV4A 4H1LH 5F0JB 2WZPA 4DAGL 4F2FA 4G8FA 5IHZA 5JR1H 1OT4A 4RFNB 1J1OL 2Z8RA 2VMFA 3C6LC 5DMGC 2VXVH 4EDXB 4MLIA 2ATPA 4LQ1A 5C2UB 2WQWA 3F8UB 5AVTB 5SV3A 4JB9L 2WO4A 2XTJE 3FQXA 4XBEH 4CADA 1AANA 5AKSA 2C9SA 4MQ7B 4ENED 1A7BA 1G5GA 1L6XA 1UKSA 4QRRE 4XC1L 1N68A 3KVQA 1T1YB 3ZGHA 2XY1A 43CAA 2Z1KA 2GW5A 1NGWA 2CDGA 4O2CA 5L8KB 3EO0A 5ESAB 2X09A 4YIQA 4U1LB 1ZGLB 2IOMA 4N87A 3VSUA 1Q8MA 1PU0A 3WNJA 2J1KA 1DBJL 4HF5H 3HE6B 1R3KB 1ITCA 2BMKB 3MU3A 2Z35A 2V9TA 1H15A 3AABA 3JV4A 1UD3A 4L8CB 1FDLH 2JJTC 4GMSL 2GEQA 5C0DB 3ARDA 5D70L 1N59A 5AQ0A 4UV4L 5E1GA 5IW6A 4DGVH 1BYPA 1MFAL 3LRSA 4X9IA 5F1IB 5C97A 3HMWL 5HJ3B 4PGDA 3ASWA 3ULAB 3TF4A 4AC2A 3AXLA 4GQ9H 4NEHB 2JB6B 3HLAB 5CIPH 5F72S 4J27A 3C8KB 3P9WB 4KK6D 3K6SA 3IGAB 4Y5YA 1AS6A 1RHFA 4TQEH 3TBCA 4L3CB 3A5VA 4PJXF 4BZ2A 3RL1A 3ULUH 2UWEF 2AK1L 2DDQL 3OX8A 1IZJA 2HFEB 4K94C 4X6DE 1M6OA 4YHKL 2X4NA 4HA1A 2R0KH 3DTXB 1BFOB 2CJTA 4Y5XC 3NIGE 1D7FA 3QNXB 4P2QE 4XNQB 5B4MC 4CSPA 5D1QE 3GXNA 4B9YA 3P54A 5E2TH 4PMEA 4JFFD 1H0DB 1WH0A 1MQ8A 2NXYB 2PXYC 3BX7C 4YEFA 3T8MA 4N0UB 5GZOD 2ATKB 2BCKB 2E76C 5JZ7D 4YDNA 5B39B 5EEZA 3U4BL 3BAJA 2P8PA 3BKJH 3FONB 4MCYA 4M4PA 3MLZH 3F7LA 1Z66A 5FA3A 1TZAA 5MEPA 2OR8A 2I69A 4GKLA 3V6OE 3Q8EA 2VDML 3KWWB 3LKRA 1PFCA 5ETUA 2DMHA 2FLRT 1DR9A 4Y16B 3LZPA 1I1FA 1L5GA 5LBGA 5IM7A 1A66A 4JFHD 4IS6B 5L0QC 1SOKA 2HUHA 5ISZD 4F91B 2YFOA 3WFHB 3VYPA 3U7WH 1NMAL 1CI3M 4G1EB 3MRIB 5DEFA 4QHLB 4JRWA 1EVTC 1AZUA 1L9OA 1JWUA 4FFWC 4OIIL 5DLMH 5FPIA 3N1MC 4TSCH 3ARFA 3O6FD 5TF1H 4PJEA 5HHPA 1JTOA 2FTAA 4MJIA 5A6MA 1KCSH 1MIEH 4XMPH 2WV3A 4X7SH 3UIYA 1IGIL 1WJ3A 4MXWH 2ADIB 3SGEH 3O3EB 4ZSOA 3MREB 4OLVH 1FRGL 2ZWSA 3CXDL 5D4QA 5K9OB 1V10A 3NDZE 1OF0A 4D8PA 1KB5L 5HD8C 3K5SA 4FQ1H 1ZA6B 5L6YL 1H9VA 4LHQB 4JFXB 5LGJB 2JCCB 1U3HA 1T20A 4AVHA 3CN0A 1TYEB 1UEMA 2UXFA 3IJ8A 4MASA 1PTZA 2IANE 3D4CA 1CYXA 4LPWA 2QELA 5I75C 1MNUH 3AT9A 4D9LH 2FD6H 3T3MB 1BEXA 1ZCRA 2QZQA 1JZDC 2VB5A 2E7LA 2FIKA 2YZ8A 4K3HA 6PAZA 5G4MA 1YUKB 3JT0A 3LZQA 2F8OA 4JREB 3NSYA 4PRIA 3NZ8B 2DJUA 3EG9B 4Z7UE 3KXFA 4GSXA 4YHZL 4ANVA 2KZKA 5I1IH 1E6OH 2F53B 2R69H 1TNNA 3ZL4H 4DVBB 3V52H 1G9MC 1I82A 3LNEA 3ZE1F 1AD9A 5F7WC 2CIKA 4HJTA 3TC9A 3DPBB 3STZB 5D5ME 1AP2A 5HDLA 3N42B 1VB9A 1KJVB 1QRNB 2J2ZB 3U83A 3R1GH 4Y4FC 5L2KA 5TE7H 5ITFA 1J0ZA 3PL6B 2VISA 1OAUH 2EC9T 3K8LA 3KL0A 4ODUB 3RVWD 2DIAA 3MI6A 2N3JA 3HKZA 3GLAA 3QJOA 3BWAB 4DK3A 2XQYA 3FT2B 5E6IB 1JYNA 1U8LB 4XP5L 1E9PA 3SKOA 1NLDL 4FTDA 5HHVL 4LLDA 4ETQB 1DVUA 4YDIL 3SDDD 1F11A 2EYSB 4KI1A 1XTLA 3O3AB 3IDMB 1JVKA 1SY6H 2X42A 4W9FC 1FIGL 1KPRA 4H88L 2OJEA 4P9HC 3FOMA 4N2CA 2UYLA 3PJSB 5ID0A 2YMOA 5IEHA 3OAZH 1VA9A 2VQUA 3MGOB 1VFAB 3PUUA 4PBWD 2DM4A 2XVKA 4V33A 1Q9WB 3O41B 5TH2B 3C9NB 4Z8FH 1ZV5A 5IB4B 1SLUA 1BD2D 5EO0A 3ESVF 1XBRA 4R90H 3FZUD 1VSCA 2MHAA 3VXSD 4E42B 1ORSA 1XGTB 2K70A 3I02B 3MKGA 3NJNA 5I76B 2E27H 4ZS7H 5T1LD 1MFCH 5I6NA 3L3IA 3BAXA 3WN6A 1BVZA 2P45B 4G7YH 3HVNA 1SJHA 4PRHB 1D9KB 3EO9H 4GXUN 1QBAA 5DVPA 2ZCHH 4HXAL 4OZFA 3WIHH 3WUWA 3X12B 2ZAIA 4GRWF 3D2UB 3WE6B 3TFBA 3D18B 4TSAL 2EEFA 4HPHA 2H3XC 2K3TA 4M93C 4M7LT 2Y3AA 3G5WA 2VLKB 1RUML 2AEPL 4RGNB 4PRAA 5G4NA 5SWQB 3BP6A 2BNQE 1ORQB 2DMGA 4IOSA 2CR6A 1CG9B 1CDGA 1AR1C 2FEJA 2Q0ZX 4AGMA 4DK6A 5JTWA 5F88A 5ICZB 1JWMA 1L3NA 3W9EA 4DN4L 4WQOA 5IOPA 2WWMD 1VFBB 5CSZA 1YEGL 4C57C 3O4OC 3L95B 5E5LA 3H9HB 1NBZB 3ULUD 3JUZA 3WFBL 1U8KB 1VHPA 1NMCB 1QWNA 2D0GA 5BUPA 4TOYH 3SSGA 5HDQL 1JGVH 2C7UB 4DEPC 3FQWB 3QR2A 5C08E 1MUJB 5CLTA 3RL2A 1W2KT 1A4AA 3FB7B 2NNAA 1VACB 4Y2OA 2YAFA 4YO0B 1VEPA 4WUKH 1K5WA 3VD0A 3HZKA 3BVXA 3KW8A 1G7IB 3TBTA 3GQFA 5JIQA 5KS9B 3ARVA 4UQIM 1HIMH 5CZXD 5IMKA 1IAOB 3FTGB 5E5MA 2ODHA 2VZTA 3FCSA 5CBAA 4HIEB 4UOQA 3P77B 3VMPA 4PJBA 4JHAH 3C5SB 1A4JA 2W60A 3O6ML 2I32A 4OT1L 1PZDA 4GG6A 4B97A 1W0WA 1RP8A 2BWDA 2WLIB 4PWHA 4XR8C 4XZ4A 5IHLB 5E1AB 1T7ZA 3HC0A 4NN6C 2NQDA 3LB6C 2YGVA 1FL6A 1TG8A 1SM3H 3AGWA 5B8CA 1U2HA 1I1AB 2OMXA 3EOTL 3P4LA 4FNRA 4JFQA 3TBYA 1ED3B 4CGUB 2C3XA 4HEMA 3OKLB 3QAQA 3V4UH 4F7TB 4NUGH 1MCFA 1P84J 3TWYA 2KLTA 2LR4A 3QISA 4PV8A 3BZ4B 2WGXA 5ENWB 4MZIA 3RP1A 3T8XA 3K8MA 4PJ8B 2AQSA 4KKLD 2IAMA 5J1AA 1PFOA 2OULB 3L17A 5DK0A 4QHUB 2G3ZA 2P1YA 2DJMA 2GBTA 2V9RA 4JDTH 4ADGA 2WWKT 2FJGA 4K9EL 2QPSA 3T0EE 1A64A 2Y06L 4MB4A 4NAMA 1DBAH 4FNSA 3UTPD 4P5TC 3FK3A 3DJSA 3RX8A 3CE1A 4F33A 1BZOA 5L88L 3PGCA 4Q56A 1AGDB 1AQ8A 2F7PA 5HHNA 3GSRA 1OGAB 3OZ9H 1RFDL 4Y2DA 2BVUA 2WWNA 4A6YA 5KTEL 4BUGA 3RZCA 3RY4A 4GUQA 3AB0C 3VXRA 4UT9L 1QTSA 3TGXA 1P1ZA 2D03H 4NUQA 2X9WA 3FSZA 4GRLC 8CGTA 2ADFH 2VL4A 5J1SC 4DP8X 4X4KA 5LBSH 3UJIL 2V33A 3X1GA 4O58L 4EOWL 4UQ9A 3GLDA 4JJOA 3QEQA 2P80A 5F6HI 1G1YA 3SY6A 4DGWC 2VKXA 3LD8C 5F96H 1T22B 1JI1A 4BGDA 1HHJA 1N0LA 1F58H 2AQ2A 1YQ2A 3V6FB 2WVVB 2VLJB 5ADOL 3MR9B 3FB8B 4NP4H 1OM3L 4EUPH 3MV9D 2XVBA 2B5IB 3FQUB 1FGNH 3G04A 4OLUH 3DX7A 3GIZL 4HKZB 2AF2A 4AX3A 3KLLA 2CBQA 4IKJA 1MZZA 4POUB 5F9WB 1LP9A 1IM3D 2NNRA 1IC4L 2QV4A 1HJBC 5F6HJ 3MRBA 4N20A 1C5DB 1CS6A 2NSMA 3WHXB 3TN0A 1KYAA 3ARED 1KBPA 2FT8A 3DX9B 3E6FB 4W4OC 1TU2B 5E8EA 3VRLE 5A2IH 2Y6SD 2VN6A 5JHLH 4G82A 2CBMA 3HNTL 5HYEA 3MA7B 1R9FA 4WI2A 1OVZA 4FCHA 2ESVD 2J4WH 1HK6A 2WCSA 2OM5A 3S4SB 4X6CE 4HBQA 1XH2A 4XGZB 3HG1E 4JN1L 2WLYA 4JO4L 2VUYA 5TFSH 2FH6A 3QJZA 1JFHA 2P26A 4BCZA 1TQVA 4BQ6A 4PY7A 3MUZ1 4PGBB 2CDFA 1Q9OA 5C6PB 2X6VA 2Y1YA 1YMHB 1YYLL 3DX3A 2VE6B 3F6JA 1QLRA 1D3CA 4IBSA 3GM8A 5TTRA 1A6WH 3N1PC 1YY9C 4ECNA 4QRUB 3A47A 1K72A 3GIVA 3MJ6A 2FYYB 2MCMA 2OP4L 2BNRD 1MH5A 2N0MA 1AY1H 4NWUL 3EHBC 4JFFE 2NY3C 1JN6A 1ID5I 1GOFA 1JHKH 4N8VG 4XRCB 3T6VA 4J4PA 3BAEH 4MHHI 3EOBB 3OWEA 4UTAA 2DLTA 1HSAA 5K39A 4OM0L 5EU7E 2R1WB 3AWGA 3T4AA 3L13A 3HPLA 4UYPA 1OAYL 4P59H 1J86A 1JXKA 1KTJA 1ZPLA 3GK8L 4G1MA 2EDFA 2OSYA 1VGKA 4BDVA 4HKJA 4B6ZA 3BSZH 1A6TB 2G0LA 1XD1A 4XN1A 2HLAB 1BWMA 1F6AB 2MCPH 3PDGA 4WO4C 1IGTB 3HN3A 2VZVA 3TPUA 1D5IH 4WU7A 5SWSD 3MV8D 3VFNB 4MA8H 4LGSB 5CMAB 3RVUD 4DGIH 3IDXL 4KQ3H 3X3FL 4X7EC 4FLHA 4EIZC 2X53A 3MUGA 3MV7E 3UEQA 4NC1E 5EZLB 5KYUB 2NQCA 4FX5A 2V2XB 3SKJL 5I16B 4XOEA 5DHYB 4TUKH 4TNWF 4JFTA 5T3ZL 4Z7NF 4AK1A 3DC0A 2E86A 3ZN6A 4HPYL 5FECB 5CN2A 1YCSA 2DBLH 3MRNB 2NR6A 1D5XA 4G9DA 5KUMA 1SBSL 3IMRA 3VFUA 5DVKA 4I0PC 5F9AC 2CHDA 2FZ3B 2DIBA 4AQZA 2R0LH 3PGDA 1OAZL 5IVZA 4KROC 4TQ8A 1KELH 4IBUA 3II2A 2O93L 4LP5A 1Y6MR 1UJ3B 1CD1B 3FQRA 1PD6A 2WCPA 4HWEL 2B2XL 1INQB 5C71A 2OMYB 1GVIA 4L3EE 3OF6A 2HRPH 1UZGA 5E4OA 4PJ5A 2R8SH 4Z7VB 3V4PB 4KK9C 4Y9CA 3JTTB 3ZMNA 3MBEC 3HB3C 3TURA 1TJXA 4LU5H 2P3YA 4XOAA 4K5MA 4XVUD 3UROR 1MCDA 2QADC 3CUPA 4OF3A 1LDPH 1LMKA 1U8HA 4LCCB 2Z91B 5DS8B 5E2VL 2IH1B 2X89A 3FU6A 3J2PA 5EBLB 3UJTL 3ZXAC 4DJMA 2DWEB 2ICES 5IQ9A 3F2LA 3SQBA 1GGBH 5LAPA 2UY6A 3DX6A 3BGMB 3U46B 2JMRA 2OMWA 5JIHA 4F7KA 3QDMA 3QQ4A 4L4TA 4LSPL 3OWRA 4G2AA 4H4NA 2B14A 1NAKH 1QUNB 4DO4A 4TTDC 1EZLA 2JE8A 3P0VL 3CSBA 4G7QB 4UNTA 3RPIA 4X5PA 5K9JL 1NUFA 2J73A 3QIBA 4Z76A 1P6WA 1MIML 3IFNL 5E9DB 3VSQA 1GZPB 1E6JH 4QTIH 2NY1C 1MFBL 1L7TL 4K94H 5D7LB 1JXGA 2COQA 5DURD 8FABA 2Y25A 5KBMA 4FEMA 2W07B 5CJQH 3HI1A 3FYIB 1O5DT 4XXDB 3W37A 2YRBA 4DP1X 4JFOA 1OIOA 4PJCE 1W6LA 5T5FH 4AUUA 1J1PL 4E41A 3IT8D 4KVNH 1DVZA 1QSED 4UTBA 1IFGA 3AADB 2CO6A 4JZNA 4OCXL 1XGQB 4FQHA 4MXVE 3SYQA 4IK7A 1HAWA 1PAZA 4WWKA 4C56E 3LHPL 4IRJD 4PWFA 4DQOH 4EIUA 4K4KA 3LXCA 2A6JA 4JFWA 4LQFH 2WXLA 3TEWA 2GTQA 2MPAL 3BT2H 1YEEL 2OX5B 4P4KC 4BWUA 4JNXA 1X5YA 1I8KB 4R9HA 5E2WL 1HCZA 1OALA 3FTUA 3L9RA 4LLUB 3QJTB 4JG5A 2WKOA 3RNQA 5I6XC 4AXWA 1PX4A 5CKGA 4OIBA 4KXCA 4P99A 2Z4TA 4YDJA 1D6EB 2V8LA 2MJWA 2J44A 2VDQH 1F4WL 5EU3B 3VD2A 4K9JA 3RRQA 3RWFB 3KLQA 4P46A 4JY6B 1FG2A 1H3PH 2Q3ZA 5ALCL 2QFPA 4LK4A 2IJ0C 2B9AA 4MD0B 1KPUA 1X9UA 3SDCD 4AQEB 4JAMA 1W72A 2J8UB 3RGVA 3Q0HA 1BLNB 1ECYA 1EERB 3OKNA 4HEPA 5BPPA 2F58H 3G3LA 2IBBA 2P9RA 5E56A 4ZNEA 1K8IA 3COOA 3G5XB 1E4KC 2EVGA 1AHWB 4OV6F 4O2FA 4XI5C 4PR5B 3VX0A 3V5DA 3HZMA 4XCEA 4WK4B 1GPOH 4PSRA 4J2QA 3V10A 2FATL 1S7UA 4FADA 3OV6A 5A3ID 5TDOB 2ZKMX 2CMRL 2J88H 3JUYA 4OCWL 4G83A 1J05B 3INUH 3AROA 5I19L 2HH0L 4YQXH 4X0KA 2V2TA 1Y18B 5DWUL 2HLEB 4JE4B 2EECA 1NBVH 1XGUB 2OZ4L 3QXVA 5BV7C 4JM4H 2TSAA 5HVGB 4NCDA 4UIMB 2GFBB 1A6AB 1BQUA 4WW1B 4QLRA 2YD3A 5BMFH 2KBGA 4K23H 3T0BA 4IOSD 3BUQA 1JNLH 3LXAA 5H37G 3F85A 5CLWA 2WXFA 2HT3C 4MJ5A 5DZVA 3IJSB 4WKXA 3V0FA 2VXTL 1BV8A 1MDTA 2R39A 4Y4HD 3B9EA 3DXAB 4JRFA 4OKVB 4W9ZA 3ARRA 4A2LA 2AI0H 1QSFB 4XVJH 1LNUB 1QFPA 1ZA3B 4B41A 5F3BB 2PP7A 1ZT7A 3NCJL 4HBCL 3IDNB 4LLMB 3Q6FB 3DK2A 1HDMA 3JWNE 4WCYH 2GB2A 1IIKA 2K7QA 2V9UA 4JRXB 4A2GA 1ZOXA 1OOWA 5A2JH 1C8QA 5GS0C 4KXBA 2N1KA 4YDKL 5EO1B 1U58B 4NENB 2WVSA 2Q7NA 3US9A 4FI7A 4R26L 4YHML 1P7KA 1E50A 3EOYG 4IOFC 3IJ7A 1A4KA 4H8VA 4M5YH 4PJGE 4APQD 4Z7IA 2VLRA 4X7FC 4WUUA 4NFDA 3BWSA 3MLTA 1BZ8A 3PV6B 4KH9A 4M00A 4XP6L 1JDAA 4KO7A 4MSWA 1LEIA 3BJLA 4I18B 1E9QB 2RFXB 1PYWA 4UF7C 4U31A 3WL9B 4KHTL 4Y19A 4PP1D 3HPJA 2HVJA 4Z7QB 1CFTA 4YLQT 1JZ5A 1MF2H 2X7LA 3GI9L 3F12B 4AGQA 5DF0A 5AW6B 2FX9L 1OT2A 1QLFB 3D0LB 2CUAA 1PD1A 4JFZH 4WVRA 2FL5A 3SEPA 4P9HH 1YEDA 1A5FH 1I4FB 5CEZE 2VXQH 3NA9H 1DN0A 3AMKA 4UDTB 1C16A 2HJFA 5H2BA 3CSFA 5F3HB 3HZYA 3WNNA 4Z7WE 3ARXA 4UT7L 4FQXA 5FGCE 5CCKH 4QRPE 1WE5A 2NLJA 3O4LB 5KSBE 5F1NB 5DZNA 4I87A 4BV1A 2VDKH 3WXWL 2AJVH 2FX8H 3REWA 1VJSA 4KZDH 1UWXK 4G9FA 4YJZL 3QEGL 3MRDB 3LRLA 2Y24A 3ZDWA 2GHWB 4YZFE 4JRLA 1BVOA 3KPSB 1DBMH 5IBLD 1RIHL 2QZ5A 1XF2A 4EI5D 5JXED 4APXB 2E74C 2IQAB 3UTTE 4A7GA 4MAUH 3SDXA 1BQHB 4MKTA 4WENB 2EVHA 1NC4A 2F19H 4Q4EA 3AQZA 3SY0A 3QEHA 1HEZA 3P1VA 5TGBB 3FCUB 4L1DA 4PJIF 5F97E 4Q74A 2ZCKH 1H3XA 1IFRA 3V4VH 4AGPA 4M29A 2XLLA 2XTJB 1OLZA 3EFOB 1JD7A 2OCFD 3C2AH 5GZNA 1DLHA 4LAQH 5GRJH 2WZ5A 3CMOL 1DVTA 3K3QA 3GSOB 4P23B 1QKZH 2BVPB 4X9HA 4XHJD 5DEGB 4X80H 4R0LC 1JNNL 2F54A 4MDIA 2BOCB 2EUWA 4LVHB 2WLMA 3K6DA 1YNTF 1M56B 1SJVA 2JNZA 3VGHA 4B9CA 1LD9A 1OAQL 1E65A 2AV7A 4L8BB 2EO1A 4P2RA 1KXTB 2FNBA 2XJKA 4OLYL 3LIZL 4PVMA 3EFDH 4WHTB 5EU5B 5DYFA 3BKYH 3M45A 3LY6A 1INEH 2OAAA 1OARH 1CQYA 5CM1A 3DUUA 3BEWB 4GAGL 5BW7A 1DBBL 3AU0A 4F15B 1VGEL 3D85D 3HAEB 4OUUB 3D2TA 1EZSA 2ZUTA 5KVEH 4GS7B 4KRPB 3B2VH 3MJ9H 3QIUB 1DQDH 1SXZA 3IDJA 3X14A 4XN4A 2HG5B 4ICXA 3F58L 4CC4A 3X2QB 1KGWA 3WU1A 5AAMA 1ZJBA 3FB5B 2BSRA 1EK3A 4MJ4A 3A6CL 5DRZA 4ABWA 3NIGB 3PS6A 4QNPE 4LKCA 4P2QB 5M95B 1S9WB 3DMMC 5D1QB 1ZDSA 4A2FA 5LQBL 1XSOA 4EZKA 3P0YL 3BPLC 2Y36H 4X8JB 2BOLA 1T6WA 3GUTA 4GIAA 1NFAA 4D8OA 3BZFB 5CZVL 5DZAA 2EH8H 3E6HB 5FA4A 4WI0B 5A16A 4CDGC 1KFGA 1FNSL 1CFNA 1GXEA 3DV6B 2HVKB 4N5UA 1E9OB 3I6GA 3OSVA 4IU3B 2A4CA 5BVJB 1YEKH 3IMSA 3VD9A 2OMZB 4NX0A 2VM9A 3D0VB 1BXVA 4CVXB 3T65B 2CO2A 4H0LC 1TMQA 3NGBC 3L4XA 3SQOL 2NYZA 2Y2TA 1CDHA 5IY5B 1JP5A 2FQEA 2UY7A 5C92A 3DOSA 5IBTL 4LGPB 2XNAA 5HI4D 3MNZA 2N0KA 3BH8B 3FAWA 1IGYA 5CFHA 2DQIL 1U8OB 1RJYA 1PEWA 1EMTH 3QAZB 4JFPA 1SFHA 4HGMA 4NZRL 5DJ8B 2O61B 2X4PB 2GK0B 1DJXA 1I1CA 1UUSA 2IBGA 5MEQB 3V0EA 3MJGX 1O5PA 2VDLL 3LQMA 1NCHA 4YHPA 4PJEE 2Q6WB 3CCHA 5I1JL 1NEZB 1XCTB 3P3UA 2FVNA 4MJIE 4P5RA 4Y4KB 4OLWH 3EXJA 2YQBA 3QHFL 4DESA 3JYCA 1JOIA 3QO1B 1XQ4A 5LWYL 3IU4L 1NAMA 4OCYL 4ZSOE 3LMJL 4X98A 1LO0L 1OY3B 1UADC 1XMEB 2DKMA 2X3AA 5DFVD 2IALA 5IROD 1QEWB 4BUHA 3WDJA 4JPIB 5FGBA 1J11A 4L5FH 1WT5C 4LFHD 1N5YH 2PNDA 2IANB 1LQBC 4GH7B 3EUUA 3VWKD 1SEBA 1G1CA 1ROCA 4DP6X 2MH4A 1CXEA 3NPSB 4HS3A 4WTWA 3L7EA 4HWZB 1T1WB 4GMTL 4YBHA 3VA2C 2JIXA 1IBZA 1MHHA 3L4CA 3NJIA 4XBGB 3PE9A 3US0A 4Z7UB 2X4TA 2HN7B 2X4SA 3MVSA 4URTB 4PRIE 3N50A 5L4IA 1QW8A 1N3NB 2LE9A 2ZUXA 5DJYA 4AUYA 1FZKB 3KXFE 1HE7A 3ARWA 4OZ4B 2QQNL 5H35A 1OQXA 1PIGA 4P9ML 1JGLH 1KTDA 1S6NA 3B9KA 1THCA 3PABB 1PKQA 1NSNH 3T0XA 4LE8A 5JIKA 3UBXG 3CMGA 3IDYB 5I74B 4F58H 5C6TH 5IB1A 4CSSA 4OD1L 5F7DB 5FKAA 4HIIA 3VNZA 4FXKB 2XPGB 5D5MB 1TQBB 3K81A 1IM9A 1FNEB 3CQFA 1D7BA 3SD5A 2W95A 1A7RH 5EWIH 3SCMA 5L2KE 3QPXL 4B9FA 3UGEA 3VXPA 3L9YA 4QKTA 1ZVHA 1NOFA 2FJHA 4OZHF 4K0OA 3OKYA 1FO0H 2ARWA 3A4FA 2A5UA 2CQVA 3P9MB 4TNFA 3TO2A 1LK3H 4IBTA 3WUZA 1AGFA 1ZDQA 4YE4H 2DYSB 3K2UH 1P4BH 1QD0A 1WZ1L 1EEQA 3GHEL 4ZOCA 1QTYT 1QUPA 1CFVL 5JHDA 4V1DA 1GJWA 2NUTA 1FYTA 1U8PB 3KPMB 3PWNB 1ZLVK 1PZAA 4N9GB 3MNWB 1S5IH 2WINA 4BSWB 4U3XA 2IV9A 2E8ZA 4PRPA 1YEFL 2R4RL 3TJEH 1NCUA 3MRGA 4DKEH 5IQNA 2WBJC 2E5EA 2YMXL 5E00A 4ZX5A 1WYJA 4HAGA 5HHOD 1BSIA 3GYRA 5FAAA 1SXSA 1R3LB 1ECZA 1DQVA 2HA1A 4TUUA 2MCG1 5B38A 1JPFA 3SGJA 1OEZW 3NH7H 2ADGB 2I9LA 3L5IA 3HI5H 4HG4K 4JKLA 2H6PA 4MXQC 3HBZA 4H1LA 1SDDA 1JE6A 5CLXA 1ESOA 1OAKH 2CRZA 2WMPA 1IFHL 3U36B 4MDRA 4K7FA 4Q0XH 4LLWA 1TTFA 3WIIH 3BI9X 4K3JL 4GBXC 3MXWL 4XB8A 5HGAA 4ANWA 4L8SB 1E5UI 2C1OB 4XPGH 2YRPA 2LAAA 5KSAC 4NO3A 3W11C 5C9JA 3TIEB 4AMKL 3CDCA 4U1GB 5I5RA 4M48L 4HIXL 2NW3A 2WQAA 4TUJB 5D72H 4ZXBA 4ONFL 2CH8A 2BNQB 4MVBD 4MDJB 3WKYA 4FNLH 3VRIA 4MCZB 4GXUM 3WMPA 4EN3A 3LH2H 1KBWA 3G5YB 1Z9PA 1A4CA 1OWRM 2VDOH 1MCHA 5HYSG 2IEPA 1KGIA 1BG9A 4HHGA 3GJEB 5IWLA 1I9IH 3PAZA 5MENA 5KN5A 5IZ7A 2LGNA 2VERN 2NY4B 4PGEB 2VZOA 1KACB 2M1KA 4F2MA 3TVMC 3BIAX 5GSVB 4KI5D 3OB8A 1XB8A 3KJ4C 5C08B 1FN4A 4D0BA 3CH1B 1BYOA 4ZAKC 4NFCA 2XQBH 4AG4H 4AYMC 3QUML 5HHME 5CIPA 2YD7A 4QYOB 5LXGL 1MVUB 2Y7QA 5IMOA 5E6UB 2OL3H 1HH9A 1KJ2B 5I9QB 4DVRH 2UZYA 4KTEH 4PRNA 3MA9H 1EAPB 2Q8BH 3GBNH 3C87A 4XMWA 1OWWA 3AG1B 4TULL 4Z0BH 3BQVA 5GGRA 4DP5X 4KHXL 3T2NH 4G8EB 4K9EC 2FB4H 1OL0A 4UV7H 1R47A 3BT0A 2AEQH 2LT9A 1JWSB 1QVOB 4R3SB 4PW4A 4G8GA 3U0TB 1FL3B 1A7PL 2X3CA 2XWEA 4PJBE 4NKIH 1JPTH 1UM5L 5FC9A 1MHEB 1WAAA 3O45B 2PYFA 3PV7A 3OHXC 1Z5LB 3VRJB 5JPNA 1FZJB 2JV6A 1D5BB 2ZJSH 2OJ1A 4N85A 3F7RA 1CIUA 2G5UA 1KN2H 5KVDH 2BY1A 3NJFA 5DGQA 2FBOJ 1JF6A 4WUUD 4E9SA 4J5VA 3ZE2F 4TRPH 3DO4A 4YSPA 5ACLA 4OKDA 1JZ8A 1U8JA 3ZDXB 1QLEH 1NBYA 2CNYA 2GKIA 4HEME 1WUZA 1JK8B 3P30H 1U95A 4N8UA 3RY6A 2TSBA 3BO8A 4POYA 1SBBA 2AABL 5IK3A 2J43A 2VH5L 2F8IA 1TJMA 3NN8B 1EO8H 4P2OA 4MMZC 2CG9X 5GGVH 3SE6A 3AVEA 3T0EB 2XXMB 3ARGA 1I9JH 2DOCA 4RFNC 1E43A 3MRCB 3RJQB 5EBWA 3KWUA 2R0WH 3LSOA 5DD6B 1A65A 3HFFA 4S10A 2YEZA 2AEWA 5AOZA 3UAEA 4AE1A 5C0EB 3O9WA 2B1OA 3ML9A 5JDJA 4Z95L 4NO2B 3QIWA 1S9KC 3WSQH 5KJRH 1F4YH 4KTYA 3ZSSA 1EXHA 3SDAC 5FXCH 4HWUA 1Q90A 1XEUA 3CC1A 3LNHA 4AQ1B 5FUCE 4FCAA 3HZVB 3CPUA 3V7AE 1UFUA 4DETA 4Z0XA 4X0NA 1EUTA 2XZQL 4RDQF 3QEQE 3EDKA 1BIIA 3GS7A 4Z7OF 4ZG1A 3Q8CA 5IF0A 1NFIB 5H37H 4LLAA 2Z9TA 1R5VB 3CTTA 3P11L 2DQDH 2J6EH 2DTML 4WU5A 4ZW6A 4N4YB 3EXLA 3KBHE 5DD3H 4YXLL 5E8DH 2XWRA 1MWAA 4MA1B 3UP6A 4JFDD 3WD5L 1AO7A 4K8RL 4HWNA 4JO1H 1HSBA 1G7LA 3NCFB 1LP9E 3O0LA 3UTOA 3ZDZE 3B7UX 4JHVA 4UILL 3ZDYE 3QHZH 4AMWA 1BVKB 3A67H 5EORH 1RIVH 1G7PB 4DEUA 2H9GA 3KS0J 4CSTA 3C60D 2XV6B 5CJXC 1K2DA 3R18A 1M2VA 5TPWL 4X6CB 2D3JA 1OZTG 3HR5A 3HG1B 2MQCA 1NIEA 1YRKA 4J8RB 4PG9A 1MJ8L 1U93A 4I0KA 5AB0A 1PMYA 2NXYC 4GAAA 1XDTT 1D5ZA 4D94A 4XH2A 6PCYA 1IU1A 3F5WA 3RIAF 2R2EA 5B3JF 4K7PH 3WEOA 4F8TA 3NABH 1JZJA 3VFOA 3GRBA 3L3OA 4NQDD 4MS8D 5AZ2L 1I8LA 3ZW3A 3H55A 3CH8A 3VE0A 3M86A 4N24A 2NY7L 4L23A 1M7IB 1JPSH 2O6PA 1JHLH 2XX0A 5FO8A 5HDBE 3GSVB 4UDUA 5AB9A 4JFFB 5D2NE 3ZTEA 3TONA 4N0CC 3U2SA 5B39G 4QMEA 4GUOA 1H5BA 3DX8A 3X1NA 5J4MA 5KAQG 1UA6L 3V9CA 3HC3L 3SPJA 1COBA 1SY6A 3ZKND 3RG1C 1YJDL 2LVEA 3WEXB 2VDRB 3DURB 4FP8H 1BBDL 2VN3A 3QUGA 3NK4A 5KZCD 1CE6A 2R83A 3FSAA 5KSVB 1EHAA 3HLKA 2ZF8A 4NLHA 4UU9A 5E8NB 4FZEH 3K6NA 3L9BA 4ZFFB 3GSXB 4OZIA 2D7MA 4UBDC 3Q1EA 2H8PB 1P5UB 1S78D 4TNGA 5ECJE 4P5SA 2G4EA 1AE6H 1EUUA 5CBEB 2QR0B 3BP7B 1RK0A 5I2IA 5KVGL 5KW9L 2Z4QA 4TLSA 1ASOA 2AKRA 4OF5A 4GKSB 3J07A 4JMXA 2I07A 1NLBL 3W5NA 5KVFE 3P2TA 4YL4A 3M8OL 3RTQB 2QV2A 4FMKA 3MV7B 1HKFA 2XPYA 3O8XD 5AB2A 3NQIA 2Z3FA 5DMIH 4WK0B 1WTLA 2EEXA 3L81A 3LKQA 1DSFH 2D8KA 2EDJA 4Q6IA 4PHZA 5CO1A 3W0WA 2OLDA 4QY8B 1GGIH 4PU2A 2AJYH 4M7ZB 4NKOA 1MRFH 3WIHA 3WLBB 3EO1B 3IMWA 3LRMA 3N41F 3V6BR 4KC3B 3MACL 3FN0H 3NRPA 5GGQH 4JREC 3BYTA 2VRAA 5KYWB 5FLUA 3A6OA 1DE4B 3SPHA 3N1FC 2FJUB 2HKHH 4U6TA 2Z92A 3HNVL 3RURA 2VAAB 2X40A 3OLDA 3TZVA 3TO4D 3QQDB 2K6WA 5ELIA 5D7IF 1U3JA 3EYFB 1BJMA 4U0RB 3NIDE 4L3EB 2JJUA 4U1SB 4ODWB 2MEJB 5FCUL 1OCRB 4JDVA 1L0QA 1QBMH 4PG2A 2A7BA 4PJ5E 5F7EH 3QI9C 3N40P 3QPQC 35C8H 1MSPA 4E9VA 3Q2LA 1Z9NA 2VUOA 2ZYRA 4LSTH 3CNKA 5CGYD 2WYIA 2GTWA 2WN3A 3RJDA 4ZS6D 1OQOA 2FECI 3F7VB 1DANU 3OR7A 2AJZA 4KMTH 4IIZA 5E6IC 3RHWK 1QMUA 3SE9L 1N64L 4J1UB 4PGCA 4JG1L 5E0FA 1I8MB 1J5CA 3QPKA 3QDME 4L4TE 3UBGA 4HP5A 1TZ8A 4YPGB 5LGHL 3APDA 5CGMA 4PS3A 3GS0A 4Z5RB 2ZKXA 2VDMH 1XF1A 3FOLB 5BCAA 1C12B 3KGUA 3PG2A 1DVFA 4GT7A 3SGKC 2G2NA 3GXDA 4AJVA 2X4RB 5E6RB 4OGYL 1CN4A 2G9HA 3F01A 3UZQA 3V6ZA 1Z6JT 2UZIH 5DR5L 3I6LD 1YNLH 2E6QA 3VW3H 2K9FB 4WIQA 1NL0H 4EEEA 2PW2B 4XN9A 3GJFB 1WAEA 2NMSA 4J3OC 4KXZH 4XE0A 3T6ZA 3ZHDA 3ES6A 1NDMA 2FHCA 1GGTA 4PJCB 2QKIB 5AZEL 3ZPDA 4JL2A 3EJZC 3MRHB 1S5HB 1XZ0B 2ZUYA 4YDMA 1JYXA 4YGAB 2EIBA 1NCGA 5LKNA 1QFUL 3TT3H 3VWJA 1AFVL 4XPTH 4C56B 3QB7C 2NY5H 4HQQL 4LCUB 1JGEB 1AHMA 3VD4A 1HHIB 4JGJA 2R56H 2ZAHA 3RVXD 3MLXH 1KIUB 2O6CA 3CFBA 3WFDH 3EFFA 5ITBH 4OCLC 3KYKH 1CICD 2VDPL 3CX2A 2AMGA 4XAWH 3VFWB 3C5ZA 1OPOA 4FG6D 3MROB 4S1RH 3HKFA 3FO9B 5SV4A 2BXYA 3TBWA 1L0PA 2YBRA 4CU8A 2ZYIA 1E4XH 2WSKA 3KH3A 2COVD 1QI5A 1R5WB 4G5ZL 4ZUVB 1EJOL 1SHSA 3KCPB 5T1LB 5I66B 4RGNC 3WNMA 5JHBA 4IHOB 4JVUA 3LPWA 5D96B 3T0VA 3MRRA 1XGPA 5IUSA 2EDTA 1X5LA 5BRZA 3RE0A 4K55A 5INDB 2XYCA 5AYUH 4BXVA 3ZHKA 1B9ZA 4BFEA 2F7IA 2Q8AL 3V0AC 2GSIA 2P5PA 3EJPA 3MLSL 4BQBA 1I7RB 2YEVB 1EAJA 1TKWB 1XF3B 2A99A 4AZ8B 4EI0A 3GMRA 4FFZA 4JHWL 2ZX9A 4UI2A 4FHBD 1AZRA 1YEHH 2EQDA 1F86A 2FNWA 4YHNA 4QRQA 1ACCA 5FK9B 1NMCC 3UTSA 3W2DL 4PS4L 1TVBB 4J3OF 1SJEA 4D3CL 1E28A 4H0HB 4PREA 5FYLL 3L2NA 4W9EC 2ZCLL 4BQ9A 1CI5A 2CIIB 3GO1H 4E5XA 2YC1A 4FL4B 2ROXA 1ADWA 3BPOB 4BK5A 1WZMA 1ZGLM 3U0WL 4GXFA 1XH3A 4WNQA 4YNYB 4JJ5A 3POHA 1KCRL 2C3VA 3IWUA 1ZLEA 3SE8L 1BP3B 4QF1A 3KPLA 1E0OB 4R4ND 2G75A 5FYLE 3PAVA 4MAYB 3VVVA 5DHXB 1MZYA 5HI3D 5F7KC 4M5ZH 3EYUH 4NUMA 5I18H 4ZJ9A 1X9QA 5E1HB 3S37L 3TCLA 1PJWA 2Z8WC 3CVDA 3QUZA 4GRMB 1WDAA 4PW9A 1EEYA 3N85L 1J9SA 4V2BA 3Q01A 1DEEA 2BIOA 5TE4H 1JERA 2FCBA 3DJTA 1SQ2N 3X13A 4AOFA 3QSKB 4WEUD 1BLIA 1P6AB 3STLB 1U8IA 4DPAX 1Z0NA 2ZXBA 1OTSD 5H94A 3RFZA 4PJ8C 3TWCL 4L3AA 1J1XL 2F5AL 2W9DH 1AGEB 1HKLL 3P3TA 3WTVA 4P3DB 2EC8A 4PJGB 4L9LB 1FFPB 2YARA 1VEMA 5C8JA 1IQDA 1ZVSA 2B16A 1K6QL 1Q94B 1WBXB 3BP4A 2VLRE 4U1IA 4WUUE 1NGXB 1IARB 2C1PA 3MYJB 5IB3A 4Y0GA 4HIHB 2PUQT 4RH4A 2EICA 4MA7H 3NRQA 2YS4A 2WB7A 5AOKA 4FKEA 5DQJB 5EIIA 4Y19E 2V37A 4KQ4H 4F9PC 5AL0A 3RDTA 4LASH 5JA9A 1P5VA 2OTUA 3P4NA 4XB7A 3SE3C 3BSZA 5IG7B 1MAJA 1RJCA 2H6UA 1PKOA 5GJTL 4CBZA 1PLCA 1KCUH 3PJLA 3KM2A 3IDGB 4Y5VB 1FFOB 5AVUB 3UYPB 5MI0C 2I60H 3SKNA 3VTMA 5FGCB 4RQQA 1I3VA 1UCBL 3KPOA 4QRPB 4XX1E 5T1MB 1R6VA 1ZXQA 5KSBB 4ZUWB 1ZT4B 1THAA 4NAJA 4PJ6A 4UZGA 4PWGA 5MHSE 4UMSA 3PP3K 12E8H 1KBVA 1ZWIA 4QGYA 4TSBL 3KAAA 5FV1L 3QQXA 2Z31D 3HRZB 3R4RA 5DC2A 2WUCL 2V5TA 4DN4H 1FC2D 2NY0B 4G9FE 1KJ3L 1I7ZA 5C7ZA 5FHBH 2ICWI 4ZMPA 3UTTB 5G5DA 1NZRA 2MNWA 5SX5K 4ACTA 2BVOB 3OKDA 3CFNA 3SDXE 2GSMB 2UWEA 4WHYG 1HHKB 3C6LA 4BKLB 4QYAA 5E1IA 3HUJF 3QUHA 4LKXB 2WXQA 5F7YC 4OFDA 5FO7A 4G8FB 5IHZB 2VXSH 1IC5L 3WHE1 4O02L 5IHUL 1MCWW 2VR6A 1X5IA 3ULVE 5T1KA 2V7NA 2ATPB 2ICWJ 3TA3D 3FQXB 4CADB 5ESQA 1A6ZB 1IM3B 1MFDH 2ENSA 1X3DA 2VOTA 4N86A 1SEQL 4O2CB 43CAB 3CIQA 3AREB 1IAMA 2VMJA 3EO0B 1J9QA 2F08A 2NX5D 2VC2H 4YIQB 5E6YA 3V5HA 2F54E 2LW3A 5DK3A 3UBHA 3S4SG 1RXLA 4DP9X 3FW6A 2JJTA 3PWJA 1WBYA 1HNYA 4ZFOB 1RJZA 1KY6A 3GRWL 4FABH 1NGYA 3F7QA 1NM9A 2X4OA 2Z35B 5JW4N 1H15B 3JV4B 4P2RE 3O0RL 4MD4A 4KJWD 4D9RE 3PDOA 1HC1A 3MTXA 3ARDB 4W70A 3D69A 1ZE3H 4AI7A 3B34A 5GGTH 1N59B 2CKBB 4AM0Q 5T1JA 1EHXA 3HR6A 3DETD 4LEXH 5HGHB 4PV1C 1XZWA 3VI4F 1FPTH 2GVYA 3QNZA 4HIJA 4ZZKA 3AXLB 2AMUA 4LARL 1ZVYA 2R9HD 2E4FA 4HFWA 4M62L 4WDIB 1BIHA 2IF7A 1OGTB 4YSRA 3H53A 3TTYA 3K6SB 4Y5YB 4HZ1A 3VXOA 1CK0L 4FQ2L 2CO1A 2NXZB 3L1FA 4LSRL 4QOKD 1UUNA 4KV5F 5E2JA 3RL1B 3VFVB 4DP7X 4WF7A 3GZQA 4O9HL 3LDBB 1YEIH 2YK1H 4WKZA 2CLVA 1M6OB 3LPFA 3G5VB 2X4NB 2KUTA 4AL8H 1QBLH 2V6HA 1VADA 5E1QA 3MODL 4IRSD 3QFJA 4DH2A 1U41A 2Z34A 1LXMA 1RZIA 2PXYA 5F3FA 4DERA 2YPLA 4UT9H 4HG4J 4HS6B 4AW7A 2VSDA 4YHOH 3B56A 4EMZA 3EH3B 1ZK9A 2RH0A 1LQSR 5AKTA 3U1PA 3KBPA 3IS0X 4LHUA 1JZIA 3I50H 3L5JA 3S3PA 2P8PB 3Q9PA 2CRYA 1AD0A 4MCYB 5DT1H 1WP6A 5MEPB 5FYJH 4B96A 5G2NA 1MJ7L 5HHQA 3QORC 4HWBH 2L7EA 4LPUA 4MMXC 1VAHA 5ADOH 3LKRB 1OSZA 2K7PA 3HBQA 5ETUB 1O7DE 4YH6A 1N6QL 4TYUA 5GIRB 1IE4A 3L4VA 1UM4L 2ENYA 3CDYA 2GAZA 1EXUA 3LH9A 4NBYB 3EH4B 3HS8A 4J6RH 4HMEA 4OUOA 5DEFB 2WTPA 4OGAC 4Y1AA 4EDWH 4YAQA 1CLCA 1JWUB 1PCSA 4L8DA 5GGSA 3CHSA 3ARFB 3KYAA 3IGFA 4PJEB 5HHPB 4HUXA 5JMOC 4GG8A 4MJIB 3G9VA 3DX2A 4Z77B 4NQEA 1CR9H 2PETA 1UB6A 4O5LH 4ZSOB 1FH5H 3D33A 2L7QA 4W9GC 1O6TA 5FYKH 4D8PB 4OLZH 4LPTA 3A22A 4XBPA 1AIFB 1P9MC 5GRUH 4PCSA 1KPVA 2JKIS 4PIRF 3Q7JA 1MW3A 3CFQA 3D1MC 5I0WA 1SYSA 3BPNB 1G6RB 4WRLA 4HV8A 4FXGB 2HMID 4QXGH 2HRLA 1XEDA 3BHBA 2BNUA 2FIKB 4AT6B 3MGAA 3CSYB 2OYKA 4PRIB 3RWJA 5BO0D 4G71B 3B7RL 2YPVL 4LCIH 3AM8C 3KXFB 5EF2A 2YXFA 3FSVA 2GUYA 1G7MA 5IFHH 1KTKE 2XPZA 1GC1C 2Z8SA 4KDTC 4EVNB 3N06B 2B0SL 2K3HA 3LN4A 3E2HB 5C0NC 3VVWA 1PKQE 1QYGH 4FA6A 4WHDA 5LCVA 5ICYA 1F3DH 3QH3A 1F90L 3CFKA 4CJ0A 4OTXH 2CIKB 1G43A 1BXXA 4Y4FA 4G80A 5I8OL 1AP2B 1BZQK 1RJLA 2A0LC 3WO4B 3WJMA 1WS8A 5DURB 4IBVA 4HCIA 2YLKA 3I6LE 4WI6A 5L2KB 1JS4A 1U33A 2WO3B 3APMA 3NJLA 5ITFB 2H3KA 5CU9A 1F3JA 2VISB 3DHMA 1DVFD 1R33A 1HHHA 2LU5A 3DRQA 4XVOA 1F4HA 1KUMA 4LSQL 3CJJA 3QQNA 2UZXA 4X8XA 4G7VL 1CLZL 3WNLA 3QCVH 2VRKA 2UUDK 2EJ1A 2EUVA 1EHNA 5JXAL 1OD9A 1RMFL 3R19A 4WK2B 1E9PB 3SKOB 3OAUL 1HAUA 4R2GB 3K4DA 4LLDB 4J12A 3GFUA 4OCRL 1CDBA 4KK8D 1ETA1 3GXTA 4JY5H 4LCWD 4TQHA 4V1DE 1LO2H 2GI7A 1WS7A 3ROLA 1KPRB 3UZEC 1AVAA 3CDFA 3FTWA 2OJEB 3BQUD 5DD5H 3PWPA 3VWJD 5IEHB 4RA0C 1AHWC 2MWCA 2BSBA 3NJMA 4AIOA 4TQPA 5DFWH 3BN9D 2BRRH 2XZCH 1ZSDB 4PRPE 2AJ3A 4WSKA 1WEJH 3E0GA 1I9RH 1CDYA 2VXVL 3SDCB 1W16A 5EO0B 2PO6D 2MHAB 4XBEL 2OXGA 5D1ZD 5AKRA 4PJ7F 4YSEA 4TVPE 1E42A 2WVTA 3GNMH 1F1AA 4MJJA 4Q6KA 3TM6A 1JXFA 4CN6A 4JLRA 1K3IA 2R2HB 4JKPH 1BVNT 3VFSB 1R3JA 4GJTB 1WC7A 1SYVA 2OMTA 1IBHA 2AXHA 3GT6A 3WN5C 2VWEC 3FCTA 3L3IB 4LVNB 4R7XA 3MV11 1SJHB 4W9DC 1SXBA 5K69A 2JJVA 5I8KL 3RVVC 3GJFK 4HF5L 4PLKD 3U25A 2P8LB 1ZLWH 1RAMA 3WMQA 3ZYZA 2JQZA 3E9TA 4YSUA 4OZFB 4KMLB 1FDLL 3TNMA 3LKPB 3DGCR 4LPVA 4W1TA 2HJLA 3RKDD 3QUXD 1R3HA 2FO1A 2YZ1A 4DGVL 2QMJA 3QUYC 4JCLA 3NCXA 1MIMH 1CQKA 3NCCB 1HHGB 1HU8A 1O7VA 1L7TH 1LO3H 1FZOA 4PWKA 1EFXA 4JUTA 5E8OB 4XN8A 5CSZB 1YSOA 4Y4HB 2F7RA 4TQEL 1M3IA 5I0YA 5IMMA 5MENE 3ULUL 4JM2D 1JRHH 3GMLA 1ES0B 4GW1A 3MXVH 3Q13A 3O2WH 3RAJH 3WLWD 3RL2B 4XXWC 5E6SB 1NFDB 2R0KL 3ESNA 2BSEA 4HMDA 2NNAB 2J1YA 2ERJB 4Y2OB 5TQ0H 3WNPA 4JDZA 3WENA 3IGLA 5IR1B 3HZKB 1KJMA 3II1A 3KJ6H 4JX0A 2ED9A 5E2TL 3TBTB 1KSRA 2CRIA 3Q9QA 3MRMA 3V8CA 5IMKB 5EIQA 1BM3H 1SMDA 4YFLF 1SLVA 3ML8A 2PPAA 2NNCA 2ITFA 2WQXA 3MLZL 3QRLA 4CMMA 2CUMA 3DNKA 4PJBB 2JKWA 5FYJD 4GG6F 1SUHA 2DB8A 2DD8H 4G8GE 2D2CC 2W60B 3H8NA 4G6MH 4J8QA 3RIKA 3SBPA 4AEEA 1W0WB 3EDJA 3WFEH 1RK1A 2F68X 1WAAE 4FG2A 5ALCH 3HC0B 1UHVA 3FB6A 3DIFA 2V5YA 2X6AA 3FUHA 2O6EA 3FPYA 3N0PB 4FFVD 3NFSH 3DTUB 3WHE0 5B8CB 3TBYB 2OMXB 5BRPA 4KKCD 2XN9A 4X6EA 4NQSB 1CMOA 5FUOH 3DOHA 1H6FA 4MB1A 3U7WL 5LNGA 4PV8B 1BMZA 1GS6X 4LEOA 4CMHB 3T8XB 5EF3A 2IAMB 4JY4A 5J1AB 5DLML 2FJSA 2FR4A 4M3JA 5DK0B 4TSCL 5AD0B 2CJ3A 3UABA 2Y22A 3NZHH 2O5YH 3HE6D 2FJGB 1KCSL 1MDAA 5A2AA 1MJUH 4P5TA 4XMPL 2FBJH 4X7SL 1HOCB 2JI1A 2WZ6A 4I1NB 4MXWL 1B4RA 1SN5A 2PCFB 3IGUA 1MRCH 5FYKD 3QCUH 4K8RC 1HXYA 1RUKL 3KPPA 4EI5B 5I8CB 2YGOA 3IKKA 3MGTA 1BQHG 1KTLB 4P23C 4FQ1L 4LNVA 1DUYB 3PGCB 1SVCP 2ORBH 4NT6A 2Z6FA 3GSRB 4GRLA 4Y2DB 1CLOH 3T6WA 2Q5BA 1AC6A 3WTYA 1NCOA 2VQ1A 1P1ZB 1MCKA 3VXUA 3RVTD 3IM1A 4AMXA 3OGCA 1MNUL 1Z9SA 3F3HA 4D9LL 2FD6L 4KXZI 3H7LA 3VH8A 1FHGA 3NACH 1JZEA 3QEQB 2XIIA 4QWWD 4B9PA 1UT9A 2R29H 4OJEH 4ZPTB 1XBDA 4KX8A 4CN1A 1HHJB 4PRDA 4RX4D 1LILA 3ZR6A 1MVFA 3F6IA 5I1IL 2EEAA 1E6OL 1LJMA 3S36X 2R69L 2AV1B 4J6IA 1GS7A 3ZL4L 4B60A 1RCYA 2B8OT 2NXYD 3UTZA 4R26H 2HTKC 3BZEA 3V52L 1UZ8A 5FUZH 1RPKA 1UWXH 2DRUA 2YR3A 1LP9B 1DQML 1WIPA 3DIVA 3N1QC 4GS7C 4W4OA 3VI3E 1BQ5A 3ZDZB 3U6RB 3B7TA 3MRBB 3MAWA 3TN0B 4ZTOH 4U3SB 4AQOA 5E8EB 3ILQC 3AXHA 5I30H 1ACYH 3R1GL 4XCYB 3ECQA 5TE7L 5DS2A 2H2SC 4UT6H 4HHWA 3ABLB 1OAUL 2NNFA 4UOW1 5I5MA 2J3SA 1HS6A 3BOVA 4Y16D 4NDMA 2YAEA 3HAEG 3U9UA 1M9WA 1TSHA 3D85B 1CGUA 4HZAA 2WLKA 4LF3A 4ZBJA 3BEVB 2ICWA 4PB0H 2HTLD 4N8VA 4XO3A 2CDFB 1U6AH 2KYIA 4L4VA 5EBMA 4AIZA 4DP0X 1QLRB 2WJ7A 3CSPA 4UT7H 5F1KC 5SX4H 1LK2B 4HW6A 1DQIA 2HG0A 3I6KA 3WXWH 2XXCB 4UQBA 5HDBB 5IESL 4CVWA 1JV2A 3QEGH 1TEGA 1MH5B 2IGLA 5D2NB 1RZPA 2L4OA 4B95C 3CHPA 2DIEA 2E0PA 3GMPA 3B7SA 4Z8FL 1M7UA 3KNBA 5F21B 5AW2B 1JN6B 3CV5A 3WAJA 2DL9A 2EIZA 1KGCD 3WFZA 1ZT1A 1WK0A 4R90L 3AS1A 2CHZA 3ZZLA 4FQIH 1HSAB 4MNHA 5K39B 3ZE0E 1IC0A 4RCAA 2E27L 2C3HA 4ZS7L 3HPLB 1MFCL 5HVHB 1S7QA 2NYYC 4G1MB 4Y4KC 2A83A 1JHTA 2VO8A 3BVUA 2WAQA 4G7YL 2D4FA 4HKJB 4OZIE 1V3JA 4M3KB