1ZK5A

Escherichia coli f17fg lectin domain complex with n-acetylglucosamine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
175
structure length
172
Chain Sequence
AVSFIGSTENDVGPSQGSYSSTHNLPFVYNTGHNIGYQNANVWRISGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWCVGNYVSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F17G adhesin subunit
publication title Impact of natural variation in bacterial F17G adhesins on crystallization behaviour.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 41
structure length 172
sequence length 175
ec nomenclature
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1zk5A00
4K0OA 1O9VA 1ZPLA 3F64A 3FFOA 2BS71 2BSBA 2BS8A 2BSCA 1ZK5A 3F6JA 1OIOA 1O9ZA 1O9WA
chains in the Genus database with same CATH superfamily
2HXAA 1NZRA 3KPQA 5EBWA 3O6LH 3PHAA 1HZHH 1KG0B 3HZ3A 4QI3A 3QHZL 2Q8BH 4XB8A 3ECWA 5HDBB 1CFBA 2H1XA 1AG0A 5JHBA 2HN7A 1FFRA 3CFUA 3AABA 1U2HA 4PHXA 2LW3A 3MGAA 1KV3A 2EYSA 3LIZA 4DZ8A 2XG5B 2Y7LA 3MNDA 1MI5B 3CLFL 5EZPA 1IKNC 2PO6D 3TBCA 2RB8A 2I32A 1UWEH 5K9KB 1BFVH 3FK3A 2VDOH 2ZXWB 1RZPA 3CFJB 3FSWA 1BOGB 2C34A 1P6FA 3DSFH 4BEIA 4D0CB 1MNUH 3CN3A 3MOBH 1EHXA 1N10A 2IAMB 4JDTL 3B43A 3X1FA 5L88L 1P6AB 3AM8C 1G7LB 1U8IB 3QAZB 4U0QB 3QI9C 3D48R 2VO8A 3VFTA 3GMLA 4R7NA 1RU9L 2EIMB 4MLIA 2RQ8A 5F6HI 5T5FA 4O51A 5K9JH 4ZMWA 3U46B 4NZUH 5IW3A 2BY2A 1RZKC 2JMRA 1I3UA 2D31B 2NSQA 3CLWA 4ALAL 3KYMA 4E5XB 2X05A 2PNDA 3RWJA 5HVFB 4FG2A 1XB8A 1MI5D 5BRQA 4CUCA 2OMVB 1I7RA 4MJ4A 3PG2A 4AMKH 3PWUA 2PP9A 4BFNA 5CUSL 3I6KA 4F2MB 5KVFE 4EI5C 4P23B 1C12B 2X89D 5CINL 5D2LF 2COQA 1WBYA 3HZMA 3S6CA 1EJ8A 1F6FB 3VX1A 3WCYA 1BJ8A 2IAMD 3S5LG 2CM6A 4P5MA 3RVWC 3U82B 1TETL 2B39A 3N40P 1N5YL 1KMGA 1XGTA 3QI9A 3II3A 3P02A 3QJFA 3OZLA 2A77H 2QQKH 4NLAA 2AK4A 4B0MM 5LUMA 3EDFA 5J56B 2QADC 1BZEA 1FC2D 1A64A 3C5SB 2XI9A 4Q4IA 5IMKA 3VJ6B 4NWTL 4GW4B 1I3RB 4X99B 2E9WA 4GS7B 3UX9B 2OMUA 4LLYB 3NCEB 4YE4H 5FOJA 1XL6A 4MGXA 4KH9A 4P23D 4EI5A 2B3IA 3T71A 2CU9A 1TQCB 4IOFD 1UXSB 5JZ7C 3VG0L 5E2WH 3CFDB 1IU1A 5F89B 2NZ1A 4QJ3B 3MRQB 4HZLA 5AVUB 5SX4H 5L2KB 2GABA 3D3VA 4NM4L 4QRSA 2CKNA 1DJHA 5J3HD 3KLSA 1TVHA 3G08A 4N20A 3HS0B 4WSGA 3D39B 1CT8B 2F7RA 5D93B 4C56E 5I0WA 2JIXD 3BEWA 3FCSB 4GG8A 4NCC2 2YK1L 2BOBA 3IF1A 4Y4FC 2WLJA 3GHEL 2VDPL 3NSCA 3AY2A 2XV3A 2OK0L 3NDYE 3W9EB 1QSZA 1YEGL 2V9UA 3K6OA 1R3IL 3L7FB 1U8MA 4GSDL 1DCEA 4Y4HB 4NKDB 3TM6A 1G5AA 1NAKL 2KPWA 3KGUA 1VESA 3LIZH 4MAUH 2FJHB 1LDPL 5INCA 3CE1A 5HDOA 1YEEL 2NUTB 5E9AA 5AAWC 5F9OH 1IGMH 2J20A 4NZRH 5L2KD 1YPZB 4DSYA 4Q97A 5GQBA 4X5QA 4ESKA 1ZXQA 3RDTD 3VQMA 2O5XL 3GTVA 5DDHB 5B3JE 1IBGL 3SE8L 4GOSA 5DK0A 4WWNA 4LSVL 4GUPA 1ZANH 3QE5A 1WJ3A 4JJ5A 5EEWA 3MRGB 3WTXA 4Y4FA 5GSVA 1GJIA 2YXFA 2JSFA 2A74B 3IFLH 1DDHB 1THAA 2UWEE 1OPOA 2EDTA 4HFUH 3U30C 3WFEH 3OMAB 1EHAA 2EIJB 5KVMC 2QKIA 3CC1A 5T5FH 3VYOA 3INUL 1CC3A 1G7MB 4BZYA 2A38A 4XBGB 5TF1H 4JFDA 4Y4HD 4QJ4B 2ZOKB 5MENB 5C9JB 2FWLB 3L4YA 3RU8L 2B59B 2BCMA 4JB9H 2ZNXA 4TVPE 3KJ4C 2QPUA 1V55B 5A16B 4WY7H 5SV4A 2K3TA 3CVBA 4MA1C 3WUWG 3BSZL 2Z7WA 2OMXB 5JXEC 4JG1L 3ZQ9A 4LFHD 3QEGL 1RZFH 3I3BA 2H41A 5AVVB 4JGMA 5AVWB 2DQMA 4OKDA 1MIEH 4I0PC 4CC1A 3VFNB 3QJSB 1MW2A 4YSUA 1DQML 4PRPA 2A1WH 4RISL 1DE4B 3G6AA 4HWBA 1T5WB 2BIHA 4OVVA 1NCCH 1BQSA 1PYWB 5T3XD 4UQBA 3ZLQC 2L7QA 2RIKA 1XZ0B 3ZHFA 4LU5H 5KSAA 1H3PH 1P4LB 3A6BH 3AXLB 3QS2A 2O61B 1RZKH 3WIIL 4CSPA 1GCYA 3IEAA 4ZS7H 2OQJB 1KC5L 1T7YA 1ZD6A 2HPOA 3CDFA 2BCKA 3FDWA 1CFTB 3QO1A 1D5XA 3RKDD 1OTSC 2XN1A 1ERNA 3Q8EA 1JZ5A 5BXFB 3AREA 1A0QH 4FNPA 5DYFA 5JXEA 1S9WA 3LQAH 2WCGA 3KJ6H 4AXWA 3MYJB 1A6PA 3FCTA 3QUKA 5EORL 3RTQB 4MCNA 1JTPA 3PHSA 4I0PA 5D5MB 3QIBD 2J8UA 4FTVB 5DK2B 3ZDXB 2GJ6D 4K3DL 3KXFA 2B9AA 3CDCA 2WWMD 1NGYA 4NC1C 2P5EA 1LEGA 5LBVA 4XZUA 5DVOA 3UADA 4RWYL 3GQFA 1SMDA 5I1JL 2OTWA 4LLWA 4QRPE 4ZD3H 2P1YA 2OW6A 4QWWC 1MHEA 5MP6L 5JHDB 3MLWL 2X10A 1A6VH 4LCYB 1V27A 2X70A 2D0GA 3P40A 1OXYA 2IADB 1CE6A 1K3IA 1RJYA 2X5PA 3FF8A 3GIVA 3WHXB 1YUHB 2X6UA 1XBRA 5DHVB 1FL6B 1MDTA 3UTSE 1TVDA 2DLGA 3NCCB 4Z76A 1V10A 3VE0B 1GH7A 4OUUA 3RTQD 2Y3NA 5HHQB 4ONFH 1JK8B 3TVMC 2PWHA 4FTVD 4L4TE 3SN6N 5DYOA 5CMAA 3KZ8A 3BPLB 5F71A 4BXVA 2V3FA 4JFZH 1C8QA 2IXQA 1GIGL 4N2BA 1TQSA 3UTQA 3L3JA 4XHJC 4WK0B 1GGBL 5HHPB 4NCC1 3UMTA 4KK6D 1NUNB 4FJYA 3QGVA 5JHDD 1M1XB 4PMFA 3TBSA 4AQ8C 3QXDB 3RTLA 4JFEE 4WTWA 3U4BH 5FWQA 3OKDA 4YDKH 2Z7UA 3IN2A 4YFDB 4P2QB 2F8IA 5ICYA 1FG2B 4WV1C 4J3OF 3MV8A 5FB8A 3VMNA 4WI5A 1BVZA 3S35L 1EZUA 4PVLA 3HZYA 5IB2A 3LEVH 3JWOL 1HS6A 1QKZH 4HPOL 3TVMA 2HP4A 3ROOA 2H9GB 3HI1B 4NNYA 4AOFA 4YNYA 1VADB 3U79A 1ACYL 4MD4A 3ZT5A 4YBQC 3OG6B 1OOAA 1A4KB 3IS1X 4HS8H 4PJCE 4UM8B 4BFIB 2TRYA 3MRPA 2OLDA 2IH9A 2J2ZA 2LE9A 3WIHA 3GTTA 3Q5TA 4OB5H 5CBEB 3CZFA 2HUHA 4H0GA 4Q2ZA 3U9UA 2WC7A 2NY0B 2Z0BA 4AQ8A 2NNAA 1UD4A 4RMWA 2WY3B 1NJ9A 5E8DH 3OAWA 3VH8G 1U36A 3JSSA 1INEH 3OKEB 4ZAKD 3UTTB 2VUOA 1IILE 2X28A 1O7SA 1B2WH 1BLNA 4PJBE 1ETA1 4OF6A 4WV1A 4ACPA 3Q2NA 4OJFL 1R3KB 4M7ZC 3L3KB 1BF8A 3EZ8A 2IOMA 4XN5A 1VFOA 1A7NH 1WD8A 3KPQB 4EN3C 5EBWB 3U7YL 1FYHB 1C1EH 1FWXA 3HNVL 3VI3E 3BDYH 2ZXBA 2F61A 3UAAA 1JHLL 1OP3H 3FHQA 3LIUA 3NRQA 2JKXA 3T1WA 1OF2A 3RRQA 3O2VH 2HN7B 2PETA 4FKKA 3VFOA 1OY3B 3SE4C 5GGUA 1SLVA 3GLAA 4O9HH 2EYSB 4IKIA 3IKCA 2X4PA 4TQEL 4DZ8B 3SPHA 3T0AA 3EF7A 2Q1EA 3US9A 2V9TA 3FB5B 3UTTD 3AT0A 5E8EA 2VXUH 3V0FA 3NGBC 2JFCA 4GW1A 1T1ZA 5C0CE 4MRCA 4CJ1A 4MWFA 3NIGF 1LO4L 3Q48A 4ETYA 1WGVA 3WLWD 1T7VA 1VACA 1RZQA 4TUKH 1X5XA 1J1OH 4Y7OC 2YEZA 2R23A 2OMBA 5DMGC 2NDGA 2BVPA 5LBSL 1RMFL 3BVUA 2NY4B 5DA0B 3VXPA 4EN3A 2WHVA 4TUUA 1PJ9A 1FAIH 4NQQA 3L9RA 1ZS2A 5AZ2H 2VQ1A 1RJLA 5F9DC 1RIVH 4HK3J 1CXEA 1G87A 4LP8A 3A6OA 3BVTA 3VFTB 1NDGB 3GMLB 1L0YA 3UZQA 4W93A 2F7QA 4R7NB 1I53A 4O51B 4OFYA 2ZP8A 3SE4A 3VB8A 4JZOA 4FQCH 1P9MC 3KYMB 4NP9A 5TDPA 3V4UL 4B9KC 3RWJB 4TTDC 4WI4A 3HG1D 2ZUQC 4G5AA 2DMGA 1I7RB 4OCWL 4CAGA 4TLSA 4YDLC 2R9HC 1L9OA 2Z93A 3MNMA 3I6KB 3UCRA 3NIDB 4AYEC 1WBYB 1B3IA 2HWZH 1BMWA 2OSWA 1ADQH 2XWZA 1XH0A 4NT6A 4P5MB 2QPEB 2JKWA 3FFDB 1XGYL 1KYUA 1XGTB 5MERB 3QI9B 1AQDB 3ZYOA 3QJFB 4LSDA 2N1TE 2AK4B 4RFOL 4BELD 2Y1AA 5CILH 3RURA 1BBDH 4G42A 3EG9A 5GHWH 1II4E 3F7QA 3L08A 5CP7A 5IMKB 1P9MA 4BV1A 2QELA 3MUZ1 4TVSa 5FGBC 2XA3A 1J11A 2W92A 2YGVA 3GMPA 4KK9D 4PWHA 4YWGH 4Y1AA 4XB3A 3WIFA 2DEYX 4J1UA 2MCMA 2J5LC 1X6LA 3IFOA 4P99A 3FN9A 3MLPA 1DBJL 5EUOA 1ECZA 1WFIA 4EI5B 3DETC 4GIAA 2ZYHA 1RSFA 1BQUA 4HETA 5D4IA 1SOSA 4JO4H 4KQ0A 4HZLB 2X0UA 3ES6A 4G7YH 1UUSA 3D3VB 4FI6A 5J13C 1RKRA 3QI9D 2JJSC 4BZ2L 3G08B 1KT2A 2AK4D 1I9EA 1E3FA 3BEWB 4LRNL 4X9GA 5KWYC 2QADB 2BOBB 3IF1B 3NZUA 4TNWF 3TBWB 5IWLA 2WBJC 3KLHC 3GB7A 2ROXA 2VQUA 5HHXL 4H44C 5FGBA 4HSCX 4HA1A 1CXHA 3Q6GL 1MCLA 2W60A 2B2XH 4N68A 2WXHA 2EE6A 1MCCA 3P3TA 5GZOC 5HYQA 1JPTL 4HIPA 3VD1A 2QDWA 4B0MB 5JHLA 2R2BA 4JANA 1S7UA 4LRIC 3UBHA 3HHSA 5INCB 2ZJSL 1BF2A 3OAZK 3SYPA 3IRZA 5C8JA 2IEPA 3FRPA 5IQNA 3TASA 3RVWD 2VKXA 2VLRE 4YLCA 2JJTC 5E4OA 3LVTA 5KW9L 1VSCA 3DYOA 4QDGA 2JJSA 3TFKC 2Z6FA 4UM9A 1U58A 3QDJD 1WUNT 5DK0B 3T0EC 4C58B 1EGJH 2VT0A 4GUPB 4S2SA 1NGQH 4AUYA 5A7EA 4JJ5B 2QADD 2YA2A 3T4YA 3K5SA 3VXSA 2D03H 4Y4FB 1SM3H 5GSVB 4HBQA 4WCYL 3WFDL 1QI3A 1YNTF 2WBJA 3BFQG 3OKMA 2PABA 4RDBA 1D7FA 1NDTA 5AYUL 3MC0A 4H40A 2QKIB 4XP6L 3S35X 5LNGA 1OPGH 4EIZC 5J4MA 1KYOK 3EHBC 5GZOA 2OYMA 3HPJB 4JFDB 4UQDA 2MNJB 2AQ1A 4JUSA 4GEJA 2APSA 4P9ML 1ZLVK 3SJVA 3ZTDC 4BE5A 1TNMA 4ZSOE 3BVNB 4TL4A 2JJTA 3PDDA 1OD7A 2TSBA 4Q89A 1JNJA 3QHZH 3N85L 5HJDA 1QASA 1BZQK 3T0EA 4A2EA 4R5TA 1FFPA 4PJGA 5DQDL 2JWYA 2NQCA 4PRPB 1T4KA 4Y4FD 2CH8A 4QLWA 4IMLA 3TYFB 3U30B 4HUUA 4IKNA 3V0WL 3CLFH 4JY4A 2ZX5A 2BSSA 3VGHA 4Y2DA 4JFDD 2YD3A 1R3HA 2IPKA 3T3MF 4PB0L 4AGOA 3BUYB 2BCKB 4NO2A 4DGWC 3BKCL 1OHQA 4ABUA 4W9KC 3QO1B 4JDTH 4N1CA 3K81A 5L88H 4MA1B 3ZL4L 3D4ZA 4GRWE 1SLWA 1S9WB 1U8HA 4AXWB 3FCTB 2AJUL 1QR1A 5B1JA 4XO8A 1BFOA 3QUKB 4Z3IA 2X6CA 1U3NA 5DHMC 2VXVL 4I0PB 1RU9H 2DW5A 2J8UB 1WAPA 5F7YC 3US0A 4E9RA 3KXFB 2LQRA 2P5EB 2YJQA 2ZSVA 4ALAH 4XZUB 4X4ZA 1G4RA 3C8HA 1S2EA 4LLWB 1S7QA 3IGLA 4S1RL 3HBGA 5FW6A 5HI3D 1MHEB 3BSZA 5HYJB 5CUSH 5LGJA 5T5NG 2BWDA 1D5MA 2YPVL 3ZMEA 3BP6A 5CINH 4GG6F 3LPOA 3KLKA 2X70B 1J8KA 3VXRA 2GBAA 5I1IL 1CE6B 3GIVB 1RJYB 5FV2A 3CHRA 3TBYA 1LEIA 1TETH 2FYVA 4WTXA 1MNNA 5JXED 1N5YH 4M6AA 3HMXA 1MZYA 1SNRA 3UACA 4Z76B 3AC0A 3OKYA 3P4NA 4OUUB 1QWNA 4PJHF 5ERWA 4AKPA 4BK8A 2P26A 4I0PD 5FYKE 3SKOA 5DYOB 5CMAB 4JNXA 3KXFD 4QKTA 5EOCL 5DHYA 3UROR 5C0FA 3GMQA 2Z92A 1EBAA 3JTSA 1Z9PA 2IXQB 3PPEA 2VMEA 5B3SB 4NWTH 2ZCZA 3UTQB 3BYYA 3L3JB 2VLLA 2LR4A 4S1QL 5HYJD 2YJLA 4GSQA 3TBSB 1WFOA 5EF2A 3IJEA 1OSYA 3IMBA 3M17A 4UIMA 5E24E 2YSTA 3OKDB 3VG0H 2FX7H 1OTSD 2HT3C 5LAPA 4LIQL 2DWXA 2GBVA 3U2JA 5EWIL 4OF5A 5I5MA 5FB8B 4NM4H 3OC8A 1LEKA 2DDQL 3HZYB 5IB2B 3HE6C 1FE8L 2NXYD 4ELDA 3C6SA 3TVMB 3ROOB 4NNYB 5ESAA 1MJ7L 2YK1H 4FFZL 4YNYB 3DJSA 4PJFA 4MD4B 4JFXA 5HVWA 1HSBA 3GHEH 2VDPH 2OK0H 2HX7A 3MRPB 3FO1A 1E9PA 1N6VA 2J2ZB 5TDNA 1SBSL 1YEGH 4GQQA 1TZHA 4QWWD 2XSKA 1R3IH 2NQDA 1MCBA 3B5HA 4Q2ZB 4GSDH 2NNAB 4BK4A 2D4DA 1NJ9B 1NAKH 2YMOA 1YUKB 1LDPH 1JI1A 3JWOC 4QTFA 4NZFA 5CLWA 3WUZA 3QK0A 4HZ1A 1YEEH 4EMZA 2WXRA 1I4FA 1BLNB 1RCYA 4WV1B 2HFEA 3L3DA 4HPYL 3VDAA 2NLJA 2OCFD 3CIQA 2O5XH 3QWNA 3HE6A 4YHIA 4LHUG 1IBGH 3OXRB 4JDZA 3G5ZA 3SE8H 3MUUA 2Q7NA 2YD9A 1H8LA 4E9QA 4E9SA 2G60L 3RGVC 4FA7B 3VD9A 2WYIA 2YUZA 1OF2B 2ZCHL 4XHJD 2NTFA 3SDDC 4A6YA 5IHZA 2Z7ZA 3VFOB 4YHPB 4Z95L 1L9MA 3INUH 3FYEB 5FLVA 5GGUB 2BJML 2ZKYA 4NUJA 3IKCB 2X4PB 4TSCL 3RU8H 4OFPA 2BHZA 2F1EA 4GXUN 4LQFL 3OAUL 5E8EB 4ODTL 5KVGE 2P52A 4GW1B 1T1ZB 2RBLA 4K7PL 3Q06A 2BP5M 2AXHA 2QLYA 1GS8A 3BSZH 4MWFB 2AV1A 2CZNA 1VACB 2XWBA 4JG1H 3AG2B 3JTTA 4M7ZB 3W9DA 2R23B 4JRYD 3QEGH 3QJVB 5HDBE 2BVPB 5DT1L 2YRZA 3TJPA 3VXPB 4EN3B 5DEJA 3L9RB 4CSZA 1DQMH 2VQ1B 1KBBA 3VTAA 4RISH 1RJLB 1DVTA 2C9QA 1KTCA 3STLA 1FVDA 2WNKA 1FGVL 1TVBA 5TK2A 1BVKA 3SDDA 1MI5E 1TZ8A 1X5HA 4BFRA 3DVFA 4N1EA 2MRYA 1SEQL 4KFMA 3TJHD 2UUDK 3BSGA 4JZOB 1V3JA 1E42A 3BSHA 5TDPB 3WIIH 3NEXA 4U4BA 3T9WA 3KPNA 4QYAA 1KC5H 1UM5L 1S9KC 2EACA 5TQ0L 3E3QE 4P07A 2AVGA 3HI5L 2DM4A 3NGBB 3DTXB 4XMZA 1O0VA 2Z93B 4PJ5B 3FT2A 5FM5M 1L3NA 5T3ZE 1GKOA 4CGUB 5I73C 2FWUA 5B3NA 3QR2A 4DK3A 2N7AA 3BVDB 4GRMA 4GAGL 5EORH 4WI6A 4EN3D 2B16A 2R2EA 2LFGA 4K3DH 4OQ1A 2PWEA 1NFDF 4OF3A 3ECQA 4JO3L 4RWYH 1YEKL 2KZ1B 4X5RA 4HOWA 5I1JH 4UMSA 4FI7A 2AQ2A 4G42B 4OFYD 3EG9B 5KUKA 4K23L 5GRXG 4FL4C 5MP6H 1Q8MA 5DZAA 1NL0L 5LNEA 1CICC 2I9LA 3MLWH 3S5YA 2C4FU 4PJIF 5F1NA 2BHUA 2VDNL 1IARB 2ZUQB 3GMPB 3KHOA 5LBSA 4Y1AB 1GW6A 4Z7VA 7FABL 1F5WA 4N2DA 4YDLB 5F1IA 4J1UB 3ULUE 4PJ5D 4KZEL 1MHCA 4NBYB 3RWFA 3IFOB 2WSPA 2WLHA 5EUOB 1F6LL 2PXYC 2ZIDA 5DMGD 3KYNA 5IJDC 5LHDA 1EAPA 3ES6B 2IF7A 1A3LL 1UWYA 1R17A 2DWYA 1KT2B 1GIGH 2XWRA 3GJFA 2D7OA 4PJ7F 4B50A 2WO2B 3KNBA 3I85A 3QCVL 2W0KA 3VW3L 1OAJA 1GGBH 1W2KT 3O4LD 3A67L 1AFVL 3SZKC 2ODIA 2DICA 3GB7B 4HEPG 4LHJB 1CICA 4MD5A 1J05B 4TTDD 5DD3L 3U7WL 3D8MA 4IKLA 1J48A 4CSTA 2W60B 4DK6A 2R9HD 1VJSA 4DZBA 4JY5L 3KBHE 1EHNA 2J5LB 5HYQB 1BJ1J 3QZLA 4HHAB 5L2KE 3KL5A 1SYSA 2PXYA 1T83C 4WHYG 2M26A 3S35H 1S7UB 1JWUA 1K4CA 4GQRA 3HHSB 1JK9A 5GISL 2NSMA 3FO0L 1SVZA 3NFSL 1JYWA 3D39E 3WNOA 5C8JB 3FRPB 4HPOH 4MAYD 2G5UA 3B3IA 4RFEB 3VD3A 4KJQC 1QYGL 5J13B 5F7FA 1ACYH 3HC2A 3MCKA 4JZNA 4GKNA 4UM9B 1U58B 3RB5A 4PRNA 3W0WA 1B0GA 3S37L 4LSSL 1PMYA 2CO7A 2NRDA 4QPEA 3T4YB 2ADGA 2FBOJ 2G75B 3VXSB 4L4VA 2EDLA 2WBJB 2QFRA 5EU7E 3OKMB 5C92A 3FNKA 1HZLA 3VDCA 1F97A 4PB9L 3P4LA 2IV9A 1ROWA 4OJFH 5KJ7E 3DETD 3PP3K 2C9PA 4KDTC 4L8DA 1UACL 3BUIA 3JYBA 3U7YH 5D1XA 4AJ0A 3HNVH 2BZCA 3RVXC 4W68A 4FCHA 1JHLH 1JGIA 3JWDL 2VDPB 4FN0A 4KTGA 3T0EB 1PEZA 4AIEA 5TK4A 2P28B 3CK0L 2CRYA 3BWUF 5T3XE 4PJGB 1IQWL 1PBYA 4N26A 4OCSH 5J0BA 2VXQA 1MFBL 1T4KB 3PV6A 1F3DH 5HI5C 5MHSD 1EH9A 2WBJD 3KLHD 1Z2KA 3KLQA 4IMLB 3DMMC 2EE3A 3T0DA 3BIAX 2H3KA 2W8CA 3FBQA 1EZLA 4TQEH 3LKRA 4FQHA 4HUUB 1WG3A 4JY4B 3WEXA 3RUGA 1CDIA 5MEOB 3S96A 5GZOD 1M2OA 3GKWL 1G43A 3EHBB 2IWKA 1LO4H 4YAQA 4FKEA 5ABDE 4AEHL 2IPKB 5LCVA 3SPJA 1A1OA 1P53A 3BEVB 4KDTA 4NO2B 1QWHA 5LBSH 1RMFH 3BGAA 3VB9A 1OLLA 3TWYA 3N50A 4ELMA 5IBTL 1KYDA 1Q0EA 5CHNA 1U8HB 1E4HA 2GJ6E 3ULAB 1QR1B 3B56A 1JGDA 3T0ED 1UOVA 2YGOA 1E4WH 3MLRL 4Q0XL 3VGDA 4MYWB 3WTUA 1QEXA 1P84K 2XV6B 5BVJA 4UMGA 3OKNB 2DQCL 3RG1C 4HC1L 3TCLA 3ZQXA 1EBPA 3DMMA 4X6FB 3V4UH 2DB8A 2X3CA 1PDKA 1YY8A 3GJFH 4OCWH 4UQAA 4RIRA 1HFUA 1S7QB 1LO2L 3PWPA 4NRXA 1ZVSB 4KXBA 3FH7A 4UAOC 5D7HA 4UOW1 1D5MB 3X1NA 2I9TA 3WDHA 3BP6B 2WXLA 4FAAB 1BLIA 3VXRB 1GGUA 3ZYZA 2HFGL 3JWNH 4CU8A 5D5ME 3CDGA 3TBYB 3IPEA 4FTVE 3ZDXE 1XGYH 4JG5A 3W11C 1J9RA 5TH2A 4WFFD 4YSSA 1MG3C 2Y36L 4Y5XC 5ERWB 4RFOH 3FPXA 4YVNA 3NDZE 2PP8A 3CHOA 3VO0A 3SKOB 4FHBD 1JYXA 5C0FB 5DHYB 3GMQB 4H8WH 2Z92B 5JHDE 5BZDA 3BJ91 3FH5A 3MXVH 4GKZA 2W9EL 1CF1A 2VLLB 4Q6KA 4XO3A 1XIWA 1QBBA 4G11A 3SYCA 4GFXA 2O6DA 4HAFA 3ZVVA 4BQ6A 1WT5C 1XF4A 1DBJH 3KS0H 2MSPA 4BCZA 3IJEB 2VLKA 3M17B 3WMSA 2QHLA 1QSFA 4BWUA 5DJYA 2QPFA 4RA0C 1PKQA 4M56A 4Z7QE 1AMXA 3X14A 2GEQA 4EZKA 4BZ2H 4P5TC 5GSRA 2QVTA 2H0JA 2X12A 4Y5XA 2XIBA 1JGUL 3OL2A 4LRNH 1HN1A 4ZW5A 1F02I 1JZGA 4PJFB 4JFXB 2YPVA 1HSBB 4IIZA 2WTPA 1FIEA 5HHXH 4DVBA 1NCDL 3HC3L 3FO1B 4KMTL 1E9PB 4IIQC 3Q6GH 4X6CA 5TDNB 2Q3AA 1QOKA 1TZHB 4P2QE 5H2BA 1JPTH 3O2DA 1EFXA 1LQBC 3N1QC 3I9PA 3OB8A 3NSFA 5D7IF 3KBFA 1J0IA 2ZJSH 4MZRA 2WNGA 1RZ8A 2P8MA 1I4FB 3P77B 3S2AA 5I23A 3ECUA 1EEYA 2HFEB 3L3DB 1EQWA 1GA2A 1TSHA 2NLJB 4QGYA 5KW9H 1ZHBA 5C0RH 1B88A 1QFHA 3LN4A 4YHIB 3HE6B 1MVFA 4HK3N 4P5TA 4I2XA 3KLAA 4JDZB 3G5ZB 5BUGA 1H6EA 1RJCA 2LU3A 2R83A 5F96L 3T3PB 2IALA 3PHQA 2GVYA 1KV7A 2JTYA 4QXGL 3MRJA 1F8TL 4WCYH 3WFDH 4PWIA 3GD1C 4UILL 3KHQA 1ZLUH 3TESA 4IHBA 4XXWC 4FXGA 2Z4TA 4XPFL 5AYUH 2NTFB 2VN6A 2XBDA 4IIQA 5IHZB 4XP6H 3CN1A 4LLAA 3UTTE 1CL7L 2PWGA 2E47A 2PTTA 4WK2B 2PLTA 3T1FA 3UH8A 1BD2A 1YO4A 4P9MH 4UTAL 3OXSB 4ODWA 2Q2EB 4R5XA 2HT3D 5KEZA 4FFZA 3S37X 2AV1B 3BPNC 2XWBB 1OTTC 5IW1B 35C8L 4X7SL 5C0GA 1WC7A 1NANI 4KI5F 5FO7A 3HE6D 2FNBA 3I2CL 3L95A 3W9DB 3N85H 1NKOA 4GT7A 3ABZA 1NUFA 3NESA 4M1CC 4PY7A 4Y89A 3FHAA 5GRZA 4OM0L 2KT6A 2OI9C 3QHFL 3QCTL 2AZAA 2Y2YA 3EF4A 3BRFA 5DQDH 3MJWA 5IQ7L 3UC2A 3RGVB 3STLB 1FVDB 5J1TC 5AW3B 5KSVB 1LYQA 4XXWA 1TVBB 5E4EC 2Q8AL 1Q0XL 2CALA 2FEDC 1BVKB 2J6WA 3GPSA 3HG1E 3P2TA 3SDDB 3V0WH 5DUJA 5DUPL 2RR3A 3LKNA 4N0YL 1AZCA 5IV2B 1CD8A 3FO9A 3KBPA 1Y0LA 2BIIA 2BY1A 4PB0H 2DYPA 2ZWLT 2P43B 3BKCH 3ZKMC 4JRWA 3N41B 1CG9A 4P2YA 4LEXL 3ZL4H 2WWNA 5GGTL 1A7OL 4ZT1A 4B6ZA 4GRMB 3B1UA 2AJUH 1I9RL 1NEPA 3NCYS 2DQTL 1WLHA 3VAEA 4JKKA 2VXVH 3QR0A 3P73A 1BA9A 4BHUI 1L9QA 4G80A 5AVSB 3QZPA 3UPAA 2R2EB 1N9PA 4X83A 5GRWA 3RGVD 3SDXA 3UTZA 4Q9CA 4B9IA 3CTTA 2CGYA 3SDDD 3NIFF 4NUPA 2K6ZA 5FDWA 3NJMA 4S1RH 1XDTT 1YMHA 5D6DA 1IJ9A 1KJ2A 3GS4A 5GPRA 2YPVH 2AEPL 2I9LB 4X9YA 3NIDE 1RI8A 5F1NB 1UWXK 4MDJA 5F0JB 5L4IA 3HRZC 4C4BA 2L04A 4Z7VB 1TMCB 5I1IH 1S9YB 1GGIL 5F1IB 5F7BA 1MHCB 3RWFB 2WLKA 4G9DA 1XT5A 1FYTA 5D4QA 5I73B 3WMPA 3WV0A 1CIUA 1IC7L 2XXFA 3GLEA 5IB5A 3EOBA 3KYNB 5DLLA 2AK4E 4YVUA 5A2LH 3S88L 1CFNA 3PP3H 4N25A 1CL7I 5KBDA 3NQIA 4C47A 4L2LA 5EOCH 1GTNA 4AYFA 1YY9C 3E1F1 4HS3A 2XLLA 4JZJC 4JO2L 3GJFB 2DY2A 1W15A 3ILQC 4E9WA 3KNBB 2CBTA 4S1QH 2KERA 2GIXA 5JNYA 2O5ZL 4JO1L 5DUML 3MV7D 2YOCA 4N5UA 5F93C 4IQHA 2BOLA 4N3TA 1CICB 4MD5B 2YD8A 4JN2A 1NEUA 5DS8A 4FADA 1M3IA 3HRZA 3MV11 4R7LA 4NUGL 4LIQH 5EWIH 1IJNA 5TJWK 4RRPM 3D3VE 4KO7A 1SYSB 2DDQH 2PXYB 1JNNL 1JWUB 3SE6A 1JK9B 1FE8H 4QCIA 4AMXA 1HSAA 4X7FC 3B3IB 4ODSL 2EXWC 1MJ7H 4FFZH 2ZZUT 2ZICA 3MCKB 4I48B 2XCMC 4LL9A 4PRNB 3W0WB 1B0GB 5DC9B 3U0WL 4Q4EA 2VR6A 2YZ8A 4OFIA 1ET8A 2CO7B 5D7SL 1SBSH 3ILDA 2ADGB 3C75A 1AQKL 4L4VB 4B96A 4N2AA 3LH2L 1CICD 3RPKA 1MCKA 1T89C 4QRTA 1SJVA 3X3GL 3IRCA 2O72A 3HA0A 1YEFL 1OGTA 5AVQB 1FL3A 3KLDA 4YGAB 4HPYH 2W07B 2PXYD 4IRZL 4PJ8A 3PNWA 1RH8A 3EBGA 3R4RA 4L8DB 3UOAB 3B2XA 2MH4A 3CXDL 2LTQC 3OJVC 4MKMA 5C0RL 7PCYA 1FH5L 3V0IA 3GK8L 1OKEA 2GT9A 4LQ1A 2G60H 4NKQB 3DARA 4KFZC 3VWKC 4LBEA 2ZWZA 1JYVA 4KKBC 2JKIS 4ANXA 3ISRA 4ADIA 3BVWA 4U6TA 4WW2A 2ZCHH 5DJ2B 4PBDA 3OJ2C 4RRPA 3QQ9C 4Z95H 3PV6B 4L4VD 2BJMH 4JFDE 4HIIA 3MRCA 3OWRA 4TSCH 4KKAD 3LKRB 4FQHB 5EZIL 1T89A 3WEXB 4LQFH 2QQLL 3RUGB 2DQJL 2EINB 4ODTH 3ZGIA 4K7PH 1TR7A 3IPFA 4PVBA 1CFVL 5LGKA 4YAQB 3PFQA 3JWDC 1A1OB 5EEVA 5J12C 5DT1H 3IFPA 3RL2A 3GZKA 3KWVA 4ELMB 4YHNA 2HJKA 1EVTC 3T0VA 4KJQD 1CWVA 3VWKA 5CHNB 3K6NA 4PRPE 2ZXEB 4JFOA 1DVSA 1JGDB 1FGVH 3L3OC 5CO1A 3HFFA 4AX3A 5I66A 4HUXB 1I7UA 3GWJA 5BVJB 1SEQH 3MR9A 3HS9A 3TCLB 1D6VL 4KKNA 3CX5J 5CGYC 4CVWA 2XQYA 1NICA 3DMMB 4YZWA 4D0DA 4A7UA 1YY8B 2NX5A 1SUJA 1JHKL 2ZUVA 1UM5H 2D3VA 4LSTL 5TQ0H 3OLEA 5AOJA 3HI5H 4NRXB 4DKEL 1KGJA 3HUJA 2XJLA 1N59A 1E30A 4PJ9C 1NDMB 5I75C 1OL0A 5DQJA 3U2SA 2Q87A 4GAGH 5JLZA 4HCFA 5FWRA 3TF7C 3L9YA 4FXTA 4JJOA 5ECJE 1SYVA 3CDGB 3RVXD 5LGYA 2J8UE 3DX3A 1QTYT 5DFTA 2P9RA 1DEDA 1YNLL 3KXFE 5TH2B 1T6VN 4JO3H 5JOEA 1YEKH 4AGNA 1GJUA 1X7SA 1S8DA 2RTTA 4FRWA 3FUHA 2I25N 5FA4A 4K23H 4W6XB 5HI5D 1XHHA 2LLNA 5ICUA 5HYJE 3DMMD 1NL0H 3S0PA 4WUKL 3MOQA 4ZNEA 5HYSG 5IVNA 4D9LL 4GKZB 2VDNH 2EECA 1AGBA 7FABH 3PS6A 1IQDA 4KZEH 2X4TA 5B39G 4UAOB 3M1BB 2Y5EA 1CFQA 1XF4B 2IDQA 4QO1A 4PJ9A 5F7HA 3V6FA 2ZG2A 3QDMA 3IS0X 3GSXA 1A4AA 3EUDA 2F2HA 1QSFB 1W0VA 5DJYB 1PKQB 3X14B 1A3LH 4DWHA 3D2TA 2N56A 4NC1E 4YUEL 1IC4L 5GSRB 4Y5XB 1KBPA 3N1PC 3QCVH 3VW3H 1J88A 4XGZA 4XMPL 4KNUA 4TKWA 2TRHA 3B34A 3WN5C 3A67H 4DP8X 1AFVH 4X0KB 3WNJA 3P0VL 5DD3H 5G5DA 3U7WH 4DVBB 4ZUSA 3U4EA 1SN0A 2WM0A 4X6CB 2D4FA 1HHJA 4TSBL 2X2YA 4YLQT 4UOZA 3SY0A 4JY5H 5H2BB 1PCXA 3IB4A 1EFXB 1UFGA 3W82A 5DR5L 5L9DL 3LDBC 1CN4A 2E5EA 3AG3B 4X5PA 5GISH 1N3NA 1QSFD 2UZXA 3FO0H 3J8F7 1F0LA 1UZ8A 3BAEL 3NFSH 2P8MB 2V5RA 2BVEA 2EO1A 1EEYB 3AWEA 3WSQL 5ID1A 1QYGH 3DSNA 3W11D 1ZHBB 3UGXA 2J43A 4TNFA 3LN4B 5FEBA 2E59A 4P5TB 3UPCA 4WI8A 4I2XB 2XTLA 2VXSL 3S37H 4LSSH 1OWRM 2W0FA 4M62L 3CQFA 2IALB 3PHQB 3WN5A 4HKXA 3MRJB 4YFLF 2CBQA 3FU9A 3IMUA 5JW4R 4UNTA 2X1QA 5EF1A 1AO7A 4PBXA 2HFFA 1HNGA 4QNPE 4IIQB 1FVCA 4IRJA 4NXKA 4O4YL 4YQXL 3G9AB 1R75A 4K3JL 2PTTB 4PB9H 4CMHC 2D2CC 2UZIL 3ZW3A 3A0OA 4P4RA 4FA6A 1KBGL 3T1FB 3PQYA 1BD2B 4F1SA 4JRYE 1UACH 4RNRA 3IJYA 2ALAA 4ODWB 4JO8A 4QRFA 1D5BA 1T03L 4TNWK 1R3LA 2CRIA 2O4EA 4L1LA 3VQLA 1UWXH 3S5LA 4YMPA 5K1NA 5C0GB 3JWDH 4XPBL 1A8ZA 1AGFA 3FBKA 4P5TD 3L95B 4P04A 4PY7B 2JKTM 4MCYA 3CK0H 1IQWH 2FSEB 2XKSA 5AB2A 1HCVA 1MFBH 4U1GC 5DVMA 3ZDZE 1RUML 1NMBL 1OSZA 3MJ6A 3F05A 4O5LL 1QFUL 1ZSDA 3DJZA 3MJ9L 5ALCL 2V2TA 4BE6A 1G1OA 2YN5A 3ROLA 4WI0B 3Q01A 2YGQA 4BA0A 4U7MA 3GKWH 5F6IB 5GGSA 2ETWA 3LKNB 1G0YR 2MFNA 5ACZA 4Y4KC 1Y0LB 4AEHH 1BD2D 1RAMA 4KUCF 3A5VA 5K59F 2DYPB 2XY1A 4X7DC 1CG9B 4AG4L 2I07A 4XXDA 3V5HA 5IBTH 5D9SA 3WTTA 3BPNB 2J44A 1QPKA 3US1A 4NZDA 2XACC 2YA1A 3IMWA 3AUVA 4QRQA 2OI9B 4Q0XH 3MZGB 4S1DC 5IBUG 4QYOA 4KWUA 2NY1C 4G80B 1A9EA 3C2SA 4KDVA 4OD2B 4H26A 2DQCH 1HNYA 4HC1H 3SDXB 3UTZB 1DL7L 3IBEA 4K3EL 5E4EB 1S5IL 5E2VL 7CGTA 1DDTA 3VVVA 5FDWB 3MVSA 1LGVA 1LO2H 2JKJA 1YMHB 2VJ8A 1MPAL 2BOCA 4N0CD 4MJIA 4PJ5E 3P9LA 1UQSB 3IJ8A 5DJ8A 1U8PB 4Y4KA 5D8JL 5F7LB 1GTFA 2DYPD 1ZV2A 4MDJB 2DIAA 2G3ZA 4EQ2A 1ZXKA 5JOFA 2CGRL 2HFGH 3FZUC 4H8PA 4V33A 3TIDA 4G9DB 4C4KT 1OTTD 5LQBL 3H7LA 4M1CD 2APWA 5IB5B 1XR9B 4AY0A 2Y36H 3EOBB 3TH4T 2KH2B 1T6BX 4I3SL 4R2GC 3Q0HA 1CFNB 1HQ4A 4AE0A 3UBGA 3IVKA 5DHXB 3VXMD 3O4LE 2YEVB 4AYFB 3M46A 1NANH 7TAAA 1ZJBA 1T4WA 2YUVA 2IWEA 1S78C 2CO1A 3QW9A 1MG2C 2FEDD 1WP6A 1SXNA 2W9EH 4IMKA 4I89A 3VXNA 4Y1AE 2VH5L 4ZOAA 5JNYB 2IWGA 5GGTA 2HT4C 5DMJB 4NOFA 5EUOE 1A3ZA 4F91B 2EZ0C 4N24A 4OJYA 5DS8B 3RVTC 4A04A 3CV5A 3HRZB 3DRTA 3ZKMD 1I7TA 4F7EA 1O7DC 1UT2A 2AV7A 3RGBA 2C5DC 2C7FA 4EXPX 2WTOA 1BVNT 2EDEA 3ARDD 1U3HA 4W6WB 5JW5A 1QPPA 5ITFA 3IAQA 1HHIA 2FE0A 1OV8A 4QCIB 3K2MC 3N9GL 1HSAB 3HFML 1JGUH 4G71B 1S7SA 3UAJC 4BIKA 2W59A 1N70A 1PLAA 4F58L 2JE8A 1QFPA 3F6LA 4JZJB 4P2RA 3MJ7A 1NCDH 2VDNB 2WXKA 3HC3H 4KMTH 1NMAH 3GO1L 3LKQA 4B9YA 3KYKL 5EN3A 4YDZA 2V5TA 2WQWA 1ED3A 3DJTA 5E00A 1TQUA 4QRTB 1LP9A 4HJIA 3ZX1A 4JHVA 3KPMA 3SY6A 4ZMAT 5IF0A 1NFAA 1FL3B 3FCBA 2BSEA 3SPGA 3PNWB 2EDDA 4FNLL 1TMQA 3VRIA 4ODUA 4CADA 4ZPTA 5F96H 3Q05A 2GT9B 4UT7L 4N2CA 3MI6A 2E4FA 4QXGH 3RVUC 4KVCH 4IOSD 1F8TH 2HH0L 5MHSE 1YY9D 3DHMA 4UILH 2AEWA 4WW2B 4XPFH 3FSZA 2VABA 4PU2A 4PWFA 1IIIA 1CL7H 2KDGA 4J23A 1G1KA 4QT5A 4WTQA 3LZFL 4HIIB 3MRCB 3FB7A 3ZDYB 3RIFF 4HJEA 4UTAH 1WF5A 1W9XA 3NJHA 4JHBA 3N42F 3VGAC 5A2FA 5IOPA 1PJWA 3OF6A 2SODB 5EZJA 35C8H 4X7SH 2WLLA 5C0BA 1FFOA 1W72L 3I2CH 1C5BL 2G2PA 4P8QA 5D96C 3V5DA 3VM7A 3CBRA 3IFPB 3JT2A 2LTQB 3LKPB 3KPLA 4OM0H 3RL2B 3G6JF 3QHFH 3QCTH 3T0EE 2HJKB 4G1EA 4WO0A 4OLUL 4R26L 2EXWD 3VWKB 4F93B 5IQ7H 1BQHA 5DWPA 4B9JA 2Q8AH 3WN6A 1Q0XH 4BA8A 2E6QA 5DUPH 4OD1L 1I7UB 3MR9B 1MIML 4JG0L 2WXFA 4N0YH 3TO4A 4IRZA 4H8HA 3K71A 4M61B 5EEYA 4D0DB 2NX5B 1F4XL 5D7KD 3GRGA 2GTQA 4QGTA 3HVDA 4R8WL 2WKLA 1KGUA 3EFDL 4AITA 4M7KL 3PJLA 5GGTH 2YD1A 1A7OH 1EUUA 3IAGC 1MFMA 4PBVC 5DQJB 1I9RH 5J12B 2DQTH 4WFFE 1ZA3A 1SYVB 4X8GA 4Z23A 3FUMA 2AERT 2ITFA 3VWKD 4AQ1C 3V79C 3W5MA 1AZRA 4FZEL 3NJLA 1EXUA 4KKBD 3ZBMA 1HOCA 4MLSA 3NZ8A 5CZRA 2YSSB 1BYPA 3L3OB 3EH2A 1JXJA 3BIKA 5MEPA 1S8DB 2AXWA 2BERA 4IDLA 4XPGL 3QQ9D 4J6RL 2ALWA 5AG9A 3RFZC 1MWAA 1KXVA 1SHXA 5HPMA 1HCYA 4YR6A 2AEPH 5L6YL 5LBGA 2W0PA 2NX5D 4L8SA 4PJDF 4WNQA 5ALBL 4Z3GA 4B7IA 5BPPA 1W16A 1KN4H 1AGBB 1SPDA 2ZPKL 1KYAA 3VH8A 1IQDB 5EG6C 1GGIH 2X4TB 3H2PA 1PPIA 4FQ1L 1F18A 4I4WA 1CFQB 4UINL 4QO1B 4PJ9B 5DURB 4NP4L 3CFMA 1IFHH 3QDMB 1BFSA 5I75B 1IC7H 3FB8A 3GSXB 1E90A 5HGBA 5ECGA 1KIQA 5I8EA 1W0VB 2PF6A 1WCBA 2GK0A 4XNAA 5DVKA 3S88H 4X5XA 1J0KA 1MCOL 1EO7A 4D9QD 1RUAL 4JO2H 3VD0A 4R4BA 5TPWL 5DWUL 3S34L 2FO4A 4G7QB 4GP5B 1FIGL 2Q3XA 4XGZB 2J57A 2O5ZH 5DUMH 1TXKA 3RFZA 1XGRB 1Q0YH 3GFUA 3VD2A 5CGYD 1N64L 1INQA 3AADB 4ZUSB 5G5DB 2IQAA 3U4EB 5IG7A 3DTDA 2DBLL 5DFWH 4P5RA 4ZUVA 1HHJB 3GS0A 1D7CA 3ZE2B 3QS3A 4HXBL 4NUGH 3I02A 4N87A 4PJAA 4P3CL 5MI0C 2Y1ZA 4PJ9D 1AR2A 1R1CA 5DURD 3QRFM 3QDMD 1JNNH 1RK7A 2V0AA 1QVOA 3LB6C 3QFJA 3DIFA 1OK0A 2UZXB 1UZ8B 1UWGL 5C6WH 1EJOL 2BIMA 4XXCC 1NAML 5BV7C 3PAVA 4ODSH 1A65A 1LILA 5ID1B 2Z64C 3DURA 3SZ6A 3DSNB 4PJFE 1NM4A 4KXDA 2OSLA 4NZJA 4JHZA 1HJBC 3U0WH 1NCNA 4PD4J 5F3BB 1DVYA 2W0FB 5E7BA 2D0FA 5D7SH 3WN5B 1AQKH 4AK1A 4HKXB 2A3TA 2D7MA 1PQZA 3LH2H 2GJPA 2AHIA 1HYSC 2OXGA 1AO7B 4WKZA 3CSBA 5FFOA 1DHKA 3ARXA 3D69A 2HFFB 1I1RA 2GPZA 2O6EA 1JZ4A 3X3GH 5F7KC 1IFRA 2APVA 1YEFH 1ANUA 4H2CA 4P4RB 2EUVA 2LOEA 4IRZH 1QNZL 4AC4A 3LDBB 1TEYA 5CKAA 3CXDH 3GXTA 1BPLB 3IJYB 4HV8A 4Q56A 1K5NA 1FH5H 4RNRB 1D5BB 3BT0A 4FNQA 3GK8H 1R3LB 3T3PE 3S5LB 3CHXA 3RA7L 1U3JA 1AGFB 1IBFA 3ZU8A 1UYWL 4DP4X 3W37A 4HXAL 2Y6SC 3GXUB 4GUOA 2R2CA 4MCYB 4L3ED 5C2UB 3IXTA 5AENA 3EYVA 2WPGA 2K78A 3HC4L 2KZBA 3T5WA 3DX9A 1X9QA 2IAND 4OCRL 1P5UA 5JYMA 1OSZB 5E4IA 1IGYA 5C3LD 1AO7D 3G7TA 2PCXA 5EIIG 2V2TB 2DMCA 3DUUA 5EZIH 2QQLH 3ROLB 2DQJH 1MFNA 3C5JA 3QBTB 3ZMNA 1KLGA 5GGSB 1EXGA 1CFVH 4CMHB 3GBEA 4NO0A 5ACZB 4OZHE 1ILUA 2NCMA 2GJJA 2YD6A 3T6QC 6FABL 2XFXA 1E5AA 1LQSR 2I07B 4XXDB 3V5HB 4PY8I 1HNFA 4W9HC 2CHZA 3DX6A 4KVNL 1CK0L 5I1LA 2VMFA 4GT0A 3VRLF 4PWJA 4WGVB 1OF0A 2ESVA 2VE6A 4QYOB 1A9EB 4U1GB 4H26B 4QRRB 4AM0Q 1D6VH 4GYBA 4TUOA 4BFFA 3NIGB 4JLRA 2HJFB 4C83A 4KRLB 2FZ3A 1M05A 4EKXA 4XOAA 4NN5C 1JHKH 1I1YB 5DGQA 5C09D 4LSTH 3RB7A 3N1GC 4NQCD 2XWJB 1AHMA 4DKEH 5EB9A 2BOCB 5EN2A 4MJIB 3P9LB 5DJ8B 2N01B 3ETTA 2JKNA 1VGEL 4WU5A 1D5ZA 4Y4KB 3WKNA 4W9FC 5BRZA 4BSWB 1DN2A 2ADJA 2CO3A 3H9ZA 4C4KO 4EPSA 3F7PC 5JOFB 1Y1DA 3FULA 5DJ0B 3TIDB 1C7SA 4AT6A 3SGJC 1ETB1 1SUHA 2XIDA 4MYPA 4GSXA 1BZ9A 4IBVA 2R0ZL 1YNLH 3RL1A 3EOYG 1NIEA 1G6VK 3MJ9A 4UOW0 3MBEC 2JELL 3FOMA 3HMWL 4Y9FA 3EYSL 2J72A 2NY1B 3IVKB 3KYAA 2RH0A 4QRRD 4XWOC 1ZHNA 2EXTA 5SWQA 4M8QA 4AVHA 32C2A 3GSUA 4F20A 4WUKH 1OWWA 3G5XA 4IJTA 2I69A 3LZNA 4D9LH 3BQVA 5B1KA 2VSDA 3VXNB 2H6PA 1ZV9A 3U48A 4C54A 3TA3D 4XP9L 4EDWL 4MJID 1OM9A 2MQ0A 4PWKA 2D7NA 3MTXA 1WFMA 3B9EA 2OP4L 2BIQA 1NGZA 3DRTB 4A38A 1UA7A 1I7TB 4F7EB 2QDVA 3CFKB 5JW5B 3CFEA 1U3HB 4YC2C 3RI5F 1AZUA 4YUEH 1HHGA 1IC4H 1HHIB 3L7EA 4P3DA 4R5VA 2UX6A 3T2NL 3MBEA 5F9JA 5GS3A 3NUKA 4S1DD 4R2GB 5EBGA 6CGTA 1S7RA 3FTWA 1OCZB 2KS0A 4ISVA 2JI3A 4XMPH 1U8QA 3AVEA 3M45A 4MJHA 3V6ZA 5BOZG 3P0VH 3TA4D 3MJ7B 1WK0A 4N2KA 3LKQB 4U31A 1PD6A 2MPVA 2FLRT 4TSBH 1UB6A 3Q2LA 4DPRA 2X7LA 1XGPA 1ZJAA 4PLOB 2IAAC 3U7AA 3ARBC 1CDYA 1ED3B 1IGTA 5DR5H 4Z3TA 5L9DH 2R29L 1JYNA 1JBJA 5E00B 2BVYA 4GUQA 1MELA 1LP9B 2DH2A 3BAEH 3C5ZC 3FZUD 4B41A 3KPMB 3X3FL 5IF0B 1GMIA 4AC2A 3WSQH 3QQNA 4EZMA 1VIWA 4XN8A 4DO4A 4U1KA 2B14A 5CCGE 4C8XA 3VRIB 4ODUB 4R2GD 3TTSA 3NCFB 4LMQI 3S4SG 4M62H 5GJSL 1IFGA 2ZF9A 3H9HA 2GIMA 5J7CC 4PREA 1JD7A 1A1NB 4L4VE 5FGRA 4CKQA 5HD8C 4W4NA 4L9LC 1S78D 3IETA 5BZZA 3WIAA 5KTEL 3U83A 3ZKNC 4YQXH 4O4YH 2VC2L 2VABB 1UADC 3NJKA 4J3TA 4K3JH 4TLKA 2HT4D 2UZIH 4QT5B 4ZUWA 3EYUL 1KBGH 2C8NA 3VX0A 3ARBA 2EZ0D 1S9VB 2BSRA 2G4EA 3PWNB 3RVTD 3FB7B 4PG9A 5AZEL 3W39B 1X5KA 4V2CB 1B2YA 1T03H 3NCWA 2EDBA 3NCMA 1IBHA 1HEZA 4JQIA 5EZJB 3AAZB 2WLLB 4B9CA 2XUWA 1JTTA 4XPBH 1CTNA 5C0BB 3V5DB 4K9JA 1RPKA 3C12A 3KPLB 4G1EB 3UAJD 2MQGA 2NUPB 4O58L 4DPCX 2NCEA 3HPLA 2NT1A 1Y6MR 2MNWA 1RUMH 3MNWA 1NMBH 2CUMA 4O5LH 4X4ME 1QFUH 3QRBA 3VNZA 1MW0A 1OAZL 4L9LA 3MJ9H 3K1KC 5ALCH 3TN0C 4Z78A 3RUGE 1CIDA 2KI6A 4OW6A 1RY7B 4BK5C 4MQTB 2JJUA 3TO4B 1HI6A 4F7MA 3MUHL 5GS1C 3K71B 2XT1B 1JXDA 4F24A 3IWUA 4M4PA 3UXFA 4L0PB 3VGAB 4AYGA 5EO9A 4AG4H 3OF6D 4ELME 5CSZB 2J8OA 5D4HA 2CD0A 1XD0A 4NQVA 3KEDA 3UO8B 5SWSA 5C0BD 4G6AC 3NK4A 1OGAD 5IJBC 4O2FA 3KAAA 5D96B 2E9JA 1H8OA 2CNYA 4A2MA 2WTRA 3UPRA 4UQ2A 3PL6C 4I8DA 3ZR5A 4Z1PA 4JPSA 3MRHA 3JZ7A 2E9BA 1UT9A 3RVUD 3U6XS 3WFCL 5CN3A 1EXUB 2XPYA 1SFHA 1DL7H 1HOCB 1JVOA 4ZTPL 3NZ8B 4K3EH 3OBAA 1TTFA 4X5LA 4X4YA 3T3MB 1A6ZA 1S5IH 3BIKB 5E2VH 5MEPB 4ZRGA 2YC1B 3CDZA 4PBWD 3IMSA 2X53A 1MCRA 1MPAH 1H3XA 3QJZA 5HPMB 4YR6B 1QP1A 5GS1A 1U8KA 5D8JH 4WNQB 4L8SB 4PV8A 4MXVE 4AZUA 4M6ML 4W70A 3VH8B 2B15A 2CGRH 3Q9QA 2F58L 1IBDA 2QPSA 4AQEA 1FFNA 4FMVA 3RVVC 2CMRL 2PPFA 5LQBH 3FT9A 1VPOL 3CIAA 5HGBB 4TM9A 5FLUA 1KIQB 2J6EA 4M43L 1FV1A 5I8EB 4I3SH 4NZ8A 2WZ0A 3PL6A 1WCBB 2GK0B 4LHUA 2FATL 2Z0UA 4X5XB 5DU7A 3S9DB 2CJTA 4JY6A 4NBZB 3OAYK 4L48A 5DHEA 4ADGA 1AR1B 4P05A 3ZXAC 4R4BB 1DUYA 2FO4B 3FQ4A 4XNZB 3STZA 2YMXH 3RDJA 2VH5H 3HLKA 1L9RA 3P11L 5B1AB 5K33A 3T0XA 3RFZB 3V7AE 2DWTA 2OMYA 1INQB 5FGCB 4H25A 2NNFA 2IQAB 4H8UA 5IG7B 3S3PA 5F2FA 1F86A 3PU7A 4JKNA 2UWEF 3SKUD 1DQJB 1QSFE 2KYIA 4PJAB 3I02B 1GHFL 1PKQE 4ZPVA 2IJ0C 1DR9A 4FQJL 4HCRL 4DW2H 1QVOB 1EANA 1RHHA 3QFJB 3N9GH 3HFMH 4ETQA 3E9UA 3ENEA 1K9TA 4HIXL 3DURB 3MX0A 3QQ4B 5MEQA 4F58H 3ZTEA 3EOAA 2OSLB 3C5XA 4KX9A 5ANMA 1G4MA 4ZZKA 3DO7A 5D55A 1EO5A 3GO1H 1I8UA 1WITA 4X6CE 3KYKH 3KWWA 3L81A 4QRPA 4B95C 4FXLA 2WWKT 1PQZB 4H5SA 2GW5A 1Q9WA 3CFTA 4WKZB 1S5HB 3Q7JA 4LAQL 4HJGA 4JG9A 5KG9A 5BMFL 4Z3EA 4PCSA 2ZOWA 5MI0B 1OGSA 4BBWA 1CF8L 3D18A 3NACL 3Q5OA 1F2XK 1LMIA 4FNLH 3SHSA 3AG4B 1ZKAA 3QFJD 1SLXA 4I2XE 4EF3A 4HV8B 2NTSP 4JREC 4BWTA 4PP1C 5BV7B 4UT7H 4L4TA 3WY3A 3H3BC 2IPTL 1CQYA 1MQ8A 1LWJA 2WGNB 3PWJA 4URTB 4WI3A 2HH0H 5KN5A 3FTVA 5JDSA 1I8IA 5AW6B 3S8FB 4EQ3A 2I5YL 3IXTB 3VQ2C 1KIRA 3EYVB 1F90L 1NIDA 2Y1VA 3EH5B 5IB3A 4L1TA 4ONGL 2GHZA 1IGYB 1HXYB 2ZUWA 5I8OL 1URIA 3H9YA 1OGPA 3LZFH 2IBZY 1ZK9A 2XN9B 4BSJA 4KI5C 1BD2E 4JFEA 3DUUB 1G84A 2C1OB 4JRFA 1RZGA 3C5JB 1NAMA 1KLGB 2Y1YA 2BNQD 4NO0B 2EH7L 1W72H 1C5BH 3LB6D 5AD0A 2XFXB 3F12A 5BQ7A 4JL2A 3FQ1A 4LNVA 1LE9A 2RHEA 1JNLL 1MFAH 5EC1A 4OLUH 3EIFA 4GBXC 4R26H 4R90L 3DX6B 5EIVA 2XN2A 2ZKHL 5I1LB 1WE5A 3IMVA 4MZ2A 4JCWA 4U33A 1U2CA 3EJZC 4W1TA 4PJCA 2GSIB 2CBPA 2H45A 2ESVB 2VE6B 4UT9A 4U6YB 4OD1H 5J57B 3ZHLA 2ZX8A 1MIMH 4JG0H 5I0VA 3GXFA 4TUOB 4C83B 4JLRB 4Z7IA 2OL3A 2RA1A 1HYSD 2FZ3B 1M05B 2XN9D 5CEYB 4DKTA 1F4XH 4HEPA 4R97C 5DTFA 4R8WH 3LV3A 5I18L 1H6UA 4JR9L 3EFDH 1FI8C 1SJXA 5EN2B 3KPTA 2H8PA 4PJBA 3NT0A 4WU5B 3BWSA 3WKPA 3ZTCC 5E6YA 1D5ZB 3V6OC 4YFLI 2FT8A 4MJ5A 4RWHA 1QQDA 1YLBB 2E7DA 1WFNA 2FEEL 1GZHC 3B2VL 5IVXF 3APMA 2WQVA 1M2VA 5GGRA 4FZEH 1BZ9B 1OP5K 3RL1B 3SPIA 3VXME 1HL9A 1WFJA 2Y6SD 3OGOE 2HRGA 4PW3A 1S9XA 3CBJB 3FOMB 1AANA 2ESVD 4JFFA 4XPGH 2IGFL 4J6RH 1DVUA 4MD0A 4X42A 3ZRSA 2A6JA 3O3DA 1E8ZA 1ZHNB 1MREL 4M8QB 5SWQB 1TQTA 1W0WA 32C2B 1HDMA 3GSUB 3MN8A 4OLEA 3G5XB 5L6YH 1HC1A 5ALBH 3F85A 4CN4A 3FFOA 2H6PB 2WUCL 3LNEA 5JPNC 2ZPKH 5F97E 1ASOA 1F45A 2YHGA 3B5TA 3CSGA 1TPXC 4FQ1H 4NERA 1HINL 3LYRA 1LM8V 4L3FA 4UINH 3WTVA 2EVIA 3FO2A 1W8OA 1X4XA 3NCXA 4NP4H 4KMQA 3QEHA 5H94A 3V6OA 4HWUA 2CWRA 4DN4L 1NGZB 4P2OA 4PR5B 3L45A 4TF4A 2EVJA 2VQTA 3K2KA 1YNKH 1F56A 1MCOH 3CFEB 3I3EA 3S3JA 3ZE1B 3TF4A 5ELIA 1RUAH 1HHGB 2K6WA 3L7EB 4P3DB 3MBEB 5F9JB 3FUKA 4NJAL 5TPWH 5DWUH 3S34H 1KEML 4OF8A 3F7VA 4ISVB 2C7UA 1FZOA 3U1QA 1IVTA 1U8QB 3VI3F 4Z77A 2KC0A 2X6MA 3KEHA 4ONHB 1N64H 3RWHA 3QIUC 2BVUA 1Q4NX 2JQAA 2MKLC 4OI9A 3BN3B 1SXBA 2DBLH 3QNZB 5JPNA 1UB6B 2ED9A 3QARA 4M00A 1XGPB 1BQKA 4HXBH 4WFHD 2B7DT 4P3CH 3FONA 3L5JA 3QJQB 5LKNA 2HUEA 1UT1A 3O6FC 5G4NA 1UWGH 4P4KA 5DD5L 1EJOH 4ODBD 4K7PY 4XBPA 1NAMH 3IDNA 5F1OB 3E8VA 4Y9CA 1QFWL 1XSOA 3QJTB 1CMOA 4YC2B 2OYPA 4J2QA 4U1KB 4XCCL 3T04D 3MBED 4KOCA 4YO0A 4DGVL 4PRAA 3KWUA 1XSIA 5KVEL 3H9HB 2XQYK 1HL8A 1X5ZA 4PREB 4K94L 1N2RA 4XOBA 4KKZA 3P30L 3IETB 3FT3A 3NMEA 1U4EA 3VXQA 4QTHA 1J9TA 1ID5I 1GW0A 2DKUA 4ZUWB 2E74C 4OT1L 2P46B 1S46A 3D51A 3WXVL 1QNZH 3ARBB 4OU3A 1QX1A 2BSRB 1JVLA 1S7VA 3D0LA 3C60A 4PG9B 3MLUL 2XPZA 3O6FA 4ELKB 4EZJA 3C5ZB 2D9QB 2QZQA 1HEZB 2R0LL 1E6OL 3CAFA 3RA7H 3EBHA 1UYWH 1RUPL 4HXAH 5HYIA 1KSRA 5DF0A 4WHYH 2Q10A 3MODL 3HC4H 1XBDA 4MVBC 4O2CA 3HPLB 4LCIL 4C59B 3QQXA 3EYQC 4K3GA 4OCRH 3MNWB 5D1ZI 5FO9A 2Z8VC 4YSEA 1P7KA 4PS7A 5I74C 2R29A 4L9LB 4UDTA 1WZLA 2X2IA 4ACTA 4HIHB 5D7KE 3OAYH 4BQCA 2WIIA 4BQ9A 3O9WA 1HI6B 4F7MB 3TBTA 3WFZA 1VGKA 3ARBD 2MPAL 2HMID 4RA3A 2KBGA 3CH1A 1K4DA 3NCBB 5KYXA 4YOKA 1Z3RA 3BUPA 2BLFA 5F8QC 6FABH 2CDEA 3C5ZD 3PHOB 3BI9X 3CPUA 4ZOCA 5EO9B 4AV0A 5G2NA 4NQVB 4YZFE 5SWSB 4LVOC 4KVNH 1CK0H 4DEWA 5C3IA 3DX2A 2CHDA 2VZSA 1U3ZA 1IO4C 3FT4B 1VENA 3VMOA 2WTRB 3UPRB 2J55A 4UQ2B 3WAKA 4IU3A 2YRPA 1A22B 3MRHB 2X2HA 4RBPK 5HD8D 1MCNA 4PCTA 4NQEA 1A6ZB 2NX5E 3ZKND 2LLLA 3CDZB 1P4BL 3IGUA 1XTLA 1QFWI 2XNAA 1U8KB 1VGEH 4Y88A 4WO4D 3D09A 3UJJL 5BUPA 1W72B 4XX1E 1MZZA 4PV8B 3WKML 2DLTA 4FEIA 1XF2A 4MA7L 4UI2A 5IFAL 4Z9KB 3GMMA 4ZSOA 3RX9A 5CD5C 1DP0A 1FNGA 1QHQA 4FQLL 4QIRA 2YBGA 1Q1JL 4AQEB 4NN6C 1FFNB 2HLAA 4H1LG 2R0ZH 4JFYA 5A2AA 1I8AA 4X6BA 4D9QE 4G5ZL 2JELH 1FV1B 3FQXA 3HMWH 4KKQA 3EYSH 3PL6B 2EDNA 4LHUB 4PTUB 1ZLWH 1UD8A 3QUYC 3SDAC 1IBYA 2BNRA 1MAKA 3WTSA 1ZGLM 1P4IL 4JY6B 3GBDA 2QTEA 2OR9L 2HG0A 2QT6A 2F7OA 1XCXA 3V7MA 4ZNEE 2WO4A 3TN0D 2YAHA 1DUYB 1BMZA 5DK3A 3JWNG 1PCSA 4YXKL 4XP9H 4EDWH 2OMYB 2VSKB 2WAQA 3O3BA 4H25B 3QDME 2J12B 2WANA 2OP4H 4KQ4L 1MEXL 2G4GA 1AS8A 2W88A 1QUPA 2FH8A 2QBWA 3U2IA 4M5ZL 4G6AD 4GMTL 5C7XL 1MN4A 2DQUL 1RHHB 3T2NH 3CZJA 3PL6D 4LHUD 4YPGA 2IGLA 3QG6A 4TV3A 2G2RA 3SDAA 3JVGA 3QUYA 3MX0B 3BVXA 5MEQB 2JI2A 3EOAB 4TQPA 2E7BA 1VZHA 5ANMB 1RSYA 2AJXL 3UEQA 5FECB 2D3JA 1AXSA 1KB9J 2WLNA 4XHQA 3BKMH 4YS4A 1NEZG 1TFHA 2QVMA 3LX9A 3B7YA 3F7RA 3H9SA 4Q52A 3KWWB 4QRPB 3DV4B 2X0VA 4OZFG 3ZE2E 4DVRL 1Q9WB 2R29H 3SODB 4EI6B 4HJGB 1NLDL 5I6LA 1TZIA 1ZGLA 1X44A 1K8DA 4BDVA 3X3FH 1JV5A 5AVYB 2NY3C 2ZP9A 4ODHL 3D18B 3RVVD 1TZGL 2AJVL 3NEEA 4XMWA 3ARPA 2OX5B 3CN4A 1NSNL 1YZZA 4NENB 5BS0A 2BVQA 1KGWA 4OCMC 4HYTB 4L3EE 3CVHL 4RDQG 1GSMA 5GJSH 2JK5A 4L4TB 2XFGB 5KN5B 3PWJB 3T8MA 2IANE 3DJ9A 2H26A 2CO4A 2L0DA 3C09C 3LXAA 5EZOL 1MCJA 5JDSB 1AO7E 5KTEH 5D7IB 1KIRB 2VC2H 3NG5A 1YVLA 3PJNA 3B1TA 3EYUH 2Y2TA 3ZN6A 5E6IC 3FAXA 2J21A 3NCJL 4NGHL 3ZHKA 5DI8A 1I1FA 4XVSL 1URZA 1MCWW 5AZEH 3ZDWA 1JZ8A 1NAMB 2IGTA 3H0TA 4AZ8A 4NM8L 4TXVB 1GY1A 4K07A 2ZYSA 3FH8A 1DBKL 4AH2A 1WV7T 3F12B 5AWNL 1SXAA 5BQ7B 1LE9B 4JREB 1ZE3C 5IESL 5EC1B 4O58H 2GY5A 2TSAA 3GXPA 1TQBB 2R4SL 1ZGLP 1JZEA 2BMKA 1OAZH 4QAMB 5IKCA 3FCUB 5C09E 1YAZA 4NQCE 4N8VA 5IQMA 1S7WA 1MVYA 2OL3B 4HBCL 3WXWL 3PABB 5E8NA 1CLOL 1SMOA 3M1CA 4M03A 3MLVL 1B90A 5DTFB 3K2UL 3LV3B 4G43B 1AP2B 2PCPA 3X2QB 2H8PB 3CMOL 4PJBB 2WVSA 3OB0H 4LGPB 5HPOA 5AUMA 5C07D 4MJ5B 1QQDB 1XAUA 2VCOA 2YXMA 4PP1D 5EOQL 4E9YA 1M2VB 2VDQL 2WN3A 4GBXB 3WFCH 5L4FA 3F7KA 5CLXA 3P69A 4QRRE 3IRPX 3RIFK 1QRNB 1ILSA 4ZTPH 3NIGE 4XO4A 4K0OA 3DNKA 1CD1A 1S9XB 2KZWA 4JFFB 4N3UA 1D7DA 4MD0B 2EKJA 3PGCA 1WWCA 2A6JB 1BXVA 1JXGA 3EDJA 3O3DB 4ZW7A 1HK6A 4BSVA 1W0WB 4MJIE 5IROD 1HDMB 1LNUA 5AAMC 2HKHL 3JV6B 3D08A 4KI5D 4BRVA 4M6MH 4R97B 3ZZ1A 3ZT6A 1JL8A 3ABKB 1IVLA 4JK0D 1EK3A 3DX7A 2F58H 5KS9A 3K6DA 5FXCH 3FO2B 3V52L 4OCYL 2A9ML 2CMRH 5H94B 3QEHB 1VPOH 4J3WA 4NFCA 4M43H 4IK6A 4P2OB 3SGDH 3B7RL 4JBSA 4ZS6C 3SKMA 2FATH 4GBXD 1AAJA 2PW1A 2E56A 5GGSY 3O8XC 1IL1A 1HAUA 1QRND 5FUZL 4A68A 5GRVL 1U92A 4OGZA 3EJZD 1MW1A 1QI5A 1KPUB 1XB3A 4JFFD 2R2HB 4AGMA 1LL1A 2XG5A 3F7VB 3GSQA 3NEOA 3O4OC 2C7UB 1FZOB 3P11H 4Z77B 4FHJA 4I0CC 4MA3A 4GEIA 5D1ZC 3RWHB 5JA8B 4BXSV 1ZSHA 2FECL 4TYUA 1LE5A 4G6ML 2KPNA 4QRUB 1FAKT 1O9ZA 1BEXA 2V2XA 5JPNB 3FSAA 2CKBL 1GHFH 3DPBA 3FONB 4I88A 4P2AA 4DP5X 4FQJH 4HCRH 1G7LA 4H2AA 1U8IA 1H3TA 3TURA 4NX0A 3F62A 4KOBA 4JRLA 4P4KB 4XBPB 3LEYL 4KNSA 1L7IL 1Z1WA 1GGTA 3BT2L 1DBML 4HIXH 1NIFA 4B60A 4TQ8A 4ZUUB 3O8XA 4N90D 4P0DA 1XL4A 15C8L 1QFWM 2QR0B 2DS4A 3QPQD 4YO0B 1TJMA 5HDBF 3A4AA 2R59A 4PRAB 3CH8A 1BAWA 4OZIF 2H0EA 5GGVL 1N2RB 2R1XA 4BRJA 1YQ2A 3I9GL 1G9NC 4LAQH 3KCPA 4N8PA 5TQ2L 4RBPH 1LP9E 2ZX9A 4DUXA 1HU8A 3QUHA 5BMFH 1O7DE 4Z7UA 4JM4L 3WGUB 1CF8H 3H7BA 3NACH 3OTTA 3QP3A 3WEOA 1ZCRA 4AYMC 4PIBA 2EIZA 3D0LB 3S3BB 1BW8A 1E27A 4FNUA 3O6FB 5F1KC 4BCXA 1PAZA 1T2JA 1VRSA 1T2QL 4LSQL 1XQ4A 2VERA 3RBGA 4K94C 2IPTH 2JIXA 4JL1A 4WQOA 4GAJL 3ALPA 2OKMA 1A9VA 2BIPA 4N5EC 2I5YH 5JW4N 2OV0A 5CR8A 1ZE3H 1F90H 1UJ3C 3LZPA 2NDFA 4L18A 4LLYA 1W80A 5FO9B 2ZAIA 4ONGH 2VW7A 3QIUD 5CM1A 1P7KB 5I8OH 2VAAB 4M4RA 5CZVL 4UDTB 5J6GA 5LJYH 4MB5A 1ZA6A 4DESA 3FQNA 1FVEA 1MDAA 1A3QA 4YHKL 3O9WB 1T1YA 3L3GA 3TBTB 2EH7H 1VGKB 2XOTA 1G1YA 1YCSA 5B39A 2HX8A 5C0BE 3CH1B 1K4DB 3TP4A 2WN2A 4RGND 5KYXB 1OGAE 1GZQA 3O6FD 1XTMA 4WEBL 3RDTA 2WMPA 2CDEB 2A4EA 3EGXB 1HJCA 1UD2A 3HS0A 1JNLH 4YDMA 1AXTL 3RZCC 4HX1B 4R90H 3ULUF 1Q94A 1H8SA 2ZKHH 4HF5L 3A47A 4HJUA 4N2NA 2EE2A 3BRGC 2VC2B 4IU3B 1NCGA 3BUBA 2DH3A 2EJ1A 4M29A 1UJ3A 1MY7A 2HB0A 2OCCB 2YD7A 1UOKA 4ES9A 1KOAA 3IJSA 2IPUG 1F11B 4Y1TA 1SY6L 4LDEB 4NQEB 3GC3A 5I74B 4NB7A 4NKDA 1KY7A 3OKLA 3KE0A 1NLBL 1VZGA 1AYRA 3VYPA 5C71A 4KX8A 3QFGA 5I18H 3CUPA 1YQVL 4GSRA 4JR9H 1TF4A 2IDCA 3TEZA 2XNAB 4JHWL 4UOQA 2AJZA 4L5FL 4N28A 1XF2B 1BXUA 2FRGP 2G2NA 3GMMB 1BWWA 4ZSOB 1UVQA 2K6YA 3WY4A 3B2VH 3ZR6A 3PDGA 3RZCA 1FNGB 1H8NA 2AXFA 1MXDA 3QIBC 2HLAB 4JFYB 2HG5A 4LVOB 2WLIA 1TSRA 3PRZA 5DVNA 4APQC 5CSGA 4YSQA 2HJLA 3FQXB 5LN8A 3T3ME 5A2IH 1VCAA 2BNRB 2IGFH 3ZZQA 3BFWA 4CN1A 3EYQD 1MREH 2NOYA 4AM0A 4NQED 1BVLA 1K2DA 2ZKXA 2AEIT 4YDJA 1DQQA 1CS6A 4ZJ9A 2WUCH 2HKAA 5CXPA 3ZTJG 2OFQA 1HINH 5AAPA 3C08L 3GEWB 1SXSA 3O3BB 1CLYL 1IT9L 1HCZA 4ATWA 3K4AA 5IQOA 3Q8AA 3ATDA 4DN4H 4EJ1C 3QJHA 1KJ3L 2PCYA 4JEGB 2DLFL 4KI1A 1BQRA 1WTGT 3EFFA 2BWQA 1B3JA 4XMVA 5DEGA 3QIBA 4NN6B 3L13A 1V05A 4NJ9L 1YPZF 3CZNA 3G9VA 4PJXA 5CN1A 2GJ6A 3BVVA 3E8UL 4LOUC 4APQA 4B5ZA 1T5WA 2L7UA 4NJAH 5FOBA 5B22A 1KEMH 2G9HA 4YPGB 1PYWA 3QXWA 3DRQA 3QG6B 2BNRD 2DYSB 4P46C 3QUYB 3SDAB 4BH8A 1I31A 4TTGA 1YMMA 4N2MA 4LSRL 4JQVC 2FO1A 1T0NA 1D5RA 3DKHA 1P4LA 5FGCE 1WIPA 1AXSB 1MJJA 4EVNA 4M3HA 1G7QA 4AL8L 1AOZA 1J5CA 1FNSL 5HGAA 3H9SB 4PJHE 1IKOP 1SDAB 3BKYL 3RBSA 4PJAE 4EI0A 3AACA 4ZX3A 1KGXA 2X0WA 4KV5E 2Q6WB 1ZGLB 1TZIB 3KPPA 1O75A 3QFJE 5DD5H 1K8DB 4BDVB 4ES8A 1JV5B 3KD4A 3SGKC 1QFWH 2BS9A 4ICWA 1EMTH 3K0WA 2W1NA 4PSPA 4I18C 2DQHL 1YEDA 4KRNA 4XCCH 3ZE0F 3ET9F 5BS0B 4DGVH 4X7TA 3EJSA 4LLQA 3SDAD 1QACA 3QUYD 4P46A 5KVEH 5LXGL 2JK5B 4DPBX 4L0YA 4IRSD 3QJOA 1T22A 1BJMA 4K94H 4JQVA 4DT2A 1TZAA 2H26B 4GAFB 5JHDA 3P30H 1HYRC 3M1OA 4RX4D 3OMIB 5GRYA 3TCTA 1TJHL 3BWZA 4POZC 4D9RD 4EUPG 5JHAA 1HHHA 3H9SD 4M8RA 3RI5K 4DKAA 5JORA 2E86A 5E9DA 3II1A 4OT1H 2BNQE 5AVRB 3B9AA 4UUJA 3WXVH 1BAFL 2DQGL 1I1FB 3N3EA 5DI8B 1S3KL 1X9UA 2CIIA 3MLUH 5IBLC 1MFCL 1MRDL 3DVIA 3O3AA 4EZLA 5KOMC 3F58L 2F1AA 4NYLA 1J0YA 1CR9L 4NO5A 5DRXB 3NA9H 3SO5A 3SGKA 2NY3B 2R0LH 1E6OH 1WZ1L 4CNIA 5C08B 2I26N 4I18A 3CZKA 1HCFX 1EERB 1RUPH 3GGWA 4AH2B 2CJSA 3OX8B 1WAAF 3A24A 4XCEA 1F2QA 3MODH 1FDLL 1PNDA 4LCIH 5D5MF 4KY2A 5FX3A 4S0HA 4ZOBA 3V9CA 1GYAA 1SXCA 3ZDXF 3C09B 4BFBD 2V7HA 3QXDA 2XN9E 3H4HA 1HILA 3DUSA 3NCYP 5IKCB 1DJWA 3IT8D 3DX8A 4ZAKA 1S7WB 4XNYL 3GRWL 4YSOA 1E3ZA 2CBOA 2MPAH 3LS5L 2PPDA 1DQTA 4YBLB 3R0MA 5E8NB 3WMQA 1JVKA 1PAMA 1CQKA 4IM8A 2AF2A 1FBIL 2PCPB 3CVHA 3VXUA 1IAIM 2ICWI 4GUCA 2JV6A 1I8KB 5DD1L 5C08D 4HJSA 2XA8L 5AUMB 2ICES 2XTJC 5I16A 2I60L 3C8KA 1DFBL 1E28B 4ZMXA 2F9BT 3SBWA 4FYRA 4EBQL 1EGJL 2ESVE 3N55A 1G0XA 1AIZA 5A6LA 4LSPL 4ZODA 4MASA 1OD9A 1R3JA 1YEJL 4FC3E 1KNOA 5HDRA 1N8ZA 3D06A 1CD1B 2CHXA 5B7FA 2H3NA 3KM2A 2OYKA 4L1DA 5ENWA 1PFCA 5FCSH 4TLUA 1KPRB 2COVD 4PGJA 4BSVB 1MCFA 3UJJH 5E6ID 1LNUB 1PG7W 5DSCA 3WKMH 2KLTA 4GXVL 4XNMA 4MA7H 4JFTA 5IFAH 3ZJAA 4XCYA 3DX7B 1E65A 1PZSA 2DPKA 2LU7A 3H1ZA 4LLVA 4RETB 4FQLH 2ZUTA 5KS9B 1Q1JH 1O5DT 3MRKB 1G7PA 4G72B 2A6KA 1G7HA 4WHTA 5D6CA 3RJDA 4G5ZH 2VMJA 1U33A 3HG5A 3F3HA 1DSFL 4NHUA 3SKMB 2AABH 1AOHA 4KVPA 3AWFA 4KKRA 2PW1B 1P4IH 1IL1B 1IGFL 2OR9H 4S10A 1W0YT 4OLXL 1U92B 4HLZG 3T0BA 4UB0L 4NEHB 5IVOA 2PPEA 2YAQA 2D9CA 3GEFA 4KH2A 5SX5H 4OGXL 3GSQB 3HG1A 4RMQA 4KK9C 4YXKH 3FB5A 3QULA 4MA3B 3O2WL 4WFHE 4OZGF 1LE5B 4Y19A 1OSEA 2WKOF 1UD3A 4BWWA 4KQ4H 1MEXH 2V2XB 3SQOL 5A1AA 3DK0A 2EH8L 1DJYA 4G3YL 3DPBB 4PGBA 4M5ZH 3DWTA 4GMTH 3SE9L 3GSWA 2X88A 3RJQB 1IRAY 3ZE1E 1SHSA 2QTVA 5C7XH 5J06A 2DQUH 4M9OA 2PR4L 4XNXL 1NDGA 1D3CA 1ZHKB 2GUOA 2A83A 2A2QT 2K9UA 3BCFA 4J3OG 4J8QA 3O8XB 1YECL 4PUBL 3FFCA 5F7UA 2GTZA 2AJXH 1PY4A 1H19A 3MACL 1FA4A 4KKCC 5DJXA 1J18A 1S4IA 1ET7A 2OMZA 1IKNA 4ZK8A 3Q9PA 4DVRH 2PYEB 2R1XB 4NC2B 5F0LB 5CGTA 2GI0A 3LQAC 1OCCB 1SXZA 4MCMA 3KCPB 1KB9K 4K8RL 3S3DB 2J1ZA 1NLDH 2KQMA 3B3BA 4FI8A 4PJ7E 4L1HA 1T80A 2NYYC 4Z7UB 3EGSA 3H7BB 4ODHH 4HHWA 1TZGH 2AJVH 3AM8A 5E2JA 3FFDA 1BBJA 2EIZB 4Z3JA 3D9AL 2HYMA 2ADIA 3D4YA 1NSNH 1E27B 5MERA 4JQXC 1AQDA 3L5HA 5EU5A 4ZS6D 2FJSA 2ORBL 3CVHH 5HDWA 5TFSL 3Q43A 3AY4C 4F7KA 2FO8A 5D7JC 2JIXB 3O8XD 4FQQA 1A9BB 4TUJA 2ZT9C 3F83A 5EZOH 5T1MB 3T0WA 4Q6YA 3ARRA 1AGDA 3BD4A 1CO1A 4L37B 5D1ZD 5BOPA 2PYED 1SF3A 4BKTC 1A02N 4M4RB 3NCJH 4NGHH 5J6GB 4XVSH 1ZA6B 2YA0A 3FQNB 4LOVA 4BUQA 2Z1PA 1FVEB 2FX7L 3GDCA 5JIDA 4NM8H 1T1YB 3L3GB 1U0QA 5BRPA 1SHMA 5B39B 1DBKH 3NIDF 1GZQB 3D25A 3RDTB 2Y4SA 2WMPB 4JQXA 5AWNH 1GOHA 4X2UA 2F68X 2YQGA 1TKWA 3QDJA 4A67A 5IESH 1Q94B 4BFJA 1QBAA 2R4SH 3NJJA 3BC9A 5SWZA 2EDXA 3TBWA 2XXMB 4HULB 1CGTA 4RSVA 1Z3GL 3ABMB 2AEOA 2VDML 4EIGB 5I0XA 5K1VA 5C0DB 1QLFA 1UJ3B 3N42B 5FPIA 4WI9A 5BZXA 1HH9A 3IJSB 2I85A 1B4LA 4HBCH 3CU1A 4PCKA 3WXWH 1CLOH 2Q7AA 4N9OB 3MLVH 5IFJA 3OKLB 1IAIH 5CJXC 3ESUF 3K2UH 5F3FA 5I76A 3CUPB 5L4MA 1KBWA 2B3RA 2CCLA 3DHJA 4Z7NB 3CMOH 4C55A 2K8QA 4KO9A 5SWSE 3NJNA 4ZMPA 2DL9A 2AJZB 3H56A 4RMSA 1OAYL 5AW5B 3WS3B 3FXIC 1V8HA 1UVQB 4MTMA 5KBLA 1TYJA 3KL0A 3QHTC 1BOYA 2AXFB 3MLXL 2VDQH 2CAKA 5EOQH 3RZCB 5LDSA 2HG5B 2WLIB 4N2FA 3O0LA 2HJLB 4X0NA 4ILDA 4N5ED 4LEOA 3K1DA 4XR8C 5F44A 3E6HB 3TEYA 3T65A 3LZOA 3FS9A 1BECA 1ZWIA 5F70A 1EJFA 5HI3C 3ZZSA 3HPJA 4AM0B 1BVLB 1K2DB 5AVZB 1VEMA 2HKHH 3ESPA 3AMKA 3LTVA 1DQQB 4P3WA 3BP4A 4W9ZA 4YDJB 4O02L 4NWUL 5CJXA 5DZOA 1QFOA 1XMWA 3DXAD 3BVNA 3V4VL 3ZT7A 2E7LC 5AAWA 1EDYA 4YE0A 1ETZA 1G9HA 4J4PD 5KBMA 3V52H 4OCYH 2A9MH 2WJ7A 4N2GA 3AWGA 3V55A 3FKUS 1HQRA 1PKOA 3QJHB 5GS0L 5C9KA 1QEWA 4GMSH 3R7RA 3RZCD 1OP4A 3EFFB 5DEGB 4DUWA 3QIBB 5DJDA 4PFEA 4DQOL 2R56L 3H3PL 4IW4C 4PJXB 1OSPL 5FUZH 5AYQA 2GJ6B 4APQB 2BIOA 3N43B 4Q9BA 2BS71 5FOBB 4E41A 1V7ML 2N7BA 4I3RL 3F7YA 2G9HB 3TYFA 5E1AA 2XXGA 5DJAA 3DRQB 2XTSA 4BH8B 4RSYA 4GI8A 1YMMB 2ZKMX 4WHCA 1EA9C 5IEHB 1T0NB 4Q6IC 4Q74A 3WYRA 4FQ2H 1MJJB 4G6MH 4EVNB 1Q9OA 1TQWA 4RZKA 1G7QB 3BUYA 5EIIA 5HGAB 4Y16C 2CKBH 4XX5A 2E7LA 1QUNA 4ODVL 2M2DA 3SCMC 5AB9A 1G9ML 2ENJA 2GBUA 5IHWA 3UFIA 2QL1A 1KFGA 3KPPB 2OPCA 4KTYA 2NSXA 2NXYC 3LEYH 1L7IH 3IDUA 3BT2H 1UFUA 4YHOL 1DBMH 1OK8A 1CVRA 3DGCR 4APQD 1YEDB 15C8H 5ANME 4G6JL 1NKGA 3FHEA 3IMTA 4N0FB 1KCKA 4X7TB 4AL8C 1EWHA 4RAVB 4LLQB 3WJMA 4P46B 2ITEA 2Y22A 1T22B 1YMMD 5IBUB 5GGVH 4RMBA 4JDVA 3ME0A 2A4ZA 5HYJA 2VDOB 4Q6IA 1RK0A 3I9GH 5TQ2H 1HHHB 1JMZA 4GIOA 3C2AL 2XZCL 4Y5VC 4B9PA 5JORB 4Y16A 1N7ML 5E9DB 4JM4H 3SCMA 4UUJB 3QUXC 3ZHDA 1BZDA 4FABL 3Q13A 2XWTB 2CIIB 5AKTA 3O3AB 3DK2A 3QZNA 2WLMA 4HLEA 1T2QH 2EILB 4NYLB 1INDL 4LSQH 4NO5B 3L2MA 5GS2H 2GJZA 4Z7QB 1WWAX 4CNIB 4I87A