1ZK5A

Escherichia coli f17fg lectin domain complex with n-acetylglucosamine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
175
structure length
172
Chain Sequence
b'AVSFIGSTENDVGPSQGSYSSTHNLPFVYNTGHNIGYQNANVWRISGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWCVGNYVSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F17G adhesin subunit
publication title Impact of natural variation in bacterial F17G adhesins on crystallization behaviour.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 41
structure length 172
sequence length 175
ec nomenclature
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1zk5A00
2BSBA 2BSCA 3F6JA 3FFOA 2BS8A 1ZPLA 4K0OA 2BS71 3F64A 1ZK5A 1O9WA 1O9VA 1OIOA 1O9ZA
chains in the Genus database with same CATH superfamily
5EF3A 1NCTA 3CXHJ 3BAWA 5LQBH 3RPIA 4JO5A 3K2UH 2AXFB 1MQKH 3H9SB 2MNJB 3U2IA 1ADQL 3EF4A 3IDYB 3QARA 4MD0B 3SDXB 1KJ2B 3V4VB 3VH8B 4AQEA 4XMZA 5A2LH 1EMTL 1YNTA 1PZ5B 4I18B 1JGDB 2CE6A 1PBYA 5JHLL 5B7EA 3MRCA 2GG1A 4QRSA 1HDMB 2P7TB 4Q89A 3EDFA 5I0YA 2KDYA 4D3CL 2AQSA 1XIWC 5KYUA 3BW9B 3VI4A 2VE6A 4G6AD 5GS1B 5MERA 3WIFA 3OC8A 1H3WM 5C09B 4ZMNA 4M8UA 4K9EL 3ABGA 2K3TA 4NZRH 3B8SA 3FUIA 1M9WA 2D9CA 3TF4A 5EG6C 4RWYL 4ZMYA 1P5UB 4A7TA 4KKCC 1BQLL 5EN3A 1BZ8A 1B4JL 5HJDA 2PTUA 1H8SA 1URLA 3AS3A 4NFCA 4ZFZA 2IANA 1BQHG 2VW4A 1OCOB 4IGBD 4JEGB 2VLJD 5DMGC 1QPXA 3CSGA 1G1KA 4HKBA 1UH4A 2OK0H 1RJYB 2WO2B 1GGBL 1W15A 5BO1H 3O6FA 3LKNB 4KX8A 2XOTA 4UM9D 4N87A 4X2UA 5FPIA 3JTSB 4L3CA 5A6IA 1R17A 3MJ7B 2ZKHH 1QASA 2QQNH 1NOAA 1BHGA 2NY4D 2Y3AA 4KK9D 3EO9L 2ZF8A 1U4EA 2H3KA 2XPYA 2ZYSA 4FQIL 3OAYK 4KJPD 1L0YA 1GGYA 3NBNA 5ITBL 4HWEL 4MGXA 4F58L 2O6FA 3GSOA 3RVWD 1JDCA 1ACYH 1BLIA 1GC1L 2BK8A 3KYOB 1KSRA 4XT1C 2R29A 2E7LA 2H2PC 2NY0B 5LCVH 1CIUA 2NYZA 3IFLH 1ZAGA 2D7OA 5GGSY 3OSKA 4QKXB 3BGAA 4F7CA 5J11B 3P0VL 3QEGH 5DVOA 5KYXA 1JNHA 2GSGB 4IU3A 4WGKA 3RHWF 3C08H 1JXFA 3MNWA 1B3IA 1OAUL 4XBGA 4KY1H 1TDQA 1LLAA 3T77A 3WD5L 2VNCA 5D8JH 5B8CC 1NLDL 2FGZA 1L9QA 3GSNL 1NFIB 1U41A 5DT1H 1OQXA 3W9DB 4WQOA 2E7DA 5B7MA 4LPYA 4HZLA 1AH1A 4V2BA 1UQSB 4BKLA 1ZGLB 3B6SB 5CLZA 4OCRH 4P23C 1YNLL 2B5IB 2P80A 1AE6H 4XN2A 1MEXL 1X5GA 5FWQA 2ESVA 1AOHA 3G5VA 1TQTA 1AD9A 1TEFA 1YZZA 2FATH 4KTDH 4B41A 1X5LA 5K9QI 2VWEE 1BVKB 4QRPA 2BFVH 2J21A 3NOIA 4PJXB 4JPVH 2ZWNA 1M7DB 1RJCA 3LPFA 4HEME 1T0MB 4P07A 1EXGA 4L8CA 2X44D 4MA3B 5D7IE 2HP4A 2J72A 3ZE1F 3KL3A 4MAYD 1ZWIB 4RGNB 5EU4A 1OSPH 1PLAA 3R8QA 3VO0A 4F2MA 3EJYC 2PO6B 3FSVA 3VE0B 4G70B 2FWSA 4JBSA 3S8GB 2X7LB 3ESUF 5C0NC 1TJHH 5TQ0L 3KEDA 3HPJB 5DLLA 3LRLA 4XBEH 5AVZB 4KWUA 5CEZE 3OAUL 1BQKA 3W82A 2B4CC 3LIZL 2IWEA 1AI1H 4OTXH 4A6YL 3KBEA 5I8EB 3OPZH 2A5UA 2NSXA 2CIIA 3LQAL 4ELMF 4XNQA 2XWJA 3NIDB 3IS0X 5D1ZC 2V0AA 1YPZF 3VXTA 2G3NA 3K0YA 3ZJAA 3U6XS 3UJJH 5GGVH 3UO8B 1GHFL 2J8UF 1CXIA 4DOHB 1HTYA 1KYDA 3KBHE 4B5EA 2KL6A 3LRKA 4ODTH 1OIOA 3LEVH 5ITFA 5IW1A 1SXNA 1DQMH 2AJ3B 2IC2A 4GNKB 3O41A 5D70H 4HW6A 1FFRA 3CZLA 1SXAA 3SKNB 4ANWA 5DJ0B 4ALAH 2V9RA 5LBSL 2EYTB 2EVFA 3PWVA 3E80A 3OKEA 2AJYL 3R0MA 3NZ8A 2P28B 5FUZH 3L9YA 2Q8BH 1OPGL 4OZIB 1BQHB 2A6IB 1IAKA 3HAEA 5DLML 5FKPB 1I8LA 4IGBA 3IMTA 1L6PA 3WNNA 2IPKB 4V33A 2VLJA 3L9RA 3QPXL 4LQ1A 1S7UA 4GXVL 5GJTH 4L9LA 1WA0X 5I6KA 1H3TA 3RWIB 2F58L 4HGKC 4MB5A 2R1YB 3K5RA 4UM9A 4WI0B 5CEZL 4AV0A 4XI5D 3DSFH 3Q2VA 1HZHL 5D4HA 1SEQH 3L5HA 4LCCC 3P9MB 4OLUH 1WEJH 5E0QA 3FT2B 3JV5A 4D0DA 3V6OC 3BUDA 3S48A 1J1OL 3BUIA 1NQBA 3M1CA 2R59A 2LAAA 3WE6B 5I19H 4UNUA 1LEKA 2FRGP 4MMYB 2P1YA 1V05A 4LSVH 5D6DC 1WFTA 1SJXA 2FT6A 4Q4IA 2R1XA 3PAVA 2PCPB 3V4PA 3L5JA 1LK3L 4FQLH 5IB1A 1WZMA 1E0OB 4XWOD 3U4BH 5AW2B 4R7VA 1WC7A 3MRBB 3WDJA 3MJ9L 5CD3A 3GMMA 4H4NA 2WQVA 2LU3A 4U6VH 1S7RB 2WTPA 1MDAA 4HQQL 3B34A 2IG2H 3OHXA 1WIOA 5BMFH 3OV6A 2GI7A 2X2HA 2LVCA 4TUUA 4YDZA 3FB8B 1FUNA 1F97A 4L29B 5BOZG 4FABH 2PP8A 2IDSA 4U1HA 1JHTA 2BJML 2N59A 3IDJA 2WSKA 2HFEA 1SDDA 1UWFA 3AXHA 2B77A 3LVTA 1ED3B 1XMWA 1I7UA 1EFXB 5K9JH 1CU4H 3VQ2C 1RXLA 4N24A 5I6NA 3IJSA 4LPVA 2Z91A 4AENB 3D0VA 2HFGL 1F3DH 2B3IA 2HH0H 2KZBA 2GSIA 3HB3C 3QCVH 5E08L 1WIUA 2OMYB 2OP4H 4Z7AA 4KVCL 3GMNB 2P8MA 4MS8C 2XNAA 1H5BC 4EI5B 1FCCA 1XB6A 5C08B 1W8EA 4MXWH 4MAYA 1YEKH 1FDLL 1SJVA 3GB7A 3LKOA 2IV8A 5H8DA 4EIGB 4F8NA 3RUGA 2FQGA 5EUOF 1Z6JT 4BGLA 3UTPD 5CKAA 4P4KD 2DQMA 4DZ8A 2VC2H 4OAWA 2IDTA 3GDBA 5E24E 2JJUA 3V0GA 2B59B 4UT9A 5FUCE 5K1JA 2ZOUA 2NTSP 3QH3B 3SBPA 3U0PA 1A8ZA 2NNAA 4XMTA 3QJFA 3OVUB 3ZTDC 1U8LA 3QJHA 5BOJA 2BY0A 1JHKL 4Q9QH 3EOYG 4XP6H 1XD1A 4H8QA 2G2RA 4ERSL 1JF5A 1RIHH 2ZSVB 4H40A 3BPNC 4M7JH 5BV7H 3JT0A 3NRFA 1OAXL 1MWAB 2BSBA 1N3NB 1CYWA 4OJEH 2V9TA 3RP1A 3HZ3A 4JQIL 2DIJA 5J12C 1KCRL 2ZAIA 2IGLA 5H37G 1XGYL 4UQ3B 3TBCA 3VI3B 3AAZA 2GB2A 3IJ8A 4IRSC 3UYOD 4AQZA 5FF6A 2OAAA 1ZDSA 1O6VA 1UB6B 5FXCH 4DTGL 3O9WB 2PR4L 3O8XD 3QEQD 3DXAE 2B2XL 3EJTA 3RVXC 3QRLA 2DM2A 4TTDC 2AQPA 1D2PA 3D2UD 1WP6A 2GK0B 2GJPA 4PCTA 4WSGA 3IN0A 1J5OL 1BWMA 3ARBD 4X5WB 4I48A 5IEKB 2F1AA 5BO0D 1EV2E 2NY1D 2E9IA 3BN9C 2GTWB 1G7PB 3FZUC 4BWWA 2AQNA 5ESAA 5B38B 1MELA 2LVEA 3TWCH 3HZYB 2IH1A 5CGTA 4N2DA 3GSXB 1RZIA 2DQUH 4PG2A 2CXGA 4KHXL 2X40A 4YUEH 4DGUA 4YXLH 4PI0A 2YBRA 1WISA 5ERWB 4R4NC 3HZKA 5ICZA 4IRZH 1G9HA 3KYKL 4QNPE 4NNXB 1B0GB 4BZYA 3QAZC 1IGTB 2AAVA 3D0LB 3DOIA 3GRWA 4P8QA 4Q9RH 1NDGB 4CJ1A 3QNZB 4JO8A 3ZDYE 4DVBA 3DGGA 2XETA 1KIPA 3QXAB 1G7HA 1FAIH 1F4YH 5I66A 1P5VA 2W59A 1MF2L 2FH6A 4HCRL 4IJ3C 4K9JA 2XWTA 1D9KB 1INQB 4CU8A 2OJEA 5DI8A 2RBLA 3WMSA 3F7PC 4Z77A 1LNUB 4ZZFA 4NIYE 2OMTB 4M6OH 3N85L 5IB3A 2XIDA 4WW2B 4FP8L 3GXFA 1NEZG 2XN1A 3G6JF 4S1RL 5KSBA 4UINH 2DQIH 2H7WA 3GSRB 4G80B 1KTKE 4AYMC 4NUMA 5KJ4A 1QAWA 1OE2A 3FPXA 5CD5D 2EE3A 3GSUB 4C4KO 2VN5A 2H6PA 3RIFF 1TZHA 1WUNT 1J0ZA 1DVFD 2VQ4A 4KHTL 3QO1A 3W2DL 2VOTA 4AYFB 3MXVL 4YGAB 5J1SC 1J5HA 4KZCA 3FHQA 1OP3K 3UP6A 2VDOL 3QG7H 4LB8A 5IWLA 1K3ZA 3QUML 3TO4D 4BK5C 4JVUA 1GA2A 4PVLA 5CP3H 2B0SH 4L3EB 1MIEH 4X6FB 4W9KC 4HJSA 2WD0A 2Q5BA 5F9JB 3IAPA 2VDLL 1MVUB 1AIFB 4JZJC 4JRYB 3GZKA 1V55B 1ORQA 4NRYA 4P4KA 4ANXA 1ZT1A 4ELDA 1IMHC 1KTDB 4RMRA 1UZ8B 3ABKB 5LKNA 3LZPA 4IBLT 1GY1A 4W9LC 2CGZA 2D3LA 4HULB 4JFTA 5KG9B 5T1JA 3KPNA 1G43A 5GSVA 5KVGE 3QO0A 4I9WD 4K5NA 4FFTA 32C2A 2YA2A 3QA3B 4FHKA 1CLZH 1IFHH 3ORJA 3AU1B 3VWJD 1VGEH 1E42A 4ZX3A 4XOCA 1UA7A 2E7BA 3RHWK 5BZZA 1MI5B 4L5FL 2VDRB 2B1OA 1JFQH 1G7LB 3UZVA 3B2MA 5HI4C 2NUPB 2YKKA 3TN0B 2Q8AL 5E23A 1ZIBA 2YKLL 3O8XA 4HD9A 3QEQA 1OGPA 3MFGB 4UQ2A 1K4CB 4KKBC 3DROB 2VJXA 2XVGA 1I1RA 3GFUA 4PLNC 3D2UA 1UWYA 2LR4A 2ITEA 2WWMC 1TTGA 5DUPH 4LSRH 3ARBA 2QSCL 5F7DA 3K71A 5KANI 5CCHE 1LO5A 2H6UA 3N9GH 5EDXA 1KIQA 1Z9SB 2TRHA 3B1TA 4AEFA 3LN5B 1YAZA 3VG0L 2FH8A 1JWSA 1KLFB 2VXTH 4FNRA 2IGFL 4P59L 5KVGL 2EUVA 2OTWB 4PREA 2HJKB 2BVPB 1OALA 4PW9A 1NAMH 2XA8H 1ZMYA 5EMYA 4YXKH 4TSCL 1MW1A 3AG3B 1OK0A 3MRCB 4AGPA 3QQ4A 2E46A 2K0RA 1MHCB 2WTRA 1ZV9A 3NMEA 4IBTA 5KYUB 2OMZB 3LZNA 4JS7A 4Z1PA 4ZMAT 3OM3B 4LDLB 3FU6A 1BIHA 3SJVE 1U93A 1U8MA 1D6VH 4LIQH 4F1ZA 3TESA 4K3DH 3QQNA 4BIKA 1OM3L 1QRNE 3C9NB 4E5XG 2B1HH 2ERJB 4XXDA 5IJVB 1U30A 1C7SA 1NCWL 1F11A 2DQTH 4WTZA 5E95B 1CTMA 2W65A 4YNYA 1VERA 1OSYA 2XFXA 5SX4H 3FQ1A 3ARZA 4FI8A 3OKLA 4HPHA 4HKBB 3ZXAC 4ZT1A 2VRKA 2E27L 1HINH 5F21B 5IIEA 1XSKA 3OJ2C 3O6FB 5IFHL 3QYMA 3STZA 1R34A 2V2WA 2WXQA 2APSA 2J12B 4LEEA 3ALPA 3MLXH 4L3CB 5HJ3B 5AQ0A 1S7VA 4MX7B 3V52H 3MN8A 1DVFA 4NFDA 2YGOA 4N90E 5ETUA 3QFJB 3M1BA 4M3JA 4M4PA 4M29A 4GKNA 1TFPA 2WIMA 5E6YA 2IXQA 1IC7H 2CKNA 1KELL 2Z93A 1XGZA 3JV6A 4K3GA 4OGYL 4YHNA 5FS5A 3V4VH 1I85C 2CUIA 2Y7LA 4P9HC 1KJ2H 2DM7A 2JB6A 3QWQB 4JKWA 1EHXA 4RMBA 1YC7A 5CUSH 1J86A 1HXMA 4KFZC 4AKQA 5JW3H 2XQ0A 1IGIL 1FFPA 4UTAH 4FI6A 3IDGA 1JPSL 4HISA 2FNBA 4GXFA 2JELH 2BVQA 2X4TA 3P30H 3FU5A 2W88A 3PDGA 4IU3B 3DYOA 2W9DL 1H3XA 4GBXC 2H41A 4Z7WB 3MGOB 5DF0A 3S8WA 2XWDA 5LWYH 2JNZA 4RNRA 3T0ED 4AV4A 2IALA 5GS2D 1BZEA 2X4RA 3WIHH 1UA6L 3VXNB 3GTNA 3LS4H 3K0WA 5DQDL 3VWJA 1KOAA 4MQXC 4ZYKA 1NMCB 3RA7H 3WCYA 1ANUA 3X3FH 3SIKA 4BKLB 2E5EA 1WDAA 4K3HA 4YSOA 1YEJH 3GQFA 1TTRA 4GW1A 2I26N 4Z7OF 1ET8A 1OTUC 1GPOH 2ZP8A 4D9QE 5DCCA 4DETA 1AD9B 1ONQA 4R97B 4XGZB 1W72L 2I5YL 1IGJB 2VLKD 2GEQA 1DJYA 2X4PA 4H13C 4QRPB 3OJMB 5FIEA 2CDGB 1PU0A 4N22A 1I82A 1CIDA 5C2UB 3ESNA 1JXJA 2IPTH 2JE8A 3LH8A 1JGUL 2OMWB 4OB5H 1VFBA 3EH4B 1NSNL 4HBQA 2AEOA 1OL0A 4HIEA 4LCYA 2WBKA 1DVZA 3C2AH 1RQ5A 3FRPG 4NNYA 5EU4B 3BWUF 4LSPH 3SE9L 2HJLB 4E41D 3NRPA 1K6QL 2BOCB 2P43B 5DUML 1QUNA 3TJEH 3E8UH 1U3JA 3UG5A 4NFBA 1X5AA 3ARGD 3U0WL 2FIRT 5HGBB 1WAEA 2YRLA 1SLUA 3ET9F 2I07A 2CMRL 4IMKC 3BRGC 3NPSB 2X09A 4OFYD 4PPTA 4PBWD 4U4IA 3LRHA 1ROCA 4QDGA 2OXHA 5I5JA 4K5OA 4E9VA 1AQMA 3RVTC 3VXTB 5DJ8B 4AIOA 3AWFA 5EB9A 4MDJB 5I0VA 2VN7A 4BQCA 1JXDA 1UD3A 4NX0A 1G9ML 3WNPA 5F7KC 1Q9OA 2VDKL 1DBAH 1A25A 3CV5A 5I1IL 1HWHB 2WAQA 2C8NA 4FJYA 4NJAL 3V5KB 3G6DL 4KK6C 3WTWA 3CFJB 4L8SA 4E5XB 3IU3A 5LBGA 3MZTA 4MTMA 4WDIB 3BVWA 3PWVB 2H47C 3OKEB 1TR7A 4M43L 3M17B 1BZ7A 3NZ8B 1BAWA 4EN3D 1A3LH 4J3OD 5LNEA 3HAEB 4XODA 1KZQA 1SBSL 5HYSG 4IGBB 1T1YA 4LCWE 1SGKA 1S7UB 4G82A 4Y9FA 3G04B 1A6TB 4AEHL 2Y6SC 5E7BA 1FFTB 4DUWA 3NFPB 4I89A 4XRCA 1OW0A 2KYIA 4DO5A 5I5IA 5CF3A 1RY7B 4N8VG 4OIFA 4FG6C 2HX9A 3IKCA 3RNQB 4FGMA 3JV0A 4XWGL 3DNKA 1XF1A 4TVPD 1RSFA 1E9OA 4DKAA 1A4KB 4IIQC 5IMLA 4D0DB 5IVXA 4UT7H 2WXNA 2R8SH 1ZT7A 2I7SA 3C5ZD 3KM2A 1BFVH 5BRQA 1GAFL 4S2SA 1YYMH 2VMCA 3AY2A 4PSPA 5AAWA 3V6BR 1JGVL 1WGVA 4U1NA 5A6LA 1YMMD 3NZHL 2DLFH 3SZ6A 3T3ME 3TTSA 3PGFL 4GT7A 5DJCA 4K7FB 1N7ML 5KW9H 4OUUA 4JLRA 5IHZB 4WIQA 2JI2A 2CZNA 5DR5L 4M6NL 3WFCH 3GMMB 1X7SA 3N04A 3T0EA 1H0DA 3CFNA 4GO6B 2K7QA 3ZDZB 5KBDA 5JTWA 4XXWA 1MREL 2EE2A 3A22A 4G8IA 1ZDQA 4S0HA 1OARL 4O2EA 1U95A 4G6ML 4LGSB 1SMDA 3D34A 5I0ZA 4U1HB 2NSMA 1F4WH 3H3KA 4XZ4A 2HFEB 4LHJB 1SDDB 1UT9A 1MY7A 4JHWH 3SGDH 3TVMD 1MCFA 3DX4A 3L5XL 3MACH 1H6EA 2WBXA 1SEBA 2G5UA 3IJSB 4JX0A 2FWLB 4C54A 3MNZA 2VLKA 5KVDE 2KZWA 1WVZA 2GSIB 3FUEA 2VMEA 3X1NA 2A9DA 3VFVB 3A4DA 1USZA 3FUJA 4MAUL 1IAOB 1WITA 3QDHA 4JO2L 5ESQA 4JDEB 1A4JB 2W0PA 2XNAB 4N0CD 5D5ME 2IFGA 4DWHA 5H94A 3TNMA 1OZUA 2A9CA 4MAYB 4OT1L 3RIFK 1X5MA 4E41A 3FYEB 2YRZA 1CGSH 4JFDE 3NEOA 4ADIA 1OAJA 1EGJA 3F58H 5EZIL 3BDYL 4MJJA 3ARGA 3GSVA 4AG4H 2YMTA 3H4HA 1EZVY 1KB3A 1X7QA 1J05B 3L3OC 2NYYD 3X12B 2VXQL 5K9OA 1GZHC 4PJAA 3MCG1 2BXZA 4OFYA 3B56A 4X83A 1DN2A 4L4TD 3GNML 1CDBA 2CK2A 5E4EC 1A7OL 1YUHA 2X53A 1U8LB 1WFIA 3QJHB 4QRQA 3WL9B 4AQAB 4GO8A 4RDBA 2J1ZA 3V0EA 2WYTA 1AFVH 4ZS6D 2G2RB 4K5PA 2KQNA 3W0WE 3ARDD 1P9MA 3AB0B 2WM0A 4M4RA 2FYYB 5HDBF 1LEGA 3K6OA 1VADA 4MNGB 2NZ9D 1ZLUH 3KPRB 4PJHE 5GZND 3DYPA 3GBLA 2EC8A 3AAZB 4X9YA 3PHOB 3VXUD 5KVDL 3ZGIA 4KJQD 3VXMB 2J88L 3Q1SL 4WNSA 5E7FA 4AVHA 5AW1B 3EHBD 1AYOA 4F33B 3NFSH 3VTMA 5CN3A 3BXNA 4PWEA 3N44F 1N2RA 2VXSL 3N40P 3P3SA 5IBUG 2ATPB 4EN3A 3HJEA 5HYSB 1QO3A 4G8AC 4R7DA 5HD8C 4ZMPA 1JNLH 3QUYC 1G0YR 3MV9E 3MLYH 3BRDA 5CZVH 1CI5A 3BUQA 2FEDC 5IY5B 4I48B 3BPOC 4DKEL 4MCMA 3HE6C 1AP2A 4N8VB 3LVEA 5HHVH 3NT0A 1N4XL 2XG4B 1K4DB 5CJXA 25C8H 1I8IA 5DK2A 1S9WA 1FGNH 5D4JA 4ZTPH 1G1OA 5F72S 2CJTA 3HG1E 4XB7A 2I69A 3LRMA 4Z76A 4PSRA 1IL1A 2J71A 2OMVA 4YDLC 4QJ3B 3C5ZA 5TE4L 2V9UA 1XAKA 2RTTA 3FN3A 1KJ3H 5FW7A 2WZ6A 5ICZB 1YMMA 3GXNA 1A02N 2L7EA 1JRHH 4ENZA 4MQSB 4A1RA 4X9FA 4TQEH 5KBLA 5IW3A 3RTLA 4NERA 3K2IA 4XMWA 3G5WA 1MWAH 4DN3L 3DGGB 1PG7X 2FLRT 3HRZA 1KIPB 5I76B 5BOPA 1I3GL 1T83C 3CZKA 5KYWA 5KSUB 3A6BH 2B4CL 4PJDE 3WXVL 4D7PA 3NTCL 2XWTB 3QQ9C 1CL7L 3G6AB 1YRKA 1M7XA 2OJEB 4D0CB 4Z0XB 5JA8B 2YPLB 3V6OE 4P2YA 5IT2L 3SQOL 5EEVA 3QJQB 4Z77B 3B2VH 3MU3A 4YDVB 5JORA 2Z8RA 2F19L 2IF7A 2PYFA 4POUB 3KR3H 3VXRD 1NM4A 3PL6D 1V3LA 4RCAA 4UV4L 4K71C 2J6EA 3HFML 1T21B 4Q0XL 1YN7A 3TA3D 3TVMA 3ARQA 3CVHL 3F6LA 4UQ9A 3PREA 4Y8DC 4X6CF 5LAXA 3ZKNC 5CM1A 1V10A 4HWBL 3VSQA 4OF3A 5TDNA 1KUMA 1U8QA 4HA1A 3V4UL 4OZGB 1NFDE 3B2XA 1MJUH 4KO7A 4LOVA 5FO2A 2E0PA 2QKIC 1MW2A 3FFCB 4XH2A 4LLWB 3FSAA 4PJEE 4FADA 2Q6WA 4HJUA 3MREA 2G3XA 3AT8A 1BBJA 2PKDA 4P4KB 4PJGB 5EPMA 1Q90A 2A9AA 1SFHA 4TULL 2ZONA 2P4AB 3L3IA 2VERA 2YD7A 4MHHI 4R9HA 4HCFA 2WVSA 4MD5A 4XZUB 4TVUA 4AWJC 4L4TA 1KTLB 3BGFC 3DPBB 3O3AB 4ZAKC 4R5TA 1AVAA 5HDWA 2FD6L 3J8F7 2ICEB 3QCUL 4M7ZB 5KBKA 3FU7B 3BPCA 4QTHA 4KVNH 3LZRA 4X7FC 2HT2D 2XQYK 3GWJA 3ARDA 5DRXA 5KWYC 1OANA 5HYJB 1ZEAH 2EZ0D 4MKMA 1QLEB 4Y5VC 4BQ9A 3BE1H 1FNAA 1PLGL 5GZNA 3L3GA 3D8MA 3VXUA 3BYTA 3VD3A 4KZDH 4JFYB 1YYLL 4HIPA 3CLEL 5F93C 1ZS8B 2ZPKH 1I3UA 3QEQB 1CICC 4G5ZL 4PJIA 1SXZA 2Y2WA 5IBUB 3RWGB 3INUH 5SWSB 2C7UA 3BH8A 2HRPL 3Q3GA 5GRYA 2IDCA 3MUJA 4G9FE 1UM4L 5I71B 3WTYA 3D2UB 4AVIA 1F8TL 5HVFB 4HIXL 1YEDB 5JHDE 2X3AA 3BAXA 4RSVA 4NM8H 4TMPA 3RWEB 4GUOA 1U3HC 5F7DB 3TX4A 2NY1B 2V5MA 1EBPA 1LO5B 3HC4L 1KIQB 2QMJA 4ORGA 1E8XA 4JM2D 4MD4A 1CURA 3ULVH 3WFEL 1A6UL 1QTYT 1JNNL 3EFDL 4GP4B 2C5DC 5CJOL 3HNSL 4HYTB 3FT3A 5JXAL 3PYCA 4LVOB 1OHZA 3B43A 2BZ7A 1CFMA 3QI9C 2EXWC 1ETZB 3QQXA 4PJBF 4ZSOE 5D1QE 4DT2A 4EIZC 3CU1A 5AVQB 3K4ZA 1AZVA 2D4FA 1J0IA 3SSGA 5BZDA 3GUTA 3IF1B 1B4TA 1Q0YL 4JFOB 2ZWZA 5DO8A 3ZTJH 3FO9A 2VERN 2Q7NA 3PDOA 5IF0B 1RHHA 4O4YH 1JZIA 3WNLA 2G4GA 4B50A 1UB5B 2XHNA 2ZX7A 2WTRB 3HA0A 3TPKA 1J9RA 4GW5B 1I1AC 2JLLA 5HVHB 3VMPA 4TUOB 5KS9E 2D0HA 2AQTA 2P5EB 4LL1A 1HH6A 1QI3A 2D31B 3PXHA 5H37H 4Z3GA 4NBZB 2VDRH 1F42A 2VAAA 5GRJH 4H1LG 1MJ7H 3MCKA 3WJMA 3GO1H 3VXOA 1M3IA 4LSUH 2XACC 3WUWG 4OZ4B 3LHPL 1F11B 1ACZA 5D2LE 4YNYB 1EJFA 1O5DT 2QKSA 3QAQA 3WS6A 4LDOB 2P46B 3OKLB 5EN2A 2NXYC 3VXRA 3FQNA 1WA2X 4P57A 1LO0L 2OCJA 3PL6A 3NJNA 4XCCL 3TEXA 2ISDA 5IIEB 4KH2A 2EH8H 3RZCB 3TA3A 4HF5L 2V2WB 1DQLH 3SE8H 4K94H 4XX5A 4LLUA 4JQXA 3CFTA 6PAZA 2X1PA 1Q1JL 3DUHA 4B9KC 2YGPA 1E9QA 2HRHA 3BSZL 1WFOA 1RUQH 5ETUB 3T0WA 1P69B 3HMWH 3M1BB 4HUKB 1EPFA 2EDQA 4GKNB 4Y16C 5L4IA 1S9XA 2Y2TA 3MV8E 4GMTH 1NINA 2AABL 2IXQB 2Z93B 5E2WL 3TO4B 5A2CA 2YA1A 3CZSA 2CKBA 2JTDA 3L16A 4NCC2 2NZIA 3G5XB 5ABZA 3MUHL 1TTFA 3K80A 3HCVA 2DDQH 1XZWA 2WQWA 2BVQB 4PTTB 2WQXA 4OLYH 4F93B 4L8DB 1DQTA 1OCZB 2XWCA 4PB9H 3C6LD 1EBAA 1A14L 2IALB 1MRCL 2X4UB 1PYWA 2VN4A 4NLAA 1YY9C 1JWMA 4N26A 3H4FA 2BIQA 1P1VA 5HYIA 2F53D 1PLCA 4R3SA 3GHBH 3TTYA 4ZYKB 1UACL 5E1AA 1G6RB 1T2XA 4JPWL 1GGTA 4CSSA 5G4MA 5C7XL 4Y4FD 1VEPA 1H3VA 4KK8C 4P2AA 5D7JD 1UWGH 5D72H 3KLHC 3HS0B 3S4SA 2HLFC 3QJRB 1JN6A 1QHPA 5AZUA 2W5PA 3V5DB 4XN4A 4ZO7A 1R3HA 5CAYB 1MJ8L 1ONQB 3T5WA 1E6OL 3PP4L 3S35H 4OBSA 3VWKD 1HL5A 1SBBA 4OZFA 2XKNA 1JTOA 4JR9H 4LLVA 2AEWA 2UWEA 4PRHE 3GC3A 2LLGA 5BUPA 3T65B 1JPFB 2P24A 3LS5L 1VFBB 4B97A 1SF5A 4DN4L 4LCYB 4AGMA 1D5BB 1Z3GH 1KCSL 3WMQA 4L0YA 1OAZH 4HIQA 3U36B 3UPAA 2FX7L 1OVZA 1QUNB 4PJ5B 3ZKQD 3HZMA 4LVNB 5T33H 3OXRA 4JM2A 1AG6A 3FUMA 3EJZD 4FQXD 1I8KB 3EGXA 4YSUA 1L7IH 5DJ2A 3WN5C 3DK0A 3WNOA 2BOBA 1S7XA 2R0KH 2NT1A 3ASNB 2AV7B 2OXHB 1EEZA 2NY6B 1KGUA 1NCIA 4PD4J 2XN9B 2ZYRA 3RX8A 3X3GH 5F3HB 5C07E 2WANA 3ABLB 4N3TA 3HW7A 4F2EA 5JYLA 3C75A 5CSZA 2VR9A 1IGFL 5FM5O 4NN7C 5IQMA 2ROYA 1E50A 1JZEA 5JO5B 1NLBL 1EEQA 3IVKB 4BINA 3PNRB 1G0DA 1IO4C 2YXWA 4L8SB 1C08A 2OR8A 3IU3B 3TBSB 3DMMC 4GRLB 2DMHA 4YE0A 1HSAA 3AACA 3SGJC 4HOWA 3BKMH 4NXKA 2XWZA 1BZ7B 1E5UI 2WINB 1HX0A 5T3ZE 5LXGL 2DBJA 4NC1C 1EK3A 5HHQB 1KTBA 1RIUH 1T1YB 5F7EH 3G7TA 3SYQA 1WS7A 5ANME 3QZBA 3TBVA 5A2BA 4Y1AB 3UBXG 3N6YA 2A9BA 2DQHH 4XRCB 2ATKB 5AWNH 4PLKD 4GKZB 2F7OA 1NBQA 2V5YA 1A5FL 1FZKB 4KZ0A 4ZNEE 1JWUB 3TT3H 4APQC 2I24N 1QZ1A 2XQBL 1E9OB 5IMLB 2F5AH 4G43A 1T1ZB 1XSJA 3UAJD 2XFGB 2X87A 2F54E 5T5FA 5ADOL 5J5EA 3B7SA 1HOCA 5TF1H 4FEIA 2PTVA 4AEIH 1X7TA 5FDWA 4DGIH 4HIJB 5D9SB 2W92A 5DJCB 5CLWA 1TTCA 3LNDA 3BD3A 2EEDA 3R1GL 4CN4A 1XVSA 3SY0A 2IAAC 3IT8D 3K8LA 3MAWA 3C6LA 1SLWA 3I6KA 2XG5A 3T0EB 1P4IL 5T3ZL 4NQVA 5L2KB 2F53A 1RIVL 3OJDB 5ISZE 4AZ8A 1CZ8H 1EDQA 5I5RA 1CDCA 1AJ7H 4JDZA 4O2EB 2W9EL 3HLAA 4WV1B 3HAEH 4Y4FA 2H1PH 3MLVL 1J48A 1VCBC 5E5MB 4XNZB 5D7JA 3MBXH 4DGVL 4UTBH 4NP4L 4UAOB 1CFBA 1CFSA 4KVPA 2EYSA 2CO6A 4ONFH 4XCEB 4RZKA 1LILA 3BKJL 3VWKA 4KXBA 4N28A 4KX9A 3WSQL 4FRWA 1LO4L 1CD0A 2WQ8A 2ZUQB 4H25A 4I0PB 4MXQD 5AOMA 4W6XB 2I9TA 4JB9H 1AZRA 1HS6A 2J1XA 5DC0A 2Z35A 3T1FA 5H94B 3TNMB 1FNGB 1S4IA 4XP1H 3EO1A 5D2NE 5TFSH 4L1LA 4E41B 4JO1H 4FKHA 1IAMA 1WBXA 3Q8BA 3ZU8A 3MRLA 3S88L 2K78A 3UYRL 3Q01A 4YAQA 4AXWA 3ARGB 3GSVB 4FQXA 4JW3A 5DRWA 3B83A 1KPVB 1X7QB 3L1OH 1XSOA 3UC0H 1D5IH 4Z3IA 3FMGL 3GI9L 2BMKA 1FVEB 5DS8A 5K9OB 1IEBB 2CO4A 2PP7A 1PFCA 4FX5A 2AKRA 3JWOH 2FSEB 2OS7A 1CDYA 4KMLB 4P9HL 3CFCH 4HPOL 1KXHA 1CGTA 4IKKA 5INCA 3RI5F 3A47A 4RGMC 3UABA 4M4RB 2WXGA 2NX5B 5I75C 1O0VA 2FJFA 1LEGB 1XT5A 2YD2A 4UOJA 2BNQD 5IROD 2ADFH 5I1JH 3IJ9A 3QZOA 4N2EA 4YDIH 4LQFH 3ZE0E 3JTBA 5ENWA 4G8FA 1AQ8A 2V4LA 4MQ7B 3CVIL 3RDTC 3KCWA 12E8L 1N2RB 3DVIA 4X7TA 4LRIA 1FL5A 1XSIA 4R7DB 3PV7A 4N0FA 1T0NA 1GYCA 2AJUH 3I84A 4NZUH 1MSPA 1NGPL 4FQJH 3B9KC 5DEGB 5AYUL 5FWRA 3UBXB 5AFAA 1G7JA 1YC8A 2VUOA 4P99A 3TJPA 2UZXA 4X42A 1RZPA 4Z5RB 4KUZH 3CC1A 2X9ZA 3VDCA 4WTXA 4KY1L 2QR0A 2VISA 1LWJA 1I8IB 4GQPH 5DK2B 1S9WB 5DT1L 1E4WH 3GYRA 4JG1L 5CCGE 1EHLL 1OOAA 4GAFB 4HCGA 4Z76B 2D2CC 3C5ZB 3UAJA 3N41B 4HC1A 2GJ6D 5KN5A 4HD5A 4OV6F 1P7QD 4XHJC 1NIFA 3S8FB 4XVSH 2QADD 1ZLWH 5CNHA 1JGEB 2D3VA 4LFHD 3ZYOA 3QRGL 2ZG1A 2AEPH 5C0EB 4GLRH 3CFEA 4TLUA 4CVXB 3S37H 3RLSA 5M7QA 2FATL 2X9YA 6FABH 2CLVA 1EEYA 2BFVL 5E6RB 1AZUA 4JPVL 4LSTL 3QIUB 4KXZI 1WAAA 3GSNB 2Z6FA 4AI7A 4EVNB 1YYCA 1EXUB 3SDAC 3VFUB 5ACZA 2H5UA 3HEIB 2P5WD 3QDMD 4IU2B 3VQ1C 1E5CA 3SDYL 3WUZA 4PWFA 1MNUH 5D96B 5ECGA 5JORB 1MIML 1RPKA 3MC0A 2VXUL 4ADGA 1TJHL 4GKOA 3TBWA 4J39A 3A4EA 1ZS2A 2X12A 1CYXA 4NKMB 4OCSH 4RFNC 1CBVL 3FT4A 4YX2L 4PJHF 2WB1A 1E3FA 1AGEA 3OKDB 1AI1L 1VF5C 4GP5B 3ZMRA 1QW9A 1DSFL 3TC9A 3VGAC 1U8QB 2FCBA 3H0TB 1YEIH 4GQ9H 1BXXA 4DP5X 2ZOKB 4N5ED 3MODH 1VJSA 4GOSA 5DMGD 1LGVA 2F0CA 2WIIB 3HRPA 4XH2B 3SYPA 4X6BB 5AW6B 3RGVC 3ZL4L 3VGBA 3S34H 3MREB 4K8RD 4PS4H 4YE4H 1SOSA 1XR8B 4ODTL 2X6VA 4Y2LA 3KH4A 1EO8H 1P7KA 2COVD 2PR9A 1ZVSA 1DQML 2D3JA 4R2GB 3FRUA 5D70L 2Q3AA 4X6DE 4ZD3L 4ZG1A 2DL2A 3GRWH 1J8HD 4BZ1L 2QTVA 2A2QT 3BD4A 5B3NA 4GSXA 2Y22A 4KRPB 2DWYA 3CDZB 3MRRB 4JGMA 4PRNA 3LNIA 1MFCL 4Q6IC 4A6YB 2EABA 1UKTA 4K3EL 4GXUN 1EHKB 4MD5B 3L6FB 4PGEA 5E9DE 3L2MA 3U4EB 2EILB 3X14A 1MRFH 3D07A 3LQZA 3T0BA 2UY7A 2G9KA 1MLCB 4FMFA 3T6ZA 1E4XI 1FHNA 1HHGA 2H2PD 1T22B 3X1GA 2WV3A 1VGKB 4HU8A 3SBQA 2JIXD 3EF7A 2FEEL 5BZXA 2Y06H 4HWUA 2RQ8A 4WEEA 2BNQA 5IROA 1SEQL 1S7QB 3BZ4A 3UADA 2QGEA 3VXUB 1WEJL 2AJXL 3HC0A 1QA9A 1MDTA 1PCSA 3V0JA 3E6HB 2HMIC 3SBRA 5D7IB 3UAAA 1WD8A 3QPQD 3BQUB 3VFNB 1TUPA 4PJIB 4P2QD 3UGEA 1BIIA 5DMYA 5JHMA 4GG6E 1KJVA 2C26A 3ARUA 3Q3GB 4JREC 4MDRA 4HJGA 3SKJH 3L4ZA 1MFVA 3BYYA 4JFFD 1XZ0A 4DQOH 4O51B 5T1KB 1HCFX 4IOSD 4F15B 1M05A 4Z18A 2Q3ZA 5GZOC 4GH7B 1FORH 4TSBH 1Z0NA 1N26A 4YHLL 2VM3A 2NR6C 3BEWA 5JMRA 1M3JA 1BOGA 4U6VL 3KLLA 1OPOA 3U1SL 2J3SA 4YSCA 3IFOA 3QUKB 2YWYA 4TNVF 4F3FB 5A40E 2RCSL 4EBQL 1JFHA 1MCCA 5EZLB 3O4OB 1YNKH 1UWEH 3O4LE 5BS0E 4ZOBA 2K9UA 3ESOA 2E9GA 3GJFB 4HPYL 3S3PA 3KLSA 3GUTB 2GJ6A 3QIBC 1IC4H 4AX3A 1P7QA 3EJYD 3KYAA 5AAMC 4KO5A 4XPAH 4NIKB 2YN3A 3KLQA 1KFAH 1NL0H 4Z95L 1UZ6E 1ZVHA 5EIIB 4J8RB 4KC3B 4KJYB 1KB5L 1QLEH 2M26A 1HH6B 1QI5A 3LH9A 3U0TA 3RIAF 2WXHA 4CA4A 1FRGH 4OLXL 3WAKA 3WJMB 2J2ZB 3UL4A 3M8OL 1IGCH 4L8BB 1JZGA 4HWZA 4MA1C 3VXOB 2P5WA 3QDMA 3FAXA 4POZC 1OK8A 4QRAA 3VRJB 1R19A 3ZYIA 4AMXA 3VFRA 4GMSL 1JPST 2OYMA 4OSUL 4F7MA 2JMRA 3FQNB 1KN4H 1U8IB 3ESPA 1RP8A 3BH9A 2QVTA 3HHSA 1EHNA 3SN6N 4AYGA 1PEWA 3HC3H 4NO5B 4QXWA 5CCJA 4NHCL 3I9AA 1M57B 4NKQB 2Y9RT 4DPBX 5IJKA 1DFBH 1Y6KR 2EDFA 1E9QB 2LABA 4FMKA 4GRWF 3F6IA 5LBVA 3PWUA 4RFOH 1I8MB 4Q9QL 5HYFA 3KAAA 1A0QH 1S9XB 4FLRA 3SKUD 2AFNA 3OR7B 5BPPA 3FH5A 2KZ1B 5ESVA 3B9VA 2XWXA 4XPTL 3ZDWA 2WXKA 1ZT4A 3L9EA 2CKBB 3INOA 2O30A 4WUUD 5CCKL 3OMZA 3BVUA 3FSOA 1BYOA 3L95A 1TOXA 4KI5C 3HCVB 1I31A 3MGTB 1PG7H 3SDCD 4DP6X 4QYAA 1J8HA 1SYVB 4KQ3L 1T1XA 1JYVA 2XXGA 5JW4M 2BSSA 2JKNA 3D06A 1EO7A 1QSED 2J25A 1PYWB 4WU7A 1JWMB 4X4XB 5DC4B 4P2RE 3AGWA 5E6UB 4FNLL 2OULB 1F45A 3UTSE 3CHOA 4RBPH 3OC5A 4IHOA 3KPLB 3EFOA 4NAJA 3VCLA 5F9WB 5C0DA 3KDMA 2FJHA 2JIXA 3CFUA 4P3CH 3APDA 4A7UA 3EOAB 4MMXA 3S4SB 3VYOA 4C4KT 4UCFA 1R3HB 3U6XA 4AVKA 2ZSWA 2UZIL 2YPVH 4QIRA 3ULUH 4CW1A 5GGRA 2X4NB 3R7RA 4LRNH 3QFDA 3MV7D 5CIPA 4LLVB 4P2QA 5EUKB 2XWBA 4HUUA 4KI5F 3IMUA 3KYMB 4IRZL 4WSJA 1MH5A 1QLFB 4WGVB 1Y1UA 2PWDA 2CO7A 4JFFA 4YHPB 1KPUA 4BRVA 3I6GB 5IK3A 4MYPA 1L7TH 3ETSA 3S3DB 4IOSA 1V7NL 5CXPA 3MRPA 2HG5A 4ELMA 5L6YL 4LDEB 1ET7A 4PY8I 2XUWA 2R0ZL 1QEWB 1AHWB 1H15A 3HB3D 3OXSA 2QHRH 3Q48A 3X11A 43C9B 2APFA 3IWVA 1FPTH 4BHUA 2J8UA 1G6VK 2EEBA 1ZHKA 2J5LC 3CLFL 3D33A 3LZFL 4MS8D 4OFIA 1SXSA 1UM6L 2VAJA 2R7EA 1AKPA 3RB5A 5MHSE 1KYOK 2YPKA 2L0DA 1EEZB 2DQGL 1YEHH 2H26B 1U9KA 4JM4L 1UKSA 4UINL 3A67L 1ZHLA 3D4ZA 4FHBD 5HDOA 2XICA 5JNYB 4AMKL 3M07A 2E7LC 3MRDB 4IYKA 1G6RH 1GJWA 3ZUNC 3I3EA 4XP9L 1BVLB 4KKLD 3QP3A 5FYKE 2EEFA 3ESVF 4M9PA 3T6VA 3DXAB 1C16B 3AROA 2GAZA 1AO7E 1C08B 4HH9B 1LP9E 2CDFB 5DJXB 2VKXA 5FCUH 8PAZA 3UBHA 3RI5K 1HSAB 5E8EB 2Z65C 1HWGB 4HBCH 5DVPA 2I25N 4N2CA 2B0SL 4OU3A 2YS4A 3QWNA 1AC0A 1GGCH 2P26A 3TBVB 2RGSA 2OL3A 5GGVY 2P8PA 5IBTH 3US0A 1HC1A 4ZODA 2IFFL 4U49A 1JGLH 1Z3RA 2J4WL 4IBYA 4NQXA 1B90A 4OUOA 1BPVA 2AJSH 2Y1AA 5AW4B 4AKOA 2ZIDA 1D5ZB 3B5TA 2N3JA 4QTIH 1QWHA 3RVXD 1IFHL 5T3XH 2VDOB 1LEIB 1RUAH 3QUMB 1UD5A 4B0MB 1NCNA 1J0JA 2UV3A 1J10A 1KACB 4X8JB 5FGCE 4AH2A 4GSUA 3QIWD 1CVRA 1HOCB 4JRXD 4HJJL 4N6RA 5FDWB 2R2HA 3NP3A 2VDLB 3DX3A 4WUUA 3UEQA 3PHQB 4ZK8A 4ODWA 4M8QA 5MEPA 4LPTA 5FYKL 4F57L 3SDCA 3X13A 3SO3B 5F0PB 4P2OD 4LIQE 3HI5H 3MA7B 3C6LB 3BT2H 1RERA 3T8VA 3NDZE 3QZMA 4N2IA 1QBLL 4LVHC 1FFNB 1THAA 2OSYA 3I6KB 4XOEA 1QSEA 5EU5A 5GGTH 4NQVB 2GCYB 3VFGL 1S7TB 1CR9H 2OI9B 3A0OA 4R4ND 3VX0A 1A3RH 4AZ8B 4B9PA 3QUXC 2KT6A 1QBML 5I6XC 3U7YL 2Y7SA 2M8XA 3LNEA 5FYLE 3KHQA 4W9HC 1FLRH 4QYOA 3BO8A 1CFSB 4J6RL 1BM7A 2RJMA 4LAQH 5DMKB 1HXYB 2CO6B 1EJOH 4AM0A 3MRJB 3Q8CA 1QG3A 5EUOA 4NGHL 2XPGA 3MV7A 4YXKL 2I9TB 4DPCX 2GIMA 3NSDA 1J5DA 5DQ9A 3HN8A 3KWUA 4AM0Q 2FX9H 2BSCA 4OZHF 4HJEA 3P3TA 1FG2A 4DGYH 4H20L 2MCPL 2F2HA 5JIMA 3KPTA 3IE9A 3GIZL 4NKDB 1MCOL 2GIYA 3F7RA 4YAQB 4KROD 5IEHA 1D6VL 1G7MB 3L2LA 4OQTA 5GRZA 3CMOH 4B96A 1Q0XL 4XBPB 1TYJA 1LMKA 1KNOB 3ALXA 2APTA 5DVKA 4YFLF 1HIML 2NY4C 3T08A 3BZ5A 4E42A 5JPMC 4KK9C 2WJ7A 4U1IB 4H5SA 4KJPC 1TQVA 1HOEA 2MEJB 2AKRB 2F1BA 1UD8A 5IGXL 5ILTH 3RVWC 5FYLL 1HINL 4RH4A 5INCB 2LTQC 3BSGA 4QMEA 3B3IA 3WTXA 5SV4A 4XPFH 4I8DA 3UTOA 3KBPA 1AXIB 1HSBA 4LVEA 2JSFA 4R4BB 3HUJE 3MTRA 1QOKA 3E7JA 3N43B 4FQ2H 4HJTA 4I3SL 5ICYB 1HCYA 1XEDA 4F91B 4LP8A 4FA7B 1KBVA 4XNMB 5ENWB 4BFGA 4NC2B 2ROXA 3MRKA 5JA9A 3Q6FB 1RULH 3ABZA 2H45A 2HT3D 2G5BA 3O2DH 1YEWA 4I4WB 5GGSA 3UACA 5SWZD 3VFPB 1FL5B 3OHXC 4ZQTA 4U7KA 4WFGD 5IMOA 1S3KH 3I9GL 4ODXB 1AXSA 4ZS7H 5AZEL 4NQUA 5D1XD 4BFRA 2D0FA 4ISVA 4YGVA 4CVWA 5TD4A 5HI4D 1ECZA 2DAVA 5CFHA 4YHYC 4NQED 3H2PA 3MNVA 2QR0B 1CI3M 1R3KA 1HQ4B 1T4KA 5ACLA 3WHE1 2NCMA 3EOBB 2Z92A 4KOCA 4Y7OC 5L88L 3MLRL 4O00A 1GJIA 2TAAA 3VG9B 1KEML 5DD0L 2KHAA 4TL5A 3RA7L 1IZJA 1ADQH 2YAHA 4UQDA 1EHAA 2WQSA 4OI9A 3NRQA 3E2HC 3MBWA 3QIWA 1FP5A 2E4FA 4JRXA 1LO2L 3JWDL 3VACA 4CSTA 1CQYA 5JHLH 5GXBB 3DOSA 4TNVK 3CFEB 3SJVB 3KS0J 2QELA 4D3CH 5MP6L 5JHAA 3V7AG 3Q8FA 2AF2A 4PVBA 2Y7MA 1QRNB 4X5RA 3PCYA 2N0MA 4P2OA 2K4WA 5KAQF 2YQ3A 3EIFA 3G6JA 2OMUB 2D7TL 2DEXX 4PJ7F 4K9EH 2NNXA 2QZ5A 2YD5A 4YZWA 3QBTB 4L4VD 4L1SA 4RWYH 2EDYA 1NH6A 4TPRL 1B4JH 2VITB 3I85A 4Y2DD 5BZWB 1GL4B 2X70A 4PGDB 1KLUA 4ILDA 1XCTB 3D4GA 4BKTC 1KENL 3TBWB 5DVLA 1KWKA 1GGBH 1EZUA 2QLYA 4FQPA 3H3PL 1W72B 4FXGC 3L7FA 3CAFA 4LKXA 4DH2A 3UIZA 5JOFA 1ZA6A 1JZ2A 3BX7C 1V8HA 4FQIH 4N5UA 1A6VL 2F8VA 3OX8A 5HHME 2OYLA 3L4CA 4WHDA 1YN6A 5ITBH 4HWEH 1CTNA 4PN6A 3MO1B 5DEJA 4F58H 2KBGA 2UZPA 1NGZA 3LXBA 2PXYD 1HHIA 3LKPA 4ZMXA 15C8L 4UOZA 3V6FA 4PJCE 1LE9A 2RH0A 1REIA 3LN4B 3OB0K 3FRUB 1Y6MR 3OKKA 3P0VH 2NNRA 5FC9A 3RKPA 4M5ZL 2V6HA 4XI5C 4HJ1A 3N1FC 4GI8A 5CEXA 4RRPG 3WD5H 4BK5A 4PG2C 3VA2C 5B3SB 1NLDH 1TEYA 4YVUA 4GFTB 3GSNH 2VRQA 1U42A 4U1GB 5DYFA 2Z8SA 4H7VA 1NGXA 3C09C 3RWCA 2V8MA 4JFZL 4G6FD 2VDKB 2PPDA 3WEBA 1YNLH 2GIXA 1DBBL 1MEXH 4GBXD 4KKNA 1OZTG 2ALAA 4LPWA 3L3KA 1HHKA 2BIIA 3IDNA 1OP5K 5C0FA 1H6TA 1K85A 5SWZA 4FJ6A 1KJVB 4UT6A 1CF8L 3GSWB 4G8GD 3RWDA 4ODBD 2O5YL 2DLFL 5HHOD 1OCWL 1XZ0B 5KW9L 5D1XA 1OTUD 3T3PF 5IG7A 2VZVA 3MV01 1M05B 2NT0A 2E6JA 2GTZA 1O6SB 1U2YA 1ES0B 4GIAA 5FYJE 4HLJA 3VFWA 5BW7A 4NQEA 3S36X 3BEWB 5TQ0H 1BOGB 3K1KC 1MVYA 3ZMEA 3ZE2F 2BP0B 4LLAA 1AGCA 1RZJL 3RILA 3OAUH 2UY6A 3PE9A 1N0XH 3LIZH 5F1IA 2ZUSA 4A6YH 1QNZL 2HPOA 3QYCA 4FQQA 1SLXA 3RL2B 3VFOA 5AENA 2G9HB 3LQAH 5I73C 2GUOB 3KHOA 5HY9A 1P7QB 1TLMA 4QWWC 5IWLC 3U2SB 4YSPA 2ZICA 1ZY9A 1XV8A 3ULAB 2IGTA 1HVXA 5BQ7B 1NMBL 1SVBA 2BHUA 3MRGA 2WP3O 1CUOA 1U8HA 5DGRA 1GHFH 1CE1H 1ZOXA 3MFFA 5DEFA 3GMRA 4X6DF 3D18A 4BZ2A 5AG9A 3KPSD 4FYQA 3RFZC 5AAPA 2ED8A 4G1MA 1FVCB 1MCPH 4L4VA 1A7QL 1Z0MA 5LBSH 1C5DB 5E6ZA 3MRNB 2AANA 3EH1A 3OZLA 2AJYH 4Y2DA 3W39B 3HG5A 5E8DL 2BW4A 1OPGH 2ZP9A 4QHUB 2BNRD 2QTEA 5DLMH 3N3EA 2DYPD 3NIFF 4JFPA 3WY4A 1XIWB 3NIGF 4TS6A 5FYJL 2H9GB 3ARFD 5B3JF 4GXVH 4XPGL 2OTUB 2VR5A 3HHSB 3HPLA 3FONB 3NCCB 5ID0A 2BVTA 2F58H 4KK6D 1MCWW 2GEEA 3F62A 3RBGA 3CN3A 5CEZH 5EH1A 3WAJA 2DH3A 1BVOA 4QAWA 5GS0D 1HZHH 2C4FU 4JANA 1CLCA 3O8XC 1R3LA 4J12A 4BFBD 3NUKA 5FK9A 2P3YA 2XQYA 3EGDB 3SGDI 1J1OH 3T3MB 1B9ZA 5F0LB 4OFQA 4LPXA 2PXYA 5G55A 5PAZA 4I2XE 3ATAA 3GJFH 4AJWA 4NQDD 1R3JB 1ZT4B 2X05A 3D48R 5EC2A 1QD0A 1UZGA 3ARBC 4RMQA 3OLDA 4NS0A 4Y5YC 3L95B 3RIKA 1LK3H 3PJSA 2G3MA 4FG6D 4GEIA 2CGRL 1GZPA 3BUYA 1XX9C 3VI3E 1G1CA 1JSYA 3EH3B 3VXQA 2DIBA 5C0GB 2BSSB 1WFUA 4TQIA 2JKIS 3O2WL 2Y24A 4WU7B 1XGUA 5AKSA 4IRJD 4X5QA 1D5MA 2D7QA 1A1OA 1P4UA 2J20A 5GGUB 5DSCB 3S96A 3VCLB 5JOPE 3EJQA 4GAYB 3QYNA 2AW2A 1V27A 2JIXB 1NGYA 5HHVL 5KVEE 2NDGA 3OGCB 3RWFA 5EORL 2BJMH 2KH2B 1DFXA 4HXAL 3LKSA 4LK4A 25C8L 4XBMA 2JKWA 4BSJA 1BMWA 2W60B 4NPJA 4GBXA 4ZTPL 3NP4A 4QHKI 3PF2A 3TXAA 4IEFA 2ZSWB 2G75A 5B8CB 1ZJBA 4Z7UA 4CW1B 2NY5C 3B7RL 5D5MB 3QFDB 1M71A 5E08H 4P2QB 1RLBA 2XWBB 4HUUB 4UBDC 4ZO9A 1IQWH 3TIEA 5HGGS 4G8GA 4KVCH 5C0AD 3EJSA 2MH4A 2LFEA 1RK0B 5HHOA 4P23B 1A9BB 1OE3A 2YUXA 5IK3B 2Z4QB 3MRPB 3RDJA 1MWAL 4N68A 2HG5B 4PMEA 2Q86A 4N0UE 3QK0A 1XH0A 4FA8A 3FQWA 3SO5A 5CD5C 3FK3A 4ODVL 3UZEA 3QNYB 4WK0B 2VB5A 4JJ5B 1DVFC 3QT2A 4LHUG 4MS6A 1RZGB 1SFDA 1A4BA 4PJ6A 2W0LA 4HWNA 4HS8L 3W0WB 5BRZE 4WO4C 4PG9A 1ZHLB 2BP8A 5KVEL 3EYOA 2FZ3A 1P6AB 4MRCA 4ERSH 1AGBA 3D4CA 4PJFF 1OAXH 1ZKAA 1DQKA 4JQIH 4DF9A 2KQMA 1TENA 2PCXA 2ZX5A 4K55A 3GRBA 4ES9A 5I1EL 3GPEA 1NJ9B 1XGYH 3IAQA 3KPOA 3KPSA 4LF3A 1K5NB 3OKOB 1AANA 2DM3A 1IJ9A 3CFKA 1SF3A 3SGKC 2VM4A 4DTGH 4UOW0 1GGUA 4LP4A 2PR4H 5D1ZB 4TNWF 5F7AA 3MV9B 5ICXA 1TTUA 2B2XH 4MJ2A 1CFQA 1L9OA 2BNRA 1KTRL 3VWJC 2DYPA 1XF3A 3CX5K 1OOWA 3OQRA 2B15A 2HKAA 3AUWB 4AKPA 1XF4B 2H0EA 2VKWA 2OL3B 2XN2A 4O58L 3ARFA 3QUZC 1A7NL 2Z8VC 1J5OH 1NIAA 2UXGA 4L3EE 5CKGA 1T04A 4NAQA 3CVHB 1H3GA 1WCBB 2YXFA 3HBQA 1TU2A 3ULVE 1TYRA 2H6OA 2VIRA 2Y72A 4JRYE 2ZWLT 3OZ9L 4ZFOL 4NHUA 1TETL 2N7BA 2XXMB 4N0RA 4G7QB 5H35A 1JYWA 3MBED 4LPCA 5CP7A 4XNBA 5HD8D 3RTQD 3U2JA 2JCWA 4LESA 3U30C 4QXTB 4KHXH 4LKCB 4KVNL 1ZGLP 4NZJA 1L6XA 2GC4C 1A1MA 2FEDD 4LEXL 1IFGA 2HVBA 3C5XA 4RQQA 4NQDA 3SOTA 1N6QL 1MFMA 4UDUA 2R2HB 3KYKH 3H6AA 1SJEA 1AG0A 4GXUM 4ODWB 3BMVA 1TTBA 3ERXA 4NWTL 1MI5E 4O2CA 4P4RA 4FNTA 4NJ9L 4PJDB 4BSVA 2ZPKL 1MCSA 4LCCB 5CLXA 4NKOA 2YD1A 5E51A 3REWA 3C8HA 3BQVA 3H6JA 3M86A 2CHXA 1T2JA 2NUTB 3B2PA 4I0CC 4OCWL 1YQVL 1QSEB 1MF2H 2N7SA 2VUYA 4UV7L 4IRJA 4R4FL 3H3BC 1N70A 1PDKA 3CD4A 2W0FB 3KLAA 3DIFA 4WRLA 3AJ7A 4NM8L 4NLHA 4X7EC 4A04A 2ZAGA 1TO5A 3PFQA 3N85H 1WG3A 4WNJA 4FP8H 1ASPA 1NCBL 2ETWA 3ULVL 1BQUA 3DV6B 1QUPA 1LHZA 2R9HD 4QYOB 1M6UA 3ELAT 3SQBA 5IQ9A 4AM0B 1HCZA 1NFDB 2J1KA 4X4YB 3DJ9A 1LP9F 3NZUA 1P84K 2CWRA 2VYRE 4DKFL 4QJ5B 2Y5EA 4KHTH 3W2DH 4OLWL 3MXVH 1MXGA 3A6CH 4YSDA 4PJEB 5DQ9B 1QPPA 5FR3A 5ID1A 3MLPA 3QZWG 5C0AA 1SOQA 5KYYA 2VDOH 4WI9A 4TM9A 3QUMH 2Y1VA 3BZFA 1I3RB 1E3XA 2GJZA 1DCEA 1HT6A 3FAWA 3RFRA 3QZNA 3TZVC 5IESL 1B88A 5CWSB 2BVOA 4LGPB 3RAJL 1SYSB 2R4SL 3WYRA 5FO9B 1JPGB 2VDLH 1UYWL 3VI4E 4CU7A 3HB3B 1ICTA 1OW0C 1FO0L 1PLBA 3U1PA 4X9GA 3MCYA 2ZZUT 1FL6B 3II3A 2OCFD 2YMXH 4LHUB 3SPGA 1H5BB 4G6KL 1MCLA 1RAMA 4P3DA 2DWXA 4ICWA 1A7RL 3VD1A 1KJMA 4MSWB 5CSGA 3WY1A 5AAWC 2ENPA 4FFYL 3PGCB 1JZJA 2IANE 2XJLA 3VFSB 1WWCA 3DX0A 2VDQL 5FLUA 3SE8L 2CBPA 2X3CA 4LNRA 1JVKA 2E7HA 1HSBB 1GZQA 1KB5A 4L5FH 4DPAX 1T80A 2A77L 1WF5A 3HMXL 3K81A 4IS6B 3JZ7A 3ZK0A 2WO3B 2ITCA 2IBZY 1WFJA 3BP7A 4JKKA 3MRKB 4G9FB 2Q8AH 4BFKA 4ZAKD 5BNXD 3F12B 3Q06A 1PKQA 2YKLH 4UUJB 4M61B 2PPFA 2A6DA 3SCMD 5IMOB 4XXWC 3BPNB 1BECA 3F7VB 2CPCA 2DWEA 4Z9KB 1XGPB 4FN0A 5A2FA 5J12B 3T6XA 4IRSB 4ABQA 1E30A 4FE9A 2IAMD 4Y5XA 2QSCH 4YGVB 1JDDA 1UUSA 3MX0A 2B3RA 1PGRB 1T4KB 3SPHA 3VG0H 2HTLD 5E1HB 4B9CA 4OD1L 1G87A 2I9LA 1TPXC 2Z92B 3ZHNA 3MBEA 2IGFH 4P59H 5KVGH 1LL1A 3RTQA 4J7RA 1ZJAA 3L48A 5CJBA 1QQDB 4RMUA 5DZVA 4AQ1C 2YJQA 3SDXF 5I2IA 5KS9B 2AZUA 1BA9A 2XU9A 3DOSB 3LRSA 4F80A 5G5DB 3QS2A 4JFXA 1F00I 1KG0B 2A74A 4FC3E 1JTTA 4KUCF 3ZTNL 4QRRD 3I3BA 1LQSR 3KPPA 1SRDA 2N01B 4MA8L 4JN2A 2ESVE 5F2FA 5D2LB 4ZW3A 3EZ8A 5ALCH 4CVZA 3C2SA 3OLEA 4FYSA 4H26A 4QRPE 1XCWA 5DHVA 4X6CA 1L9RA 5K1NA 1OAZL 1NCWH 1KXVA 5IB4B 2Q7YA 2X70B 3QAZB 3TBTB 4ZBJA 3FTVA 5LDUA 2EACA 3SPJA 1I1AD 2Y1YA 2R29L 3DBXB 3FFOA 2N4IA 1P9MC 3ARPA 4F2ME 1AZNA 4IKNA 2LT9A 5IFHH 4MB4A 3E3QE 4IJ3B 3O0RL 2A73A 2WXFA 3B3BA 3SPVB 3L7FB 3ETBJ 4UDTB 2JJTC 2CHNA 2FHBA 2R0KL 3MV8B 4YSRA 3QGVA 5I8CB 1R24A 3HVNA 3FQUB 3JUYA 3WI9A 4EN3C 2NXYD 4J3OC 4MASA 4OGYH 4ADJA 1NGZB 3LKPB 3V6FB 1UFGA 1I1YB 1J0HA 1S9KC 2O5ZL 3ISYA 5FO7B 4B9JA 1JPSH 3OMAB 5EFIA 2ADGA 5F88A 3NAAL 2EIZB 4TL4A 3TCLA 3VM5A 4FLSA 1QLRA 5CJXC 3KGUA 4GIOA 4X5XB 2W9DH 2ALWA 1O6TA 4EUPG 5CEXB 2PCYA 5F7EL 4GW4B 4Y2OA 3STLB 2O72A 4M5SA 3TGXA 1UA6H 4JFQA 3JV4B 5T1MB 1NWPA 1RSYA 2EUZA 5KSVB 3QDJD 5DQDH 3WJJA 5F9DC 4OV5A 1OTTD 2AXHA 3RWCB 4JZJB 3D87B 1XGTA 2VLJE 4AE0A 4YFEA 4PBXA 1ZV2A 3LJ3A 4LO9A 1TVBB 4YEEA 4OLVL 4HMEA 4UQBA 2VSCA 3P2DA 1M53A 5JDSB 1UCBL 4O5LL 2OKMA 5DA4A 3CZFA 3W11C 4X98A 1A9EA 3CE1A 1W72H 3EJRA 2UYLB 5AOKA 1VACB 1YEGH 4ZAKA 4K23L 5C0FB 3MRIB 3UGUA 3WIIL 4GIPD 3KVQA 3SCMA 3D7PA 2YUVA 4PJXF 5LG6A 1JGUH 3BVVA 3RWDB 5MEND 1NSNH 4KK8D 3HNVH 4D9LL 2B08A 4Y5VA 4PJBA 5C9KA 5IG7B 3LPOA 3SE9H 3WHXA 3BWAA 3HG2A 3L4VA 1K6QH 5KAQG 2IAMA 4FNUA 5DUMH 3CXHK 2BHZA 3CZUB 5AL0A 4ZPVB 3IEAA 3N42B 4JAMA 3TVMC 3VFWB 4JY6A 5F7UA 5I1AA 3U0WH 1FZOA 2JCCA 2QPFA 3GT6A 3IBEA 3MSPA 3E38A 1AGCB 4W9JC 3MYJA 2CMRH 1T5XA 3BEVA 4NRXA 1C5CL 1JF1B 4PM1A 3C8DA 3H42L 4HKJB 3OWRA 2ITFA 3VFOB 2XRAL 4N0CC 5HY9B 1S6NA 1S9YB 2EDRA 1O7DC 3IRPX 3B2DC 4KNQA 3NIDF 5F9OL 1DBML 1D5XB 3F3HA 4LCUA 4ANVA 3HKFA 3ZUCA 5D6CA 5LG1A 5FW8A 4MCNA 1U8HB 3FT9A 4F7PB 1JP5A 4RFEA 4UM8A 1G9MH 3MFFB 2YAPA 5DEFB 4QRRA 3GMRB 3RU8L 2VDKH 5DZPA 4WJ5A 1DTUA 1JIBA 1QATA 5KSAD 2B9AA 4JHAL 5I1IH 3C5SA 4NJAH 4RIRA 3VFTB 1WBZA 4G1MB 1A4CA 3G6DH 4XO3A 4L2YA 2NYYC 4PGCB 1TCMA 1XH2A 5F71A 4L4VB 1ZIAA 1TQUA 1LXMA 3O3DB 3NDYE 2QEJA 4M43H 5ANMB 3RJQB 4MA7L 1P4BL 4OM1H 4JO1L 1T89A 3WG7B 1LE5B 5D7KD 1SBSH 5E8OB 4OZIF 5LO7A 5TDOB 1I1AA 1MHEA 4PRID 3WBDA 5DRZB 1VKXA 2ENQA 3ARDC 2P9RA 3V4PL 4URTB 4GRMB 3QNXA 2BHFA 4PP2A 3ETTA 3FTYA 5IOKA 3RUGE 2NZ9C 3TH2T 5GZNC 4TNWK 3EGSA 3LX9A 4BSWA 2VCOA 3MI6A 5FO8A 3WFZA 4JANB 3BP5B 3EHBC 2HT4C 1YMHB 4BFFA 3FTGA 1BF5A 3N0AA 3LPGA 3TPUA 5FK9B 2IBGA 1E4HA 3BH4A 1GAFH 4P5MA 1OB0A 1CB4A 1JGVH 4Y4KD 3DRQB 1J8KA 4UNIA 2OCCB 4YDIL 1WAPA 4J4PC 3PGFH 1JDAA 2HYMA 2BRRL 4GSDL 1N7MH 3KVDD 1W0WA 2BIOA 1NUDA 1I1FB 3MLZH 5J6GB 4GAAA 1FH2A 5DR5H 2XCMC 4PJ8D 4M6NH 4CDGC 3U9UA 4X6EB 3V95A 5ISZB 2AJUL 5DUJA 3ZDXB 4QRUB 4WHTB 3UAFA 3O6KL 1D5MB 5CJQL 3QDJA 5GRUL 3M1OA 3VNYA 3Q13A 3FQ2A 5FHBL 4Z7QE 5I9QC 4JZOA 1OARH 1RUKH 1NGYB 1E28A 1SN2A 3HBPA 4QF1A 3T2NL 2MOVA 1UUNA 1U21A 4JCWA 2JJWA 3LKSB 5EO9A 5DZAA 1G5AA 4OGQC 4GBXB 4NPYB 3L5XH 3PWPD 3FN0L 5F6IC 1B6DA 1DEDA 4Z7UB 4QHLB 2CSPA 3KGSA 4HUNB 2BPBA 4LLMA 3P4OA 4UT9L 3VJ6A 1E4XL 4MAUH 3QXWA 4JO2H 4G8GB 5HHOB 5MENA 1TSRA 2VUKA 4HV8A 4S0SD 2NMSA 3DARA 4OT1H 4ZX4A 6FABL 4V11A 3B9AA 3CDYA 3PL6C 4XN9A 2LU7A 3EBAA 4LT7A 3TA3C 5EZIH 5IR1A 1QNIA 5CHNB 1D6EA 1FLTX 1ZTXE 2WXIA 4PR5A 2ARJB 4JQXC 5EZJA 4ZI8A 3D3VD 5AVUB 2R4RL 2VXQH 4YHIB 3IFPB 2V5SA 3FB7A 4YL9A 1HKLL 2AK4D 3GNMH 2E8YA 1HQRB 1A1NB 4ONGH 1A7OH 3L3JA 4PCKA 2ADYA 4OCXH 2FR4B 1U92A 4WWPA 1YHPA 1TO4A 3CG8A 4G8EB 3ZE0B 2LE9A 5D71L 1SDYA 1QW8A 5KSBE 4FFZA 2R2EA 4JO3H 4XVUD 3KPOB 2APWA 5KSAA 4GQ9L 4LF3B 3WN5A 5KVDH 2E76C 3VI3F 1E6JH 1FNHA 2Q3XA 1BFTA 2AJVL 2GBUA 2J88H 3KCPA 1MAJA 3MODL 3Q1SH 3WS3A 4LLDB 4MMZA 4GLRI 3G5YB 5L8KB 2VXSH 4A7GF 5BVPL 1CFQB 3ARRA 3EFFA 1F56A 1BFOA 1WZAA 1BZ9B 2NQDA 3GS4A 4PS4L 4I7ZC 1JPTL 1XF3B 2DYPB 4JFUA 4ZMWA 3HVDA 4PRIA 2BXYA 3ZN6A 2HT2C 3SHSA 1UATA 2RFXA 3T2LA 3HG4A 3GRWL 2EZ0C 1T04B 5JDJA 5I6PA 3FOMB 1KCWA 1ZTXL 4DKEH 3UTPE 2PUQT 3S36H 4H8WC 3MLTA 4BEIA 1BD2D 1N4XH 5TTRA 4CBZA 4NHUB 3ZR5A 4BELD 1N19A 3GMOB 4GSRA 5H35B 1F1DA 1FV1A 2BSDA 5CP7B 2WXMA 1Z2KA 4MNQD 5JQIB 1WK0A 4BRJA 2B39A 4PAZA 3U7WL 5TE4H 5I0XA 1YEFL 2X4OA 1QVOB 3RY6C 4WU5A 2Y06L 5ELIA 4MKTA 4Y4KA 2BX5A 3BGMA 4UDUB 1NTDA 1BZDA 2HLAB 4FLOA 1F18A 3RX9A 1NKRA 1SHSA 4P4RB 5EWIH 2TSBA 4YR6A 3NK4A 3CBJB 4JM2C 2PTTA 2LGNA 4P5TC 4DN3H 2F74B 2DLEA 4GAJL 3POHA 4IIQB 4OGAD 1E90A 1PL3A 2GBVA 1I3GH 4PJ8A 3RL1B 1I7TA 1PJ9A 4EIBA 5A16A 2A6KB 3OLIA 2B4CH 2CLRA 3WXVH 4I1NB 3NTCH 5FYKU 1CL7H 1EAPA 4FQHA 1XGRA 3N06B 2VRAA 3PIQB 3QEQE 3HN5A 1DDTA 5IT2H 1GYWA 3SQOH 2F15A 3ZKXC 1Q9KA 1VFAA 3R8BB 2MQ3A 4TSBL 2F19H 3CZJA 4NAMA 4NUGL 4Y8AA 4XNAA 4WW2F 3C87A 1NUNB 2AEQH 3DRTA 4TUJB 4UV4H 5CGBA 3HFMH 4FCAA 1C12B 4Q0XH 5K59F 2ZKXA 2IPUG 3CVHH 3PWPA 2NPLX 1YNKL 1UXWA 5IQ9B 5BXFB 5C86A 5I1CL 3SDAD 4MVBD 4A38A 4LZKA 4HWBH 1IC4L 4WY7L 2EIDA 2QPUA 2ZCZA 2CRMA 3V4UH 1A3QA 2EKSA 5ID1B 3QR1A 5J57B 3S5YA 5C0AB 2KZKA 1WT5C 5E0FA 2Y4SA 2OA9A 3GJEA 1EQWA 3BZFB 2WO4A 4N2OA 4NO2B 2WC7A 2R2BA 4MQTB 1QLEL 2Y07L 3IXTB 2R23A 4OJAA 3MR9A 1COBA 3SQRA 2BVEA 3ULVF 5LGJA 5E9DB 4PRDB 1KCKA 4IKLA 1Y0LA 3D3VA 1BEXA 1F6AA 3LRGA 4TULH 5DQJA 3TU6A 1FJ1A 5KUMA 4N2MA 4BHUI 1UKQA 1MG2C 1K9TA 2AK4A 1BX2A 3N0PB 3RGVD 3TURA 2BRQA 5FLVA 2FD6H 3QCUH 4KDTC 2EDOA 3MOQA 5KANG 1X9QA 1BGXL 5AW7B 4XE0A 4DVRL 2EIJB 2CCVA 3ZIYA 5J4MA 1QSVA 3DPDA 5CILL 1KB5B 2QVMA 1DFBL 4Q52A 5JQ6H 3L3OB 3CMGA 1PLGH 5HGAA 3ES6A 2F1EA 3M6DA 4GB9A 5H2BA 4R6UA 3B2UC 4GG6B 2IWGA 5IFAH 1YYLH 5E4EB 4ZUSB 1A0QL 1C1EL 1VESA 1UFUA 3CLEH 3H9HB 5DJZA 4AC2A 1R5IB 2WVUA 4G5ZH 2A6DB 1UWXH 1HE8A 4U6TA 2HRPH 4WKZB 3RNKA 3DECA 2PYED 2XV2A 1H3UA 1UM4H 4ODHL 5I17A 1F8TH 5J9PA 4HIXH 2YSSA 1FBIL 4Y4FC 3VVVA 5AUMA 1QWUA 3V6ZA 3MXWH 5D7JC 3KL0A 3IJ7A 1SLVA 1OSZA 4CU6A 4Z3HA 2JKLA 2HMID 3U48A 3L3HA 3HC4H 2WBJD 1BD2A 4KV5F 1OAKL 3O4LB 3VA6A 3C8KB 5BS0B 2D9QB 3WFEH 1A6UH 1OE1A 1OT2A 2NY5L 3ATBA 3EFDH 4OQTH 3VWKC 4DIXA 5CJOH 3SGEI 1H9DA 3S98A 5JXAH 2VMFA 5DJ6A 1T3FA 1TCRA 5CGYC 5F96L 2W0KA 3QUYB 1CF1A 4MNQA 1K2DB 4I9WE 4QXGL 4FXKA 1Q0YH 3BPOB 1IVTA 2F7RA 4GT0A 1RP9A 3DV4B 1Z9PA 2XZQL 3MLUL 3I02B 3ROLB 3HE6B 2BZCA 1NCAL 5BUAA 1U8CA 2FE0A 3HZVA 1KBGL 3LH2L 4PCSA 3DX9A 4S1DD 4YDJB 1U8KB 4FQXC 4TQPA 3MUZ1 4YDLB 3BAEL 3QDGD 2X4QA 4G7VL 4QO1A 4CVZB 1BLNA 5E4AA 2W38A 43CAB 1XL4A 1JHLL 2CNYA 1D3CA 2LU5A 3DVGB 5DHVB 3CFDA 3NABH 4JE4B 4M1GH 4N1EA 3CUPA 3LSOA 4F92B 2O6PA 1OLLA 1XR9A 1AGDA 4X8XA 2O6DA 4XVJL 2VMJA 1U8JA 2ZCKL 3G08B 1LO0H 1EX0A 3NJKA 4XCCH 4QAMB 2EDWA 1AR1D 4JPIA 1NBVL 4QR7A 1FE8L 3ZL1A 1N68A 4HF5H 4PV9A 1CT8B 1KCUL 3NCYP 1CS6A 1IC5L 1HFUA 2SEBA 1R3IL 3SDAA 1Q1JH 5EU7E 2WWNA 3BSZH 1ZA3B 5I6LA 4U3CA 2V7HA 5DURD 4ZMTA 2MRYA 4LRIC 3O3BA 2AABH 3C6EA 5E2WH 1RUPL 4WWNA 3R06A 4K71B 1T1WA 2H32A 1OB1B 3FUDA 3DYMA 1I7RA 7CGTA 3P4MB 2AI0H 1OWRM 1U8PB 4QPEA 5F88B 4PLKC 2ADGB 3TCLB 4K7PL 3HR6A 5EEZA 1DCLA 1KXQA 3N1PC 1E2ZA 4S1QL 3NSJA 3UTSB 3HIZA 3E6FA 1A14H 4Z7WF 1SMAA 2QKIB 1MRCH 3TYFA 1XQ4A 1S5HB 4WFED 3RGVA 4BDVA 4JFQB 2XT1B 4GAGL 5IBTL 1RJLA 4TLKA 1LTXA 1UACH 2DF3A 1NFKA 1NC2B 3HHMA 4JMXA 5C7XH 3EBGA 3P0YL 4KI5D 5M95B 3SEPA 1FZJA 2AV1B 4OF0A 1DLFL 1D7FA 1IEAA 2D2OA 3CPLA 1UOKA 2WLKA 3U9PH 3MRFB 3BAKA 5I1DA 4YWGL 4HXBL 1KEGL 4ZUVB 1MJ8H 1E6OH 2QGBA 1A9EB 1OHQA 3BGFB 3F8UB 3PP4H 4X98B 4ZO6A 3L4YA 2EDDA 4RAUA 5EBMB 2R69A 1QR1A 1YUKB 1IE4A 5T1DL 2IDFA 5IVXE 4HS6A 2ZP0T 1ZLUK 2PYEA 3LS5H 1F4XH 5CINL 1GYUA 4Y5VB 2AQ1A 4JVWA 3QFGA 5F1SA 4DN4H 1KCSH 4BGDA 2VABA 3WHXB 3BWAB 3U25A 2X1WL 1N0LB 4DUVA 4HP5A 4N1HB 4JAMB 2WBJA 1CK0L 3L5WA 4HK3J 1NDMB 1RURH 1DQDL 2ICWB 2JCCB 2BC4A 4GUCA 1CICB 5FGSA 2G0LA 3NCXA 3VD4A 1CR9L 4ZDHA 2OMXA 2EH7L 2YEZA 4LPUA 1NPJA 4MXQC 5PCYA 1NANH 3BEVB 1ZANL 4N20A 1PFOA 4RAVB 1W0VA 1N6VA 4XNYL 3T0EE 2VQUA 2WTOA 4JKNA 4OFDA 1MWOA 1IKFL 1U3HB 4HKZA 3KNBA 3AU0A 3A3YB 4LCUB 4WI5A 1QYGH 1DJHA 4S0TD 4NQCD 5D6CB 2F7QA 2RB8A 1OLZA 2OR9L 4XCYA 3VDBA 1IGFH 1AO7B 1U3YA 4XC1L 2Q76B 1L9TA 1XF5A 3NK3A 1QI4A 3RJDA 1YJDC 1NLBH 3H85A 3D12B 4HZAA 4WJ5B 4MJ6A 3KZ8A 3QI9B 3LZLA 4FXTA 2YFOA 3QDGA 4RIRB 3OKNA 3S5LA 2OZ4L 1YCSA 5KVMC 5L2JA 1FIEA 3OB8A 2VLKE 3K1DA 4OLZL 4KI1A 3OWEA 2EVJA 1NA8A 1AY1L 1WLHA 1X5YA 3WKML 3F5WA 1VAHA 5AAMA 2HSIA 3EYSL 5I1HL 5LXGH 4IW4C 4PFEA 1I1AB 1MHEB 3LDBC 1QTPA 2E56A 1VKXB 4E41E 2OMBA 3QNXB 2YXVA 4GKSA 7TAAA 5F3BA 3ECWA 4DZBB 5EBLA 3JWOC 1WHPA 5IROC 3TA4D 1MG3C 3LMJL 1A5FH 3VU2A 5FYJU 4LLYA 3APCA 5LGKA 5FGCB 2XQBH 3GHPA 3HHRB 4UB0H 4PJAE 2P8LA 1WWAX 5EIVA 3TPUB 2NXYB 3UX9B 2IOMA 2BCKB 5FKAA 5FOBA 4P5MB 4A68A 5ADOH 3OKYA 5EO1B 4FQ2L 3AG1B 1B2WH 3HI1A 4U6HA 4Y9BA 3MRQA 4PB0L 3EW3B 4Q56A 1W0WB 4E68A 4D0BA 3R1GH 4D8PA 1PZ3A 2J6WA 2R27A 4Y16B 4BUQA 4FL4C 3QUGA 1P4IH 1PY4A 1MW3A 5T3ZH 2EVHA 3V5HB 2QVKA 1CGVA 3ZDZF 3T8XB 5KUKA 5EV7A 3RBSA 2QADC 1AKJD 5DK0B 4TVSa 2W9EH 4IDJL 3MLVH 1DUYA 2OPCA 3PWJB 1EGJL 1QSFD 4DGVH 1RU9L 4NP4H 5E94A 3L1GA 2QZQA 1YY8B 4U6YA 2DRUA 4ETYA 3IDIA 3FTXA 2MIZA 2NY3C 2WNKA 5DD3H 2UVFA 3BKJH 3OGOE 3OHMB 3WSQH 2B20A 4LLMB 3P4OB 1LO4H 1PX8A 5F3FA 3NCMA 1LQBC 4TVPE 4YPGA 3QUXD 4KKAC 3VJ6B 1OP4A 4NUPA 1IBFA 2DQCL 4ANKA 3L7EB 4JFED 5E00A 3VRIB 1TJIL 3KPMB 3PP3H 4MRBA 4B9IA 4XN7A 3QULA 1PZDA 1XGQB 5BJTA 3IJHA 3C60C 1KB9J 1YMME 3RQ3A 3LZQA 4CSZA 3DGCR 1M42A 5I0DA 2OBGA 2DLTA 4M3KB 3D69A 3S88H 5F1NA 3ZSSA 5CMAA 3UYRH 5IR1B 1FFOA 1VZHA 4N0YL 4YHKL 1D6EB 5C8JA 1S7SB 4R96B 5DU7A 4ZW5A 5EZJB 5IJKC 1IM3B 1SJHA 1MQ8A 3FMGH 3GI9H 3P54A 3QWOA 3K72A 4FDWA 5B1CA 4FFVD 3IBOA 1CG9B 4N5EC 4EUPH 3GTVA 3O45A 2C9XA 3TCTA 1BM3L 3L3JB 3OLGA 1U92B 2IMMA 4P9HH 3HUJB 5HI3D 5C0CD 3NA4A 4G9DA 2JK5A 4HPOH 1O5PA 4NQCA 4K8RC 2ZCLL 1WYJA 3GKZA 4ZPTA 3DX6A 4B3EA 5CZXD 1SY6A 2HA1A 2YARA 4F2FA 2J73A 2IVFC 2J8OA 1E9PB 3L45A 3WN5B 5B1JC 3WFHA 4TVPL 3WS3B 1Z66A 4K5MA 4ACPA 1EANA 1AD0B 1TT6A 4HK0A 2ZUUA 3CVIH 3IYLW 4HJ0C 4RAHA 2X0WA 1D7BA 12E8H 3ML8A 4OF8A 3SOBL 3EFFB 3IMVA 3MROA 1DE4A 5FOJA 1NGPH 1JK9A 1O7DE 2E9JA 1IAII 4NN7B 5AYUH 2RFXB 1Y6NR 3MRHA 4DHLA 1AHMA 3IETA 1OM9A 4MMXC 4LEBA 3KJ4C 4XVTL 2FNWA 3DMMB 3ECBA 4OI8A 3G9AB 2JQMA 4ECNA 3IJYA 2RR3A 1X44A 2J1WA 4JG1H 3QPQC 1TZAA 3QWRD 1EHLH 1GGIL 1SOKA 3TT1L 1KPRA 1QFWI 4L4TE 2JQZA 3R4DA 2X4OB 3RKDC 2AEIT 4I87A 2Z3FA 2P47B 2WYIA 3EO0A 3BGMB 4NM4L 3IGAA 4FTDA 3QRGH 1FN4A 2WP3T 2XBZA 4E9LA 2J6EL 2N1TE 4EOWH 3BESR 5AW3B 3UYPA 2DH2A 2IO5A 1ND0B 3X1FA 3H8NA 4APQB 3NEXA 4GUPB 3LKQA 5C0BD 1IM9D 2EUWA 3VXSD 1WZKA 2ICWJ 3VXUE 4LSTH 1I7TB 1OGAD 2PW2B 1XL6A 4N9OB 5A16B 2CLRB 1PS3A 4BE5A 1E40A 2NYKA 4PJIE 3WLWC 2XTJD 2CO2A 1BBDH 2VQTA 3SDYH 5TJWK 1AKJA 1INEL 4TOYL 3FH7A 2QT6A 1MIMH 4QHNB 4BJLA 2NLJB 2EXYC 2VXUH 5CLTA 4FG2A 5AEAA 2HFFB 4PWHA 3BZEB 4X9BA 1QSFA 1CFNB 3FB6B 4OZHA 3QXDA 1Y1DA 3AT0A 4QXVA 1CBVH 3BDBA 4HGWA 3AM8C 1NCDL 2XZZA 4ATTA 1Q9WA 1GMIA 2O6CA 1NC4B 4YX2H 4NDMB 1EJ6A 1N0XL 5HHMB 1QKZL 2IQAA 5FB8A 1DSFH 1T6WA 5J1AB 1CFVL 3QUXA 3QHZL 1JYXA 2CALA 4JFEA 5EEUA 4PJCB 4ANUA 1UJ3C 1EIBA 4OZGF 3U46A 3GJEB 1CE1L 1U58B 3ZL4H 2R2BB 3IDUA 4PCYA 5EZOL 1A3ZA 3SB3A 4QXUL 2C9QA 2ZWKA 3Q05A 1MCIA 4IKIA 3V79C 4LBAA 4LCIL 3WEMA 4ZD3H 5CBAA 2EC9U 5I24A 1MCPL 4AYBA 2FJGB 1Y0LB 4PJGF 3TWYA 2RACA 3AADB 4B0MM 4BZ1H 5HHPA 1FJ1B 2HTKC 5F0MB 3KL5A 3KM1A 3L4TA 4MWFB 3RPBA 1TMQA 2ENJA 1MFCH 3UTTD 2D03L 1MAML 2BDNL 4K3EH 3P69A 2H4EA 2XYCA 3ZTEA 2YQ2A 1Z5LB 5HI5C 4DW2L 2PPEA 4MXVE 4XAKD 5C0CA 2W81C 1VLXA 1JD7A 5TGBA 1DBJL 2QGCA 3I2CL 4DPRA 3VXRE 1OD7A 3NVQA 4WCYL 4PGBA 4AIZA 3ZBMA 4J3VA 4BKSC 3TEUA 2DZEA 5JPMA 3ES6B 5B38G 3SDCC 3FO2A 4ZUTA 1M6OA 2AJXH 2CJUL 4HKXA 3VFMB 3WJLC 3ARWA 4UMSA 4LSQL 5E2TL 3PABA 3GHEL 3V0FA 5FA3B 4TLSA 3FBKA 4NUJB 3CSTA 3KVPA 1TQCC 4N6QA 4RGMB 2Y69B 1I7ZB 1SHWA 5I75B 3K7UA 1BMGA 2DYSB 3UZQA 2YSSB 2GITB 1LK2A 3N55A 1GOHA 1DQJA 3LV3A 3N1QC 4G1EA 1OSEA 1R5WA 1QPKA 2AITA 3BLKA 4KTEL 4BK8A 5IZ7A 4YHLH 2YAMA 5JPNA 3RDTB