1ZK5A

Escherichia coli f17fg lectin domain complex with n-acetylglucosamine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
175
structure length
172
Chain Sequence
AVSFIGSTENDVGPSQGSYSSTHNLPFVYNTGHNIGYQNANVWRISGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWCVGNYVSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of natural variation in bacterial F17G adhesins on crystallization behaviour.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords F17G adhesin subunit
total genus 41
structure length 172
sequence length 175
ec nomenclature
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1zk5A00
2BS8A 3F6JA 2BSCA 1O9WA 4K0OA 1ZPLA 1ZK5A 2BSBA 3F64A 3FFOA 2BS71 1OIOA 1O9VA 1O9ZA
chains in the Genus database with same CATH superfamily
2DAVA 4W68A 2Z35A 3NN8A 2WAHA 5C0CA 2DQHL 2PO6A 2UWEB 1HS6A 2JJUA 2Z8WC 4FI6A 4NQEA 3SCMB 5MERB 5L4FA 3G5YA 3RL2B 1NBZB 1VADB 3ECVA 2BC4A 4MHHG 3TVMD 4JANA 3NZHL 1THCA 2YR3A 2ZXBA 1DYZA 1TJXA 1ETZB 1UKTA 2HCZX 3QBTB 1ONQA 3LEYL 4LSQL 3QJTB 5DJDB 1PBYA 5DVLA 4L4VB 3CXFA 5LB1A 3RDTC 4CVUA 2PTVA 1I8LA 1B0WA 1TZIA 2G4EA 3HRZC 4XOEA 1VZGA 1PAMA 4LIQH 1TNMA 3KXFA 4UT9A 43CAB 3MRBA 3M45A 5IESL 4GRLA 5HGDB 5CILL 2AVGA 2DICA 1G7JB 5EU6A 2ATKB 1ASQA 2EICA 1PG7X 4UAHA 2HT2C 2OKMA 5HHQA 4Z76A 1BFOA 3FOMB 3FTXA 3VWJA 1SBSL 5BO0D 1KZYA 4YUEL 4N0YL 5ILTL 4CU7A 4NRZB 2ED9A 2BW4A 3RHWK 3QQXA 4QO1B 2FX9L 4MXWL 1ZHBB 5DJXA 1FVCB 4JKPL 5KVGL 4OQTH 5ES4B 4XNXL 5F7EH 1KEMH 1E3ZA 1N4XL 1PJWA 1KXQA 4PJ8B 1H6TA 2VXQH 5E2VL 3U2JA 5EBGA 3R1GL 1B2WL 2YAPA 3WO4B 4OD2A 1MFDL 4R9HA 3GMPA 1MKFA 1X5LA 4FQ1L 1FNGA 4ORZC 3ZRCC 1VJSA 4LFHG 3QHFL 2YQ3A 5A1AA 1FZMB 1HWGB 4H8QA 1J5CA 1XF1A 3Q9PA 2COQA 4AJVA 4FP8L 4FP8H 1DVQA 4YZWA 3QJRB 2CBPA 3DROA 5DJ0A 2PXYD 2EABA 4WCYL 4LP4A 2G5RA 2EC9T 4LCIH 2BIPA 2YK1H 4G9DA 2Q5BA 3O2DH 1VFAA 4B5EA 5JOPD 3B56A 2Z1PA 1LK3L 5CCHE 4OQTL 2K6YA 1JFHA 8PAZA 4PCKA 5JW3L 4NB7A 4OVUA 2BCMA 1TJMA 3BP4B 4HS6A 1OF2A 2M1KA 2VDKB 2ZYIA 3MMEB 4BSVB 1IT9H 2WYIA 4R0LA 3L3DB 2JLLA 4PLNC 3FB5B 4YUEH 4FG0A 4JM2A 5FK9B 1KJ2B 5F9JB 4MMXA 4WSGA 2IOIA 3B9KB 5D1QA 4PJEB 2YPKB 5F72S 4QRFA 1LO2L 3RILA 3TBWB 4L8SC 4KNUA 4ALAC 2Z92A 2VDMB 2C3WA 4XN1A 4A1RA 5KANI 2XVBA 5GRVL 3FUJA 1BV8A 3BZEB 1R3JB 1NEZG 5I2IB 5EZJA 3HEIB 5C0DB 3WKNA 2C9SA 1ETB1 3U7WH 4HK0B 2GJZB 1XB3A 2PXYC 5HI3C 2J57A 4OZFH 5D7KD 5JO5B 2HVKB 4PM1A 3LS4L 4FFYL 1XWVA 4FNUA 2NDFA 3OSVA 3Q6GL 4IRJA 1ZE3H 3EHBB 2LU7A 3W9DB 2GBVA 1GS7A 1MJJA 1TT6A 5H94B 3S34L 1RMFL 2CGYA 1T66D 4G7RB 3STBA 1DEEB 3TTYA 3ZW3A 5T1KB 2V4LA 1KY6A 5D5MB 1JNHB 4PRIB 1JF6A 4PRBB 1XGRA 4WI3A 5DZVA 4XP5H 5AW6B 3IAGC 4U6VL 4V2BA 2G30A 2ADYA 1CCZA 5F1KC 4QRTB 2EXSA 1WSST 2IJ0C 2QL1A 2VW6A 4DPCX 3AY2A 1KUMA 3T4AB 1CXLA 1RZ7L 3ULVE 1RIVH 2D8KA 1CURA 3L5WA 5AW0B 1SJHB 1R33A 2GTWA 5AW2B 2ICWB 1ADQH 3I9GL 5IVXF 3SPIA 1CBVL 4EI5B 3BH9A 5HVFB 1QI4A 3GHBL 4X7FC 2KI6A 3RRQA 3BUYA 3UFIA 3WTXA 3BKYH 3QUMB 1B0IA 4TSCH 1X7QB 4Z7WF 2ZXQA 4N2BA 2PMZA 2ZOUA 1AE6H 1H15B 3LKPA 4GSQA 4PJIB 4ADGA 3GC3A 2AK1H 2KZKA 2J56A 1QWUA 1AD9A 2I69A 5D1ZD 1SXBA 43C9B 3GRWL 4BFBD 1TTAA 1CDJA 4WUKH 4LOUD 5I28A 3P4NA 1MUJA 5ICZA 3HBZA 2FWOB 4HXBL 1I1FA 4Q9QH 2WXIA 5JLZB 3KNBB 1KTCA 4DN3L 1XIWB 1KWGA 1U92A 1NSNL 2V2WB 1NSNH 5E1AB 1EVUA 1IC4L 5EOQL 2OMYB 3TJEH 2ZWZA 5KSAD 3UBFA 4XH2A 4FAAB 4GRWE 4WNJA 1U8CB 1COBA 2WLLA 4M5ZH 3PWUB 2EXYD 3WS6A 4XCNB 1VERA 2BWIA 4JFFB 4Z7IA 2NNFA 2HTLD 4X5PA 5HHNA 2Q3ZA 4DP6X 1QLRA 2EQDA 5IW1A 1YYLH 1G7PA 1XAUA 5KWYC 1I7ZA 5ICYA 4L29B 3FF8A 4PJGF 1QFOA 3EYQD 3IU4L 2RFXB 5ALBH 4XVTH 3WU1A 3TURA 2DYPB 4AL8H 4YXHH 4OCNC 1NCWL 1N0LB 1QEXA 2AMGA 3BP7B 3KYAA 4Q6IC 1E4XH 4NN5B 4QTHB 1AR2A 3ARBA 5GS0L 2G0LA 2VM9A 2J6EL 5EUOB 1WFIA 1S7RA 4W9CC 3DI2B 1ZCRA 2P5EB 1F3JB 3H53A 1NANI 3HN5A 1RU9L 2DQGH 3MRQB 3ZL4L 4R2GC 1UGKA 1IC1A 3D33A 3FMGL 5T3XE 4PRNA 2H1LM 2PW1B 4LSRL 1CFMA 4WFHD 3UERA 5FYJE 4JPWH 2R69H 4F37K 3Q5TA 3U6XA 1CGSH 1CR9L 1G6RA 1NGQL 4OTXL 4ONFH 2WXPA 4K5OA 2Q86B 4JREC 4CRPA 2CGRL 3HBPA 1NUGA 4O02B 3DSNB 3FCGA 3BYYA 4U7KA 5D9SB 2JE8A 3VTTA 2JQZA 4TPRH 1U8PA 3PWPD 3ARXA 4Y16A 1K8IA 1ML0A 1JXFA 1MI5A 1U8OA 1BWMA 4JFEE 1HCZA 3IFPA 3N1GC 2IPTH 1CZ8H 2W9LA 3AG1B 1C08B 4XNUH 1TITA 3FB6A 5CJBA 3RJDA 2P1YA 5IJBC 1T03L 1T4KB 5DYFA 2OP4H 1N5AB 2L7EA 4TL4A 2EE3A 1TVDA 2IANA 1AY1H 3VDBA 5CFHA 4GMSH 4JY6A 1A14L 1YEIH 5EA0H 2GSIB 4AENB 5JHDB 2XN9A 5ANMA 3DVFA 3BE1H 5IUCA 4J3BA 5DYOB 1I75A 4JFDB 4JDVA 2F7RA 5IBTL 1UGNA 4NJAH 1D7FA 3KLQA 2A6IA 2VZ3A 2EE6A 2YGNA 4I13B 1J9SA 5F89A 3GXUB 4ZT1A 1QBAA 2DIEA 5ADPL 3CFEA 5HPMA 2ZXWB 1P6WA 2BNUA 2FEEI 3TBYB 1IARB 1HH6A 2FB4L 2FEJA 4A2MA 5HYSB 4OD3H 1PZ5A 5CS7A 3WEXB 5F71A 3PYCA 3OAYH 2J8OA 4HAFA 2DWEB 4R5VA 4N2MA 4F80A 4J3OC 3RTQB 1DBML 1RD6A 5IHUL 1NFKA 3W82A 3VFOA 2R2EA 4RNRA 4Y4FB 2B4CH 3SBPA 4HKJB 5JDSA 3SE4A 4A2HA 1EEZB 3MRDB 3CZGA 4X6BB 3C6LC 5DK2B 4WHTB 4Y8AA 4J1UB 3UZQB 1BMZA 1FYTE 3WLBB 4XMXA 2N1KA 4P9HH 1ZLWK 1MCFA 4J5VA 4OZIF 4LBEB 3S6CA 5CUSL 2CLZB 2CM5A 4APQD 1KCSL 1EJ6A 3ECUA 3N55A 3QXDA 5J4MA 3I3BA 3WN6A 4P5MB 4E0RA 1FDLH 2YBRB 4XP9L 2VR9A 3CDGB 4HJ0D 5DT1H 1TXKA 1CTOA 2W59A 2F54E 4Y0GA 3FU7B 4CMHB 2XYCA 4H44C 1TFHA 1EAPA 4YC2B 1FC2D 4G8GB 1E4WH 3FSAA 5I8OL 3GSWA 1JDDA 3KYOA 4ONHA 2GBTA 2VR5A 4JO4H 4XMWA 1IQDB 5IROD 1M56B 2EH8H 3UPRB 1U8LA 4P3CH 4FFZA 5IHUH 4A2LA 4YSPA 2WO4A 2AV7B 1G9NH 4IQHA 4MXWH 2DYPD 4YN3A 3B8YA 5J12B 1XF5A 4PLJD 1T6BX 2P48B 1KJMA 3LIZH 4OCRL 4R4NC 3APCA 1SQ2N 3FONA 3WYRA 1C5DB 2AABH 4JFXA 1Y07A 2VDRH 3C60D 1HYSD 5DJ8A 2C7FA 3OJDA 4AI7A 5B1CA 4DK3A 3U7AA 4F7PB 3VXMB 4YS4A 5J9PB 1VFBA 4UIKH 1T04B 2CDEB 4CNIA 2C3XA 3NCYP 3VFVA 2L4OA 3SPJA 4ODHL 4AQAA 3H9SD 4AGQA 2E7LA 1NM9A 1Z3GL 5CXPA 2K70A 4UANA 4I3SH 1TJIH 1CO1A 3A3YB 4QD2E 2DMGA 4G8FA 1P2CA 4FYRA 5KSUA 3ESUF 1WAPA 1PLBA 2A4EA 3VSTA 3GMLB 1WAAA 4DN4L 4PJIF 5C08A 3W39B 4Y8DC 2BJMH 5LO7A 3TBBA 3I6GA 1I3UA 1OAZL 1MFBL 4KK9C 1KIQA 3CSFA 5DD0H 4HJGB 5FLVA 1G87A 2VSDA 1MFMA 2CD0A 5DVKA 1XBRA 2XIDA 5D1ZB 1LEKB 3HI1A 4H26B 4HKXA 4TVPD 2E74C 3SYCA 4XNUL 1HCVA 3X13B 5DEFA 5C09D 3V0VA 1JF1A 2C4FT 2AJVL 2CQVA 4Z78B 2NY0C 3K4AA 3TBVB 3N04A 1S7QB 2HPOA 1FFPA 4UINL 1E0OB 1QPPA 3EOAB 3L6FA 5J13B 4IGBA 5CGBA 2O5ZH 3TBTB 3L2LA 4JRXE 3TEZA 2OR8A 4X9YA 3GKZA 4H2AA 1CR9H 1K4CB 3ARFA 4HJTA 4P2RE 4UTCA 2BVEA 5IG7B 2X2UA 2WVVB 2E7BA 3OR7A 4HCRL 2CDGB 3L45A 4LXFA 5DS8A 3RU8L 3TF7C 3I84A 1A64A 2GFBB 4RWHA 1KENH 4HIEA 3WL9A 5HYQB 3IKCB 2X41A 3FUKA 4ZX4A 1LWRA 3CMOL 2WSDA 1P7HL 1NUNB 3DOHA 4B9IA 2ZQKA 3QDGE 3L3HB 4M1DL 3S37H 4CDGC 3MNZA 3M8OH 5CCKH 2HKAA 5FUZL 1CTNA 2XZQH 4PJHA 2WJ7A 5I17A 2FK9A 2GUYA 3O9WA 1DQLL 3DYMA 3QAZC 3NACL 4D9QD 1B4RA 3P11H 5CEZH 1TZHB 2KERA 3BUTA 4R0LC 4I87A 1QPKA 1WFTA 5DD6A 4YWGH 2QFRA 4DVRL 2YN3A 3MJ7B 3T4YB 4F8PA 3QXAA 1CGTA 3BEWB 3DBXB 2EADA 3ZYIA 3S8FB 1FV1A 4JJHA 1DL7H 2IQ9H 4XMKL 1P1ZA 2NT0A 4P5KA 4CSZA 3S98A 2A9MH 4F7EB 1I9JH 2XZCH 4R0LB 4XO5A 3MV8A 2NCEA 2CO7B 3VXSE 1MCDA 4G5ZH 4RFOL 3BFQG 3E3QC 2CNZA 1Z5LA 1CLOH 4BFGA 3MREB 4PGCA 3QK0A 3SGKC 5IVXB 1MHCB 1D5BB 3U0TB 1TSRA 3K6FA 4OJYA 3BUIA 3O2DA 4P2QD 1DQDL 1JZHA 4DGVL 3VFPA 5IZ7A 4CW1A 4MRBA 5EF3A 3INOA 4WGVB 2AK4A 1GS8A 2ZYSA 3N06B 4LZKA 5I18H 3MA7A 5CIPH 2YGOA 4FNLH 5C6TH 2H45A 5E6IB 2A9NH 2GJZA 3AB0C 4M1CC 2IFGA 1JUFA 4Y2LA 3B9VA 3NZSA 2J6WA 1CGXA 2TSBA 4B9GA 1MQKL 2IQAB 4B60A 5L8JB 5TFSH 1UKSA 4L8DB 2DWTA 4TF4A 5B4MC 3OKNB 4HWEH 1U8NB 1ORSB 1ADQL 4UT6L 4HEPA 1Y18B 2XTJE 3K5RA 1NFIB 1T3FB 2ZKHH 4R4FH 3LNFA 1F90H 2BNRD 2FX7L 2P5WB 2NY0B 1ZE3C 3C60B 4MA8H 1QHPA 3SDXB 5DS2A 4D0BA 5K59F 4OD1H 5EUKB 5EBWA 4TLKA 3S3PA 4PQXA 1E6JL 3PIQA 1LEIA 1O9VA 5KAQG 4ZX5A 5KYWA 3GEFA 3ARTA 1HKLL 2E4FA 3ISRA 1RAMA 3TPUB 5DZOA 2LABA 4F7CB 3GMOA 4LVOC 3DJ9A 4PJ8D 5L4JA 1TVHA 5DHYA 4P23B 1OSPL 2DF3A 1QRNB 2XQBL 1VAHA 3SHSA 3G04A 5FKAB 4X6DE 3JBG7 4FQ2H 2LW3A 2YAOA 3Q2WA 4PSPA 3ZDZB 1M53A 1W2KT 4MNHB 3RWJB 4APQB 1ILUA 5TE7H 3AMLA 3Q8CA 4DGWC 2IDQA 3QDJA 3EGSB 1HL5A 4YR6B 4OF8A 1IEBB 1W8NA 3QH3A 3BGMA 3MRCA 2OMNA 4AXWB 1H6UA 4UM8B 1U93A 5IB1B 2W9DL 1OSPH 1GIGH 3FTSA 1SZNA 3QCUH 2HKFL 2UZPA 1YMMA 3RY5A 2AFNA 4IDJL 4HF5L 2EZ0C 2OSLB 5HYJB 3QR0A 3SYAA 4L1BA 5AB0A 1HDMA 4WFGD 2QELA 3L3OC 1TLKA 3H42H 2OMYA 4HH8A 3GRGA 4NCC2 3QFJB 2WWMD 4WTQA 4RZKA 3VFWA 4OGAC 4UYPA 1AOZA 2XRAH 2CSPA 2R1WB 5LNEA 2BFVL 2W8CA 3KCPB 2X9ZA 4AM0Q 2WSPA 3BVXA 2NY4C 3U4BH 5I0DA 2EXWD 1KF9B 4C56A 4WK4B 3ROLB 3IDXL 2KL6A 1N7ML 1T21A 1EGJL 3QZWA 3BP7A 5DZ9A 5C0FA 4IBUA 3DK0A 3QRLA 4A7GA 4UQCA 5BW7C 5FM8A 4L4TE 1LMIA 2GT9B 2ZD0A 2D7QA 3V9EA 2EDWA 5A2AA 2FWLB 4BH7A 3QHTC 3N85H 3SBWC 2HLAB 4OJFL 2C9PA 1QWNA 4M3JA 3F7YA 1JZFA 1RZKH 4JY4A 4Y19E 3FT0A 4HUCA 1A4BA 4R7NA 1DQDH 4GQPH 3IVKB 3AADB 3N0PB 4HIQA 1FORH 2X4NA 2XG5B 3QG7L 5BRQA 3UJTH 3KL0A 2G3NA 1PW3A 3JVFC 3TBCA 2UUDK 2HJKB 1X6LA 2WINA 2Z91B 3Q9QA 4O2EB 5AZEH 3ZDYB 4BA8A 5I0WA 1T1YB 2YXWA 4WI2A 1I1AD 4EI6A 1U8OB 2EO9A 1UZGA 1XF2A 1GSMA 5AALA 2A9ML 3L13A 3MBEC 1OAJA 3D9AL 3VRIB 3QRGL 3HZYA 2WUBL 4LLMB 2YGVA 3V0GA 2HFFB 5DRNA 3VFTB 3FO9B 4ELMA 3QZOA 5HYSG 3SD2A 1SVBA 5J06A 1II4E 3CHPA 1CFTB 4IOSA 4NAMA 1FG2A 3WJMA 2XG4A 1D6EA 5SX5K 4Y4FD 1KLFA 1IM9D 4H20H 1E65A 1IAKB 1MCIA 4B9PA 1SN5A 2YD5A 4UQ2A 5D96C 2XWEA 2F5BL 3QIWB 2LU3A 4MAYD 4QRQB 4HIHA 4KJPD 4YDVA 2FJGB 4EE2A 1I7RB 2DBLL 1GGIH 4P4KD 1T5KA 5IBUB 3MYJA 3QEHA 1S9YA 5D4IA 2HT3C 2Y1AA 4XTRD 2VDQL 1J86A 5D2LB 4F15B 4TULL 1XD1A 3UGXA 4CGUB 2F8IA 2VUKA 4ACTA 2F15A 4U1MA 2F2HA 1IBBA 4DKFL 1VFOA 3HS0A 3A4FA 5FECA 2ED7A 3A67H 4W9KC 5KBDA 3DV6A 4PJBE 1HKFA 5FGRA 2ZE0A 4DEPC 3KPOA 2DEWX 4Q4EA 4P49A 1EBAA 3FUHA 4IW4C 4X6CA 1PEWA 1OD9A 5SWSE 3O2VL 4A55A 3L3GB 4I4WB 4MJ4A 2NUTA 4ICXA 2WCPA 3D4CA 2E6QA 4GSDL 5AVQB 4YHNB 1NM4A 3V5KA 3IKKA 4XBEH 1IZJA 3NACH 3DSFH 1T7VA 4AEIH 4NFCA 4HJJL 2CAKA 4DFHA 2WLHA 3D39E 4OW6A 1I7TA 2F7IA 5DMJB 4JHVA 1P4BH 2GSGA 1QO3B 3KL3A 4OCMC 5T3XH 1UT9A 5BS0A 2WC7A 1OGAA 1B0RA 4KKCD 4G8GA 5D7JC 5E5UB 4PJHF 1CYXA 3QQ9D 1UWXK 4FYQA 4PFEA 4FLSA 1TJGL 1XIWC 2EACA 5JHLL 2BSTB 3U79A 1TSHA 3QDMD 3NFPA 1DBAH 4RA0C 1F2QA 3TONA 4E9TA 2O5ZL 1LXMA 3VI3A 3ARDC 4JMXA 3NJKA 1C5DA 3HAEH 2YUZA 1OTTC 4KQ4H 5E5RB 4Y1SA 1RVFH 5DHVA 5SWQB 1Q72H 1MW2A 4QHLB 2HMID 3WTWA 2E46A 3TLRA 5HP5A 4U0RC 3R06B 5CEXA 4TULH 4Y16C 4GS7B 4XO3A 1UWYA 5TH2B 3RVVC 1AXTL 4GRWH 1KELH 4PRHE 1OGTB 2XTJD 1H5BC 3TZVA 2Z65C 2K3TA 4KKCC 4G8FB 4DKEL 1WEJL 3DXAA 1JPGB 3HBGA 3B2UC 5DF0A 4W9HC 4GRMB 4EI5C 5ADOH 1MAJA 1BMWA 1BQHG 3KJ4C 2AQSA 3ERXA 3FAXA 4G80B 1XGTB 5AW8B 5ICXA 1S7SB 3JWNE 1KTLB 3CVHL 5EMYA 4PCSA 1RSYA 1ZLUH 3D3VB 1JFQL 2DS4A 5DHEA 1IFHL 1T0MB 1QKZH 4XXDA 4J2QA 1FZJB 3DURA 1MRDH 3CSTA 1R0AL 4JB9H 4K7FA 2J12B 4X4ZA 2XV6B 1ZTMA 1IQWH 5FKPB 4U1NA 3KZ8A 2G9HB 1EFXD 3TYFA 2DTML 2GBUA 4F15C 1O6VA 1P7QA 2XTJC 4JFQB 4Y9FA 2J5WA 3DO4A 3O2WL 2VLKA 3S48A 4C83B 1MLBA 4KI1A 4UUJA 1MNUL 3VM5A 4P2AA 3DRQA 5DWPA 3CPUA 4EIGB 4P48A 3MBXH 3PXJA 3QG7H 3FN3A 1IC7L 2ITDA 3HPLA 4NBZB 4PV9A 5CD5D 3JTSB 2IFFH 5GHWH 2KZWA 4JO4L 3AQXA 3L9EA 1UADC 3F6JA 1E4KA 3QR1A 4M4PA 1FNLA 3C2AL 3K2IA 4J7RA 3IN0A 2WKGA 2APFA 3L3HA 1YEKL 2MQGA 1HT6A 2D31A 1AIFA 4MNQE 4K94L 1J5IA 3FU5A 5GRVK 4KROB 4NHCL 5IJKA 3B9KA 1X5AA 3F83A 4HWUA 3CSYA 1JPSL 2BVYA 3Q43A 4RZCA 3TOPA 3I9AA 4P9HL 2NT1A 2QMJA 4OT1L 1B4JH 4GKZA 3N40F 5FW7A 4I3RL 3D0VB 3RVUD 3KPMB 1W9XA 4R97B 2ODIA 4HEPG 2ZP0T 1NJ9A 3MROA 5B3JF 1D5MA 3FO0L 5IROC 1EDYA 2CK0L 2A6KA 3O4LA 3ZX1A 3O81A 3BKJH 2LLLA 5L9DL 1ZT4A 4HDIA 4OM0L 5JQ6L 4ECNA 3CHRA 3DPDA 3T2NH 3ULAB 1K6QH 1V7MH 4JZJC 5GGRB 3GXPA 3VH8B 1GIGL 4Y1AB 2N56A 3O41A 2H1PL 3VM7A 5D5ME 4PRPE 1DN0B 1XCWA 4HMCA 2IVFC 3SB3A 2YO3A 5AW4B 1A7NH 3QJUB 1FGNL 1R3HA 1RUQH 3HC0A 3CFJA 3WO4C 1KPRB 3NOIA 5KVEE 3EGXB 3ARWA 5HHPB 1CYGA 5C0NC 2ZCLL 4GMSL 3QC5X 4L4JA 3KPQA 2B3RA 3KEHA 5LXGL 4PJ7A 4Y4KC 1XBDA 4FD0A 4APXA 2CO1A 4ONGL 3THMH 1ZA6B 3SKMB 4BFIB 2DEYX 5I30H 3FUMA 3B2MA 2EDNA 2JELH 2FIRT 4EVNB 1EAJA 2GPZA 4B7IA 1WHOA 1FVDB 1Z7JA 4PS4L 4XNAA 3KWUA 1CF1A 4MA7H 3OKKB 5I1KH 3C6LD 4H2CA 2O61B 3V4UL 4QI3A 2WGNB 4RQQA 5T1MA 3ARRA 1R5VB 4N8UA 2DB8A 4KNSA 4E41E 4PJCA 2DJUA 1X5XA 5DSCB 2NXZB 4WEMB 1ACZA 3THML 5JIIA 2VUOA 5JLZA 4U4IA 4P4RB 3D2TA 3QEGH 5I1DA 5MP6H 1Q9KB 3DIVA 4XXCA 4JFSA 3K5SA 5JPNB 3HG3A 3IF1B 5C0BB 1GKEA 5FOJA 1UM4H 1LO0H 4M5YL 4QHNB 4M5YH 1CDHA 3IDIB 3N43B 1BM3H 4BWWA 3AY4C 4P5RA 3PWNA 4DQAA 1U8KB 4D9RE 1QLEH 1ZXKA 3T65A 3L17A 5HHNB 1KFAL 2VLJA 1NCWH 1QSEE 2WXLA 3ZRSA 2GITA 4NUMA 4TUOB 4XMLL 4I1PA 4OZFB 1URIA 3QH3B 2J8HA 2HT4C 5FWRA 1U8JB 1F56A 4AEEA 2BIOA 4KJQC 3ZE1E 5TK2A 1GHFL 5C0EA 4F20A 2RD0A 1HHIA 4TQ8A 3ARGD 5HHOE 2VNCA 3V4PL 1XGPA 4PJCF 3UROR 4YNYA 2OZ4A 1XCQB 1GYWA 1P84K 3PXHA 4RAVB 4AG4H 2IAMB 3T0EA 2WZAA 4D3CL 1AZUA 2Y5TB 3RJQB 1QRND 3HRPA 5C7XH 4NZTH 5I6KA 3NABH 1SEBA 4HLZG 4P23D 3FQXA 4YHZH 1G6RB 4I77H 1S9WA 1D9KB 4C56B 1FWXA 4KKPA 2Z8SA 3ZTJG 1NBYB 3CZFB 3QNZA 5TDPA 1T0PB 3S3SA 5IB4A 1YVLA 5KTEL 1L7IH 1YPZF 3OAZK 4U2YA 15C8L 5CEZE 2CDFB 4BV1A 2F8OA 3COOA 1ZSDA 1WFNA 3D07A 2PYFB 1YY9D 1RPUA 2Z0BA 5D1XE 3QQNA 4FFZL 3TV3H 1GL4B 3BKYL 5E4EB 3EYOA 1A4KB 3OPZL 5FEBA 3H85A 1J87A 4X83A 1GPOL 1KGUA 2Y22A 4NI3A 1GOGA 5J6GB 4LLVB 5EOTB 4FFWC 2B08A 1CFNB 5CD3B 3RZWA 3ZSTA 4O2EA 2LOEA 5I19H 1S7WB 5A2JH 3RFZB 4XP1L 3HS0C 4GH7B 3ESVF 4MJID 3VB9A 1FBIL 4XN8A 1AYRA 3NVQA 4LEEA 5A6LA 4JN2B 1HFUA 4WHYG 4TNFA 1LP9F 5B1JA 4MYWB 1BFTA 1JGIA 1IFHH 1QFUL 4WSKA 5DLML 2VW4A 3SPHA 2XPGA 3BO8A 2R15A 5FF6B 3RLSA 1NDMA 3NJHA 1IFGA 3I75A 2PP9A 3L4ZA 2F08A 4LASH 4LLQA 1F00I 4DVBA 1RK1B 5I1EH 5PAZA 3BZFA 1W72H 3WUWB 4PVBA 2LT9A 5I1JH 3ZKSD 4XC3L 2DKUA 3LEVH 1Z3GH 3CG8A 4LCWE 4GP8B 1LLAA 3EBGA 4WTZA 2A74B 4JG0L 4QRUA 4MZRA 5IB2B 1DQJA 1NIFA 4GBXD 2UWEA 2DLGA 1CU4L 1N18A 1MCPL 3F64A 3RX9A 1MCPH 4U1MB 4WRLA 3WLWD 5I6XB 3OQRA 1YAZA 3PHOA 2J7LA 1M7DA 1MHHA 1DQKA 3GS4A 4FOMA 3VFRA 2Q8BL 5CP7A 1G9NL 1TZAA 4Z18A 3ABZA 4OI9A 4L4VA 2XVKA 4NQXA 2WWMC 3KS0J 3L3GA 4I4WA 4M43L 3UACA 5JIQA 1U41A 3PAVA 5BOPA 3MX0B 1YNKH 4HP5A 3N9GH 3HRZA 2NYYD 4H5SB 2ENYA 2VABB 2NNXA 1R47A 3NPSB 8FABA 2IWGA 2FGZA 5EZPA 1MCEA 4MD4A 3WKYA 3K6SA 1W0WB 1G7JA 4C55A 1MCWM 2ESVA 2D2CC 1TQTA 3FF7A 4XP9H 3U4EA 2N1TE 3QVAA 3IMRA 2WZ6A 2WQSA 1RL1A 3MRFA 5AVZB 5G4OA 5IJVB 5DDHA 1AXTH 4XNQB 4XMTA 1MLCA 1QYGH 1NICA 3RZCC 3WIFB 4MBOA 3TA4D 3ZQ9A 1Z5YD 2W38A 5ETUB 3ZT5A 1NCOA 3RTQD 4HA1A 5ALCL 5I1CH 1U3HB 3GBNL 1TZ8A 2YGPA 1AO7E 5KYUA 3K6NA 1IL1B 2DI8A 1TQSA 5D7IB 2J8UB 5CJOH 5GRJL 1FA4A 1AMXA 3GMPB 1UM5L 1N3NB 4PJ6A 3E1F1 1J5DA 3MFFA 1V8HA 3WEOA 5EPMB 3QJOA 3V0EA 3HJEA 4N0YH 1UOLA 1GGIL 1HL9A 1XGYL 5E8PA 3R0NA 4KDWA 2FEDC 5IBLD 3HE7C 4PY8J 1BAFL 1JWSB 1Z2KA 1ZKAA 3TVMC 4NJAL 5L8LB 3DROB 5DJ0B 2Y69B 2CK2A 1KJ3H 2W65A 1UQSA 3DSFL 5DRWB 4YXKH 2Y9RT 4BH8A 2CGZA 3NDZE 1K4CA 2D4FA 1SMOA 4JS7A 4F8LA 4Z9KB 3D3VA 5HSFA 1GRWA 5EO9A 4NC0B 2FO4B 1M9WA 1FSKB 4AKPA 3N41F 5C3TA 3SO3B 1AY1L 3K3QA 3UBGA 3PDDA 5GXBB 3VG9B 4B9CA 1FLRL 2OCJA 1PLAA 4KY1L 1BEYH 4HS6B 1NCCH 1FHGA 2ITCB 1PIFA 3MGAA 3PGCB 3D52A 5I1AA 2X4RA 1XR9A 5AD0B 1FIEA 4R7DA 2OXHB 3KPRB 1IEHA 3V55A 2HX8A 2V2XB 2R23B 1JXKA 5B8CA 4I2XB 5IK3B 4CVZA 1DBBL 5BPPA 3WNLA 5IVZB 1L4IA 5CJQL 4ZW8A 4BQCA 4HU2A 4URTB 2ROXA 3WIIH 3D4ZA 4QTFA 4XODA 5ALCH 5KOMC 1KEGH 3VU1A 3QS3A 5DC0A 2R29A 4IU2B 1RK0A 4XB7A 5C86A 3S8WA 4JHBA 3N85L 5E1HB 4LSRH 4R8WH 4HZLA 5H4YA 1NCDH 5HGAA 2A73A 2FQFA 1A6PA 2R27A 3IT8D 4BWUA 3NJVA 4YFEA 3CHSA 3UBXA 3DRTA 3P73B 3T3MF 3ZO9A 2PO6B 3EDFA 1EHLL 1JD7A 1FLTX 1G84A 1N7MH 3SKOA 2HSIA 3GWJA 1AGFB 1C16B 1UXSB 2E3VA 2VXSL 3QGVA 2Z64C 3SDAB 4HXAL 4EN3A 4PRIE 1CICC 3AQZA 4KI5C 5ALBL 4BK5C 2O93L 3VW3H 4GAFB 1YNKL 5E8EB 3B83A 2VSKB 3H9YA 3DX2A 3QQDA 3ZSSA 4N26A 3R4DA 3KPMA 2V3FA 1Q94B 1N5YL 1HWHB 1HZLA 1UD6A 2ZICA 1KBPA 1N26A 5BNXD 1ZLSL 5F7MC 1N64H 4CBZA 5GS1B 5TQ2H 1U3HD 4NZRL 1AJ7H 3SODB 1CU4H 2PCPA 5KYYA 3OX8B 4CILA 4JQXA 3SDDC 4NENB 3SDCC 2CIIA 1FG9C 4L3EE 3S4SB 1RUKL 4WI6A 3QUZA 1U95B 4JGUA 3S36X 1G6RH 1HI6B 3JVGA 3ZHNA 4J4PA 4OB5L 1Q0YL 1XV8A 1S8DA 3MCLH 3GRWH 1Z1WA 1UC6A 3G6DL 3HTLX 1AD9B 4HH9B 4XWGH 5I1EL 5FOBA 1SHWA 2HTKD 2ICCA 3BGFB 3PJSB 4L1LA 5KYWB 1C8PA 5HHXH 1UZ8B 4AV0A 4K71B 2Z93A 4EI5D 2XT1B 3UEZA 4LPVA 3TT3L 3FYIB 3FK3A 2HH0H 2OL3A 2I7SA 3POCA 4KKBD 3VQ1C 4KOBA 4LLUB 2Z4TA 1NUDA 3HAEB 5JNYA 1O7DE 2H2PD 1OAKH 5AL0A 2WNKA 1UD5A 1T0OA 1ND0B 5CZVH 1XDTT 1E6JH 4I89A 3ULUD 4NWTL 4MCZB 3QJQB 1E9PA 3IDNA 4ETQA 5FGSA 5F7LB 5MEPA 1C1EL 3CSPA 3ULVL 3APMA 4J3VA 1QLRB 2P24A 3GF8A 3CUPB 3MLUH 4MHHI 2LQRA 1DDHB 3SSGA 3BP5A 2BVUA 4G42B 4F1ZA 3GBMH 4D8OA 3V0AC 4XNDA 3MRCB 4AXWA 1ZT1A 4GBXB 2NLJA 1HJCA 4HEME 4W70A 1HZHL 3LD8B 1AQMA 1UWGH 3TEXA 4QJ5B 2OA9A 1BQSA 3BVUA 3GSOB 3HR5B 3SJVD 1GCFA 4EXKA 4KPHL 4A7QA 4HPHA 4DO4A 2JLPA 3MUZ1 5EC1A 5LXVA 1CBJA 1DFXA 1Y0LA 2FLBT 3L16A 3QPQC 4XPAH 1XL6A 2AQ3A 3DECA 3ZTCC 4CC0A 2OFQA 1EAOA 3L5XL 5BUGA 2AJYH 4ABVA 3NJLA 1XIWD 4KKBC 2MPAL 4UIMB 3E2HB 3TJPA 1B6UA 2IFFL 2UY6B 2BW5A 2UZXB 3BYTA 3HW7A 4QRSB 3WFHA 4OB5H 3P3RA 1MFEL 1H5BA 1CT8A 2QHLA 2R0ZL 2VOTA 1ZV9A 4O02A 5LG1A 3OKEB 3RY6A 4POZD 3IGLA 1MN4A 1L0XA 4UZGA 4UTAL 3MGOB 1JI2A 4GKSA 2B3IA 4WVRA 2EKSA 4ZW5A 3JT0A 3O2WH 4U1GC 3HHMA 5LJYH 3EJSA 3VD0A 4MX7B 3NCFB 1PDKB 1M6OA 1O75A 1XCQA 2DV6A 3PGFL 4LF3B 4RAHA 1U6AL 1D5IH 5CEYA 5CGYC 2GTZA 3BKCH 2YRZA 3C5ZA 4G9FA 4U6XA 1X5YA 4JY4B 3TIEA 1EXGA 1OAXH 3A6BL 1N12A 2ZJSL 5G55A 5ID1B 4Y4HC 5DO8A 4YFLI 4JDEB 5B3NA 3VCLA 3EJZD 4JGJA 3FO1A 5FLUA 4PEEA 5E70A 1A47A 4W6XB 1GVIA 1BLNA 2PYEE 4JFDA 3SGEH 3VGBA 4ZMVA 4JO1H 4WI4A 4KTEH 5DJZB 3MLSL 3AREC 3NJGA 3IDGA 4U0QB 3WDJA 2CDFA 1AGBB 4UQ9A 4LFHD 3SDDB 3G6JF 2J72A 2HJLA 2R2BB 3B9KC 3QCVL 1RZJL 1OCCB 1HZKA 1LD9B 1W91A 3NMEA 4G6FD 4LOFA 1W0VB 3JV4B 3WXVL 2BNUB 2SEBB 3TBYA 1NCDL 4I5BB 3SE3A 3UC0L 2HVBA 2C3VB 4B95C 3D69A 3FT3B 1PZ5B 2ICWA 5JW4N 5F21B 4YHOH 4GT7A 4GKNA 4CC1A 2XG4B 2NY6C 4PJGE 2FX8H 2YUVA 3MLYL 5D1XC 3NEOA 5FB8B 5J1SC 3EFDL 3LMJH 2YFOA 5SWZA 3QEUB 4OGXL 2BVPA 3RKDD 1DBAL 5F7EL 2XY1A 3VXQA 3BW9B 1XGUB 1SLUA 5ECGA 4FXGC 4LAQH 4OF5A 4RGMC 4HFUL 1FQ9C 3WN5B 2VE6A 2WV3A 4HIJA 2PWGA 4X4ME 4G1MA 4NBXB 1SJVA 2HAZA 5C09B 4IRZL 2XBZA 4M6OH 2H5UA 5D1ZI 3TO4A 3BIBX 2WLIB 3QIBA 4ZFOL 1SHMA 1XO8A 3KJ6L 3VFMA 2RQ8A 1IGYB 4OCWL 5AOZA 4OCWH 1H0DA 4GXVL 4N87A 3BC9A 4Y4HA 1ASOA 4MA1C 1QR1A 1OT1A 2FR4B 3KW8A 1TZIB 1MWAA 3BXNA 4OZIE 3SCMD 4K3DH 5FYLE 3MJ9A 5E5LA 2AEOA 3DX7B 4W6YB 2BOLA 2XOTA 4NC1C 1ZK5A 5DZNA 1BP3B 1MVUA 4MWFB 1E5BA 1EX0A 1R24A 2VN5A 1G7QA 2YPLA 2N7AA 4GP5B 2CKBH 3LZLA 5CJOL 1UH4A 2OMWA 4O51A 3IJ8A 1OGAB 2X4PB 5EU3B 1YEFL 12E8L 3SO3C 3M88A 2YBGA 1CDBA 5EF2A 2DL2A 3FO0H 4MB1A 3ZZSA 4FFVD 3W11C 4PCTA 1JVLA 2DBLH 4DP7X 1AQKL 1MFBH 5DJXB 2NNAA 2JB6A 4Y2NA 3VD2A 2BJML 2X4TA 3C09B 3JZ7A 5LGJB 5C08B 3W39A 2B1AH 5TDOB 2V9RA 2PWFA 3LIZA 1OV8A 4G8GD 4PY8I 4G3YH 1FNSH 1QD0A 2H8PB 5EO0B 4FXKA 3HNVH 1CN4A 1JHKH 3SQOL 1A3LL 4QNPF 4X50A 1MCBA 3MSPA 5D7LB 3GZKA 4OGQC 1W72A 4HIIB 1AD0B 3LKRA 1ZVYA 4Y88A 2E9GA 4HJ0C 4M62H 4AIEA 2MNUA 4BUHA 3DXAB 4E68A 2C1PB 4WKXA 3NH7L 2DLHA 2DLFH 4FZEH 7CGTA 3IETB 1G4MA 1RPKA 4AENA 1MWAL 2BDNH 5EEYA 2D4DA 4J6IA 2P52A 2WLJA 1A9BB 3TP4A 1MJ8L 2B5IC 1NINA 2JJVA 5DC4B 4JDVB 2ADIA 4YSOA 4GQ9H 3BVDB 4ETYA 3DDGA 1RZIA 4LP8A 4EI0A 4S1SH 2PYED 5CF3A 3CLEL 1MPAH 5AB9A 3NTCL 4MNQD 3QR2A 1OF2B 3RG1C 1IBGL 1A0QL 1O7SA 4V1DD 4ES9A 5FGCB 4XPTH 2JK5A 1FDLL 1T7WA 1EFXA 1FRGH 4POUB 5TD4A 2GEQA 1A6VL 3NPSC 4MZ2A 3HC3L 4BH8B 3DUUA 3IDMA 1Y6MR 2XI9A 2VLLB 4ZPVB 1SDAB 3JUYA 3MV7A 5J5EA 3IN2A 1P7KA 3K1DA 3NP3A 4JPKL 1SOKA 3MJ7A 1YUKB 2VIRA 1K4DB 4QY8B 4RX4A 1MW0A 4KVCH 5FYKU 4Y4FA 1PEZA 5T3ZL 4HKJA 3UJIL 3OZ9H 3NSXA 5D70H 1Q8MA 2QDVA 2X0VA 5IEKA 2VKXA 2MQ0A 4NWUL 2ITCA 3PWPE 3FB5A 1HZHH 3ZPDA 5FK9A 3QORA 3QWRD 4R7VA 2Y2WA 5E99H 3E38A 5H2BA 4D9LL 2YS4A 3LKNA 4KX8A 1NBVH 2A74C 1DZBA 4QT5A 5I0YA 5LDUA 1BZDA 3GGWB 3RP1A 3CLFH 3NCCB 5GS3A 3FOLB 1CLZL 1G5GA 1M7UA 2CBMA 3HFMH 4G8AC 3L54A 2QVMA 3WEBA 2MKWA 4CADB 2EVHA 2QEJA 2R8SH 4QRTA 1YDPA 5KSVB 3ZR5A 2J88H 3NFSH 2OZ4H 3P1VA 4RSVA 3NCWA 2J55A 4U1HA 3FQYA 4M03A 2YAEA 4N1CA 3D3VD 1J8HB 3R0MA 5DI8A 1CDIA 3MNMA 4MQ7A 1OM3L 1QUNB 5CZXC 1ZT4B 2K1MA 4ES8A 4OZGE 5HHXL 5KS9A 3OAZH 5FW6A 2XNAB 3FBKA 3S96A 4Z7UF 5T1KA 2ATKA 3U4AA 4L9LC 1S7VB 4PVLA 4JAMB 3CFDB 3F84A 3WJLA 4JFPB 4Q74A 3VXMA 1ZLDA 2JKSA 3FS9A 1OQOA 3JTTA 1DN0A 1CUOA 1KCVH 4IIQA 4K7PL 4OCXL 3GHPA 5CSZA 5IF0B 3QDME 3O6ML 1MELA 5F9DC 3JV6A 4PJAB 2ZONA 1FVCA 2C7UA 2W0FB 1AC6A 4KAQH 1A6AA 3TTSA 4N0CC 5KSUB 4AIXA 1J8RA 2IDCA 3UYRL 3BZDA 4AG4L 3VFSA 4WFEE 3EGDB 4XB8A 1KB3A 5E4EC 1OHZA 5FO7B 4JJ5A 1MWAH 2BDNL 4FG6D 2ZX8A 4BA0A 5C3LD 4JVPA 4L5FL 4UTAA 3VGEA 3PL6C 1NCBL 2V2WA 2IG2L 5D72H 4MJ5A 4FF9A 1JSYA 3BFWA 5DEFB 1YEGH 3MCG1 5FYLH 4Y9BA 5GGVY 5C0AA 2ARWA 2C9AA 4IEFB 1QVOB 1L7TL 4KFZC 4NO3B 5DUPH 4JGNA 5TTRA 2APBA 2PR4H 3K71A 3V6OA 3BJLA 3O8XD 4ZSOB 2Y7LA 3HR6A 1QSFB 4N85A 5A43C 4Y7OC 2WCGA 5FPIA 5HVWA 4GKLA 2WTOA 1NCBH 2XVGA 5HYJE 4AE1A 4EZLA 4E9LA 1YQVL 5HYQA 1KTDB 3IF1A 4PJEF 4LRIC 5ESQB 3L3OA 4JFZH 3F2LA 4G5ZL 2JKLA 1IEAA 3OAWA 2BNQB 1DANT 4OCSH 3S5LG 2Y3AA 5BXFB 1A7OH 1I9JL 4NDMA 4IOSD 2M83A 3C5XA 1PLCA 3FT4B 1JJUA 2PW1A 3K8KA 4DEUA 1YEFH 3HG1B 4AZUA 3VJ6A 3M1BA 4C4KO 2NYYC 4TUOA 3RGVB 1WDAA 4OFVA 3U1PA 4AV5A 3FL7A 5DMKA 4YE4H 1A02N 3QUYD 3G6AB 2CCWA 2EC8A 2HZHA 2LU5A 3X12A 3ULVH 2BS8A 1CD9B 1UENA 2JCCB 3EBIA 5I30L 5I6NA 4LCUB 5D7HA 3WG7B 4HZAA 3UTZB 3HE6B 2JKWA 5I2IA 1R3LB 3U30B 3EJUA 5L4IA 1QPXA 1T5XB 2VZTA 3MLTB 1CFQB 4XE5B 2IAMA 5A2LH 1WYJA 3AXLA 4ZXBB 3US1A 2ZOLA 4Y2OA 3G5ZB 3PQYA 3GHBH 5DJYA 2BSSB 5E9DD 5J6SA 1FPTL 1T5WA 4TYUA 3WS3B 4CKQA 1YN6B 2XIBA 4MB5A 2WQRA 4GI9A 5TDNA 3HFML 3C87A 3DOSA 1RIHL 1PNDA 4PLKC 3UGUA 3K72B 5BRZD 1E8XA 2GJ6A 3T77A 1JWMB 3BSZH 1SDDB 1WBZA 3AQYA 3UZEA 5C6PB 5JIPA 3DPBB 2FIKB 4J39A 4OU3A 5B8CC 1MZZA 4HUMB 4I48B 3HUJA 3LVEA 3S37X 2VXVL 4J28A 4PJFE 5L6YL 4Y4KB 3TWCH 3LPPA 2DH2A 1KB5L 3MJ9L 2VDPL 3OZ9L 3D06A 4IK7A 5IHZB 4KMLB 3RI5F 5KVFL 1T3FA 1SF5A 3ALWA 3D08A 4HCRA 1UOWA 3UG3A 1W80A 4O4YL 3S97C 4JO3H 3UTSA 4B53A 4DTGL 3IEAA 2GHWB 2GABA 2UZIL 1RZ8A 1RHHA 4WUUB 2G60L 5SX5H 4ZFOA 2R2BA 4WJ5A 5FX3A 4YHML 43C9A 4GI6A 4QRRA 2NY3C 1IGIH 1ZLVK 2A6DB 4C47A 4GO8A 5C0AD 3CFBA 3DBSA 4QRBA 3CVHB 3IJEB 1NMBH 2O26U 1IBDA 4H1LH 2CPUA 4N28A 1W15A 2CLVA 4YFLF 1QMUA 4ELMF 4F7CA 2YOCA 3N9GL 4LCCC 1CLCA 2XA8L 1BOGB 1PSKL 3MN8A 3RWCB 4EZMA 3J2PA 1KEML 2FT7A 2ZAHA 5GZOD 3GZPA 2R2EB 2P8PA 1BQUA 4R97C 4BCXA 5MENE 1FGVL 4JPVL 4ENED 4WWID 3QFJD 5J3HC 4BBWA 4M4RB 5IMOB 1T2JA 1U0QA 2WOYA 5FDWB 1NGZA 2X0UA 5GGTL 2D3JA 3UH8A 3LY6A 3P4MB 4NM4L 3MUUA 1SNRA 1FL6A 1S7TB 2YD4A 4HGWA 1VZIA 3TFKD 1OB1B 4MDJA 3K6IA 3R7QA 1C5CH 3HG0A 5F7DA 1KGCD 3HZKB 1OGPA 4I9WE 1F3RB 2CA3A 4HIJB 2NW3B 4QXTB 5DURD 5E6ZA 1KGCE 3O8XA 4WCYH 4UM8A 1PCXA 5IB1A 2PN5A 1UKQA 3D39B 4UV4L 2DLTA 3OGOE 4MAUL 2MMXA 4YHMH 5DQ9B 1JHLL 3CZUB 1OPOA 4KHXH 2MOVA 1QAWA 4FXLA 5FW8A 1EEQA 5AAPA 4NN7C 2NY5C 4LQ1A 1F4XL 1EJOH 3PL6A 4R8WL 1ITBB 4ADIA 3QIBC 4U49A 3SY0B 4RAUA 4LMQI 5HI3D 3WNIA 2NY5H 4YBLC 1CLVA 4DKEH 3MX0A 3IDUA 2VAJA 3QDHA 5KUKA 3AT0A 5C97A 1OY3B 1TO5A 4UDTB 4GRLB 5FUCC 5FXCH 5GSVA 5E7BA 2OI9B 1QFUH 5DLMH 4EBQH 4JFXB 2XY2A 5B1JC 3U30C 3AWGA 4N90E 3N1MC 3FPYA 3P3YA 4AL8C 1T66C 1FAIH 3QZWB 4LIQE 5DHVB 5SWQA 4RFOH 1WO2A 4CSPA 1UHVA 1K8IB 1L9MA 2N01B 3PP3K 3MBED 3BWUF 5T3ZD 2FB4H 5EU3A 4MJIA 1IC5H 2KQNA 1OZTG 5FYKL 3QWRA 3FH5A 4QRPD 1HXKA 3WIFA 1FLRH 2MTPA 3B5GA 3VB8A 3QO1A 4MA3B 4FQXD 3UCQA 3C75A 3RWEA 3ZGHA 2IH9A 5I75B 5HHVL 3CZEA 3MRKA 2CKBB 2OMVA 4HS3B 4ORGA 2HXAA 3MRPA 3TNNB 4J3WA 3P11L 2LHAA 1NTDA 1CE6A 5D7IE 4QXGL 1OARH 4ZNEA 3QIBD 4QPEA 4NPYB 1SYVB 2H8PA 4H88H 4HWZB 3R8QA 2YQ2A 3BOVA 4AK1A 1HL4A 4KNQA 2B1HH 2CUIA 4IBQA 1N2RA 1XSOA 4UILH 4UNTA 5E6ID 5FFGA 4P4KC 2APSA 2VO5A 3VQ2C 5F6IC 4HHWA 3C5SA 1G7LB 4LARH 4OJCA 2H26A 2VM4A 1CE1H 3ARDB 3FQTB 1F5WA 2IPTL 5F88B 1QLFA 4UTBH 3HMXL 4JRXB 4XNZB 5DD1H 4F5CA 5HHMB 2VR4A 5GGTA 3WJMB 3BKML 3ETBF 4N0FA 4YHKL 3GSVA 4UQIM 3MYZA 2Y4SA 5EWIL 2QGBA 1GGBL 2VDNL 3QXWA 4D9QE 1LJMA 4G70B 5D93C 3PWVA 2ADFH 5HDWA 4B5ZA 3PWLB 1FO0H 4NCDA 4D0CA 1CF8H 4F7EA 1KIRA 4JM2B 1C12B 4GYBA 3LV3A 1O0VA 4JHWL 1ZJBA 5D2LA 3C9NB 3SQBB 1U91B 5KVDH 5KVDL 3DUUB 2H0FA 3U0TA 5BMFL 3G5YB 3FU7A 3MRGA 4DP2X 5D7JD 4XOBA 5J11B 3G9VA 4K2UL 3NSJA 5HGBB 4PJXF 5D7SL 4DEPB 1TJIL 1CK0H 2C4XA 3LH8A 4ZAKD 1QG3A 2DH3A 1HE8A 3QI9A 3DMMA 4QYOB 4M1GL 4MD5B 4TSBL 3CX5J 1BWWA 3DJSA 3Q5YA 3UYRH 3BEVA 2IDSA 3WO3B 4ZZFA 2YSTA 1DEEA 2BZ7A 2NTFB 4TVPE 2XC8A 4Y5XB 1AGFA 4L4TD 1KTJA 2CE6A 3IJYA 3OVUB 1JGEB 3QWQB 4QGYA 2APWA 1PZ3A 3FOMA 3IB4A 1VACB 4XZ4A 5F1NA 4KKQA 3C60A 1OLLA 5I66A 3ARUA 2R2HA 5DFVC 3T9WA 2QLYA 3ZL1A 4D0BB 3ZTNL 1Q94A 3GBEA 2QDWA 1E4WL 2ITEA 2AKRB 2BIMA 3L5WB 1SJHA 2GTWB 2A9AA 3QI9C 3L1OL 5DI8B 3ZE1F 2F7QA 4NUGH 1YEEH 4X0KA 25C8L 4YBHA 1NGXA 4Z7OB 4QNPE 1EEYA 3BDXA 5F96H 2EYTB 3NEXA 4Y5YA 3VFGL 4ZAKC 3L1FA 1I4FA 4YDMA 3LAFA 3CC5B 5DJ2B 4AZ8A 1D2PA 1WBXB 1LEGA 4J4PD 4XHJC 2W88A 3LB6D 3QUZB 1FZMA 2ZF9A 1BFSA 2VDLH 4MNHA 3PJNA 3IBOA 2O6FA 2XZAL 4QKTA 3QUML 4RQQB 5H37A 1EO7A 5DFVD 1NDTA 4Q52A 4U3SB 2MKLC 2WANA 3FO2A 5I19L 3QB7C 5L2KE 1MIML 2CALA 1ROCA 1UZ8A 1TVHB 1MZYA 2Z93B 4XR8C 1QSVA 1FAIL 3LH2L 5AKTA 5CZVL 3LH2H 3O3AA 4G9DB 5DJCB 3RNKB 4GMTL 3G6JE 3JV5A 1Q9WB 3I6LD 4PR5A 4Y5YC 5ID0A 1A1OB 3NCJH 3MV9D 3RURA 1NANH 4K7FB 1YEJH 1ND0A 1DJSA 2QSCH 1LO5A 4YHPA 3K80A 1F4HA 3QXVA 1ICTA 2TSAA 3UZVA 5C0AB 5K39B 4WEBH 5KTEH 1HCYA 1A7PL 3ZLQC 1F4XH 5F9OH 5I17B 5DUBA 5FC9A 1MNNA 1BD2B 2JTYA 4X5XA 4AM0A 5E2UH 3RUGA 2EUWA 2DN7A 5EA0L 2ORBH 3DRQB 4DK5A 1UTDA 5EUOA 2AXWA 2ICES 3AXIA 4HOXA 1F3JA 1E4KC 4N8CL 5C7XL 3BPCB 4NZRH 1PKQE 2OYLA 3CPLB 1Y7VA 3INUL 1XTLA 4BH7B 4ZMWA 2XFGB 1R5IB 1XZWA 3G5VB 1RUAL 4TLUA 2VDML 3F00A 3ZHDA 2B59B 4Z7WE 5JMOC 3CZSA 3L95A 3B7SA 1JPTL 3GXNA 3HNTL 4KJQD 1YCSA 3ROLA 4PJDB 3AWFA 4NUPA 5IVXE 1D5BA 3VX1A 1YC8A 4UOJA 3GM0A 2FSEB 1OSYA 3MGOA 3ULVF 3OKOA 4FQJH 5ENWA 4XNYH 1P4IL 5CCGE 1ZK9A 5K9JH 2UV3A 3ZE0F 3HN3A 3PG2A 4G7VH 3BAKA 1JMXA 2G60H 3VFTA 3N91A 2ODHA 1UM4L 6CGTA 4LVOB 2IPKA 4A2FA 1TYRA 1G9MC 3QIUB 2CR6A 3OKDA 2R56L 3KR3H 5EU5A 1TU2B 2QR0A 2ZUXA 4AL8L 4OI8A 1WRFA 2PXYA 1I9RH 2X4OB 4PLOB 5B22A 4MNGA 2VH5H 2WINB 2CH8A 2Z91A 3SKJL 4HSAC 3HS8A 3UC2A 4JHWH 4ZW6A 3ZT7A 3O4OB 1N4XH 3V0IA 2ETWA 2X4UB 2YA1A 4MS8D 1MRCH 3SDXE 3C60C 3U9UB 1HYSC 3FU9A 3IDGB 4MXQC 4UZSA 3NPZB 4PU2A 4MVBD 2VLKD 2ADFL 4JQXC 2ZUUA 3SDDA 4BK8A 3CDZA 1ZGLA 3B43A 1WLHA 5BO1H 5B7MA 1GGBH 1JV5A 3F8UB 4JE0A 4WFHE 4G1EB 3LZNA 4KH9A 3FU8A 5CGTA 4EUPA 3B9EA 1JE6A 3QC6X 4ZMQA 5BJTA 1UCBL 2FWOA 3U83A 4UTBA 1DL7L 2IQ9L 4P46A 1UB6B 4TNEA 4APXB 1NDMB 5CO1A 3SBWA 5K9QI 3RZCA 4FNSA 1CJYA 2IOOA 4DZBA 4HIHB 2R4SL 1I1CA 3TCTA 1PJ9A 4WNSA 1YNTF 2OMZA 5E9NA 2VT0A 3D5OF 1DQLH 4Q0XL 3Q5OA 4YSUA 3UAJC 1A7NL 1U9KA 3DX6B 2ZPKL 1UXWB 4NNYA 1AE6L 3BPLC 5T1MB 3WN5A 1R5VA 3A23A 3VD5A 4ZX6A 4FMFA 4PJCB 1JYXA 3KLHD 2Q7YB 1I3RA 3GSQA 3HCVA 4L1DA 1CWVA 3FRUB 3OTTA 3TZVD 1HINH 4QF1A 2J21A 4JHAL 3NP4A 4WFFE 2WXJA 2AXFB 4W9JC 3KH4A 4HWBH 2OSLA 4MVBC 5B4MD 4AGPA 1ETZA 3RB5A 1AXIB 1N8ZB 4X2UA 1NZRA 1V3KA 3NABL 3T0DA 3HMXA 4Z3TA 4ENZA 4HU8A 3WD5H 4CDHA 4KDVA 2ZCKL 1IC5L 2ZCKH 4FTVE 4C4BA 3BWSA 1WTLA 3PNWA 5INDB 3VD7A 3ZQXA 3TCXA 4FFWD 5FO8B 2H3NA 5GRUL 5CNHA 5FYKE 5GGQL 3UC0H 3JT2A 4IIQC 4MTMA 4N0UA 3VGGA 4EZKA 5HHQB 2X1QA 5A2FA 2QHRL 4QRRD 5EIIA 3KPTA 1TTUA 1HXMB 3UIZA 4K94H 4QHLA 2ARJB 3QXUA 1MI5B 3R06A 2PWDA 3DGDA 4U6HB 2IPUG 1VEPA 3MLRH 4P9HC 4MJHA 1XEDA 2HFGH 1K5NA 2DQUH 3EO0B 4DGYL 4YK4B 4H20L 1AANA 2NX5A 5F7HA 1DHKA 3GMLA 5AAMC 2NNAB 2GIMA 1LE5B 2R4SH 2YMXH 3I02A 2KUTA 4DZ8A 5ITFA 1EHXA 1A3QA 1A22B 3IAQA 4AUYA 1EK3A 2X4NB 4GAAA 4OD2B 3FUNA 5AYUH 3ZZLA 2DOCA 5EO1B 3PHSA 1C5CL 1DO5A 4FXKB 5E23A 2ZYRA 3VA2C 3X13A 2F53A 1MG3C 1XB6A 4FEMA 4M9PA 2BVQA 5FDYA 1HHKA 1KCRL 2ZWSA 1OL0A 5GSRB 1HK6A 3MO1A 5C0RH 4FLOA 5KG9A 4DSYA 4AEHH 1PD6A 1XFPA 3G5WA 4ELMB 5F3HB 2ZAGA 1M3JA 3I3DA 2WQAA 3P30H 4XN2A 2P43B 4XX5A 3HB3D 2BRRL 3ZHFA 3JWDC 1RZKL 4LCIL 3QJFA 2BERA 1ZHKB 4BM7A 1LWJA 4H7VA 5ADOL 2FO4A 2WVUA 4B0MM 3HPLB 1KIPB 3DGGA 2ORBL 3T71A 1LQSR 4NHUA 4IRZA 4HLZH 1QBLL 4U33A 1T1WA 1ZVSA 3F65A 3GUFA 2J88L 1G7LA 2F58L 4MDRA 2VLRB 2YAHA 4GIOA 3MBWB 1MCJA 2J73A 4FQJL 4MNQB 1LDPL 3T3PE 3LZPA 4PJEE 1XMWA 3O6LH 3KDPB 5LG6A 2DZEA 3QORD 4I2XE 4LLYA 3M07A 5JUEH 2JJTA 2GCYB 2XKNA 3D8MA 4NP9A 4UCFA 1CVSC 5CKGA 2W07A 4ZW7A 1IKNA 5KVFE 3TC9A 1UJ3A 4AVJA 4RFNC 3N6YA 4N3UA 2X6BA 1JV2B 3H42L 2ZUTA 1BVZA 5SWSB 1UYWH 2UX7A 4P8QA 3ATFA 4P99A 3V0HA 4FI8A 3WMPA 2JXMA 2A74A 3KXFB 4XXWC 4N8CH 2GY5A 1MAMH 3P4OB 2P26A 3FONB 3IPFA 3X11A 2EXWC 4HJJH 3L3JA 5IBTH 4LESA 1CICB 1CFBA 3PDOB 3S3CB 4XBEL 1XMEB 3EH5B 3RIKA 3S4SG 3P3TA 1CL7H 5F0LB 2ATPA 5FYJH 2IV8A 2H0EA 4GJTB 3VD4A 1GGCH 1HN1A 4WEBL 1BF5A 1YDPB 4FQLH 5L88L 2YEZB 1D3CA 1FFNB 3CLEH 2RB8A 1HCFX 1EPFA 4KJPC 4OKVB 1NGYB 3IXAB 1YNLH 5HGDA 4KXZI 4ZQKB 2LLNA 4BDVB 4HPYL 4KDTA 2FECI 2HT2D 3JTBA 1QHQA 2R4RH 4Y1AE 5J57B 4HJGA 2HRPL 1GHFH 4JL1A 5L0QB 4MZIA 1WFMA 4YAQB 5BQDA 3QO0B 2HA1A 1YMMD 4L3EB 5CEXB 5FO9B 3HJ0A 1RJLB 1CLYL 2C4FU 3MNDA 3L7FB 4MMZC 1ZHBA 5L7XH 1HNGA 3BRGC 1G1CA 5I0VA 4OGYH 4NO0B 1E8WA 2C7UB 2W0FA 4HWEL 2YGQA 4NKOA 3KNBA 1TZOA 3FUIA 1S7UB 4M00A 2W1NA 5AKRA 3CSBA 4N9GA 2OR9L 1GOFA 3KLKA 5AAWC 1HAUA 1I4FB 1BZ9B 1CS6A 1SBBA 4XPGH 1N3NA 2DJMA 2WBKA 3JXAA 4CKVX 3ATEA 2OULB 1LEGB 4L4VD 5JXEA 5C6TL 3ILQC 4QHNA 3GFUA 2DM3A 4WIQA 4HFWA 4Z3JA 3MJWA 2W0KA 3SN6N 3OXRB 1A6TB 1U3ZA 2DY2A 3D9AH 2Z7ZA 4PV1C 2AK4D 1E9PB 3TVMB 1KN4H 2IDTA 4B9YA 4P2QA 1IEBA 3FCBA 1M1XA 1I9IH 1NKRA 3CUPA 5LBSH 2RFXA 1CLOL 3WIHA 3V95A 3F7VB 4AVIA 3U0PA 1UXLA 1KACB 2YPKA 1YMMB 4L3ED 2H9GB 4P4RA 4BKTC 4BUGA 4EKJA 4UV7H 4FA7B 5I16B 1R5WA 1TOXA 2D3NA 1AGCA 1X5MA 2F1BA 1A1NB 2I07B 4RFNB 3UO8B 2R7EB 3QFJE 1SXAA 1UUSA 4RGOH 4WTWA 2AQNA 3BP4A 2BNQA 3C5JA 4NRYB 1ERNA 1LO5B 1ULVA 4NDMB 1AYOA 4Q6IB 4HKZA 1EHNA 3D87B 1ANUA 3LDBB 4G6FB 4P46D 4W9DC 4JLRA 1P5VA 1JP5A 4X8CA 3SYPA 3D2UA 3VXSB 4Z7UE 1IGFL 2HG5A 2XKUA 1PIGA 3DSNA 1OCWL 2VZVA 4LNRB 4V1DA 1U8PB 2Z3FA 1B3JA 3G6AA 3GIVB 5E6YA 3SEPA 1F1DA 4S1RL 3RE0A 2EEAA 1N8OE 2X4QA 1EEUA 1JVKA 1PDKA 2WLKA 3G5XA 1VKXB 2Z7UA 3LIUA 1ZSDB 2WXFA 3QQ9C 4M7KH 4PRAB 5FUCE 4HZLB 5HGHA 3REVA 5CEYB 5ITBH 1QFPA 5L9DH 1SEBB 5JOEA 1B0GA 5DJYB 1MRFH 1QRKA 1U8NA 3BZ5A 5IIEB 4YHLH 4BYHA 3MRJA 3ILPB 1XSIA 3X1GA 1UVQA 1MI5D 3REWA 3DETC 3VXTB 4YQXH 1C16A 1UXSA 2WXHA 3HMWH 5GZNA 1XGRB 3ABLB 1CXKA 1S3KH 5DD1L 2D7TL 1XF2B 2DQ6A 4LSSH 1B9ZA 1JPSH 3LRKA 4AGNA 2AEQL 2QQKL 4Z3HA 3UJIH 4EIZC 1QBLH 5CD5C 3O9WC 1UD2A 1F4WL 2DWDA 3OV6A 3EGXA 2XX1A 3UYPB 5HHPA 4KQ3H 1JYWA 1L6XA 4HQQL 2IIJA 2SEBA 4JQIH 4LSTH 1OAQH 1X4ZA 2GHZA 5IMLB 2M8XA 2WKOA 1QNZH 1I1FB 1IAKA 1OARL 3I3EA 4PPTA 5DHYB 1T6VN 4YXLL 4JY5H 1HKLH 3UCRA 5FV1L 1N68A 5I1GH 3BQVA 1HOCA 3NRPA 2J43A 5JDSB 3OG4B 3AXHA 5FO2A 4AUUA 4F2FA 4WHTA 5AB2A 1RZ8B 3NTCH 2IH8A 5A3IC 1RHHB 4WUUA 4QDGA 4JVWA 3PGFH 1OK8A 4JFFE 3FB7A 5IW1B 4BZ2L 4JRFA 4LOUC 2VDRL 4YR6A 1YYMH 4BZ2H 5IWLC 2DTMH 4G1EA 3QJSB 3EHBC 4QRUB 3GXDA 5E2TL 4EUPB 2NW2B 1OWRM 1GW6A 1P6FA 2ICEC 4K73A 2F54B 2DYPA 3HS0B 3IRZA 3B2UD 3RFZC 1G7HB 3MCKB 3KPOB 1JFQH 1HDMB 2NZ1A 4PD4J 1GZPA 3IS0X 1A9VA 3E6FA 3MRQA 3U6RB 2MPAH 2VR7A 2O5XL 3NJNA 4N2NA 3L5XH 4WU7A 2HTLC 5ESVB 1I8IA 4NO2A 1QR1B 2OJ1A 3P0YL 1GJWA 2A99A 5DMIL 1OB1A 3ARBD 4KUCD 3L7EA 4XNBA 4Q9CA 4ZTOL 2RMNA 2VYRE 4NNPL 4NQCE 5T5FA 3NQKA 4KPHH 5JPMB 4JFVA 1WIUA 4JVUA 1KCSH 4H8HA 3ETSA 3H9SA 1IIKA 5EU6B 3MODL 1HQ4A 1KELL 3CN3A 5HYFA 5HY9B 1EWHA 4LCWD 2ESVB 1BFOB 2NRDA 3V0FA 2KPWA 4ODTH 4XCFL 5E7FA 2CHZA 3C8DA 3K0WA 1HHIB 1WC7A 3E8VA 4O51B 3ZIMA 4XPBL 2FL5A 4ZMOA 2B4CL 2YRPA 3CQPA 2E4TA 1FI8C 2NXYB 4N0RA 2ZF8A 3BN9C 3KM1A 5CGYD 3R7RA 5K9KA 4NC2B 4AYBA 1F1AA 4H0HB 5ISZB 2G4GA 3OMIB 2UXGA 1M57B 4Y4HD 2Q86A 3MRNA 4TOYH 2V2TB 3RKDC 1JNJA 3MRLB 3WFHB 2MNWA 3P2DA 4IDJH 3H55A 2V7NB 1YAIA 4GUPA 1JTOA 4G6JH 3CZFA 5TDPB 3DIFA 1T1YA 2XV3A 1KBGH 2EVJA 3WBDA 1MCLA 2F7PA 4NXKA 2ZWLT 1VA9A 1RUPH 2N4IA 1KYUA 1N5AA 3QPKA 2BNRE 4GSUA 2Z4QB 4JL2A 4UOW0 5C0IA 1YC7A 5TE6H 1U3HA 3GJEA 4G7QB 3VGAC 1S3KL 2EKJA 2W65B 1V05A 4OZHB 4TSAL 1JF5A 1CQYA 3ZYOA 3LEYH 4L37A 3H0TB 5EOTA 2Y7NA 3CBRA 5DYOA 1SEQL 1CFNA 3VFUB 4XN7A 3LKQB 5E95B 1R9FA 4HFUH 5EN2A 3TWCL 3WAKA 1VEOA 4QXWA 4TVUA 3MMEA 2HVJB 1OEZW 2NXZC 2AJVH 2ILLA 3AM8C 4ATWA 3MCYA 4N20A 2Y3NA 1QOKA 4KDTC 1ROWA 2YKLL 1BJMA 2YUXA 3PUCA 1JGUH 4ZFGH 2JJSC 3W2DH 5DHDA 1BOYA 2QPFA 3TJHD 2AQ1A 2VXSH 3CDGA 1BVNP 1A3ZA 3KDMB 2QQLL 5D7EA 2RTTA 3LQZB 3QXAB 4Z1PA 4ZFFB 1Q1PA 4KKAC 1FV1B 2ZXDA 2OX5B 4EDWH 3EYSL 2DWXA 3HE6D 4XP6H 2J1ZA 3BSHA 4PBWD 2AEWA 1U33A 3SJVA 4G9FD 4Z8FH 2J6EH 4TTDD 2EEFA 3PGCA 5I1AB 3DO7A 1WITA 1FO0A 4P3DA 1INEH 2VDKH 4YHNA 3SCMC 3V5KB 3FTUA 3UBXB 4WTXA 5IB2A 3KM2A 4NQVB 4JBSA 1YEGL 4B97A 4PB9H 3WGVB 1JGDA 1ZS8B 3MACH 1I8MB 1TENA 3HI5L 4D7BA 1M42A 3FQ4A 2HX7A 4HUXB 1RUAH 5GZNC 5JQIB 1CYWA 2N3JA 2BVTA 4JZJB 2G3MA 4XVSL 3IDYC 1NAML 3GTVA 3ORJA 3QQDB 2TRHA 1AVAA 3UPCA 4AOFA 2EH8L 1I1YB 4M9OA 4WW1A 3T6XA 3IU3B 2WMPA 4B7LA 1MCWW 2ZKWA 3EW3B 4PLJC 1AG6A 2FRGP 4OJFH 4KXAA 1OVZA 1XQ4A 4HXBH 3GMNB 3S8GB 4HJEA 2AQTA 4NAJA 2VDPB 3FW6A 4G6ML 2XUWA 3BUYB 1ECZA 1NCJA 4NKMA 2P5WE 4Z76B 4JHZA 4DP9X 1XGQB 3CFDA 3H56A 3HG4A 4CNIB 4EZJA 1FZKB 2FGWH 2NQ3A 3VFVB 3AT9A 1T7YA 4BCZA 2EH7H 3MXWL 4UWQB 1MAML 1E9OA 4MS8C 4DAGH 4WHDA 1F0LA 1QFWM 4MMXC 3PF2A 4PJAF 1QSED 4KROC 4XPAL 4YSEA 4M6NH 3L4UA 3C6SA 4GB9A 4HH9A 1BQLH 4OLVH 3QP3A 4LSUL 4BFNA 4PJ8A 3AU1B 5LGJA 4OM0H 2HJFB 3SKMA 4BFIA 2WQWA 3OX8A 5IG7A 3CN4A 1YHPA 4QUOA 3O3BA 5JIDA 1IMHC 5I6PA 4N9OB 3QUMH 3RKPA 4GNKB 3CTTA 3CDFA 2DJSA 3T2QA 4RDQF 3V52L 2A9BA 1KB5B 1BJ8A 4OLXH 4FA8A 5IEHA 5KVEH 5IJDC 2VDOH 5M7QA 2ADJA 4OJDH 5DJ6A 2ESVD 4N0CD 4MYPA 4G71B 3S3BB 1ASPA 1QFWI 4KXZH 3FPXA 2VJ0A 4NHCH 5EU6D 1U93B 1VF5C 5T1DH 4X4XA 4R4BA 1MHPL 1UQSB 5DRWA 1N0LA 3MZGB 1TZHA 1GTFA 3LS4H 3GZOA 4Y5VB 4OZ4B 5LHDA 2XQBH 5C0BA 2QADC 2BMKB 3FSWA 3ML8A 4PV9B 1H3VA 4C57C 1NOAA 3DJTA 2Z31B 1PD1A 3TT1H 3W81A 4AEFA 1JDAA 3FZUD 1MW1A 3QEQE 1RUKH 1NBCA 2F54D 3FFDB 5FGBC 4GAYA 3O9WB 2MSPA 4LGSB 3KBFA 2OQJA 5IT2L 1TG8A 4L0YA 2NLJB 3K46A 3KL5A 4JM2C 5D9SA 1H5BB 3HZMA 4JQVC 2CGRH 4YSRA 3C12A 4I7ZC 2OMUA 4U0RB 2YPVA 4YL9A 1CGSL 1FFRA 1MSPA 4L4TB 5DZPA 1BQ5A 1RURL 1ZOXA 3BLBA 3NAAL 1F1GA 4OIFA 5ACZA 5IMKA 1UJ3C 2R7EA 3UTSD 4AMXA 1N5YH 4MLIA 2ZWYA 4UT6H 3GTTA 2OK0H 6FABH 2DBJA 2IBGA 1X9QA 5IVOA 4YLQT 2LVEA 3GLDA 1RU9H 2DQGL 5KVDE 1NFDE 1W72L 3VI4F 4BZ1H 2CM6A 3BAXA 3DRTB 2V9TA 3G5ZA 5B7FA 3MKKA 3MREA 2BSSA 1ORSA 4YX2L 1ZWIB 3EADA 3EBAA 4FQIH 4NFDA 5D7JB 1NFIA 5GGRA 3HC3H 4V1DB 4M5SA 1XAKA 5C2BL 3EYVB 2Q20A 5KSBA 4WHCA 5LUMA 3VD1A 2VZSA 1EDHA 3WUZA 1YYLL 2PYEB 1WBYB 4XVOA 1UEYA 2HWZH 5DJZA 3POHA 2K9FB 3LN9A 5B39B 2E5EA 4DK6A 3DPBA 3O8XC 1WZKA 3X3GL 1RVFL 3OMAB 1LP9E 1BGXH 3ALPA 4JM2D 4MCNA 4X5LA 2E9JA 5IW6B 4JHUA 1U58A 4KITB 1NAMB 4M7LL 2BY3A 2C3VA 5F7YC 4DIXA 5I75C 3OM3B 2ZUWA 2XNAA 3KPSA 1RXLA 2D9CA 4MKTA 5D6CA 1UH3A 2PCPB 2X1PA 1AZCA 2VMJA 5JW5A 2YOAA 4HWBL 2VAAB 2WXRA 1GPOH 1KTRL 3D34A 4KU1A 4PB9L 1QFWH 2DQUL 1AS8A 2GW5A 2WLZA 3Q1SL 4JRXD 5DURB 3WV0A 3V6OC 4BWTA 4KUZL 2ED6A 2B20A 3QSKB 1P4BL 3GHEL 4K8RH 4LSVL 4OFPA 3FN9A 3ASNB 4H88L 4ZOAA 2Y7MA 4R26H 4L3FA 5C08D 1IBFA 2WLMA 4A38A 2RBLA 2XPGB 3BO8B 1HILA 4NX0A 5AENA 4GG6E 1FH2A 2CXKA 3BFOA 2E75C 2AP2A 3W57A 3ZMEA 3FTWA 3HAEA 4OCYL 5E1AA 3QIBB 5I1DB 4JRYE 5FKAA 4RMUA 5D96B 1F18A 1MF2H 1S7XA 3O2VH 1RIVL 4XH2B 4BQ9A 1J5OH 3WXWH 5HDBB 3E8UH 2NCMA 3GM8A 2OP4L 1UM6L 3ZQWA 5C6WH 1YMHA 3DV4B 2NY3D 2X7LA 1CICD 3KLSA 3VGHA 3L9RB 4TUKH 2HLFC 1I7ZB 3MDJA 1Z9PA 3Q0HA 4H40A 2FR4A 4K9JA 4XP5L 3DYOA 1TF4A 2X9WA 5DD3L 2D0FA 3FQNA 1HNFA 4MMZB 1H6FA 5DQJB 3MBEB 1QQDA 1TEGA 3T6ZA 3PHOB 5D2NC 1B4LA 4ENEC 2G75A 5F9AC 5IGXL 3CXHJ 4RBPH 3BPNB 2AITA 2MEJB 1AH1A 3ME0A 3MHZA 5HHOB 4AQAB 4XP4L 3W0WA 3GMQB 3OAYK 1Y0LB 3HA0A 1HHHA 4E5XA 5LKNA 2WY3B 4AE0A 3FMGH 3DA0A 5F7FA 2CIKB 4BSWB 3PP4L 1H8OA 2DJ4A 4NPJA 4D2NA 1MEXH 5F9WB 4XMPL 3NA9L 3OKMA 3QPXL 4MAUH 5MI0C 1BVKB 1P4IH 2P8LA 1GY1A 4NO0D 1SLXA 1NLDH 7FABL 3HE7A 1ORQB 4RFEA 4NT6A 4TS6A 3VD3A 3VXOB 3QQ4B 3C6LA 4G6JL 3T1WA 4NQDE 4PCYA 2RR3A 4MKMA 5IJVA 3B7UX 1WC7B 3ET9F 3KGTA 1ZHLB 3HE6A 1MG2C 2X2IA 5G5DB 1JNLH 1JPTH 3HNTH 2WXKA 2V17L 2J5LB 1TTCA 2DQIH 3O45B 4DKDC 1JPGA 5ANHA 4IGBB 1MCOH 2CUMA 1LK3H 2DM7A 4ODVL 5IROA 1X44A 4Z0XA 5HGGS 1D6EB 5J3HD 4Y1TA 2EIKB 4P5TB 2VDRB 3NRFA 3VXUE 3WKML 5EO0A 2HN7A 4U6YA 2V7NA 3WFZA 4KHTH 3PGDA 1IGIL 2XYBA 5HJ3B 4G6AD 4L1TA 4Q14A 4OZGF 5C07D 2X44D 2PP7A 5PCYA 1HHKB 1ZTXH 5CZRA 4XC3H 5C07E 4MGXA 1ZLUK 4ODSL 3HG1D 2PPFA 1ITCA 2CBQA 3WSQH 1BVLA 5DMIH 5FA4A 3BHBB 1X4YA 4PTUA 2Q3AA 3VNYA 5ABAA 3HKFA 5KVFH 2CCVA 3AG2B 2ADGB 4Y19D 4ZXBC 2ALWA 3ESOA 4K3GA 5EO9B 4RMRA 4O02H 5E00A 5E5MB 3DV6B 1RUML 3SDYL 4YIQB 4DVBB 1RZIB 1NL0L 4M8VA 4POZC 2EDDA 2FX9H 4PJDF 4KVNL 2IH3B 2C8NA 3MYJB 4HK3J 4D0CB 1ZANH 4ZFOB 1YYML 3FH7A 5KN5A 2X6VA 1JGVH 4QRRB 3MBWA 3KPRE 5B3JE 4U6VH 1DQJB 3RGVC 4DP4X 5JMRA 4OGZA 4OSUL 4Z0BH 3QQ3B 3AM8A 5DA4A 5IM7B 3SGJC 1GGUA 1UZ6E 3M86A 2LGNA 4RIRA 4AVKA 2HRHA 4PP1D 2OMXB 1EAPB 3QYNA 4IKLA 3S35L 3DX8B 3Q6GH 3TCLA 5F9OL 4E9SA 1B0RB 1WF5A 1XZ0B 2OR7A 5E8DH 4XE0A 3H2PA 2AJYL 2LV4A 3B34A 3IK2A 5IOPA 3C2AH 5D4JA 3OPUA 3DO7B 2AV7A 4A68A 4MDJB 1F86A 4OZIB 1J8HA 1QZ1A 3LKOA 3OGCB 5IQMA 1UG9A 5EULV 3AZUA 1T7ZA 3BQUB 3PREA 4HOMA 4HG4K 4ZUWA 3QT2A 1YN7B 4JFPA 4LOVA 5C7ZA 4NI6A 2JI3A 1R3KB 4KKNA 3ZHKA 2C9XA 2X4PA 3NT0A 3BESR 1N64L 4K4KA 2VXUH 1ZLSH 3V0WH 1IVTA 5KBPA 4RAUB 2FX7H 2FJFA 3ULSB 3ESNA 5HI4D 4P2CG 2R69L 2YFNA 4KC3B 1KBKA 4X8XA 1NGYA 1U2HA 3SDYH 4X5WA 5C9JA 4JFOB 2VR8A 1RFDL 2EDOA 1WK0A 2AQQA 4RGNB 3BH4A 1AHMA 1OTTD 1HEZA 5F96L 2V5RA 1EEYB 4OF6A 4M5TA 2FEEL 4NENA 1EV2E 3LN5A 1ZVHA 2E59A 4XXDB 1KFAH 4UNVA 1U95A 3ROOB 3K6OA 3TM6A 3PFQA 1SY6L 4K3JL 2O6PA 3IGUA 1A4AA 1W72B 4HIIA 4P59L 2WZPA 4IU3B 3HLKA 1HQRB 3SZ6A 3WTSA 1PYWA 1IJNA 1L3NA 2Q0ZX 3RWEB 1GGYA 3BQUD 2EIZA 5IB5B 2BWQA 3QIUD 3CH1A 4M5ZL 3SE6A 2I26N 3WY1A 3VVVA 1HSAB 5HI4C 3BIAX 1VFAB 3IGFA 2ROYA 3V79C 4FJZA 4FLHA 4NPYA 3IWVA 4KZEL 2YZ8A 3LB6C 1IAII 1BZ8A 4E9YA 3UG5A 1NCUA 4XNXH 3A6CH 3EJZC 1SYSB 4U1NB 1IX2A 3WY2A 4BSVA 3FU0A 3VI4A 4PD4K 4JKMA 4LP5A 4F8OA 1I9IL 1N59B 2KC0A 2X2JA 1J0JA 1OALA 3OD3A 1KJ2A 4LARL 2WNXA 3LZFL 3HG1E 2K8MA 4KY1H 4N4YB 2BS9A 4K3JH 1M05B 1ZD6A 4AK2A 5LNGA 1OQXA 3GKWL 4MRCA 3BIKB 3HR5A 1K8DA 3JUZA 4F9LA 2OJZL 5D1ZC 3MZTA 3NA9H 4QJ4B 2JFCA 4NIYE 4XMPH 5DJAA 2GB2A 4HK0A 1K85A 3R19A 5HVHB 2OZ4L 3CN2A 3T0EB 2HRGA 1UA7A 3OL2A 1T5XA 3MLTA 3QIUC 3JWOH 1ET8A 5EEVA 2D31B 4Q6IA 5FV2A 2DYRB 3RJOA 1BAGA 4AV4A 4LSQH 3WAJA 3OSKA 1HXYB 4L8BB 4DETA 2UZXA 2A4ZA 4Z7UB 1L9RA 4WWNA 3V0WL 2GI0A 1DBJL 1A6ZB 4OLEA 4CMMB 4QTIL 3SKOB 3RWFA 3NESA 2HJKA 3BKMH 3P9MA 3QNXA 1UM5H 3IRCA 5L2JB 4LLDB 2QQQA 2IV9A 1XH3B 2QVTA 3AGWA 2D0GA 2IAAC 1E8YA 4PJXE 1RMFH 2V3EA 2K9UA 2YZ1A 5C70A 4PMFA 3RWDB 3LSOA 2FNWA 2B5IB 5BRZE 4HETA 4EBQL 4PGDA 1IRAY 2FIKA 2WPGA 2Q76A 1XR8B 4A7VA 5I1CL 3W5NA 3E8UL 4UDUB 3ZYJA 2EIBA 4HDIB 1SJXA 4DP8X 4QRPA 1YUHB 4XBGB 5E9DE 4HAKA 3T3ME 4DN4H 3S2CA 1WS8A 4AQ1B 5DMGD 3U7WL 4U1IB 1AZZC 3QUMA 4G6KH 4GAJL 5TDNB 2FT6A 2DQJH 3BVNB 1DSFH 2BY2A 4OVVA 5IUSA 4Q9RL 4RETB 5IREA 1A8ZA 4RMQA 3QCTH 3WTUA 1FNEA 4S1QL 3TO4C 1NC2A 5TPWH 5B39A 1KPRA 4S11A 1W0VA 3JV4A 4KGJA 3S36L 2O61A 2XHNA 4QOKE 3JV6B 3PPSA 4PJAA 1MJ8H 5I26A 1AXSA 2VQTA 1S5HA 4XCCH 3U4KA 3QZPA 3CVHA 3IJEA 3TGXA 4FFVC 3W11D 3VFSB 3L5IA 5BJTB 5GJTL 2ZOWA 3D85A 3QUHA 4O58L 1RZQA 2FQEA 2ZOOA 4GUCA 2LAGB 2P8MA 4LVHB 3AC0A 1MJUL 3PWUA 4FE9A 2R39A 3GZQA 4M4RA 5HHOD 4Z7QB 4CGTA 1IJ9A 3QDJB 3RGBA 2XFXA 2P7TA 3FULA 3O11B 4RMBA 3LEVL 2O5NA 2AJZB 3MPCA 3KVPA 4X7EC 2Q6WA 4HOWA 1I7TB 2UY7B 2J44A 1X9UA 1BOGA 1QSFA 2I7OA 2WTPA 3KVQA 1IKOP 3C6EA 1JNNH 4L3AA 1ZLWH 2NZIA 5TGBA 4C59B 3WKMH 2YD1A 1D5XB 1SXCA 5ID0B 1MJUH 5FAAA 1KXTA 2ENJA 3R1GH 2OTWB 3GMMA 3IJSB 4WU7B 4HGWB 4FMVA 4A6YA 2AGJL 2A83B 3B7YA 1L9PA 4KK6D 4KK9D 1KC5H 4YSTA 3WFCH 2V17H 4AYDC 5EBMA 1MWOA 1W0WA 1BD2A 4LGPB 4AM0B 1D9KA 1HQ4B 1DUYA 3MUY1 4MWFA 5HJGA 3A5VA 1E5UI 1PVHA 4FXGB 2EIDA 5TH2A 2VLME 4DPBX 3LPGA 2ZCZA 3QUZD 4DQOH 1DJZA 4XBPA 2VQ1A 4Z7VE 3AGVA 4EN2A 4JY5L 4JREB 1DDTA 4ADJA 3TA3D 2H2SC 1NOLA 1IM9A 2Y1VA 4UT7H 4M7LT 3WHXB 2N0MA 4ODBD 2D7OA 4M3KB 4MDIB 4O4YH 5ID1A 1R19A 2F9BT 1FE8L 2XG5A 5FCUH 4LVNC 2WK2A 4M6OL 4PJ5E 1IBZA 2BFGA 3P02A 1GW0A 3VGFA 1KOAA 1YA5A 5G4NA 2JI1A 3UAJD 3UEQA 2ZNWA 2XWTB 2FSEA 3DNKA 5EN3A 4WHYH 2GJPA 1LL1A 4GSDH 5B21A 4KK6C 3RFZA 4MJIB 1ZHLA 4XX1E 3VRIA 4L8SA 1HOEA 3HZYB 3SDCA 2KMWA 1E5ZA 5T33H 1H3UA 1OM9A 3FO9A 3ZXAC 5HPMB 1H3TA 1ZA3B 4XVJH 1OCOB 3HMWL 4F92B 3ZE2F 4NZTL 4TUKL 2Z4QA 5C0IB 4OGXH 4FQQB 3RVTC 3FFOA 1F13A 3CHQA 4QGTA 1VFUA 2OMVB 4WW2B 1DVFC 1MIEH 3MRPB 4JFZL 4GKNB 3UTTA 2MOQA 3ZMRA 4BGDA 1DFBH 5CZXD 5KSBF 1NAKL 2WCSA 1TYJA 3DGGB 3HB3B 2CRIA 3X1EA 3EFFA 4NNXA 3GDBA 4U7MA 4XNMB 2BP8B 3QG6B 1WD9A 4NXSA 4DAGL 3MVSA 3X3FL 3DTXB 4JO1L 5F88A 3EO9L 1U2CA 4C56D 3T3PB 3IU4H 3E2HC 1JZ2A 2LTQC 3IDMB 4JPSA 3MV9E 3RL2A 3G7TA 3VXRD 5EHFA 1M2VB