1ZK5A

Escherichia coli f17fg lectin domain complex with n-acetylglucosamine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
175
structure length
172
Chain Sequence
AVSFIGSTENDVGPSQGSYSSTHNLPFVYNTGHNIGYQNANVWRISGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWCVGNYVSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of natural variation in bacterial F17G adhesins on crystallization behaviour.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords F17G adhesin subunit
total genus 41
structure length 172
sequence length 175
ec nomenclature
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 1zk5A00
2BSBA 3FFOA 1O9VA 1OIOA 2BS8A 1ZPLA 2BS71 3F64A 3F6JA 1O9ZA 4K0OA 1ZK5A 2BSCA 1O9WA
chains in the Genus database with same CATH superfamily
3RWDB 1CO1A 1XIWD 2H3NA 3MA7B 5CINH 3BT0A 4HS3A 2WBWB 2LR4A 3NIFF 1UXMA 4JRXD 4YN3A 4JFSA 2UVEA 2VDKB 4KY1H 3T0EE 1E4KA 4QY8A 4B96A 3VGDA 3NZUA 4K7FA 4FNLH 5JPMA 1VZGA 3GBDA 3H6AA 4GP4B 5C0CA 2OMXA 5SWZE 4RFOH 3B2VL 4M3KB 3RP1A 4PV9A 2WZAA 1Z3GL 5BNXD 4H26B 4CC1A 3FQUA 4GPVA 1NUDA 3P73A 5EBMA 3MZTA 5F3BB 1FL5B 4WO4D 4GS7B 2C9AA 4UYQA 4AIXA 1UD8A 5KN5B 3X3GL 2E47A 2LTQB 3EFFB 4A7UA 1X7SA 2PYFB 4HUNB 3O3DA 1RUML 5C0AE 1MAML 2X89D 3MLYL 2P52A 1MDTA 3JWNC 4PGCB 3I6GA 3SGEI 2AJ3A 1KG0B 3FFCE 4LCUB 3MXVH 3JWDC 1EEUA 4PBDA 4UNVA 5D96B 1FDLH 3NACL 2C9RA 3WMPA 1JV2B 1S78C 4U1HA 3V6OE 3FRPG 1V27A 2W9DL 4GAJL 4WWNA 2AANA 4OCRH 1CDGA 1H8OA 3STZB 4KK9C 3BZDA 2PF6A 3LKQB 4X5XB 3VFVB 4E36A 5KW9L 5JW4M 2RQ8A 3PDOB 4I4WB 1GTNA 5CZVH 2HFEB 3QUYC 2PUQT 3L95B 2G4EA 3NP3A 5F0JB 3CZGA 3Q9PA 2FQGA 3QZNA 3LQAC 3LV3A 5JO5B 1KMGA 3B3BA 3MV9D 1IBZA 1Y18B 2OL3A 3QJFB 3PV6A 4IMKC 4U3CA 2EVHA 4WFGE 3E1ZA 4G1MB 4QKXB 1OM9A 1I7RB 2R0WH 3DHUA 5TPWH 3FJTA 3RL1A 2V9QA 5BPPA 1KJ2B 4GKSB 5DJZB 1E2WA 4HIHA 1YEWA 1YDPA 1G1KA 1U4EA 3UADA 2X6VA 5HHME 4F15C 4RFEB 1MHCB 2QJDA 4I0PC 4BZ2A 4LGSB 2IBZX 4DTGL 2OYLA 4M1CC 4XX1E 5AW9B 4AMXA 1KOAA 3CVDA 4LQFH 4OLVH 4Z9KB 1MFCH 1YEFL 4R8WH 1OCZB 4LCYA 2XX0A 1AMYA 1WUNT 1YNKL 2O5XL 4A63A 1BWMA 4GMSL 3MRNB 1I8AA 4KKAC 1Y1DA 4LPCA 4KX9A 1FE8L 1LO4H 5ALCL 4JMNA 2A9AA 1NC2B 3BLPX 5DJ8A 1XGRB 3HZMB 3Q13A 5I6PA 5JOPD 2H2SD 5FFLA 3B3IA 1G94A 3BAYA 1U91A 2PABA 2BWQA 2IAMB 3M45A 3DGGA 1IFGA 5BO1L 1BD2A 4ODBD 2CHDA 1JZJA 2L3BA 3A67H 2PCXA 4X0KA 1TEFA 3MMEA 2E7DA 3BISA 4MMYB 1TETL 2YPLE 3VI4A 3QNZB 1FE8H 1S8DB 2DQIH 4H5SB 2NPLX 3RE0A 1F0LA 1OW0A 2D2OA 4GG6E 5EO1B 3QJTB 4XBEH 4P5SA 4MA3B 2NY1C 1F1GA 2A6IA 3REVA 2K9FB 2OZ4L 3QZOA 3SJVB 1NAMH 1XR9B 2BZDA 3BZ4B 2ZOLA 3RILA 4UT6A 1WZ1L 4DSYA 2XKSA 1F4YH 1KENL 3C5JA 3BAXA 2FJGB 4OFYD 1MFMA 4Q6IB 3WXVH 5BMFH 2AJ3B 5JW4N 4ZFGL 5DRZB 5C09E 4Y89A 1NIDA 3DX7B 3U30B 4O51A 1K8DA 1PCSA 2WKOA 3WBDA 1AS8A 4BINA 4JFEA 5JOPE 4NC1E 2PCPB 4P2RD 1SOXA 4XAWL 2F53A 2YD7A 3LXCA 3TH2T 3UBXA 1J5OL 2E75C 2C26A 3VG9B 2KERA 2NY4C 5CKAA 4GQZA 2Y1YA 1H3WM 1DVFD 5DHVB 4WO4B 1IEAB 1HH9B 3BPLB 3SYPA 4F33A 5D1ZI 1JFHA 4WGVB 3VACA 1G7IB 4DO5A 3PY9A 1WZMA 1SBBA 5AAWC 2PW2A 1QI5A 3V4PA 1QSFB 3JWDH 4NHCL 1T6BX 3WE6A 2YAFA 5IGXH 3RBSA 2OL3B 1CG9A 4NQSA 5IW6B 4IHOB 3S34L 4NUJB 4JHBA 4UT7H 3T77A 1PIFA 5CF3A 4Z76A 1BBJA 1NOLA 5A3IC 1C7SA 1Y0LB 3JYBA 3OGCB 1C5DA 1KTCA 2C1OB 3GUFA 4R7DA 1OZUA 2WWKO 3H53A 4L4VB 4ZTOH 3CAFA 2FLMA 5IVOA 1ZLVH 5HP5A 1R75A 1Z5YD 1IQWH 4G70B 4LP5A 5EORH 1OAQH 1MCDA 4JJ5A 4OSUH 3VCLA 4DP5X 2VL5A 3ZRCC 4LESA 2IANB 2WW8A 2Z8RA 5GGVL 4ZO6A 4GY4A 4JZOA 4YDLC 3UG4A 5I0WA 1MQ8A 3NCYP 5TFSH 2W9EL 4A2DA 5MERB 5CMAB 4JL1A 2ZZUT 3ARUA 4G6AC 2Q7YA 1U33A 2D3VA 3HBZA 3IFLH 1OY3B 1EZUA 4KZEL 4R7VA 3PGDA 3KWWA 1N64H 2VRAA 4M61B 1F45A 5EOTA 1ASOA 1HXMB 4DVBA 2MPAH 1KACB 3IRZA 4D0CA 2WQRA 3PNWA 4Z0XA 1NBVL 3RY4A 1G7MA 2CUHA 3EJZD 1GXEA 4AM0Q 5GS1B 4KK8D 5AZ2L 1CFTA 5BRZB 3PAYA 4YEFA 1A02N 2CXGA 3BMWA 3UMNA 2YAHA 4I3RL 4JPWL 3CVHL 5DVPA 3A6OA 4FLRA 4JBSA 1S7QA 3HZ3A 3TIEA 3BPOB 4N6RA 1XF4B 3K2MC 4H13C 1UKTA 5FF6B 1LQSR 1BJ8A 2X0UA 4NZFA 3WKPA 5DWUH 3L48A 2ZP9A 1DLFH 5SWSE 3VE0B 1AR2A 3QWRA 4QT5B 3KCWA 4AMWA 1ZTXL 4MMXA 2IBZY 2BZCA 4P4KC 3KGTA 3VGAB 3HS0B 1K2DB 2A6DB 3D39D 5D2LB 1QG3A 2EYTB 4PTUB 4JZJC 3EADA 4LZKA 3LIZA 4I85A 4MD5B 2DEWX 4L1TA 1AACA 3QUMB 3NMEA 4K4KA 3AREA 1KIRB 3TVMC 3MKGA 1FN4B 1T4WA 3D52A 3EW3B 4JG9A 3RFZB 3WNOA 4XPBH 4P3CH 1CQYA 3QUYD 2WKGA 3K2UH 4WW2B 4ZFFB 2X6BA 3IRPX 1YEJL 4MD0A 1VEPA 3R0NA 1IRAY 3Q8CA 1NOAA 3WKML 4ABVA 4Y2OB 2WVUA 1YDPB 1UOKA 2GY5A 3D87B 3L3KA 2BHFA 5F6IC 3W0WE 4MSWB 5EMYA 4UDUB 3IJHB 2AABH 1ZLWK 2ITCB 4KO9A 3UJJH 3VI4F 3WEOA 4YSEA 3HC3L 1LDPL 2G9HB 3LKRA 4D0DB 1UGNA 1CE6A 5DFWH 4Y0GA 5F1NA 5BRZD 2NNAA 5GGQH 1AD9B 2BSTB 3L16A 3I9AA 3FRUA 3QDGD 4W70A 4P2QE 4F7PB 4F8TA 4B5EA 4PJDE 4NDMA 2B1HL 1S9WA 4PJAE 4F8OA 2YOCA 2FDBP 4NOBA 1V5JA 2A9NL 4X99B 3VQMA 5B8CC 1HCVA 1JTTA 5CJQL 4DKEL 2XC8A 1AGBB 1K4DB 1T66D 3PGDB 1W72A 5A2LH 4YXLH 3LXUX 1NMAH 5ADOH 5BCAA 2GY7B 3PQYE 5HDWA 3BLKA 4F2MB 3DO3A 4XGZA 4M7LH 3QUMA 2D7TH 3C5SA 4EZMA 1OB1A 3U6XS 1C16A 4EZKA 1QO3A 3DUSA 1FG2A 1WFTA 5GZOA 1QFWI 5JNYB 1UTDA 3FO2B 5H4ZA 4UIMA 1OAXH 1XQ4A 4DW2H 1YEDA 3EAKA 5KZCB 3O2DH 1AP2B 1M7DA 4A6YH 3FH5A 3HNVH 1PZAA 2X4TB 1EEYA 3QI9A 4Y2OA 1YZZA 4MJID 2YA0A 2IANE 2E27L 2XZCL 5J8OA 3OVUB 3W5NA 3FB5A 5GZNC 2DL9A 3T1WA 5FW8A 1H15A 2QPFA 5IR1A 4GSUA 1P5UA 2BP0B 2Z8WC 4BZ1L 5FB8B 1U95A 2APBA 2EDRA 1RQ5A 2HT2C 3CHRA 4RGNE 3WN6A 5E5UB 4MHHI 2CM5A 5E2VL 4P2RB 4HLJA 2JTYA 3DYMA 4AJYV 2XTJD 5JYLA 1KCLA 1MW3A 3PABB 5J6GB 4GQ9H 1RIHL 3GM8A 1UYWL 2K4AA 4A6YL 4H1LA 5AW7B 5HGAB 3L6FB 2VOTA 1A9BB 1FZKA 3CSPA 4G5AA 4NPJA 4UWQB 5I1JL 3OAUH 3MUHL 4G11A 1MCCA 4OT1H 1JCVA 4LHJB 1J1PH 1LGVA 4EXPX 2E9IA 1FCCA 1F5WA 1XMWA 4EI5D 3PJLA 2GK2A 4H2CA 1AKJD 3X11A 3T0DA 4RZCA 4AG4L 3VAEA 5EOQH 3HG0A 2CO3A 4MA7H 4MMZB 4PJ5A 3CFBB 4ZTEA 4PWKA 5CJQH 5EO9A 5AZUA 4DKEH 5E4EC 1HU8A 1MCOH 1U8NB 1SLUA 3P30H 3TJEL 4AENA 4JREC 2AZAA 5FGBA 4YR6A 4TUJA 2FH8A 4HA1A 5EH1A 4K8RH 3B7SA 1PW3A 3VI3F 1ET5A 4NOFA 5C8JB 1BZ9B 4HU8A 5B39A 1XD0A 2BNUA 1JTOA 1IV8A 4IBSA 1JHLL 2YD4A 5EOTB 5FGSA 3RAJL 1OE2A 2P5ED 5E6IB 2YMOA 1SEQH 2BMKA 3W39A 2BP0A 1G9HA 1S9VA 2X1OA 1PY9A 2BIMA 2BNQE 3GEFA 1IKNA 3SPVB 2JI1A 3VXRB 5KJRH 3QXUA 5K59F 4ZMQA 3EJZC 4CN6A 1JK8B 3A4FA 4R7NA 4LLYA 3VUAA 3QO0A 1J9CT 2IALA 3LEYH 4OU3A 2HLAB 1QNIA 3KPMA 4NM8H 3RX5A 4MD0B 1XXDC 2IPKB 3NJIA 1N6VA 5BVPH 3PUUA 4Z7QF 3ELQA 3GSNL 1KCRL 2ESVD 4PUBH 3IMWA 4U1KA 1E27B 3CGTA 3ULVD 2R29H 5ADPH 2ZUQB 4KK5C 4UDUA 4GO8A 5FUOL 4GXFA 4MXVF 4H88H 4CNIB 1X5LA 2CBTA 3CU7A 1K2DA 2A6DA 1F4XH 3FQ1A 4PW9A 5CEZH 3NCJL 5DQJA 2FHBA 3G6AB 2AXWA 4YUEL 3LS5H 3J27A 3HS8A 3DRQB 4OY9A 1MF2L 2E6QA 1P5UB 4F80A 2YD5A 5F7YC 4XH2A 2Z4TA 5BZDB 1XGUB 4BFRA 4BK4A 2B9BA 3QR1A 1M7IA 1FPTL 5C6TH 1RD6A 3V6ZA 3O45B 3C6SB 2CLZA 3VWJC 1OT1A 2WSDA 4Y2DC 2ITFA 3IEAA 3PGFL 4U1MB 5JORA 1E6OH 3EHBB 3S4SG 3FFDA 5GS1C 3GXMA 4BZ1H 5C70A 1ULVA 5I17A 4DUXA 3F6IA 4ENEC 3RGBA 4C54A 3NJVA 2QADC 5I1CH 2A99A 3B37A 4XMKH 3S5LG 1UFUA 5CEXB 1V55B 2EXWD 2H26A 1HC1A 1KF9B 2AJVH 1BZQK 4LVEA 3DC0A 1Q0XL 1ZLSL 5CSBA 1T20B 4PP1D 3RHWF 4TOYL 3PHAA 5DT1L 3MUJA 4PP2B 3GTNA 3U4KA 4CL7A 1RHHA 1UWEH 1S7TB 3TBSA 2R56L 4CKQA 1GS6X 1HKLL 1TQCC 3NSYA 1E9OB 4RGNB 1VFMA 1HXYA 1AG0A 2CBMA 2F53E 3QJHA 4G7VL 3U4BL 3QI9B 2A4CA 2Q6WA 2B2XH 1LDSA 3QK0A 4HWZA 4JFFE 4LSUH 2X4QB 4HPOH 1JGIA 3FQXA 5JHDA 1H8LA 2AQQA 2VDLB 3HS0A 3WFCL 4FQXD 5F1KC 5LBGA 1RMFL 4BDVA 2DQGL 1KIQB 2DIAA 3RBGA 3DJRA 5EORL 4PWJA 1GH7A 4DZ8B 4TVSa 2F53D 1IKFH 1MG3C 1BG9A 4JFED 4WK0B 5T33L 2ZXWB 3MA7A 4Y4HC 2DLHA 1SJVA 3WD5H 4FABH 2B1HH 4PLKC 3V4PB 3IGUA 4PJ7F 3O8XB 3W9DA 4IHOA 4O9HL 3MROA 4H8WC 1U8JB 1JVKA 1UT2A 5I1EL 1TZGH 3OXSA 4ODWA 4XPAL 4XCEA 4W9HC 3IGLA 3WLBB 4WI5A 3BZ5A 1KB9K 1P7BA 4RMWA 3FT4A 3LTVA 2ZAGA 2XRAL 1NOFA 1AXTL 1TQBC 4FFYH 1TJGH 4G43B 1UT9A 4IW4C 1G1YA 2ZWZA 4FKEA 4KJWC 3ZZ1A 1T0NB 4JFXB 4I5BB 5LDSA 3D0VB 2W60B 4Z7UB 4ZZFA 4J6RH 3K72A 4BXSV 2EZ0D 4NGHL 2P1YA 1O6SB 3B4NA 1T80A 3NFSH 3ALPA 3TH4T 2H8PA 4NX0A 1NJ9A 4WJ5B 1MH5A 4N0CC 5FA3B 4AQZA 1W80A 2QSCL 4MAYB 5FUCC 3AW5A 1P5VA 1CD1A 2Q6WB 3WIAA 3L3DA 2AMGA 4WUUB 1VCBC 4W9FC 5E6RB 5F7BA 3MLUL 3W0WB 4QHNB 5IB1A 1U8CB 2EYSA 4ZW8A 3F2LA 5IVXB 3SKNB 3O3BA 3QEQA 3TF4A 4G6JH 3CJJA 4R7XA 5CIPH 3DNKA 3SDYH 2VDMB 3ARGC 1N4XL 1FO0H 4YDJB 1IGCL 3J7HA 3D2UD 4N2CA 4DERA 3FB7A 1BREA 2VZSA 3WO4B 5C86A 1TCRB 2D0HA 5GGTA 2OMUB 5ICXB 4BH7A 4KDTA 3VG0H 1WITA 3T3MF 1G9MC 3CBKB 3FQNB 4YZFE 3X14A 1KPVA 1JRHH 4UQ9A 1NUNB 3KBPA 5TGBB 2C1PB 2YJLA 4K2UH 1PYWB 5FHAH 3LQZB 3V7AE 3CH1B 5E08L 2KZ1B 4L3CA 2NZ9D 4PB9H 1LO4L 4NYLA 3DJ9A 4G43A 3KYKH 3UZVB 4F15B 2DY2A 5C0CE 3VXMB 1SHWA 5GGRY 3X3FH 3T0EA 2NMSA 4PN6A 5SX5H 2PP7A 1B9ZA 1L9NA 5I1AA 4HUKB 3PHOA 4TTDD 5I2IA 2Y7NA 1BLNB 4DTGH 1LK2A 3DX8A 1JDCA 2WPGA 3ARWA 3QUZB 4R2GC 3EJTA 5DYOB 3BVUA 4MX7A 3E6HA 5TPWL 1YUHB 4U1MA 3RA7H 2IPKA 4M7ZB 4LASL 2BSSA 3VDAA 5AAPA 1M6OA 4AVHA 2X89A 4PCKA 4RH4A 2GJ6B 2OR7A 4ZUWB 3FT4B 4X6FB 3PP4H 4ZSOB 3GBNL 5AW4B 2FX7L 4O02H 3MCLH 3I74A 3W9EB 3K4DA 4FNPA 1B4LA 4JKNA 4EI5B 1CFNB 4OLUL 2BX5A 2VLRB 1BVKB 1HAWA 3QXAA 4LNRA 4DN4H 2WUBH 2ZWKA 2XKNB 3SDAB 3MJ9L 3T0XA 5CJ5A 4QY8B 4ENED 5IB5B 4YHZH 2W0KA 5EC1A 3U0PA 3F7QA 2F5AL 1AGFB 1ZV9A 3O3EA 4OZ4B 1KCUL 2JJTA 5FYLE 4CADB 4M4RB 4N1CA 4MXWL 5HGHA 2GSIB 4Z18A 4OZIA 2EDEA 1NFIA 5HGGS 3MRKB 3MCLL 4KU1A 4MLIA 2OX5B 5HI4D 5LQBL 2R69A 3UC0L 1RJLB 3EO1B 5I30H 1F3JA 2OMTA 3D4YA 1UH3A 3QIUC 1D5IH 4W9KC 5D7IE 4M6NH 3AS1A 3C8DA 4P46B 4FAAB 1Q72L 4AUYA 5I8EA 3HLAA 3OSKA 3WFCH 2YAQA 1F8TH 2MCG1 3VWJB 4NT6A 3O6ML 2A38A 2CUMA 3JV4B 5TH2B 2B8OT 4KUCF 1JGLL 1GJUA 1P1VA 5D70L 5CLWA 1W0WA 3L4YA 4MCNA 3U4BH 3I6LD 2DBLL 2CO7B 4CUCA 2NY5H 5HDQL 1IC1A 4FTVD 3VDBA 3GSRB 5E00B 2J44A 3SSGA 2CKNA 5EN2A 4A55A 4M5TA 4MXWH 2HFEA 4A2MA 2HTKC 5IESL 4LL9A 2CWRA 2B3RA 2E3VA 2XICA 4B6ZA 4GXVL 1DN0A 3NFNA 2PPCA 5J11C 2W65A 3RDTA 3APDA 1CDUA 3BGFC 4LBEB 1QBML 2OM5A 2XV0A 3TLRA 1M56B 1EEZA 2UWEF 2CGZA 4HKBA 1NCAH 1Z3RA 2AV1B 1LILA 3G6JA 3JTSA 5G2NA 2V4LA 1FL6A 1A8ZA 2PTUA 1YG9A 5F9WB 5CHNB 1PX8A 3F7VB 2OYPA 3CNKA 5L2JB 1CD0A 1BF2A 4E9TA 3SPGA 3S35X 1INEH 2ZG3A 2B1OA 4L1BA 4WK2B 1CLOL 1YRKA 4G6KH 4K3JL 4KJYA 4YO0A 4GLRI 1ZXKA 4PJGA 5TE6L 3RLSA 2Z91B 2BS71 4PBVC 1FCGA 1IBDA 2Z34A 3T3PE 4HIQA 3V5KA 3FFDB 4PGZA 3NIDF 1HFUA 4PGDA 1CGVA 1D5BB 4OJCA 1WRFA 1M57B 3IJ7A 3NPSB 4UQAA 1ACZA 5CCHE 1Q94A 4AQOA 5CEZL 5KBPA 3DPBA 4OQTA 1D5XA 1F4AA 3ZKXC 3ABZA 1Q9OA 1R5VA 3MV7B 5HDOA 4W9ZA 5J1SC 1JSYA 3ARFD 1ZHNB 2B77A 3GGWA 3P1VA 2GFBB 3QDMD 5LGJB 3ULVC 3HAEG 3SYCA 1NUGA 3ZDZE 4FKKA 1ZTMA 1N7MH 3U7YL 5B7FA 2PW1B 2MQ3A 4AQAA 1GGBL 1NFDE 3PPEA 2KI6A 1BQKA 2EKSB 1R1CA 1ZJAA 4NO0D 3VQLA 5CZVL 1ZVYA 1LK3H 2BY1A 4Y1TA 3TN0D 3GWJA 2BY2A 3SPIA 1VDGA 4JO2L 5FDWB 2CHNA 3ZU8A 1ZIBA 2FCBA 2WQWA 3QA3B 3VXNA 2J8HA 1NM4A 5HI5C 1BBDL 5LCVA 4I18B 4N6QA 1HL8A 4O9HH 2VN6A 3ZZQA 3LPPA 3HUJA 4XPHL 1NGZA 1M7IB 3WFDH 5IIEB 3KWVA 3BP4B 3QQ3A 3SODB 3LMJH 4HIJA 6CGTA 2DKSA 3S48A 5CCKH 3B1UA 3RIFF 2R23B 4FQ1L 5EN3A 4QOKE 1K6QH 3KPOA 5GGVY 2OXHB 4JZJA 3K6NA 2R7EB 5IBLD 4JO3H 3MO1A 4H7VA 2QHRH 5I8CB 3BUBA 1QWUA 4ORGB 1OPOA 3QISA 4AGLA 1L9MA 1FIGL 2R51A 4OF7A 1BYOA 4RDQF 5D7EA 4YXKH 3KGUA 4L4TA 5HHOB 3BD3A 2VR4A 1XD1A 3EYFB 2K3TA 4FLHA 5B1CA 4N86A 4JMXA 4BIKA 2WTRB 2WANA 3KLSA 4FQLL 5JIIA 4M9PA 4NRZB 1EANA 3D69B 3GBLA 2N0MA 4P0DA 5J56B 2JKSA 2DKUA 3BH8B 4U1GB 5D4JA 3EGDA 3U9UA 1B0IA 4XCNA 5I73C 3AG3B 2Y6TE 4G7RB 4U7KA 2OMVB 3QUXB 2IQAB 3QRGL 5E1IA 3H2PA 3TBBA 1E28A 1GZQA 4NQCE 1JZ2A 1QHOA 1FFOA 5I73B 1PKQA 3O6FD 4W93A 5ABZA 1A3RL 1MVUA 4RA0C 1KY7A 4UTBH 4XXCC 4XRCA 1KEML 3V4VA 3QYMA 4DO6A 3DXAE 1T04A 1I1RA 4FNQA 4K9EC 4BQ9A 3HHMA 3S8FB 2Z9TA 2FB4L 3SDCB 2AK4B 4ZMZA 5IMMB 5F7FA 1UM5L 4HEME 3DUSB 3WTWA 1INQB 1SFDA 2BDNH 3MLWL 4M5ZH 1U2YA 3QUXC 3UTZB 2Z7UA 3VXUA 1NLDL 1XB3A 1NCOA 1DUYB 2OS7A 3BO8B 3GMRB 4L9DA 2FSEB 2K6YA 4IOFC 4WFFE 4JFOA 4U6YB 3DVNB 4MAUH 3ZMEA 2N0KA 4HS6B 5CSZB 1T5WB 1KFAH 4APXB 4OTXL 1XGYL 2AI0H 4PHXA 4AGQA 4R97C 4YXLL 4X9YA 3HHSA 2BP8B 3EDKA 3MBWA 3NCEB 4ZI8A 3LZOA 3ETBF 4FYRA 5DRXB 5E9DA 3AABA 4EUPA 5K9OB 3H7BB 3QRLA 4YS4A 3MRDB 4NM8L 3ARBA 3IDGB 4LEXL 2CDEA 3GMPA 3TEXA 2IV8A 1MCPH 4FFTA 4MFHA 4BA0A 3AB0B 4LPXA 1EVUA 4N22A 1YVLA 5DJ0A 2XV3A 2XFGB 4S11A 4ES9A 2E5EA 5CBAA 2RCSL 2XA3A 1TLKA 1H5BB 3W81A 3NPZB 5C9JA 1BVNT 1UM4L 5CEYA 2DQDH 1FNEA 3VX0A 5IY5B 2R2HA 3QDGB 1O7DE 3NBNA 2R0ZL 3O9WC 3I75B 1F13A 4F33B 2NTFA 3P4MA 2AABL 3QGVA 2ZCKL 5CN3A 5BV7C 3IDIB 3FO2A 1ZLDA 3I02B 3DBXA 5K9QG 4YPGA 1SJMA 3MX0B 2RACA 2UZYB 3NCWA 1OL0A 3Q2VA 3OHXC 4L4VA 1M3JA 4WWOA 3OKNA 2ZWYA 3CFCL 4U0RB 1R3LA 3T3ME 2GBAA 4Z6AT 2CDGA 2H6OA 5DC4B 1PQZA 3Q6GL 5EUOE 4XAKD 5DJ2A 4LLMB 2DL2A 4PJAB 1O7SA 4TLKA 2ESVE 4G8FA 2VM9A 3NH7H 3WKNA 5DWPA 1N12A 3G6JF 3PFQA 2Q20A 1ORSB 2D0GA 2VZ3A 1SXBA 2I5YL 3UTTA 3DRQA 1XSOA 2XQBL 3VFUB 5K69A 3OMIB 3EFDL 5ITFA 2NLJB 4W9JC 5GSVB 4LDLB 1JYNA 3TGXA 1HH9A 4EN3D 1SVZA 1TLMA 5FCUH 5JXAH 3IAGC 3N06B 3F7VA 2V5SA 5A2JH 1UM5H 1J9SA 4OLXH 5DMKA 3ULVH 2MRYA 3Q6FA 5C08A 3VMNA 3NPSC 3BP7A 2J1WA 2X1WL 2ZICA 3C09B 5F72S 2H1XA 2O72A 3OV6A 4ORZC 4P5MB 4F3FA 1DVFC 1N0XH 1REIA 1CXEA 3BAWA 4YHOH 2D7MA 1YJDL 4FLOA 1EZSA 4I0KA 4QRQB 2WWMD 1SHSA 1ZT1A 2XN9D 3THMH 1E6JL 4EPSA 2D2CC 4N8VB 4AL8H 3QULA 1IO4C 4LVHB 1CLZH 3QH3A 1HNYA 2ICCA 1JXJA 2A73A 2QQNH 4K5MA 2XN9A 5JXEC 3MNWA 3UERA 4NAQA 4WJKB 3WTSA 4TN9A 1P4BH 5I6OA 2PCYA 3B2UC 1FNGB 3CXFA 3KWXA 4IMKA 2AC0A 5IB4B 2UWEB 1NL0H 2Y07H 4GFXA 1ONQA 4HGMA 4P2OC 5HD8D 1EV2E 1D5MB 1QLFA 4MAUL 4M8RA 4UI2A 1YN7B 1OCCB 2DLFL 1S9WB 3EKCA 4HJ0C 4JL2A 1DSWA 3GMMA 4KY2A 4QGTA 4YSOA 2NUPA 4C56D 3N0AA 1OHQA 3AM8A 1PSKL 2JQAA 3A47A 5KYXB 1MY5A 3KH4A 3ETBJ 4ODTL 2ZJSL 1C8PA 1D7DA 4NQDB 2CNYA 3F00A 4NQTA 1V3LA 4DUWA 2QGCA 3QAZB 4Z7VF 2A9NH 4NKQB 2IMNA 3IWUA 3K8LA 3W3BA 4DWHA 2OSYA 4KPHL 1MCRA 1IJNA 3QO0B 3CC1A 1EDHA 2L7EA 2GKIA 1OAYL 2DWEA 4L4VD 5HTSA 3VO0A 4XP4H 2AVFA 3CFIC 4XPHH 2GITB 3TIDB 2YHGA 1L5GA 2HT3C 3VRLF 3MLPA 2EECA 3GRBA 2ZOOA 5DO2C 4PJBE 1CLCA 3MFGB 3I3EA 3DSNA 1DVUA 3SGKC 5CD5C 1QRKA 4JDTH 1FLRL 2IOMA 2BIQA 3QFJE 5CFHA 5BS0E 3I9IA 4IOSA 5GGUB 2NCEA 2WWKT 5DD3L 2IGLA 4NN7C 4MNQE 5JPMC 4G59C 5CNHA 4GQPH 2DJSA 2WXKA 1JNJA 4X7EC 2ICWI 1JGVH 1U8NA 1R3JA 4O2EA 1X44A 3U1SH 3JVGC 3V8CA 1SEBB 1A4BA 1MW2A 2WO2B 4KJYB 3GKWH 4BCYA 4J1UB 3S96A 2XETA 3DMMA 2WXQA 4DPCX 3D1MC 3C2AL 3QR2A 5AW3B 4AKQA 2BSEA 1SJXA 4QRSB 4IRZL 4MWFB 1HI6B 4PJHA 3RPKA 2PCPA 2ED7A 1BVNP 1CGSH 1QRNE 2VL4A 2WLJA 1JPFB 4PJIE 4W68A 1MI5B 4P5TB 1TEGA 4MMYA 2WB7A 2DWDA 3SJVD 1PCXA 1A7RH 1PTZA 4FJZA 1YEGL 4PD4K 3BH9A 3Q01A 3KWUA 4P2QB 4XN1A 2FJFB 1NIEA 2ZE0A 2WBJD 3MCKA 7FABL 1F97A 4PLJD 1NTDA 1S46A 1JK9A 1NCDH 3NSCA 5AVSB 4HBCL 3H3KA 3NG5A 4NO5A 5E8PA 4HJUA 4H2AA 3ULUD 3QUZD 5CGTA 3PPSA 3VH8G 2FHFA 4NB7A 4X7DC 2HG5B 4N1HB 1U2CA 2BXZA 2HAZA 3TZVA 2BOCA 1DJSA 4PYHA 1N4XH 5C09D 3VFVA 1A7NL 1U8CA 2EYSB 3E8UL 5E1QA 4AYID 2HVJA 4W9GC 3T0WA 4EN3B 4E9XA 3D3VD 3K2UL 5GIRA 1CDCA 3SDXA 1RUPL 4IGBD 2OR8A 2XN0A 5C71A 4X4YB 2OMYB 1FYTE 4JG1L 3DX8B 1ID5I 3ZTCC 3TCLB 3C6LD 5E8DH 3P9LA 4P23A 3GKWL 1JYWA 4F27A 3WHXA 1QHPA 4PI2A 4PWHA 3RWFB 3DVGA 3MRGA 3ARXA 3MXWH 3ARRA 2IDQA 2A74B 2AJUH 1A22B 3EG9B 4JFFA 4MNQA 5GGVH 5HYQA 1MJ8L 4JANA 5DK2A 2WKLA 1RZPA 2WOYA 5C92A 4TSCH 3S3DB 3BAKA 3RWGA 5LGHH 1JVOA 4C4KT 2ZUYA 2JKWA 5ISZB 4UU9A 4JQVC 3S98A 5FECB 5I8KL 4H8VA 2J8UB 4JPKH 4DESA 1NDMB 4LCWB 2NR6A 1F3RB 2BS9A 2IBBA 4YBLB 3TL5A 3QFJD 3RL1B 5C7XL 1XBRA 1MH5B 3MCKB 3FFCA 5FA3A 1MI5E 4CDHA 1NC2A 5I1EH 3UXFA 1E5CA 3NGBC 4WCYH 4A66A 1P53A 1C7TA 3CU1A 4N2GA 4HIIB 4UM9A 5B39B 2AS5M 5IESH 3H4FA 3WJJC 2VDMH 2GSIA 5CIPB 3I3DA 4MNHA 3ASNB 4X9GA 3Q2LA 2ED6A 1QLRA 3QEQB 3RWDA 2JI2A 1QVOA 4BDVB 5TDNB 1BQRA 2GI7A 3VFTB 3EH5B 4F9PA 1CZ8H 1MJ8H 2EQDA 4JY4A 3KPNA 3GSWB 2KUTA 4LL1A 5EA0H 3H85A 3AITA 3CPUA 1DBBL 2H2PD 4K5PA 3FYEB 5F3HA 3TN0A 2J8OA 2W9EH 3DYOA 2VE6B 3HC4H 1EZVY 1F3DJ 2FNBA 5F1IA 3D0LB 1Z0MA 2VH5H 3QQXA 1NIBA 2EUZA 1NICA 4CJ0A 1BD2B 2JSFA 1OAQL 1OGAE 2NUTA 4OLZH 3WGVB 1O7VA 3UEQA 3U0PB 2ICWB 2Q7AA 2YJQA 1M71B 2VM4A 5CLZA 5IB2A 1E5YA 1OOWA 1D7FA 3O6LL 4WDIB 4N8VA 1A0QH 3H9SA 5GPRA 4Z5RA 1MCWW 1WBYA 2VDML 4JGMA 5J12B 5JHDB 1GZPB 3T2OA 2IG2H 2QGBA 4B9JA 4PB9L 4Y4KA 2AJYL 2G2PA 2ZOLB 5D7JC 2AQ2A 1P4IH 4PS8A 1LEIB 4G80B 2VDLL 4P46A 2Y1VA 4DN4L 5E1AB 1AJ7H 2ZIDA 2F15A 5FFGA 4JM2A 1H0DB 5KBKA 4U1HB 3EZ8A 1HL9A 2X1XR 1MCKA 5IFHH 2XWBA 4NQDE 1HWGB 3IE9A 5DYOA 3MRPB 4JGNA 5CJ8A 3FU5A 5E8EA 1S7RA 4XO3A 4JFTA 4KFMA 1J48A 1JV5A 2FE0A 4JDVA 3U7WH 1BF8A 5GS1A 2CKBA 4OJYA 2K7QA 3C5XA 3P73B 1QMUA 3MC0A 4L3EE 4OIFA 5D71L 5HVWA 3WN5A 4XE5B 1MFCL 3OSVA 1XTMA 4QRTA 2AHIA 3FOLB 3PWUA 4XN7A 5E8DL 3ETSA 5DI8B 3IMBA 4F57L 1KENH 4EZLA 1LM8V 1SF5A 4PJ5E 3MRMB 5F96H 5T1KA 4LPTA 2EXYD 5IVZA 2K7PA 3SE8H 5KSUA 1RUPH 2IADB 4JM2C 5BOZG 5E2JA 5BZDA 2C34A 4Z3TA 4YDZA 3CSTA 2B59A 3NIFB 4ODUB 4RAUA 1UD3A 4OZFH 4UQEA 2VLKD 1Z0NA 2CK0L 2EZ0C 2Y4SA 2E7CA 4QRPB 1KBKA 5GHWH 4MJ2A 3WXWH 4FXKB 1RJLA 3EO1A 4CDGC 4K2UL 5FHAL 1MCWM 4OH2A 5DD3H 5C9KA 4KK6C 4HS8L 1KZYA 5F2FA 4ZS6C 4JHAL 4TVPD 1JRHL 2HJLA 4CRPA 4XPTH 4X42A 4FN0A 1AIFA 1QI3A 3ULUC 3EYVA 4K7PH 2EVGA 4MRCA 4FP8L 2MNUA 5GRWA 2FBOJ 2QGDA 4FXLA 3DX1A 4K55A 4X7FC 5E1AA 3VXOB 1G7IA 2HKHH 5HYEA 2Y3NA 2OMBA 4GMSH 2ESVB 1RPKA 4FNUA 3FUIA 2H45A 2YGPA 2BNRD 2YRPA 2HKFH 3UTSA 2ZKYA 4B5ZA 1QASA 2EDXA 4RMQA 1ILSA 2ATKA 1ZSHA 2ZUUA 3C6LC 3TO4C 4Z7WB 3BD5A 2BERA 4ACPA 2JVUA 3L2NA 4F1SA 2UUDK 2XQ0A 4IU3A 1H6UA 3QNXB 5LBSL 3VXRD 3MRNA 4Y19E 2C9QA 3RTQB 3RB5A 4JN1L 3L4WA 4MD5A 2HVBA 1K4CB 4LLWB 4U0RC 4XVJH 4IBVA 1LVEA 4FFVC 1B9KA 3Q5OA 5DO2D 1TITA 1XF3A 4JKPH 3F58H 4A37A 4NGHH 4X6EA 2GHZA 1XEUA 2EACA 3BEWB 1BMZA 1FZOA 4AYSA 1MCFA 4M5ZL 1V7NH 1XSIA 1NCUA 2CLVB 4FFYL 5D2NB 3HI6L 3IU3A 3QE5A 3S96B 3BIKB 3TYGL 2BSRA 4BZ1A 4EI0A 3OGOE 3R8QA 1YMMA 5DUPL 4CSSA 2KH2B 4QHLB 4M62L 2GBTA 3KCPB 4DGVL 4KUZL 2BMKB 1RZJL 3PV7A 3RVWC 2IDCA 5I30L 3VXUE 4OD1H 5I26A 2J8UF 2BRQA 4MAZA 2WD0A 3FTVA 3PGFH 3GDCA 3TA4D 4G9DA 1CBVL 5K1VA 4NQCD 2EYRA 2AJXH 5AYTA 2CM6A 5EHFA 5BOPA 3OF6A 5IFJA 1I4FA 1OAUL 3PNRB 3PWPA 1MFVA 1IM3B 2C4XA 3MLXH 4TUUA 5H37G 1DANU 5LBSA 3P3SA 1G7PB 4AK1A 5AVVB 4XXCA 3WEXB 3ZE2F 3HS9A 3BJLA 3IFNL 1BYNA 5CUSL 5JXAL 4AXWB 4MXQC 2XJKA 5KAQG 2OKMA 1QHQA 3L1OL 4M48L 5KG9A 2A6KB 2F7OA 1ES0B 2VABB 1SJHB 2EE3A 3AU0A 2V3EA 3BAJA 1SMOA 3QIWA 3EO0B 1SJEB 4EIUA 3MN8A 3KYAA 2XVKA 1X5YA 4LSRL 1UKSA 5J9PB 2R56H 5LAXA 3BKJH 3JT0A 1S9VB 2IWEA 2Y6SD 4F37K 1SEBA 4LPWA 2H3KA 1L3NA 3GXTA 1T1XB 1PEWA 4NCC2 3HUJE 1JNNL 1NKRA 4FD0A 1GMEA 1T04B 2CO4A 2ZOTA 3SHSA 2YK1H 3CHXA 4X7SL 3THML 1BIIA 1NBZB 2HVKA 4LDCA 3B9DA 4M29A 3AXIA 1IL1B 1UT1A 4QRRD 3UDWA 5JQ6L 2QADB 2X4NA 5AVQB 3N5AA 2MWCA 4PJHE 1UENA 4FHKA 3O4LD 2H41A 4JFUA 4M7KL 1JHTB 2E4TA 1FVEB 1TMQA 4L23A 4RZCB 4NQXB 2O6EA 2BIOA 2GYSA 43C9A 4Q74A 4AIZA 4BEIA 4OUOA 3S35H 1YYLH 4HUXB 4QTHB 4EDXB 2OSLA 2HKAA 1I9EA 2B59B 1MCPL 4GRLD 2XQBH 4H0IA 5L2KD 3APNA 4JM4H 1YEHL 2O30A 5K1JA 1FNSH 4E9WA 4ZW6A 1SN5A 5DDHA 2NY3B 4BKTC 3K91A 5C8JA 4IU2B 2J2ZA 1Z9MA 5FYJH 2R29L 3J07A 5ADPL 1HNFA 5TE4L 1MVYA 3T65A 1E4XI 4MQ7B 4QRSA 3VX1A 3H7LA 3TEYA 2GTZA 4OGAC 1W72B 3PHQA 2HUEA 3ARTA 3VD9A 4LCWD 5ENWB 4ZW3A 3OKEB 4XNBA 2WV3A 3VFUA 4P4KD 5JUEH 1A4KA 4HCRA 3OX8B 4IBQA 4ZOEA 3OHXB 3SCMB 5FYKE 1BXUA 4ZFFA 1FAIL 3N43F 1LLAA 3S3PA 2GJZB 4AMKH 4DEPB 1J0HA 3GGWB 2Z1KA 1YN6A 4B3VA 2XPGA 4L8DB 4I18C 4BE5A 1AP2A 4FYQA 3UTZA 4FXGB 1NCJA 5F7AA 5IREA 5I6XC 3ZMNA 2RFXA 3IGAA 2VLJB 2EDKA 2NY2C 5IKCA 3JUYA 3WAKA 4FXKA 4RZKA 3KAAA 4GKLA 4AIOA 4XNUH 4FA7B 4GW4A 1T3FA 3ARVA 3MRRA 1I7TA 3D18B 3LRGA 4Q58C 3P0GB 4TQPA 4WAFA 4PWEA 5D1ZB 2B5IB 4QOKD 3CZSA 4UBDD 3V0VB 3WJLC 2KHAA 1NEZA 3KBFA 3BKMH 4LLDA 1UWYA 3LZFL 1RH8A 5IMKA 3CLEH 1SHMA 1TTFA 4GKNB 3V55A 4KOBA 4R4FL 3AU1A 4M03A 4WW2A 2VQTA 3LXBA 3NAAL 3RWCA 2ZCLL 4Z7UE 2BSRB 1NWOA 4JJHA 2MMXA 4JFHE 3X1FA 1ZT7A 4TLTA 1AZNA 4Z7AA 3HCVA 3SD5A 5IEHB 5T3XD 2PYEB 3ARSA 3WFBL 4Q6YA 1DDTA 1O9VA 1VESA 1X4XA 3GJFA 3MDJA 1OGSA 2IV9A 4B9YA 1ZHLB 4YHIB 5FA4A 1KIUB 4I3SH 1XGPA 2F19L 4YXHL 4A6YA 1I1YB 1I7UA 1ODAA 2HA1A 4LOFA 3EBAA 2BIIA 3UC0H 4L4TB 4FZEL 1BFTA 3C5ZA 4Y9GA 2YLHA 1C5BH 3SKMB 5I28A 5IG7A 1PD1A 1U58B 1Z1WA 4LF3B 3TBWA 5L4MA 5HDBE 2OSLB 4PCYA 1EFXD 2W0FA 3ZYJA 4AQAB 3FN0L 4X8JB 4NSKB 1LEKB 1P1ZB 2F58H 2ADFH 2UZXA 3MRLA 3HN8A 1DANT 3HVNA 2VDOH 3H54A 3MJ9H 1COBA 2QVKA 3FCSA 4FXKC 1RP8A 4Q9QH 4ONGH 2EDMA 5DUBA 1T21A 1CICC 3Q0HA 5L4IA 1N6UA 5ETUB 4GB9A 4D0BB 3QNXA 5EPMB 1A6ZB 1TZIB 3Q2NA 4JFEB 3C60D 4I18A 3BP5A 3LDBB 3RX8A 1I7ZB 3HPLB 1F86A 4HD9A 5GZND 1OGPA 2O5YL 4Z8FL 4HK0B 3VD4A 4PVNA 4IIQC 4YHPA 3R18A 4HKXA 1TG8A 4LSQH 1ECZA 4LLQA 1NBQA 1C8QA 2WXLA 3A4EA 3VGFA 3T0EC 4OCNC 3SE4C 4MD4B 2B7DT 1VACA 4FQIH 5JOFB 1N18A 2P9RA 3KYNB 1QRNB 3GMOB 4QI3A 5AAMC 4NQUA 5DHYA 2H6UA 4HZLB 4GXUM 1A7QH 2G2RA 3PIQB 3LRSB 4K23L 2RALA 2YEVB 4FERA 3UG3A 3D85D 3ZHFA 1BECA 4EO5A 4BZ2H 4RETB 3MRMA 5CO1A 3L3HB 1N26A 5IROA 5EBGA 4IU3B 2IXQA 3OKMB 2IQ9H 4G9FB 4JQIH 2ZKMX 1E5AA 1BBDH 4UQ2A 4G8IB 3EBHA 4ZMTA 1WBZB 1VZIA 5AUMB 3MJGX 3U2IA 1RY7B 4XTRD 3GT6A 2XTJE 2IJ0C 2VW6A 2GC7C 5HVHB 1RUKH 1JZ7A 3VG0L 2A2QT 4MMXB 2JIXD 1WFOA 3MJ8A 1EDYA 3GHEL 1HK6A 3VB8A 3IPEA 3LYRA 5D6DA 1A7OL 3BC9A 3CD4A 3ZTEA 1N7ML 4I87A 2W95A 1PLGH 4O4YH 1TJMA 1YPZB 4PJ9C 2ORBH 4R8WL 5FKPB 2E74C 5ECJE 3AXHA 1Q0EA 2BVYA 3GBMH 1G1OA 2VISB 5KVEH 2FHCA 3GF8A 5CU5A 3VGEA 1BYPA 4YFDB 1UUSA 2OXGB 1BXXA 4NBXB 3P4OB 5BUAA 4ETYA 3M1OA 1D5RA 3SIKA 1FJ1B 3WTVA 4JFZL 1NAKH 2IH8A 4U1JA 1TU2B 5AW2B 5I1GH 4HLZH 1UC6A 1GS7A 1RJZB 3SPCA 3RIKA 6PCYA 2I07A 3KXFA 1ITCA 1ZIAA 1SZNA 2GJRA 4U0QB 2H1PL 3NUKA 3R1GH 4U6TA 3AAZB 3CZLA 4X4KA 3X13B 1GYVA 4M6NL 3SGKA 5I1IH 3TJPA 5JHLH 1LXMA 3B7UX 2CD0A 4PJ8B 1PLCA 2XI9A 3KDMB 2R15A 1X4ZA 2BLFA 2FGZA 1GPOL 3BI9X 4QWWD 5D7LD 3VGAC 5CR1A 3BKCH 5IFHL 3HI5H 5C2BH 4PS4L 1MCIA 4HISA 3UP6A 3Q43A 3ZHKA 4K5LA 5DMYA 5D7HA 5MENB 4BJLA 1U3ZA 3QWNA 1OAZH 1WBZA 5F7DB 2GBVA 2AJYH 3SQRA 3QCTL 5E0FA 5H37H 2RMNA 1AYOA 2ODHA 2DTML 1FDLL 3OAYK 1KLGB 4N2OA 3O2VH 4MNHB 3F65A 1W8EA 5IMLA 2NY4D 1JWSB 1OAJA 3L54A 3BKCL 1TJIL 3AACA 3G7TA 3IXAB 4L1SA 4PJFA 3V4LA 1IC0A 2MTAA 2VSMB 2HYMA 4UDTA 5F89B 1R4XA 2V6HA 3VI3B 2VKXA 4ALAL 1FFQA 2HSIA 4HH9B 1QRNA 4X7CC 3ZZSA 4AQEB 4XWGH 4D8OA 4H8QA 5IHUL 3CZEA 4IBZA 3OQRA 1KTLB 1RMFH 4YHKL 1KJ2H 2HLFC 4TF4A 1MCLA 1IBHA 4RFNB 5GJSH 5SWSB 1EJOH 3I9GH 3U7AA 2R1WB 3O4LB 1AKJB 1M05B 2QELA 2NYZA 1QUNA 1CR9L 4TLUA 1BVZA 3KWTA 4D9RD 3TPKA 4FMFA 2WB1A 2BY3A 3T77B 4NENA 3TNNB 4RMUA 3QQ9C 1ZLWH 2X4OB 4OCYL 2LU4A 2XDHA 4HFUH 5C0NC 5EUOF 4A2HA 3LKSA 4E41A 1U3YA 3BQUB 1IBGL 2YXWA 3WS3B 3IVKB 4I77L 4DUVA 4P59H 4Y1SA 4RNRB 4GBXD 4N90D 2TRYA 4Q89A 3UH8A 5EZIL 4AWJC 3AWEA 3FN9A 3TBTB 4X6DA 4P5TA 3Q48A 1R24A 2CLRA 4XCCH 5H2BB 5H8DA 3VFSA 3RG1C 1CUOA 1YPZA 2X9ZA 1F4WL 1YAZA 2AQNA 2H9GA 3OB0K 1FV1B 1ZS2A 3HI5L 5C2BL 1TF4A 2X2JA 2XYBA 3N3EA 2CDFA 4UQBA 4H4NA 2HJFB 1R3KA 3VA6A 1ED3B 2OR9L 2EEBA 2FQEA 4G5ZH 2Z7WA 4U4IA 4QHMA 1IE5A 5EN2B 2KMWA 3MV9E 5IJKC 3INUH 1AO7D 4JPVL 4Z7UF 5D1QE 2XY2A 1MRCL 3K72B 4B9FA 5IBTH 1O0VA 4E5XG 1KGWA 4WWID 2P43B 3KJ4B 4ZFOL 1T66C 2C7UB 3C2AH 3P2DA 3ZL1A 1NGPH 3MBXH 4LCCA 4L37A 1ONQB 5T1KB 4PTTA 4RQQB 3RWIA 5ES4B 1HINH 4N24A 4HXAL 4AC2A 4Y16B 1J7VR 2MCMA 3NFPA 2J12B 4P46C 4RRPM 1ZVNA 3NCXA 1KELL 1F58H 2CHXA 2YRBA 2KDGA 5IVXF 4UAHA 2GSGB 3JXAA 4JO4L 1LMKA 5IT2L 3LEVL 1QFWL 3ATEA 2DI7A 2F8VA 4DZBA 5I8OH 3H9YA 4MZIA 4LCIL 3WENA 2BVQA 5AOMA 4E9SA 4KXCA 4DGWC 1RK7A 5B4MD 1DEEB 4FTVE 1MI5A 1ZHLA 1G87A 4RA3A 3U9WA 2VDOL 5TF1L 5HXMA 1L0QA 3FUHA 2XWCA 1U4FA 1E4JA 1FLTX 3FB8A 4HUUB 1ACCA 5EFIA 3ZKMC 5D93B 4OGYL 3KLLA 4P59L 4K3GA 3RKDC 4PRPA 4N8CL 2Z0UA 3F85A 1D5MA 1KBBA 1PZ5B 1QLFB 1ZXQA 2BNQA 4PRIA 5T33H 3VXPA 3I84A 1MNUL 1E90A 3MRLB 5GRJL 3QWOB 4PD4J 4D9RE 2KLTA 3V0WL 3TPUB 5JLZA 1IC4H 3VMOA 4MNGB 3N50A 2AQTA 3FTWA 2X28A 1PGRB 1IC5L 5IQ7L 1QFUH 1I9IL 4ENZA 4KMLB 3VYOA 3MFFB 3OB8A 4YDJA 3O3DB 4ELDA 3WNPA 2WLLA 3SQBB 1G0XA 2EIEA 5IVNA 3AY2A 4DP1X 4XP5H 3CX2A 5C0BD 5F3HB 4N0UE 2B16A 3TN0B 1NGXA 5A6IA 3KLKA 2X3BA 3APMA 2K45A 4YGVA 1MQKH 3OG4B 2BW5A 2GEEA 4X0NA 3V6ZB 2PPFA 1TTUA 3L3GB 1B4JL 2FEEL 3HHRB 1QVOB 3QDME 4JFYA 3WSQL 5MP6L 1SXAA 5JPMB 4A7GF 4Y1AA 5A16B 4GEIA 3K7UA 3FB5B 5A2KH 2J4WH 4UB0H 2YGNA 5KVMC 1FL5A 2HFFB 2QSQA 1EJ6A 3JV5A 5MI0C 4HETA 5IB5A 4C47A 3BRDA 3QVAA 4NI6A 1P7QA 3G04A 3QNYB 3QW9A 1YEDB 5INCA 4UQ2B 1O9ZA 3HMXH 3M7OA 2WWOA 5DYFA 2QLYA 5DRXA 5DRNB 2CGRH 2V33A 2A9ML 2HLFD 1E8ZA 2ZJSH 1OAXL 3JWNG 2CA4A 2FK9A 1VZHA 3MRCA 4Y16D 1CIDA 1SOKA 2OSXA 3MCYA 1EERB 2Y36H 1ASQA 2XWRA 3QIWB 1QWHA 2QQLH 4PW3A 4OFIA 1ZANL 3F7YA 3FO1A 5B8CB 4CC4C 1OK8A 1P7QD 5C0IA 4HV8B 2XBTA 3TASA 3Q6GH 4OIBA 1NCHA 3GRWL 1XGPB 3BGAA 3CLEL 4FFWD 5ITFB 5DUJA 1Z6JT 2R8SH 3JBG7 4HKXB 2YARA 3MJWA 1QQDB 3FCBA 4N68A 3ZUCA 4JHWH 1GKEA 2LT9A 3RGVD 3SDCA 4ADIA 4NM4H 4E9QA 4H25B 4P57B 1BF5A 2Q2EB 5DJCA 1ACYH 4OCSL 4YL9A 5KOVC 1D2PA 2NY0B 4KITB 3PWLB 1RUKL 1Y7VA 1E6OL 3C9NA 1I8MA 3HMWL 3FU0A 4F7CB 2UZYA 5DF0A 4P9ML 5DUBB 4M5YL 3LN4B 5E6UB 4M7KH 1A1OA 2K9UA 2A83A 1WCBA 4YDKL 1Q9LB 1JNHB 1BFOA 3DK2A 2EDQA 2WQ8A 4G8FB 1DVFB 4UNUA 1WIUA 4PRAA 2VDRB 3TA3B 4M93C 5L2KE 4WI2A 4NRZA 4UMGA 1KZQA 5EO0B 1S7VB 3TEZA 4DOHB 1UB6A 3SZ6A 3ERXA 2XHNA 1A4JB 5F7NC 4U1SA 4H1LB 4EKJA 2HX9A 3G6DL 4ZJ9A 1BOGB 4MA7L 1IZJA 2BNQD 5I71C 4BWTA 2Y3AA 2AGJL 5TE4H 4JO5A 4L4TE 3QPKA 3W0WA 5T5FL 1NCWH 2NY2B 5BRPA 4MA8L 2VSCA 3IXTA 4Y1AE 4OV5B 3B9VA 1CI5A 1E3FA 4A7TA 1BVLA 1AHMA 1QX1A 4OIIH 4LKCA 3SE4A 4V33A 4JM4L 5DEFB 4KVCH 2YA1A 4RISL 3IN2A 5EUKA 5I1JH 5DQJB 2VKWA 1IUZA 5HPMA 3KZ8A 1J1OH 3D39E 3H55A 1L3WA 3RNKA 5MI0B 2ZCKH 3T08A 5KWYC 2F5BL 1MXGA 2KBGA 2VDQH 3PP3K 3S37L 1I9RL 2UYLA 3QS2A 4LIQL 4HVBA 4YR6B 1MLBB 4P9HL 3W11D 1AKPA 5KSAC 3G5XA 1SEQL 2Y7QA 2X0VA 1SFHA 1XEDA 3IF1B 4LOUD 1CBVH 3L4CA 4KVPA 4EBQL 4HXBH 1QBLH 3CN1A 4BFNA 3PJNA 4HYTB 4OB5L 2MCPL 5CM1A 5LJYH 3EBGA 4ZS7H 4WI3A 2EAEA 3BW9A 5C08E 4I3RH 2ZT9C 4K0OA 1BJMA 4F2MA 4HWBH 4NKDB 5GS0L 1U9KA 2XZQH 2GAZA 4M7JH 1MVUB 1MY7A 2W8CA 4DIXA 2VQ4A 1B4TA 1MFUA 1NEZB 1DO6A 3WDHA 2E4FA 1FZKB 2FIKA 3FRPA 4NKIL 3TCTA 5CEZD 1S7XA 4GAFB 2LLNA 2XU9A 1FFRA 2YMXL 4KUCD 1P4LB 3D3VE 3VFMB 1RP9A 4HWBA 3WMQA 1PY0A 4DN3L 3LZRA 1NLBH 2B1AL 3EOBA 3UAEA 3OAUL 5I66A 4Z0BH 1FYTD 4XXDA 4LSPL 3LZFH 3V6BR 3ZT7A 4WKXA 3STLB 3WAJA 4R7DB 1PFCA 4A7GA 2FATL 1EX0A 1CLVA 1UZ8B 3NABH 5C07B 1JOIA 3V0GA 3H1ZA 4DK3A 3UOAB 4NUQA 4P5TD 2HKFL 4PP2A 2YD8A 2EUXA 3SGEH 2VDQB 4K9JA 4RGOH 4S1RH 4AYGA 1A9VA 1TENA 5IBUG 4BFGA 3CHOA 1H0DA 5EZPA 1S4IA 5AOKA 4TULL 3ZSSA 1ORQB 2PP9A 3EGDB 2P5EE 3WJLA 4TSBH 4L9LC 4OCXH 4N2DA 1YEIL 4GLRH 4G1EB 2Y7LA 4L8CB 2I9LB 4TQIA 2EICA 3H0TB 1YPZE 3VM5A 4FP8H 3TX4A 1O6TA 3JWDL 4N3TA 5IOPA 4ODSH 5B22A 3K6FA 4LIQH 1T5XB 3KD4A 1PY4A 1DZ0A 4XHQA 3HNVL 4LAJH 1RJYA 3ILPA 2ED9A 2YGQA 4JQXC 4NWUH 4P5KA 5FO9A 3US9A 3DOSB 2C3GA 5TQ0L 3BQVA 3VD3A 5IT2H 1CU4L 5F9WC 3CDYA 3E9UA 5AVZB 2J72A 5JPNC 1KCKA 1Q4NX 2JWYA 2WM0A 5HHVL 1QRND 1QSFA 3WE6B 1SF3A 2FYYA 3RWEA 2I69A 1PMYA 3MODH 2J88H 4TUOB 3ZN6A 3QQ4B 1ZLEA 1R6VA 3L1FA 3MBXL 2QHRL 3KPRE 1IC4L 4L8BB 4DQAA 5IHHA 4KZDH 5KSBB 2FX9L 1MAKA 1CGWA 1AS6A 2P45B 3WIHL 5D8JH 3QHFL 1T1YA 4X4ZA 2VABA 3RVTC 5D7IA 4XC1H 4FQ1H 5L8LB 4JRXB 3CPLB 2WXPA 2G0KA 4KHXL 1AMXA 3TBTA 1SUHA 5DU7A 4WTQA 1NBYA 5FEBA 2OR9H 1P7QB 4O58H 3Q1SL 4HT1H 5DHEA 5EC2A 4N87A 5K9QI 1FC2D 1JK8A 2VAAB 1JGDA 2V9TA 4OR1A 5TF1H 3LXAA 4RAVA 4KXZH 4M1CD 5DJXB 4HPYH 2XYCA 5CFAA 4LSVH 3SDAC 3KWWB 2I9LA 3KXFD 3HMWH 1S7WB 4S1DC 5B4MC 5I6NA 2X70A 2CKBH 2J8UE 3FTGA 5CEYB 3RGVC 3CSYA 4U3SA 2A6JB 3QR0A 4AVIA 5B7MA 2ZG2A 4GRLC 4PMFA 1DJXA 5JHBA 5HHNB 3SE6A 5DXWA 4YHYB 4B3EA 1U8QB 1VFAB 1GW0A 4OV6F 2WZPA 3BVTA 1R3HB 5B1BB 3TIEB 1ND0B 3FCGA 5AVUB 4NFDA 4DHLA 5IWLC 3PRZA 4ZO7A 3BKJL 2ITCA 3C87A 1WS7A 3BUYA 5BUPA 1S5HA 1FG2B 3ULVE 3ZO0A 3BDYL 3HE7D 4ABWA 3QUZC 3B9KD 4Q52A 1AC6A 1RZ7L 4APQD 3ZHLA 3L45A 1U3HC 4FMKA 1ZVSB 1KXTB 3ESPA 4F7MB 3INUL 2JIXA 3ZY7A 3EO0A 4Y9FA 4S2SA 1EHNA 2PKDA 4HH8A 4YHKH 4X5WB 3AY4A 4B9GA 3QIWC 4MDIB 4OBRA 1H3TA 1KFGA 1VRSA 3CMOL 3AJ7A 1YUKB 2AEQH 1OAUH 4NKDA 5INDA 5J57B 3T09A 4NT6B 4ZUWA 3U0TB 1MFEL 1D5ZB 4NN6B 2LLGA 1UKQA 5KOMC 3ECQA 3ECVA 5DEZA 5EB9A 3W9DB 3SY6A 1H6FA 3MV8B 4LO9A 2XG5B 2E46A 3CN3A 3E6HB 4GXVH 2OYKA 4DGVH 4PB0L 3NACH 5LDUA 2EDWA 2X88A 4IOIA 5CN2A 4EN3C 2QLVB 3ZDZF 3CFQA 1MCSA 5GRYA 5LO7A 3SBQA 3GJEB 4J4PD 4FRWA 1IBGH 3QEUA 1MG2C 2PO6A 2WN3A 1KXHA 4J3BA 5IW3A 2COQA 2UZIH 1KCWA 1EEYB 3F64A 3CMOH 4XVTH 2ADGB 3GIZL 4P4KB 3TFKD 1IGYA 3FFOA 2DBLH 3KYMA 1A1NB 4KI5E 4XP5L 3E38A 2QMJA 1BVKA 3PDDA 5D7SH 1INDL 1WG3A 4HFWA 4QJ5B 5DD6A 1OM3H 5C3LD 3LQAL 2ZCZA 5AEAA 5IVZB 3B2VH 3B5GA 1AQ8A 1U92B 1HSBA 2NX5B 4O2EB 1RZ7H 4YBHA 4BCXA 1XDTT 1F4YL 1Z32X 4JG1H 5E8PB 3ECBB 4UM9B 2GHWB 1A1MB 2R4SH 5FYKH 4XVTL 1F00I 1QPXA 1KWKA 4XVUC 4YFLI 3OB0H 4ZTOL 2E8ZA 5J1AB 5D2LA 5J12C 5E7FA 1NC4B 4HEPA 4YMPA 2O4EA 1OK0A 4YJZL 1CICB 1MJ7L 5INDB 2EILB 4LPYA 4NQVB 3QEGL 3VWJA 4K3DL 5FS5A 1CDHA 3BVWA 5KAQF 3QEHA 2P8LB 4P2OA 5CILL 3LPOA 5FK9A 3STBA 3VXOA 1DVXA 3IBOA 4J5VA 1WFUA 2H9GB 3TO4D 2IEPA 1T7XA 5I8KH 1N8OE 4PS4H 3NIGF 1PJ9A 2I24N 1CBJA 1L7IL 5DHMC 4QAMB 4XI5C 5D6CB 4AYDC 5C1MB 1E42A 2WXGA 1AXIB 1P5VB 4XAWH 5E0QA 2FUTA 4JO4H 1HQ4B 4BFOA 4CADA 1A7RL 4DO4A 3TBVA 1JF6A 2WLHA 4G83A 3VYNA 3N9GL 2UXTA 1XWVA 5J6HB 4E41B 3T0EB 2D7PA 2L8AA 1N8ZA 2G5BA 4Q9RL 5D8JL 3UGUA 4KXBA 4AQ1A 4N2NA 4ZFQA 3ILPB 4LBAA 4M7ZC 5JIPA 5AW0B 5IHZB 1BGXL 1OF0A 2R27A 2VN3A 3EJUA 4JM2B 1I8UA 4NKOA 2DLTA 1WE5A 3UAFA 3CQQA 4BQ8A 1XH2A 2VAJA 1R5VB 2LABA 3MV7A 4QXTA 2AK1H 4PRPE 1E4WL 4B9KC 3VFNA 3F83A 1CFQB 5PAZA 1A7NH 1FYHB 5LKNA 1L7TH 4Y9EA 1L5GB 5D7JA 2CO6B 1I75A 3EIFA 2FEJA 4J7RA 1ZLUK 2V2XB 5DZAA 2C5DC 2BK8A 5IF0A 5E08H 2XWXA 3RI5K 1HSAB 5I1HL 2VQ1A 5IB2B 4HQQL 2JLPA 1IAKA 1X7QA 1GJWA 4NO2A 4HPYL 3TC9A 4XWOD 3U30C 1ND0A 1UXWA 5KS9F 2DF3A 4HMCA 1OP3K 4M1GH 3SN6N 2FIRT 4ZYKB 4FHBD 4IOFD 1FGNH 1DBJL 1T1ZA 3QJRB 1FO0L 2NY4B 4XH2B 3WNIA 4A2GA 2PR4L 5FOBA 1HXYB 2KC0A 4A7SA 3ZIMA 2LU5A 2YD2A 3AGWA 1DJIA 1JWMA 3ZT6A 2XTJC 3JWOC 4F9PC 3U6RB 4KV5E 1H8NA 2W5PA 3ILQD 2P80D 3MGTB 3MI6A 4XP9L 5DJ2B 3WS6A 3P11H 3S88L 3LSOA 4QD2E 3WFBH 3HI1A 3EOTH 3U36B 5LXGH 1RJYB 1DFXA 3MBEB 5BUGA 5DZVA 1OM3L 2X41A 4FEMA 3GLAA 2ZCLH 5HDBB 2NXYC 3WO4C 1E2VA 1NL0L 1MHHA 1HWWA 4OJDH 4XO4A 3CZFB 2XXCB 3ZDXF 4KXDA 4B41A 4NSKA 1YSOA 1P4BL 4Y4FD 5GRXG 3AQZA 1KJ2A 2DTMH 4HAFA 4PB0H 4ZX6A 1YNLL 4NRYA 1HOCA 3VI4B 2Y69B 4PWGA 1OCWH 3A22A 1MJJB 5K33A 1ZV2A 1TZGL 4BFIA 1K85A 4ZS7L 3QUXA 4GG8B 9CGTA 1FH5L 5D5ME 5JW4R 3NCBB 1OSEA 4DAGL 4NXKA 4R3SB 5AUMA 2PWFA 5SX5K 4AENB 4TVPE 3QNFA 5GGTH 3D69A 4QLWA 4ZXBB 2NCMA 3VRLE 2NR6C 4JW3A 5I1IL 5ID1B 5DD0L 3MHZA 1BPVA 3IAPA 3UMTA 2Z1PA 1PKQE 3K8MA 2JCCE 3S8GB 2VDNH 4BELD 4NHUB 5AWNH 5I6LA 3M8OL 5EF3A 2OW6A 3O8XA 1VACB 4HPOL 1WJ3A 2CNZA 1ZPLA 4U1IA 3GJEA 2A6JA 1F4XL 4GRMA 4JFZH 4Z7NB 3NH7L 5A43C 2DLFH 3CUPA 3MSPA 4NNXA 1JCKA 1A2YA 3PWPD 4OLWL 3S7GA 2GG1A 3OF6D 2I32A 2OMWA 1CD9B 1JVLA 4KTDL 1DQDH 1ZT1B 3N91A 4PR5A 4OZHA 2DW5A 3NEOA 4U6VH 5HYSB 3IM1A 1QPPA 3G5YA 4KQ4L 3H3PH 1FFPA 3HZVA 1XR9A 2VR6A 1BX2B 2FUQA 2WP3T 3HNTL 1DFBL 3M46A 4OF5A 2CRYA 1HSBB 3L5JA 1RULL 3AUWB 1ANUA 1OD9A 1R3LB 1TT6A 2N1TE 4I1PA 1NBCA 2QR0B 3E80A 3QJZA 2M26A 3BE1H 3RQ3A 4JFDA 2GIMA 3KYMB 3IMUA 3UBHA 1L9PA 2RAMA 1H19A 3IFOA 4M6OH 5LAXB 2IPUG 3QZWA 1QEWA 4KH9A 2VDQL 2KZBA 3IJSB 3V9FA 2F7PA 5E4EB 2RHEA 3VXRA 3L4ZA 2NTSP 5DJ8B 4LCUA 1OTUD 3SYOA 1USQA 1J12A 3L9RA 4KVCL 5BQ7B 2XTLA 3TVMA 3CV5A 2XIIA 3MV8A 1A4JA 1BQ5A 2WAHA 1FZJA 2O61A 2WSPA 3ABKB 3HBQA 3L5HA 4PJCB 4YPGB 4L0YA 2OMNA 5IOKA 3S3SA 2BNRA 2G3NA 1H3VA 3GRWH 5F70A 3QHTC 1KFAL 5IEHA 2B20A 1Q9WB 2VLRD 2QPEB 2JTDA 3GYRA 3P54A 4G71B 1L6ZA 1IGYB 1VFUA 2WZ6A 3Q1EA 4E68A 3SDDB 3GIVA 5J9PA 2H8PB 3VGBA 4JB9H 4KTYA 5LHDA 2JKXA 3TWCH 1GHFH 2YEZA 3X17A 4NNYA 5E7BA 3SZKC 1JD7A 3V4VL 3OMNB 2AW2A 4QXGH 2G2NA 1UWFA 3G5WA 4WHYH 2MQCA 4TVPL 4YGVB 4RX4D 5E24E 2Q3XA 1EAOA 1BVOA 3ESUF 1WD8A 3FHAA 2MKWA 3U0TA 3BRGC 3SEPA 1MIEH 5HVGB 2HLEB 2PLTA 3IJSA 5SWZA 4FZEH 4KX7A 3TYGH 3SCMA 5FYJD 3DJSA 4KQ4H 1URLA 5MEOA 2ZOKA 3PXHA 4DK5A 2O1AA 4XVUD 4XOCA 1MCHA 1V7NL 3CDGA 4ODXB 4F37F 3QQNA 2P5WE 3ENEA 3VXQB 1OAKH 2N7SA 3P0YL 1UZ6F 4I1NB 4ODTH 3MYJB 1LP9B 1SGKA 4NPKA 1RUQH 1G0YR 4LSRH 4NUPA 4I2XA 4OI9A 4YDVB 2P5WB 5BZWA 3V95A 5EEZA 2OK0L 3RU8H 5I1KL 3L1GA 1I85A 1V8HA 2VIRA 2PWHA 1A4CA 4P3DB 1BZDA 3S0PA 3ZE2E 1GCYA 4J3OH 3IGAB 4TL5A 1FIGH 1ETZA 4DVRL 4AEFA 4P8QA 2BDNL 2H47C 5F1OB 2F7RA 2V5MA 5AKTA 1RIHH 2Y23A 3BH4A 5C09B 2FB4H 1EH9A 2GI0A 5JIQA 3R19A 1ZMYA 1NCGA 4HV8A 2Y2TA 3HNSH 1OANA 4MQSB 5DTFB 4HOXA 2YGVA 3GTTA 4PJXE 2YUVA 1P84J 3ZKQD 4WUUD 2HKHL 4QRBA 3UX9B 1UEYA 2XQYA 4HJGB 1NM9A 1W0YT 3ZTJG 3AWGA 1IAIH 3LN9A 4HIPA 3J8F7 3SGDH 1CK0L 5L2KB 1LDPH 2BVOA 1JZ3A 4FFZH 5BQDA 2WZ5A 3FMGL 3LNGA 4F7CA 1KGUA 1WGVA 4OLXL 4OZGA 3ULVL 3CVHB 2ZP0T 5HJDA 2WUCH 2EYRB 3BWAA 4KRPB 5FCUL 1Q94B 5D1XD 5B21A 2OSWA 4Y16C 5GJTL 1RFDH 5ICYA 2Y0SA 2EINB 1P2CB 4G6FD 1Y1UA 3D0LA 1HWHB 4OZFG 1AFVL 2BNQB 1THAA 3P2TA 4M7LT 3NCFB 1WF5A 3C5JB 4Y5YC 4BFKA 2BFVH 1BLNA 5I75B 2Q76B 4ZUSA 4QT5A 3QQ4A 4N5ED 1J11A 2JFCA 4AYMC 2AGJH 3VVVA 4RX4A 5J11B 2CLVA 4HCRH 5TJWK 4G8EA 3T3PF 3P3RA 1Z9LA 4F2EA 4PY8I 5I6MA 1I8LA 1O9WA 4XVOA 4NHUA 5JW5B 3BVXA 3NJGA 2NT1A 5D7KD 2WLZA 4BGDA 4R83A 1K6QL 3F5WA 3K6IA 5D71H 3GXDA 4B97A 1N10A 4WKZB 5HGDA 3VD0A 4U1LA 1PX4A 4Y4KB 3U7WL 2VLME 3MBEA 4IBTA 5ID0B 2B4CL 1HZHH 5GS0D 1ET8A 3RPIA 4PIRF 2C9SA 3PABA 2R0LH 3FQYA 3L5WB 5D7JB 4LNRB 4XOAA 3SO3B 3SE9L 3OHMB 5JPNA 5K9KB 3ZX1A 5JQHC 4JFFD 3VXQA 4PRDB 1KJVB 1QR4A 1PZ5A 1ITBB 1IKNC 2X53A 2XV2A 1IAIM 2VR5A 3C60C 4XWOC 3BIBX 3D05A 5ELIA 1RULH 3T2PA 2Q7NA 3WXWL 1AIZA 2ROYA 5K9JL 4IBLT 2GJ6A 4LAQH 4NI3A 1SJHA 1I8MB 4IS6B 1MCEA 1V54B 1HCZA 3L1EA 3TOPA 3FOLA 3S8WA 1PS3A 5HYSA 4PTUA 1E4WH 4KNQA 5ITBH 5LAPA 3FDWA 5IB3B 5HDQH 4RESB 3QDJE 3TA3A 3Q8EA 2WTRA 4C56B 5IMOA 3FTYA 3CSFA 4YQXL 5SWQB 1OP3H 2HX7A 4TS6A 3PQYA 4Z7QB 2L0DA 3GI9H 4QRPA 3BUPA 3C2SA 2WLYA 3DBSA 1U8LA 4AKOA 1IX2A 4K7PY 2WO3B 3LSOB 1ZSDB 5CS7A 1B88A 1RI8A 3UBGA 3NP4A 5KSBE 2H4EA 1QZNA 4OSUL 3KBEA 2OYMA 5BXFA 3QNZA 4ELKA 4PJGF 3O6KL 4PV8A 2J6WA 2CIIB 1W0VA 2WBJC 2X3CA 3MLXL 3OQ3B 1SY6L 5HDLA 1IQDA 4KKZA 1YCSA 1L7IH 2XWEA 3W1ZA 2XZZA 3WNJA 5ACZB 1B2YA 3N44F 4X6FA 3OKLA 5BVJB 5DWUL 3RY5A 3HIZA 2APFA 1AJ7L 3DWTA 4M6AA 3BPLC 2L04A 2J1KA 3KPQB 4NWTH 4WI0A 1ZLVK 3I2CH 1FZJB 3CX5J 3HA0A 4NN5C 3QFDB 1YNTB 3RWFA 4N2BA 5IUCA 1JIBA 4QTIH 2BSED 3FT9A 1C5DB 2ZAHA 2VDPL 4FL4B 2WZ0A 4GP8B 4NNYB 3ZHNA 1C12B 3WKYA 1MJJA 3IDUA 4R9HA 1SLWA 4M4RA 3M7FB 2IO5A 4MSWA 4Y19B 3V6FB 2Z0BA 3L3OC 1L6XA 5LGHL 1UXSA 1YPZF 5AOJA 1NMBL 3FO0H 1N68A 4CW1B 3Q5TA 5IW1A 1I3VA 3R1GL 1FNHA 2J8UA 1AY1H 5KSAA 4ZUTB 4HHWA 4KXAA 4ZXBA 2WCPA 4DKFL 1QOKA 2WGNB 1JFQL 3RDJA 1J1XL 1OSPL 1R47A 2EO9A 5F0PB 4C4BA 2X40A 1ZD6A 1DBBH 2J25A 2NXZD 2LFEA 4HWEL 4XN2A 4ZPTA 5GJSL 3ULSB 4EOWH 1TTRA 5HYJD 3QXVA 5C0DB 1FNFA 3TONA 4OZHE 1XSKA 3RZCD 3OL2A 3S5YA 1RZIA 1DE4A 4XO5A 1UCBL 3MNVA 4GUPB 2ZCHL 3VFGL 2EXYC 2OZ4H 3F7KA 2SEBB 4OQTH 4PGBB 4DPBX 2J6EL 3GLDA 2CBQA 5IJCC 1DBKH 2AQSA 3HFFA 4UMSA 1HESA 3E6FB 1IQDB 3LKPA 4HGWA 4Z77A 4WUKL 1JNHA 1DDHB 1OGTB 2F6AA 2R2BA 1YMME 3X12A 3ABLB 1RERA 4B7IA 1OAZL 1KGXA 2FWUA 5EZJB 4OZFB 2Z92A 1WV7T 3QDHA 4B0MM 4EIGB 4QRPE 3VFOB 1M7XA 4MASA 1OE1A 2NNAB 5E94B 4XNMA 1MWAB 3DECA 4LRIC 2O6FA 4G42B 3PP4L 2FLRT 1VB9A 3GK8H 1XH1A 4HIHB 1SBSL 4KKAD 3T4YA 4TUKH 1YEGH 4PJ7E 3BQUA 1RURL 1BQLL 2EIBA 2YAMA 1UA3A 2F9BT 5E23A 5BS0A 4Q9CA 1ROCA 2ICEA 1YEFH 4Y2LA 2W92A 2X2UA 4HXAH 4M4PA 1E4XH 5EU3A 5JDJA 5A6LA 5ILTH 1KB9J 2GK0A 2XG4B 3EBIA 4AKPA 1AO7B 3RFZA 2K8MA 3L2MA 1W0WB 1JUFA 1I1AA 4J3OD 1WWCA 4U1NB 2Q8BH 3M1BB 3SYQA 4ZUUB 3LHAA 2DYPB 3SKJL 4EVNA 2VE6A 3V79C 2HLAA 3KPMB 1M05A 4P2OB 1S7WA 4OCLC 3EG9A 3VGGA 1DEDA 1G9EA 1JGVL 1Z9SB 3B8YA 3IFPB 1XCXA 3IKCA 5TDOB 3K1DA 3L3IA 3WEXA 3QEUB 1MPAL 2AK4D 3UPRA 1INEL 4XMVA 2QKIA 3NSFA 5E1GA 1K3IA 4QRQA 4XMPH 5CCJA 1SXZA 1T1WA 2D31A 2WJ7A 1TJGL 2QPSA 4N5EC 5JHAA 1HHGB 2P3YA 5HYIA 4BFEA 2BHZA 1PZBA 4MXQD 3KPPB 5JLZB 4BYHA 7FABH 3HE6C 2FWSA 4WV1C 4GBXB 4PTTB 4RQQA 3RWIB 3QEGH 3TT1L 4XMZA 2F58L 1YY8A 3OR7B 3ZDWA 5TH2A 1XGUA 2LFGA 4JX0A 4EI5C 2H0PA 2ZXGA 1IGCH 1IBBA 1OAYH 2Y24A 1JP5A 1I31A 4BZ2L 3U79A 3N85L 3FT3A 1JMZA 2CRIA 4H8WH 4A38A 1ZRUA 4Y4KC 2J1ZA 4PJ6A 1FUNA 4GRWE 1KN4H 1MELA 2ENYA 5TF0A 1NQBA 4RRPG 3AQDA 1SRDA 3CZKA 4YHLL 3I6LE 1JMXA 4WEBL 2EIJB 4I3SL 3WHE1 3MROB 3GSRA 2FX9H 4N0FB 1JHKH 1O7DC 3MNVB 4P05A 1QSEA 2R1YB 1CXIA 1U2HA 4KGLA 4F24A 2CRZA 4WEUD 2VQ1B 3LQAH 1A65A 1IEHA 5AOLA 3RVVC 2A4ZA 3L3HA 1S78D 2MIZA 4X5LA 4HUWB 4OGXH 3FO9B 5EA0L 3LX9A 5LN4A 4ZNCD 4TNWK 4Q14A 4OM1H 2FQFA 1SPDA 4U7SA 5DD6B 4BSWA 4ALAH 1NMBH 3UPCA 4V2BA 2F68X 5F7LB 4AZ8A 8FABB 3WDJA 5D72L 2GITA 5C0AD 2YUXA 3TIDA 5KW9H 5LQBH 1TJIH 4V1DD 3Q06A 3V4PL 4WENB 3ML9A 5BO0D 4P2CG 2YPLA 3VI4E 3N41F 3RZCB 3ZO9A 2KPNA 3ARGD 4MAYA 3DDGA 1FFNB 3QIUA 4FEIA 4QTIL 4E2OA 3FQ2A 1U8MA 2XZAH 3LKSB 4O5LL 3EJPA 4X5WA 3QCTH 1ZSDA 2FBRA 4XXWA 3I2CL 4YC2C 2PYFA 3TO2B 3T6ZA 5IJBC 2YXVA 5DSCA 3KPPA 5E9DD 3D3VB 2DM2A 1DCEA 1UCTA 1JGDB 4EUPG 4YZWA 4BSJA 1VFBA 4HS3B 5ACZA 5CEXA 2YPVA 1UWXH 3ARBB 4DEWA 3P9MA 3O9WD 4YBLC 3A5VA 5HI3C 2YLKA 4LHQB 1MJUL 1TZHB 1IT9L 2VXSH 2Y7SA 5KVDE 2H1PH 4YDVA 1SNRA 3OXSB 4ODWB 3X1GA 4J4PA 4ODVL 3UJIH 4KRLB 4MZRA 2W07A 1KT2B 3O3AB 3TBCA 4AEEA 1CVSC 1H3XA 2BVPB 1D7BA 2GC4C 3MREB 3QDMB 3VDCA 3ZBMA 1OW0C 4ERSH 3NCJH 1Q1JH 4AX3A 2KT6A 3NJXA 1J5DA 4KX8A 3BO8A 1D3CA 4DP2X 4U3HA 1QNZL 3T71A 1PZ3A 5I9QC 2F1EA 43C9B 4RCAA 4A6YB 1N8ZB 3V8OA 2VLKE 1NWPA 3MBED 4TOYH 4LSSH 1P7HL 3KVQA 1U3HB 4G1MA 5MENA 1IGFH 1P69B 2DQEH 3BSGA 3ZUNC 1PLGL 4G8GB 5J6GA 1X5FA 1NPNA 5FO7A 3S36L 3V52H 1DQQB 3RHWK 1KWGA 2IFGA 5F3FA 3NZSA 1OEZW 2J5LB 5DJYA 5E03A 3T4YB 2H0EA 5K9JH 1USZA 2BRRL 1CYXA 2CDGB 3CWGA 3DXAA 5DA4A 1KJ3H 2I7OA 1TZOA 2DN7A 4KKCD 2CKBL 2ZUTA 5IQOA 4JFPA 3F5WB 3FCSB 2VM3A 5FGCE 1NCDL 4JJOA 1GYWA 1IKOP 1Y6MR 3HAEH 2IFFH 4YHNA 1B2WH 1SYSB 2P48B 1IAKB 1UD4A 3X11B 2HX8A 2PTVA 4OV5A 1P84K 1J1OL 3QORA 3QAQA 5JW3L 3IPFA 3KPRB 4U1GC 3RURA 4DOHE 3EFDH 3FB6A 2YK1L 2VLLA 3QCUL 1O6SA 4FTVB 2DQCL 4HKJA 4GW5B 1RZFH 3C5ZB 1RZIB 2DWSA 4DKDC 4F3FB 1CTMA 4PM1A 1GVIA 4FQPA 2BVTA 1CTNA 2H32A 3UTQA 1S7SA 2W0PA 5EZOH 3TS8A 5F7EH 3IMRA 3DIDA 5F3BA 3S36X 1A3LL 1B90A 3GMOA 3V0HA 3D06A 2D03L 1NANI 3GSNH 1ZEAH 3E6FA 5E6YA 3G6DH 2X4QA 3ULUL 3B56A 4GYBA 3NT0A 3EHBC 1J8HD 3LNDA 3B9KC 4HFWB 4AIZB 1BFOB 1E8WA 1H3GA 4P3WA 3H9HB 1R5IA 3SO3C 1IVLA 1PKQB 3QG7H 5HJ3B 5L0QC 1T89C 1VFOA 5F8RC 4QMEA 5JDSA 3R8BB 1RFDL 3B6SB 3DUUA 3GXPA 4WNSA 1E3XA 1VGKB 5CKGA 3S35L 2JELL 3BPCB 4IM8A 1FLRH 5LVEA 3DXAD 1N5AA 4NO0A 5D1QB 3DX6A 2BC4B 4HIIA 4IJTA 5HHOE 3MRQA 4Z7NF 1AHKA 4JHZA 2VERN 4TV3A 2MNWA 3CBRA 1BHGA 4QAWA 5I17B 5BOJA 4NWTL 4P5MA 3HCVB 2AXGB 2JNZA 3CHPA 1YEIH 4Y2DB 3WLBA 4GQRA 2EDLA 3O0LA 2Q86B 4MA1C 1N5YL 3B43A 1MAJA 2OMWB 2F1AA 5ABDE 4NQEB 4WFHD 2E27H 1CQKA 3VW3L 4WI9A 1SY6H 4XNZC 3CZNA 2XLLA 2F54D 1QP1A 1S7TA 3NRFA 1CICD 5D1XB 3TBSB 2O6CA 1UZ8A 4ZQTA 3RNKB 3W56A 2FECI 2GFBA 4K7PX 3BZFA 3V0VA 2HRHA 4AXWA 3OR6A 3MNZA 1CIUA 1E65A 4IDLA 3GMQA 4BV1A 5DRNA 3GI9L 1OQOA 5ID1A 3RJQB 5DJ0B 1OHZA 2X4TA 5DJDA 4G7VH 1ZT4A 1NLDH 3CMGA 4JFVA 2RJMA 3QUML 5IOPB 3EOYG 5JA9A 1GYCA 5ADOL 1DO5A 4RMBA 2XX1A 4EIZC 3SO5A 2V7NB 4RMVA 4Y9BA 2CGRL 1S9YB 3LNFA 5B39G 2VRKA 1J0JA 4YDIH 1KV7A 4WW2C 5A2CA 1LD9B 2QQNL 1K5WA 4WNJA 1T20A 1S5IH 2JCCF 1E6JH 4LLVA 2PW2B 2F8XC 5EEVA 5JXEA 2ARJQ 4V1DA 5MEQB 3WY3A 1A9BA 4UIMB 2C7FA 3DTUB 2OXHA 4JZJB 4NNPH 1KYOK 2VDPB 4B9CA 1DLHB 3EOBB 1MLBA 5FM8A 4YWGH 5D4HA 3MV8D 2HZHA 5K39A 1XX9C 2E7HA 3O41A 5AB0A 3AQXA 4Z7IA 1NMCC 3GHBH 1FSKC 5ACLA 5B3SB 3WTTA 4KQ3L 5ETUA 1TVBB 5HHMB 1YHPA 2NSMA 2VYRE 3DX3A 4LT7A 5T1MB 3G5YB 1FQ9C 1U3HA 2VDNB 1MKFA 4JPIA 5FB8A 5EOCH 2XWZA 1R5IB 2RTTA 1DSFL 5KSVA 4Q6IA 2BIHA 5EO9B 3N44B 2WAQA 5D1ZC 4J2XA 3JV4A 1A7PH 2X4PA 4M1DH 4UV7H 3BYYA 4S0TD 5CD5D 2V5TA 1RUAH 3I9PA 1AAJA 3ILEA 5ESQA 2NW3B 4XOBA 3BP6A 3VH8A 2I9TA 4FNSA 2VR7A 1Q1PA 1UADC 3HKZA 4TTDC 1EGJA 2GTZB 1AFVH 4PJCA 4P06A 3P3YA 4LCVA 4URKA 2WO4A 4KKLD 3JZ7A 5EOCL 4W6XB 4H5SA 5AAMA 1H9DA 3IU4L 1PZSA 4LSTL 5L4JA 4KKBC 1I8LC 3GSNA 4UANA 4QNPE 5EIIA 4NZ8A 1KGIA 2Y2YA 1CF8H 4OGYH 5LNGA 3IJHA 1H5BC 4JG0H 2CJUH 5ESAA 3ZMRA 1CLOH 4G6KL 2CG9X 2QHLA 3FUFA 1L9RA 3D85B 5I18H 1QPKA 3IDJB 4XP6H 1LQBC 1T03H 3G04B 2R0ZH 2PR9A 1OTTD 1PNDA 4IRZA 4XPTL 5AZEL 4OVUA 4Z7QE 5K9KA 3US1A 1K5NB 4JHAH 4X8GA 3O8XD 2P28B 4QHPA 4DGIH 5D5MF 1HEZA 1E5UI 2DTSA 2YKKA 1NUFA 2ZONA 5I8OL 3Q05A 2P26A 1O6VA 4JFPB 1IGTA 2DBJA 1QBBA 3D33A 3WNKA 3QYNA 3ZGHA 1I1FB 4S1SL 4TPRL 3CPLA 3LRKA 1F4HA 2AV1A 4ZW5A 2WXIA 4FQXB 3HG2A 1G0DA 4G8GA 3TJHD 1UB5B 1XGTB 4NJ9L 4HHAB 1JZ4A 5BS0D 3KGRA 1MRDH 4MJJA 3RWJB 5JIMA 3QUXD 1QFOA 3BFWA 1TOXA 2OMYA 3O2DA 3R7RA 3PAZA 3HB3B 3B9EA 3DIVA 1A5FH 2IDTA 1RUQL 2EIZA 4B9ZA 2FJSA 1SVCP 5DZLA 3BESR 4JKWA 1MREL 1B4RA 1HN1A 1EFXB 3JV0A 4P4RA 4PJBB 5DD0H 4ZAKB 4NYLB 4NQCB 4DPAX