5I28A

Azurin t30r1, crystal form ii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Determination of nitroxide spin label conformations via PELDOR and X-ray crystallography.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
molecule tags Metal binding protein
total genus 31
structure length 127
sequence length 128
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i28A00
5TK4A 4NB7A 2YXVA 3PXLA 4YSAA 3TBBA 1L9QA 1IC0A 2PPCA 4PAZA 1DZ0A 1PZAA 1HAWA 2DYSB 1TEGA 1KBVA 2DY2A 2UXFA 3OD3A 1NZRA 4PCYA 2GHZA 1V54B 1BQKA 4E9SA 1JXGA 2UXVA 3WKPA 4G71B 1J9RA 1J5CA 2HXAA 2TSAA 3ABMB 3NJNA 4A2FA 2HZHA 4BDVB 2GC7C 1NICA 2BO0A 5B7FA 1BEXA 4UF7C 5I5MA 1XB8A 3KW8A 1AG6A 1NDTA 1BAWA 1NIDA 2B3IA 4KO6A 2I85A 3FU8A 4G72B 4GYBA 1IKOP 4BWUA 5I28A 1J9QA 1A8ZA 2I7OA 4M3HA 2RACA 2YAMA 2UXGA 2QPEB 3FYEB 1NPJA 2HX7A 2EIKB 4HCIA 1MDAA 3PAVA 1YLBB 1M57B 1ZDSA 1SNRA 4DP0X 4DPAX 1J9TA 2IDTA 3UACA 3X1GA 1B3IA 1E65A 1NPNA 2PP7A 4BXVA 1GYCA 1BQ5A 1E5YA 1R1CA 2XVBA 4N4YB 1OCOB 3CVBA 2WO3B 3FYIB 2N0MA 2X88A 3NJLA 2VM4A 4HHGA 1AANA 2PLTA 4AX3A 4DP2X 4DP8X 2H47C 2PP9A 1CYWA 3HEIB 5I6OA 2AFNA 3ZDWA 2TSBA 3OMNB 4KNUA 4ZK8A 4A2EA 4QLWA 2FQDA 1AZCA 4K9JA 1V55B 1TEFA 1GR7A 5I6MA 3GDCA 4E9TA 1JZIA 2Y1AA 1OV8A 3X2QB 3FSWA 2XX1A 3NSCA 3N55A 4YSDA 1FFTB 1AQ8A 1AAJA 1ID2A 1DYZA 3QPKA 2VMJA 2R7EA 1TKWA 5AFAA 1T5KA 2DYRB 1BXVA 1BXAA 1XB3A 4EF3A 1ADWA 2HLEB 3N2JA 2EINB 1NWOA 2B08A 2X87A 4KO7A 2CUAA 4KO5A 3HB3B 2IWKA 2YAOA 5FC9A 3UAAA 1RKRA 3NJFA 1PZBA 2BP0A 2QDVA 3S8GB 3WKQA 3GXUB 2AANA 1SJMA 3CZUB 3SQRA 3T6ZA 1PZCA 3ABLB 1PMYA 1ASQA 3ASOB 1GY2A 5LDUA 3ABGA 3ERXA 1PNDA 3AG2B 3NJIA 3CG8A 4E9WA 1RCYA 5I6KA 1NTDA 3NYKA 3BVDB 3IEAA 1SF3A 1A3ZA 2UX6A 2IWFA 2J5WA 1MG2C 1JZFA 3X1EA 3FU7A 1J9SA 2GI0A 5E9NA 3QJRB 5PAZA 1UATA 3S3DB 1PLAA 1WS7A 3QJQB 3PAUA 3FSVA 4GP4B 3GYRA 1SFDA 2AVFA 3QJSB 2VN3A 3PCYA 1OE1A 2BHFA 2VSKB 4DP9X 3H56A 1NIAA 3OMIB 3OQRA 4BWWA 3NSFA 1KDIA 3FT0A 1N70A 4DPCX 3CVDA 2PPDA 3UAEA 2W8CA 4A68A 1J5DA 2IDSA 9PCYA 1WS8A 4GP5B 1L9SA 1ZPUA 4N8UA 3S3CB 3FPYA 4YSQA 3BQVA 2UXTA 3X1BA 1WAEA 4E9RA 2J56A 3D12B 4G7RB 2YARA 2CBPA 1F56A 3IBOA 4UAHA 4YVNA 4A67A 2FQGA 4JHVA 3JT2A 1MZYA 3QJVB 1ASOA 4HALA 1AZNA 1L9PA 1BYOA 4TXVB 4E9YA 1ILUA 2Q9OA 2YAFA 5A7EA 4DPBX 1WA2X 2MRYA 2OCCB 3T71A 3UABA 2VSMB 3NSYA 3IE9A 4HAKA 5AZUA 3DTUB 6PCYA 1V10A 4BWTA 2BWDA 3S3BB 1SHXA 5EHFA 3IN2A 3NP4A 3ABKB 1KYAA 4DP6X 1JXFA 3X1FA 4FA7B 1AACA 4AKQA 2IH9A 3EH5B 2VW6A 2FNWA 4W1TA 2I7SA 2IDQA 2FQEA 3ZIYA 1A4BA 5I5IA 4M4RB 2QPDB 3T9WA 5B1KA 2A3TA 1ZIBA 2CCWA 1AS7A 3CVCA 1PAZA 3FQ2A 1W8EA 1AZUA 2WSDA 3FS9A 3H4FA 2YAPA 4UANA 4WKXA 4YSUA 2DWSA 1GW0A 1RZPA 4G70B 4DP7X 4E9VA 2XX0A 2FJSA 3AY2A 5I6NA 1PLBA 4HCGA 1ZV2A 1M9WA 3IN0A 2HX9A 2CAKA 3CDZA 3AW5A 1IBZA 3NSDA 1GS7A 3AG1B 1A4AA 2HRHA 1JZJA 2E86A 1A4CA 3UADA 2OJ1A 1NIEA 1PF3A 3EH3B 1QLEB 1SDDA 2JKWA 4HZ1A 2GSMB 3NT0A 1GY1A 3H4HA 3ZX1A 1ETJA 3SBRA 1GSKA 4KNTA 4Q89A 2VW4A 2BW5A 4FAAB 3UGEA 4A66A 2HRGA 2W88A 2GC4C 2H3XC 5D4HA 2CJ3A 4CSZA 3SBPA 3KW7A 1TU2A 5B7EA 5PCYA 1KV7A 2XU9A 3SBQA 1A65A 1BQRA 1HFUA 1AIZA 1I53A 2BP8A 4HIPA 2R7EB 1AG0A 1MZZA 2BZCA 3OMAB 1E67A 1OCRB 2WO2B 3DKHA 2FWLB 3NJKA 5F7BA 5B7MA 3WIAA 3WNIA 1OCZB 2PP8A 4AKPA 1ZIAA 2ZOOA 1IBYA 2P80A 2PPFA 1L9RA 3NJGA 3FU9A 3V9EA 2YQBA 3NJJA 1M56B 2BW4A 2XV2A 2HX8A 3DIVA 4AZUA 1WA0X 2BP0B 2YAEA 1E30A 4AKOA 3X1NA 2AZAA 3MX0B 2Y69B 4NAJA 2DV6A 3S8FB 2FQFA 4GY4A 2ZXWB 1JVLA 1OE2A 2JXMA 5TK2A 3AG4B 1N68A 1VLXA 2XYBA 1FA4A 2PPAA 4YSPA 5I5JA 3FSAA 1QHQA 3TASA 4GXFA 3MBWB 1OCCB 2QT6A 1JZGA 3FU7B 1PY0A 1BYPA 2FT7A 2J55A 1L9OA 2IAAC 2UX7A 4YSTA 2FTAA 4P5RA 1CYXA 1AS8A 1MG3C 2PCFA 1L9TA 3G5WA 3L45A 2Q5BA 4G7SB 7PCYA 4WTQA 1AS6A 4BDVA 4YSSA 2FT8A 3OM3B 3FQ1A 6PAZA 1XMEB 5B1JC 2NRDA 4F2EA 4KO9A 4YSEA 1W6LA 1CC3A 4CSPA 2H5UA 4YL4A 1JXDA 1NWPA 2XWZA 3AG3B 5F7AA 5I6LA 1CURA 1SFHA 2XV0A 1RZQA 1JZHA 1X9UA 2IH8A 2XXFA 4QKTA 2JFCA 2PPEA 1AOZA 2XUWA 5I26A 2ZWNA 2XXGA 2MTAA 4HHWA 1URIA 3TU6A 1AZBA 2BZ7A 2QDWA 2XV3A 4P5SA 3T6XA 1OOWA 4KOBA 1EZLA 4GP8B 2OV0A 1GS8A 4BK5C 1ET5A 3FPXA 4G7QB 2IDUA 2FT6A 2P80D 4KNSA 2ZONA 1AZRA 3V9CA 3QJTB 2EIJB 4YSRA 1QNIA 1CUOA 2DWTA 1ET8A 5B1JA 1E5ZA 1KCBA 4YVUA 3WG7B 1KCWA 1JVOA 4A2DA 2LLNA 1AR1B 1JZEA 5IY5B 5B3SB 3EF4A 5B1AB 2AZUA 7PAZA 3U25A 3RYMA 4RH4A 4X4KA 4AI7A 3CDZB 3T6WA 5D4JA 1JERA 4YSCA 3WI9A 1ILSA 1BXUA 2EIMB 3QQXA 2J57A 2EILB 4A2HA 3EH4B 1NINA 4DP5X 4E9QA 1SDDB 3AZUA 2YXWA 4NERA 3FQYA 4YSOA 4DP1X 4E9XA 3PPSA 1PCSA 1SF5A 3NJMA 3PAZA 1X9RA 4HCFA 1SHWA 5B1BB 1PLCA 2BP8B 4F2FA 2VW7A 3PLYA 1JOIA 4Q8BA 1PNCA 2CALA 2YAHA 4JKNA 3JTBA 4BXSV 1WA1X 5AKRA 8PAZA 3T6VA 3ZBMA 2GIMA 4W9ZA 1GS6X 1FWXA 3EHBB 5D4IA 3TBCA 3NP3A 3TA4D 2GB2A 4DP4X 1ET7A 3QJUB 1OE3A 2PCYA 3FSZA 5ANHA 2GBAA 2IDFA 3WNJA 2BWIA 1ASPA 2VM3A 2XLLA 1NIBA 3C75A 1XB6A 2IWEA 1OF0A 1HAUA 1ZDQA 1IUZA 4A2GA 1KDJA 5I6PA 3ASNB 4F7KA 4JHUA 1NIFA 1KBWA 1EHKB 2YAQA 4MFHA 3NJHA 4L0PB 4ENZA 1W6WA 4KOCA 1KGYE
chains in the Genus database with same CATH superfamily
3NPSC 3PWPD 1R19A 5ISZA 2F7IA 1PPIA 1QA9B 5IFAH 1J0JA 2VITB 4NKMA 3J27A 3U2IA 1SY6L 4L4TE 3WNLA 3BP7B 4RQQB 3SY6A 1S7TA 4JN1L 4JFXB 3QQDB 1UH3A 3QPXL 4JFZL 4U0RB 1RZKL 2XBZA 4ZFGH 2B77A 2WLHA 5FO7A 3EJPA 1EA9C 2UXVA 3C8KA 3MLXL 1TCRB 3N9GH 2AQPA 3QUZC 1BWMA 3OKOB 4NUGH 3NJNA 3RPIA 1K5WA 1YMHB 2V7HA 3F85A 1BFTA 3EYFB 4XB7A 5BUPA 2JMRA 1RULL 3B6SA 4R3SB 2YO3A 3MO1B 2AQTA 4JPKL 4Z0XB 2VDRL 3T04D 4NEHB 1KEGL 3FRUB 4M7ZB 1S9KC 4NPJA 5HHNB 4QTHA 4J23A 1NCHA 3U9WA 5I66A 3FBQA 3IU3B 1T0OA 1OLZA 3DWTA 4POUB 4J8QA 4PG9B 3L17A 1YNLL 2Z4TA 3LKNA 4GB9A 4KXCA 2C26A 3HG5A 3MJ7B 1J9TA 4MRCA 1BBDL 1B3IA 3P4LA 4GAYA 1E65A 2A38A 2ZXEB 4YE4H 5G4MA 3SCMA 1I1AC 5LDSA 1QUNA 4WI5A 3HE7C 1GYCA 1TTRA 1ADQA 3WDIA 4HC1A 1V7NL 5ID1B 3D7PA 5I0DA 1JN6B 3BZFB 1OCOB 3CVBA 4IRZA 2KDGA 4U3SA 3GMRA 4HGKC 5C8JB 3O6LH 4YJZL 1CBVL 4O02B 1A7RL 2BLFA 3RVXC 5E94A 3LY6A 3S3JA 4PJFB 2A4ZA 2PP9A 1UENA 4JHWH 1F4XH 2HRLA 4OZFH 4PTUB 3QFJD 1A3LH 1AHKA 4HUMB 2VDMH 4MNHA 1REIA 3BI9X 3SGDH 1S9VB 1CB4A 2EXYC 4CC4C 5MEPB 2CNZA 4A7TA 3DGCR 5DVPA 1M2OA 2QFPA 4LSTH 4NXKA 5FM5M 3QR0A 4OCLC 3QDMA 3LHAA 3PP4H 5EV7A 1Y18B 3DBSA 3NSCA 5F9DC 4U3HA 3GGWB 4DGIL 3LKPA 2WVSA 5CD3A 4AYEC 1LEKB 2W9LA 3W9EB 4NUQA 1JYWA 2DLHA 1G6RA 4LOVA 1KTBA 1FIGL 2EINB 3FU3A 3SODB 2X4RB 4HFUL 3QG7H 2HKAA 3JXAA 5GGTL 3IRZA 4KO5A 3L5WA 3LKSB 2CGYA 2DIAA 3ROLA 4BKSC 2OZ4L 3DJTA 4HP5A 5IW3A 4FQXB 3HFML 3FB8A 1KTDB 3HBPA 3T6ZA 4M1CC 3UBXI 3HW7A 3FO1B 4Q2ZB 2BVTA 4WSGA 2FX7L 4X4XB 4NN6B 2JJUA 1ASQA 4PLOB 1G0YR 1VEOA 4MCYA 5A2JH 2R59A 2WJ5A 4KKLD 4RFNB 4ZO6A 2E27H 1ZLSH 2AQRA 2H45A 1UWGH 3FQRB 5KSAD 4ZW6A 4TRPL 2MCAA 5L4MA 4LNVA 4KJPC 5BRQA 5TGBB 3QH3B 1C5BL 4UM8B 3EJYC 2AP2A 3DTXB 2EIBA 2AMUA 2D7TL 4HIIB 5T1KA 4JVWA 3U9UA 2J6WA 3BZEB 2OTPA 3PWUB 1XT5A 2X41A 3QWOB 2BHFA 3WNNA 1PZUB 2W59A 4P9MH 4NZRL 4E0RA 2ARJA 2BHZA 3QQ4A 5DR5H 3G08B 1A14L 1S7XB 3I6KA 1SOQA 2KHAA 3MV8E 3SPHA 5DMYA 3CVDA 4K5MA 5TFSH 3KM2A 2W8CA 4A68A 3FO2A 3MUZ1 3AT8A 5T3ZE 3NFPA 4PU2A 5AB1A 2GEQA 5AW6B 2WLMA 1IC7L 4DK6A 3ML8A 1H5BA 5CLTA 3EAKA 4PMFA 1RP8A 2N3JA 3FUFA 3CXFA 4KQ0A 3CFEA 1AXIB 1F97A 3QJVB 3V4PA 4PI0A 4OLVL 3U6RA 3AY4C 3E3QC 2KZBA 4UZSA 4XVSL 1BOYA 4TQ8A 4TXVB 1XIWA 4YDVA 4XNDA 4NC1E 1FVDA 2OQJA 2MOGA 5D1ZI 5E8DL 4BRJA 3BT0A 3FULA 5IVOA 6PCYA 1UG9A 1NGPH 2JB6A 2PWDA 2PTUA 5FLVA 3IRCA 2JJTA 3BP6A 3TCLB 2ZOUA 1UWFA 1ZPLA 5JXED 1IEHA 4A7UA 3EH5B 2EO1A 3L3DA 2DWDA 1OB1A 3O11B 1J0ZA 3L6FB 1A4BA 2EC9T 1CIDA 4MD0A 2ISDA 2WBWB 4HK0B 2KLRA 2Y36H 1Z32X 3PWLB 1QFUL 4X9HA 4RAVB 5E2JA 5CGYC 4QRSA 4RWYH 4BZ1A 1TT6A 3K0WA 3QXWA 1XZ0A 2ZCHH 2XBDA 2ICWA 4UU9B 5HSFA 2QADB 3EF7A 1S7SB 4Q0XH 3GSWB 4KKAD 1T4KB 4TVPL 1RJYB 2CKBA 4AE1A 2YXFA 1H3PH 3NPZB 1CG9A 4QGTA 4W9HC 1IGCL 4CMHC 4FN0A 2Z8WC 2G9HB 1NDMB 4XVUC 3RI5F 3RL2A 4FTVE 2EDXA 5JORB 2EABA 3QQ3A 1R33A 3MROA 5ADPL 2CJ3A 4MA8H 5CHNA 3KW7A 3VSQA 3GMMB 2FK9A 1K8IB 3VFGH 4NAMA 3LPWA 3LZOA 5LVEA 2FSEB 5T1LA 1AIZA 3MJ8B 3M1BA 5EZLB 5I8CB 1XO8A 1CZ8L 5I19L 3L4YA 3DOIA 2DKSA 4D9QD 4GW4B 4U7MA 2V9TA 3NJKA 3LZPA 4ZSOE 4JQVC 2D31B 5JIKA 3CUPB 3QDGE 1X4YA 3QUMA 2CO7A 4C8XA 5HGBA 2VIRA 4G1MB 4ZTOL 1J7VR 2WV3A 3VFOB 2R1YB 3W37A 1DSWA 1YSOA 3LZRA 2A4CA 3OHMB 1UZ8A 2XCMC 1R3KB 1MY5A 2VDOH 3E38A 1FORH 2NY2D 4KROB 1IZKA 2EP6A 3GSVA 2X1WL 3V6ZB 1UGNA 4HHAA 4LP4A 3HTLX 4R4BA 2P49B 3LX9A 1QZNA 1T1XB 3W39B 1O6SB 2PPAA 4R97B 4YSPA 4HOMA 3O4OC 3GUFA 2OL3A 2W38A 2DJUA 3KYNA 3LRGA 3APDA 1QHQA 4PP2A 5AOMA 4AEFA 2QQQA 3MBWB 2BIOA 4LSQL 3MSPA 1GAFH 3CFJA 2FO8A 3C5SA 1ZT1A 2FT7A 2WYTA 3IMSA 1ACCA 4BK8A 3BVNB 2DQCL 4GUPB 4Y4KB 1E9QB 1L0QA 2DQFB 3G5YA 1EDHA 4V2BA 2A1WL 3MUGB 2XJLA 1L3WA 2EH7L 2GITB 2IGFH 2OTUA 5K1VA 4FCHA 4J3VA 3C60B 2EE2A 4G7SB 5HGDA 3UPAA 3WFZA 3REVB 1FZMB 5ALCH 3ARQA 2B2XL 1KJMB 3UC0H 5KSBE 3ELAT 4L4JA 2N7AA 3OM3B 5CU9A 2YC1B 1CE6B 4NSKA 5H94B 5K39A 3T8VA 5CFAA 4F2EA 2WO4A 4S1SH 4JG0H 2VQ4A 5HYSB 1A6AB 1N0XH 3JUYA 2R2HA 1IM3D 4K71C 1CC3A 1EEYA 1NCDL 2DH3A 1KB5L 1FSKC 5IKCB 1BIIA 4F58L 1FI8C 1FLTX 3PNWA 3BESR 4MASA 4OJYA 1N0LA 1QSFB 2V5RA 3GMNB 2X3AA 4NENB 3VTTA 2NY6C 2G4GA 3B8SA 1JZHA 2OPCA 4Z7WF 4YHLH 1BVZA 4IBSA 4U1KA 4W4NA 3ULUF 3CQQA 3PUCA 1HQ4B 3MGTA 3T8MA 1YEHL 5D4QA 5C08B 3R7RA 5C0BA 3VGFA 3IFNL 4F5CA 2EXTA 1CDUA 3PPEA 4F57H 3EO0B 3M45A 2VZVA 1WRFA 4D8PB 3FPXA 4Q7DA 1KIQA 3HG3A 3K8LA 4XH2A 4YHIB 4ZFFA 5C0JB 3QWRD 3APMA 4NYLA 1W16A 4FCAA 2D7MA 1KSRA 4QHLA 4KVCL 2BDNH 3WLWC 1MFAL 4WUKL 1A0QL 3CH8A 3CZNA 5C0FB 3RPKA 4TNFA 2XKUA 3D1MC 4FABL 4U1HA 3WJLA 1F45A 2LLNA 1COBA 3ZZQA 2O6DA 4FQ2L 2B1AH 1CGYA 1PS3A 1I7TA 2NR6D 3EF4A 1WWBX 3C6SB 5FYKE 2EDKA 3T2NH 3TM6A 4I4WB 4IU2B 1KNOB 2Y2YA 2YGOA 4HDIB 2VT0A 1RUQH 2ZCKH 1KB5B 2H1PL 2XIBA 4QI3A 1PZ5A 4MX7B 4WUUA 1KLGA 3O8XB 2GFBB 4YDIH 4F7TA 1G7HB 3NSJA 4A2HA 2MSPA 3FDWA 1MFEL 1AC0A 1N3NB 4OU3A 3OQ3B 3QYNA 2PYED 4HUXB 3SPCA 5I1LB 4N8CL 1QZ1A 2BVOA 3I75A 1IAIL 3CFUA 1TVHA 1HL4A 5JIQA 2OMNA 1RZFL 2F53B 5BO1L 3W0WD 1T5WA 5FM4A 1SOXA 2OTWB 3DPBA 1FFPB 2CQVA 1HEHC 4X5RA 2BCKB 3ATBA 3OTTA 2D03H 2MQ3A 4J3OD 3ILQD 3NCBB 1LMIA 3N0PB 1IEBB 2CWRA 1IT9L 4L4TA 2Q1EA 2GVYA 3CMGA 3H9SE 3MUY1 3RWHB 3SDCC 8PAZA 1PG7X 5JOFA 1H8OA 1PZDA 4CU8A 4GG8B 1FWXA 3ZTJH 5LGHL 4KZDH 5IGXL 4HULB 3TF7C 2Y25A 1TJIL 3MV11 2PCYA 4PRHD 2PWFA 1ACYL 1ERNA 1FNEA 2PXYA 3ZMRA 1ZTMA 1IJNA 1M7DA 1PEZA 5D7SL 5EEZA 1QBMH 2VM3A 3ISWA 3TA3C 5E51A 3WFDH 1DVSA 5ACZB 1B2YA 3SDAB 3PGDB 1KB3A 1YNTF 4GXUM 4OCSH 3STZA 3HJ0A 4Z1PA 1MFNA 4PWEA 4I9WD 3GTVA 1QHPA 3RA7L 5TQ2H 1RIUH 1KCLA 1OAXL 3KGSA 4IGBD 4D7BA 4TLUA 4PJGB 2Z31C 4XRCB 3C5ZA 1MFDH 4HS3B 4ZOBA 3VH8G 3BW9A 5CP3H 1LO4H 3TYFB 5T3XL 2DY2A 3HN3A 3LV3B 2Z92B 1YNKH 3KHOA 3CJJA 5EEYA 4HJ0C 2H32H 2LTQB 4PRBB 2B5IB 4Y9GA 5KJ7E 3NFNB 1SJXA 5TQ0H 1KWKA 2VISB 2ZG3A 4BDVB 1WJ3A 4CMMA 3QJFB 4KNQA 1IFHL 3BH8A 3DRTA 3RWDA 1S6NA 3CSYA 2G5RA 2Q0ZX 5D7LD 3OG4B 3U83A 1PX8A 2W80C 5I23A 4DVBA 5DF0A 4GYBA 4P3WA 4LL1A 5FS5A 4LRIA 2ZUYA 5EF1A 3RWEA 2EVHA 2FUQA 4GRWF 2F7PA 4PV8B 3VWJB 1GC1C 2WKOA 3X12A 2I69A 3HAEH 4IBLT 4XCEA 1NFAA 1LP9B 1XV8A 2ESVD 2J8OA 4YPGA 5JIMA 5KS9E 3I02A 4XP1H 4MZRA 3QULA 4M4RA 5D5MA 4NM8H 4Z7UF 3GSQA 4XWOC 1DVUA 2NUPA 5T1DL 3L5XH 1C5DA 3OGCB 4P2OC 2C8NA 2A73B 3KJ4C 3Q5OA 3QW9A 4Q9RH 2J5LB 5B8CB 2GT9A 2BK8A 3A6BH 6FABL 3SE4A 1TCMA 4P99A 2HFEB 3BUYA 1E28B 4P46C 4OKVA 1AY1L 1EO5A 1N6VA 4HUUB 4BXVA 1BQ5A 3F7KA 4K7FA 2JV6A 3QEHA 3NJLA 4TOYL 5DD1L 3G5ZB 1AVAA 1ZLUH 1QFOA 2OLDA 3FQXA 3GRWL 1MOEA 5IFJB 1RJLB 3SOBH 4IKLA 5JTWA 1T0NA 4DEWA 1ML0A 2VZOA 4WO4B 4EZLA 5I6OA 5JW4Q 3ETSA 3ZDWA 1WCBA 4RZCA 2OMTA 3ARBA 1V05A 3H3KA 4R6UA 3W2DL 5IJDC 4LARH 4FFTA 1F4WH 1KT2B 1JYNA 4W9IC 3GIZH 4H7VA 1HH9A 1MKFA 2X4SB 5DLLA 3E1ZA 5HYJB 1U8JA 1MFUA 3SHSA 1SVCP 1YUHB 3DA0A 5JW5A 2P24B 4XT1C 1NMBL 4PTTB 5HHME 1J88A 5AZEH 3ARPA 2DQEH 1E5UI 2VUOA 3NIFE 3QPKA 4GBXA 3MRQB 3OPZL 5GGSA 1M4KA 4KQ4H 1ETZA 2W60B 4J3UA 2G60L 4QRRB 5F89B 5FXCH 2X4UA 4UT9L 2F15A 4FLQA 1I8LC 3OAZK 2QKIC 1QBBA 2J6EL 4J3OH 1Y6KR 3P40A 3L54A 4FNLH 3VXPA 4HV8B 4XCNA 4DO5A 4IRSD 3R19A 1FBIL 1T4WA 2P8LA 4Y1AB 4Y4FC 1G9MC 3OWEA 2IWKA 4K7PH 1MWAA 4NUPA 3JV6A 3UAAA 1JFQL 3NJFA 4TL4A 3MV8A 5ILTH 2R0KH 4QCIA 2X6AA 4PGBA 3ARTA 4V11A 5I8OH 1WC7A 1NOLA 2ICEC 3P11H 3MX0A 2DTMH 2JI2A 1T66C 3UDWA 5T5FH 1TQCC 3MV01 1FLRL 4YLBA 5DMIL 4OKDA 4YDZA 1A2YB 5C0AD 4MXWH 4TTDD 2J8UE 3CFNA 3SB3A 1E6OL 3VXSE 3KG5A 2GSGB 3ERXA 4BGDA 5I6KA 1E27A 4UQDA 4ONGH 3DARA 1KENH 2H9GA 3MRCB 1HEZA 5AOLA 3GRBA 4HG4J 3U48A 1DJWA 1IGYB 2WSPA 5CS7A 3UG5A 5D7HA 4RSYA 4GAGH 3LQAC 1WS7A 4QDGA 1EMTL 3FSVA 4RGOL 3RURA 3T0EE 2K6WA 5H2BB 1NOFA 1SFDA 2C9QA 1CICB 2VKXA 3P30L 3SZKC 3V5HB 1FQ9C 1XSIA 5DXWA 2YIHA 4YNYA 4RMWA 2YSSA 1AZZC 5JPNB 3O0RL 1WCQA 3UZVA 1BVLB 1PFCA 1NCUA 3NCEB 3LH2H 5I17B 2XWCA 2Y3AA 2N01B 3TH2T 2NW2B 3L3GA 4XMLL 4IIQC 4TNWK 1Q0YH 3UAEA 4UV7L 1Z5LB 5G5DA 1Z0NA 5EU7C 4N8UA 1L9SA 1YEFL 5CSZB 4TUOA 1BVNT 2BIQA 4DTGH 1QLEH 3RNQB 1P6AB 3HMXH 1QACA 3BHBA 3L2MA 1JPTL 2BRQA 4CBZA 3B9AA 1ASOA 4ADJA 4G80B 4U6YA 5DVOA 3TZVC 2I24N 3V7MA 2M8XA 4D9RE 1JD7A 1FYTB 2DM7A 2YAFA 1OAQL 4ATTA 3QE5A 3QPQC 2VSMB 3D85B 4KZEL 2IAMA 4LP5A 1OAZL 3RX7A 1S78D 1HTYA 3S3BB 5F3BA 1XXFC 2BSDA 5F71A 1OGPA 3LVEA 4FTVA 5AW3B 3O9WB 1FUNA 5F7WC 4HH8A 4MB3A 4XN5A 1GH7A 4HVBA 4H0GA 4ZUUB 4QRAA 1BDYA 3UGUA 3U6XS 4KPHH 4WDIB 2PW2A 3NJXA 4P07A 3T9WA 4JFDA 3WS6A 1AMYA 4TLTA 1P5VA 3FS9A 4DO6A 4GQZA 1BWWA 4N0FB 4DP7X 1UC6A 3EO1B 3F84A 5J11B 2NNRA 4ZSOA 4ETYA 3MRFA 4LASL 4GUOA 1IC5H 1U8IB 2UUDH 2BSSB 4GRLA 1IGFH 3BFOA 3QDGA 3ARUA 4RIRB 4ZMXA 2PR9A 4GKZA 3C2AH 4NZTL 1N59B 5CILH 5DQDL 5IFHL 1UB6B 3G6DL 3WJMB 5LBSL 2UWEB 3POCA 1D5ZB 5LNEA 4MQTB 2WZAA 1XD0A 5LO7A 1HWGB 3ZE2F 1MJ7L 4I9XA 4M7KL 1AH1A 2AJYL 3SBPA 3TNMA 1DQJB 5E99H 4JFEE 1E5CA 3Q2VA 4FQJL 1BFOA 1M05B 3PXHA 4HX1A 4H88L 4N86A 3BD3A 3TYGL 4FFYA 4YIQB 4X8XA 1ANUA 3L1EA 4MA7H 1I9IL 4G9DB 3U4BH 4XBEL 1S7UB 1T83C 2FWLB 3RRQA 4YFEA 2LR4A 4NJ9H 1S9YA 25C8L 4S10A 4ZMZA 1IVTA 3NIDF 4D0CB 2COVD 1G5GA 3QO1A 4IS6B 3N6YA 2WZPA 3NJGA 4RRPA 1ZVSA 2Q87A 2E47A 3P02A 5D72H 5L0QB 3HUJE 1A7PH 4DHLA 4DKFL 3U7YH 4L4VD 4EUPA 2Z4QA 3IDNA 2X10A 3ZDXB 2EDYA 4EBQH 2AZAA 2Y69B 3IGUA 4HG4K 4NHCL 3BPLC 4TNVK 2UUDK 3OLIA 3S37H 3DX9B 5F7YC 2ORBH 2Z8SA 5EOTB 4HEPG 2N1TE 4MJ4A 4PRIB 3TVMB 1A6ZB 3VGGA 4P4KD 1PY0A 4JFPB 1J1XH 4JFHE 4LO9A 5HPMB 2IPTL 4JO8A 2ZKHH 2Y06L 3QT2A 2NXYB 3GBMH 2SODB 2PCFA 4A7SA 4NRYA 3UPRA 2CKNA 3QIUB 4ZYKA 2LVEA 4PJ5E 1HS6A 4FXKB 3H9ZA 1OAKH 3L45A 1WFTA 5E1AA 1P7QD 3ARGC 1AO7B 1XGTB 5E03A 4ZDHA 2A6DB 2YKKA 4HT1H 5TDPB 5K69A 1XMEB 5E5RB 4WWKA 4C4UA 1XD1A 2ARWA 4R0LC 1E8XA 4CSPA 2AEQL 1OM9A 4W9JC 2QZ5A 1YQVL 5H37H 2VXTL 3JSSA 1RI8A 3MLZL 4FP8H 4YL4A 5JUEL 5C2UB 3QA3A 1CFTA 3P0VL 4H20H 3BAXA 3QCUH 4L3EA 3TBSB 5I5RA 4WENB 1FHGA 3ABZA 4O5LL 1KJVB 3BUBA 3VYNA 5T1LD 1KPVA 2XUWA 2Z35A 1BW8A 2ZWNA 4GSUA 2XXGA 1YYMH 1URIA 3IT8D 5D7KE 3V4VB 3TU6A 4ZMVA 1GJWA 3QRFM 5ES4B 3Q48A 3BIBX 2G2NA 4CILA 3D39D 4RGNE 5C0NC 4X80L 3VM7A 2WVVA 3MNZA 4F8TA 1DVFA 1NGQL 2VLKA 4NPKA 3N0AA 5EOQH 5AAMA 5IROC 3PQYE 3PWJB 5ELIA 2ZXDA 4A38A 1NBQA 4HJJL 4C54A 3O0LA 2G30A 2LABA 5HVHC 3Q2LA 5AB2A 1EX0A 3FTSA 1RLBA 3OZLA 3SE9L 3Q2WA 5F96H 4QXUH 4CGUB 1CLOL 4HCRL 5I73C 3EYOB 4ES9A 1KC5H 3D09A 3TNNB 3PIQB 3H9SA 4XCFL 1I1RA 2OCFD 4TQEL 5IY5B 1FL3A 1ZT7B 5JHAA 7PAZA 2P5PA 5DHVH 1T3FB 3MBEA 5ITBL 3ARED 1B0RB 4X4KA 3LRSA 3WIFA 2ZX7A 4B60A 4DO4A 4IMLA 4J3XA 2YRZA 3HHMA 4I13B 4PBVC 1O9VA 2BWQA 5FK9A 1ONQA 4OD2B 4WI9A 3LPFA 3OV6A 2MCPL 4LCIH 4FJYA 2YMXL 4NI6A 4XC1H 4KKZA 3S36X 4E42A 2YD8A 3BVVA 4ZXBA 1CFQA 4XBPB 3MNWA 3L95B 2XZCL 3ZGHA 4DJMA 4YSOA 4DP1X 1FCGA 3KCPA 5E1GA 1LK3L 1PCSA 5A1AA 1I1AB 1MN4A 4OTXL 1HYSD 2XVKA 3DX6B 2VGLM 3HHSB 4AGMA 2ZOKA 2DL2A 3WE1A 5AG8A 3M6DA 3S5YA 4KFZC 4AJ0A 4Y2OB 5GRVL 2HLFD 5EZOH 4WNSA 3IRPX 5DYFA 3HG1B 4OGAC 5CLZA 3V7AE 4B3EA 4KITB 5IB3B 1F6FB 1JPEA 4EI5B 2OM5A 4UB0H 1G5AA 3ESVF 4ANWA 3H54A 3KEDA 2MQGA 3Q8AA 1B6UA 3HI6L 1ZV9A 3UBHA 4APQC 3U4EB 2HSIA 4NN5B 3L7FB 2X70A 2AEPL 2WQRA 1JWMB 1OQOA 2JQMA 2WTOA 3QXAB 4UBDD 2XOTA 4OI9A 4G8FB 5DVMA 3TEWA 3P4OB 2YPKA 4DW2L 4PJIE 5KZCD 4S1DD 3ASNB 3F5WA 4ICXA 3P9WB 1BZ9A 3X3FH 1UQSB 1IC1A 2XTSA 5GHWH 1QWHA 4PLKC 4PWGA 2VDKL 4LSVL 4JR9H 1PG7W 4NO5A 4YSAA 5KS9A 1SLXA 1HAWA 4LL4A 5TE7H 1ZHNA 1RZ7H 2FX8H 3FT1A 3C6LB 4XPAH 3W81A 3KGTA 2OSLA 3RDJA 1QW8A 2UXFA 1NZRA 1F3JB 2GHZA 4E9SA 2AXJA 1MCSA 3SDXB 3HNTL 4JANA 2R23B 2X4QA 4MJIE 1CXFA 3IJYB 5EOCH 4FFZL 4OF7A 3WJJC 2IPKB 4A2FA 1HDMA 1YEKH 2HZHA 3CVHH 3ELQA 4LMQE 1AKJB 2ZOTA 4XNQB 4XB3A 1MQ8A 3HZVB 3TIEB 4ACPA 2XN1A 3ARDC 3N50A 4RDBA 3I6GA 3MMEB 1NSNL 3UJTL 4XP6H 5KYYA 1N5YL 3G5XA 3FU8A 1I4FB 1WO2A 4MJJA 3O6ML 3EG9A 2NW3B 1TTCA 3NUKA 4GW5A 5IVXE 3SO5A 2Q6WB 3K2IA 4Y4HC 1MDAA 2WXIA 4K2UH 4FJ6A 2FB4H 3FB6B 1BM3L 3IDGB 1X7QA 4MVBD 1RURH 5CP3A 3OR7B 2MCG1 2EADA 4PGDB 5JA9A 2VDKB 2YBRA 4I0PC 1ZGLB 1U8NA 3U0WL 5E8NA 3FAWA 3U2JA 4PVNA 2E7HA 3QUHA 4K8RH 5IM7B 2WQVA 3TN0B 3FFCE 2ITDA 3NACH 5D70H 1H15A 2M26A 4F9PC 1U93B 2YSTA 3RIAF 1KIUA 1J8HD 4J2XA 4URTB 2XQBL 3CH1A 2PLTA 2GK0B 3QDJB 3NCYP 3EDDA 3NFSH 5DMJB 1HU8A 1V3MA 3V10A 2FIKA 5DMKA 3UYPB 4HIQA 5GGVY 4MZIA 3EGXA 2CO6A 4P5KA 4FG6D 3ZQWA 3OJDA 1C5CL 4ZK8A 4NWUH 4B9JA 1I7UB 3N5AA 5JR1L 2AV7A 4UDUA 2A6JA 4AITA 4KFMA 4HZLA 2V2WB 5I1JL 2HT4D 5D1QB 4ZD3L 3GDCA 2JVUA 1JZIA 5BMFL 1BLNB 2J8UA 2PWEA 3NABL 1QD0A 3GO1H 3HAEA 2F58L 1MHCB 3KBPA 3ZE1F 3N55A 4ALAH 1XCXA 3NCYS 4Y2DA 5F88A 1JJUA 2J4WL 1X4ZA 2AJSH 2P28B 2BFGA 1J10A 1YEWA 3JTTA 2P47B 1T5KA 4JZNA 3CGTA 4KKQA 4ZFZB 2AGJH 3Q9QA 5DQJA 4AV5A 4BEIA 3N2JA 2EDTA 2ICWI 3KPSE 1G7JA 3FKUS 1IAOA 1AGEA 2PF6A 4UTAH 3OKMB 1TQTA 5E08L 4OZHB 1QYGL 1XH1A 3HB3B 3QI9A 4ADIA 1NAML 1UM6L 3IMTA 4OZGE 3M17A 3MQIA 3OKNA 1I3UA 4QRUB 4UQ2B 1L9MA 3OBAA 4K15A 4PJHB 4Y5YA 1R6VA 5DI8B 1CFVH 1T1YA 3US1A 4AEHL 4EKXA 3QZWG 1CS6A 4G9FB 2IH3A 4KJYB 3MRBA 1ORSA 3ZSTA 4JHAL 5DJ8B 3D6GA 2GY7B 3IU4H 1ND0A 1A9VA 1JPST 3TO4D 2YWYA 4KQ3L 1PNDA 3QXDB 2EEXA 2XG5B 3NCXA 1ZANH 2DWEA 4J3SA 4H5SA 5E9NA 2MPAL 4ABVA 5IQLA 1UATA 5IMOA 4EIUA 3LNGA 2CO3A 1HNGA 3QIWA 5BXFB 4UOW1 4IBTA 2BNRE 1UXSA 2ZWSA 3CHQA 2HVJA 4LCWB 4EDWH 2FUTA 3IJSB 3VTMA 4G6AD 3WIIL 3FSOA 4A1RA 2PYFA 4LESA 4AIEA 2MNUA 5A2IH 2Y07H 3HC3H 2BX5A 5HI5C 3FT0A 4YGVA 1CD9B 5JLZB 1E5BA 1J5DA 1IGTB 1JK9B 5ABAA 5IZ7A 5T33H 2EDWA 1VFBA 4ISVB 1OF2A 5HI3D 1WS8A 1SYVA 1DN0B 4ZPTB 2E6JA 3AQYA 3BQVA 5KANI 5L2JB 1QATA 1KJ3L 4GSQA 4IHBA 1LEGB 4X6CB 5T5FA 1T2QH 3PV7A 4LIQL 4N2CA 4OM1L 4L8CA 2EVFA 3BJLA 4LLMB 1U58B 1JF6A 4NQSB 3KWWA 5AZ2L 3L7EB 4M7JH 2WSKA 1NCIA 1OANA 2K45A 2R0LL 1N2RA 1N6QH 4PIRF 1WIUA 5DK2A 2E46A 4H8QA 4ZUSB 3QCVL 1V10A 3KPLA 1CDCA 3QRGL 2Y5TA 2BS8A 3BO8A 5HHXL 4Y16A 2FATL 3RBSA 4JN2B 1PX3A 1IKFH 3ZU8A 3X1FA 4DN3L 2WKOF 1MCPH 5T5NF 4JPSA 4DQOH 5CBAB 1LE5A 2CDGA 2IDQA 4UTBL 3GSOA 3MJ9H 1C12A 2FO4A 4PCSA 5D5MF 2Y7OA 5C1MB 3GS7A 1R3IH 4JFEA 4WI2A 1I75A 3IXTA 1QFHA 1OT1A 4ZI8A 4C56E 2EUWA 2WAQA 3K2MC 1WYJA 4U1MB 5CAYB 3NEXA 3GLDA 3RWGA 3BZ4A 1MHEA 2BSTA 3KJ6L 3TWCH 1NEZA 3UO1H 2XX0A 1H3TA 4K71B 2GCYB 4X7SL 3OX8B 5F9OH 1FSKB 4R8WH 4X2UA 5EFIA 3D2UA 5MP6L 2IADB 5IQ9B 1D6VH 3HE6B 3KPOA 5D7JA 5GS1A 2JKRM 3HUJA 1DL7L 3TEZA 3ZN6A 2F19L 3FU5A 2GSMB 2Y5EA 1X5GA 1A3RL 8CGTA 1NJ9B 2CR0A 2DIJA 1LO2H 2E9BA 2FJGB 2H4EA 5I82A 3UGEA 1OXYA 4F9LA 5DJZA 2VDQB 4CSZA 1QX1A 2WTRA 3QFGA 4XMXA 2YPVL 4A7GA 5B7EA 1JGEB 1I8KB 5F9JA 3HMWH 4ZUWB 3T8XA 2DYPD 5MENB 2R7EB 3TIDA 4K07A 4UV4H 3BSZH 1LL1A 4AEIL 4NM4L 4NBYB 1VPOL 4ANXA 1H6TA 3WNIA 5E2UH 3ECBA 3ULVC 2QHRH 4HBCH 4MMXA 1F58H 1FL5A 2GJZA 4FKHA 2LFEA 3RZCC 2RR3A 4NPYB 3S97C 3CDYA 2WUBL 1Q9WB 5BS0D 2J1ZA 4OH2A 2J71A 1CVRA 5INCB 5IUSA 1BCIA 4JJHA 5DUBA 1ZA3A 2YUWA 3N1GC 4XPHL 3D05A 3KHQA 1O7DE 2N7SA 3V2AR 4JO3H 1A4KB 3AJ7A 2ZXAA 1ZS8B 2JIXA 1R0AL 5C0CA 1MCRA 3IS0X 1UD5A 3GWJA 5EWIH 1OZUA 4CVXB 4NIYE 3Q2CA 3VGDA 4OIAA 3WS3A 4PRDB 4WFFE 3SKNA 1K6QH 3J07A 2ETWA 5K59E 1YN6A 2UVEA 2OR8A 1T6WA 5GJSL 15C8H 4CL7A 1E4XI 4H8WH 4PLJD 3BP5B 3IJ7A 4M6NH 4PJDB 5AAWA 3R8BB 1DJIA 2FTAA 3FCUB 4H13C 3VD4A 1N18A 4PJEE 3GUTB 4GI9A 4WW2A 5JHLH 3GS4A 1SHSA 5BCAA 4NQCB 1JGDB 1VADB 3IBEA 3SDCB 4U6VL 2Q5BA 3QDGD 3OXSA 5CUSH 5LGJB 1NGYA 4YSSA 4AGLA 4TSAH 3PQYA 3SCMC 3UTSB 2LLLA 3BAEH 5IVZB 3B2XA 4F15B 5D1XD 1T21B 3HC4L 4BJLA 4KDWA 1R4XA 1S5IL 4QF1B 1YJDC 4TVSa 3EGSB 5F0PB 5F7KC 2ITEA 2Z91A 5EBMA 2XV0A 1FJ1B 3VFTA 1CGSH 4MD4A 5GJTL 2XWEA 5L8KB 3LSOB 3EOTH 3OKEA 1YY8B 2AVGA 1X5LA 2QR0A 4Z7OE 4ZX3A 2JFCA 2Y7NA 3MCG1 2VC2H 1AOZA 2B39A 4I3RH 3SDDA 3D4ZA 3FO9B 4EXPX 5L6YH 5E6ID 2AJXH 2ZXBA 3WKYA 1U4EA 2A77H 4KHXL 4YEFA 1R3LA 2CIIA 1KN4L 1HKLL 3IKCA 3MV7D 4LLUA 4OLUL 4PJ9D 2DMGA 4L8DA 4R7DB 4ZNCD 5ICXA 1MI5A 3IETA 2FT6A 5IEHA 5ERWA 2F54D 4JQXC 2WZPD 2VZ1A 4I18A 4YR6A 1BGXL 4H8HA 2F5AL 4CU7A 2J20A 4NWTH 2FR4A 5B21A 3QUXD 1LO3L 5MI0B 5FO9B 1PBYA 1ET8A 3WOVA 5L2KE 2F1AA 1I1YA 3CTTA 3DBXA 2X4PA 3IFPA 4H1LH 4I85A 3S2CA 3ZDYE 4D0BB 4XMVA 1WZLA 3J2PA 1BYNA 1C8QA 3B5TA 4CJ0A 5B3SB 1E7UA 1G7MA 2AQNA 5IB2B 1TZHB 1WT5C 5FB8A 5H37A 3RPBA 2FGWL 4F80A 1QNZH 4L5FL 3TC9A 4R2GC 5AVZB 3OGOE 2NY5H 4QRBA 3GEFA 1XGYL 1MFBH 2LU5A 3KLLA 5IBLC 4M48L 2UZXA 4E36A 4BH7B 1MCOL 3US0A 3R1GL 3ILPA 4LQFH 4PP1C 2V2TB 3ZO9A 1SEBB 4X6BA 4M03A 3WFBL 2Y1ZA 3QR2A 4KVPA 1HX0A 1DO6A 1F8TH 4IBVA 1IVLA 2FRGP 3KJ4B 3FTUA 3UBXB 5I74C 5M95B 4PJIA 1AXTL 1ZTXE 3MRKB 1X9RA 4AUYA 1DQVA 3G5VB 3SJVB 1SOSA 1PEWA 1XL6A 2YD1A 2NT0A 5GRZA 4E68A 5ANMB 3N44F 2X9YA 3MYJA 5DVKA 5JW4M 5DZJA 3WD5L 5H4ZA 4H25B 2HMID 1DUZA 1Y07A 2E9IA 4J27A 1NAKH 5C6PB 4FC3E 3NQKA 5IQ7L 3LMJL 5JXAL 3SKJH 2GTQA 1OPGH 2WBJC 1TYRA 2NY4C 2UY6B 4R96A 3GI8L 3GMPA 5C09B 4UZGA 5FYKD 5IT2L 1PKQB 4KK5C 3WNJA 3F6LA 3CSFA 4LKCB 5DFTA 2QVFB 4QXWA 4Z7QE 1DQLL 5MHSD 1CTOA 4O4YH 4Z8FH 2XDHA 3LQAL 1AHWC 4YHKL 2V3DA 4A04A 1NC4A 43C9B 3PFUA 4R4FL 3MFFA 4AM0A 5T1MB 2PWGA 3W11D 4HW6A 2CK0L 1XIWC 4AY0A 1EHKB 1II4E 1MJ8H 3OVUB 3WHXA 3FCSB 4JM2A 1YQ2A 2APXA 1OW0A 3TTYA 5IVXA 2YPLE 4HLEA 3E2HC 4YHML 3PHAA 4PJ8A 5E2TH 1RL1A 2NXZD 2Y9RT 5ALBL 4AQ8A 2CR3A 2JJTC 4PAZA 4WTZG 2AK1L 1ZD6A 5D1ZB 2HT3D 2H1XA 3ZMEA 4LLYB 1FGNH 1GYVA 4P9HC 3SGDI 3U79A 1P7BA 1UXWB 1A22B 2BOBB 1PFOA 5TDOA 3VWKA 3CFCL 2BINA 1J5OL 3LEYL 1SYSA 3FFCA 4OD3L 1HWHB 3MBED 5KBNC 5JOEA 2B4CH 3IMBA 5C07B 2L8AA 2ZKMX 5DD3L 5JQ6L 1H3VA 3A47A 5DO2C 4UF7C 5I5MA 2R29L 4O2EA 3KW8A 4LHUA 4MNGA 1NIDA 1BZQK 3RWFB 1NCCH 3G6JE 2KKQA 4HJ1A 3MV9E 1BA9A 1A8ZA 4NO2A 1NCGA 4ZS7L 3TOPA 5HDBE 1BQHG 1U8PA 4HCIA 1NCOA 3KYOB 5J1TC 1YDPA 4P23A 1YO4A 3VXOA 2QSCL 1XGQB 3CC5B 3ALPA 3CLFL 3DGGA 4X4YB 1HXYA 4MXQC 3RGVB 4DEUA 4RAUA 3JWDH 3F05A 3UTPD 1CVSC 4BSWA 1A7NH 4MNQB 1RZGB 5DU7A 4ZS6D 4N4YB 2NNXA 1CO1A 4ENED 1G43A 3KPSA 3IGFA 3ETBJ 5IK3B 4UDTA 1JNLL 1QAWA 4M29A 3RWCB 3LN5B 4XPBL 2XZQH 4DP2X 1OAUH 1EUUA 4R5XA 4NHUA 3HI5H 4OZGA 5CMAB 3OSKA 1IB5A 3CBJB 3FUIA 3UTTE 5H4YA 4PRPA 1KTLB 3V0VA 2PW1A 2R83A 2CLZA 4C4KO 5ESQB 3DRQA 1C7TA 2H2PC 1MAKA 2IDCA 2CRZA 3MRHB 1JPFA 1SEQH 3FSWA 4BFIA 3QEUB 2ZF9A 2IH1B 5HHVH 3UZEC 4KMLB 4YSDA 1Z9PA 2VRQA 1DQML 3HPLA 1DYZA 3NTCH 1TKWA 2Q86A 2ZX9A 3ARFD 3FXIC 5BOPA 1YHPA 4PSRA 1YA5A 4XTRD 3FH7A 2I26N 1I9JL 3HRPA 3IFOA 5DGRA 4EQ3A 3N40F 4ELKB 2EYRA 2J72A 2BNRA 4HH9B 5DUML 4OJFL 3HIZA 1E8WA 4OD1H 4UM9B 2IAND 1Z1WA 2WZ6A 2DQGH 5LLIC 2N7BA 3ULAB 3V0HA 3EOBB 3WV0A 1P6WA 3KPQA 4LLWB 1MAJA 4N20A 4RNRA 2WCGA 3ABLB 4G8IA 3CU1A 5I76A 3OHXC 1TJHH 2DD8H 3ABGA 1JHTB 1FAKT 4HJUA 3KLDA 3UL4A 2WBXA 2CM5A 4IJ3C 3PDOB 3B9KD 2RFXB 1MG2C 3ZZ1A 3L1OL 4UQCA 3JTSB 3EDKA 2PTTA 2QVMA 4I48A 3IDUA 4JFOB 5HHMD 4RVBA 3VI4E 3NZ8A 3QFJB 1G7LA 1BQLH 3FT4A 1QOKA 2VN3A 2C5DC 1ZT4A 5G4NA 3PCYA 5L7XL 1XZWA 4M5TA 4NP4L 4X0KA 3O3EB 3L3JA 2EYTA 3MLWL 3DX0A 5CIPH 5BZXA 5E9DA 1K4CA 5KAQF 7FABH 5CJOL 3E8UL 2EICA 2DF3A 2IDSA 1PG7H 3ZR6A 4JNXA 5KYUA 2M2DA 3PV6A 5HDWA 2CR6A 2JKLA 4JO2L 3MOBH 3I85A 4C56A 5L4JA 1UFUA 2BOCA 3FO0L 1HL5A 3OAWA 3VVVA 3PWNA 4B9GA 3HZMA 1VGEL 3QJHB 4A6YA 3JT2A 3BT2H 5IBUG 3DURB 1QW9A 3BPLB 2CO2A 1U2HA 3VXSD 4RFOH 4M62L 1NBYB 4JCMA 4U05A 4X6DE 3CFTA 4WIQA 5E8PA 2ZAGA 4Z3HA 1DSFL 5C0GB 3Q6GH 1X7SA 1SXNA 5AQ0A 2VE6B 1G1CA 1AP2B 3G3LA 3HHRB 3OXRA 4JGUA 4FQIL 3T0ED 3GXNA 3VXNA 5K9KB 1VFAB 4DP6X 3GJFH 3LS4H 4TLKA 3LEXB 5DK0B 1ZE3C 4WU5A 1NGWB 2H0JA 1D5BA 4JX0A 1IM9A 3K72B 4OIIH 1FFNB 2WLIB 4JPIB 3U0TB 4QTIL 2E0PA 4N0CC 1KYUA 2HG5A 1X9QA 4NNPH 1EHNA 4G7VH 1JZ7A 2MQ0A 1RUKH 3QZOA 4ORGB 3EZ8A 4DERA 4OQTH 1BVNP 3ESNA 5SWSE 4MQXD 4Z7AA 2VL4A 4HCGA 4R0LB 5AYUH 2CK2A 1FPTH 2CAKA 4HLZH 2AMGA 5IJVA 4X50A 2NSQA 1IBZA 3AW5A 1MIML 4XX1E 1K3IA 3FT3B 3WEBA 1R17A 4POZC 3LKOA 2HLAB 1ZOXA 4LVNC 4JKKA 3QNZA 5LQBH 5E5MB 3Q3GB 5EU4B 1T0MB 4HXAL 1IRAY 3HNVL 3QIWD 5CF3A 5BVPL 4YK4B 4KNTA 4WW1B 5HHOB 4XGZB 5EZIH 2VW4A 2BW5A 4FAAB 2DWXA 2PXYC 2YFOA 4P2RB 5HJ3B 3NMEA 4IK7A 2J8UF 5FCUL 3HZYA 5J0BA 2PUQT 4ONHA 5HVGB 3BUPA 2WVTA 4ZUVA 4JFFE 2VAJA 4R4NC 3ZYZA 1A9EB 3GPSA 3KXFB 1KLUB 3MJ9A 3VMPA 3DMMB 2ROYA 4FQ1L 4LOUD 4Y5XA 35C8H 1J1OL 1D5IL 2KUTA 3WXVH 4FRWA 1DEEA 5DC0A 4ANUA 2BS9A 5GGRA 3D48R 1ZHLA 3PUUA 1SN5A 2VRKA 3C5ZC 3RU8H 3E3QE 1HXMB 1D9KC 4HWZB 4PJEA 5EEWA 3FU9A 3QO0B 5ENWA 4YUEH 3DVGB 3VXQA 4RISH 5I8EB 3NVQA 3RTQB 4MMZC 3DIVA 4XI5C 3D50A 4AKOA 4UMSA 1KGCD 4TVUA 4FHBD 5E7BA 1J05A 5SWQA 1DUYA 5DJCA 4U1IB 3D3VE 5D6DA 3BPOB 1D7DA 2IWGA 4ERSL 5I1KL 2F8OA 4CUCA 1FA4A 1Z5HA 3T0XA 4UQ9A 1ROCA 3ULUL 3U7WL 1Y1UA 1DBJH 1U3HD 2BFVH 5EO0A 1KFAH 3GMLB 4LKXB 5DRNB 1WP6A 5EULV 1DBAL 3FQ4A 4JFED 1KXQE 2VJXA 4AE0A 3FUEA 2WZ5A 3C08L 1NLBL 3MBXL 4JY4B 2Q7NA 2J55A 4Q6IA 1RZJH 4MA3B 4YSTA 3M1OA 5I18L 3KYKH 3IDJA 3SQBB 4O2CA 1AD9B 2J6EA 1ZHKB 1UCBL 2P7TA 1A64A 4BUHA 4LEXL 3RX9A 3OLGA 2D3NA 1Q9OA 3MVSA 5C92A 4PJCF 2E74C 2ROXA 5D7JD 5FGCE 6PAZA 4PUBL 5B1JC 3IDXH 1G9EA 4QO1B 2DB8A 5L2KA 4G82A 3AMLA 2ZWLT 4DGYL 1PIFA 3MGOA 2XNAA 1CK0L 3U7AA 3HZKB 4G42B 5A3ID 1JXDA 4TUJA 1KBPA 1P5UB 3BN3B 3H3PL 1V3LA 3MC0A 4R7VA 4Y19A 4Y7OC 5E00B 4ZOEA 3O45A 2XWJA 1AXSB 2CLRA 1ED3B 4DFHA 4Y88A 4DEPB 2V3FA 2VH5H 5EDXA 2HWZH 3OB0H 2WNGA 3LNDA 1KACB 2P48B 1V7ML 4N9GB 1U3ZA 4MHHI 4K3EL 2BIHA 4QD2E 3SY0A 3BRDA 4NFCA 1AZBA 2BZ7A 5I6XC 3C9NA 4KUCF 5GZOD 2B0SL 3X14A 4G6KL 1HQRB 2E76C 2EDEA 4LCYB 4XCYB 1HINH 2C3WA 2OJEA 3D0VB 5EB9A 5JHLA 4GBXC 3S98A 1HHHB 2OK0L 4QXVA 1GMIA 4FQXD 4GKSB 2XVGA 3QCTL 4PJ5D 4XVJH 2XPGB 4HUKB 4HOXA 4NJAL 1CJYA 1CUOA 1HILA 4LDCA 5JYLA 2E7DA 1E5ZA 2D7NA 2NMSA 4YVUA 3MN8A 5I8KL 4H0HB 2HB0A 1AR1B 4M1GH 2QGEA 3MUUA 4ZUTB 2QFRA 3FTZA 2D0GA 5I30L 2NYYD 4EKJA 4E2OA 2IBBA 3GSUB 3FF7A 2CD0A 3KYAA 5A6LA 4K5PA 2ADYA 3RNKB 5K1JA 2VKWA 4N0UB 4NGHH 3DO7B 1F90H 5KANG 1OOAA 1MLBA 3HUJF 4B95C 1QASA 1RJZA 1JWSA 1TJMA 1JS4A 4DKEH 2RQEA 1IM3B 1OGSA 1X5ZA 5KVGH 2BRRH 3B9VA 1M7XA 4GO6B 5JO5B 3IDMB 4JKPL 4G8AC 3O2WH 3RTLA 4P2YA 3QQNA 5KN5B 4I0PB 3DV6B 4F3FA 3EYVA 2F6AA 3HC2A 1FZKA 1MELA 3AT0A 4ZTPH 1OCWL 4XO4A 1SHWA 5B3JF 1M7IB 1GJUA 2OYLA 3MREA 3R18A 3K6NA 1LEIA 4IU3B 4G7YH 4OLWH 1MHHB 3ZDZF 3T1FA 1E9PB 5EO1A 2XG4A 4H26A 1BZDA 1DQQB 5I1EL 1QMUA 3TJHC 2DQUH 1TZ8A 3EJSA 2W1NA 1MUJA 1D5RA 3BZ5A 4QOKE 3BAJA 1EAPA 3IS1X 4P3CH 4TNVF 2ZUTA 5TE6H 3FSZA 1KULA 1XCWA 2R1WB 2RH0A 3BUIA 3E9TA 1ASPA 1RMFL 4LGSB 4YGAB 1A47A 4Z3IA 5D2NB 3K7UA 4YAQA 3MLRL 4ONFL 4ABUA 4OI8A 4P04A 4XC3H 1DDHA 3G6JA 4XP9H 4B5ZA 1DQKA 2B9BA 3MV9A 3TJPA 1AI1L 1KBWA 2VLRB 5LWYL 1KN2L 3BMWA 3STBA 2G75A 4GO9A 2IAMC 4JG1H 1TYJA 5ESAA 3QPXH 1RZKH 2P8MB 4O02H 4GQ9H 2X1QA 3JV4B 1QSEE 3L4VA 4EN3C 2DM4A 4Q6KA 2YEQA 3CSGA 1NBVL 3S5ZA 3RWIB 3TH4T 4Z95H 2ZSWB 4HUWA 1P9MA 2QADD 1VSCA 2WLLA 4WW2F 2FJHA 1J9RA 3W0WB 3A23A 1Z7JA 5D2LF 3T4YA 4JPKH 5HDRA 1MDTA 3P9LA 1HH6A 4FI7A 1CD0A 1WZKA 2XQ0A 3WY2A 1KEML 4F33A 1M6OB 3AT9A 3ISYA 2R1XB 1CWVA 1LD9B 3LXBA 3EFFB 3FTGA 4PJAE 1EZSA 2HUHA 4GNKB 3BPNB 1JYXA 4FMFA 4XP4L 2QVKA 5EU6A 4FADA 4PRHB 2BZDA 4RMVA 2Y6SD 5CZXD 1HWWA 4Z7UB 4AUJA 3O6FB 4X0NA 1SNRA 1EJOL 1V7NH 1S9XB 2WQUA 1BZ7B 2WUCL 4CA4A 3BMVA 3A22A 2Z0BA 3V4UL 1QSVA 3ENEA 3QK0A 3S35L 2GJ6E 2V9UA 2V2XB 1A1NA 4NN7C 5D9SA 3VRIB 2EEBA 3D30A 3BE1H 1KZQA 4HS8L 2R2CA 2WO3B 3QUZA 3Q7JA 1LK2B 2O6FA 4MJID 4O2FB 4NLAA 1JXJA 4DF9A 5CN1A 1EAQA 1JWUB 2FLBT 5IBTL 3FOMA 4TVPD 3HN5A 3ARSA 3UJJH 1FO0L 4MAYD 2O5NA 2D3LA 4M00A 2WYIA 4U7KA 1MRFH 2NY7H 1CDJA 3VFRB 2JSFA 3AVEA 4LXFA 3F7YB 4ETQA 2X2HA 2OULB 3R06B 3BXNA 4OQ1A 3UBFA 1U6AL 3PL6B 5SWZE 4K3GA 3QVAA 5IHLB 4QY8A 4PJ8D 1FV1A 4ODBD 1ZK5A 4L3CB 4ZJ9A 4J4PD 2RCSL 4HK3J 2WP3O 1BG1A 3WKNA 5GGTH 4HWNA 2ZUXA 2GSIA 4IBWA 4KXBA 3VI4A 5DRXB 3RP1A 1JNHA 1NQBA 3HE7A 3VJ6B 4L9LB 3UROR 5CCKH 1SJEA 2JKNA 2O5XL 5I1AB 4PJIF 3CBKB 5BZDA 1XGZA 3ZKXB 3Q06A 2OP4L 2QQNH 5C0RL 3OKDB 4PGZA 3FUJA 4Z18A 2X6BA 1PTZA 3D52A 2FX7H 3EGDB 3S2AA 2BP0A 3HKZA 4ZMNA 4JUTA 4GW1B 4U4IA 2BJMH 2ZICA 3BISA 3SQRA 1AJ7L 3QIBA 3KCWA 1U3YA 4X5WA 5AWNL 1QSFD 2ADFL 4W9FC 3GTTA 3MKGA 2FE0A 4LF3B 3VW3L 3O4LE 1BX2A 1QSZA 2L3BA 4BFNA 1FN4B 3I3DA 1FO0B 2WOYA 4TRPH 4CBPA 4WEMB 2YGVA 5EEXA 3BVDB 3E1F1 4NRZB 1PU0A 1ORQA 1M3JA 4MCZA 3S36H 5C08D 3TBWB 4KKLC 5T5NG 3QG6A 5PAZA 4X6DA 3QFDB 1GTFA 1WZAA 3WEXB 5F6IB 5I1CL 4WI7A 4ZO8A 3CDGA 1A14H 4KX9A 1M42A 1SMDA 3N43F 1OE1A 3CK0L 3ZGIA 1QLRB 2Y3NA 4KKNA 3LHPL 3H56A 5ECJE 5J89A 5B22A 4S1RL 4JM2F 2VXSH 1I8IA 1MJJB 4YO0A 4D0DA 3CN0A 5IVXF 1XFPA 5ISZB 12E8L 1N70A 3L4WA 3FUMA 4AT6A 4NKMB 1ADQL 4XXCC 4HC1L 4YN3A 2CBOA 5IR1A 1S7TB 4GP5B 2AQ1A 4PRNA 4OLVH 1ZY9A 2DLEA 1P1ZA 1WAEA 4XVSH 1TNMA 5AAMC 2JJSC 5EN3A 3A4DA 4OCWL 3C8KB 2NUTA 3O8XD 2A83A 5E8DH 1NMCB 4L5FE 1HESA 3AUWB 5SWSA 4K4KA 1EUTA 2JTDA 1XEUA 3RJQB 1TTBA 4M4PA 1DQDH 1WA2X 2MRYA 4JZOA 3T71A 1FNSL 4QHKJ 2C1OA 3B6SB 4BWTA 3ML9A 2Z3FA 1OALA 5EU5A 3DHMA 4AVIA 3KR3H 2F53D 4TUKL 3WENA 2J88L 3EJZC 1RK0B 2W91A 3K0YA 4QTHB 2QELA 1YUKB 2BNRD 1JXFA 4XOCA 4AKQA 3U82B 4MLSA 3BDBA 2R4SL 3T2OA 3BKYL 5EUKA 4KVNH 1G6RL 3TO2A 4U2ZA 3LKNB 3RVUD 4ZXBC 4KKRA 2IPUG 4IMKA 4L05A 5KTEL 2FBJL 4PW3A 2BY3A 3SCMB 1AD0A 4UIKH 4E9VA 1J48A 4TVPH 3SE3A 2HKFL 4KKBC 3VG9B 3AY2A 3SOTA 4U3SB 3S88L 1ZV2A 3TBTA 1WWWX 3GMRB 2HX9A 4ECNA 1IBBA 4OZFG 1IGCH 3NSDA 4FFZA 4MBOA 1YN7A 3CN1A 3B4NA 4A39A 4MD5A 3DJZA 4KXAA 3FH8A 2VN7A 4KKAC 1XH3A 5IBUB 4MNHB 3NT0A 3U0PA 4B97A 3CV5A 2VQ1A 3E7JA 3D3VA 4CADA 3ZE2B 3AXHA 1DJGA 4XPTL 1CZ8H 3D06A 4JG9A 4W9CC 4PG2A 3V0EA 1PD6A 2VXQA 1AQKH 4M93C 3S48A 5CD3B 4KTEL 5EU7E 2HRPH 4LVOB 4WHDA 2MQCA 2A5UA 1KXQA 4UQBA 1B90A 1C1EL 1OTSD 3P0YL 2NCMA 1K8DB 1E4JA 1OGTA 2BP5M 2BP3A 3L5WB 4RMBA 4DOHE 3ROLB 5CLXA 4Y9BA 4N24A 1UYWL 2BNQE 3LB6C 2EDNA 2VO8A 3N85L 4R2GB 2FYVA 3BD5A 4WNQB 3FB8B 1UFGA 2PN5A 2Y7LA 4FDWA 4YZFE 3RUGA 3V4PL 3VWJD 1Q90A 1BF2A 2OX5A 1OGAA 2APBA 2CHWA 4GY4A 3NRFA 4JK0D 5KSVA 4OB5H 2JXMA 2NY2C 3UTZB 4ZAKC 2HTKC 1VLXA 3LNEA 4X6EA 3BPCA 1DJHA 4DESA 4H8UA 4N8VB 3SE8L 3INUL 2A1WH 1DLHA 2DPKA 2X89D 1IBHA 5T3XD 2R8SL 4P9HL 3B56A 1Q1JL 4XMKL 2KZWA 5F97E 4XB8A 1KBGH 3U9UB 5T1KB 3ZKSD 2B2XH 5AYTA 3G6AB 2MKLC 2CH8A 4YHNA 5D96C 5AOIA 2AQSA 4WFHE 1JV2A 4XNZB 4E0RB 2ARJB 4WV1A 3QQ4B 1A6VL 4WO4D 1IAKA 1EFQA 2MH4A 1NCDH 3V6BR 4L1TA 1KB5H 4BZ1L 1BP3B 2NY4B 1T5XB 3H0TB 4HKBA 2VAAB 3A24A 3CLEL 4POYA 4P5MA 3NFPB 1E2WA 4YSEA 5HD8C 2G3ZA 4GO8A 5EBLA 5HYJD 4JDZA 1H5BB 3NCJL 3ZE0E 2JWYA 2H2SD 3KPPA 4X8JA 1QABA 1YPZA 4I88A 2CKBL 3CFEB 3V4PB 3U6RB 1XCTA 1RERA 1LYQA 3FC8A 1KIPB 4YDVB 3QJOA 4UCFA 1DBBL 1FVDB 2OQJB 1DE4B 4QKTA 3LNHA 1VKXA 3P3TA 1VCBC 4M5ZH 4PY7A 1QI5A 2VB5A 3L8QA 4YXKL 2A0LD 3HS0B 1ZEAL 2EC9U 2JB6B 4IDJL 5KVDE 1H8SA 1EEZA 3OSVA 4FFWD 3PREA 4YOKA 5LXGL 4HETA 1ET5A 5TDNA 3KVDD 3G9AB 4AL8C 3L3DB 3AQZA 1GZQA 2DWDB 1OB1B 2ZONA 1QVOA 2X6UA 2A9NH 1CLCA 3Q44A 4MD0B 4FQ2H 4OY9A 2NNAA 1KCBA 1KPRA 1F13A 4RRPG 3QUML 2XTJE 3LDBC 1MRDL 2VDNL 2YWZA 4QRSB 5I1HH 1CL7I 2Q76A 3DOSA 4HK3N 1XZ0B 3QI9C 1OWRM 3QNFA 3T0BA 3RWJA 4KRPD 2ICWB 3BQUA 3GEWB 4RMSA 5JMRA 1SOKA 4QOKA 4YHZL 3RVVD 4YSCA 2I07A 5BV7B 2GG1A 3OPUA 4ZMOA 1CICD 1L6PA 1GOHA 3L81A 5DRZB 1CG9B 4OT1H 1RZFH 1NINA 1UUNA 4HKZA 2CO1A 4TL5A 4AEEA 2BVQA 4OJEH 2OL3L 3DIDA 2VDPL 4IOSD 3LTVA 3PAZA 4MSWA 3MROB 4BFJA 3JWOC 3VI3B 1RK1A 1JSYA 4UTBA 3NA4A 5B1BB 4XX5A 1PLCA 5T1LB 1YECL 4PWFA 5LGHH 3UXFA 4F8LA 1JOIA 4FFVD 4PB9H 1WVZA 1KMGA 1UOKA 3L9BA 4ZMYA 1WA1X 3MHZA 2F08A 1TJIH 4ZBJA 2CMRL 2L7JA 4W6XB 4AQZA 3S0PA 3D0LA 4NKDA 4QKXB 1OP5K 1F1AA 3R4DA 3TEYA 1FYTD 3QUMB 2CO7B 4PJEF 5HGBB 1KCSH 1YMME 3TONA 3D85D 4PLNC 3JYBA 3KD4A 5EEUA 3ZR5A 2QTVA 4QHUA 5DFVD 2NCEA 5IOPA 5TF1L 1B4JL 1YYCA 3B83A 2NZIA 1CDHA 1OP3K 3RA7H 3KS0H 1QA9A 3NAAH 1E2VA 2EXSA 3GSNH 3O9WD 3C09C 2R39A 1S8DA 3P4MA 4RQQA 4HHAB 1F5WA 2DBLH 5T3XH 1F4YL 2L7UA 4PJAA 4PP2B 3RIFF 2IQ9L 2UYLB 2E6PA 2VDPB 4Z77A 1GIGH 1NFDB 3TBBA 3QDHA 5LN8A 4OZIE 4IGBC 3CFJB 5E4AA 1MAML 3PAYA 4Z7OF 1KBVA 5INDB 1YMHA 2OXGA 5CEYA 3RL1A 2IC2A 3G5YB 1U3JA 5CWSB 2BERA 4R3SA 4PEEA 2OTUB 4TQPA 4WKZA 5E4EC 3FRUA 4L8SA 3LVTA 5HGDB 1YG9A 4AG4H 4ANKA 4AVHA 4H44C 4EJ1C 4UIMA 2DEWX 1PKOA 5K39B 4G1EA 4PG9A 4JHZA 3KDPB 3K4ZA 3WEMA 1XCQA 2R2HB 1NMAH 1NLDL 1EEYB 4MAUL 5F7EL 2F74A 4EZKA 3MJ7A 3CIAA 1IAII 1BIIB 1Y1DA 3F58L 4LU5L 3PNWB 5GS1C 3D4CA 1N0LB 4N6QA 3QHFL 1JTOA 1KIRA 1Z3RA 6FABH 5ID1A 4H8VA 3BZFA 2Z31A 5GRUL 4DNLA 4PN6A 3GXTA 2C1PA 2YPLD 1AY1H 4M3KB 3WO4C 4B41A 5C8JA 4F2ME 2IDTA 2AV1A 4JGNA 4U1KB 4PH8A 2J1XA 5F6HJ 4TOYH 3MGTB 1SN2A 3F04A 1NPNA 5DD1H 3SQOH 4FNUA 1U0QA 5C0BB 2ENJA 1NUGA 3GRWH 1Z3GH 3N04A 2XN9E 1NBCA 3DPDA 3CZKA 1KIQB 4XH2B 4HUVA 4ZFFB 4WK4B 5MEPA 2XA8L 4FL4C 1B0GB 3T2QA 5BO0D 3ORJA 4P5TD 3CDCA 4QHLB 3AWEA 1A6WL 1R24A 1KB9J 1UJTA 4JREC 4U1HB 5IB4B 2A9ML 4JW3A 4Z7WE 4MMXC 1TOXA 2NY3D 4PRAA 3IXAA 1I7TB 1ZXKA 3TVMD 5BOZG 3O4LA 3X2QB 5FOBA 5EH1A 3APNA 1IL1B 4FZEL 4HPYL 1PZ5B 4RA0C 4WUUB 1KLGB 5F7MC 1P4UA 3BCFA 4Z7NB 5KWYC 3VFPB 4UT9H 1FNLA 4YBQC 1R46A 2NXYD 3CMOL 4F7TB 3WN5C 4P2OA 2NNCA 5FM8A 1N7ML 3QIUD 1FBIH 2EEFA 4IHOA 1IE4A 3K71B 5KAQG 1T6BX 2PKDA 3AXLA 5L88H 2BVOB 3I75B 1JFQH 2AJZA 1CLYH 1HSAA 2AXWA 4L1DA 5CD5C 3DPBB 1UB5A 3SIKA 4MHHG 3BJ91 3HKFA 2HJFA 3MXWL 4IRSC 2XN2A 1FLRH 3F62A 5DMIH 5HDLA 5AAWC 2C7FA 1JZ4A 1NCAL 4M43H 5KJ4A 3S8GB 5JZ7C 4IEFB 3GXUB 4WW2C 2AANA 5KVFL 4UAOC 2LFGA 4L4TB 3MZTA 3HR5A 3J8F7 2AJUL 2CZNA 1Q1PA 2VSDA 4D9LH 5JOFB 2WK2A 3UTTD 3HZ3A 5GGUA 5LDUA 4IOFD 4J5VA 4UM8A 4BA8A 4EAEA 2DMHA 3WKML 1RCYA 1FE8L 1NEUA 1ZMYA 4RGOH 4LSSL 1J1PH 3BZEA 1FNEB 2Z1PA 5AW1B 1M7DB 3QJRB 2WXLA 4W81A 3OZ9L 1OT4A 2X2IA 5IW1A 1PLAA 2QQLH 1HI6A 4XN4A 4XOEA 1F11A 3UX9B 5FA3A 4XMLH 1SM3H 1I8LA 1A1MB 2QKIA 3G6JF 3FRPA 4BZYA 4JQIA 1QFPA 4G8EA 3FT2B 5IFAL 3SDDC 4Y4FA 5HDBF 3OQRA 3NSFA 3SDYL 3S8WA 1JGIA 1AGCA 3BW9B 4I89A 2PPDA 5AKSA 5IHHA 1CI3M 4AGOA 2P5WE 2YGPA 5DZAA 1AHMA 3VD5A 1E9OB 1FF5A 4ZX6A 3N9GL 4LB8A 5ID0A 3X1BA 2J56A 1FCCA 2E7CA 2CBPA 1F56A 1OAQH 4UAHA 5JYMA 3E6HB 1MZYA 1NKGA 1YYLH 4KZEH 4GKNA 4IK6A 4B9CA 4XMWA 1A4JB 4CMMB 1QTSA 5E23A 1VCAA 3BH8B 3DRTB 3FB7B 3L6FA 4AZ8A 4UT7H 1V3KA 4WY7H 2OMWB 1U92A 3DTUB 3WSQH 3HAEG 3LIZH 1MVUA 1RUMH 2VUKA 3II1A 4KKCC 3RWEB 1I1AD 3ABKB 4MZ3A 1KYAA 3WMSA 2VMDA 1MW0A 3CFQA 3ZJAA 5KBDA 3X12B 2IH9A 3DJ9A 2Y1VA 4XCEB 1TZGL 4NO3B 4YPGB 1CFNA 4QAWA 4AMWA 1GGBH 3VXRE 3RY4A 3I02B 3W57A 5I5IA 3QULB 1TZOA 4M4RB 3CHPA 3EFOB 4IIQA 3RVXD 1HJBC 5B1KA 2A3TA 3GSQB 3HG1D 2NUPB 1C5DB 1S7SA 3FQ2A 2WSDA 2JB5L 2EC8A 4GT7A 4K94C 4UANA 2GT9B 2DWSA 1T1ZB 3V5DA 5HY9B 3BUYB 5C7ZA 4JL1A 5F1IA 4HJTA 3IMVA 5DSCA 1BPVA 4OKVB 2K8MA 2F8VA 3O6LL 4ZQTA 4X7EC 4BQ9A 1MSPA 5I6NA 4K7FB 3T09A 3QEHB 4WWPA 3G6DH 3TZVA 1KOAA 3UFIA 5LBSH 3WAJA 5FV1L 2CHZA 2FAUA 3BH4A 3FQXB 5F9WC 4JHWL 3D5OF 1F4XL 4NQDE 5T3ZL 4N90E 2WXNA 4GRWE 5JDJA 1A3LL 4X5LA 4FQHA 3N41F 4UT6H 5I16B 2E86A 1A4CA 1I9RH 1K8IA 1WCBB 2BNQA 1PF3A 2R29A 4O51B 1VIWA 4RZCB 5TF0A 2OMTB 3WFCL 4M7KH 1I3RA 3WNOA 4LSTL 3ARBB 1J0YA 4WGKA 1I1FA 3PP4L 3VQMA 1HOCA 1HH9B 2OAAA 1U8JB 4OLXL 1T22A 2ZNXA 3CUPA 4DGWC 1PZSA 2V7NA 1GYWA 1A65A 1HFUA 5DZ9A 1YVLA 4K3JL 1WICA 3S3SA 3MXVH 5FA4B 4N2AA 5GGSB 1ETZB 4M1CD 4MQSB 2IVFC 2FL5A 1CCZA 3QG7L 3VI4F 2X4UB 4TSCH 2FJFA 3VFMA 1AKJD 1IBYA 2K70A 4ICWA 4XCNB 1Q9LA 4AQ8C 2P8LB 5B39B 5TE4H 1MWAB 2XV2A 3JV6B 4NHCH 1T1XA 2AC0A 3MV8B 4UQAA 2QPUA 1CDGA 4PGBB 4EI0A 1X3DA 1WC7B 1GHFH 1MLCA 3MX0B 3DYOA 3EJYD 4I77H 2ZXWB 3V4VH 4EE2A 4HXBH 3KPRE 4OFPA 1R5IB 2E27L 2WQAA 3BVNA 4GUPA 4Y4KA 1ZLSL 1E27B 1MCEA 3VD3A 3MUGA 3L4XA 3TPUA 5FYLE 2H9GB 4G5AA 2Y06H 1HEZB 3V0JA 1UACL 3VGEA 5EORL 2EXWC 1YEGL 3S4SB 1ZLWH 2VR8A 4JFFD 5CCGE 4X6DF 2EUXA 3TN0D 4P4KC 1WSST 1CE6A 1H3UA 1T83A 1CYXA 1QWNA 2COQA 3ES6A 4YNYB 2YSSB 3B2UD 2VLJE 3MRRB 3QDJD 1F18A 5EN2A 1DJXA 1VENA 2X28A 5TFSL 4OFQA 3COOA 5I0YA 1L6ZA 3DUHA 3L3GB 2APSA 4I7ZC 4LSRH 1R3HA 5L8JB 2AXGB 2NT1A 3FQ1A 1NEZG 3GHBL 5I1IL 1YQVH 1QRNE 4NENA 2VXTH 5G5DB 5IESH 2SEBA 4KO9A 3K5SA 3P0VH 4TUOB 1J11A 4N6RA 4Y0GA 2H5UA 3QZWA 3AQXA 3OJVC 3BHBB 2NY1C 1ACXA 3AG3B 4U6YB 5H35B 4CDHA 1OTUC 1XSOA 1RZQA 5CBEA 1BJ1H 4HOWA 4I1NB 3VGAC 3K5RA 1PDKA 3CN2A 1OZTG 1UOWA 4X80H 3WNMA 5DEFA 1S5HB 1G87A 1A5FL 3NG5A 1NCJA 5CGYD 2W65B 5F3BB 3MCLL 2O6CA 3M1CA 4WFGD 5CJQH 1LWHA 3ULVE 3FUHA 4ZPVA 3SPGA 1TO5A 4O9HH 5A2FA 3KPNA 4FTVB 4MB5A 3J7HA 1PYWA 4FFYL 4X4ZA 3SE9H 1CLOH 4HCRH 4KDVA 4L0YA 3ARGA 3GZOA 4I4WA 4BQBA 4G9FD 1QNIA 1QTYT 2O30A 3IVKA 4F7PB 4RWYL 2AABH 4XCFH 4TQEH 2LW3A 1P5VB 2A9AA 2R69H 2KERA 4K8RC 5ITBH 5JOPE 1FC1A 1PGRB 3ARRA 4XVUD 1G7HA 3S96B 1QBLL 5IV2A 5GZND 2FSDA 4I3SH 4Q0XL 2AEOA 4ZSOB 3U25A 2MCPH 3F2LA 3MRFB 4X7TA 3A6CL 5I1LA 4IKNA 4GRLB 5SV3A 3QDGB 2ZF8A 2F5BL 4LPTA 3U4KA 1H3PL 1YMMA 1EHLH 4GKZB 3PP3H 1T2XA 1IILE 3QQXA 2J57A 3AREC 4MXVE 4X98B 4LCWD 2OTWA 2NYKA 2EILB 4OGXH 4U1GC 2E7LA 1LXMA 3NN8A 3MZGB 1Z9OA 1AE6L 3RWHA 3VFGL 3MRDB 5ACLA 4GG8A 3TNMB 2AI0L 2OCJA 1AZVA 3A3YB 5FGSA 2Q20A 4EVNA 4HX1B 2ZXQA 3N44B 4NUJB 1HYSC 4I0CC 4OZIA 3BDYH 4J6RL 4KJWC 1JZ5A 4N5EC 1JYVA 4HLJA 4PJXE 1S9YB 2HLFC 3THMH 1EQWA 2LU7A 5ACZA 1MCQA 2R56H 4UYQA 3NP3A 3SDAA 3QO1B 3TA4D 1YY9C 3HRZA 4FXGA 2EH8H 2IDFA 3QUXB 1CTNA 2VDOL 4QXTA 2HFFA 4EUPB 5KSBB 3GHPA 4PJGA 3QDME 4S2SB 4XRCA 3RUGF 1WPCA 2ZJSL 1MEXL 4HS3A 1PSKH 2GIYA 2QLYA 4JE0A 3MOAL 4AC2A 2XWTB 2VDKH 4LSVH 3I9AA 4HKJA 3LPOA 4UBDC 4LLQA 5BRZE 3SPVA 3GS0A 2DDQH 4F37F 4RAHA 3NJHA 3OKKB 1LWRA 4S1DC 1XF3A 1M1XA 4PRBA 4EN3D 1NH6A 3MLVL 4NB7A 5DHDA 1F3RB 3IF1A 4PWKA 3OR6B 2CCLA 3NIDE 2PPCA 3HNTH 2H6PA 1TEGA 5EO9B 1VHPA 2CXGA 1J87A 4F2MA 3OD3A 1M9SA 2YOCA 2RMNA 1LHZA 3TBVB 4ZNEA 2V3EA 1W0WB 4NRYB 2KC0A 2P5EE 1M71A 5EUOF 5ALCL 4ZYKB 3UC0L 3IAGC 4HF5L 2P43B 1NSNH 1BEYL 2OI9B 3BWAA 4OM0H 3ABMB 5E1AB 1NBZA 4FMKA 3RVWC 1N5YH 2NY6D 4APQA 1TTFA 2WXPA 4S1SL 2OR9H 5EF3A 4IBYA 4JG0L 1ZLVH 4ZDHB 4CN1A 2VQTA 1LP9A 3V7AG 4WWKB 4HIJA 5H37G 1K5NA 4NZFA 2YD4A 4PWJA 2JE8A 4KK6C 3F7QA 5IMKB 4JPVL 5TD4A 1I8UA 4IRJC 1J0KA 3U36A 3GSNA 1W72A 2HP4A 1YPZF 4Z7WA 1CFTB 3ECWA 3FYEB 4LOEA 1E28A 5DC4B 5MEND 4YHLL 3IDIA 4ABQA 3U0WH 1CGTA 4WFEE 4GLRI 3WLWD 3ZKMC 1KPVB 2Z35B 1XEDA 3D25A 5IIEA 5IREA 3KL0A 4JHBA 3AWGA 1QSED 3WTXA 3O3UN 5DDHA 5JDSA 5FECB 3PABB 3Q8FA 1JRHH 1RZ8B 2ZSVA 1JDAA 3MNZB 4IDLA 3PNRB 1DVFB 1YRKA 2BDNL 2X88A 8FABB 3V0GA 3WJJA 4AW7A 2D9QB 1KT2A 4PJBF 1XGUA 3ZYIA 4LFHG 3ARDA 1YUHA 2ZUUA 5I75C 3WYRA 5I1JH 5IEKA 4ZD3H 2AK4E 2B1AL 1OAYL 2I60H 2OW6A 2MOVA 3T2NL 3QEQE 5FHAL 5GQBA 2F58H 3MRQA 5KEZA 3H9SB 2ZG1A 4FG6C 1RUQL 1LTXA 2EACA 1FL3B 4QRRA 1Q9KA 4FNPA 4ZT1A 3MBEB 1RIHL 4YDIL 1MNUH 5EZPA 1XX9C 4IMLB 3O81A 5BQDA 1DLFL 1ONQB 3BN9C 2C9UA 5E08H 4NQCD 1BD2E 3SDCD 1KXTB 1QYGH 1W8NA 1CFQB 4XZ4A 1I31A 3MNWB 1UM6H 32C2A 4KUZL 4V1DD 2R9HC 3KCPB 1J5HA 2B08A 3AU1A 2GJ6D 4JRFA 1VB9A 1MVYA 2G3NA 4HKXA 3HVNA 2OYMA 4JHAH 2ZOKB 3ARXA 3MLYH 4L23A 5IVNA 3NDYE 3TA3D 3WKQA 2GW5A 1NC2A 2P5WA 4CNIA 4NQTA 1GGIH 5E24E 1EXUA 4P0DA 3PJNA 2MPAH 4LHUG 4E9WA 5J13B 2Q7YA 4UQIM 3TO4C 1FZJB 3B37A 1BVLA 1KWGA 2J73A 5SWZD 1WLHA 2WTPA 2O5ZH 4K5LA 3EH1A 4OCSL 3WIIH 4B7LA 4X99A 4M93B 5F3HA 4FI8A 1IGIH 3PRZA 3P77A 1Z5LA 3GIVB 1UT9A 3C8HA 4KXZI 5TQ2L 4HJ0D 3VX1A 1RIUL 5F7LB 3F5WB 4AV4A 5CU5A 1NIAA 4LPYA 1BZ9B 1E2ZA 1T20A 4PW9A 2HKHH 1TYEB 4G6AC 4BWWA 1LO4L 4NO5B 4DPCX 5J56B 1Y6MR 3G04B 3GXIA 3VXRA 5KS9B 1KJ3H 2A6KA 4WAFA 1YNKL 4LIQH 1ZHNB 4OM1H 2WCSA 2OSLB 2XETA 3NQIA 4ZX4A 3NCWA 4AYFA 3DTDA 4YEEA 2ZKYA 3CHRA 5A6MA 1T7YA 5DS2A 5TQ0L 2R0LH 2YARA 4FQPA 4JANB 2FDBP 1LVEA 1MCWM 1RK7A 2X4QB 3P3RA 4EIGB 5BRPA 4G6JL 3FL7A 3NOIA 1WD9A 3QCVH 1L9PA 1J8KA 2VDQH 5F3FA 5J12B 4E9YA 2AJ3A 2FATH 3NGBB 4UNTA 2NDGA 3PGCA 5SX5K 4NQDA 2YXMA 3I6GB 4DN3H 2YBGA 5TJWK 2YN3A 5KYYB 1A8JH 3G5XB 4PI2A 5F2FA 3LN9A 4OF3A 3EG9B 4P46D 2QLVB 2P4AB 5G4OA 3SJVD 1P4IL 3EADA 4CC0A 4AL8L 4XP1L 2PO6A 5JW3L 4NM8L 1L0PA 1Q94A 2FQEA 3EO1A 2DM3A 3CZEA 1KCKA 3U1PA 5FUOH 5J9PA 1U8IA 3KJ6H 1AS7A 5HHMB 3GBLA 4ESKA 1X7QB 1VGKA 2DI7A 2YBRB 3GTNA 3NIFB 1U8NB 5EC2A 5E8NB 4JBSA 5C09D 1MF2H 5G2NA 2A9CA 4N2FA 1D5ZA 5EU3B 2ITDB 2O1AA 1H15B 1DL7H 1S7VA 2KS0A 2Z6FA 4NIKB 4BA0A 4JEGB 2DIEA 1KIUB 5DUPH