5I28A

Azurin t30r1, crystal form ii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
127
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Determination of nitroxide spin label conformations via PELDOR and X-ray crystallography.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
molecule tags Metal binding protein
total genus 31
structure length 127
sequence length 128
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i28A00
2J57A 1DZ0A 3T6VA 4EF3A 4YSRA 3ZIYA 1ZPUA 1J9TA 3NSCA 2YQBA 3IN0A 1FA4A 1BQRA 4E9RA 3AZUA 4YVUA 3T6ZA 2GC7C 4F7KA 1AOZA 2QDVA 1ETJA 2XYBA 1IC0A 2VMJA 4GYBA 1QNIA 4HZ1A 3HB3B 5B1JA 3OM3B 4DP1X 4N4YB 2TSBA 4AKPA 1ASPA 2VW7A 4DP9X 4KO7A 2XLLA 4YSOA 5E9NA 1OE3A 4DPBX 4WTQA 1FWXA 4KNSA 2H5UA 1A65A 3UADA 1HAWA 2PP9A 1N70A 1L9SA 2VSMB 1PZAA 1HFUA 5A7EA 4YSTA 4AI7A 3PXLA 1URIA 3NP3A 1OE1A 1ASOA 1F56A 2MTAA 1NZRA 5I6LA 1L9QA 2EINB 2QPDB 4A2HA 1JVOA 2CUAA 4GXFA 3WKQA 1KV7A 3WNIA 1WS8A 3ASNB 3FU8A 1PLBA 1W8EA 3DIVA 4W9ZA 4YVNA 3GXUB 3NJMA 1A4AA 4KO6A 3QJTB 3QJQB 1RZPA 3X1BA 2HXAA 1J9RA 1TKWA 1WA2X 2IWEA 2R7EB 1PNCA 1SHXA 1CC3A 3FU7A 2GIMA 1XMEB 2HRHA 2FTAA 2YAHA 5B1AB 3NJLA 5I5MA 1ZDSA 2GBAA 3SQRA 2YAQA 3X1EA 3PLYA 1CYWA 3PAUA 4A68A 4HALA 5B3SB 1TEGA 4ZK8A 4AKQA 1L9RA 2FQGA 4G7QB 5AZUA 1E67A 3QQXA 3AG4B 2UXGA 1AQ8A 3EF4A 1JXFA 2XV3A 1OF0A 5FC9A 3FQ2A 3KW8A 3RYMA 4P5SA 3S3BB 1TEFA 4WKXA 3FU7B 4F2EA 3DTUB 2ZONA 1AG6A 3FPXA 4M4RB 2QDWA 3FQYA 4HIPA 3EHBB 1AACA 1KCBA 1PY0A 1MG3C 2XV2A 1MDAA 2X87A 2WO2B 3FYEB 1KCWA 1NIDA 2EILB 3NYKA 1X9UA 3CVCA 4NERA 3TBCA 3WKPA 3CDZA 3DKHA 3FSZA 2PP7A 2IDQA 1GSKA 2P80D 3UACA 4TXVB 2YAFA 3PAVA 2BO0A 3SBRA 4QKTA 1ET8A 3UGEA 1NIEA 1AS8A 5B1BB 2CAKA 3D12B 3OD3A 4KOCA 3T6WA 1GY2A 1QHQA 2DY2A 1IUZA 8PAZA 2PCYA 1L9PA 4E9XA 4E9WA 4UF7C 3AW5A 4PAZA 1V55B 3NP4A 4HAKA 1NIBA 1AIZA 3ABGA 3CDZB 4GP8B 1B3IA 1NIAA 2DWTA 2PPDA 1JXGA 3ABLB 4K9JA 3PPSA 4HCIA 3ASOB 1YLBB 3S8FB 1AZNA 1FFTB 3JT2A 2YAOA 2J5WA 4DP7X 3ZBMA 1NICA 2VN3A 3CVDA 2OV0A 3FSAA 4HHGA 4BWUA 1IBZA 2ZXWB 5I28A 6PCYA 1BYPA 4JHVA 5ANHA 4F2FA 2B08A 2XUWA 1A8ZA 2BZCA 2EIJB 5I5IA 4GP5B 5F7BA 3NJJA 1JXDA 1BAWA 3NJNA 3BVDB 4BXVA 2XVBA 1E65A 1QLEB 1SDDA 3S3CB 2PLTA 4RH4A 1RZQA 5IY5B 2TSAA 5F7AA 4YSAA 4DP0X 2PPAA 3X1FA 1M57B 1OOWA 1RCYA 2E86A 4E9TA 2BP8B 3AY2A 3JTBA 2WSDA 4A2GA 4BDVA 5TK4A 2DYSB 2HX9A 4BWTA 4G7SB 5B1KA 3G5WA 4G72B 2R7EA 3TU6A 1EHKB 2BWDA 3NSDA 1SDDB 1ZV2A 2YXVA 1SFHA 1XB8A 2PCFA 3FPYA 1OE2A 2Y69B 1WA1X 5D4IA 1JVLA 1KBVA 2VSKB 3T71A 1TU2A 4NB7A 3NSFA 1AZUA 1KGYE 2CBPA 2PPEA 2XWZA 4PCYA 3CG8A 4W1TA 1RKRA 1WS7A 4AZUA 2VW4A 1E5YA 1SF5A 2FT7A 3IE9A 4BDVB 4E9VA 4AX3A 5TK2A 1SHWA 3FSVA 2HLEB 2I7SA 3OQRA 7PAZA 2CCWA 1KDJA 3GYRA 5EHFA 1CYXA 6PAZA 1AANA 4JKNA 3SBQA 2BW5A 1WAEA 2XV0A 2ZOOA 1OV8A 1ILUA 3UAEA 4A2EA 1PCSA 3T6XA 2Y1AA 1KBWA 2CJ3A 4CSZA 3AG2B 3HEIB 2DV6A 4KNTA 1JERA 4N8UA 3WG7B 3PAZA 3TA4D 4KO9A 1GS8A 2BZ7A 1V10A 1J9SA 3NJHA 1OCZB 2EIMB 1AZBA 1VLXA 1WA0X 3FSWA 2N0MA 1JOIA 1X9RA 3OMAB 2OJ1A 3WIAA 1W6LA 2UX7A 3KW7A 2FWLB 2FQDA 3AG3B 2JXMA 2IDSA 1T5KA 2IAAC 2FT6A 3OMNB 2OCCB 1AR1B 1BXUA 3WI9A 1JZJA 4HCGA 1BXAA 4BXSV 1E5ZA 3WNJA 1A3ZA 3IBOA 4YSDA 3S3DB 5B7FA 1XB6A 3X1NA 1ZDQA 2VW6A 1OCCB 5I6NA 1GS7A 3NT0A 4DPAX 4HCFA 2UXFA 4KOBA 3EH4B 1GR7A 1IKOP 3IEAA 1ET7A 4DP2X 1ID2A 1CURA 2H3XC 4A2DA 3ABKB 9PCYA 4CSPA 2W88A 2YARA 1BXVA 2I7OA 5PAZA 1V54B 2JKWA 4E9QA 1BQKA 4BWWA 2AVFA 4DPCX 4QLWA 2VM3A 4UAHA 2HX7A 2IH8A 5D4JA 1IBYA 2BP8A 2FT8A 3TASA 1AS7A 2X88A 4FA7B 1JZIA 3SBPA 3FYIB 4A67A 2HZHA 2UXVA 4GP4B 3V9CA 2AFNA 2BW4A 5D4HA 1MZZA 3PCYA 1A4CA 5I6OA 1NWOA 1ILSA 2GI0A 2J56A 1PNDA 1I53A 2AZAA 1SNRA 3MBWB 2Q9OA 4X4KA 1OCOB 1BEXA 3L45A 5I6KA 3N2JA 2BP0B 1NPNA 1PZCA 2IWKA 2DYRB 2HX8A 2P80A 4UANA 5I5JA 2FNWA 5AFAA 1EZLA 1AS6A 3H4FA 3EH3B 2GHZA 4DP8X 1JZGA 2WO3B 2VM4A 1J5DA 4ENZA 3NJKA 4G71B 4YSCA 2UXTA 2AZUA 1N68A 4YSSA 2XX0A 2J55A 3QJSB 4DP4X 2NRDA 3ABMB 1PMYA 2GSMB 1UATA 1KDIA 1A4BA 3ZX1A 3IN2A 1MZYA 2PP8A 3UAAA 3QJUB 3NJGA 5I6PA 1NPJA 4YSEA 4G70B 1J5CA 3N55A 4GY4A 1NWPA 2XXFA 3X2QB 4DP5X 3T9WA 1W6WA 5B1JC 3ERXA 3EH5B 1BYOA 1JZHA 2I85A 5I26A 1JZFA 2RACA 4L0PB 1SFDA 1JZEA 1L9TA 2PPFA 3H4HA 3H56A 4AKOA 1SJMA 2IWFA 4JHUA 1ADWA 1OCRB 5PCYA 4MFHA 4YL4A 1E30A 3QPKA 2MRYA 4G7RB 1NIFA 1CUOA 5I6MA 2BHFA 4Q8BA 2QT6A 3CVBA 1DYZA 3QJVB 2YXWA 2A3TA 1ZIAA 2PPCA 4BK5C 3FS9A 4A66A 1GY1A 1SF3A 4M3HA 3NJIA 1PLAA 4YSPA 2XU9A 1HAUA 2H47C 3NSYA 2YAEA 1NTDA 2FJSA 1PAZA 1KYAA 2Q5BA 3GDCA 1PF3A 2JFCA 2ZWNA 3MX0B 3S8GB 1GYCA 3X1GA 3QJRB 4HHWA 2YAPA 2BWIA 2IDTA 3NJFA 2AANA 1ZIBA 1AG0A 4KNUA 1PZBA 2GB2A 1AAJA 3AG1B 4DP6X 5B7MA 4FAAB 1NINA 1AZCA 1MG2C 1NDTA 4NAJA 1M56B 2UX6A 1R1CA 4KO5A 2IDUA 3C75A 3ZDWA 1J9QA 5AKRA 1ET5A 2XXGA 1PLCA 2B3IA 2FQFA 4E9YA 5B7EA 4YSQA 3BQVA 1ASQA 3UABA 2IDFA 2XX1A 3V9EA 7PCYA 4YSUA 1BQ5A 1XB3A 4P5RA 1AZRA 2EIKB 3U25A 3FU9A 3OMIB 5LDUA 1GW0A 3FT0A 4E9SA 1GS6X 3FQ1A 4A2FA 2IH9A 2DWSA 1L9OA 2HRGA 4Q89A 2QPEB 2LLNA 3CZUB 2YAMA 1M9WA 2BP0A 2CALA 2FQEA 2W8CA 3TBBA 2GC4C
chains in the Genus database with same CATH superfamily
3KG5A 2A73B 5J12B 4EI5D 1G7IB 2GJJA 1FV1B 3SGJA 1NCDH 2VDPL 4QHLB 4ABQA 3MJGX 3BEVB 3H0TA 4WWKB 2OBGA 2YC1B 3II1A 5C6TL 2EVGA 5IB5A 1AGFA 2YRZA 1XEUA 2CHXA 3MKGA 5D5MB 5E2UL 3TEZA 3UERA 4WUUD 1KPUB 1DQTA 4NRXB 4PRPB 5GJSL 1KTKE 3HZKB 4Y88A 5FKAB 1ASPA 4XMKH 1EPFA 3FB8A 1CFNA 1RHFA 1UKQA 2RD0A 4L4VE 3H2PA 5C0AE 5DRZA 3MRJB 3WEXB 1E9PA 2VDMB 1CF8H 1N70A 4GB9A 4N2BA 5AKSA 2IJ0C 4AIOA 4LOFA 3SDAA 5HI5C 2EYRA 5J1SC 2Q76B 3ARBD 5FS5A 1HE8A 5I73C 5FB8A 3ZRFC 2J2ZA 4H7VA 2PW1B 4ZD3L 5F89A 2OMZA 4GBXD 1LEIA 3EYFB 3BX7C 4OAWA 2GJ6E 3QIWB 1HI6B 4AV4A 2ICEB 5FGBC 2P7TB 2VNCA 4MXQD 3JV5A 5CZXC 4LOEA 4NUMA 4M5ZL 2XN9D 3B2VH 5J3HC 3B2UD 4M7LH 4XXDB 2X1XR 3WFHA 4NJ9H 1FPTL 5CKGA 1G1YA 4PWJA 5FYJL 3V6OC 3AACA 1YNKH 2A6KA 1FFNA 1YEFL 1WYJA 3EOBB 4YDNA 2RCSH 4JM2C 4L5FH 1IFHH 2ADJB 9CGTA 3G6JE 3RTQB 4Q9CA 5AOJA 2D7PA 1WZ1H 4H8WC 4PIBA 2VIRB 4PJ7E 3AY4A 3Q9PA 2GIMA 3KPRE 4N9GB 2YAHA 1OAUL 1P1VA 4UQ3A 4LFHD 3DK0A 3DI3B 4XNQB 1ZDSA 4FJYA 4P3CH 4N2CA 4UZGA 1MFEL 2F54E 2EYSB 3REVB 5F7HA 3A6BL 2QQKL 4PJDA 2YPVL 4B5EA 1L9RA 5H37A 4J3OF 3MSPA 2ARJA 5DFTA 1DBJL 2UXGA 1OARL 4XH2A 2I5YH 4EI5B 2YLHA 3KW8A 3PWNB 1PJ9A 3V9FA 3A24A 1OKEA 3F6IA 4GW5B 2JKXA 4WW2B 3V0WH 3LVTA 2FLBT 4TLKA 5AW0B 5HDOA 3QCVH 4OGXL 3AT9A 4HIPA 5D7HA 4A7SA 3L3IA 2YGPA 1PY0A 4NJAL 2NY0D 4P8QA 1XIWA 4WUUB 1S3KH 2DQDL 1QSED 5EIIB 4V33A 3HFMH 1CQKA 1X9UA 3DLQR 4NWUH 3TONA 1YEEH 1H6FA 1HSBB 3QR2A 1EX0A 3G3LA 3O9WC 3ZHKA 2WVSA 3U30C 1HHJB 1FLRL 4ZW3A 5F1NA 3ARVA 4TPRH 2NX5E 3D33A 5DJ2A 5KYXA 1CDUA 3VX0A 1F45A 3LKOB 3NPSC 4KHTL 3ARBB 1ZS2A 1C8QA 2PCYA 1IAII 2XQ0A 4LF3A 3HC0A 3AW5A 2YGQA 3BAEL 4B7LA 1AIZA 3SYPA 3U2SB 4AK2A 1OM9A 5A1AA 5DVKA 2G2RA 3LIZH 3SE9H 4BSWB 1I3VA 1HIML 5IB4A 4X0KB 3MRLA 5CAYB 3ASOB 1ZEAH 3P9LB 3S2AA 2UZXA 2YD4A 1JUFA 2C9PA 2O5XL 1WIUA 4MNQD 3R8BB 4LCUA 1P7QD 4N0CD 1FC2D 1FCCA 4XMLL 4ZJ9A 1UXSA 1HNFA 4FQIL 4JHVA 2FBJL 5K39B 3HRZB 5IBLC 2VCOA 5DFVC 1VFAA 5BRZE 1MCJA 1ETB1 2BZCA 5B38B 2Q86A 3O6KL 1G9ML 5KANI 4JFEE 1WAAE 5IHUL 1JXDA 4JPKH 1K4CB 1BAWA 1XR8A 2OMXA 5I23A 1KJMB 4CILA 3HCVB 2APVA 3LN5B 3S3CB 1HEZA 1WZKA 4HJJL 4NXSA 1MCIA 1T0NA 5JOFB 1NM9A 3EYSL 3CGTA 2R0KL 1JJUA 1KXTA 1A7RL 4YSAA 1W0VA 3GT6A 3PXJA 2DLHA 1DJYA 1GGIH 4W9JC 4XCNA 3O3EB 4D3CL 4FG0A 1PU0A 3UTSA 1AHWC 2PMZA 3BT2L 1CF1A 4X6EA 4YIQA 5A43C 3HFFA 1SFHA 3LZNA 4R5TA 3CLEL 4Q2ZB 5DJXA 4PGJA 2XRAH 1JDAA 3BSHA 2X10A 4XX5A 1TU2A 3EDKA 1YN7B 1CGTA 4HEPA 2XWZA 1RHHA 1QSEB 4XCFL 3T8VA 3QEHA 3L8QA 5BUPA 5ANME 3RWHB 4ALAL 3OHXB 4ORGB 3EJTA 4WVRA 1E5YA 5BZWB 1JD7A 1IGIH 2QTVA 4JZJC 5EUKB 1HQ4B 1KJ2H 5GZND 1X7SA 5ADPH 2EACA 1QLEL 5J6SA 4QOKA 2QFPA 5LBGA 3OQRA 3ZE2B 4JO8A 4HJEA 4JDZA 1YAZA 5AB1A 1JFQH 1DFBH 3AM8A 1OEZW 2IFGA 4K5LA 4G8AC 2Y1AA 1GKOA 4Y4KA 5FYJU 12E8L 3PNWB 1GGCL 1P4LB 3GTVA 3OJ2C 2C1OB 2R39A 1PL3A 3CFEA 4S2SB 3HE7A 4LCIL 2YD6A 2LR4A 4MQXD 3D05A 3KDMA 4KO9A 4V1DD 1ODUA 4XGZB 1KXQA 3EDJA 3WY4A 2J8UE 4X7CC 1G0XA 4PG2C 4FNQA 5KUMA 4JMXA 4MNQB 3VWKC 3FMGL 4PTTB 1SXSA 2ZP9A 2I07B 3B2PA 4HKXB 2NCEA 3X11B 5F96L 2N01B 3ILQC 1OP3H 3ZGHA 4G8GD 2NZIA 3O3AA 4LSRL 2UUDK 3V6FA 1Z9SA 3E38A 2F19H 2PTVA 4JO2L 3QWRA 2FQDA 4PJAA 2VMEA 1T5KA 5IM7B 4OBSA 2VERN 3D3VD 1NDGB 2HJFA 2H2PC 4NRYB 4LCCC 1JWMA 3ZYZA 5B8CB 1X9LA 1I9IH 3COOA 3HZYB 3MJ7B 2VXQL 2BHYA 4C56D 4DQOL 4O2EB 3CFTA 5HHQA 3IDYB 2ITCA 3B6SB 1JN6B 1ZVYA 3HC4L 4ZX6A 1MFBL 4KC3B 2HT4C 4Q6IC 4RRPM 1MCOH 4AYFA 3N91A 3DYOA 2QVKA 2MHAA 2Z64C 3GZQA 4JJ5A 1M3JA 4FTVD 3CFDB 4H5SA 3X14A 3A6CH 2Y7QA 5JUEH 1T22B 3GSQA 1XZ0B 1AO7E 3SGEH 2YBRA 3NRFA 3WD5L 5MHSE 1OTTD 1TLMA 4ZSOB 4Z7WB 4XCYA 2HJLB 4UNUA 5LVEA 4APQC 1WFJA 4H26A 1I7ZB 1JTTA 1LDSA 3VSVA 3TM6A 1ROWA 1EIBA 4S1SH 2R2EB 3UH8A 1S7SB 5JIPA 5IK3B 1X7TA 4AJVA 4B50A 1C1EH 5EZLB 1NMCC 3WEMA 4XVJH 1IAIL 1U8NA 2UXVA 4XVSH 3SGDH 1X5LA 2CG9X 1AZVA 4H8UA 4BA8A 3IJEB 4OZIB 1YEGH 3NK3A 3RVWC 2Q87A 5HVHB 1A4CA 2VL5B 2OQJB 3I3EA 2QPFA 1ILSA 4HX1B 4AQ1C 3PP3K 4ZPTB 3FULA 5L9DL 4M1CC 1SNRA 2TRYA 2D3VA 3TBYB 5ESVB 3KYMB 3RDTC 1IL1A 2EDYA 1S6NA 4PREA 4OF0A 4V1DB 4EOWH 1E27A 3A21A 3HAEA 3CC5A 4R26H 1MREH 4QY8B 4BEIA 2JF1A 2VH5H 4GG8A 1HYSC 1AGBB 5DD1H 2BNQD 3T3ME 2ZCLL 1AS6A 4AIZA 3H4FA 4MXVF 5KN5A 1U3HC 3VFTB 2QQNH 4OM0H 3NZSA 4OIBA 3C60D 4PY7A 4MZ2A 2GAZA 3OKNB 3ARDD 4U7MA 3JWOH 1CXIA 3O8XD 1F6FB 5I1GL 3D3VB 4U3XA 2BSRB 1XD0A 2X6CA 2AGJH 4C56B 4Z7UB 1W0WB 4I9WE 3NZHL 5DVNA 3F7LA 1MZYA 1I82A 1UJ3B 2E0PA 3DPBB 5H37G 5LXGL 2QPUA 2WZ5A 3WSQH 1G6RH 5D1QA 3FQWA 4PJDF 3NG5A 3UIYA 1QZ1A 3X2QB 3ZT7A 4CADA 4FTVB 1GOFA 1RIUH 3H7BA 4GUPA 1NGWA 4QRFA 4W9KC 3OAUL 3RNKB 3ULSB 3CFQA 3M8OH 3LKRB 4LPCA 5F97E 2PPFA 3DROB 1ED3A 5ACZB 3B34A 3L3HA 2CO7A 2JLLA 1OGAA 4IDJH 3WHXA 5TE4L 1U8LB 1FSKC 4P9HL 1D5XB 4MDIA 4KK9C 4JFOA 1TVHA 3JV0A 3Q3GB 4J8RA 4WFFE 1GY1A 4M43H 4XBEL 3SHSA 3VI3E 1SF3A 1B6DA 1S9XA 1Y1DA 1YQ2A 3ISYA 1OP9A 1P2CA 1VFUA 1WCBB 2VZVA 3DJ9A 4G80B 3K8MA 1JRHH 4WTWA 3RDJA 4B3VA 4GI8A 2ROYA 1KFGA 4YZFF 4AT6A 4LLVB 5BQ7A 3MRCA 4FLQA 4Y2LA 5D7SH 2OJZL 2K6YA 4CVXA 1WIPA 2J6EL 2PN5A 2DL2A 4I4WA 4PJ5A 3WV0A 4GRWE 32C2A 3B9DA 1UADC 1BBJA 1UB6B 4PJFF 1M56B 5AEAA 5HYSB 1PY4A 5DSCA 5T5FH 3BZFA 4GEJA 3WJJC 3AAZA 4RGMC 1MFNA 4GG6E 3F00A 1WVZA 2E59A 3RKPA 5AKRA 3BPNB 1A1OA 4A7GA 4CRPA 5IVXB 2C4XA 3ZTNH 2EZ0C 4NQSB 4YSQA 1IGJB 2BNQB 1ONQA 3CBJB 3SDXF 5FO9A 1YPZE 4WQOA 1SMDA 2OCFD 1R3IH 4PP1D 3F7YB 3C60B 3Q01A 5G4OA 4DCQA 4AQOA 3INUL 3OMIB 2AJZA 1QI3A 3MLUH 3ARDB 3WENA 3QXVA 5KAQF 4QCIA 3HNTH 3FQ1A 3O8XB 3V0VA 3FCGA 1P6AB 3O0RH 1C5DA 5I2IB 5DK0B 1X4YA 4M8VA 4RLDA 1EAPA 2OMTB 5DURD 1TQWA 5FYKD 4Q89A 3TT3H 2LLNA 3EIFA 4EXPX 4UV4H 4F3FB 4F7EA 1M9WA 1HL8A 4G7VL 1QG3A 2BCKA 1O7VA 2WOBA 5K9OA 4LL4A 2XTJD 4PJGE 1PIFA 1U8PA 4KY2A 1I8MA 3VFWA 1CLZH 3GZKA 1FA4A 4AGQA 1SYVA 3D0LA 3DDFA 5FA4B 2N4IA 2QHRL 4DQAA 2YEZB 3O3DB 3EJQA 1DQIA 1X9QA 4IGBC 5J5EA 2DM2A 3QP3A 4WNQA 3BIKB 1CDYA 4HEPG 2EO9A 4MS8D 4QGYA 1OSZA 1LJMA 4ANXA 1N26A 3WFDL 5AAMC 2BNUA 1RMFL 4XN4A 3AITA 4N8PA 1UFGA 4TOYH 1SXCA 3D9AH 3H0TB 1I3GH 5JW3L 1EHAA 4MJIA 2X4UA 3EH2A 5IB5B 5EBMA 1R9FA 4YPGB 4JPVL 1HL4A 1XIWD 4AI7A 4RWYL 3NP3A 3L1OL 2WJ7A 5K9KA 1M7UA 3ESPA 4AGPA 3PGCA 4UQIM 5T1KA 2WBJA 2A4EA 2CE6A 3KL3A 4H20H 4HC1L 5E9DA 1JVOA 2C9QA 5I74C 5TDNA 4S1QH 1C9SA 3B2XA 5AWNH 3WNIA 1UOWA 5DUBA 3DGGA 3A22A 1WS8A 3DV6A 3RVTD 1E9PB 2IAMA 5MEQA 3MOBL 1CJYA 4WV1A 5E4IA 4HPHA 4H88L 2GEEA 5HBBA 4L3FA 5H4ZA 3FRUA 2J21A 4OM1H 4V2BA 3RI5K 5FB8B 1ZTMA 5F89B 4GRLC 5D7IA 1LEIB 4GFTB 1CGUA 2FCBA 3HIZA 3W5MA 3DJSA 2P46B 2WNGA 4OAWB 4G5ZH 1PNCA 2HP4A 2VRAA 2WLLA 4TN9A 5F9WC 1XVSA 4L9LB 1T0PB 5EZOH 5E00A 1QLRA 3M7FB 3DGCR 5E1AA 4A7UA 5KS9A 3QAZB 1CGWA 2NXZC 3WFHB 1BG9A 2IPUK 3STBA 5KYWA 4FADA 2UY7A 2DIJA 2F5AH 2YPLD 1BPLB 5DURB 4CUCA 3PJNA 2A6KB 2V2XA 5GXBB 1Z9NA 3DTXA 3QULA 4G7QB 1QYGH 1VFBA 3L48A 1UZ8A 5EC2B 4CC0A 4DTGL 3L17A 2FATH 3W2DH 4QXWA 4U6TA 2ZPKH 3FCBA 2ZYIA 3NDYE 4G9DA 3LDBB 5GGSY 3PWUA 1BMZA 4ETQA 3U2JA 1UA3A 1INQA 1AG6A 3ECBA 3S34H 2XKSA 3ECWA 1ECYA 4KH2A 2J1WA 4Y9BA 2CUHA 4NZRL 3S5ZA 2A9ML 2R0WL 3MR9A 1E4KA 2X1WL 5K5YA 5KYUA 1JZ8A 4FULA 4LSQH 3DOSA 2ARJB 4MAUH 5EU5A 1CBJA 3SYQA 1JMZA 4XPFL 3BSGA 3QJXA 4XH2B 4BKSC 2ZCHH 1EJFA 3UTSD 1TZIA 2BSDA 3WIHL 4YPJA 1WZAA 2GSGB 3Q6GL 4TUOA 1QR1A 5B22A 1G6VK 2MPVA 3GIZL 4AH2A 1FDLH 3O2DA 4DW2H 4LT7A 1QD0A 5CFAA 1RK7A 1SBSH 4AEIH 3VQLA 1XIWB 5IBTH 1IUZA 5C3IA 1CZ8L 2YK1L 4X8XA 5B3NA 5G55A 3K81A 3BDYH 4UT6L 1XT5A 3D50A 3NN8B 3TCXA 2DWTA 1RK0B 2BVEA 2ICWA 4JK0D 2KZKA 4QOKD 1NEZA 1B0WA 3FUNA 3T0AA 3WCYA 1K72A 4MKTA 1W72L 3P2BA 3HAEG 1NICA 4PVLA 2FZ3A 3ZBMA 4HFWA 5DJ2B 3JV6A 1U95A 3MRHA 5KYXB 1AXIB 5SX5K 1M42A 4Y4KD 1JI1A 4LF3B 4ENED 4Q0XH 2YSSA 2HA1A 5I5IA 3HE7D 4XCCL 4WWNA 3SPIA 1S7XA 1CE1L 2YMXL 3N41B 4OIAA 5DJ8A 5FLUA 2G2RB 1S9YA 2APTA 1K9TA 5IB4B 3WFCH 1E65A 3MRLB 5DD5L 2J4WL 2Z93A 4DETA 3PWVA 3TXAA 4LCUB 4B27A 2WAQA 1O7DE 2YD0A 2ZOWA 3SPJA 1JFHA 3K1DA 3UBFA 2YPLB 1UXSB 3ULUL 1Y18A 2JJTA 5AG8A 1KIUB 1YECL 3KMDA 3LJ3A 4HV8B 5ERWB 3MA9L 4L8SC 2WSDA 1BD2E 2HX9A 1LWRA 2OMXB 2VXSL 3GBLA 4G7SB 2ZD0A 1EHKB 3NSDA 4NQUA 1XGRA 3SE6A 2V17L 4OV6F 1WA1X 5D7JA 1JVLA 2NY3D 4YBLB 1NC4D 1H0DA 1KXTB 4L3EA 5FYLL 4XODA 3BGAA 1QI4A 1W91A 1JGIA 4JEGB 1TQCC 4NKDA 4IMKA 1FJ1B 2KMWA 2BRRH 2LE9A 4ZW7A 3EXLA 4P5TA 1MFDL 4UT7L 1S3RA 2DZEA 3PU7A 3NDZE 4AYGA 1CYXA 2WQUA 4YIQB 5E94B 1U8MB 1HS6A 4YFDB 2XV0A 2ZOOA 1ACYH 3CHXA 5J4MA 5HDBF 1TU2B 4HCRA 2Y1YA 4GKNA 2H0PA 2VTFA 1RHHB 2K78A 4YE4H 1SVBA 3QEHB 4CSZA 3MCYA 4KXDA 3KLKA 3P3UA 1FH5H 2AEQL 2VDLL 3AQXA 4XXCC 3DMMC 5IB2A 3LMJL 3RWEB 4QOKB 4HKJB 1LEGA 1TDQA 2BZ7A 4WKZA 3UC0H 3CU1A 3GJFH 2EIMB 5E23A 5KBMA 3MLSL 3MA7A 3PWLA 1NCHA 1I8LC 3HUJF 3WEAA 4Y4KB 1X9RA 5F71A 1IC5H 1M7IB 4YDJA 3F8UB 1N5AB 4KAQL 4KJQD 3AG3B 3HE7B 1F86A 1FUNA 2EH8L 3MXWH 3RIKA 5AB9A 3KDMB 1INDL 5F3BA 4IKNA 4I18C 3UPRA 5CBAA 3OKEA 3LN4A 3TEWA 4LMQI 1T03H 3WMPA 3ZW3A 4X7DC 2F53E 5I1IH 2AW2A 4KK6C 4G11A 2EDMA 3KM2A 3O3AB 5IMKA 5IT2L 4DF9A 2BIPA 3V6FB 5FF6A 2UXFA 4OFIA 4PJAB 1KB5L 4AEHL 2WW8A 2B2XH 3J2PA 4RFNC 1HE7A 1FNLA 2HJFB 5ITBL 4M7JL 5CR8A 1SJVA 4KKLC 1RK1A 1JWMB 1JNJA 1NSNH 4MYPA 3RL1A 4PB0H 4PRIE 2DQUL 4AUYA 4A2DA 5FO7A 3ABKB 1BM7A 1U8CA 3EZ8A 1T1WB 2NY3B 5GS0D 1NC4B 4JDEB 3TNMA 4DGUA 5D1QD 2JKWA 3L4TA 4PI0A 4YHKL 2MHAB 4JJ5B 4JN1L 3MO1B 2VLJE 3BPCA 3X14B 2IQ9H 2Y7QB 3ARFA 1QSZA 4QHUA 2DLEA 3TASA 4N2OA 2YBRB 2YRBA 3WJMA 4FA7B 3HG1E 2WWMD 2FL5A 1TENA 3A0OA 5C0RH 3LZRA 4GP4B 4YDKL 3V9CA 5FFLA 4XCYB 1OGAD 3KPLB 4H26B 5LWYH 3QH3A 1NWOA 3VRIA 2P5WA 1RJLA 3OJDA 3SE3A 3QXTA 4GXVL 1BVOA 3HZMA 1JGEA 4FOMA 3HA0A 2OKMA 3QQ3B 2Z3FA 4JO1H 1BZ7A 4S1DC 3S37L 4OCWH 5I6KA 2X0WA 2HRPH 4KKCD 4Y2DC 1BJ8A 2PO6D 4YLCA 1UXLA 1U8NB 2KBGA 4RSYA 3KS0H 4HUWA 4X9BA 3UTTA 4M3JA 1BFOA 5BOZG 1KN2L 5AYUL 1V7NL 2CQVA 3PIQA 1XGQA 4DP8X 1PFCA 3A47A 4POZD 4PJ5D 3GXTA 3V0AC 4ADJA 1OAQH 4LLUB 1EDQA 4ZMWA 4JCMA 5CCKH 4LCWE 1IL1B 4JUSA 2HTLD 2NQDA 2VUKA 1E40A 4LDLB 4DP4X 3W5NA 1UATA 1N18A 1Z6JT 4CA4A 3FU5A 2FEDD 4QO1A 4AIZB 5KN5B 4B9PA 1DL7L 4P49A 3SY6A 3VX1A 1C5BH 2PCPA 1Z0NA 1MCPH 1SM3L 3ORJA 4PY7B 3RWDA 2GAZB 4NLAA 3IWUA 4B9IA 4M9OA 2DI9A 1BMWA 5FFGA 1RIVH 3QEGH 1HEJC 1G0DA 3EH5B 4JL2A 1GPOH 1M9SA 3B9KC 3GSNL 1BYOA 1HU8A 1JGUL 4LKXA 5HHXH 2Z35A 3PV7A 3IAQA 3Q8CA 4OD3L 5EB9A 5HGHA 4NQQA 3TCTA 1MJUL 2NOYA 4GKZA 4ECNA 3VD5A 3N06B 2Z7UA 3T8XA 3UTPE 3LRSA 1KTCA 3DX4A 3LQAL 2OAAA 2BCMA 5D1QB 1V27A 2PPCA 1O7SA 4QRTA 4CADB 4ONFL 3V4VH 1EERB 4GUPB 3VG9C 4PWKA 1I1FA 4L8BA 4QT5A 2DEWX 3JWNG 4ZO7A 2X0UA 1LEKB 2AQSA 4WEMB 3QHFH 3ELAT 1G7HA 1ED3B 1MH5B 4LZKA 5CN1A 5C0ND 2NYZA 3LVEA 2E7HA 3L3HB 4MBRA 1Q0YH 4TSBH 2CO7B 5C8JA 1B0RB 1OGAB 3MRBA 2DWDA 4RBPH 3WHXB 5LGYA 1UD5A 4PVMA 1OD7A 3X3GL 3B5GA 4M48L 1YQVH 4X7SL 4NZTH 4QHNA 2ZUSA 3P9WB 2X6MA 3GD1C 4MDIB 1R4XA 4F7PB 4MJID 2AK1H 1NEZG 1MG2C 4J8RB 1PVHA 2CKBA 5DMIH 1IBGL 1JNNL 1S9XB 1NCBL 2C4FT 3ZIMA 4BK4A 5KSBF 1FL5A 1I9JH 4D9RD 2PO6B 1O75A 3SCMA 2AEPH 4EDWL 2IQAA 5T1KD 1F11A 5BQ7B 4LAJH 3T0EE 3T65B 3JTSA 4CVXB 4LOVA 4N28A 5E9DD 3J07A 4TSAH 4HWEL 4PJ5B 5ISZA 3PE9A 4NN5B 3EHBC 2DTML 4KXZI 4U0QB 3K72A 3KLAA 2IAMD 3V4PH 5DSCB 4V2CB 4J3VA 2BERA 3Q8EA 5GGQL 5I6XC 3AT0A 3ENEA 2C1PA 1EZSA 1VRSA 4JHZA 3LV3A 4M7LT 1J12A 1ONQB 1JV5A 4Z0XA 2FJHA 1JZDC 5EIVA 5GS2H 4PGCB 4ANUA 1FZJB 2AJZB 4MCZB 3TJHD 4QCIB 3ZQWA 3V0VB 3VFGL 1DBKH 2NZ9D 1GGUA 4ZUUA 4YVUA 3T6ZA 4TVPL 3ZKXC 4J3BA 1CK0L 3D6GA 3KAAA 4FG4A 4PGEA 2LTQC 4A55A 1YYCA 1CICA 4HIIA 4F7EB 3KYAA 2BCKB 4Q9RL 3DURB 4YGVA 4WUUE 1K2DA 3KPSD 5FHAH 5DJYA 4YSOA 3AS1A 3BN9D 3DSFL 4Z7VA 3VFWB 1H9DA 3IJ8A 1A65A 1P4BH 1SOXA 1MJJA 1SYVB 1YC7A 2HFEA 4Q9QL 5TDPB 4NZUH 3ZL1A 4RDQG 1RJCA 3AS0A 1KBGL 3DBXA 3Q05A 3VQMA 4ZFFA 1BQLH 1G94A 5EF2A 2A9NL 3HLAB 3VO0A 3MQIA 4BSJA 2VLKD 4UTBH 1E4WH 1QATA 2EEXA 4RDQF 3AXHA 3H53A 4L1BA 1A6VL 1F6LL 1WV7T 4GXFA 3WFZA 1N6QL 3GK8L 3P73A 1KYDA 1ID5I 3V4UH 2X4UB 3FU8A 4K23L 2B1HH 2F8IA 3O3BA 4W9ZA 5EBMB 5KBNC 3K71B 1PX4A 5D9SB 1UWGL 4JRFA 2XN9E 5DRNB 4LP8A 2MNWA 3Q2WA 3V4LA 1RUAH 4ZMLA 5K9KB 4Z78B 3PGCB 5T1KB 4A6YL 2HN7A 4HG4J 3DO4A 4XMZA 1TQSA 1I9RH 5C3LD 5LAXA 4JJOA 5E9DB 3IFPB 5TDNB 1MAMH 3C12A 4OB5H 4OZHA 1XMEB 5TPWL 5DUBB 2H2SC 3TZVA 3DV6B 3NJLA 2ZF9A 2COVD 2IAMB 3L3OA 1CLCA 4WV1B 4Q56A 4XWGL 5LKNA 1J0ZA 1MEXL 2WUBH 3FRUB 3HZVA 3MROA 3VAEA 1JG9A 4OLVL 3P11H 5EOCJ 2FBOJ 1L9MA 3QC5X 5D7IB 1XSJA 3BVWA 3VGEA 2EXWD 4FQLL 1F4HA 1OAJA 2MQGA 3DBSA 1V3JA 3JUZA 3RYMA 2BNRB 2WLLB 4WO4B 1PGRB 2IPTL 6TAAA 4ZPVA 2JB6A 3UCRA 1IC4H 1QLRB 5E00B 1N9PA 3DTUB 3IMBA 1LE5A 2OZ4H 5KS9B 5GRVK 4FHKA 2D2OA 1IU1A 2OMUB 2V9QA 2VR6A 2R56L 2VDMH 2X2UA 4JPIA 2BXZA 2UY7B 4U6VH 1MG3C 4DKAA 5E51A 1HL5A 2XSKA 2BK8A 3US1A 2HG5A 3FYEB 3WS6A 3DTXB 5CGYC 2NW3B 3GBNH 4XNZB 2ENQA 1VFBB 2XKNA 4Z7QF 3UBXI 3RU8H 3KPSB 4PJ9A 1QSEE 1DVFD 1I1YA 3CFUA 1M6OA 3BPLB 3UACA 1RZKL 4G9DB 4F8PA 1IC7H 1VADA 1ZT1A 2OPCA 1J1XL 4UQCA 1CGSH 2XFGB 4GIAA 1INQB 5I16B 2AJSH 1NIEA 3ZE2E 1JHTA 1CS6A 2ADIB 1R5IB 3OD3A 4KOCA 3MR9B 1TZHA 5E99L 2O4EA 3VCLA 4DERA 1CDBA 2VLKB 3DOSB 5EU5B 3DOIA 4YXLH 2F74B 1BM3L 4Z7NF 1O7DC 4U6XB 1TZIB 4JFWA 3TYFB 2W59A 4P5TD 1JXGA 4X7TA 2QSQA 1YLBB 3IDNB 3NVQA 3S8FB 1QR1B 4FYSA 2YAOA 4AH2B 5SWSA 1IB5A 3CPUA 4UZUA 2J7LA 3FTXA 1RSYA 1LXMA 1FNSL 3KLHC 4BJLA 1HNYA 2B08A 2J1XA 2W1NA 1K6QH 2IH3A 3C2SA 3GNMH 4DOHB 4P2YA 3GDBA 4W6XB 2ZG2A 3CDCA 4X6BB 3QXUA 1EMTL 3I9GH 5IMOA 5JHLA 1U93A 4JG0L 5MP6H 2WVTA 4FFYH 1T4KA 2A77H 3EJYC 4ZS7H 3P0YL 4XNMA 4WI5A 1A7NL 1U95B 3K3QA 1MI5A 4GRMA 5F7AA 1Y6MR 2CXKA 3IU3A 2ORBH 3FO0H 1XF3B 3JTBA 2TAAA 2NNRA 3KE0A 1S7XB 1VSCA 5DJ8B 3SDCC 1DQLL 1EO8H 5B1KA 4G72B 2Z93B 2Q7YA 2PCFA 1DJXA 2YRPA 5J8OA 2AAAA 3U79A 5C7XL 5E9AA 4LLYB 2BWQA 4ZSOE 4ICXA 5G4NA 3CG8A 4Z7WE 4KDTC 1Y18B 1RKRA 4FXLA 3EYUL 2R8SL 2IG2L 4UILL 3H3BC 4DN4H 1ZCRA 1DVFB 3LRHA 4AX3A 5A2LH 5LBSH 4YHYC 3FT9A 4YQXH 5DS1A 3T4AC 1MAKA 1F4XH 5ALBH 5FUOH 1U3YA 4I89A 2E6PA 4LRNH 3MLYL 1ACXA 2XWRA 3L4XA 1AIFA 4QXGH 4XPTH 3B7RL 5DEGB 1H0DB 3UG5A 1IO4C 3GBML 1GOGA 4OZIE 4B9KC 1B6UA 1D7CA 4PCKA 5K1VA 1MW2A 1E2VA 1PD0A 4RIRA 2VZOA 4NKDB 1TZGL 1AC6A 3ARFD 4M8QB 2VB5A 4P5TB 1I1RA 5EZJB 2X4SA 4XO9A 4HJ1A 5FOJA 4H8WL 4MB4A 2YHGA 4V1DE 4G2AA 4HOWA 2YOAA 3HG5A 3QVAA 2AAVA 3FSWA 3E8UL 4XNUH 4ATTA 2N0MA 2WQXA 3IXAA 4GKNB 2P5WD 4EO5A 1D5ZA 3EOTH 1ZE3H 1YRKA 1CFVH 2OJ1A 2QSCL 4Z3HA 2CO6A 1DJHA 3VWJC 4JO4L 2IDSA 5IB2B 4G8GE 2J8HA 1GSMA 1ZHBA 4W9FC 1F41A 1LEGB 4L2LA 1NCNA 4ETYA 1INEH 1NM4A 4OZFA 4WKZB 3M1CA 1FN4A 2LT9A 1JD9A 3UTTD 5EBLA 4OY9A 3CFMA 4XMTA 5GPRA 2HRLA 3MA7B 3PWLB 5B7FA 4C56E 2KPNA 4Z7UE 2VW6A 2YUXA 2HH0H 3AB0C 4XN7A 4NGHH 3NJVA 2FHCA 3ASWA 4YDJB 2CMRH 1S7VB 4FP8L 4HCFA 1BAFH 3QJFA 4ODVH 1OGTA 5I9QC 1Y7VA 4B41A 3BAKA 1ZHLA 1QEXA 2EE0A 3GMPA 5F3BB 3BKCH 4FL4C 3UPRB 4BFEA 2GG1A 1PLGH 2DEXX 1FAKT 1HWWA 3OKEB 3KBPA 4CSPA 2EC8A 3CVIL 1P1ZB 3N42B 3FQRA 5JIHA 4LPXA 3CX5J 4DPCX 1H3PL 5IMKB 5FF6B 2ZCKL 1U8OB 4K7PL 2CDFB 5ESAA 4RETB 3GLEA 5HD8D 2X88A 5JNYB 1T1YA 1HOCA 3FYIB 4IQHA 3VFNA 4WHYG 3RL1B 1UM5L 1T2XA 5FLVA 3HI5L 5FO7B 1EEYA 1U8CB 5FO2A 3RWIA 4QKXB 1CL7I 2OFQA 2ZUQB 1CLOH 3O2VL 3D0VB 3X3FL 2OK0L 4Y5YA 5SWQB 3GLZA 4YC2B 2J56A 1WFIA 5DDHA 5EUOB 2XXCB 3ULVH 4Z3FA 2BVTA 4OQTA 1TTRA 4JPWH 2Q9OA 3NIGB 5AENA 3VFRA 5KYYA 5IHWA 4N86A 3BPCB 3ARFB 5CUSL 3B9VA 3L45A 4JQXC 1RZ7L 3MUJA 1PZCA 2A9BA 2EC9T 2P80A 4MA8L 2FL5B 4PJIF 1VPOH 5J12C 3U4BL 3LEXA 1P5VA 3ULVF 4YHZL 2XWTA 3VD4A 2FJFA 4FLRA 2W38A 4OKVB 1NQBA 2ZX7A 1O9VA 3QHZL 4WWKC 4ELMF 1A1NA 3QH3B 4QWWC 5IVXE 1ZOXA 1RJLB 3HZMB 4OF8A 1JGEB 1FHNA 1UD6A 1UWEH 4KKRA 1BZ7B 4LQFH 3EJSA 4B60A 5DLMH 1LL1A 3IRPX 2X4TA 1QFHA 3QUML 3SPGA 3QYMA 5JLZA 3QJSB 2MKWA 4HUWB 4MHHI 5TE6H 3UTTB 4JKPH 3E8VA 2A4ZA 2QKIA 1U2CA 1D9KD 2CK2A 3NJGA 3PIQB 1XGQB 3C8KA 3Q1SL 5CS7A 3F12B 1T7YA 3NACL 5B39A 2FH8A 5ISZD 3D39D 4P2OA 3HZ3A 5DI8A 2O30A 4B6ZA 1A7PH 1JZHA 4FXKB 3PQYA 2BMKA 4KMTL 4L0PB 3THML 4NQVA 2P48B 4UDUA 4KKNA 4WAFA 1ADWA 2ICEC 2XFXA 4BZ2A 3KZ8A 5KSUA 2XDHA 3B4NA 1E30A 2CGRH 4KKPA 4QO1B 5MEPA 1K5WA 4KJWC 2P5PA 4XP5L 4F2MA 3MLTB 4PEEA 2ZAHA 4Q8BA 4HZLA 1B2WL 2EE9A 3CVBA 3PHQA 4JDTH 1XGUA 2VR9A 1PG7W 4QPEA 5EO9A 3RWDB 4OLWH 4KX9A 5I30L 3VA6A 5CKAA 5I1CH 3MBXL 3VM7A 1ORSA 4LKXB 5FGSA 2XU9A 4LL1A 1NTDA 2PYEA 3SKNB 3RTQC 3I85A 4EZMA 1CICD 3ZE0F 2PWFA 2UVEA 4GKZB 2WZ0A 4LLAA 4UTAL 5CJXC 4XHJD 2HFTA 5D6CA 3I9AA 3T8XB 4XP1H 3LRSB 3NEXA 1PZ5B 4CBPA 3NJFA 4Y16A 2ZUUA 4N90D 3VTTA 5B7MA 2E4FA 4AENA 4QRTB 1NDTA 1O9WA 2GTQA 3KL0A 4L8BB 3O4OB 2AV1B 2HLFC 4MD4A 5GS1C 5CR1A 5FXCH 3GWJA 1FE8H 3LYRA 2B3IA 4EI5C 1KC5L 5JPMB 1HWGB 5E24E 1F1DA 4RZKA 5C8JB 3RGVA 3MRBB 1HWHB 5FM5O 1YY8A 2NY4D 4WW2C 1CDIA 5C0BA 2V2TB 1BQ5A 3MLRH 4I87A 3RA7H 3T1FA 3SKJH 1S9WB 4F57L 1UM4H 2R4RL 1QQDA 1ADQH 1WZMA 2GUYA 1YUHA 4DUXA 1BCIA 4OLEA 1K3IA 3FCTB 2K7QA 4RA0C 1T7XA 3FN0H 2H6OA 1MELA 4CGUB 4XMKL 1FL5B 1OP5K 4FNRA 4H0IA 4XXWC 4KJPD 5FYKE 2BIIA 1N7MH 2IQAB 1F11B 4CVUA 4GMSH 3BDXA 1GTFA 1IGFH 3EUUA 1D9KB 1CF8L 3JTSB 2B1AH 3ALPA 2VDNH 4EF3A 2XTJE 1MHHB 5ISZB 3IJYA 4HS6A 4NC2B 1ZPUA 2WY3B 3D39B 5ID0A 3KGSA 5CD3A 2ZKHH 3K72B 2J20A 3TZVD 3ARBC 1ZK5A 3ETTA 3QYNA 2Z31A 4MAYA 4M93B 5D8JH 4TYUA 2WANA 4R3SA 4IOSD 2C1PB 4LSSH 4JFDA 3FQTA 1N19A 4NBZB 3MJ9L 4X8CA 3LNDA 4MTMA 4UOW0 2VQUA 1KUMA 3LHPH 3LV3B 4KO7A 4MXQC 3B2VL 1JV5B 3KWWA 1JPGA 4Z0XB 4M7LL 4BFFA 1BZOA 2EDLA 2FJHB 3CTTA 2B0SH 1U58B 4NJ9L 3B2UC 1X3DA 4ABUA 3IDIB 1YNKL 4B97A 4FLHA 3QCUH 3S88H 3EG9A 2H3KA 1P4UA 2CPUA 1L9SA 2YGOA 3CQQA 3HRZC 2LVEA 4L5FL 4ZUUB 1IFHL 3C09B 3L3JA 1CL7L 1UT9A 2DH3A 4PGEB 1U8IA 1CICB 1WZ1L 4HIIB 3GKWH 4FX5A 4XMWA 4YGVB 2G2PA 1C7SA 4PJ9D 1MCCA 3MVSA 2CCVA 2Y1VA 4P3CL 5E6IA 4F7CA 2ZSWA 2CPCA 1ZE3C 3FH7A 4PJEF 3IKCB 3U6XA 1K85A 2HFEB 4K5NA 5GRVL 1NCIA 2NR6D 3GEFA 2I5YL 3DBXB 4ZFFB 2R1WB 5JYLA 1Q1PA 1X5ZA 4K4KA 1J0HA 4BUQA 4WF7A 1HQRA 4ZZFA 2NY4B 4MDJA 1TJIH 3N0AA 3QCVL 5MI0B 3MYJA 5DK2A 3VA2C 3QDAA 1KT2A 3P73B 1S3KL 5B21A 3WTYA 4LAQH 3O3BB 3HFML 5SWSD 4Z18A 2B39A 2WHVA 4OZFG 2O1AA 4PLJD 1CYGA 3OHXC 1YEEL 5HHVH 3PPEA 1OTUD 1C12A 4U7SA 5DUPH 2YPLE 1WFOA 3FUJA 2HN7B 4N2EA 2BVQA 4NZ8A 1LHZA 4TPRL 3S3BB 1GJWA 1UYWH 4OZHB 3KXFA 5FCUH 2YZ1A 5F8RC 5T3ZD 1YMMA 4JE0A 3TZVB 5E5LA 4QRRA 5C0RL 1Y6KR 4JZNB 3SGDI 4KNQA 3BGFB 4HS3A 2RFXA 1I7RA 1USQA 3HZVB 3MROB 3PV6A 1A6WH 3SE9L 4QAMB 1DLHA 3CVCA 1ZEAL 1OAYH 5GGRB 1KPVB 3FSZA 3N3EA 2D7QA 4IRJA 4PVBA 2OX5B 3TN0A 2Q20A 3LB6D 3EFDH 4WDIA 4N0CC 4ZPVB 4UYPA 3GTTA 3UTSE 4H40A 3ULVC 3SBRA 1KIRB 1ET8A 1QWHA 4JPIB 5TFSL 5EBWA 1GY2A 4AIEA 4XC3H 3QUZA 2HG5B 3A67H 2WXQA 1WFUA 2XKNB 1WWWX 2IV8A 4LEOA 5B8CC 4PJ9B 1P7KB 4PJ6A 4WGKA 1XL4A 2YWZA 1M6OB 3IDYC 2BX5A 1FFTB 5F9JA 3WNOA 1KWGA 2DQIH 4QOKE 2B59B 1T0OA 1F02I 3CJJA 3R06A 1IBZA 3D4CA 4S0HA 4X4XA 1GGIL 1XHHA 4PM1A 1TZHB 2LABA 3IJ7A 4FXTA 4MZRA 2D0GA 3VCLB 1SPDA 4TL4A 4FCAA 4AQ8C 3LRKA 3FBQA 2AF2A 2WYTA 4LIQE 5H2BB 3ISRA 5BV7L 4GP5B 2YPVA 2KLRA 3NJJA 4H8PA 4MJ5A 4YN3A 5HDQH 5T1LA 3VFPA 5IMLB 1AR1D 2XRAL 1N2RB 1J5HA 4X7TB 1UACL 3IMVA 3FTZA 5DD6A 2QV4A 4IBTA 3QORA 2E6QA 3PABA 5SWSB 2ZXCA 4AMXA 1BFSA 1KXQE 3ARYA 1AC0A 4LHJB 3GBDA 1IGIL 1LE9A 4ZFZA 1KJ2L 5ADPL 5GZNC 3AMLA 1FF5A 1R24A 4HIJA 2JELH 1HXMA 5B39G 2IH3B 3UPCA 1SLVA 4TQEH 2OMBA 4A2GA 2X4RA 2DYSB 2HVKA 1JFQL 4MXWH 4HGWA 2OW7A 1DFBL 3TBSB 1IGMH 4L1HA 2G5BA 5IMOB 2NY6D 4PJAE 3UDWA 2LAAA 4LBAA 1LO0H 4OZ4B 3U0WL 1T4KB 1HVXA 2WWOA 1JRHI 5HVHC 3FPYA 3AREA 2D0HA 4D9LL 1WC7A 4GRMB 1DVQA 3H2WA 3IU3B 4MQXC 5BO1H 5HVGB 1MDTA 4D0BA 2NZ1A 3NFPA 3MRRA 3NGBB 1HKLH 1T6WA 1D2PA 3MODH 4CKQA 2CBMA 1SHWA 4ANWA 1IRAY 4FERA 4OLZH 3IF1B 2IDCA 1ETZB 1MFCH 3IXTA 1BHGA 2Q7YB 3P69A 4Y5XB 3FF7A 3FU3A 1J11A 4JFFD 4AMKH 2F19L 4LLDA 3TIDA 3QXWA 5JHMA 1AFVH 3N1FC 1RZ8B 3ZMEA 3W9DA 4CMMA 4MD0A 4NCDA 5C08A 4X7EC 1I9IL 3NA9H 1WISA 4LSTH 1WTGT 5HHMD 2XWEA 2FJUB 1BZ9B 3JZYA 3CAFA 2FWSA 5GS3A 4ZO8A 1KTDB 1UJ3C 5G4MA 3LAFA 3G7TA 3QQ4A 1OCZB 1ZMYA 4QRAA 1WK0A 4AIXA 4A2LA 1UWYA 1OF2A 1AIFB 4E2OA 1JL8A 4LVEA 3A6CL 5INCA 5JUEL 3OKOA 1KXVA 4ONHA 1WFTA 3OG4B 5B1CA 1LNUA 1DCEA 1HEHC 1FYHB 2DIBA 1G1KA 2JXMA 1ZGLM 3QIUA 2WLIA 4OUUA 4RIRB 4F20A 5D7LA 1AR1B 1OTTC 2XVLA 2X4SB 5D7EA 5LBVA 2Y5TA 4BXSV 2H6UA 3RIAF 5E7BA 1LWHA 1MCQA 3VXQA 3BP5A 3OLDA 5T3XD 3IXAB 3WIIH 2HCZX 5E1QA 1D5ZB 1C1EL 1NBYA 4MMXB 1PD6A 2FO4A 1QTSA 1AVAA 4TUUA 1ZLEA 5CBEA 2CO6B 5JMOC 1J8HD 1BBDH 3ARUA 2YUVA 3PDOA 4X9YA 3WXVH 4XVSL 1TPXB 4F7TA 2H3NA 4NS0A 4ERSH 2VXVH 3TIEA 1YEGL 2EDBA 2NY6B 3H55A 4GW4A 5AYQA 2F8VA 2H3XC 5DD3H 1FN4B 2WK2A 4KTEH 5EBLB 3S5LB 4JPSA 1CWVA 5I0XA 3EYQD 4N68A 3F7VB 1SVCP 1BZEA 4EOWL 3MBWA 1L7IH 4KVCH 5E5RB 4R26L 3ZDXE 2DQCH 3IMRA 5D1QE 3BPNC 5D4JA 5DD1L 1ZHLB 2BVOA 3GMPB 4OI8A 2W0LA 2EDHA 4NOFA 3SO3B 2ED7A 4OM0L 2JK5A 2JTDA 4N0UA 4X6CA 4EEEA 3C60C 4JFFB 4J3SA 4R4FH 4CC4A 2ZNWA 3JWOL 1MZZA 3ARDC 4KKBD 4ADGA 2LLGA 3O8XC 5ALCH 5DLLA 1OGAE 3S96A 2Y06H 4U6YA 4PJHB 2IH1A 2AGJL 3N04A 1NCUA 1E9QA 1SXZA 5HHMB 5ESAB 3B2DC 4CW1A 1T2QH 3L16A 1CDHA 1A0QH 4H1LA 1T1YB 3WSQL 4AC2A 1HOCB 1G6RL 2PYED 5CU9A 3VFNB 4HLJA 5JYMA 2VDQH 3KPOB 3MLVL 1EEYB 2BY3A 1LDPH 4ZAKD 5L2JB 2VXQA 4WUKH 3OGCA 4Y5YB 2QBWA 4YDMA 5DDHB 4I0KA 5C07D 5EC1B 3MREA 4Y16D 2EDNA 1KTLA 3VFRB 2BIMA 4PJ5E 3LPFA 3GIVA 5LB1A 3BW9A 4N2DA 1FYTA 4ESKA 4IDJL 3BZ4B 2CU9A 4RMQA 4M00A 1F42A 2GSMB 3LEXB 1P5VB 3GLAA 5TF1H 3RGVD 2FJFB 5CJ5A 5C0BD 1IKNA 1FRGH 1AY1H 4M43L 5LN8A 2JSFA 4JANA 2F2HA 2DTSA 2G5RA 3IPFA 1J8HB 1JRHL 4FNUA 4Y9EA 2YO3A 1JYWA 1CO1A 4IOFC 5D7SL 5EMYA 1LMKA 2D4FA 4JL1A 3CN0A 5D1ZD 3WIFB 4U1LB 4XWOD 3QRLA 1NAKH 1WD9A 4KQ4H 5T5FL 1B2YA 3K8LA 3N9GH 3ZDZF 4JRYA 3VU2A 1KGIA 3E80A 2KC0A 4QRQB 1ZIAA 4Y4FA 5F1IA 3S35X 1ZLSH 1PKQA 2VSCA 4DUVA 3U36A 2Z31D 3I02A 3ZTNL 3D2TA 4O00A 5HVWA 1HAUA 3BT0A 3HG0A 2BMKB 4ABWA 2VXTH 5AOKA 3B8YA 4PP1C 2XFXB 3MLXH 3B83A 4L9LC 5KSUB 1GYCA 5MEPB 4HBCH 1WF5A 3O0RL 4F2MB 3QAZC 3PHQB 1XGUB 2EDQA 1MOEA 5EO9B 4FAAB 1CCZA 2LU3A 4NAJA 1HH6B 3OV6A 5FM5M 1MCHA 1SJHA 4M02A 4H13C 1ORSB 2UZIH 4MJIE 4JKWA 4WHTA 3P40A 1FORH 4JREB 1SOQA 2FQFA 2PYEB 1CLZL 2ATKB 4OFDA 5CFHA 2X6VA 3LDBC 4D9RE 5KJ7E 3AY4C 4ZAKB 3V9EA 2Z8SA 4U3CA 4YMPA 1BG1A 1AZRA 3BQUA 5E6ID 5C07B 4N22A 4Y16B 4HLEA 3VXPB 2IBGA 4AENB 5E9DE 4A2FA 3TX4A 1NFDB 2P8PA 3LXAA 1E7VA 3BZ5A 1SXAA 5CEYA 3BUYB 2GEQA 4ZO9A 5C0IA 4MD4B 4MS8C 4IMLA 4A7QA 2QGBA 2CALA 3HS8A 4ZFOB 1I3GL 2J57A 3RGVB 5C0BB 5HGBA 1YY8B 5I82A 2ZTBA 3UMNA 3WFBH 5L8LB 5D7IE 4DKEH 5GS0H 5INDA 2O72A 2ZUWA 1G7PA 1QQDB 1U3ZA 2K1MA 4W9LC 1BQRA 1WHPA 1YUHB 1XIWC 4OQ1A 3ZKND 4PJCA 1FZMA 3T3PF 4XMXA 4R7DB 4IBZA 2G4GA 4GQZA 2H0EA 2X28A 1QNIA 5KS9E 4DP1X 4K2UH 5GGTL 3B7YA 4S1QL 1CFBA 2MNJB 4ZX5A 5D1ZB 1G7JA 3KHQA 5AWNL 4X5PA 1HHGB 2ZXGA 5EU7E 4BKTC 1NKGA 3RZCA 3RVTC 1GZHC 3CUPA 3IPBA 2VDOL 3IJYB 3KXFD 2H5UA 5ID0B 2V8MA 4OM1L 1MQKH 3WNMA 4XN1A 5CD3B 1UD8A 3PL6A 1A7QH 2J6EA 4QRRD 2Z31B 1GKEA 5CCGE 3CH8A 1T7VA 3GKZA 4JY6B 3EZJB 3S3SA 4JB9L 1URIA 4G5ZL 4R3SB 2LFEA 3IU4H 3FQTB 3U82B 4H25A 2YJQA 4PCTA 1S5HB 1YY9D 3G08A 2VLLA 4IRJD 4RAVB 4ZW6A 1JPGB 5TQ2H 3TN0D 1WBZA 5KVMC 2F5AL 3TJEH 4KRNA 1GGBH 3CHQA 3EG9B 1PLBA 3BJ91 3WELA 3LH9A 1QYGL 1FG9C 3BD5A 4WI3A 4P46A 4XAKD 4XZ4A 3L3JB 5AUMB 3JWNE 2NTFB 2DBLH 1UZ6E 3W2DL 3L81A 1Q9LA 3QUZD 2YD7A 4LKCA 5ITFA 3PGDA 5FYJD 2R2BA 4GIOA 1L0XA 5LHDA 4FMVA 3K4DA 2YN3A 2IWEA 3S34L 3SGKA 1SHXA 1SEBB 2WP3O 2B5IB 3ROLA 5E6IB 1D6VH 4DOHE 2ZSWB 4DZ8A 2WYHA 1Z9LA 2VGLM 4YBLC 2NSXA 4P2CG 3WNPA 3R18A 1T3FB 4LSQL 5E8DH 5T1DH 2DM7A 2WXKA 3BWSA 3MGOB 4MAUL 4L37B 4MAZA 5ECGA 2ZCHL 4F1ZA 4MD5A 4KI1A 4JBSA 2OSLA 3BP4B 4GXUN 1U33A 2ZX8A 1E67A 3DO3A 4RNRA 4G8FB 1VGEL 1HQRB 2JE8A 2XV3A 1FDLL 2CDGA 3C5JB 4X9IA 4MDJB 3OKDA 5T1LD 4DW2L 43CAB 1GIGH 1QWNA 5JHAA 3MYJB 2UZPA 5DK2B 1SBSL 4AEIL 3RJQB 2H1LM 3NCMA 3N85H 3QORD 3UZEC 5AAWA 4FXGA 3BDYL 4PJBA 1C8PA 2P24A 2X2HA 2COQA 4NKIH 3TOPA 3U83A 3LRGA 2HKFL 4R7XA 4XMVA 2AXWA 2YD5A 2BVQB 5JHDD 4NSKA 1II4E 3BAYA 3AM8C 3KXFB 4NKOA 3FQXA 3WEBA 5CZVH 2YN5A 1AXTH 3AMKA 2CLVA 4HC1A 3TTYA 1M3IA 3ARED 4FMFA 4QRRB 3GZPA 2F7IA 4Y4KC 3SQOH 2CAKA 3KPTA 4Q0XL 4HS3B 2YUZA 1WGVA 4ENEC 4GUQA 3HE7C 3PV6B 3PYCA 3D25A 1KCSH 3WFCL 4HUVA 2BHUA 2OJEA 4AL8H 4L3EE 1OLZA 4IRJB 2NUTB 2PPDA 3TN0B 4RSVA 1K8DB 4C8XA 1K4DA 3MU3A 2PKDA 4H1LG 4F91B 2DQGL 4E0RA 3UX9B 3RY6C 2QHLA 5CLTA 3BWUF 1ROCA 2JJSA 3MOAH 3BDBA 4ZTOH 4YOKA 3VGBA 3A3YB 3I74A 2WZ6A 3QUZB 4U3SB 1R5WA 1QWUA 2OMVA 3GXMA 5IMMA 5C08D 3QG6B 5HJBA 3IYLW 4LEOB 1PKOA 4Q97A 3RBGA 1R33A 3HMXL 1T1XA 3E1F1 4HJTA 3T09A 2NY3C 1CXEA 5F9JB 4C58B 1PQZA 3AWGA 1EK3A 1J1OH 4X4XB 2EEFA 4R90H 2WXHA 1CFQB 4G43A 2BRRL 2RGSA 3LZLA 3DIFB 2MMXA 3X1FA 1GCFA 4YHOH 4OVVA 3M17B 3I6GA 3MRKA 4D0CA 4J12A 4CMHB 4MJ5B 1N59A 4BWTA 3OKLA 5T1LB 3QR1A 4GAYB 4YXHH 5CEZH 1ACYL 1KLUA 3TBWA 3KH4A 2BWDA 1EDYA 2DAVA 5DD6B 3QORB 3WIHA 1EUUA 1HT6A 4KZDL 4JQIL 1KBVA 4OU3A 4R8WL 1LE9B 1KGYE 4ZFZB 1QO3A 1GC1H 4MLIA 3ECVA 3FT2A 5I1EH 2K6ZA 4HIJB 1J05A 3LNHA 1WS7A 3CZKA 3BUDA 2VW4A 3RLSA 3UC0L 2W9LA 3FDWA 4GXUM 3U7WH 1XCQA 2X4RB 4E9VA 5JHDB 2OP4L 4HGWB 4X5RA 2G5BB 4UT6A 2X70B 3D69B 3MGTB 3AREB 1IC5L 1RPQA 4MQ7A 2LU5A 2MCPH 2JNZA 5EOQH 4Z7QE 5HXMA 4LSPH 1W15A 1W72A 3O2DH 1E5BA 4KJQC 3MXWL 1IX2A 2Q3ZA 4ZX3A 5JMRA 1MHCB 5C6WH 2KKQA 4UDTA 1S5IH 5TTRA 1PG7X 3DRQA 1HL9A 1PX8A 2R51A 3MRRB 5EUOE 1N8OE 2IANA 4G6ML 2XQBL 5AOZA 5JORA 3NIGE 3GI8H 1T03L 3C8HA 4N87A 1J9SA 3OVUB 4J27A 3IXTB 2WYIA 4WJ5A 5I1IL 2C9AA 2A5UA 4KH9A 4LLDB 1U8HB 1IAOB 4NO0A 4RA3A 4Z7NE 1YZZA 4F37F 1SXNA 2CJTA 2P42B 2B2XL 2XZQL 3WUWA 2NY5H 3DUUA 1I7TA 4YHIA 4CMMB 2DQFA 5C08B 1NSNL 2AEIT 2DQJH 2P5WE 1HH9A 4PB0L 3G5XA 3NABH 2ENYA 2EVIA 1JPTL 1DVTA 3QNYB 3DJTA 3IDXH 1MNUH 3GSWA 1AGDA 5GS0C 1I1AA 1EJ8A 2YGNA 1PZ3A 1RH8A 3QQ4B 5EPMB 1PTZA 1OM3H 4CJ1A 3P30H 3MLPA 5HY9B 1T21B 1BZDA 3IBEA 3ESUF 2MSPA 1JCVA 3H42H 3P9MA 1YVLA 2IQ9L 3OKOB 3QXAA 3UTTE 5JXEA 4ONHB 1HHIA 1LNUB 3NT0A 3STZB 2H32A 1TQVA 6FABH 4DFHA 3MV8B 2JXMB 1NL0H 2WWMC 3L7FA 4OUUB 2HAZA 3CMGA 5AOMA 5LG1A 4AOFA 3F7KA 3D4ZA 3RUGF 1FYTD 5SX4H 3MUGA 3TO4A 3KEHA 2BP3A 1ID2A 4DP2X 5LWYL 2Z4TA 2R69L 3LZQA 4JN2A 4ODUA 2E7CA 2YMTA 4M8RA 5IKCA 3FOLB 5ILTH 2W9DH 2KH2B 3PHOA 2OMYA 4NYLB 3E6FB 4JO1L 2P8LA 2IBZY 3BP5B 4KXCA 1X6LA 1Q9WA 1V8HA 4WWPA 4OCWL 4XTRC 1NBYB 5CBEB 3P54A 4KKCC 3PDOB 2Q8AH 2IH8A 2PO6C 1IIKA 1A6ZA 4FLSA 5DRXA 2FX7L 3TIEB 2R15A 2Y7OA 3FRPA 4GW4B 3IVKA 2EDWA 2B4CC 2HZHA 4HOMA 4POZC 4P4RB 4LPTA 5EU3B 4GQ9L 2N56A 4NN5C 5AALA 3FUMA 1OAQL 4ZMVA 1DVXA 2JQZA 3KVDD 2E9WA 4O02H 3U1SH 5CCKL 2G75A 2GI0A 4JRYD 1Z0MA 3ESOA 4ICWA 4HMDA 4U1NA 5FGRA 1I53A 4KVNH 3UYRL 3FB7B 3MBWB 2HTLC 4Y4FD 3ATBA 5CNHA 2YS4A 3H3PH 4XVOA 1ZS8B 4AQEA 1A4KA 2BVOB 4L3AA 1JZ3A 2FEDC 3CZFA 4MWFA 1Q9KA 1C5BL 2E7LC 1SVZA 2JK5B 4KJYA 4N0UB 5C0AD 1MCPL 4X6CB 3S98A 1FNAA 3UAJD 1UD2A 3QUXA 1RIVL 3QEGL 4AGLA 1GPOL 3O6LH 3LNEA 3S96B 2FO1A 4R4ND 2H4EA 1L5GA 3ZTJG 2FJGA 4LEEA 3WAJA 2YXFA 1W9XA 4YSSA 2JI3A 3EADA 4H1LB 3U7AA 1KB5A 2CO2A 3LPWA 3DI2B 4AGMA 4HETA 3MV01 2FX9H 3QJUB 4ZW8A 5ACLA 3V4VL 4WI9A 3GFUA 1S7RA 3OGCB 3TPUA 4YSEA 1J5CA 3BQUD 5CJOH 4KX7A 4YR6A 5KVEH 3CDGA 4G42A 5C0EA 3FOMB 1J0KA 3SD5A 4I1RA 5JOEA 5ISZE 3H7LA 2YQ3A 1Q0YL 3EJUA 3BW9B 3RVXD 1AP2B 1FYTB 1MHEA 2R29H 3SYOA 5C0NC 2RACA 3FTGA 4HXAH 1ZLDA 2BY0A 1A21A 1YQVL 4NZTL 4JHUA 5IR1A 4ZXBA 2AK1L 4H0HB 4NC1C 5I6MA 2BHFA 1R0AH 5DMIL 4D8OA 3BFWA 4BIKA 5J0BA 4DZBB 1I9JL 4JGUA 4AL8C 4XN5A 4X98A 5TGBA 1HXYA 1H3UA 4KK8D 4LO9A 2YAEA 2WCGA 3KPQA 4NO5A 1TKWB 4TSAL 2CUIA 3NSXA 5IB1A 1OSYA 5IBUG 4G3YH 2NT0A 5I8CB 5GGVY 4YLBA 3UP6A 1YN6B 2IAMC 4XI5D 1MCKA 2GB2A 4WV1C 4Y0GA 4NNXA 1I9EA 4JFHD 4M7KH 4Y4FB 5F1IB 3PL6D 4Z7VE 2GIYA 2GBVA 4FJZA 1BJ1H 4YDIL 3U36B 3I02B 4N90E 4WJKB 2EE3A 2FNBA 1R1CA 4KO5A 4UQDA 3GM0A 5D2NA 2Z9TA 3PDDA 5C0AB 3GSRA 3SE8H 2IVFC 4TVUA 4WO4C 4J4PD 1GXEA 2Z92A 2AV7B 1DBKL 3POCA 3TJHC 2UWEA 2NZ9C 2CJUL 4GQQA 4GKSA 3GXFA 1JGDA 3LKQA 3T2NH 1ZXKA 5EU7C 1N12A 1SJHB 4P46D 4XNZC 1XF2A 3FCUB 2AABH 5FHAL 2Z34A 4Y4HD 4WHTB 1ZHKA 2NW2A 1S2EA 3CZUB 2BP0A 3TFBA 2Y7LA 1VF5C 4LSUH 3BN9C 3GSNA 3BPLC 4F9LC 1UHVA 4LVNB 3BN3B 4NZUL 4YSRA 3BQUB 3ZIYA 3ILPA 1GC1C 5T5NF 1BQLL 2V2WB 1IGCH 1DQKA 2ZYRA 4OZHE 1F00I 1IBBA 4JFED 2QKSA 1HHKB 1E9OA 3OAYH 3UZVB 5C0IB 4DKFH 1OL0A 2DQHH 3L7EA 3OM3B 5KVDE 1URZA 3DX3A 4PLOB 3KPRB 1XXFC 3VXOA 3DDGA 1S9VA 3V4UL 2B1HL 3TA3A 1GMIA 3DUHA 4B9CA 1DUYA 4JPQA 2ERJB 3IDUA 5INDB 1ES0B 1S7UA 1D5MA 1G7PB 4ZOAA 1LE5B 1H8LA 3C5ZA 1RUAL 3BJLA 4PJCB 4U1GB 2G2NA 4X6DB 4FD0A 3JBG7 4IU2A 5A7EA 4J5VA 4XOBA 1MY7A 1I9RL 3B3IA 4LESA 1WWCA 1MAML 25C8H 2G4EA 2MTAA 2XWJA 5F7UA 1G7JB 3W38A 5IJBC 4GI9A 4M03A 1L9QA 3MV7A 4ONGH 4U2ZA 2C3HA 2EINB 2W07A 4RZCA 2I9TA 3CUPB 1U4FA 2PYFA 2YWYA 2DWEA 5CLZA 2NY5C 5GGUA 2QLYA 2IFFH 3IS0X 4TNEA 3PL6B 3DIVA 4HWBH 4OZGF 3P11L 1ANUA 1QLFA 2F6AA 1HSAA 2LAGB 4MB5A 2WSPA 1HILA 4E68A 1CTOA 2EXWC 1T80A 5LJYH 4ILDA 2FIRT 3HC3H 1ZHNA 3MTRA 4OKDA 2NX5B 3WUWG 3P3TA 3G08B 5DVOA 2VLLB 3Q48A 2Y5QA 3V5HB 1L7TH 1LQBC 1PYWA 2VDML 3IGFA 4U6VL 4AXWB 4DAGL 3OR7A 3QHTC 5CXPA 2ARJQ 1RJZB 3GBNL 5DMKB 3NFSH 2PF6A 4P46B 2UZYB 2JJTC 1IE4A 3RU8L 1X7QB 4Y4HB 3S0PA 4JCLA 1C08B 5SWSE 3QUKA 5DZLA 4WEBH 1DVFC 4LKCB 1A7BA 4XCEA 2F0CA 2VISA 1UB5A 1IC7L 2ZJSL 2R2BB 3HHSB 3PGDB 3IPEA 5F21B 3WJLC 1AQ8A 1CGSL 4R6UA 4CU7A 3BP7A 4KPHH 3GS4A 4PBDA 3ROLB 3VMNA 4CDHA 1N64H 4DZ8B 1KIPA 4ZQTA 5CGMA 4ES8A 2HLAA 3U9PH 3DVNA 4JFEB 3CWGA 1TMCB 5T3ZE 1BF5A 2K3HA 1OIOA 4MD5B 4IBWA 4LPYA 2OSLB 3IGAB 1Z32X 1MI5E 4RNRB 3S3JA 3DKHA 1G9NH 1QNZH 3HRPA 2CDGB 2DQMA 4U4IA 3OKDB 4DKTA 4C55A 1PSKH 3O6FA 3C2AH 1EXGA 5F6HI 2V9TA 1W80A 1L4IA 3FRPG 3QC6X 3S5YA 1KG0A 4FXGB 1K6QL 1EZVX 1KPRB 1CD8A 1F6AB 3GNML 2P24B 3GXNA 4PJBB 2WNXA 5IHHA 4ZUSA 3PWPA 4OF7A 5GSVB 4J28A 5CCJA 3DPDA 4KZEH 4W9DC 4WHYH 4KI5F 1P6FA 4PAZA 5IWLA 5MP6L 1UC6A 4FFYL 1KN4H 4OD1H 3NH7H 3EO9H 4NSKB 3V52H 4FA6A 4L8DB 3CSGA 4A6YA 4NNPH 4NKOB 3FQXB 1AZNA 2GIXA 4ODXA 1F4YH 4G1EA 5F88A 2CLVB 2ORBL 3ARGA 3IETA 3FO0L 5I28A 1DFXA 4HUKB 3CSPA 4K94C 1TQTA 2IALA 2MIZA 3IFNH 4JY5H 4ODHH 3UTZB 5ANHA 4XBGA 3MC0A 5IBUB 1EO8L 5JR1H 4H4NA 2FGWL 2OJEB 1ND0A 2EDFA 3LKNA 4L23A 1PDKA 3NJNA 3ABZA 5FO8B 3F04A 3H8NA 2WKGA 3EBHA 4S0TD 1K4DB 5C1MB 1Z3GH 1UXMA 4JLRA 4UUJA 3UOAB 3CHPA 1GZQA 1JK8A 3OPZH 2GT9A 4NM4H 4NO0D 4DN4L 1X5GA 3LX9A 4DP0X 1MUJA 5KW9H 3HI1B 2IF7A 2OSXA 4YDVA 4YQXL 1M57B 1R5WB 2FVNA 2J8UB 2OMVB 4XPGL 3VTAA 4A63A 5IMMB 3KYOA 1F4XL 5ALBL 5FUOL 3ULUD 4LRNL 2FD6H 1T1XB 4XPTL 2ZKMX 5E03A 4CNIA 4X83A 2ZUQC 1I1AD 5BS0A 4P3DA 4YC2C 4ZNEA 1NBZA 1QFWM 3ARWA 4CAGA 1BFVH 2CBPA 4G43B 2OSYA 4LL9A 4Y5VB 1WFMA 3L5XH 1IT9H 3ARFC 2X41A 1YCSA 5ENWA 4D0CB 3VRLF 5FYLD 2FT7A 1N59B 3L9YA 1E42A 4XNUL 3TBWB 2F1BA 1H8OA 3TO4D 1GA2A 3HR5B 1NOAA 2JIXA 4N6RA 4XMPH 3EOTL 3QT2A 3U2IA 1CFVL 1OV8A 2DJSA 2ZT9C 2A6JB 5GZOA 3T6XA 4HJGA 4DGVH 2ZOLA 4MB1A 5E5MA 2DKMA 1INEL 3U1QA 2NDGA 2XG5A 3GHEH 2ETWA 1J5IA 1I4FA 3NESA 3K2UH 1BA9A 4MCYA 5C0EB 1HINH 5HHME 4QI3A 3QPQD 2YD3A 1DLFH 2YKLH 1J8SA 2CMRL 4CN1A 5IV2A 1BAFL 4ODVL 3L9RA 1W72B 3MJ8A 5FOBA 2KL6A 1JDCA 3BKCL 4FXKC 3KW7A 1HK6A 2NCMA 2WLNA 1PLGL 4KUCF 4LVOB 5JORB 8FABA 1NAML 2WTOA 2UWEF 1XGYH 4WJ5B 5JHLH 1CPUA 3UZQA 4WU5A 5T3ZH 4D7PA 5KUKA 3QUXD 4NO0B 4HWUA 4N2IA 3T8MA 2QVIA 4FQ2H 3WUWB 4DPAX 5HD8C 1I7TB 4YHIB 4BZ1H 4U1KB 1CD9B 2DQFB 4MMZA 1IKOP 2BINA 4W70A 1FBIH 4M5TA 1CURA 1I1AB 3ULVL 1S7WA 1A1MA 3II3A 5KJRH 1IJNA 3OAZK 1TIUA 1AYOA 2V9UA 1HHIB 3CU7A 4FS0A 4LCYA 4AE0A 3A4EA 4AYEC 1OOAA 3O4OC 2H32B 1J88A 3CFBA 4UAHA 2A0LD 3MV11 3U6RB 3V6OA 1VPOL 3L7FB 1LK2A 1ML0A 4RISH 1SXBA 4G8IA 5JPMC 2QFRA 1AS7A 2RR3A 2JKLA 2VAAB 3MUGB 1LGVA 1QFUH 3TO4B 3UTOA 5ELIA 3S7GA 4YHLL 1THCA 4JN2B 4ODUB 5DYOA 5BO0D 1XGTB 3PAYA 3PQYE 5ETUB 5EO0A 1FO0B 4TQHA 5IKCB 4ZXBD 4RMUA 3PHOB 2OMYB 1I8AA 3AXLA 1UWEL 2Q7NA 3BD3A 4BQCA 5GJTH 1Q9WB 4EVNA 2CLZB 4YBQD 1W8OA 3LQZB 1OY3B 4F2ME 5IIEA 3O45A 4X4KA 2VKXA 2G3ZA 5J6HA 5TE6L 1A6ZB 5DRXB 4JKPL 2CO4A 3D07A 3NRQA 4UOW1 2GTZA 1U8KA 4NFBA 1P7HL 2RB8A 3FRPB 1ZD6A 3GB7A 3P77A 1D9KC 1TTAA 4NOBA 3IVKB 5C0CD 2MOGA 1DANU 4FDWA 1ERNA 4LDEB 2PYEE 5DF0A 3T2OA 1BVKA 1A7PL 3V5KB 2WCSA 3WLBA 2G75B 4H8QA 2ZP0T 1OAZL 4U1NB 2Z7YA 4NQDA 4M93C 4QJ3B 3T4YA 2E9JA 4JE4B 3VFVA 3ZKMD 1OWWA 5CIPH 5G5DA 4KGJA 1OGSA 5T1MA 1A4KB 2CGRL 3QXDA 3SKOA 4Z3IA 3CZFB 4FABH 4GRWB 4ZG1A 4XE0A 4KJYB 4JDTL 2E9IA 5DUJA 5DQDH 3MUZ1 2LW3A 3KGTA 3QA3A 1KCLA 3TVMA 3O9WA 1XBDA 2E7DA 3QUXB 3BZEA 4NT6B 3S35H 5I1CL 1NPJA 1RJYA 2IOOA 4D0DA 2ZKWA 3UBXA 5AL8A 5C0BE 3C09C 3AU1B 4DP5X 5D2LA 4QTHA 3LTVA 1WO2A 2FJGB 1JIBA 3CZEA 1CICC 2APXA 2I85A 4XHJC 1RFDH 4XP1L 3GSVA 1OSPH 1LP9F 1H3XA 1IMHC 2CIIA 1WITA 2C3VB 5GRYA 3DJZA 1F4AA 4ODWA 4JFZH 2IPUG 4HU2A 2VT0A 3TPUB 1MJ8H 1DYZA 3QJVB 4YR6B 3CDGB 4X4MA 3WKMH 1FE8L 1JGVH 3JYBA 2R1YA 1DQJB 1RVFH 4PJGB 1RSFA 1SOSA 3NCEB 1MHEB 4POYA 3RA7L 1MXDA 2NY4C 2WZAA 5MI0C 4P5MA 1FIGH 1ADQL 3RURA 3QDGA 4ZXBB 3TL5A 5IR1B 3RNQA 2OL3B 3DOHA 3X1GA 4JFDE 3TA3D 1U6AH 4OR1A 3FN0L 4OJEH 2AQ3A 4U0RB 3FCSA 1AZCA 4M6OL 1MRCH 3W81A 4OQTH 2BIHA 1N7ML 3H9YA 4X98B 4XB8A 4GMSL 5TGBB 4KJPC 3EAKA 5A3ID 1IGFL 2WP3T 5AD0A 1S78D 2VDNL 4E9YA 4HUMB 1MCLA 4NO5B 2BHZA 1MNNA 1MVUB 5C0CB 5IW6A 1DQDH 4U1MB 2X40A 1AHWA 2P3YA 3QUMA 3GMMA 2ZKHL 3Q2LA 5FGCB 2XX1A 3MV7D 5IREA 4F27A 5BCAA 7PCYA 3QZBA 4JZOA 3ZDYF 5JQIB 3TZVC 1CG9B 3OXRB 1GRWA 3QPXH 5D8JL 4M7ZB 2EE2A 3BGFC 3IJSA 4MJ2A 5T3XH 3EOAB 4CVWA 5JOPD 4JG9A 4LSSL 3EXJA 5CO1A 3P3RA 3VTMA 3LHPL 5JIMA 1OALA 2X6UA 3ECQA 4ODBD 2B0SL 1E6OH 5E6ZA 2Z92B 3BYYA 3QCUL 4MZIA 4NIYE 3S88L 1BW8A 1D5RA 1QAWA 4N20A 4LLQA 3ATFA 4MX7B 3OQ3B 2YQ2A 2Y7NA 4GKSB 3WUZA 5EV7A 1JGDB 3B1TA 4U1JA 5LAPA 2H0JA 5DEFB 3WS6C 1TYRA 1U36A 5IF0B 1RAMA 4M6MH 1ZHKB 2NW2B 1YEJH 2RJMA 4N4YB 4PJ9C 4GLRI 3GSNB 1P84J 1KACB 2HT3D 2V6HA 5E9NA 4F8NA 1OE3A 4PRNB 4BZ2H 4UTAA 3SY0A 3UJTH 3EOYG 3VWKA 1O9ZA 1V7MH 3ILPB 4HPYH 5CJQH 5CZRA 2NR6C 1CLVA 2P28B 5CSGA 4JX0A 1G9HA 3KXFE 2K9UA 4OT1H 1BD2D 4EDXB 4EUPA 3E6HB 5JIDA 1TJIL 3L4VA 4QRRE 4QNPE 5BOJA 4OSUH 1KLGA 3D85A 3MYZA 3VXOB 4KV5F 1QPKA 1S9VB 3QIBA 1EAOA 2ZXEB 2FB4H 3CHSA 4LAQL 3NIDB 3TA3B 4A2HA 3TNNB 1XD1A 2XYCA 4PLJC 1D5MB 4OD2A 4NUJA 3UMTA 1AD0A 4QTIH 1P6WA 1NGYB 3LHAA 1OTUC 2LVCA 3OSKA 4UV7H 5DUPL 3WE1A 1A4AA 4IU2B 3SKMA 4QUOA 3PWPD 2Q2LA 3QJTB 5DHDA 4XAKE 3B3IB 1E8ZA 1UYWL 1KJVA 4TV3A 2HXAA 5FCUL 4QJ4B 3AROA 2AXHA 3MV7B 1BVLA 4ZMOA 1T6BX 2W07B 4RZCB 5CGTA 5FYJE 2I9TB 4TMPA 2QELA 2AQ1A 3CK0H 5JIIA 2DWEB 3ZOAA 3IJ9A 5GGUB 2F1EA 1NFDF 5B1AB 1A6WL 1FG2B 5CEXB 1OAYL 4PGZA 5FV2A 4FQXD 3NAAH 3QUGA 4JFQA 4A68A 4XNAA 5C86A 4FQHA 1L0QA 1HILB 3NGBC 5F44A 4QF1A 2EVFA 4LVHB 3O11B 2X05A 3EFDL 3JTTA 1WP6A 1X5YA 1XF4A 3D18B 3LB6C 4UB0H 1EHXA 5IB3A 1B3JA 5D71H 3FT3A 3FQ2A 2EABA 3HMWH 3MJ9A 3FQNB 3P0VH 4Y5XC 2FYVA 5F72S 4IS6A 4JR9H 5BRQA 5F7LB 4XC3L 3A67L 4ZT1A 5BVPH 2RQ8A 1U30A 5KOVC 5KBPA 1JZ5A 2DS4A 2P5EA 3EDDA 4PRHA 4IRSB 2NY1D 4Q4EA 2WO2B 3QUKB 3F58H 5EZPA 3RWCB 4IBVA 3BEWA 3EH1A 3RDTA 1UB5B 5EIQA 1N8ZA 5C0DA 3HG2A 2HUEA 1UJTA 5CZKA 2CSPA 3J8F7 2F53D 1F90H 2CLRA 1KIPB 2XN2A 5BS0D 4AVKA 1DDHA 1U3HA 3REWA 2G60H 3UGEA 2HLAB 5C6PB 1ZTXE 4WENB 3DVNB 1BD2B 3D12B 4E41A 2WUCH 3WNKA 3Q7JA 4J2QA 3T6WA 5HDQL 3QO0A 2V5RA 4IDLA 4PJXA 2D7TH 4XC1H 4K0OA 4FNTA 4JM2F 1AR1C 1HDMA 5E1IA 1IVLA 3RX7A 4OH2A 3JWDC 2B9AA 1NGXB 5ICYB 3ABLB 2X5PA 3PPSA 3NCYS 1L9NA 3RPIA 4AC4A 3V6BR 4NP4H 1DEDA 4ELKB 2JELL 3B8SA 4MMXC 3ZR6A 4OJFH 1CMOA 1XWVA 4TQEL 5DQ9B 5GZOD 1XGZA 5A2IH 2MEJB 4L48A 4ZUSB 35C8H 3PWPB 4MXWL 2AJ3A 3HG1D 3L3DA 1IGML 1TPXC 2ZCZA 2EIJB 3RHWF 5E8PA 5F7NC 5HHPA 1LO0L 2NY6C 4R0LA 1JYVA 2H8PB 4I48A 2H1XA 1I3RA 5C08E 3H9SA 1JP5A 1OGPA 4A6YB 3MFFB 4BFGA 4TUKH 3ZT5A 4ODXB 5F88B 1RZQA 1KCUH 5FKPA 2SODB 3IETB 1H19A 4FQXB 1HKLL 2IALB 3MODL 1CGVA 3VI4F 4MKMA 2PPAA 4WHCA 1OOWA 1VEOA 2E86A 2YKKA 3V7AG 4LSVH 1G4RA 4HVBA 2WLJA 3SO3C 1MFCL 3LKNB 3UBXG 1PDKB 1BYNA 3W11D 5DHEA 1BSIA 1ORQA