5I28A

Azurin t30r1, crystal form ii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Azurin
publication title Determination of nitroxide spin label conformations via PELDOR and X-ray crystallography.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
total genus 31
structure length 127
sequence length 128
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i28A00
1OE2A 4YSPA 2ZWNA 3FSAA 2XV0A 1QLEB 2CBPA 3L45A 2YAOA 1FWXA 2PPCA 4E9VA 4L0PB 2WO3B 2YAPA 2QDWA 3OM3B 4PCYA 3ABGA 1CUOA 2PCFA 1NWPA 1GW0A 2BHFA 4AKPA 4YSTA 2UXVA 1PNCA 4JHUA 2IDFA 2W88A 4P5SA 2I7SA 4KOCA 3FU9A 1AQ8A 4HAKA 5I5JA 1PLBA 3T9WA 2AFNA 3FQ1A 2J55A 4AX3A 3QQXA 4YL4A 5B1AB 3CVCA 6PAZA 4G70B 1MZYA 1ET7A 1PZBA 1AZUA 2IWFA 3NSYA 1L9SA 2NRDA 3NSCA 4NB7A 4HHWA 4KNUA 1N68A 5I28A 2EIKB 2QPEB 2YAQA 3IBOA 2VW4A 4A2EA 1GSKA 4KO9A 2ZOOA 3ASOB 3S3BB 4AKOA 3FYIB 3OQRA 2J5WA 2WSDA 5PAZA 4KO5A 4A67A 5AKRA 4FA7B 1EHKB 1QNIA 2IDQA 5ANHA 1OCRB 2FT8A 1NTDA 4HIPA 3NP3A 3D12B 3QJTB 1RZQA 1A3ZA 3CDZB 4A2DA 1IKOP 3DIVA 2FWLB 2PCYA 2GB2A 4WKXA 4BDVB 2FT6A 4QKTA 2CAKA 2VW6A 4FAAB 3ERXA 2CCWA 2IDTA 2B3IA 2IAAC 4UANA 3NJFA 4DPAX 3H4HA 5I6PA 1JOIA 3MBWB 2B08A 4DP7X 1JVLA 1OE1A 1KDIA 1A8ZA 3PLYA 2BW4A 1W8EA 1IC0A 2PLTA 1ZIAA 1NINA 1OCOB 3EH3B 3X1NA 4DP6X 2VM4A 1RZPA 3FT0A 4EF3A 1PNDA 5A7EA 1CURA 2LLNA 2XU9A 2PPEA 8PAZA 1SJMA 1NIBA 3FPYA 1E65A 1J5CA 1L9QA 1HAWA 2YXWA 2BO0A 1AACA 2DWTA 4YVNA 3EH4B 3PAUA 5PCYA 3FSZA 2XWZA 2YQBA 2UXGA 3QJUB 4UF7C 3WKPA 1XMEB 2HZHA 2BWIA 3EH5B 4G7SB 3X1BA 2OV0A 1OE3A 4M4RB 5B3SB 2PPAA 5D4JA 3WI9A 4BK5C 2XV3A 2FQDA 1MZZA 4N8UA 2OCCB 1MDAA 4HCFA 2IH8A 5B1JA 2UX7A 1L9TA 3CDZA 3H56A 4AI7A 4F2FA 4AZUA 1N70A 3NT0A 4YSSA 3GDCA 2IDUA 4GYBA 1KV7A 4F7KA 1OF0A 4BDVA 1PZCA 1VLXA 4BWTA 1V54B 4TXVB 3NJMA 3OMIB 1ILUA 3V9CA 4A2FA 4CSZA 3S8FB 3V9EA 3FQYA 1IBYA 3KW8A 3PCYA 1JXDA 3ABKB 1V10A 5TK2A 3PPSA 1NDTA 1NICA 3HEIB 1ET8A 1NIAA 2GC4C 1GR7A 3AG2B 1AANA 4YSRA 1GY2A 1ASPA 4HCIA 2GC7C 1BEXA 4Q89A 1KBVA 2WO2B 3WNIA 1PLAA 3AG4B 2FTAA 2FQGA 1BQ5A 3ZBMA 5LDUA 3SBRA 1AIZA 1JXFA 1BXAA 2X88A 1A4AA 1RCYA 4YSDA 4P5RA 1OOWA 2GHZA 1DYZA 2DYRB 2I7OA 2VSMB 1ETJA 4WTQA 2YARA 1J9RA 2MRYA 2IDSA 2ZONA 3DTUB 1YLBB 3ABMB 3HB3B 1OCZB 5I6MA 4HALA 1WS7A 3QJQB 4X4KA 1ID2A 3AW5A 4DP4X 1A4CA 2DY2A 2OJ1A 3SBQA 4W9ZA 4DP0X 2BW5A 4E9YA 5EHFA 1JERA 1AS6A 4BXSV 2W8CA 1J9TA 1AZBA 3NJJA 1WA1X 3T6WA 1AAJA 3T71A 3NJKA 1AOZA 2P80A 4ZK8A 3BQVA 2PP8A 2YAMA 3GYRA 2BP0A 5FC9A 3NJGA 1L9PA 3S3CB 2XYBA 3H4FA 1KBWA 1PLCA 1NIDA 5B7MA 5I6KA 1SFHA 2GI0A 1X9UA 4JHVA 1BXVA 2GBAA 2MTAA 4G7QB 4HHGA 1JVOA 1SF3A 2H47C 1GS6X 3AG3B 4A68A 3DKHA 5B1JC 1JZIA 1OCCB 2J57A 3TASA 3T6VA 2UX6A 3FU7B 4E9XA 3NYKA 3BVDB 2H5UA 5B7EA 1PZAA 1T5KA 2TSAA 1L9RA 3QJVB 4DP9X 3CG8A 1SHWA 1E67A 3X1GA 3WKQA 1SFDA 1V55B 1HAUA 3TBCA 2BP8B 4JKNA 3WG7B 3ZX1A 4AKQA 3T6XA 1A65A 1AG6A 4A66A 2H3XC 1I53A 4KO7A 1JZJA 4A2HA 5B1KA 5I6NA 4G7RB 1MG3C 4QLWA 2XLLA 5I5MA 3OMNB 2Y69B 4A2GA 1FFTB 3AZUA 2J56A 2DV6A 2R7EB 1BYOA 5I6LA 2A3TA 3UAEA 3T6ZA 1PF3A 1W6LA 2YAEA 4HZ1A 3OMAB 1BAWA 3TBBA 2JXMA 2HLEB 1GYCA 3JT2A 1M57B 1GS8A 3NP4A 1XB6A 1J9SA 1SHXA 1CYWA 2BZ7A 2VN3A 4YSCA 2FT7A 4E9SA 2AZAA 7PCYA 4F2EA 1NZRA 4DP1X 1ZPUA 1NPNA 2CJ3A 3FSWA 2BP0B 2CUAA 3CVDA 1RKRA 1JZHA 1ADWA 4YSQA 1J9QA 3FU7A 4GXFA 2UXTA 3FQ2A 2EILB 3TA4D 3UACA 2VM3A 1NIEA 4BWUA 4M3HA 2BP8A 1NIFA 2XX1A 3AG1B 2XXGA 3FSVA 1KYAA 1CC3A 1QHQA 2TSBA 4DP8X 3X1EA 3QJRB 2XX0A 2CALA 1WA2X 3CVBA 3SBPA 2IWKA 3U25A 1AS7A 4DP2X 4UAHA 1JZFA 2VSKB 2XXFA 1TEFA 1PCSA 2PP9A 6PCYA 3ZDWA 2XVBA 3AY2A 1GS7A 4CSPA 3UABA 1BYPA 3FS9A 3N2JA 1UATA 2R7EA 2FNWA 2DYSB 4YSUA 4G72B 3EF4A 1M56B 4E9QA 3JTBA 1BXUA 1TEGA 2AANA 4Q8BA 1IUZA 1ASOA 2HRHA 1NPJA 3NJLA 1CYXA 1E30A 3ABLB 4KNTA 5F7AA 4YSEA 4E9WA 1W6WA 2HRGA 3PXLA 3S8GB 5B7FA 3MX0B 2HXAA 3G5WA 1URIA 2GIMA 1PMYA 4PAZA 4DP5X 1AR1B 3GXUB 2AVFA 2Q9OA 2YXVA 3CZUB 3FPXA 5B1BB 3WIAA 5AFAA 1PY0A 4RH4A 3X2QB 1WA0X 2EIJB 1SF5A 2PPFA 4E9TA 4MFHA 2AZUA 1KGYE 2JFCA 7PAZA 1KCBA 1E5YA 1JZEA 1J5DA 3ZIYA 1SDDB 1XB8A 1BQKA 3IEAA 3IN2A 1ZIBA 2FQFA 3NJIA 3PAVA 2FJSA 1L9OA 2RACA 1ZDQA 3N55A 3NSFA 1OV8A 2VMJA 4GP4B 1JZGA 3RYMA 3FYEB 1TU2A 4KNSA 5D4IA 3FU8A 2IWEA 4W1TA 2QPDB 1A4BA 5I5IA 2HX7A 1AG0A 2P80D 2YAFA 1TKWA 9PCYA 1AS8A 1XB3A 2YAHA 4ENZA 4KOBA 5I6OA 2XUWA 1R1CA 1KDJA 3SQRA 3UAAA 2EINB 1ZDSA 1ILSA 1NWOA 2DWSA 3QPKA 1MG2C 2I85A 1JXGA 4YSAA 4GY4A 4KO6A 4N4YB 1WS8A 2Q5BA 1SNRA 1AZRA 1AZNA 2QDVA 3PAZA 1IBZA 3EHBB 4GP5B 1PAZA 3IN0A 3QJSB 3UADA 4NERA 3UGEA 4YSOA 1WAEA 4GP8B 3X1FA 1FA4A 3TU6A 1AZCA 1HFUA 2N0MA 2PPDA 2BWDA 4E9RA 3ASNB 1ASQA 4HCGA 1BQRA 5I26A 4YVUA 1F56A 3IE9A 3NSDA 2IH9A 2HX9A 4BXVA 2HX8A 1DZ0A 5D4HA 2Y1AA 2GSMB 5F7BA 2VW7A 3C75A 4DPCX 3NJNA 2UXFA 2PP7A 2E86A 5AZUA 3S3DB 1EZLA 1SDDA 5IY5B 3OD3A 1ET5A 3KW7A 1B3IA 1X9RA 2XV2A 3NJHA 1KCWA 2BZCA 2X87A 1M9WA 2QT6A 4G71B 2EIMB 3WNJA 2JKWA 1E5ZA 4DPBX 4NAJA 5TK4A 4K9JA 1ZV2A 4BWWA 2FQEA 1GY1A 5E9NA 2ZXWB
chains in the Genus database with same CATH superfamily
3HG1B 4NUPA 3QCTL 2NUTA 4PRIB 2YAOA 2PPCA 2D7MA 5TF0A 3L3GA 4AIZB 1NC4D 2QV4A 4E42A 4DPRA 3UYPB 4I0PD 4KTYA 3T5WA 2F7IA 2P26A 1EHLL 4L5FL 5DQJA 2G60H 3WENA 1S7RA 1JYXA 3WSQL 5IBLD 5E4EB 3NH7H 2PETA 1P6AB 2CLVB 3ZLQC 2J43A 2K45A 4I3RH 1EXUB 4P5SA 3F7QA 5AZEH 5BO1L 4CW1B 1FLTX 1MFDL 2H0FA 4YHLH 2H1XA 3HHMA 3RP1A 2J55A 2VAJA 4ZTPH 4R90L 3VD4A 4P0DA 2P8LB 2DQTH 5AKVA 1PZBA 1KN2H 1J0HA 1JRHH 2HVJB 2F1BA 4NQEA 1HOCB 4ZXBA 1E90A 5CM1A 1NOFA 2UUDH 1H8NA 5C2BL 2BNRB 3FCUB 5JR1L 4XMTA 5FO7B 4Z5RA 3FN0H 4JFYA 4Y16D 2NY2D 2GUYA 5IJVA 1HZKA 1PG7H 1F45A 2BVEA 2EEBA 3OLEA 1CD1A 2MQGA 4HEME 4X7TB 4ODVH 1OANA 5K9QI 2X1OA 1F4AA 2W9DL 4NHUA 4XXWA 4KDTA 5FF6B 1QO3B 1T83A 4P2AA 1Y18A 4LLUA 4PS4H 5CIPH 4XO9A 4ORGB 3PWVB 1JV2B 3HG0A 3IRPX 3HCVB 4TV3A 3ZTCC 1S3KH 2VH5L 4OT1H 4P2QB 1J8RA 3TJPA 4AQ8A 3JT0A 1FGNH 2E7LA 2V7NA 2IGFH 3ERXA 1OSPH 3EOBA 1ACYH 1VFAA 1CL7I 1WVZA 4X7DC 5TH2B 1G6RH 2DYPD 3ZUCA 1MPAH 3ZGIA 3VX1A 1VKXB 5I16B 3SDYH 3SPVB 4OIAA 2ATKB 3SOTA 1RZPA 1HHHA 3BMWA 3FT0A 3T3MB 2P7TB 1FE8H 4P4RB 5DQ9B 2WSKA 4D9LL 1HDMB 1X4YA 1S7SA 1NGWA 1DEEB 1ZEAH 4XC1L 3BFQG 4FX5A 2YXWA 1E4XL 2VDRH 3ME0B 4HGWA 3N5AA 3W0WA 4M43H 3QO1B 1HX0A 4RRPG 2OMWA 2XWZA 1H3PH 2O5NA 1OALA 4NPYB 3KDPB 4Z3FA 1EO8L 1XMEB 4LDEB 3TO2A 5KG9A 4I13B 5IB1A 1F90H 3QIBD 4WJKB 3DA0A 1UOKA 4QHPA 4M4RB 4ZW3A 4P3CL 2ZX6A 1KCUL 3KPRE 3L17A 1JCVA 3U46B 1J05B 3VD7A 3G3LA 1P1VA 1U21A 5EH1A 4UTAA 1EGJH 1KB3A 1ZXQA 1XMWA 3B5HA 1L9TA 2CRZA 2GEQA 1RZGB 4GMTH 4H44C 1R33A 3IS1X 1RVFL 3Q7JA 1EZSA 4W9LC 3GDCA 4GYBA 5D7JC 1KYOK 2EIZA 2W91A 2ZOUA 5FWRA 4Z7WF 2ILLA 2GAZB 2P5EA 1WF5A 3OMIB 4TXVB 4Z95H 2WKGA 5DJDA 1FNHA 4MXQC 1IILE 3Q2NA 2IGTA 4TUJA 4UAOB 4B9CA 1OB1A 3C6LD 3LS5H 2ZKYA 3D18A 2PW1A 2Y1YA 3P11H 1M2VB 1ES0A 2WZPA 3KWVA 4MXVE 3WHE1 1G1CA 3GSWA 1YNKH 2BPBA 4J3OF 4OUOA 5J6GB 1MRFL 5JOPE 2F7RA 3BEWB 1NIAA 2QVIA 3S3SA 2XA8L 3BIKB 3FCGA 4OKDA 1MFBL 4KDTC 5KSBB 5CBAB 3S35L 2HTLC 1FPTL 1A22B 1CD8A 4GO6B 1JMXA 2ICES 1CMOA 3K8LA 2AEQL 4X6CF 2E7LC 3MA9H 4AIEA 4Y1TA 1RI8A 1BLNB 1W2KT 4ZFQA 1OOWA 3N44B 2ORBL 3E0GA 3HFMH 1DBAH 1Z9SA 3KPSB 5IBUG 3S36X 4Z7OB 3D87B 4NZRH 3X13B 3WEBA 1G9NH 1N8ZA 3QQDA 4O2EA 5E8PB 3NCWA 3P30L 2J44A 1J1OL 1L5GB 2BC4B 4XBPB 4M29A 4ZMWA 4OLWL 4XZ4A 5ABZA 3K6IA 1OCZB 5I6MA 2MJWA 3IJ7A 3EFFA 2Z8SA 2G3XA 4TSCL 5HYJB 2DY2A 1LDPL 2H6PA 4PIRF 4HWNA 3SBQA 1N12A 3AY4C 1A5FL 4APQD 2O4EA 2G2NA 2HB0A 3TEZA 2AXGB 3ULSB 3DK2A 2W0LA 3BGAA 1AS6A 3GSVA 3MLSH 1ZWIB 3O6ML 1AZBA 1WICA 2Q3AA 4YHIA 2ITDB 3QUZA 4NUGL 3NCMA 4J3OD 4IOIA 5CF3A 4XOAA 5C7XL 4HBCH 2CUIA 3H54A 3GS4A 3TBYB 4DVRH 1QRND 2F5BH 2IH1B 2WV3A 3G5YA 2D2CC 1IKNA 3VGHA 4GUPA 2PF6A 1KBWA 4FQLH 3A3YB 5BUAA 3MCLH 1JWUB 1VHPA 4G8EA 3N1QC 4XNXL 3TFKC 3T8MA 2X4TA 3OX8B 3RL1B 1G7MA 2DQFB 4X80L 4Y1SA 3OVUB 3AG3B 1NEZG 3CN4A 3DKHA 3BLKA 1MQKH 2KL6A 3FKUS 3QG6B 2O61B 2FCBA 1T5KA 3FO1B 3IJSB 5F89B 1U91A 4DP9X 2CHZA 1V55B 4LPXA 2BP8B 1HE7A 2J4WH 2X4UA 3AXLB 5AW8B 3TBCA 4C56B 3T6XA 1MRCL 3VI3E 3NN8B 2XKNB 1WTLA 3JWOC 1PSKL 4JJ5A 1EBAA 1LO3H 2R59A 4K73A 2XY1A 4OIIH 1IKFL 4Y2NA 3HI5H 1J9CT 2R23A 5MP6H 5ERWA 1KELH 3P4NB 1I31A 4YL9A 1K5NA 4AEHH 5JIQA 3UBFA 1G1OA 4EZLA 2ZIDA 5D96C 4K9EH 5FGSA 4WTZG 5CD3B 4KXZI 3QI9B 2ZOWA 1W72B 3X3FL 2YPLB 1RIUL 4ZAKB 1J8HA 1WBXA 1INQA 2VJXA 2X6UA 4ADIA 3UTQB 1KBGH 2DV6A 3VGEA 3U4KA 4Z7NE 4OBRA 5T8IA 1ZS2A 3WJLA 5GS0C 5FECA 1YY8A 3TJHD 1EK3A 4JG1L 3BQUC 1KC5L 3LJ3A 1GA2A 4MS8C 1FRGH 3JTSB 1ICTA 4IS6B 5D7IA 5I76B 2YUVA 5DD3H 4YXLL 1B0RA 1C12B 2XOTA 2VN3A 1DO6A 3MJ7A 1PKQB 4GEIA 3ETBF 1EVUA 3HZVA 4NM4H 2B2XL 4A55A 2OKMA 4LBAA 4NJAH 4FMFA 1FO0H 1FZMA 1IC5L 1FORL 4LP8A 2ZJSL 2JELH 1NMBL 1XGUB 3JWNE 4YZFE 3O6FC 2DBLH 3LCYA 3GB7A 2PYFA 2QBWA 3EDJA 4XXCA 3T2PA 3QUZC 1OAYH 5F7DB 1FGVH 1MIEH 4BWUA 5IGXH 2F54E 1TVHB 2WPGA 2V9RA 2UWEB 3HG5A 4OU3A 1NEUA 3DUHA 4PS8A 4YPGA 4LSQH 2XX0A 2Q1EA 3B9DA 4EN3C 1RJLB 5EOTA 3SBPA 3ATAA 3SDAA 4CU7A 4UAHA 5E23A 3QIWC 3F7RA 4PJFE 1JPSL 3HI1B 4R4NC 3DO7A 5EEUA 4HJGB 2OMYA 2HP4A 3CLEL 3SDDB 5FGCE 4ZS7H 3HPJB 3ILPB 3GSNB 3OHXB 2H0JA 2PWFA 3VU2A 1T6BX 3QPXL 4JBSA 4V2CB 5E99L 4AVKA 1A6AA 3MNZB 2WUBL 1Z0NA 2H1PH 4ZOEA 1XH3B 2RGSA 2YPKA 1MH5B 2AQRA 3S3PA 3FQNA 1IM9D 4MXVF 4CKVX 4D0CA 1VFBB 2HRPH 3BZDA 4XPHH 4WY7L 4ZO9A 1KXHA 4P9HL 4JQXA 4QDGA 3PDDA 4YSEA 1KB5B 4B9KC 2I9LB 4ZPVB 2D03L 1DJSA 1I7ZB 3LNFA 4AL8L 3MBEC 4QPEA 3ZE0E 1RK1A 2W07A 3DTXB 4HUUA 2XICA 2KKQA 5INDB 3CZUB 1OM9A 3FPXA 5EC2A 3FXIC 5L8KB 2YC1A 4GAJL 4JCWA 5CZXC 4NNPL 5FCUL 4OV5B 4YEFA 1WC7B 4JO4L 3ETSA 4HX1A 4LSTL 1MFUA 3KPRD 5TD4A 2ADIA 3V0WL 2WQUA 2BSTA 4WO0A 2Z7YA 1NQBA 4AYFB 1SDDB 2J25A 4MDJA 5CJ5A 4QHKJ 1BZ8A 1L9OA 2C3WA 1SMAA 2FSEB 2VWEC 4FF9A 4P46A 2I07A 4Z7UE 3UCQA 4M6AA 2JB5H 2QADB 4AEIL 4KZ0A 2CJUH 1JZGA 3HLAA 5EF3A 1DFBH 1CZ8H 4AIZA 1GGTA 2DQJH 1JWSB 3LIZL 2X6MA 2BY3A 4TUOA 4UTAH 1BW8A 3PABB 1H5BB 4KFZC 5DR5L 4RMRA 2WKOA 2YAFA 2A5UA 4XXCC 2ZSVB 1J5IA 3NGBB 2CG9X 4NQDA 5JOPD 4HU2A 2EINB 4Y2DD 4OD1H 3ALWA 1I85A 2AITA 4F57H 1XXFC 3BZEA 4HD9A 4YSAA 4TMPA 4MA3B 4PJ9B 1RSYA 3VFMA 2XIBA 3Q48A 4BSVB 4I9XA 3ZYOA 2V2TA 2E4TA 5FDYA 2WXOA 2FECI 4KDVA 3SDAC 3MYJA 4BHUI 4K94L 1OGAB 4HPOH 1MAJA 2KZWA 1TMQA 3WLBB 3B43A 4NCDA 3FH5A 2NSMA 2X4SB 3JYBA 3HZMB 5LXVA 3IE9A 4R4FH 3RIAF 4CA4A 5FGRA 1WYJA 1MEXH 1RUAH 3JQOB 3MZTA 4HOXA 2JLPA 3V4VL 12E8L 3FTYA 4KJYB 4UWQB 3ZDXF 2NXYD 2QPFA 3VI3F 1F6AB 2F15A 3BPCB 3OXRA 4GEJA 5JZ7D 2BP3A 2Z7WA 4XE5B 2PP7A 5E8NB 1MFNA 5I0YA 5IY5B 2NXZB 3G6DH 3KW7A 4QJ3B 2HN7A 3RA7L 5BS0B 2B9AA 2F9BT 3NEXA 4M6NH 3I6KA 1NCBL 3EOTL 3GS0A 3HCVA 4GQ9L 4UV4H 2UY6A 3JXAA 5J13B 1Z5LA 3DJZA 3Q8BA 3VXRE 3ATFA 3GSUB 3S36L 2V9UA 5E9NA 4Z7NF 4GSUA 3BUQA 3IDIB 1ECZA 2K6ZA 4IRSD 5LG6A 2WP3T 4U7SA 4F7EB 3GJEA 4OGZA 4NOBA 2FO4A 3BT0A 1SEBB 2O6CA 2WO4A 4FHJA 1KLUB 2AQPA 3A22A 1RIVL 2X2UA 1QPXA 2DMKA 4WGWB 1WO2A 2BZDA 4PCTA 2I60L 3B7YA 3SE8L 2XKUA 2GUOB 2IV8A 4P4RA 1E6OH 4N2MA 5F71A 1T3FA 1TLKA 3FQTB 4B3VA 4UYPA 2QV2A 2HFEB 3ME0A 4DQAA 4K8RH 4YQXL 1W8NA 2H3NA 3T9WA 4ICWA 1B9KA 5DEJA 4WW2F 5IFJB 4PD4K 4U3XA 4FG6D 4YZFF 3SQBA 3ZQ9A 3LRSB 1KWKA 4XBGB 4IBTA 1TFHA 5IOPB 2OXGB 4I85A 5E4EC 4NCC2 1GOGA 1ET7A 4M93B 1OCWL 1FNEA 2OK0H 1N19A 5F0JB 4M4RA 4XP6H 3CK0H 1I85C 2Y9RT 5E2UL 3U46A 2VJ8A 4LU5L 5IB5A 4MKTA 1C5CL 2X05A 3MU3A 4TNGA 4N85A 1HQRA 5E6ID 3B56A 3OQRA 5C0BE 2A2QT 2F19L 4ZSOE 2A0LC 2PWEA 4ZOCA 3SBWA 4F8QA 2YLKA 1EHKB 3ULAB 1JGEA 1QNIA 4PJFF 1RZJC 3O4LB 3GBML 3EFDH 4H1LB 5F0LB 4UOJA 2EKJA 3C60B 4OKVB 1E4KC 3KLSA 3H7LA 4KKCD 1AD0B 2H32B 1HU8A 2IQAA 4HJJH 1NEPA 5BVJA 3FTGB 1IEAA 3KZ8A 4NJ9L 3V5HA 3EJCA 3KYMB 3TVMA 2FWOA 5F96H 2IANE 2JH2A 2R4RL 2VLKB 5EZPA 2V37A 3E9TA 4TPRH 4FQHB 1I7RA 1P1ZA 4HXAL 3KLKA 3PAYA 4M7LH 3BKYH 2BIHA 4MMXB 3C5SB 4DIXA 1JOIA 1OAQL 3SDXA 2CIKB 3QBTB 3W9DA 4I0KA 3CQQA 2OYKA 3ESMA 4RMTA 4MLIA 5A16B 2APTA 2F54D 3ZE0F 3QXAB 3BISA 1A1MA 4OZFH 4XNBA 5LQBL 2AXFA 3T3PE 5FFLA 3FHAA 4IW4C 5G55A 3VXSB 3FPYA 5EC1B 1N6VA 5FK9B 3GMPA 4IBUA 4FQQB 2BO0A 3JWDL 1CLZH 3P4OB 2YA2A 3FSZA 5ACZA 4Z0XB 4AJYV 4HZAA 3WS6A 3MCG1 5HYJA 2XIIA 3OJDA 2CGRH 2DD8L 1JN6A 1HHIA 3GGWA 4JFOA 3T4YB 3U9WA 1L9MA 3QFJA 4Z7UF 2VUYA 3ULSA 5DHDA 1SOXA 4YX2L 1GGBL 4X4ZA 3KEDA 2WXGA 2ITDA 2LT9A 1BVKA 4W9FC 3ASWA 3O6KL 4YE0A 3E8VA 4AENB 1MELA 3U0WL 4L05A 1BVLA 2Z93B 2AABH 4OJCA 1COBA 5D6CA 2CO1A 3CN1A 5EA0L 5IR1B 3DPDA 2AHIA 3PRZA 3T8VA 2RFXA 4OLXL 3FT2A 3OBAA 1KCRL 5DRNB 3TT1L 3RL1A 2DQFA 4JG0H 1KXQE 3C5ZB 3MBWA 5T5NG 5ACLA 5DHMC 4Y9BA 2XKSA 5C6TL 2F1EA 3NABH 3QCUH 1FG2A 3JV6A 1SHMA 3DX2A 1TG8A 1P4IH 4FABH 4JQIA 2CIIB 3OJVC 3VAEA 4FQ1H 1RUML 5E1IA 5FM4A 4E9LA 3DROA 2BSED 3AXLA 1PLGH 2NTFA 3IDNA 2YSTA 4QXUH 4TNWF 4UAOC 4C56A 4X4YB 1FYHB 1U8KB 1TQUA 4B97A 1NMCB 1OPOA 4U1KA 1OHQA 3FQUA 1E6JH 3EW3B 4WWID 1KGIA 3X14B 5IBTH 3BCFA 1CICA 1QFPA 5I17B 5JORB 1F86A 2ESVE 2NYYC 2H6OA 3GJFK 2LHAA 2W9EH 5JIKA 1CJYA 2VMDA 1W72A 1QUNB 5CCHE 2BIPA 2WWMD 4JDVB 1BJ1H 2YARA 4FKEA 4OCNC 4OCXL 3C2AL 1NLDH 2IDSA 3RB5A 5TPWH 4RX4A 3QPQD 2D7TH 4X9BA 3D4YA 2W9LA 1KZQA 4H88L 4K23L 1YECH 3DETD 4QHMA 1S7VB 1KLFB 1MCQA 3HC4L 1U42A 5GGSB 1BREA 1WWCA 3K4DA 1LHZA 2EYSB 3FK3A 4G9FB 5C09B 2H2SC 4BZ1L 3F85A 1MCCA 3CFJA 4RAUA 3V6ZB 1TQCB 1Y07A 5GS3A 3AMKA 5I0ZA 3MRCB 1DZBA 3DRTA 5J12B 1PKQA 3GIZH 2DL9A 3UO8B 5F7YC 1Q0YH 3WS6C 2CHNA 2IBBA 3P3SA 2EDTA 1I3VA 1OM3L 5AYUH 4GRMA 1EDHA 4ZMYA 5HHXH 1THCA 1XEDA 4K3JH 5CCKL 1QEWA 3S3CB 1XIWA 2B4CC 1NC4B 5AVRB 4LAJH 1F2XK 3V4PH 5HYQA 2W1NA 5F7DA 3RAJL 4E0RB 1YYMH 2F5AL 3QQ3B 1ZPLA 3Q2WA 2BH0A 4OF6A 1KBPA 3NYKA 4NP4H 4U3SB 1G84A 1RJLA 2XPYA 3A4AA 3APCA 4FQPA 8FABB 1U8IA 4QY8B 1R17A 2VSCA 3OZ9H 5IQ9B 5GQBA 4MD5B 3QFGA 5LBSL 5FXCH 1RZIA 4UB0H 3VXRD 2XYCA 1XDTT 2FX7L 4KO7A 5C9JB 2Y7SA 2JSFA 1ZHLA 2NDGA 2MQ0A 5HDWA 3QCVL 2NY2B 4MNGB 2YN3A 3TNNA 2JJUA 3A6CL 5EOCJ 5D2LA 4QOKA 4DKDC 1DQVA 4UQ2B 2ICWB 1MH5A 4PY8J 4TSBH 5I6LA 3PL6B 3MLWL 1NCJA 5EUKA 1IBGL 3TJEL 4LXFA 5I1KL 3IPEA 4J27A 5D1ZD 1CICC 4I9WE 2YEZB 4FOMA 4TM9A 3MDJA 4XVJH 4ZPVA 5L2KE 4XWGH 3QI9C 4LRIC 2BSSB 2JXMA 2NQ3A 3CPLB 4C47A 4ZAKC 1XGYH 1Y6KR 5FYJL 4ZUTB 1GS8A 2YHGA 5HDOA 5C2UB 2O26U 4XPBL 1QNZH 4OFYD 5DFAA 3L3DB 2VDOB 4OZFG 2DYPB 1WC7A 2AKRB 3L4VA 5DEFB 1NZRA 3P0GB 4YDKH 3RY5A 1B0GA 4BH7A 1ZLSH 3T3PF 4WTWA 4L8SB 1CQKA 3RFRA 1ADWA 1Q0XL 5C0BD 1GZPA 5IEKB 3QE5A 4AM0Q 2Y1ZA 1DVFA 3F00A 5KANG 3OZKA 1T89A 2Y72A 3QUXD 4U3CA 1KYAA 2DL2A 3HPLA 1JYVA 3C8KA 1RUPL 3PABA 3VFUB 5C0ND 4XZUA 1TQBB 3HZYA 2DF3A 4EIBA 2Z9TA 1WIOA 4GW5B 2IAND 5F9AC 2XXFA 1JV5A 1QTYT 3DUUB 3ETBJ 1DSYA 1YEDB 1PCSA 3QIBB 1IAIL 3LYRA 2WZ6A 3FS9A 5DGQA 1ZA3B 1U93B 2WBWB 5FUCE 4J3UA 4HH8A 4MA3A 4YPJA 3CQPA 3T77A 4BSVA 5E56A 3UPRB 4DN3L 3ARGB 2P46B 3IKCA 3L7EB 4XHJC 1AXTL 3ALXA 3WLBA 3TV3H 3SDDC 1WLHA 3OHXC 2Z6FA 1RK7A 4N0YH 3R06A 3RZWA 4Y4KB 3F7YB 4ECNA 1KTDB 3C6LB 2TRYA 1UACH 4FDWA 1KEMH 3IKKA 3PXLA 1LYQA 4N68A 5CR8A 1CGTA 4HWBA 1TMCB 3VCLA 1H8LA 3G5WA 5KSUB 1A3RH 1OGTA 5MENA 5EEWA 5JPNB 5DMGC 4UNVA 4EBQL 5BQ7B 3VB8A 4EKJA 1E7VA 2GSGA 1AMYA 2N4IA 3ARED 5ITBL 4GKSB 2JE8A 2X3CA 2XFXA 3PIQB 1VCAA 2HFGL 3BT2H 5EU5A 5LCVL 3HNSH 2I26N 3PWNB 2EXYD 2J88H 4IIZA 1KN4H 2B1AL 4PV8B 4KUZH 3CHPA 3HNTL 1N9PA 4YOKA 2ARJB 1PAMA 1VGEH 2VTFA 3DX9A 4HISA 3RWJB 1TTAA 2LFEA 4LB8A 3WKYA 5FYLH 4HUXB 4KJQC 5I15H 4F7EA 2VMJA 2AV1B 3DGDA 3T2NH 3VWKD 2BHUA 2EXWD 4KNSA 2F7QA 4EN2A 4MCYA 3SY6A 5I1LA 4YDIL 2AMUA 1A4BA 1O6VA 5DVNA 3L3IB 4KU1A 5MEQA 5DRWA 3TTSA 1VEMA 3POCA 1WD8A 2W0PA 5HHOE 3IDYB 1AS8A 3FQTA 1ETB1 1IM3D 2HFEA 2QADC 3SE9H 4TVUA 4APQB 4P4KD 1WWWX 5F6HJ 4XAWL 1P2CB 1S7QB 3VRIB 1AXSA 1I1AA 3IFOB 1R75A 1YEHL 1H5BC 2VDPH 4IRJA 3WY2A 1N6UA 2X4OA 1AZNA 4M48L 5CJQL 2H41A 4OIBA 2EDRA 1QRNB 3NGBC 4LCCB 4QWWC 1AZCA 2ESVD 1Z7JA 2EUZA 3WFHB 2BWDA 4OBSA 3UYRL 4OFIA 2ZXBA 4JRXE 4ETQB 3GMOB 4HETA 4PJ9C 1QWHA 3BDXA 3WIHH 4CC0A 4R5XA 4QXGH 1MWOA 2VZVA 3VSUA 4TSAL 2NZ1A 2GY7B 5AQ0A 2CQVA 1VACB 2WBJD 3IMUA 1Z2KA 3QHFL 2WVTA 2H32A 2R2EB 3CFDB 1OGSA 2ZKHH 3FTGA 4ISVA 4UT7H 2CO7B 2UY7B 3S9DB 3RI5K 5TFSH 3KYMA 3MXVH 1P7KB 2IFGA 2JKWA 3WNJA 1F3DH 2GTWB 3WY4A 4LESA 5TK4A 1ZAGA 2HT2C 4BCXA 1BSIA 4DTGL 5D6DA 1OE2A 5AOKA 2NXZC 2QVMA 4MMXA 3L16A 4W6YB 3T0BA 5J4MA 1QLEB 2P8PB 1MVYA 4B5EA 5BQDA 3BH8B 4ERSH 4L0PB 4IBYA 4ETYA 2R1WA 3MRHA 4FYSA 2YPVH 4KHXL 5A16A 2V8LA 5J13C 4F8TA 3V7AE 3CMGA 3QXAA 3MRBB 2WXIA 3FZUC 3P69A 2BLFA 3ZVVA 2Y24A 2ZYSA 3H6AA 3KWWA 2IDFA 3IFPA 4KK6C 4RMVA 3MKKA 3NG5A 3QEUA 5FK9A 1AQ8A 2EEFA 3L4YA 3EJSA 3INOA 3PWUB 4HMDA 4HUNB 5KN5B 3P4OA 4Z0XA 2ZAGA 2HPTA 3FFCE 4H8VA 3FO0L 3BDYL 3MRKB 1BBDL 1AZUA 2FGWH 3GSQB 5I18H 2A74B 1BFOA 1NKOA 2OMTB 4QGYA 1AD9A 2WUCL 3FRUA 4QHUB 2K3HA 5FW7A 3W81A 4S1RL 3LN5B 1FNFA 2VE6A 1TQVA 3FFDB 4XTRC 1OOAA 5KUMA 1PJ9A 1B6DA 3G08B 4DUWA 1KZYA 4URKA 3LKQA 1L7IL 1FZJA 4M93C 1BPLB 3WUWA 5INCB 3M7OA 4S0TD 2CHXA 2IDQA 3WN5A 4I9WD 5HHNA 6CGTA 5L2KD 5I66B 5E5UB 32C2A 5DRNA 3PPEA 1GGYA 2NTSP 1LE5B 3CZEA 4XMXA 1NAKL 3C5ZA 4D0DA 1ZGLA 1RUKL 1AHMA 3HE7D 3IAPA 5ECJE 4Z76A 1V8HA 1XQ4A 5DHEA 3DV4A 4G42A 1IJ9A 1FP5A 2PR9A 1EEZA 2XZZA 3C60C 6TAAA 1UWFA 5D1XA 3ZL4L 1JI1A 1XVSA 4DP7X 4MA8L 4RISL 1DQML 2C3VB 4X4YA 1MIMH 2VL5B 2C8NA 4NPKA 2XG5B 1NINA 3EJJX 4D3CH 3BH4A 1ECYA 1IM9B 3MRRA 1MWAH 1BMWA 3SPCA 1RAMA 5A7EA 1FCCA 2LLNA 4GQRA 4MMXC 1X9QA 4EMZA 1IMHC 4KJPD 1NPUA 3C6SB 4OIFA 4XWOC 3QEGL 1MJJA 1E9PA 2J1KA 2CU9A 3H9YA 4JFTA 4K15A 1H6TA 5L9DH 3ZMEA 1VB9A 1WIPA 2QEJA 1U8PA 3DOHA 2BWIA 2JIXA 3DVGB 43CAB 3D1MC 1YDPB 2P28B 2WQAA 3HE6D 1UOVA 5GS2D 4QF1B 1N5YL 1AQDB 5AWNL 4OF7A 5AW6B 5FDWB 2QQKL 1SVCP 1MCKA 2FQDA 4EO5A 5DC9B 2IH8A 1BVOA 3D2UD 1U95B 4XP1H 4AZUA 3F7KA 1JWMB 3IDJA 3LQAL 2YRLA 4K3EH 2V0AA 3SCMA 4M4PA 1T5XB 2X4PA 4BWTA 4B27A 1ILUA 2CDGA 2WLHA 1MI5E 3V4VB 3D3VE 4PRAB 2XN9E 5TDNB 3PCYA 5HBBA 3COOA 4PRHA 1OSEA 5CINL 2CA3A 4Y2DB 3V52L 3UZEA 4PGDB 1UADC 7FABL 1NLBL 5AW3B 5C6WH 3TBWA 1ET8A 3EH1A 2QVKA 5H37A 4NWTL 1XF4A 2FYVA 3L3OB 5IROC 2D73A 3SZKC 5K9JL 4LRNL 4P3DA 3GK8L 1RZ8A 1BBJB 2N1KA 2RJMA 3C5ZC 4PP1C 4W70A 3WJMA 4A6YH 2GK2A 3N85H 4ABWA 3QDJE 5IJDC 5MERA 3UP6A 4X9HA 4H8WH 4YHKH 1XCXA 1UKSA 2XIDA 1CYGA 3B3IB 2XV6B 2J1XA 2BS9A 4XBMA 3D0AA 1MQ8A 4GXVL 4H26A 4DO5A 1NMCC 2NXYB 3FHQA 2V9QA 5HHOD 3PL6A 1E7UA 5TQ0L 1IGJA 1EEYA 5GSRB 3TN0A 3UJTL 4CAGA 2HTKC 1WGVA 3R0MA 3D5OF 3RTQD 2K4WA 4MB5A 2DQHH 2ZCLH 4N8VA 4JZOB 3O3UN 1T0OA 4O02L 4MRBA 5KVFE 1NGPL 4E41A 2Q76B 1L7TL 4GW1A 1BQLL 4CUCA 1RJYB 1XHHA 4ZUSB 2AKRA 2IPTH 4BINA 4IRSB 2BXYA 1MW2A 3GUTB 4TVPL 3AACA 2Z91B 4JRXD 4XPFH 2OJZL 3U2SA 1PLCA 2WWKO 5I6KA 1TQCC 2JCCE 4LOUD 1MHPL 3V6OE 1TJMA 4O2FB 5J12C 1DBBL 2WWOA 2M1KA 1OTUC 1P7BA 2HFFB 4KY1L 1BMGA 1HILA 5ANMA 3GMNA 4KX9A 2AAAA 3SIKA 4I0CC 5K9KA 4NZ8A 4LF3A 1PZAA 4V1DE 3VI3B 4ELKB 3OKNB 4JPVL 4QLRA 5IBLC 2CLRB 2KH2B 2D7PA 4P5MB 4GPVA 3EOAB 3H0TB 1YEDA 3WFEH 1YAZA 3DRQB 1I53A 3T8XA 4U33A 5E1AB 4PRPE 1ZA3A 2R27A 3UZEC 4OLEA 5IFHH 1DE4A 1QLFA 5ICZA 3LMJL 5HHQA 3TZVA 3UPRA 5E6IB 1PFOA 4ONGH 2W0FA 2WXPA 2GABA 3ARGA 4Z7NB 3HZKB 1NMAH 2X1QA 1M3JA 3L7EA 1J88A 4UQ3A 1OP3K 4HIIB 4KQ0A 3B2UD 3EGSB 3N91A 4UDTB 3WEXB 2FWUA 1O0VA 3DMMD 5ADOL 1K6QH 2AQQA 1F4XH 1W6LA 4Y4KA 1N6QH 3OMAB 1KTDA 3ARUA 4MNHA 5F7NC 2NY2C 5DK2A 1KG0A 1S9XB 3B8YA 2WNKA 3I6GA 3L9EA 1BXXA 3FFCD 3UBXA 3TC9A 4PIBA 1D2PA 1E8XA 2DQMA 1J9SA 1JMZA 3MOBH 1NCCL 1BPVA 3PL6C 5JPNA 5D70H 4HS3B 3OXSB 3TXAA 4AJ0A 5BQ7A 1R46A 4J6IA 3FO2B 4IEFA 4V2BA 3ROOA 5J06A 5HI4D 4ELMF 4GI8A 3PIQA 4XN8A 5HJGA 3ECUA 4LP4A 5DK0A 5H2BB 5CP3A 1SYSA 3GXDA 2QSCL 1FG9C 3PWNA 3DOSB 4URTB 1KXTA 4OM1L 4XCFL 4Z18A 5AW1B 1M7IA 2F54B 3KR3L 2ARJA 4BUHA 3RWJA 2RAMA 1CI3M 1EEUA 1DL7L 3BDBA 5E4IA 1AHWB 5GZND 2CZNA 4B0MB 3ELQA 3CZJA 4XCNA 1FL5B 3V0VA 4BUGA 4L8SC 5DHVB 1U2CA 5T1DL 1XCTB 3GHEL 4WWKD 1JHTB 4NBYB 2MNWA 1FZKB 2VC2H 4FRWA 4JZJB 4PJFB 1K8DA 4KXBA 3U25A 2VLRE 2CMRH 1CE1L 4ZW6A 4BFIB 5FGCB 4I2XE 4M5YL 2VDQB 1DUZA 5AZ2L 4ZMPA 2ED9A 3VFOA 1CF8L 3IJ8A 4TLUA 1P2CA 1S7QA 4DGIL 1BYPA 2BFVH 1ADQL 4KMQA 2XWCA 3WNKA 1QEXA 5DRXB 1TQBC 2G5BA 1TETH 5EFIB 4ZFOL 1P7HL 1AGCB 3FT4A 1JNHB 4FQCL 1OZTG 1CT8B 3VU1A 2WGXA 3QIBC 4JM0A 2IJ0C 4N9OB 4JDEA 1NSNH 2R0WL 2WIMA 3B9AA 4J12A 4NQXB 1CYXA 3WFHA 2DIAA 1A7RL 1BOGB 2J8UE 2SEBB 3MFGB 4FNTA 1TQTA 4AH2B 4Y5XA 1N7MH 2F74B 2VRQA 4HJSA 5JXAL 2GFBB 4JFSA 3TEWA 3A6OA 3B2MA 1NAMH 3ARGC 3OHMB 5CS7A 3S96B 1J1XH 2VJ0A 5EUOF 1EJOL 1ZTMA 3HG4A 4HKJA 2YXVA 2OSWA 3MUUA 4W9CC 5BZDB 3X12A 2A6JB 3FUEA 4Y4KC 3C6LC 2YLHA 5FA4B 2OP4H 5DJ0B 5HDQH 4NHCH 5EZOH 1FZOB 4OD2A 4C57C 4OCSH 2R0KH 4PM1A 2GTWA 4Z7UB 4WJ5B 1TZGL 4XVTH 4DQOL 1IFHL 3IN2A 3BAEL 3K2UH 4JRYE 5JPNC 3N9GH 5IHWA 5IFAL 4YHZL 4OAWA 3BH8A 1SY6L 2CRMA 3EYQD 5IB2B 1OP5K 4AG4H 1MI5D 1IE4A 3D3VD 5ILTH 2EO7A 2XN9D 2YSSA 5FS5A 2QMJA 3QT2A 4PRBA 1R0AL 2QVFB 4G8FB 5LWYL 3OPZH 3CFMA 4Y1AB 5JR1H 5I6OA 2JV6A 3HHSA 3TH2T 4U1HA 1DQKA 2GY5A 3VM5A 5KN5A 1YQVL 1W0YT 1I3UA 3O8XD 1MG2C 5FFOA 4MBRA 1M53A 3MQIA 4FXGB 4EJ1C 2WC7A 2JCCF 3S2AA 3ZTDC 1YMMA 1PZ2A 4WU7A 3IDYC 4NNXA 4KI5E 4EZMA 2BHZA 1PAZA 1UWEL 2NY3D 3LKPB 4N1EA 3QYMA 1QWNA 1I8MB 3QDJD 1R3HA 2JQZA 4LHJB 2WXHA 5GHWL 3VFNA 3I50H 3OKOB 4APQC 3S7GA 4QHUA 3G5XB 3MX0A 4ICXA 1CF1A 4PMEA 2NYZA 4OLVL 3QK0A 5IP4A 3MV7A 4J3OC 4GBXD 2IBGA 3EYUL 2EXSA 2D8KA 4YUEL 3QH3A 1IC7H 4U1JA 4Z0BL 5ICUA 4LCCC 4O9HL 5H4ZA 1TQWA 1QR4A 1CFVL 4FXLA 2HLFD 1CE6B 2QGBA 3C12A 3S3DB 5I66A 1KPRB 5BMFH 1PD6A 2G75B 1E4WL 1CU4H 3NMEA 5E6RB 2YGQA 2XN2A 3KDMA 1MW0A 2FIRT 5T1KA 3VXRB 1ZOXA 2LTQB 3W11D 3S48A 5JQIB 2W94A 5E0QA 1I9EA 2DQGL 5H94A 3WGVB 3WN6A 3ZPDA 1I1FA 1ZV2A 4QD2E 1F42A 1VGKA 5GS1A 1MCEA 4ZFZA 1RU9H 2X4QA 1G43A 2MFNA 4ZDHB 2E4FA 1EXHA 1VIWA 3RWCB 3UTPE 4XBEH 4JZNB 3STBA 5DRZB 2ZD0A 4UT6L 2VXQH 3RJQB 4DFHA 4L1DA 4OCWL 5EPMA 3FMGL 5D1ZB 3D09A 4V1DD 2I7SA 3LIZA 4X9GA 4TOYL 2N01B 3QZPA 3LZLA 3OG4B 2XWBB 5B1AB 3CVCA 3PHOB 4LSSL 4HEPA 4MX7B 4X8XA 1UM6H 4PRPD 3HC0B 1HQ4A 3TJHC 1JTTA 43CAA 1QA9A 4FCHA 4PTUB 4NDMB 1YDPA 3VD2A 2HVKB 1A7NL 3BSZL 1GHFH 4QF1A 5F3HB 1HHKB 1FC2D 3RUGE 1AQDA 4W9GC 5IESL 4ZSOB 4WFHE 4HUMB 2ED8A 4KO9A 4Y8AA 3WUWG 2A6DA 1MRFH 1ZGLM 4GXUN 3QUXB 1LDSA 4Y5YB 5C9KA 4YXHL 2A74C 2XRAL 1NGZA 1R4XA 5DFWH 1FPTH 2FEEI 4N0FB 4IMLB 4OFVA 2DLFL 1JZ3A 2AEQH 3V4VA 1VSCA 2C1OB 1F6LL 1JPTH 3QR1A 4KKZA 3SKMB 1QZ1A 1KXVA 1OAUL 2CK0L 2IANB 3VI4E 2FZ3B 3X11A 3LNIA 4PJGE 1LE9B 3WXVH 1A21A 4G8AC 4F58H 1HSAB 4PJEE 3ESVF 5L6YH 5FM5O 3O6LL 4N6QA 1QBLH 1WZLA 4PJAB 2IQ9L 4LBEB 1J1OH 2OZ4H 3PHQA 3CVHL 4P9HC 1YN7B 4DPAX 3H4HA 2X6VA 1R5WA 2J8UF 3P73A 4EIZC 1MXGA 3WBDA 3AQXA 1M7UA 1KTLB 4I88A 4M9OA 2VITB 3LV3B 4FQIL 1IC0A 1S5HB 1ZT1B 4XH2A 3T3PB 5DMYA 3TO4D 3EJTA 3NA9L 5JTWA 4OGXL 4J5VA 3VQMA 1CURA 3O6MH 3GPEA 1KGJA 3DC0A 1JNLL 3B3IA 3MUY1 2XC8A 5L4MA 1CXEA 2DMCA 2FJFA 4YMPA 5F9DC 4OZHE 1RZKL 1AOHA 3EBGA 2VLRD 2CNZA 4GKOA 4HT1H 4RFOH 2V8MA 4O4YL 2I32A 1XAKA 4PJHE 3MXWL 1CS6A 5F70A 1VRSA 2VR6A 4A7VA 4BFKA 5IF0B 4HJ0D 1LEIB 4RWYL 1E5BA 5DDHA 3CQFA 1T4KB 5E2VH 3OAUL 1A7OH 1BM7A 2JKXA 1WV7T 4R5VA 1T1WA 2PPAA 4L9LA 2AJXL 2BCKA 3RIAK 5LVEA 3U0TB 5E00A 4P5TD 4N8UA 4U6YA 4ZNEE 5F1IB 1LMKA 3IGKA 2CBQA 2OMXB 3Q13A 3VWKB 1N70A 2P24B 1TJIL 4XNQB 2FIKB 3KVDD 1PSKH 3NFSH 1UQSB 1PY4A 5EOCL 3UTTA 4QXVA 5E5MA 3VE0B 4O2FA 1IGFL 4BFBD 3V9EA 4DESA 5IJKA 5GRUL 5C0CE 4WFFE 2AEWA 1IM3B 4MQSB 4LPCA 1G7PB 4YS4A 1O75A 2HT4D 4P4KB 2DKMA 1GYUA 1VEOA 5DZJA 3CXHJ 4KV5E 5HGBB 5I23A 3OF6A 3KGTA 4JN1L 3QDGE 4ELKA 4Q6IB 1EPFA 4UQDA 4OCMC 2BERA 2NNXA 5CD5D 1BJ8A 1KXVC 2A77L 3Q5OA 4JFFA 5D7EA 4HUVA 2J2ZB 4JRYD 1OW0C 1KBKA 3Q9QA 4Y2DC 3L2MA 4UOQA 1TZ8A 2ESVB 1A64A 5F8QC 4NIYE 2B77A 5ISZE 4S1SL 1MCOL 4GNKB 2EH8L 2V2WA 4YXLH 5E6IA 2Z4QB 3A5VA 1DYZA 2YJQA 2KUTA 3L3OC 5TE4H 3KYKL 4DH2A 4XNZB 1TJGL 2C1PA 4R3SB 3QZWB 4TLSA 4W9JC 2CKBH 4N8VG 3R7RA 2WBJB 1DQLL 1N64L 2DN7A 2IFFL 1JZ2A 2AEPL 1ZV9A 5DTFB 5JHLL 2WLLA 2RQ8A 2PTVA 3LSOB 1AIFB 3VG0H 2QLVB 1N5AB 1EA9C 4HCRH 4OLYH 2NXYC 4ODHL 1HXMA 4BFNA 4KI5D 5JZ7C 3QYNA 2X3BA 1E3XA 1FV1B 4L3EE 1U0QA 3NJKA 3PWPE 4JFDE 1AH1A 5KYUA 4ODXA 4CNIB 3DARA 1RY7B 2DLIA 3I9PA 2JKIS 1XCQA 2C9VA 4BQ8A 1JPSH 2W95A 4NRXA 3HAEA 4K7PH 2PCXA 5MI0B 4G7QB 4PJCF 1V27A 1KTKE 1BQSA 2E6JA 2PW2B 4A7TA 8CGTA 3QPXH 2CDFA 4IRSC 5I73B 4K07A 1FQ9C 1OCCB 5FHAL 2J57A 4C4KO 1RP8A 4RESB 5A43C 1YEKH 2QVTA 3RVVC 1IAOB 3N41F 4YBQD 4W4OA 3OTTA 1LM8V 4APXA 4UDUA 1PG7W 1HEZB 3BH9B 4ONHA 3RUGF 2UUDK 3JWOH 2C9SA 4BFIA 3OAYH 1ACZA 1NCDH 3IS0X 1UURA 2UZIL 1DCEA 1LNUB 2VRAA 2AAVA 4GG6E 6FABH 4KPHL 2D03H 1S7WA 5DSCB 4Y4FA 1MG3C 2B39A 3UTPD 3GQFA 4MJIE 2WXLA 3AU1B 4Q0XH 5DRXA 4E2OA 2E3VA 4FG6C 2A1WH 4Y5VA 3STLB 1AGCA 2FBRA 5FOBB 3VYPA 1QSFB 3JYCA 2WLJA 2LE9A 2C3XA 1CDIA 1BJ1J 4LASH 5FCUH 3VI4F 1CDCA 5K69A 2HJKB 4PJGF 5CEZE 3V0WH 4NQXA 1NBZB 1W16A 5L2KB 3LTVA 2J73A 1BOGA 3MLVH 4JFEA 4MNQE 3UBXG 4PJEF 5GS0H 1F5WA 1EHAA 1SXSA 3P4MA 2WXFA 5I1IL 4P57B 4U2YA 5E6IC 4XPGH 1A6UH 5SWSE 1RUQH 1A7BA 1AY1L 5FKAA 4AK2A 2DWDB 3UC0L 5EEYA 3NP4A 3RL2A 1JZ5A 5D71L 1JZ7A 4NIKB 5DS8A 4FFTA 3TWCL 1N4XH 4MJ5B 4FADA 4KKCC 3HVNA 5IZ7A 4BZ1A 5FA4A 2XWTB 2LLGA 4TQEH 4WFHD 1LWJA 1FZOA 3U9PH 2RCSH 2VDNL 4XC3L 1FFPB 4OZHF 4B9IA 3FFOA 4XCEA 3HN3A 3QXTA 1Z3GH 5JYLA 1BAFH 4L8BA 5E2WL 1U8JA 3JWNC 4PGCA 3SY0A 1DVZA 3HRPA 1H3TA 1HZHL 3LKRA 4AV0A 3N04A 1AR2A 3K81A 1D9KD 1I4FA 4K94H 5SX4H 4MB4A 2EVJA 1H0DA 4TNWK 3GO1H 2IWKA 4HGKC 1TITA 1BF5A 1JZ4A 4YDMA 3ZSSA 4Y1AA 1I7UA 4Q6YA 1T2QH 1UZ8B 2P43B 1ZD6A 1AHWC 4U6VL 4DUXA 4HC1A 1UVQA 1S2EA 3ZRSA 5IB3A 3LAFA 2AJVH 1XD1A 4JKLA 3HE6B 4NRZA 5HHPA 4NKIH 5D7SL 1JSYA 3IU3B 4LHUD 4WIQA 4YGVA 1SXNA 4JZJC 1TNNA 4MSWA 5LBSA 1M56B 2HJLB 3SGKC 3E1ZA 3LKPA 4LSVH 4YDVA 3MI6A 3DX8B 1CFTB 1U8OA 3S5LB 1NCBH 3FBKA 1WZAA 3KL3A 2J20A 4KV5F 3Q6GL 3LXCA 5JIHA 3ULVH 1S78D 2J21A 5I6XB 3C87A 1MFEH 1Q9LA 3EO1A 1UJ3A 1XAUA 2GIMA 1YJDH 2R29H 3MJ9L 4RGNE 3MV01 2MPVA 4XNUL 5EBGA 3SDCD 4R8WH 4ATTA 2O5YH 3DHPA 3OC8A 4N24A 3WD5L 3PFUA 4F37F 3BKML 4L37A 1FVDB 1U8HA 3ISYA 1KBBA 3AT8A 2AZUA 4FG2A 2N56A 4NN7B 1JFQH 2Q7YB 2BVTA 2K1MA 3CSTA 3H9SE 4J2QA 4AIXA 1BM3L 4J1UA 1E5YA 2O30A 1XB8A 4TL4A 5CKGA 1GJUA 2BIMA 4MHHI 4A1RA 2FYYB 3EBAA 4BE5A 2RACA 1IE5A 1LK2A 3NCXA 3NSFA 3N55A 5CZKA 5EU3A 5DRZA 5GRXG 2QELA 3LEXB 2OFQA 5D4IA 3FQXB 1IFRA 5HHOB 5C0CD 2KLTA 2CPUA 4WFFD 2A6KA 4LDCA 2X38A 5FYKE 4X6BA 3RTQB 4MCMA 4MAYD 4WI7A 5TDPA 2Y2YA 1XB3A 4NXSA 1T4WA 4FYRA 2WLMA 3NIGB 4WZ9A 3QDGD 4W9KC 3QUYB 1MCWM 3F7LA 3IB4A 2WWMC 2EUWA 5KSVB 2BVQB 2WTPA 3VGGA 4KRPD 3QPQC 4R4BB 1UXSA 2NDFA 1ZA6A 5GZOA 2YQGA 1SNRA 3DETC 3PAZA 1DDHA 2WCPA 1CDYA 5IVZA 5ISZD 2E8ZA 4PTUA 5HDBE 2H26B 4N3UA 1GIGH 4JRXB 1PQZB 1WFMA 3ILQD 4GAGH 2PTTA 2EDJA 3FH8A 3KVPA 1BQRA 5I26A 3NIDE 3L5IA 4FXGC 2YR3A 4FLSA 4J3WA 4HSCX 3US1A 2G60L 3S4SB 2APVA 5IJCC 1URZA 1MCFA 4Y5YA 1HL4A 1TZIB 2LGNA 1T1YB 2GSMB 3NH7L 4RMSA 3BZFB 4NQEE 3C75A 3TCLA 4AUYA 3RZCD 5DC0A 4I3RL 1CG9A 4GG6F 5AZEL 1DQDH 3SE4C 4IMLA 2FR4B 3FRPB 4X8GA 5K39A 5DJYB 1BVNT 1OF2A 1B3IA 2XPGB 4YHLL 4E68A 1H6FA 2R39A 3RWHA 2R1YB 1WBZB 3L5JA 1LE9A 4ZTPL 4L3ED 3HHRB 2DQTL 4LLQB 2J6WA 3PWPD 4G6KH 1W0WB 4JFDD 5E5RB 2WQRA 1KN2L 1JRHL 3OSVA 4PJAA 4K9JA 1U8QA 2PCPB 2NX5A 3R8QA 2HKAA 3QORD 5CEXB 4G43A 3ZE2E 2ZX5A 1GW6A 2FLMA 2MCAA 5LCVA 2Q7NA 1G7IA 3FN0L 3LV3A 1AKJA 1S5HA 2YAPA 2Q8AH 1XGRB 5CFAA 3QO0B 4G1MA 1KGCE 2LTQC 4PCKA 1PG7L 1TZHA 2ZG1A 2APWA 4HLZH 4FTVA 1UCBH 3DMMB 4ODVL 4QTIH 4WLCA 4KBPA 2VOTA 3V4LA 2BMKB 1CD9B 4YSTA 4F7TB 4N28A 2UXVA 4WKZB 3LKNB 4YDLC 2H0EA 3FFCB 3I85A 1IAMA 5I8OH 4HEPG 4PS4L 5C92A 5I5JA 1OSZA 1YNTF 1J0JA 1KPVB 2ZXAA 5LUMA 4ZUWA 3GJFA 2AQ2A 1S3KL 2RTTA 1P9MA 2DIJA 1FDLH 3FQ4A 4G70B 1ACCA 1FGNL 1LEIA 2IWFA 1OSPL 5D1ZC 1ACYL 2ADFH 3BAIA 5F9JA 5TE7H 4MJID 4QXTA 3BAKA 4YHOH 1N10A 1G6RL 3U7WH 4EZJA 2ZUVA 4ACPA 5I28A 4NO5B 1CFBA 1EBPA 1MPAL 4H13C 3IBOA 3TBTB 3LQZB 3W0WE 1U8CA 4QTHA 4ZFOB 2ZUTA 3SDYL 4UTBA 5H35B 2DB8A 4AC2A 1KYFA 2CDEB 1NH6A 5F1IA 5CEZD 4K5PA 4XN1A 4LPVA 3HUJA 3U4BH 1WCQA 2OMXA 3HZ3A 2XZQH 4MNQD 1RZJH 1FE8L 2Z8RA 4JMNA 4OFQA 4XNQA 2PO6D 1CFQB 3D85B 4WWKB 4AVIA 1ZEAL 3WKNA 2VQTA 3OKMA 5SWSD 3VE0A 1AQHA 2VDRL 4HIPA 2Y7MA 4RAVB 3D12B 4M43L 2OZNA 5IW6B 1H3PL 5AL8A 1YRKA 3QUMB 3QUXC 3UPCA 4Y5YC 1A9EB 2BS8A 2GB2A 3BLPX 3VYOA 4ZZFA 3K72B 4WI6A 1T1XB 3U9UB 5CN3A 2IDTA 1F90L 3V6FB 4BZYA 5C0NC 3BAWA 1GGUA 3ARXA 2F8VA 4AGOA 5JMRA 1RHHA 5EF1A 4BKSC 1T21B 3VJ6A 2H9GB 1TO5A 2GTZA 2P5EE 3UAJA 1JF6A 3UFIA 4X7EC 5HY9A 2Q87A 1MHHB 1EGJL 2XWJA 1A2YB 2JTYA 2N3JA 3M17B 3MUGA 2EYTA 2F08A 5E7FA 1PZ5B 1YN6A 2IEPA 4GMTL 4JPQA 2DJMA 4PB0H 2Z4QA 4LLDA 2BX5A 2XU9A 3VFSA 3CXFA 2FO8A 2Y06L 5L2JA 4Z95L 1ZVHA 5KSAD 5J6HB 2VR5A 1RFDH 4R84A 3P11L 3QVAA 3PAUA 4TQ8A 1JTOA 4G5AA 1VZGA 4RNRA 4PS7A 3EXJA 3QULA 1FL3A 5DTFA 2X2IA 2HZHA 3IXAA 3T1FB 3NDZE 5ENWA 4DGYH 2FRGP 3ZHNA 5IG7B 4EVNB 4DJMA 1MF2H 4I89A 1DN0B 4CADB 4HC1H 5DD6A 1P4BH 2ZP9A 2OQJB 1MDAA 2DLGA 4YN3A 4FCAA 3Q44A 4JM2D 1BDYA 3MA9L 4XB3A 4KVNH 1QPPA 4G7YH 3QEHB 1MI5B 3D51A 3HFML 5LBSH 3D3VB 1DBAL 3UJIL 1MCPL 1PZCA 2EXYC 4NZRL 3W82A 3WCYA 4X6FB 1G9NL 4Q4EA 2A9CA 5EU4A 3S8FB 3WAKA 1LP9A 3SJVA 3LRHA 2J5LB 4RGND 1K2DA 4DETA 1G7QA 2A9MH 1EAJA 3VWKC 4XR8C 1GSMA 1EXGA 3LVTA 4FFVD 1S6NA 5HDBF 1AR1D 2JJSA 3IF1B 3O8XB 2JB6B 1B4RA 2J8HA 1CIDA 3F3HA 4GRWF 1E9OA 1B9ZA 3TNMA 2NR6A 3DX6A 1R3LB 4CBPA 1DBJH 3KPQB 3H9SD 3MLSL 4YSRA 3WTVA 3K0YA 3REVA 1L3NA 3NIDF 4WV1A 3R19A 2NY3B 2DMHA 3PGDB 2CKNA 3QDJB 3SBRA 4HBCL 4P4KC 3ZYIA 1T22A 2DH2A 4PQXA 4LEOA 4X5XA 5DSCA 4DVRL 2XZCH 4B7IA 2F5BL 3E8UH 2DJSA 4Q6IC 2QQLH 3OQ3B 4FQLL 4GMSH 4OVVA 4XPBH 4JGUA 3MCLL 1QSFA 1MNUH 5FYKD 3RGVB 4WTQA 3CFQA 5CNHA 2OM5A 1NKGA 2HWZH 5D5MA 1MQKL 1IX2A 1ZS8B 4JNXA 4BFFA 1SVZA 4HALA 1UD5A 3TEXA 2EECA 3HG3A 4P59H 2DJUA 1CGUA 1AZZC 5T1JA 2VISA 4M1DL 4NKOB 1UWYA 1I7TB 3ZE2F 1XF2B 4UM9A 2YUZA 4XNZC 4HLZG 5E95B 3WMPA 1QSZA 1ONQA 1J8HE 2GYSA 1E8WA 3NIFE 4XCYB 3T6WA 1JZDC 1LO3L 2KI6A 4OIIL 1DVYA 1OQXA 2WBJC 2ZOKB 4H40A 3HI5L 4LL4A 5AB9A 3GYRA 1KELL 2JCCB 5K5YA 2B4CH 1A6TB 2EABA 3MN8A 4AEHL 1NFIA 4DK3A 4K9EL 1FFPA 3P77B 1NGQH 1JAEA 4HKBA 2LU5A 2GW5A 4QXWA 3VD5A 1O7DE 1SFHA 2GBVA 4GSXA 5D7IE 4HHGA 2BK8A 1KBGL 3D69B 3ZMNA 1TYJA 5D7HA 4NQED 1SHSA 4KXDA 1AKPA 2GG1A 4ZXBD 3P3RA 4V1DB 3LH2H 4LKXA 4PGBB 3PUUA 1FC1A 3SOBH 3MRGB 4DN3H 1X6NA 5I8KH 2AEIT 1FRGL 5IREA 2BJMH 5KW9H 2EDXA 3X1GA 2AERT 5MI0C 1HAUA 4PRPB 5LNDA 4U0RB 3ARDA 5I8CA 5I73C 3CZKA 1L4IA 1PZDA 4NM4L 4IIQA 4PTTA 1XGQB 2HUHA 1HOEA 4NJAL 3F7PC 3O3DA 1FO0L 2ENPA 1FLRH 3CVHB 4H7VA 1BIIB 2VLLA 2JELL 3VH8G 4QLWA 1A6ZB 1KGCD 1QFUH 2DBLL 4XPAH 3BD3A 3DHMA 1QI5A 4U4BA 1U36A 2QFRA 3KPPA 1PTZA 1FGVL 3UZVB 3S5ZA 1MIEL 3S5LA 4Z7AA 1JF1B 1DJWA 1HT6A 1ZHKA 3GMRA 4KK9D 1OD7A 3T6ZA 1WCBB 4HZ1A 1BAWA 3CXHK 3OKDA 4H20H 4LSQL 3O3EB 3IXTB 3CBRA 4LLWA 2IADB 4YAQA 3U0PB 4FQ2H 3F7VA 4OSUH 4Z78A 2BFGA 4QYOB 4M6MH 4NRYB 2WP3O 4F24A 4FA6A 4PWEA 4F2EA 5IB4A 1A3LH 4O02A 2X7LB 4PHXA 2WYIA 1D2OA 3GSOB 4EDWH 3W0WD 2IXQB 2Q7YA 4ANUA 3CMOH 2D3NA 2BOLA 5HJ3B 4AEEA 2H1PL 2YKLH 4S11A 3TO4B 3WY3A 1UXWB 3FQ2A 3UACA 1PU0A 1USZA 4BFOA 2C4XA 1BZ7A 4UU9B 1NIFA 2Z3FA 2OL3L 3LEXA 3MLXH 3E6HB 4UTBH 1ZVSA 1RLWA 2COQA 2XXGA 3FQXA 4XPHL 4DGWC 2VLRB 5BZWA 2IG2H 4I2XB 2DJ4A 3EYSH 3EFOA 3PWJA 2YRBA 3ES6A 1JS4A 1F02I 1JZFA 3ZKND 2ZTBA 4PV9A 5DT1H 4PJXA 3IMRA 4I77H 4ENED 3ZDWA 3LQAC 2YD9A 3QUYA 4FQJH 1GS7A 4KJPC 2YN5A 1AFVH 2O6EA 2BVQA 2P5ED 2Y25A 3BP5B 3RQ3A 4EUPH 2F1AA 3GMQA 1TKWB 2QSQA 1Q4NX 4TSAH 4P5TB 4FJYA 4QO1A 4NSKB 4ZPTA 4Q8BA 2WZPD 5HGHB 1SOSA 2DDQH 4JY6A 2XETA 2J8UB 5FUCC 5GRZA 4WSKA 5KVGL 4AGNA 5CHNB 1H15A 1PQZA 1SXAA 3EYVB 4IIQC 4NQDE 3HE6C 2JB5L 4Q2ZB 2DWXA 2CJUL 4LCUB 5FHBH 1DFBL 1CZ8L 2ZAIA 2BRRH 5EIIB 2D0HA 2DQJL 3CX5J 2VKXA 5DVOA 4UTAL 5G4MA 5HD8D 2D7QA 3CUPA 5C86A 3IMTA 3MAWA 2G2PA 2ZCKH 4MMZA 4WW1A 2Z1KA 4LNRB 5FO9A 2XCMC 4IKIA 1FH5H 4N86A 4OD1L 3OGCB 2H7WA 2NY4D 2XPGA 4KHXH 1WA0X 1DTUA 5EBLA 1MCBA 4F57L 3KPMB 4IU2A 3HBPA 2W38A 4K7FB 5I6XC 3DVNB 3HBQA 4F9PA 4PV1C 2G2RA 3IJHB 3H3KA 4MGXA 1NBVH 1ZCRA 2PCPA 3ARBA 4NBZB 4HWEH 4G1EB 1QRKA 5CEXA 4Q52A 4U1IB 4D8PB 3M1BB 4JFPB 3IM1A 2MOQA 1XH0A 4UOW0 1P53A 1TU2A 4R4FL 4NN7C 1O7VA 5LNEA 3WU1A 5F9OH 2JJTA 1RUAL 4QRAA 5IK3A 2ZP0T 3QUZD 4YFDB 3BP7B 2V4LA 3IRZA 3NIFF 4X99B 3GM8A 4QTFA 3FUFA 1X7QB 4XAKE 3LKNA 4KZDH 5JO5B 1NDMA 1OLLA 2LAAA 1RPQA 4HJIA 3S88H 3G6DL 2GSIA 2A73B 2BCMA 3CFIC 4MA1B 2YD6A 3GZOA 1R24A 2DQCH 1KPVA 2FJGA 3DECA 3TEUA 4PUBH 4K8RD 4M6NL 3MCKB 2IIJA 3BKCH 3QR0A 1NUGA 4IDLA 4PLKD 4UV4L 3ZZ1A 3RTQC 3RFZB 5KBDA 4GP5B 1LEGB 3T3ME 3D8MA 4UIKL 3L4ZA 1ADQA 5ICXA 5DMKB 3KHQA 4IDJH 1BF8A 4PG9B 1FFOB 3P1VA 3QUYC 1V7ML 3L4TA 2DI8A 5C8JB 4BSWB 3LEYH 1NL0H 2IALA 3QNYB 4FQXA 4O5LH 4ZFOA 5H35A 4HPHA 1T7YA 4W4NA 4BXVA 4M03A 5D4HA 4BQCA 4FN0A 1E6OL 1ZT4B 3CVIH 2GQHA 4OB5H 3D85A 4DPCX 2E0PA 4Q9CA 1A1NA 4YO0B 4LOUC 4ONFL 4WO4B 3VM7A 5CU5A 3TBVA 2XBDA 3NJHA 1Q0EA 1J8HD 2GITB 3D52A 3QZBA 2QT6A 3CFKA 4G6JH 4WI0A 1AO7A 3B9VA 1WWAX 2HVBA 2OK0L 3NP3A 1YNLH 1LO5A 3M07A 5GISH 2H9GA 4M62H 3FSAA 3CK0L 4MAZA 1I9JH 4IBQA 4OZ4B 4XP6L 3TT3H 3V0DA 2MPAH 2VDNB 4YXKL 2XG4B 1PZ5A 3IDGB 1ZSDA 4IJTA 2PCFA 1HXYA 1IEBB 1OL0A 3WFBH 4YDNA 2XSKA 3MREB 2BSDA 1F58H 2B1HH 1KSRA 1SY6A 3EFDL 3N1PC 4LOVA 1UWXH 4RQQB 4A04A 4LT7A 2GEEA 3SDXE 1P7QB 4HJJL 3B2UC 2ERJB 3N40F 4J2XA 3LNDA 3DMMC 6PAZA 3N41B 4CSSA 2FGZA 5F96L 4TPRL 5IW1B 3AS3A 4XB8A 3T1FA 5GGRY 5CZVH 5GRWA 5BV7H 3UERA 3BKYL 4EVNA 5HYSA 2QTVA 3WELA 5CINH 4R0LA 2VW4A 3SDAD 2X4RA 3ESPA 3FULA 1NLBH 1LO4H 3J7HA 2OQJA 2F8IA 3HS0A 1HI6B 1B4JH 2YMXH 5C0AA 5PAZA 1I1YB 4HS6A 5HI4C 5HYJE 4PGEB 5JMOC 4PRDB 2ENQA 4QRRA 3GZQA 3QFJE 5K9JH 2V2XB 4LRNH 1D6EA 4EUPG 4QIRA 3V55A 3VI4B 4PJGB 5KVDH 4PJEB 3ETTA 4OQ1A 5GZNC 4OUUA 2YS4A 4PJBA 1HHJA 1QW8A 2CGRL 3QUGA 1PVHA 2WKOF 1JUFB 1X3DA 1XSKA 4H1LH 1OK0A 4WWKC 4F3FA 3G6AA 2KDGA 3O4OB 4Z77B 1ED3A 4OZGA 1EFXD 3UJTH 3DGCR 5FM8A 3RWEB 2V9TA 5CJXC 1E4XI 4LPYA 4YNYA 5DVLA 2AABL 4KJWD 4UILH 1G7LB 4YHMH 3OPUA 4KKLD 1RERA 4N90E 3OJ2C 1PNDA 4RGOH 1LL1A 4A37A 4UT6A 4QT5B 4PJHB 2K8QA 3OAZK 3RGVA 1MOEA 1VADB 2GBTA 3L5WB 4BFJA 4C56E 4MZ2A 4JO2H 2DWTA 4AQAB 4JG0L 3QB7C 3OSKA 1JK8B 3O2DA 3I3EA 4P46D 1J0KA 3NABL 3QCUL 1GXEA 3SE3C 1P4IL 3C5JA 4FABL 3NRPA 3ARZA 1F18A 2OXHA 3KE0A 1LWRA 3V0JA 4FQ1L 5IBUB 1PLGL 4QXUL 3GDBA 1RIHH 4XCYA 2XV3A 5E1QA 2DH3A 1I8IB 2K6WA 3WNPA 2Y1VA 4ODBD 2VO8A 3U7YH 15C8H 1T7XA 3BXNA 2XTLA 4MLSA 4NQDD 5BNXD 1BX2B 2C9QA 3ZTNH 5KTEH 1C08B 3BSZA 4J4PA 5DYOA 1YC7A 1JGLH 5IV2B 2W9EL 5C0CB 1OF0A 1PW3A 2NY1D 2XWXA 3BD4A 1F3RB 4R0LC 1AGFA 4JG9A 3WL9A 4OI8A 1NLDL 5TPWL 1HH6B 1PKQE 2D7TL 2G4GA 4V1DA 5CAYB 5B39B 3QDGB 3T3MF 4UI2A 3EYQC 4OY9A 4MD0B 2VLJB 5FB8B 5B8CB 4ZD3H 5AW4B 3QHTC 4XO4A 4YEEA 4KRPB 3VW3H 5GIRA 4Y8DC 3WE1A 2LQRA 1UA7A 2COVD 5FEBA 5F7KC 3MUZ1 2GC7C 2YRPA 3PUCA 2J5LC 5FFGA 4DERA 3C2SA 5ISZB 3GIZL 2EDEA 3R0NA 4TNVF 2A83B 1XGQA 4WK2B 3QDMA 1Q0YL 5HGAB 3QP3A 2DMBA 5J9PB 5HPMB 5AYUL 5I2IB 3CVHA 3O8XC 2YBRA 5F88B 5HHXL 4K3JL 2FH6A 1UB5A 5LGKA 4C83A 1ZSHA 3V4PL 2ADJB 2VERA 4GT7A 3ECBA 4X6CA 2BINA 2VSMB 3UTOA 4M61A 1KACB 1FVEB 1UA3A 2NY3C 3IJEA 3VTMA 1R47A 1YYML 2MRYA 1JPGA 1JG9A 2RA1A 2ZONA 1DBKH 4XAKD 3RZCB 1MAKA 4YR6A 1E2VA 1WCBA 3RTLA 2WZ5A 2P42B 1EMTH 3O3EA 4NP4L 3BPLB 5DUPH 2ZWYA 4L3EB 3GTTA 4ZBJA 3OZ9L 4K4KA 2EP6A 3RGVC 5DUMH 3PWPB 4IRZH 5D2LE 1GZQB 4QOKE 3W1ZA 4R83A 1S5IH 3LEVH 3VDCA 4UB0L 1EANA 3RE0A 1BLIA 2HJFB 2OCJA 2VZ3A 3QORB 3ZDZE 2GJ6B 4TYUA 2OW7A 3EHBD 3GSOA 1G6RB 3K6SA 2G30A 4B41A 1CE1H 2L7UA 2XYBA 1QOKA 1HHGB 3NAAL 3MMEB 3W11C 4S2SB 2XVLA 3UL4A 3SDXF 4IGBA 1Q9WA 2WNGA 2MTAA 5DD1H 1A7QH 3R4DA 4C54A 3AROA 3OWEA 2K0RA 1YUHB 1ZRUA 3V6OC 5JLZB 3G5VA 3KPOA 3F12B 5G5DB 3MLZH 4XVJL 2ZCZA 4HUCA 4XWGL 5B7EA 2W59A 4Z7OF 1L9RA 3L3KA 5HYEA 4GG6B 5IHHA 2QPUA 2GJRA 4I48A 4S10A 5EO1B 3B1TA 3GS7A 1QNZL 3G9VA 2Z35A 4ABUA 4O58H 1OAXH 1VENA 5IIEB 3ECWA 1NDGB 4YHPB 2V3DA 5AENA 5C0IA 4YDKL 4Y9GA 1ZLSL 3RJDA 3DO4A 3BP6B 1AQKH 5EF2A 4NO2B 1WQVT 4U0RC 3TESA 3TVMD 1H3WM 1FFTB 1TCMA 1OKEA 2AJ3B 5AW9B 4H1LG 3EYVA 2PO6B 2O5ZH 2VUKA 1QR1B 5FKPA 1T0NB 2CK2A 5SWSB 4AW7A 5LN8A 2WZ0A 1PF3A 2YAEA 5EEVA 4F9LC 1WIUA 2JWYA 4PJDE 3TBBA 3ALPA 3QRLA 5IFAH 1HL5A 4OLUH 4HV8B 4XNYH 1HEHC 1FF5A 1SY6H 1FIGH 5JHLA 4P9MH 3DO3A 2Y5TA 2OTWA 1F1GA 4YWGH 2ZWLT 4ZO8A 2XJLA 1YPZA 1N0LB 3S2CA 3H3PH 1XEUA 3CDFA 2BP0B 5T3XE 3DVNA 4N9GA 3UDWC 1XR9B 5LAPA 3WTUA 1UB6B 3IJHA 2EKSB 1U6AH 2PN5A 1Y0LB 2VDOH 4G1EA 3GTNA 5F0MB 5HYJD 1OT4A 3M6DA 5IT2H 1GCFA 3QFJD 4MXWH 4M3HA 1NCUA 1VPOH 4D8PA 5MENE 4RMQA 1NOLA 4N0YL 4J3TA 4GO9A 1YA5A 4NO3A 1QHQA 4POZD 5ESAA 5DD0H 5KSAB 3X1EA 2ICCA 2WQWA 1UACL 3G04B 1KEML 3KPLA 3APFA 5KS9B 3TO4C 3M46A 3E80A 2W5PA 1V3KA 4AZ8B 5JNYB 1SYVB 2UYLA 4OLVH 2M8XA 1A3RL 3LKSB 2WNWA 3REWB 3QQNA 3V79C 4ZUVB 3MKGA 1OHZA 4BH8A 1CLOH 1P5VA 4KTDL 1X44A 5BOPA 3ZL1A 3KLAA 1PD0A 3SGJA 3UTZA 4F7PA 1UM5H 2XACC 2WJ7A 2FNWA 3FN9A 1EVTC 4OTXH 3BT2L 2J1YA 3LXAA 3HNSL 3GXMA 3RFZA 2CCLA 5ID0B 1XTMA 1BYNA 1EIBA 3EF4A 2J88L 3QUKA 1KN4L 1ZE3H 3BW9B 2AANA 4JM2B 4KUZL 4R7LA 1VGEL 2QHRH 3EO9H 4N90D 1OAKH 3KPTA 5FYLL 2BP5M 1FFOA 2G5RA 5I15L 4NQVB 3MRFA 1TT6A 5KVEE 3T2NL 5C8JA 2B0SL 1G7JA 3PXJA 1RURH 3T2LA 4AGQA 2DQGH 4C56D 1Z0MA 3SSGA 2X4NB 4P5TC 3EBHA 1MCIA 4RGNB 1JNNL 4F91B 3M88A 3KCPB 1I9IH 4IKKA 1ZT4A 3ULUE 2VAAB 4EZKA 5FPIA 1U3HD 2HXAA 2GK0B 4MA7H 1SEQH 1AR1B 1WEJH 1LWHA 4UT6H 1CICD 1JVKA 3CDGA 4WO4A 5CLZA 3SE9L 3H9SB 2R56H 1P6FA 2PR4H 3WHXB 1D5XA 2VDPL 1I8LA 3O2DH 3O3BB 2HT4C 4RX4D 2OMUB 3UPAA 3TCTA 1SQMA 3MRJB 5J6GA 2YWYA 4M7ZB 3LRMA 5CD5C 1MY7A 1OV8A 4LIQE 4IQHA 1T20B 2YK1H 5F72S 4W1TA 3ARYA 3WIHL 3MTXA 1SUHA 3IDGA 2EDNA 4QXGL 4NXKA 2WXNA 3AADB 3BSZH 2V7HA 3K6OA 2B16A 1TSRA 3HR5B 1KDJA 3L3GB 3ZDZF 1XIWD 1U4EA 1BMZA 3L4UA 4RQQA 4E42B 1SN5A 3QGVA 5FV2A 5I1AB 5DQJB 1P7QA 3OMZA 3FHEA 2I85A 2ZKHL 3ZT6A 4UT7L 3RVTD 1F97A 1Q38A 3MXVL 1U8MA 4H0LC 3D48R 5CCJA 5CILH 4X9IA 1MFCL 3T65B 2JKJA 4MJ4A 5E5LA 3NIDB 1FO0B 3N3EA 3TU6A 2NT1A 3MRLA 4MA1C 1A9VA 2I69A 4J3OH 4ERSL 4KI5C 3MRPA 3MSPA 4TUKL 2W65A 5C0DA 4RRPA 2YPVL 5IQOA 3RFZC 3L95A 1OP9A 4X9FA 5EU6A 4ZXBB 4PRDA 2CO6B 3UC2A 3H2WA 3FONA 1M05B 5AZUA 4Z5RB 1JZ8A 5IJVB 5C3TA 3MZGB 5DJ6B 3ROLA 1X9RA 2XV2A 1CD1B 2X87A 4QOKD 2NPLX 2W81C 3CFEA 3TONA 4NHUB 2FGWL 2NY6D 5KAQF 5I18L 1RZKH 1Y18B 3BESR 3FT9A 5F7FA 5C0GB 4LLUB 4XN5A 2YD7A 4WO4C 1MUJA 1TQSA 5DWUH 3CX5K 2K70A 1I8LC 4TVSa 5DJCA 2V7NB 4ZX6A 3WGUB 3EOBB 1VFAB 1A7PH 5GSVA 2NCMA 1XGPA 2AQ3A 4KJQD 1R3JB 4H0IA 1QLEH 5HJBA 2AJXH 4AKPA 5D7LA 3ML8A 4NN6B 3KGSA 3L3JA 4QT5A 2EIEA 2V3FA 3V0AC 5D1XE 1HHHB 3EJUA 3ZO9A 3GSXB 1XTLA 2OCFD 4XGZB 3BWUF 1YEWA 2ZKMX 3OKEA 5EZIH 1DVFD 1S7SB 1NGWB 3CHXA 5D1QA 5HYSG 3WFZA 5EOCH 1MVUB 3P40A 4WW2A 4HGWB 1IC4H 3W0WB 1IVTA 4GI6A 2F6AA 4K55A 2OMWB 2PUQT 3AB0B 1PJWA 1NCNA 1NCTA 1MIML 1G9ML 4DKFH 1OP5H 4L5FE 1EO5A 1URLA 5D4QA 2ERJC 4A2EA 4GS7B 2ZOOA 1P5UB 4AKOA 3TO2B 2KERA 3UG4A 4D3CL 5KG9B 5J57B 2WSDA 1MWAL 3PP3K 1GTFA 3SPJA 2NOYA 1M6OA 1QVOA 1ZHNA 1KUMA 4NC0B 3VQLA 2BNUA 4X0KA 4RIRA 2WLIA 3QAZB 4ZUUA 1HL8A 4L29A 4UMGA 2ENSA 4OGYH 5EN2B 4HPYH 5L9DL 2EH8H 3AITA 3L4XA 4FLHA 2EIZB 4MD0A 2VLJA 2Z31A 1DQJA 3MJ6A 4XO5A 4QKTA 2CAKA 2RB8A 2P5EB 1S9YA 2WXKA 2XNAA 1Z6JT 4TUJB 1UCTA 2B3IA 5T3XD 1WTGT 1OB1B 3T09A 3D18B 2PW1B 4Z7VB 1ES0B 1FN4A 2VIRA 3BGMA 4RFEB 4X0NA 1JVLA 4EIGB 1OE1A 1DLHA 3OR7A 3GSWB 3DYOA 5C3IA 4WI3A 4Z3HA 4M3JA 1NEZA 2NY5C 5MEND 3BCDA 2OPCA 4PRHE 3ULUF 2KLSA 1HCFX 3TGXA 3APNA 5F88A 1MDTA 4XP1L 1HKLH 4S0SD 4EF3A 1G94A 4K3EL 5HHME 3O4OC 1RHFA 4KKPA 4XVSH 1SJMA 4XOEA 8PAZA 2I24N 2C4FT 4NI3A 1E65A 1FVEA 5DZNA 3W5MA 1PBYA 3Q6FA 3LS4H 5EDSA 2WVVA 3QZNA 2A6IB 3F58H 5CU9A 2YQBA 5IWLA 2NY4B 1Z9SB 4TQHA 5IVOA 5BRQA 3KPNA 4X42A 2Y6TE 3QQDB 4G7SB 2WYZA 4OH2A 2AS5M 5CIPA 1S78C 4BD4A 4WTZA 3VB9A 3MBXH 4OI7A 2A9AA 5B3SB 2OMZA 3FAWA 3LZPA 2AJYH 3EFFB 4PREA 3K2KA 4MD4A 1Q9KB 4A6YL 1RH8A 3IJ9A 3N85L 2GJ6A 1S7TA 3CDZA 1G6RA 2VXTH 2VZTA 1OSYA 4H8WL 4YHKL 1A6VH 1I1AD 3GSVB 1XZ0A 1HHGA 4DGUA 2BVOA 3GI8H 2JKTM 4MQTB 4F7KA 3QUZB 4IRJD 4XTRD 1TUPA 4IOIB 4NC2B 3HOGA 4CSZA 4L1SA 1XL4A 2NZIA 3VGAB 3ULUD 3APMA 4E41E 1HVXA 4WK0B 5E08H 3G5YB 2C34A 1GYVA 1TIUA 2P1YA 4GUPB 2IMMA 5JLZA 1BZDA 2YJLA 3F12A 5G5DA 2DQHL 4G8EB 2N59A 2X4TB 3FUIA 4F8PA 5CN1A 1G7MB 2EDQA 1I3RA 1I1CA 5EO1A 3B3BA 4FMKA 3D50A 4FNUA 2WY3B 1PLAA 4MWFA 4XN4A 1BQ5A 4G11A 3P9LA 3TIEA 2IPTL 1NDGA 5B8CC 1U91B 2VZSA 5ANME 2F0CA 3JSSA 3W37A 3UC0H 4KRPC 4XPFL 2X4UB 4YFLI 1JNJA 5DEGA 4JJ5B 2ARWA 1EGJA 1HNGA 3TWCH 4HW6A 2CE6A 2R23B 1QR1A 4DKEH 5ERWB 1K5NB 4ANVA 3ILQC 5JIIA 1WS7A 3IDXH 1AYRA 5KBNC 2OJ1A 3PJLA 1J8HB 1OO2A 1WBXB 3NIFB 5CGMA 4IBLT 1INQB 4R9HA 5BJTA 1UFGA 5K33A 3ZMRA 4U1LA 3RZCC 3WFEL 3HMXH 1YY8B 2Q8BH 2CXKA 3NFNA 5L7XH 1AOZA 4KK5D 2NQDA 2Y5QA 3BKJH 4UT9L 3FQWA 4J3VA 3MLUL 4LCIL 4NAMA 2BP0A 3BPLC 1BZQK 5D7IB 3RWIB 2IOIA 1B0RB 1XD0A 1XR9A 4ONGL 5B7MA 1UB6A 3MJ7B 3C08H 4OGQC 3D4GA 1NMAL <