4LBEA

Structure of kcsa with r122a mutation
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein, membrane protein
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lbeA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lbeA02
4GOSA 3WLWD 2GYSA 5EIQA 1QEWB 5ICZB 1MJUL 3QPQC 2D0HA 3C08H 3KS0J 4LRIA 4NWUH 5D1ZC 4X4YA 1T4KB 4ZTPH 1KJVA 3ZDZF 5CUSL 3HAEB 5BV7L 1F3DJ 3U4EA 3FB7B 3VWKC 1RUKL 3PGCB 5IB1B 1XMWA 1VESA 1PEZA 4KTYA 4GW1A 1G0DA 3V6FB 2OR9L 1OAKL 5K9QI 2R29L 2HH0H 3QDMA 1FVEA 1UZ8A 3QH3B 3HRZA 5JXEC 1M05A 1HXMB 1I7RB 1T66D 1EBAA 1CFTA 3FQWB 1H9VA 5EDXA 1UWGL 4Y4KB 5C0GA 1DBKH 4NRXA 5C86A 1JV5B 2JB5H 4PJXF 4IIQB 2MTPA 3GSNL 4JLRB 3TP4A 5KVGL 4XPTL 4WFGE 1EHXA 5A16B 4I48A 2X10A 1KJMA 3KPSD 2IANE 5D6CB 5F7UA 4R26L 2FBJH 1PAMA 1Y6KR 1HZHL 5KVFL 4U1GC 5CMAB 3PWUB 1T0MB 3T77A 1S7TB 4JRYD 1ROWA 3NABH 3MRDB 3ZSSA 2HYMA 4DGVH 4YHYB 3FFCD 4R7NB 3DUHA 4WDIB 1DANU 2HFEB 3U6RB 3LKOA 3LV3A 3E1F1 5HYSG 1LO5B 3MCKB 4PJCA 5EBWA 1DUYB 2VISA 2AABH 3C6SB 5C0JB 5JR1L 2VDPH 2X4TB 3CAFA 1XR8A 2BXYA 3NCYS 4JZJC 4S1DC 5JIHA 3V8CA 2HVJB 2FH6A 2CPCA 3MXVL 4XAKE 4XBGB 2X4SB 3B4NA 2YD9A 5BVJA 3VFOA 1E4XI 2JB6B 3UYOD 3IJSB 1BVKA 4JFYA 3M1BA 1GSMA 3P4LA 1PKQE 4L9LC 5I1KH 1FGNH 7CGTA 5L2KE 4GUPA 4OFVA 3VFMB 3QEHA 5DLMH 2GY7B 5JOPE 3EFDH 3SGKA 5K33A 5MHSD 3V0VB 4C4KT 3GI8L 2BNQD 2HKFL 5I73B 1BZ7A 1UH3A 1DQDH 3AAZB 1F3RB 3MV8D 5GGSB 1Z3GL 4OUUB 2GJ6E 3KPTA 5GRJL 4S1SL 1S7XB 5D71H 1M7IB 3QIWD 2ZUQC 3P4MA 4M6OL 1UZ6F 3L5IA 1SEBA 3LDBB 2F74B 4HQQL 4OQTA 4S1RL 4U7KA 5K9KB 3ISWA 2ITCA 1ES0B 3TNMB 1RZJL 3W9EB 2VO5A 1BOGA 4XP4H 5ESAB 5JZ7D 1OAZL 3HC0B 3IDMA 4YBLB 3ZE1F 2I60H 4OI9A 5DJAA 4MNQA 4DZ8A 3AREA 2AXGB 1N0LA 3DECA 4GRLB 4D94A 4UQ3A 1KBGL 4JVUA 1YEGL 1S9KC 5C07A 5D1QC 1WITA 5EZLB 3GM0A 2EDRA 4CJ0A 3MJ9A 5J6HB 2MPAL 3SHSA 3ZKSD 2ICCA 1OP9A 3WS6C 4NZRH 4OZFB 2YBRA 1MCBA 2HLAA 2R1XA 6CGTA 1QBLL 3FO9A 1U8PB 5IT2H 1CF8H 1F02I 3OBAA 1NBZA 4KUZH 4LCYB 3E2HC 2X5PA 5KBNC 1PYWB 4NOBA 4U3XA 3GSQB 3UO1H 1PVHA 4JHAL 3B5HA 3OKLB 4MD5A 2ICEB 1R5IA 4QRPA 3WKMH 4HDIA 4YBQD 1N0XL 5AYQA 1BFSA 1C5BH 2GK2A 5D1XC 1UJ3A 1BQSA 4RAVB 1T21B 3PWNA 1HE7A 1HINH 3OPZL 5F89B 3TWCH 1CDGA 1Q1JH 5BO1L 3RVTD 3TNNB 3VFPB 1FCCA 2OXHA 4Y2DA 3C5SB 4NZUL 4C83A 4J8RA 4FQ1H 4GG6E 3SPVB 3QI9C 4HKJA 2YD8A 4WCYH 4XAWL 1JGLH 2IMNA 1PZ5B 2HTLC 4S10A 5HY9B 1UG9A 5D7SH 2LU7A 1TPXB 3Q3GA 3DX6A 5FYLD 1I9IL 1IGTB 5CEZH 4PIRF 2NY0D 1I3GH 1TQCB 4JFQB 1X4ZA 5IBTH 1TDQA 2MSPA 3PHOA 4XPAH 1QYGL 3RL1B 4L8BB 4P2OA 3U4AA 3OG6B 3OX8A 4BQCA 1I1YB 4NP4L 3DUUB 3BDXA 3GSRB 1UEYA 4F7MA 1S9WA 1X5LA 3PP3H 3TESA 3DYMA 1BFTA 3T0EA 1A47A 2YD3A 1LE9A 5HI5C 1NBVH 3QP3A 3DV6B 5GJSL 4L5FH 4MQTB 4KKAC 5GSVA 2ZOKA 2ZG2A 4PJ8A 1B90A 5T3XE 2OR7A 3CJJA 4MQXC 4PLKC 1GIGH 1A9EB 3LIZL 2R0KH 3IGAB 1ORSA 1MF2L 3OKNB 2G9HB 1NMBL 2VXVL 2EE3A 4QHNA 3BPLB 3MRHA 3RY6A 6FABL 1IJ9A 2ATKB 3WDHA 4Q9QL 2IG2H 4G9FE 1BOYA 4MMXC 4XPGH 3SDXF 2GSIB 4YH6A 2J8UF 4V1DA 5SV4A 4W4OA 5DK2B 1ZT1A 2CLZB 2DQUL 3WIIH 3VRJB 4NHUA 3LRSB 1CLYL 1UB5A 4RMTA 3V4VL 4HPOH 4K3DL 4P2RA 4XCYA 4YDVA 2YD6A 2VLKD 3RTQC 1MRFH 2EIBA 1OSPL 4I3GA 4FABL 5DT1L 2H32B 5J13B 1JZ3A 4XCCL 2VABB 5E2VL 3T2NH 4HIIB 4TVPE 1DUZA 2NXYD 3VWKA 3H9HA 2JIXA 4D8PA 2A77H 4KJQC 5HHXL 5IKCB 5IFJB 3VXSD 3QCTH 2ERJB 1FNLA 1NGPH 4NNPH 2F58L 5CSBA 3CFBB 4XNQA 5JW3L 5JXEA 5HVHC 5CD3A 2P24B 5GZOD 4BQ8A 3O3EA 1UWXK 1V3MA 5HYJD 2GJZA 3VXRB 3EJYD 5T3ZD 1UXWA 4LPTA 4HUMB 4U6HA 4U4BA 3V5HB 4YFEA 5BXFB 3IRZA 2QHRH 2YN5A 3INUH 4BH7B 5BOZG 1T03L 2XTJB 4PRNB 5L8JB 3D9AH 2PYFA 1OD9A 1YYMH 4CVZA 3JWNC 2FEDD 3VXQB 5ACZB 4QXGH 5DD5H 5IB4A 2CIIB 2W0FB 1JJUA 1SJHA 4PJDE 4PJ7A 43CAA 3FB6A 4ZAKA 5GS0C 5EWIH 5D5ME 5LG1A 2EO1A 1LO0L 4DQOH 5EU6B 5I2IA 2DQHL 1KB5B 3LHPH 3F7VB 1P4BH 5KAQG 4G9DA 3NGBC 4KGLA 4OZIE 4XP1L 5KJRH 1A02N 5DO2C 2NY2C 2XRAL 5E5MB 4QTIL 5HPMA 3V5DA 4JZJA 1K85A 2I9LB 3DHJA 1MCQA 3CVHL 1HXYB 1G7JB 5C71A 1CDYA 1YEEL 3QAZC 1MFEL 1BBJA 4PGEA 1OTUC 3DTXB 1FCGA 3CFCL 3CH1A 3VD7A 2OZ4A 5JQ6L 5EIVA 5KW9L 2Z35B 5EO1A 1LQSR 1KJ2H 2ESVA 2FATL 4O2FB 1F3DH 4D0BB 4YNYB 1WV7T 3ET9F 1D5IL 1LEGA 1IZKA 1LP9A 2X4QB 4Y4HD 3MGTB 5E4EB 3R06A 1BECA 3U0WH 1C16B 1AI1H 4X4XA 5C6PB 2H1PH 3P77B 4HAFA 4PGBA 3D87B 1IGIH 4QGYA 1KNOB 3THML 2AV7A 5JHDA 4Z7VB 5C0CD 1ND0A 1PY4A 1RIHH 3LN5A 1QBBA 4WI2A 4YO0A 4HWBA 1PLGH 3F7QA 4HKZB 1X5KA 3T3PF 2XI9A 3BUTA 2GW5A 2A38A 3K0WA 5LKNA 3H3PH 4IRJD 2NY6C 4PJ9C 4JRXA 1B0RA 1IAKB 4CBPA 1YC8A 2VWEE 3G6AB 5D1QA 1MLCB 2VLRA 2BVQA 4Z7QF 4ZPTB 4YXKL 3ETBF 4GRWB 4Z7WF 3QUXC 4DGIH 4LPWA 1EEZA 3MUZ1 4XBPA 1F2QA 2WSKA 5I74B 5F1IA 3O9WC 4FTVD 3IVKA 4FQLH 3P40A 1XIWC 2YUZA 3BYTA 1N2RA 3GKZA 4IMLB 4NFDA 4MAUH 4W6XB 3MXWL 4LF3B 4NOFA 4X9FA 4WNQB 1QG3A 5F3BB 1IRAY 5HHVL 3LZFH 4NPYB 1QFHA 3K2UL 4U1NB 4HW6A 3W2DL 1SJEA 4D3CH 4MHHG 1JZ6A 1K3IA 3BRDA 5SWZB 4J6RH 3TFKC 3CUPB 5IQ9A 4QRQA 1I8MB 4V2CB 4UQ2A 2Y07H 1BFOB 4ODHL 4UIMB 1FVCB 4FQHB 1A7RH 2O5XL 4KRLB 1CICD 1E4WL 4GAGH 2YA0A 4MS8C 2W9DH 1EZVY 4NQXA 3IFOB 4EJ1C 4HG4J 2J6EH 3WFDH 3IFNH 1DL7L 3T4YA 2ZPKH 1BD2D 5CGTA 4FP8H 4DFIA 4ZS7L 1P5UA 4ZOAA 2ZCLL 1FE8H 2QQLL 1OGAD 1QFWI 2FWOA 3Q1SL 1FVDB 1XGUB 4QLRA 4YDJA 4QRRA 2AP2A 3U36B 4K3JL 4G8GA 4HIXL 3BE1L 4P5MA 4JEGB 5HI3D 3H42L 4M5ZL 5EO0A 3K4DA 5HDQH 4GQ9L 1W8NA 4NO5A 3RKDD 4W68A 2DWDB 2VXUH 2ZWLT 4J1UA 4YDLB 4MA1B 1GPOH 1R5WA 1KTDB 2CLVA 3V7MA 4HWZA 3WIHL 2FYYA 1YPZF 4WI8A 2IBZX 4HUWA 4PJAA 4WUUB 3NH7H 5KG9B 1SYSB 4ZFGH 3VFVB 4AEHH 2APTA 1TZIB 3TA3C 1U58A 3UPCA 5I15H 4DGYH 3RBGA 5B39B 2NLJA 2VDLL 2C3VB 1YJDH 2VDOL 1YNTB 4G8FA 4HKXA 2VZSA 4DN3L 4CVXA 5FYKD 4Z76A 5LGHH 2MKWA 2ZUSA 5DMIH 2EC9T 3L5WB 1NC2A 2VXTH 1T5XA 1XF2A 2P5WB 2PYEE 3P4NA 1OY3B 1U8IB 5I16A 4OZFG 1VGKA 1OLLA 4CMHB 3LD8C 1OP5H 3J7HA 5FECB 3MRJA 1BJMA 3X13B 1JNNH 2NY5H 4HIHA 4LGPB 1CR9H 1MLBA 1T80A 4ZXBC 5BMFH 1GZPA 1DSFH 1G6RA 5FDWA 1UEMA 1OQXA 2UVFA 4JFFE 2V5YA 1MCFA 1MCNA 2C1OB 3CXDL 3STLB 1MREL 4HEME 5FF6A 2SEBB 1R3KB 3FTGA 2BVOB 1XCTB 3IXTA 3MJ7B 4TTDD 4XTRD 4L4JA 3O6ML 4JR9H 3OXRB 1BQHB 4OGZA 1I7UB 4L3CB 4DZBB 1RFDH 5DUMH 4RDQG 3ARFC 3HZVB 1TZGL 2PTTB 1GHFH 3CFKA 3NIFE 1PX3A 3OKYA 1ZHKA 1KEGH 3BKCH 4P23B 3BWAB 2F54B 5F9JB 3C8KB 1G7IA 1KCUH 1NFDE 3V52L 1HN1A 4ZUVB 1JPTH 4LRNL 3HE7C 3KYKH 4Q2ZA 3CFDA 5LCVH 4E5XA 32C2B 3RVWC 1LNUA 5E9DB 4LBEA 4YPGB 2BSTA 3ARDB 2DM4A 1A5FH 5C0RH 5IHBA 2R8SL 4Z0BL 1WBYB 4I0CC 3DRTA 3NVQA 4IRSB 1ZTXH 4KK5D 3PGFL 2FIKA 3G5VA 4CMMB 4ZFOA 5DWUL 4HJGA 5TF0A 1U3ZA 2YHGA 3MRCA 1I1AB 3HZMB 2MCPL 3ROLA 4HKBB 3KWWB 3PABA 4PBXA 4GKSA 3QO0A 4LSVL 4R4BA 2DQCH 3FRUB 5DEFA 1FFOB 4TUJA 5JORB 4MNQD 4LLVB 3ARED 3K80A 3LCYA 3EO9H 5AZEH 4PBWD 3CIQA 5D7LB 3EYUL 5C07D 2A1WH 3Q6FA 3MLYL 3FOLB 2XKNA 4BFIA 5BOPA 2ADJA 1LEKB 2HRPL 1JHTA 1IBGL 2XFXB 3QQ3B 2AEIT 2W9LA 4HK0B 1A64A 1SBSL 2MKLC 2AXFB 3ME0A 1QSFE 4G42A 5E8PB 2FZ3B 3KR3L 1WGOA 3QDGB 4PJEE 3FB8B 5CWSB 1A6TA 2HTKC 1S7RA 3KPOA 2PTUA 4LLUA 1NMCB 4QRPD 1VKXA 5BZWB 2VXSL 3PDOA 4KDVA 4ELMA 2XPGA 2NXZD 3TT1L 5FIEA 3BWUC 1L0XA 4IOIB 5CBAA 1RZ7L 1X5FA 4TNWK 2WQ8A 1FL3B 1T2QH 3L3OB 1UGNA 4LHUB 4NSKB 3QDJA 5BQ7A 1II4E 4M7LT 3U9PH 4MA8H 1WZMA 4A6YB 4S11A 5JO5A 5JW4N 1QA9B 4Y2DD 4IS6A 4LEOA 1YEIH 4UT6L 5EO9A 2VLLA 5F71A 3BRFA 4OB5L 1KB5L 2CRYA 3ULUC 4Z7NE 4MDIA 4ZNEE 4APQC 3WDJA 2J7LA 1D5MA 1F6AA 2FCBA 2V2WB 3DRQB 4F8TA 3BPOB 5GIRA 1F4XH 3QUXA 3UJIH 1JF6A 4C57C 2P49B 1C12A 1KIQA 1OGTB 4JCLA 5EZIH 4NKDB 2QSCL 1G7LB 3O9WA 3RUGB 4G7YL 2VAAA 1CG9A 1N5AA 1INDL 5C0EB 3B3IB 3RZWA 1FFQA 3PIQA 3NA4A 4P2OD 5F3HA 2HMIC 4AENA 2EXWD 1JHLL 4P2QB 2XZQL 4AZ8A 2CKBH 4OZGB 5EU3B 4WIQA 1P4IL 1QSEB 3D6GA 1TENA 1CFBA 2Z92B 4OCSH 3T0ED 1QPXA 4JFZL 5ALCL 4U49A 1S78C 3QCVH 2KH2B 3S98A 3FFDA 3GMPB 4N0UA 5C7XL 1EHNA 1UB6B 1NSNL 4AL8H 3D69A 3CSYB 4ZO6A 4Z6AT 2QV2A 4B7LA 5DS8A 2HT3C 3G5ZA 3SOBL 1KULA 3BD5A 4PJFB 5EBLA 4XCNB 4G80B 3DIFB 2RQ8A 3RKPA 4XVJH 5DJZB 3LKQB 1BPVA 1IT9H 4JRYE 2ITDB 2ZSVA 3QJHB 3RU8H 3QUZA 4HWEH 1A3LL 1DVFC 5MI0B 2WLYA 5DJDB 3KYOB 5GRYA 5IVXF 3W82A 2AXJA 3OJMB 2HT2D 3BH9B 3QEGH 4V1DD 3SO5A 4DVBA 2X4UA 4I18C 5C0BA 1OAXH 3D48R 3SE3A 3S7GA 3TV3L 4XPFH 2H2PC 2H3NA 2QBWA 5FGCE 3K46A 4P2RD 4CN4A 5LGJB 1SHMA 4H5SA 5DTFA 3E6HA 4F2MB 3QPQD 4OLWH 5D1ZD 2DWEB 5D8JH 1KXTB 4GXVH 3DPBA 2YD1A 5F7NC 4HC1H 1MI5E 2N56A 1WUNT 3RA7H 2AERT 1UQSB 3VWKD 3TC9A 3ZT5A 1ZHBA 4LLAA 4OZHA 2ED9A 3MGOA 1LK2A 1LO3H 4KVCL 3IF1B 5E2WH 3QIUB 2W92A 4N8CL 4PJBA 3CK0L 1I85C 3CD4A 4Y19E 2DQEL 4R0LB 2X05A 2BNRB 1F6FB 4WEBH 5JXED 1S9VA 1WFTA 4U2ZA 3MREB 1NLDL 5ISZA 5BVPH 5MHSE 4OLYL 3TH3T 3QXDA 3UYRH 5GQBA 3RWJA 5T1LD 3VA2C 5C8JB 3MV8E 1AXIB 1RZFH 3GGWA 5FO8B 1RURH 4QHKJ 4GKZA 4MDJA 2IH1A 3GHEL 4LSPL 2VDMH 1FRGL 4KQ4L 2LVCA 5I17A 4HUXB 4I77L 5FCSH 4F57H 3VFSA 2BNUB 5C6TH 4JO3L 1HK6A 3CZFA 3WHE0 4J3WA 4JANA 4X6CA 4MNGA 3BZFA 4ZAKD 4N68A 4XP5L 1TVDA 3UJJH 5DQJB 5SWQB 1FZOB 4RAUA 4P4KC 4FQIL 4KY1H 1RJYA 5EU5B 1U8HB 2NR6C 4P99A 1I9JH 2N4IA 4NN6B 2ZSWB 3KGRA 1Q72L 3MNWB 4MD0B 3K7UA 3V79C 4J3TA 5IFAH 1J10A 1CVRA 2WM0A 4YIQB 3PV6A 3RRQA 2EH8H 4WWKC 3PGDA 1J1XL 3TO4C 4YHZL 5A2FA 2NY7L 3FONB 3LEVH 3MRKA 1KPUB 2H6PA 3O6FB 2P5EB 3HZYA 1GZQA 4M4PA 1TZHB 3DVFA 4XPHH 1AQDB 3GIVA 5C09A 1Z5LA 1N64H 3VGAC 3BP4A 2XA8H 1ZHNA 3ARFA 1UKQA 1EUUA 3FMGH 5D72H 4LVHB 4XC3L 3BUYB 3CMOL 4PJXA 5FAAA 2YXMA 2B1AL 1IC5H 4HGKC 4NM8H 2ESVD 3GUTB 4Z9KB 5KVDL 1OPGH 3HE7A 1NCBL 1HEZB 1V3KA 2A6IA 1FL5A 4V2BA 1GOFA 3SKJH 3SKMB 1V7ML 4JY6B 1X5AA 1TVHB 5E2TL 1P1ZA 4DW2L 1I3RA 1H15A 5IMOA 1CL7H 4UOW1 1JNHA 1N3NB 3FT3A 1GGBH 2WUCH 4WW2C 1CGWA 4PJDF 4JKMA 2YPLB 4BYHA 4JQXA 3OAYH 5DJCA 5BCAA 5JHDD 2FX9L 2G60L 2EE2A 5D5MF 4MWFB 4H8WL 1TJHL 4JFDB 3ULUH 2F8XC 3MRMA 4LLYB 1A14H 5D9SB 3WIFB 3WEXA 5FYLE 3BGFB 1U92A 5GS2D 4HS6B 3UP1A 3QFDA 4O2EA 1G7HA 4OZIF 2D03H 3LH2L 2GTZB 3D3VB 1NMAH 2JF1A 3LEYH 4JRXD 4F3FB 5D1QD 3IDJA 1P5VA 4N0YH 2VLRD 2QQNH 4FQXA 4ZSOB 1HWGB 5F9OL 4UV7L 4OGAC 1HYRC 2LABA 4NRYA 2DTML 5ETUA 1A6WH 3W81A 4Z95L 3RHWF 3SCMC 4PREA 4OF3A 2LAGB 2DM7A 1QR1B 1VADB 2DI8A 3L7FA 3R1GH 1JGVH 4H88L 3MCLH 4BM7A 5IW1A 2RJMA 3RZCA 2EKSA 4M1CC 5JOFB 1B88A 1RULL 4ERSH 1OSZA 4OIAA 4K23H 1J05B 3BIKB 12E8L 2AQ2A 4JM2B 3I50L 4X8JB 3KHOA 1B2WH 1WBXB 4FQCL 5TDPA 3BEWB 4M02A 4ZTOL 3REWA 3ROOA 3DI3B 4EI5B 1F8TL 3RIFF 3KPQB 2PUQT 3OTTA 1JWUA 1EEQA 5D2NB 1G0XA 1WTGT 4A2LA 1HHHA 43C9B 4M62L 1VFAB 4OF8A 5KSAB 1HH9A 3O2DH 3HC4H 1X5YA 2IPUK 1YUHA 3WN5B 3QG6B 3QNXB 1UCBH 4JFEB 5F96H 3MFFA 2HTLD 4ZOEA 5C9JB 4PG9B 5IMLB 3GHBH 4TNVF 3RI5F 3QPXL 3QSKB 4NNXB 4KZDL 4BSVA 1EFQA 4P4RA 3T0BA 1KCKA 5GGUB 2OTWB 2YK1L 5BRZA 3R0NA 4TSCH 4FFWC 4BELD 1VGEL 2FX8L 3FO0H 3PQYA 3MA7A 4QRRD 3VXSE 4MD4B 3V0WH 2BK8A 1ZS8A 3UTSA 3ZDXE 4C56A 5JPNB 3MRFB 5CILL 3C2AL 5BZDB 4G6JL 4D9LH 4YX2L 3EGSA 5HYJE 4RAHA 3SGDI 4Z7OE 4RFOL 4KDTC 4NUGL 4LPUA 5HI5D 5T3ZE 2R2BA 4NT6A 5DQ9B 3RPKA 3QNZA 3UMTA 2R56H 2ZOLB 4MX7A 4GMTL 2IPTH 3MACL 4PLKD 3V95A 3E3QC 1SM3H 2GUOA 4EOWH 1AO7D 5DD0L 5I8OL 5AZ2L 3LSOA 3OR7B 2F53A 4ETYA 3D85B 5C0AB 4LCCB 4XMKL 1A2YA 2R1YB 3SKUD 3QUMB 2YWYA 2M26A 1HQ4B 3QHTC 5DXWA 1DVFA 5L2JB 2WIIB 2FNBA 4OGYH 3BP6A 3GBNL 4K7FA 4DAGL 1NC2D 1YMMA 4I18A 4JHWH 3BXNA 1FYTA 5HHMD 2R0ZH 5F8QC 4NDMB 4N90D 3CZJA 1JZ2A 4LVOB 5ABDE 3LN4A 1JF1A 3GMOB 3ZTNL 5A2KH 2QQKL 5DR5L 4OKVB 3EYOA 3RTQD 3DO7B 4PJGB 4GG8B 3MRRB 3VCLB 1J0YA 1J8HB 3BQUC 2PCPA 4KUCF 3GIZH 2B7DT 3ULVL 2KL6A 3C2SA 2IQ9H 5TDNB 1M6OB 4JDVA 4KJQD 1QFUL 5GRUH 3NBNA 1MRCL 1RIVL 1I85A 4C54A 2BCKB 2XV6B 4GRMB 4PV8B 2GTWB 4XCEA 3O2WH 2ZZUT 3MYJA 4KK6D 4ZMAT 4PRIA 3OAZH 5C0DB 4WUKH 3E6FB 5FKAB 3MMEB 3W9DA 2NX5A 4Q97A 4M00A 3MBEA 5IF0A 1Q0YH 3HUJA 4FS0A 4XX1E 1W72H 2OJEB 2R4RL 3SDXA 2NW3A 5C0CE 1CBVL 4P5TC 3CFEA 3EBAA 1RZKL 1MQKH 1OCWH 5GS0D 4RGMC 1FAIH 1FFPB 3SDAC 3RIAF 5IESH 2VE6B 4L3EB 1MJ7H 3O41B 5I1DB 4XGZA 3IDNA 3LKPB 1I75A 4TSAL 4U31A 5F72S 4LLDB 1SMOA 3CCHB 4MJ6A 1ZXQA 2B0SH 1FFNA 5ILTL 3TO4A 2QADB 5DO2D 4YPJA 4KZEH 4AJ0A 4FTVE 2NY2D 3QHFL 4E0RB 4NM4H 5B4MC 4KTEL 5MP6L 3BW9A 4S0TD 4LSRH 3HNTL 1MH5A 3G6JE 3DLQR 1NKRA 3MLZL 3KJ4C 3P2TA 1OTUD 2Z8SA 4L1DA 5FHBL 1Y18B 2HG5A 3MBXH 2HFFB 4PRPA 4ZG1A 4EQ3A 1AFVL 4OI7A 2ZNWA 3ZTJH 3NIFF 4G43A 4JG1L 4JO4L 4RNRB 4EI6A 4NCC1 3RWCA 1A6UL 1EO7A 5FA4B 4X99B 4LKCB 4MA7H 1NFDF 2W07A 3LKSB 3T04D 4RGNB 2GK0A 3NACH 1QQDA 1GVIA 3FT2A 3B43A 5E6ZA 2EYSA 4X9GA 1JUFA 2E7MA 1BD2E 1RIUL 2ENSA 1FAKT 3GJFH 4NJAH 3VWJA 2PN5A 3QZWG 1AKJD 5HI4C 1A7PH 1NEZA 4YDIL 5MEOB 3KLDA 3OKKA 3FQRA 1M7DA 5HDOA 1RJZA 1S8DB 1RUML 3PL6B 5C0IB 2J88L 1ETZB 1QKZH 3NFSH 1U8QA 2XICA 4I0PA 4UT7H 2Z91A 3S6CA 2NY6D 4KHXL 4KROB 5EPMA 2VQ1B 5TJWK 4TVSa 2E9WA 1S7SA 3KNBB 4L8SB 3KG5A 3EFFB 1HHJB 1OT1A 3QUXD 4YE4H 3PJSB 2BFVL 4ZUTB 1TXKA 4UINL 3X3GL 2IFGA 4YHOL 3O9WD 2QKIA 5D7JB 3S36L 4R4FL 4PGCB 2O93L 2X9WA 1H3XA 3SCMA 1CXLA 4FN0A 3WFEH 3PP4H 5CP3H 4WGWB 3PXJA 1ZVYA 3WD5L 4MNHA 3C5ZC 4P9MH 1L7TL 4GBXA 1U3HC 5J7CC 1M7XA 1MJUH 4PJEF 5CZVL 3P73A 3FO1A 3S4SB 3GSWA 5CUSH 4CRPA 4LLQB 4WTXA 2Z31B 1FLTX 3NPSC 2P8PB 5BV7H 4RZCB 2WLZA 3JWOH 4HBQA 5IROA 4X98B 1TJIL 1RUKH 3WHXA 3TFKD 5E7BA 3VXUA 2OQJA 2Z0BA 3N1GC 5FYKE 1UVQA 5F9WB 2OR9H 2GEEA 2XT1B 2R29H 25C8L 1ZLUH 4EUPG 1JNJA 2O5ZL 4OLVL 3BIBX 2H2SC 4MQ7A 1A4KA 1UC6A 3KPRA 1I4FA 1UWGH 5I1AA 1KPRB 1IGCL 2IALA 3GSNH 5C0BD 5KVGH 1FZMB 4XPTH 4Z7NF 4R2GB 4UTBL 1CGTA 3X12B 4TN9A 1FNGA 4Z7WA 3TIEA 4I2XB 1AGEA 3D39D 3JUYA 4R26H 4PJCE 1HZHH 2E6PA 3KHQA 2XY2A 3FO2A 5T1KB 5K9OB 5E1AA 4UBDC 1C08A 1ZA3B 2G75B 3FOMA 1BF2A 2K3TA 4Q9RL 3KJ6L 1PQZA 4X80L 3D25A 2P47B 5J8OA 2A6DA 2A74B 2BSRA 2AS5M 5T33L 1T83A 3BKJL 1AGDB 2JCCA 4IOSD 1UH2A 5ENWA 1EGJL 5TE4L 1ZT4A 4XWOC 1ZSDA 4J12A 1NCTA 3MLTA 2Q76B 3TA3D 5ERWA 5DMGD 5IG7A 2R23A 2MNUA 4QXTA 5DD6A 2CIKA 4M7LL 4ODBD 3M17A 5KS9A 3MXVH 1AR1C 1ZVSB 15C8L 2X89A 2RHEA 2YA2A 1ZLWK 2ADGB 5IB3A 4F15B 1E0OB 3U9UA 3RIFK 4QHLB 1VPOL 1Z6JT 2PO6C 4K2UL 1SYVB 3VXTA 3GI8H 3ECBA 3EO0A 2HKFH 4XPBL 3GJEB 1UENA 1MAML 4NQVA 4MNQE 5DUBB 1Z3GH 3VMPA 3BQUA 4LHJB 1G0YR 1EFXA 5B22A 5GRJH 4S1SH 5C07E 2CJUL 2X4RB 4LMQE 3EYFB 4S2SA 5ID1A 4M6OH 4HZAA 4KMTL 2XN9B 1A9BA 1RZIB 1AHWC 1GC1C 3FQTB 4TNVK 4UT9L 4HQQH 4XRCA 1YDPB 3RI5K 4P3WA 3GMNA 4S1RH 2N7AA 2EDBA 4CUCA 4D9RD 4MB4A 1RZJH 2AKRB 3OXSB 4L8CB 3MLWL 4BUGA 1XGPA 1YPZA 4QRTB 1OAZH 5C09D 2IBZY 4RISL 2ZKHL 2NY1B 3QXAB 3P9MA 1CD1A 1KBGH 4QRPE 1YEGH 2QSTA 3ARFD 3T0DA 3DETC 1S7QB 4O51A 4ALAL 2MPAH 3OKDB 4PY7A 1KLFA 1XT5A 1TETL 2EIEA 1QBLH 3KXFA 3HE7D 3EOAB 3B9DA 3UTTB 3ZE2E 1ZHLB 3RVWD 3QUML 2V2TB 2Q1EA 4P5TA 5T3XL 3R8BB 1ZGLA 5E6IA 1WFOA 3NCFB 3JTSA 5I8CB 1PY9A 3G9AB 1HCVA 3DGGB 4JHAH 4DOHE 1CE6B 1X5GA 5INDB 4WI5A 4LMQI 1N0XH 1BP3B 4Y4KC 5ITFA 4IIQC 3CPLB 4MXVE 3SGEH 1JRHI 2FGWL 3QZWA 4JGUA 3VXPA 3U48A 5GS1B 3U79A 3VFTB 2V7NA 3OGCA 1WSST 3OPZH 1CFVL 4PB0L 5IQ7L 3DO3A 5BO1H 5MEQB 2P8LB 2ZG1A 1KJ2B 4QOKB 1UXSA 2MHAB 5DRZB 4NZUH 5FGBC 4YHYC 4FQXD 4WY7L 2GT9B 1Q9OA 3VDBA 1A6ZB 2UUDH 1CDCA 2X1XR 4XAWH 3WUWG 2APFA 4FQQB 4UDTA 2FHCA 3K2MC 3T0EE 3VA6A 4RMSA 5EZOL 1I9IH 3TIDB 4GLRH 3QQ4A 2HTKD 2X40A 1CT8B 4O00A 3W39A 1CGVA 1P84K 1QYGH 5ITBL 3RZCD 1ZWIB 5IV2B 1G84A 4NP4H 1YNLL 1T1ZB 2AQ3A 4ZPVA 5LGKA 3QCUL 2KBGA 2IANA 3GEWB 2FJHB 3O3DB 3T8XB 2BXZA 5DYOB 3QO1B 3EOYG 2RFXA 2WZPD 4FRWA 3WE6A 1Y6NR 4NRZA 1FHGA 5GJSH 1MJ8L 2GFBA 2VUYA 4CGTA 3MO1A 4V1DE 2Y23A 4CN6A 3SGJC 4EUPA 1NGYB 1V05A 3U7WL 5B8CA 1AP2A 3DROB 5I73C 5SX4H 3L9RB 1I7TB 1PW3A 1X7QA 3LIZH 1J0IA 4OZ4B 4P2RE 3ULUD 3RIAK 1JK8A 1MF2H 1P84J 2VXVH 4HSQA 5C2UB 3H9SB 3BEVA 3GMRB 4B7IA 4BSWB 5EUOA 3LDBC 5DLML 4NO0A 1S5HB 3BPCA 4Q9QH 2PW1B 5BRZD 2QR0A 4RFEB 5M95B 4JJ5A 2DQUH 3RGVB 3O3BA 1DQQB 3PQYD 2HMID 1FG2B 5CSZA 1CLYH 5DJYA 4AEIL 3C5ZA 3V4VH 4YBLC 3UTSD 4K3DH 2V7HB 3LQZB 4LAJH 4GRLC 3ARGB 3ZT7A 2IBGA 1OSPH 1VACA 2C1PA 1PKQA 1U8OA 3HE6A 1J1OH 5DT1H 3RWGB 1S78D 2J1KA 4XCCH 3F5WB 5E2VH 4PJHB 3A6OA 4WV1A 1H3PL 3L7EA 4E42B 3NFNB 3RY4A 5I1LB 1EEYB 4YEEA 4U3HA 5IR1B 1QO3B 2VL5B 2HT3D 5HHXH 2XZCL 2GJ6A 4K3GA 4K8RL 3O6KL 2F58H 4H26A 4Y5XB 4FZ8L 5C92A 5LWYL 2F53D 5JW3H 3O6LH 1C1EL 3P11L 1DVFD 4NC2B 2YZ1A 3RWFA 5GGQL 3KPSB 1R3HB 3T65A 1JGUL 1YEJL 3IU3B 5IW3A 1T03H 3O45B 5KOVC 1GGIL 1ZANL 8CGTA 2OJZL 3VH8B 4GKOA 3ESVF 5DRNB 3FFCB 2FLRT 5GGVY 4JFPB 4Z7UA 2GAZA 2YPKB 4WU7B 4Z77A 3MUGB 4X4ZA 4XVSL 1P7HL 3DMMA 4WTWA 2H26B 4YLQT 1S9XA 3MOQA 2DQHH 3ZDXF 1BVLA 1TPXC 2EE6A 4RBPK 4U1LB 3CLFL 3GI9L 1KT2A 3FJTA 1TQCC 2FEEL 4BK5A 1CFQB 4U1SA 3BJLA 4XP1H 5E8EB 4Z7OF 3BP5B 3U0TA 2ESVE 1G9NL 3CDGB 3TF7C 5E2JA 5EZJB 1QFWL 1NGZB 2XRAH 3OKEB 4I9WD 4N9GA 4QTIH 1LP9E 5D7SL 3DX8B 3AMLA 4JG0L 4HS3B 2P8MB 4PRID 4UV4L 1F4HA 2G5RA 3SY0B 3U2SB 1EHLL 5TDOB 5AG9A 4PLJC 3CVHH 3T1FA 3SJVB 2UVEA 3LQMA 1X4XA 3P9LA 1TNMA 3IB4A 1NC4A 1YEEH 5DK0B 5DEGB 1MFEH 2NX5D 1ERNA 4GKNB 2ILLA 2BNQB 3CFCH 3MBED 4KWUA 4QRSA 5ANMB 5JQ6H 5IVXA 1Q9WA 3MV01 5EG6C 5JHDE 2FATH 2A9NL 3TBWA 3ZYIA 2YD5A 3OKOA 1BGXH 2GSGB 3MNVA 4HGWA 1D5IH 2NR6D 4P9HC 4YDKL 1KCLA 3SDYL 1XH3B 3BPLC 3BGAA 3WJJA 4FXGA 2JE8A 4JRXE 4KXZH 4M93B 1KACB 4LCWB 3FB5A 2VLRE 3ARZA 1BJ8A 2DIAA 3GRWL 1CD8A 5E99L 4NWTL 3TO4D 3THMH 4PRHD 1NAMB 2W38A 4CADB 3FQNB 5TE6L 1HSAA 3REVB 2I9TA 3C60A 3S34L 1AGBB 5ICZA 4OD1L 4EBQL 4MJ2A 5CBEA 1V8HA 3MRIB 2E5EA 4X6BA 3WCYA 3STZB 1RHHB 3TGXA 1JGDB 3WUWA 5J13C 1NBYA 2HJLB 2OS7A 3HAEA 4QWWD 4YXKH 1DEEA 3Q5OA 4NQUA 3L5HA 5DJ8B 3WIIL 1OAQH 2NW2B 1KIRB 3FB7A 3PGCA 4OFPA 1N59A 4HPOL 3N06B 5JLZA 2ERJC 4Q6IB 1FGVL 3I75B 3QH3A 4N8VB 5C6WH 5C0FB 1I7RA 1MJJA 3T2NL 3MXWH 4G9FA 2AK4B 5DVOA 1L9MA 4Y4KA 5E8OB 2A77L 5HHVH 4IIQA 4JLRA 1F58L 3K2UH 5EN2A 1F5WA 3W2DH 2XTJC 1BIIA 1ED3A 1D5BB 2OBGA 1XIWB 4KAQL 1P4LB 2Z93B 4ODHH 4BA8A 5CMAA 1DDHB 2DQTL 2O5XH 4HUKB 4PGJA 1OOAA 1E4WH 2FB4L 1SY6L 1U8NB 4QRRE 5HGGS 3KAAA 4URTB 4WDIA 5ID0B 2HFEA 1DL7H 2HFTA 4OGAD 3U6RA 2CXGA 2MFNA 3DVNA 5J9PA 5IBLC 1LO5A 4KRPB 4ZS7H 3V5KB 3BDYL 4M1GL 3SCMD 2ZCLH 1DUYA 2QQLH 3G5XB 1B9ZA 1YN6B 5HGAB 2NYYD 3C6SA 3Q1SH 5C0JA 3MR9B 4BQ6A 4GAYB 5D4QA 2X4TA 4L8DA 4Y5YB 2BVYA 4ENED 3MRLB 4K3JH 4OZFH 5HBBA 1AO7E 4HIXH 3BE1H 4KGJA 1HOCA 3H42H 4M5ZH 3S35L 4XBGA 2Q87A 4FG6C 1H8SA 1B6DA 4GQ9H 5E7FA 2VZVA 1N7ML 4O02L 1N5YL 2JB6A 3IJSA 4R4ND 4PJDA 5DMJB 4N0FB 3LEXA 3WIHH 4UUJB 4YAQA 5D5MA 5HHME 3A6BL 2MCG1 3ESUF 3BIAX 4N90E 4Y88A 4KI1A 3AAZA 2BRQA 3JV5A 4QYOA 2ZUWA 4P5KB 4HCRL 4QCIB 4JM2F 5FCUL 3KPRD 5DJ0A 4OCRL 5E4EC 4QT5A 4OZIA 2CKBB 2VDLH 3BHBA 3UZQA 2VDOH 3EOTH 4DN3H 5SX4I 5FV1L 1FZKB 2BC4B 3MRGA 2L7UA 2DQIL 2VLKB 4POYA 1IM9D 1ES0A 3W9EA 5IFHL 2L7JA 3HC0A 3FZUC 2EC9U 1DQJA 4LASL 3F8UB 4GRLA 1CDUA 3E0GA 5D96B 3D2UA 5IB5A 4OCWL 5EZLA 1TQBB 4KKBD 4Z18A 2AVGA 3BD3A 5J6HA 2EDOA 1D5XA 1MEXL 4H1LG 1QHPA 3HA0A 3PXHA 5I74C 5I76A 4Z5RA 3JBG7 5SWSB 1YY8A 2P45B 3O11A 2XNAA 5KOMC 5DMKB 2GHWB 5HYJB 3NIGE 4KMQA 5ICXB 3RWHB 2HLFC 3GSQA 3CXDH 2FRGP 1NJ9B 4JQVC 1MREH 2VITB 3OKLA 2ICEA 2E6QA 2I27N 1P7QB 3O6MH 1R3IL 2DRUA 4ZOCA 2J4WL 3RDTB 1YZZA 1TZGH 2CDFA 5I0DA 4FQLL 3GNML 1T21A 4CNIB 1BM3L 3HRPA 3V52H 4LRNH 3UTPD 3W11C 5F89A 1PG7L 3TEUA 5L9DL 1XF3A 4JB9L 3C5SA 3LKNB 3NCBB 3FHAA 3BQUD 4N5UA 3VG9B 5IOPB 3EYQD 4OD3L 2DS4A 2R8SH 3SKNA 2AQ1A 1I8KB 3BSZL 4PJCF 4Z0BH 3L3IA 5F1NB 1MIEL 1ZA6B 5IEKB 4J6RL 1PZ5A 3PGFH 2UY7A 5DWUH 4RQQB 2X4PB 5ESVB 4QF1A 1IGTA 1CFNB 2MCPH 1HKFA 4MMZC 4WO4B 3TPKA 2H32H 1DBAL 3RL1A 5BS0D 1DLHB 2WP3O 1I1YA 1INQB 3GSRA 4G6KL 3UDWC 3EYUH 5C08B 1PDKA 3OR6A 4W70A 1EIBA 1WIOA 3MLYH 4ELME 1HHKB 2NZIA 4M61B 4YDLC 4MA1C 2HRPH 1R3LB 4WI6A 1SBSH 3DV6A 3NTCL 5FO7A 4ISVB 5ACMA 5I1JL 3KR3H 4P5TD 4U3CA 1OD7A 3ARBA 2ATPA 5HDQL 3SDAD 1T04A 2P4AB 4XNZB 3NZ8B 2NY4B 3GRWA 3OKNA 3AM8C 3WS3A 4J3XA 1J9CT 2VXSH 5EUKA 1XGTA 4G8EB 5J57B 3TBTA 3TT1H 2X1PA 5M94B 1XGQB 4EN3A 3WL9B 3A6CH 4NFBA 4F9PA 3LRSA 4IRJB 4CMHC 2XQBL 2CRZA 5TGBA 2OK0L 4OLZL 2FJFA 4F7EB 4UT6H 4HWNA 1FN4A 4OB5H 5JDJA 3B2UC 4MCZB 4QXWA 2VABA 5FO9A 3AS3A 4HIIA 4G5ZL 4JRWA 2FR4B 1T22B 2EIDA 1FO0B 2QSCH 1XR9B 2D0GA 5AUMA 5IKCA 5IFJA 1INDH 1JN6B 5DK3A 2DTSA 1EK3A 4D0DB 1JHLH 4BH8A 1WCBB 5B3JF 1FC1A 2XZQH 5KSUB 1OWWA 1P4IH 3ZE2F 3K4ZA 2PYEA 2VR5A 1DSFL 4JFZH 5ALCH 3V5HA 1QD0A 5BXFA 4LEXL 5IMMA 1GOHA 3K8MA 3T2OA 2AGJL 4P23C 1JWSB 4MJIB 4OCXH 3VMOA 5C7XH 5HI4D 1NSNH 2BJML 5C0BE 4PP2A 3VXQA 4MXVF 4JKPL 4GFTB 2JJTC 3ELAT 5T1MB 3SOBH 5DUML 3ARDC 3D39E 3JWDL 4XNMA 4PG2C 5GZNC 5MENB 4G7VL 5IM7A 1NAML 3VDAA 5JW4M 2R69L 4IRSC 1D9KB 1Z0NA 1KCUL 1T1WB 1A3LH 3UAJC 4NO0D 4F9LA 1OGAB 1OAUL 1I1AC 4UB0L 4NQEE 2BSED 4OZHE 4X4YB 2X09A 1F4YH 3TV3H 1KJVB 3C5ZD 4NNYB 4GQPH 4GRWH 1U3HD 2BVPB 5HTSA 5E5MA 3T2QA 4Q0XL 4YZFE 4FNLL 3LPWA 2A83A 5I6XB 4F33A 3HE6D 2FH8A 4GW1B 3BI9X 1HXYA 2JJSC 3WNMA 5JOPD 3MX0A 3GSVA 4H1LA 3EHBC 2WK2A 3QDMB 1FVEB 2D0FA 3DTXA 4FMFA 2M2DA 2R9HD 3KYAA 4KVCH 3V7AE 4TOYL 4H0HB 4N8CH 4ODSL 3CK0H 4O2FA 4D0BA 2W0KA 5J4MA 2DQEH 4YNYA 5C0GB 4NRXB 1NMCC 2WBJB 4Y1AB 5C9KA 2X4QA 2H2SD 1NLDH 4X6CE 3IFPB 3MGTA 4OLYH 4CW1B 3PHQA 4OIBA 1JZ4A 1KV3A 2Y6SC 3P77A 3GHEH 4LSPH 2Q8AL 1CQYA 1FRGH 1JYWA 4KQ4H 4N1CA 1KNOA 1EXUB 2FSEA 4I77H 2MQCA 1FV1B 3MTRA 4JO3H 5FYLL 1ORQA 4YUEL 1DBML 1XF4A 4HXAL 3LV3B 4D9RE 4XP5H 1QLEL 3QDHA 1PKOA 4FQIH 5C09E 3DMMD 1QSFA 4PY8I 2E7HA 3I85A 3W0WB 5A43C 1MLCA 5TH2B 4Y7MA 4ZPTA 2NQCA 1Q72H 2O5YL 5EBWB 3BPOC 1ADQL 2J12B 3U30B 2VISB 4M8QB 5DC9B 3ILPA 2DQGL 2Q3ZA 4Q7DA 3GMMA 1XR8B 4NC1C 1J1XH 4YHZH 1SQ2N 1VERA 2NY7H 3ULVC 5DHVH 5FYJD 3WO4B 3C6LB 4J4PC 2WANA 4JQVA 3VFOB 2V5SA 1F00I 4X9BA 1Q94B 3QUYB 4JFYB 2D9CA 3M1BB 4PPTA 1AR1D 1NAKL 2X4OB 5E6YA 5F3BA 4GUPB 1NC4D 3GO1L 1U3YA 3TBYA 4XC3H 1NGXA 3CMOH 5IK3B 1BZ7B 5HHNA 2PO6D 3QRFM 3CUPA 2B1AH 3S5LG 5KVDH 4ZNEA 1U93B 1FVCA 2C9AA 4Y16B 3ORJA 1NCBH 3VRLE 1MHCA 2VZOA 3P4MB 3TYFA 5D7IE 1V7MH 1EX0A 1RJLA 4G6AD 3G5YA 5E2TH 2IEPA 3IFOA 4YGVB 1JYVA 4DW2H 1J5OL 3NA9L 4X7CC 2DDQL 4YJZL 2VR4A 4LPVA 2ITCB 5MI0C 1RZKC 3W5MA 5LQBH 2FX9H 2G60H 1F6LL 4M7JL 5DJAB 4OF6A 1KELL 3AREB 4H8WH 1TJHH 3UBXB 3L3GB 3C60D 1J8KA 3RU8L 3U36A 3LH2H 3AY4C 3DNKA 2G2RA 3UDWA 2YBRB 3QEGL 2HLAB 4P3CL 3DETD 4UZGA 1I1FA 3FO9B 3EDFA 3DBXB 2DWDA 5F9OH 4UV7H 1NBZB 2DTMH 5T3ZL 4WTZG 1LP9F 1ULVA 4HFWA 3QIUC 4MD5B 4Z95H 3BD4A 4WUUA 2D7MA 4R0LC 3QWRD 1SYSA 5E70A 3SQBA 4GXVL 3S37L 1CS6A 2NXZB 4H88H 1TZIA 3LPGA 1KN4L 4HJ0C 3EYSL 1UJ3B 4NN5B 2I26N 3AM8A 4X6EB 4Y4KD 2C3VA 3PWNB 3ULUE 3X11B 1K5NA 2EDYA 1DQML 5IMKB 2GITB 12E8H 1EVUA 1G1YA 1YNTA 2XWBA 3I50H 4M6NL 3H7BB 4FQCH 4XHQA 4ZTOH 4Y2DB 1M1SA 1F8TH 4C83B 2ZUTA 4HAGA 2QLVB 5BRZE 1MI5A 5C0ND 4M03A 4M62H 3B8YA 1QBAA 3F58L 1DFBL 5FECA 5JA9A 1IKNC 1FNSL 3VD4A 3X13A 3Q3GB 3UTSE 4GW4B 4NN6C 1WWBX 3EJZC 4ZS6C 5F1SA 5T1DL 5CEXB 5C6TL 4JQIL 5I19L 4Y19A 3PHOB 1FJ1B 5F7HA 3KDMA 4JPKL 4PFEA 3QPXH 1IEBA 4XHJC 4KZDH 4PV9B 4P2OB 3C8HA 3OX8B 5SX5H 3V2AR 2YK1H 4KY1L 3BRGC 1S9WB 3MJ8A 2A2QT 3O6FC 2KZWA 3MV8A 1BVZA 1VGEH 1WK0A 2FX8H 3L5XL 2ZUUA 5E8DL 1LE9B 1QPPA 1XCTA 3MJ7A 4LNVA 3OXRA 1BQHA 4UNUA 5CILH 5MEPA 4GH7B 4L3CA 5GSVB 3C2AH 5DD1L 4G6JH 3GSUA 2ZOKB 3HZVA 2EH7L 5DRWA 4YX2H 4LVHC 4PJ8B 2PTTA 3Q2CA 1J7VR 2RIKA 4RFOH 4J7RA 4NUGH 4M43L 3C8KA 1ORSB 3UYPA 4ZODA 4GMTH 5HDBE 3MACH 4QHNB 32C2A 5GRVL 3MRHB 2JJTA 5F97E 3QFJB 5GRXG 4YPGA 5M7QA 1IM3A 2BY0A 3MV7E 3OAUL 5D72L 5DD0H 5EORL 5I8OH 5AZ2H 4NCDA 5A3IC 1T5WA 1WBYA 2XQYG 4IRSA 3WJLC 4XMKH 3FAWA 1ZT1B 1IC5L 5KZCB 1EERB 4L29A 4N8PA 4NHUB 2DLEA 1H8NA 1UB5B 3AGVA 1DN2A 3GBNH 4DAGH 5BV7B 1I1AA 4YDVB 4OV6F 3KWWA 1CGXA 1W0VA 2ICWJ 3FRUA 3BGFC 3DGCR 5HYSB 3ZTNH 4GSDL 2HJFA 4LPXA 5E8NA 5DR5H 4GRLD 3I6KB 4NQDB 1DUZB 3O2VL 3H9HB 2JIXB 1FO0L 3FOLA 4I3SL 4JN2B 3ULVH 3MV9E 2AJUL 2XFXA 3BH8A 1X9QA 4XNQB 4DK6A 4HK0A 5ESQB 1X3DA 5CD3B 5KTEL 3GSNB 4LLMB 1QFUH 2FZ3A 2YN3A 2DIBA 2NX5E 3QDGA 1MRCH 1NMAL 1RIVH 1OF2B 2DQJL 2XYCA 3HUJE 3V6ZB 2XWTB 3HG1E 1WQVT 4U1KA 2W65A 3M8OL 1E28A 4HMEA 5KSBB 4JM2C 4MAYA 3OJDB 1F3JB 4CVZB 3CMGA 2YUXA 3L3OA 5D2LE 4LHUA 4NSKA 5IB4B 4EI5C 3MOAL 3JVGC 1S5IL 1SJHB 4PJ7B 3S5LA 2WWKT 43CAB 1MWAL 4A6YA 4ZAKB 1JYNA 1BWWA 2P7TB 1J0ZA 2R4RH 4PRHE 5D2NC 2A73B 4XZUA 1CBVH 5GGRB 5I2IB 5KSAC 1RZKH 2V5MA 3BOVA 3IAPA 4M5YL 3VG0L 3WN5C 2XWJB 5DDHB 3OWEA 5DGRA 4TSAH 2Q3AA 5EBMB 5I30L 3LY6A 2E7LC 4PD4J 3GMQB 1A8JH 3RUGA 5ILTH 3P4OB 2I24N 2OL3A 4KRNA 4LQFL 1D5ZB 2ZUVA 3QHFH 2CO7B 2ZCKL 3EKCA 4P2QA 4KTEH 5MP6H 1BBJB 2H45A 4PGEB 5FGSA 1LO2H 2WWMC 3IDIB 3CH1B 3H9YA 2B4CL 2Z92A 3HNTH 3NIGF 5EO1B 3K8LA 1U42A 4WTZA 3MLZH 4AMKL 5FHBH 5CIPA 1UB6A 5L0QB 4RIRB 1AFVH 1KJ3L 5FYKL 2WP3T 4HFUL 4FFZL 1A3RL 4JG1H 1S9YB 4JO4H 3R06B 4D9LL 4U2YA 1A6UH 5H37G 4X4XB 4G80A 4XCNA 4QY8A 3ZYOA 3LKQA 2AV7B 4LCCC 2X7LA 1ND0B 1IKFL 3MLVL 3LN5B 4KUCD 1Z9OA 3KYOA 3ABZA 3WYRA 5F6IB 1WISA 4DTGL 3BH9A 3DXAB 5HVGB 1MIML 3P30L 1RIUH 1MCRA 5F6HI 2R0LL 4LVOC 2VNCA 3MLPA 4ZFFA 1FNEB 4JRXB 5LGJA 5AWNL 4YDIH 3BZDA 4POZD 3AXLA 1RUMH 4UILL 4F2MA 2J88H 1UWEL 4JY4A 2PW2A 4KHXH 3TT3L 2WIMA 3PP3K 5F1IB 2BHUA 2VLJB 2C4FT 2Y7QB 4YC2C 1UQSA 2BFVH 4UINH 3X3GH 3JZ7A 3QRGL 1N2RB 4YHOH 4ELMF 3NCYP 1K9TA 3S36H 3SE8L 3MYZA 4R0LA 2BNRA 3WD5H 2BERA 1TTGA 1L7TH 1LEIA 4Y4FA 5C70A 3D1MC 4JDTL 2DBLL 3ARVA 4NZTL 3VXRD 5I75B 5DURB 2F19L 5CD5C 5CZVH 1N4XH 5FO8A 5IB2A 3KPRE 4UQ2B 5HGDA 4O58L 5H8DA 1TJIH 2KUTA 2YXFA 5FOJA 1WT5C 3HPLB 3DSFL 4F58L 5GGTA 4OQTL 4X7FC 2EEDA 4UMGA 3RVUC 25C8H 3T4YB 1HHGA 1NDGB 4QXUL 5DQJA 2O5ZH 1Z9SA 4OLVH 5EU5A 1U8HA 2LQRA 4UNTA 1R5VA 1JI1A 5EU6D 3VGHA 2BZDA 2ZSWA 4E41B 5IBLD 2HRLA 3QEUA 1ITBB 3MJ9L 2FWOB 1IGCH 1U8LA 1HHIB 4NJ9L 2EDWA 3PWJB 4YIQA 4EVNB 4UTBH 4YDJB 1JRHL 2QADC 4G8GB 2JCCE 4NO5B 3K74B 4Y4HA 2VDQL 3LMJL 1TZHA 3E3QE 3QR2A 5IGXL 1I7ZB 4DVRL 1R5WB 3QQNA 2VN4A 4QHKI 5CGYC 2CLVB 1CVSC 4FG6D 1E4KC 1T20A 2FYYB 4Q9RH 3KJ6H 4HUWB 4PJAB 4X80H 5KS9E 4C59B 1TTFA 2QQQA 5T33H 3BKJH 1IAIM 4LNRA 1NFIA 5TE4H 4HT1L 3EJJX 1BF8A 5I18L 1AXSA 3SKMA 2ZUYA 4HKXB 3UTPE 1FH5L 1MCPL 3MJGX 4L4TE 5F8RC 2P43B 4UTAH 4PGZA 4CVXB 4HUUA 4RGNC 3NZHL 1YY9D 4DKEL 1NC2B 3VRIB 2CK2A 4K8RC 4M7LH 1XF2B 3P4NB 4ETQA 5BW7C 5I16B 35C8L 15C8H 3T0WA 2YPLA 5FOBA 2C3XA 4KKLC 1NLBL 1YYLL 3MRPB 4MWFA 4JFDA 2HT4C 2OTUB 5IW6A 2P42B 1VPOH 4LLYA 3WIFA 2K7PA 4K2UH 3QIBB 1F97A 3N9GL 2ADIB 3FZUD 3PL6C 4HS6A 1YC7A 1MLBB 4JO2L 3P0YL 3MJ6A 2GTZA 4KROC 4XPBH 1BJ1J 5BS0E 1BX2A 1QSFD 4HXBL 1MAMH 2FX7L 1DP0A 4RCAA 1YEKL 1QLFB 4L8SC 4MJ5A 1G6RB 4ZSOA 2CJUH 5FDWB 4YZFF 1IILE 1JTPA 4KMTH 1FLRL 4UT9H 5FF6B 4KJYB 5D7JC 2DIJA 1CICA 4GW5B 3I3DA 1QR1A 1VADA 2UWEB 2HLFD 2OR8A 3MNZB 3ZHKA 3MLWH 4FXLA 2X4NB 3CFKB 4FQ2H 1KTRL 4LP4A 3G08A 4J2XA 1ZHKB 4RISH 2Y5TA 2ZKHH 3UTOA 1BD2A 3H0TA 1J05A 4JM2A 1OTSD 2Z31C 1G9NC 5E4IA 4ALAH 4X6CF 2E8YA 4ZQKA 4LBEB 4EI5A 3JVGA 2BSTB 1TETH 1U8KB 2H8PB 3I3EA 3W11D 2B1HL 5F9WC 5DFTA 4JFXA 3QUMH 1KB9K 1RUPL 5T3XH 1P6AB 2FIKB 3G5VB 5KSAA 2B39A 3L3JB 3JWOL 4N9OB 3WN5A 3MRCB 2A6JB 3ROLB 1QRKA 3QNXA 3B9KB 1OHQA 3IXAA 3PABB 5FM5M 5C9JA 3QO0B 4PG9A 1P2CA 3CVHB 2E7LA 4TUJB 3CSBA 4R2GC 3S3JA 4NNXA 2FGWH 1CTOA 5GGUA 2OTWA 3BMWA 1PG7W 3CLEL 3Q6FB 1CFVH 2YR3A 4PB0H 5IQ7H 3KPNB 4MD4A 4IMKA 4U1HA 2QHLA 1RZ8A 1JHTB 3IDXL 2EE9A 1KB9J 4PRBA 5BZDA 5HVFB 4WY7H 3DSNA 5IVZB 4OQ1A 2WQRA 5KSVA 4JKKA 4TPRL 1S7RB 3KPOB 1HH6A 3ZDYE 4LLUB 4TVPH 3TZVA 2D31A 1HI6B 4NBXB 3MGAA 4PJIE 4WUUD 5EZOH 3PDOB 1ZLSL 1QRNA 3TJEH 1F13A 4PTUA 1DZBA 3T3ME 3AB0B 2JTDA 2EIZA 5CBAB 5ITBH 2W0PA 3OR7A 1JZ8A 3QDJB 1YNLH 3D85A 5C0AA 1U8JA 1CXIA 2J2ZA 3BO8B 4LCCA 2AJZB 3QCUH 3VRLF 4WEUD 3U7YL 2NPLX 5D7IF 1OM3L 4F15C 4IS6B 4LEOB 5EUOE 2V2XB 5EO9B 4NDMA 1HCFX 3Q6GL 4HPYH 1MJ8H 4MDIB 1MI5D 3O4LB 3U7WH 1D5MB 1FZJA 3RL2A 2EYTB 4OKVA 3B2UD 3DO7A 4PJGA 4GG8A 4ONFL 3VCLA 1NCWL 1KG0A 2X41A 4O2CA 4Y19D 3UJTL 2VAAB 5CJXA 3S8WA 1N5AB 1RD6A 5TDNA 5JHLL 1M6OA 5TQ0L 1BAFL 5FUOL 4GMSL 3BVNA 4AENB 2E6JA 1OTTC 2ICWA 5L88H 3BFOA 4X6DE 2OZ4L 2Z8RA 3EDDA 2BCKA 1WBZA 4GRMA 1YNKL 4AEIH 5D6DA 1MCCA 2GTWA 4X9IA 1NCDL 1U95B 2IAMB 2NY1C 3FFDB 4N0UB 1LHZA 2EDKA 3D69B 1RU9L 1U9KA 3NCMA 5HHOB 5DS8B 4ONHB 3G5ZB 4K7PX 1H3PH 5FKAA 3MMEA 5CJQL 3ULUF 4HMCA 3PNWB 4K07A 4BZ2L 2XZCH 3IT8D 2ZSVB 3PWPB 4K8RH 1OP5K 3ARDD 3QUZB 3CH8A 3O6KH 4HWBL 3WBDA 5BJTB 4FZ8H 4YHKL 1FFPA 2IC2A 3NAAL 5GZND 5LWYH 4L3EA 3RVVC 5IHLB 4IRSD 1C1EH 4Z7UE 5I1DA 3P11H 3UAJD 2NCMA 5GGQH 3RGHA 3OL2A 3R4DA 1I1AD 1DQLL 3CCHA 3E6HB 1CE1L 1F11B 1IC1A 1JGUH 1DE4A 1YEJH 5GS1C 4BQ9A 3S36X 2OI9B 5HHPA 1GGIH 1ZANH 2OJZH 5DHYA 2F9BT 5H2BB 4POUB 1HIMH 4E0RA 3PUCA 5FYJE 3MA9L 2V9TA 1ZHBB 1FPTL 2DICA 4XVSH 1SMAA 3EHBD 4PJBB 1KCSL 4WHYG 3C87A 1E27A 1MPAL 5GGVL 1S9VB 1SVZA 5TQ2L 3QDGD 1XFPA 1IGFH 2DF3A 3HNVL 5ISZB 3CLFH 1ZV5A 3GI9H 4R96B 2HWZL 3QXDB 5IVXE 3RWJB 1C8PA 2D7NA 4HIEA 3GGWB 1CXKA 5FA4A 1G9NH 4GKZB 3F12B 2IH1B 4J3OC 1T0NB 1FDLL 1QFWH 3LKSA 4MLIA 4PRAA 5I17B 5HDBF 4MAYD 4JG0H 3VFSB 4UV4H 1I3VA 2Y6SD 4H20L 1X5IA 2LV4A 1EHLH 4YFLI 2DOCA 2ZJSL 3CZFB 4LHUD 4RRPA 4JANB 5B3NA 2QTEA 4MNGB 3VXNA 5F88B 4UIKL 4RAUB 1K4DA 1EEUA 3O4OB 3P0VL 4U1JB 2A9NH 3F7PC 2CQVA 2WBKA 1U36A 3IRPX 4YDKH 3SDYH 3HKFA 4NO3B 1T6VN 3EFFA 2A9ML 3PJSA 4PJ5B 4ZUTA 1EAPB 2R4SL 4O5LL 3GRWH 1H3TA 5E99H 4NWTH 5I1EL 3B5GA 1O7SA 3GIVB 4PGCA 4NQSB 5H94A 5TE6H 3RGVC 4RWYL 3BP4B 3JUZA 4WFFD 2X6MA 3FCTA 3HPJB 1ZHNB 1ZT7B 5GISL 4P2QD 3S34H 1RK0B 2CH8A 4OD1H 3TVMB 4EBQH 1QSED 3ARGC 4WI7A 4PJXB 1VEPA 4N5EC 3S4SA 3HUJF 2P8PA 1QVOB 3BESR 3SQOL 2YEZA 1FL5B 2R1WB 5ALBL 4R3SB 3MLUL 1T66C 5IIEA 4PTTA 1P1ZB 1FIEA 1L9NA 5IMOB 2YZ8A 1JNHB 5D1ZA 2XKUA 4Y5XC 1FGVH 5D2LF 5E1HB 1J1OL 1UA6L 3F7YA 1ZVHA 4AIOA 2Y06H 2F8VA 4DKAA 3MRMB 3QULB 3WEXB 4TULL 3MODL 1F58H 1FZMA 1KXVC 3QFDB 4O2EB 5FV2A 4WW1B 2AEWA 2BX5A 1OT2A 4XBEL 3O6LL 3IDJB 4HZLA 4KAQH 1G6RL 4P3DA 2QSQA 4JDZB 2YC1B 4FQXB 4OV5B 2DQTH 5T1LA 2C7UB 2FB4H 3L3HA 4YFDB 5ETUB 1SY6H 1YN7A 4TNWF 2G75A 1UYWL 5KN5A 1QSVA 4UOW0 2YS4A 3M45A 1YJDC 5FKPA 2A74A 5CFHA 1BJ1H 3QIUD 1B3JA 1JTOA 3BDYH 3BX7C 2EKSB 4M1GH 3RZCB 2EKJA 2OM5A 2BNRD 4OFIA 4WW2F 2CRIA 4G8IA 3NCCB 3U46A 4Y4FD 1RUQL 3S88L 3MFGB 4I4WA 4D9QD 5A2JH 4BZ1L 5GS0L 3UXFA 1R0AL 2DB8A 2AAVA 1GGTA 1JWUB 3S35H 1JWMB 2NY5C 4QRUB 3U4BL 2EDNA 1HHHB 1N7MH 4O02H 1N5YH 4ZFOL 4QHLA 2E9IA 5ADOL 1A1NA 2A0LC 4JY5L 3RAJL 1SYVA 2GQHA 2Y1VA 4H1LH 3A6BH 3WLBB 2GIYA 4MYWB 4U6YB 2P48B 4HCRH 5FCUH 5DUBA 3EJZD 2NMSA 3DYOA 4BSVB 4OCRH 4M93C 1NDMA 2YWZA 2X4RA 1KN2L 2Y9RT 3EYFA 4L9LA 4ODUB 5FYKU 2XN9A 1RZIA 3PQYB 2DI9A 3MA7B 1ONQB 2VZ3A 5JZ7C 1BGXL 1ZS8B 2VDNL 1KF9B 4C56B 2DQIH 3O6FD 3QNYB 2P5ED 3SDCB 4L8CA 2J5LB 4OD2A 5IFHH 2IH3B 4WJ5A 2CDEA 4QRTA 3EGSB 4KVNL 4LASH 3QXAA 1E6OL 5DZNA 4OCWH 2YOCA 4OTXL 1REIA 5DRXA 1S7QA 1FORL 2A6KA 3KYNB 1MEXH 1G7MA 3DUSB 5EB9A 2F53B 3EOAA 4ZO8A 4Q6IC 1ZHLA 2V2TA 5DA4A 1YEFL 1GJIA 1A2YB 3IJHB 5DJ6A 5EOTA 2XXCB 5A3ID 3GKWH 3BP6B 2CXKA 4K7FB 2Q20A 1OAQL 4OGXL 5JMOC 1XEDA 1YMMB 5INDA 3BXNB 1FYTB 1R3IH 1MOEA 7FABL 3WS6A 2YPLD 2J4WH 1N8ZB 1YQ2A 1DJSA 2AJ3A 3LN4B 2MMXA 1JF1B 1A7OL 5I9QB 3GNMH 4JFDD 3EYOB 4HG4K 1BM3H 2IQAB 3VFTA 1C7SA 2YMXL 5MEQA 2P8LA 3KLAA 2CUMA 1PG7H 5L9DH 1KJ2A 3D3VD 4JB9H 2AV1A 5D1XA 5DRZA 2JCCF 1MSPA 4OD3H 1XGRA 1AR2A 3BSZH 3GBML 3S3PA 1MIEH 3N1MC 2HVKB 1IGML 4FQQA 4JFHD 1OARL 5B38G 5GJTL 4KRPC 4XCEB 3VFWB 5DD3L 3VXMB 5ELIA 5TF1L 1CT8A 1EH9A 5KS9F 2HJKB 4WRLA 1DBAH 3QI9A 4PRIB 4Y5VB 2OTPA 3NN8A 3DURA 4UU9A 4Y5YC 4OLUL 1JHKL 3N1QC 4G6KH 4JREB 4JM2D 3A67L 1WFUA 2FEEI 3CVIL 3VXOA 2FJHA 5IF0B 1HSBA 3SDXB 2J8UB 3T8XA 2NW3B 4EI5D 3OAYK 3CFEB 5AAWA 3NTCH 5I1JH 2OSLB 1NGYA 3Q5YA 1QP1A 5KSAD 5DHVB 1EUTA 3S96B 1I7TA 3L9RA 1Z9LA 5DFVC 4PLNC 3DYPA 4BSJA 4MJ6B 3HCVA 2WMPA 3B6SA 3HLAB 2VJXA 3QA3A 3GMRA 5C3TA 1ZK9A 2KKQA 5FM5O 5DSCA 4HJJH 4RFEA 1AO7A 3RGVA 1DQQA 2R0WL 5L6YH 2CGRL 1FG2A 1Y0LB 4X4MA 2XQBH 2OK0H 1MH5B 4XVUC 4OLZH 3RVXC 2V7HA 1MHEB 1IC4L 5FUCC 2WWMD 3KLHC 3ARGA 3KPLB 2XOTA 3EOTL 5D96C 1X5XA 1GYAA 3QDAA 3ES6B 4PRPB 1TQBC 1I9RL 3VXRE 2J6EA 1MNUL 3F5WA 3LQAH 1SJVA 1AD9B 3TZVD 3RWCB 1W2KT 5GSRA 4G5ZH 4TTGA 1IC7L 4Y0GA 3NFNA 3O3AB 4N0RA 4WWID 4AH2A 2OMNA 2X1OA 4FFYL 1QRND 2VL5A 2XTJE 5GZOC 5JDSA 3AU1A 3O3UN 3RTQA 1M71A 2F5BL 1G7QA 1YQVL 2H9GA 3FT2B 4KI5C 4RMQA 1OB1B 1Q9KB 3VE0A 5J6GB 3D85D 5C0AD 2EYSB 1JUFB 3O8XB 5CJOL 4X7SL 5FK9B 1FQ9C 2R2HA 3VWJB 1JZ7A 1VFOA 4DFHA 3RDTC 1U6AL 3GZKA 5EU6E 1R3HA 3FQRB 4LEXH 1M7DB 1RJZB 3EZJB 3SKOA 2AGJH 3HZKA 3IU3A 3O45A 4I0PB 1T1YB 4MSWB 3HMWL 3VH8A 4Q58C 5EPMB 1WWAX 2BJMH 4JKPH 1S7SB 2AEPL 1UH4A 2VKWA 1KEML 4D0CB 3JWDH 4XT1C 4JFPA 1J8HD 2VH5L 3VG9C 2YPKA 4RFNB 4WU7A 4PBVC 4G7VH 1CWVA 1NAMH 2QKIB 2R69H 4YEFA 3V7AG 1A6AB 3LRGA 1ZLVH 4HLJA 1IE5A 1OAUH 4GBXB 1KOAA 4UB0H 1CFQA 3X14A 4NBZB 4WO4C 3P73B 3BP5A 2Y36L 2APWA 2YA1A 3RFZC 3ZDYF 3CDGA 5I66A 1A21A 2GCYA 4PRDA 3V6OC 1O0VA 4Q0XH 2BOCB 5CD5D 4PJIF 4FNLH 2E27L 4Y89A 3WHXB 2P8MA 4MXWL 2ZCHL 3U2SA 3VXUB 3T3MF 3SJVA 1A0QL 1V5JA 1P7KB 5DK0A 2WNGA 8FABA 1ZE3C 1BLNB 4IEFB 5ANMA 1JMXA 2EEAA 3GSOB 4TOYH 5A1AA 4J3VA 4MQ7B 4Z7VE 3RVUD 1FNFA 4ODSH 4P46B 1R24B 3V8OA 5EUOF 4XNZC 1IQWL 2NY4C 4L3ED 3N50A 1PGRB 1XH3A 1FNGB 4Z7WB 3PE9A 3TIEB 4ODVH 4NQCB 1QBML 4LCWA 1T7VA 1EZVX 4GRWE 1CCZA 2Q8AH 3FO2B 2I25N 2QADD 4CADA 3FQNA 3REVA 3IAGC 4LU5L 4PYHA 2JKXA 2X1QA 4RGOL 4IRJC 5FYLH 4TYUA 5J0BA 1HILA 4YUEH 1PQZB 3WSQL 1N6QL 1DBMH 3D25B 4HXAH 3JV4A 2VC2L 2A6DB 1J0HA 4LQ1A 1QLEH 2BSRB 4X6DF 3QEQB 5CGYD 3STZA 1RHHA 1T3FB 3S35X 3A6CL 5ENWB 2HJLA 5IVOA 5B38A 1DEDA 1ZSDB 2O5YH 1GGYA 3OAZK 1ADQH 1LD9B 2NW2A 3MLTB 4PS4H 1AKJA 5ERWB 4NO2B 1CDBA 3DI2B 2X1WL 2DI7A 2DQGH 2R23B 4Q6IA 5SWZE 5DD6B 1D6VL 4HMDA 3LOWA 5JPMB 3EYVB 3MRNA 3I75A 3M17B 4PJ9A 4G6FD 1MY7A 4N8VA 1N6VA 1RSFA 2CUHA 5IB3B 4RGND 3C9NB 3U9UB 1OLZA 1NAKH 3BAEL 5ICYA 2I07A 5CJ8A 3GO1H 4KKLD 3ECBB 4Z7UF 2HT4D 3SGDH 3MOBL 3VFUA 1D5BA 1XIWA 1CN4A 4NQVB 3FQUB 1P4LA 2Z93A 3PL6D 1EFXB 4YFLF 4KROD 1C5DA 4S2SB 5ID1B 1AIFA 3Q48A 1NGWA 1A9BB 5LJYH 4XRCB 3CDCA 5ID0A 1I8LC 1D9KC 1J5OH 3GMNB 3NA9H 4LSUL 4OCXL 4ZYKA 2DDQH 5MERA 3EUUA 1Y6MR 1XGPB 1YPZB 5D7JD 1X6LA 4LKXB 5F44A 3LS5L 4M7JH 2Q86B 1KELH 1KTKE 3GSXA 3P9MB 1CD1B 2ICES 1YN6A 4WUUE 1LMKA 5HGAA 4O51B 3MR9A 4ODTL 2NNAB 4GAYA 4WEMB 4CU6A 5INCB 3MRLA 3QB7C 5I6XC 3C5JA 2YD7A 4KJWC 4P3CH 2Z31D 1DTUA 4JZNB 3KXFB 4NFCA 4L4VB 5EU7C 1F4YL 1DBBL 1RMFL 5HGBA 1ZGLB 5JW5A 5E6IB 5T3ZH 2CRMA 3D39A 3GJFK 3JTSB 5CEZD 5FM4A 2B4CC 3FQXA 2P5WE 1Z2KA 3ARRA 3S37H 3AFLA 2WBJC 1KN4H 3EYSH 1HQRA 4P5KA 4QCIA 1O5DT 3RBSA 4LSDA 2D2OA 3QZWB 2CKBA 5AG8A 4NQEA 5DUPL 3EO1B 1DQMH 1H0DB 2V7NB 4M6NH 4BFBD 4R2GD 3F62A 4MXQC 4NKMB 3TA3A 2PNDA 4LIQL 1GXEA 1Q9OB 5T1KD 3G6DL 1FL6B 1MAJA 4TSBL 5HJ3A 4JFOB 3F58H 3FN9A 1DFBH 4GO6B 4UDTB 2C3WA 4OFYA 1G9EA 1MHPL 1B4JL 1FNSH 3KVQA 3WFHB 1ODAA 5HHQB 1URLA 3HC3L 1PSKL 2FECI 5T1DH 5I19H 3QQ4B 4JQIH 4NQTA 4O4YL 5JIPA 4FXKB 4JO1L 3U30C 2N7BA 4JPKH 4ODXA 2DQFB 2F54E 3T09A 3VFRB 4YBHA 5SWSA 4TTDC 4ZPVB 3ARXA 5LAXB 4RMUA 3WO4C 1U8MA 2LTQC 3C6LC 3UTQB 2IANB 1ZLUK 2PR4L 3L5XH 1G7PA 5I1HL 3BZ4A 5E8DH 5E9DE 1MCDA 2RFXB 4KHTL 3TH2T 4ZUWA 3QUYC 1YMHB 4IM8A 3WE6B 1IAOB 4ZXBA 4NRZB 2GFBB 5J06A 5DD1H 1D7FA 3RDTA 3MO1B 1IEAA 2EH7H 2OX5A 4LDLB 4JAMA 4EUPB 4HC1A 3SGKC 5B8CB 4ZO7A 4DUVA 2O61B 1AP2B 1V3LA 4M43H 4CNIA 1WWCA 4XNXL 5HYFA 2OLDA 4KK8C 2XY1A 4S1DD 4Y16C 1RVFL 2AJYL 4G6ML 1KTLA 4ZOBA 1A4JA 3BEVB 1YA5A 2W9EH 2RBLA 1FC2D 3OAUH 5EORH 5IOPA 4LP5A 5D7LE 1S3KL 3RWEA 4UI2A 5F1NA 5IEKA 3SE9L 2XN9D 5CSZB 1OTTD 1XF5A 4HBCL 1S7UB 5E95B 3IJYA 5ESVA 1CFNA 3AREC 4ZUUB 2XZZA 2Y5EA 2CK0L 3SEPA 3H7LA 3QDGE 5K9JH 1VACB 2C1PB 1PKQB 1U8OB 3HE6B 5E94A 2FDBP 1CIUA 5E0QA 5L2KB 5JW4R 2Z8WC 1TVBB 4GSDH 2NY1D 3H3BC 1INQA 4WV1B 3L7EB 3O2VH 5LQBL 1FO0H 1UM4L 4I3SH 3K1DA 2GJ6B 2IF7A 4M61A 4BKLA 2AJUH 1R3LA 1CFSA 4H26B 2E8ZA 3U0PB 5D7IA 5KTEH 4ISVA 3QWQB 4WI9A 5I1IL 3QUKA 5DQDL 2DQJH 1L6ZA 3WXWL 2NXZC 3I6LE 4NN5C 3RWFB 3BZEA 1AD0B 1UJ3C 1D6EA 3NZ8A 3RVVD 1NCCL 3M8OH 1U2HA 3T65B 1MFAL 1P9MC 4G8EA 2K1MA 4LOUC 4M48L 1XGQA 2RGSA 3HI1A 4EQ2A 2L4OA 4Y2DC 3MRBA 3MOAH 1S5IH 4KRMB 1MWAH 2GAZB 1YEDA 3ZKNC 3RUGE 4NC1E 2YSSB 3TCLA 4F7EA 3ULVE 4XP9L 5D1XD 3MQIA 3UCRA 1P6FA 4WFFE 4M5YH 3VG0H 4P2QE 4OZGE 3NFPA 1K2DB 1QSEE 5H35A 4MCZA 5H37H 4P0DA 4U1SB 1IFHL 1EDQA 5I30H 3MZGB 1BFVL 3U0TB 2PKDA 1AGCA 4P2OC 3D18A 1NCNA 2EXWC 1NEZG 2CLRA 3WDIA 4K7PY 5HPOA 3QI9D 1PEWA 4LQFH 3QG7L 4APQA 4D0DA 2FIRT 3T1FB 3T0EC 1MCIA 1WCBA 1NC4B 3OMZA 4PJFE 2ZCKH 1WAAF 4FA8A 1B6UA 1MRDL 4F7PB 4YXHL 1K3ZA 5IVXB 1Q9WB 2B4CH 2FL5B 4PJ8C 4GG6B 4FQJL 4U1IA 3TBWB 4AEFA 3DV4B 1KENL 3U7AA 1JWSA 3P9WB 3PHSA 4RDQF 4BUHA 3MNVB 4AMKH 4MJIA 1I3UA 5F21B 4YHLL 1NKOA 3EZ8A 1KJ3H 5FYKH 4HFUH 4FXGB 4FFZH 2OYPA 3VMNA 1A3RH 1W0WB 3RY6C 3DWTA 3U82B 3FB5B 2W60A 5MENA 1AC6A 3B2VL 5EIIA 5J56B 2HT2C 1UADC 2UUDK 4KKAD 4W4OC 4XC1L 1GAFH 1T1WA 1IKFH 3MLVH 3QISA 2I9TB 1JYXA 4MQXD 5BV7C 2XIDA 3C60B 5LBSL 3JWOC 4DTGH 1A1OA 1T7ZA 1MIMH 1KPVA 1LWRA 3P30H 1B0GA 3RGVD 5CBEB 1QLRA 1T89C 3I02A 4X6BB 3OHXB 2R0LH 4NNYA 2YPVH 3WUWB 5AWNH 1NBYB 2BVPA 2BNRE 1DEEB 3ARGD 4UILH 4BFGA 1UWEH 3ARUA 4N5ED 3O2DA 1N59B 3BGMB 5FA3A 3TT3H 3W5NA 2X42A 5DJ2A 4LK4A 5JLZB 3ARTA 4D9QE 2EEBA 2C4XA 4JKWA 1SBBA 3OB0H 1WIPA 3MV7A 3QRGH 1MJJB 5DJXA 2HN7A 1VB9A 4QHUB 2C4FU 4G9FB 1JPFA 4YK4B 2VLMD 3SE8H 4HD9A 2WBJA 4Y1AA 1JNLL 4S0SD 2VZTA 3IFPA 4R97B 4YC2B 4JDTH 2DBLH 2FJGA 4FOMA 4NZTH 5EN2B 4CW1A 3PDDA 4YR6A 2F19H 4PUBL 1BIIB 1ED3B 1TITA 3QHZL 3PDGA 5EU4A 1WC7B 4F80A 1IGJB 4X5WB 4ODWB 4O58H 5FFLA 5JW4Q 4I5BB 2VDKL 1K8IB 1BEYL 1EXUA 2IGFL 4ZAKC 1FV1A 5E24E 3DSFH 4F58H 4OQTH 2FD6L 2BSSB 2P5EE 4I3RL 3DVNB 3MV9A 2ARJQ 5J9PB 4QXUH 1UFUA 3W0WA 5TH2A 1DBJL 1VFBA 1T0PB 4NGHL 4ZDHA 3MJ9H 4B53A 3HG1A 2OP4L 3WKNA 4M8QA 4NJ9H 4HX1A 3IU4L 4L8DB 1JRHH 2DKUA 1CXEA 4PR5B 4P4KA 1HOCB 3T08A 3S37X 3C6LA 3L6FA 2VDQH 3LMJH 3TN0B 4HLZH 5IGXH 2YRZA 5D2LA 4DVRH 1Q94A 4PJDB 4TUOB 3QUYA 2X4OA 3LEXB 3SJVD 5CHNA 4P2CG 4NUJA 4WWKA 4YAQB 5D5MB 2DQDL 4PRHA 3VJ6A 4MB3A 2YPLE 5IK3A 4P59L 4QYOB 2PXYB 2A0LD 5L0QC 4JFDE 5DJ0B 3VI4E 1U93A 1LO2L 4HT1H 4QT5B 4QGTA 4Y16A 4OZIB 3BHBB 5I18H 2NZ9C 3OJ2C 2BOBB 1RZJC 1RK1B 2WUBL 1EJ6A 1FH5H 1MCPH 1W8OA 5ADPL 3D3VE 4LARL 4YGVA 3MRGB 3VFNB 3NZHH 1WEJL 1KCVL 1Z9MA 4LCWD 4DKEH 4F7TB 4U1MA 4K3EL 3FN0L 3K3QA 4ZSOE 3GM8A 35C8H 5EOQL 4CDHA 5F6IC 1S7WB 1NLBH 1DQJB 1HNFA 1YYLH 4JFHE 4YWGL 3D2UB 5IB5B 3UBXA 3L3GA 4CU8A 3N9GH 5F7EL 1W72A 4WW2A 4JO2H 3P0YH 3DOSA 2WBWB 2VB5A 1D5XB 4JHBA 5I0ZA 5DFWH 1CLCA 4HXBH 5A2IH 4UDUA 3KYMB 3GMLA 2FX7H 4LAQL 5I76B 5KVEL 4XH2A 1YEKH 4N1EA 4Z5RB 3DBXA 1YY8B 4J3UA 3IDYB 3O11B 2XNAB 3PWLA 1IQDB 1NANI 2EYRB 2X9YA 1FLRH 5IEHA 5E08L 1BZ9B 1DR9A 3TYGL 1XCQB 3IKCA 1JPGB 4PJ9D 1LK3L 1X5ZA 2CDGB 5D2NE 1QHOA 5FB8A 3WNKA 2V9RA 2CDFB 5EOCL 5F9DC 4ZNCD 2AK4D 4LHQB 1F4WL 4DUWA 5I75C 4HV8B 4Z7VF 3BN9C 2VOTA 4X6EA 3WUZA 5D70L 1P9MA 3X11A 5TPWL 5IMKA 2GITA 3EW3B 1V3JA 5IBUG 1NFKA 2C3HA 4JFEE 3H7BA 2BMKB 2D7TL 1XF3B 3KPPA 1XIWD 4DN4L 4GT7A 4OCYL 4P49A 3V4UL 1AE6L 2B1HH 3SKNB 4DUXA 4XMLL 4GRWF 1N4XL 3L3IB 1RUPH 2J3SA 2VYRE 2WAHA 3TO2A 4M6ML 3T4AB 2QEJA 2IPUG 2Z9TA 4GW4A 4QF1B 1RZGB 5CEXA 1ITCA 1SVCP 5JIIA 1KLUA 1FJ1A 2JJUA 3CU7A 4KRPD 3SDDB 4PV9A 1OP3H 4RA3A 4MS8D 5JTWA 4AT6A 3IDGA 3FT4A 3GJFA 3CLEH 3OR6B 3G04B 4NC0B 2ADFL 1QRNE 1FFRA 4NKOA 3HR5A 4LSSH 1ACYL 1I1RA 4WHTA 5CZXC 1VEOA 3IDXH 4P2YA 5FO7B 5C0AE 1IVLA 4RMWA 1WTLA 2EDTA 1U41A 3LB6C 4X5LA 4TPRH 3ARBB 2ATPB 1IM9A 1T04B 2YRLA 3RJQB 3WS3B 2WINB 1ZLSH 1FIGL 5EUKB 1XGTB 1CU4L 3QFJA 3TBTB 5CP3A 5DFVD 4WGVB 1FSKB 4EN3B 3DX9B 1H3VA 4PJGE 4NQED 1JCKA 4KDTA 4WFEE 3ZT6A 1J8HE 2DL9A 2VXQL 5J1AA 3U1SL 3U7YH 5TGBB 1OM3H 1VFMA 2FJFB 2V9QA 1FN4B 4XNUL 4UTAL 1T89A 3Q6GH 4OLXL 4Z0XA 3QIBC 2LAAA 5I8EA 4XVUD 2ARJA 3RVXD 3L3KA 5HYSA 1E6JL 5C2BH 1F45A 5FO9B 4OFYD 3KLHD 2ZNXA 5FYJL 3I6KA 4NQDA 4ONFH 2RCSL 1NCWH 5HYQA 4JN2A 5AUMB 3IAQA 4NZDA 4U6TA 3UJTH 1RUAL 1WIUA 5JHLH 5TQ0H 1BAFH 5FUOH 4M9OA 4GMSH 5ESQA 3GSNA 4LLMA 4L4TA 5SWSD 4BH8B 3I6GA 1B4RA 2HA1A 1KIPA 2DD8L 1JPST 2OZ4H 1OF2A 2VR9A 4KI5D 3V6ZA 2PYEB 2XWTA 1VSCA 3RWDB 4KK6C 1YNKH 4ONGL 2Z4QA 1P7QD 5IMMB 1NCDH 4ZXBD 3RDTD 4L3EE 5KSBA 4DK3A 1SEQL 3OJDA 1F3JA 1NCAL 4PP2B 1RU9H 4NKIL 1BHGA 3WV0A 2D7OA 4X0KB 4L3AA 4XNMB 2ICWI 3B9AA 5CJQH 4FQ2L 1GC1L 4WHYH 4X83A 5BS0A 2B2XL 5CP7A 4ZFZB 3GB7A 1NCUA 5IM7B 3QBTB 2P7TA 1JIBA 4BZ2H 2A73A 4AIZA 4X6FB 1CK0L 2CMRL 5E2UL 5GGRA 2VIRA 4HWBH 4RX4A 4JFFB 3F65A 4YHKH 1LE5A 3NAAH 4XXDB 5HYEA 5GS2H 2XWJA 5DDHA 3B9KC 5FM8A 1IGYA 5HGHA 4QHMA 5EBMA 5B3JE 1T1XA 1IMHC 1DQLH 4A2MA 2RAMA 3TPUB 3CU1A 1CE1H 1I1CA 5I71B 3GMQA 4IDLA 4JZOA 4WO4D 2A83B 3SDAA 1MCOH 2DMCA 3P4OA 4OM1L 4F33B 2DJSA 1NUGA 2Q7YA 1NFDB 3ARSA 5CAYB 1D5ZA 4OKDA 2DYPA 3GSVB 4IDJL 4KV5F 4PY8J 4H1LB 1WF5A 1LGVA 4YHIB 5C08D 3KS0H 3MA9H 3IDIA 3WNNA 1O7VA 4Q6YA 3WNPA 1FPTH 4U7SA 4RGNE 1RJCA 4CDGC 4PP1C 1AY1L 2B8OT 5D7KD 1DLFL 1KCSH 1MPAH 5GGVH 3VGFA 3P0GB 4U0QB 5TQ2H 1ZOXA 1EMTL 3HNVH 5EC2B 4RIRA 1MVUB 2VL4A 2HWZH 3PHQB 3VGBA 4HUVB