4LBEA

Structure of kcsa with r122a mutation
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
molecule tags Transport protein, membrane protein
source organism Mus musculus
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lbeA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lbeA02
3V6ZB 4Y16C 3WD5H 1YEKH 1CZ8H 3O4LD 2YD2A 3REWB 5GRYA 3BQUB 2OX5A 3PP4L 2ESVA 3VGBA 1S7UA 2QEJA 4DGYL 4NT6A 1CDHA 4O51A 2DB8A 4JFHE 4MXQD 5F9DC 2DQTL 1V7ML 1SVCP 4L8DB 5JW3L 1FZOB 3M07A 3ZKQD 4JCMA 2HN7B 5J11C 1PEWA 4KKBC 5FCSH 5CCKH 5JOFB 1U9KA 2BXZA 3TH3T 1S78D 4RDQF 1JZ4A 4C54A 4J3TA 1JGEB 1WBYB 1MCPH 2HJLB 4Z7NF 4R90H 5EZIL 2ZCHH 3C5ZA 1JGVL 3NCEB 2JIXA 4XRCB 3U9UA 4HMEA 2JCCF 3RVWC 1Q9KB 3QA3A 5CJOL 3TA3D 1BJMA 2XN9A 3RAJL 2BOCA 4JRXA 3IDGB 1Q1JL 1T2QL 2Y07L 4NHCH 1RU9H 2Y6SC 5F8RC 4CVWA 3DETD 3HG1B 3LY6A 4TYUA 1BBDH 1N8ZB 5D7IF 1M7IB 3TYFB 4UNVA 5CD5C 1TQCC 1YN7A 3GJEB 4Y4FB 3GI9L 4OF6A 5FB8B 4H26A 3QIBA 3LKPA 4PLNC 3SDXB 5KSUA 1TLKA 4QTIL 4RX4A 3MLYH 3AM8A 4NQDB 4U31A 3SE9L 2NY0D 4QHUB 2EDTA 3LN5A 2O5YL 4I77H 5GGQL 5E1AA 2DQHH 1FAIH 4PGDA 3MGOB 4NZRH 4NFCA 3BD3A 1ZLVK 2CK0H 4V1DA 1RZGB 5DHVA 5JPNA 5ANME 1G7IB 4DN4H 3OAUH 4X6BB 3MLTA 4DEPB 5B38G 3PV6B 3P40A 1NCDH 3PDGA 3H9SB 3T09A 1NCWL 2Q7YB 3O6ML 3OB0H 3NPZB 4QT5A 3HAEH 4NKDB 3MYJA 4G3YH 1IC1A 5E4EC 3STZA 3TWCL 3GSRA 4IHOA 1A3LL 3CJJA 4S1RL 4WW2F 3BGFB 3A6CH 3WNLA 1ORQA 5A2KH 3OBAA 5HYQB 5L8LB 1FPTL 5INCA 4XVTL 3I02B 1F6FB 1MCOH 4HS6B 3ZHKA 5F7UA 4R4NC 4X4XA 3I2CH 1T80A 1KENL 3I6KB 1RJZA 2A6JB 4G8GA 4LIQE 3O2DA 4PJGE 1ZWIB 5H2BB 3SO3B 5KSAB 2W0FA 1EIBA 5J13C 3AMKA 4QOKA 3VGEA 1C7TA 4JFED 3SKOA 3ISWA 5HYSG 5GGSA 1VACB 4QXUL 3P4OA 3AXLA 1WCBA 3INUL 1JNNH 1U3HD 1QOKA 5IMLB 1EFXB 3FOLB 5C08A 1IEHA 5JO5B 1DBBH 1NC2A 4M7LL 2CDGA 1NCTA 5ISZE 4J6RL 4LCYB 3V4VL 3HB3D 3VD4A 3IVKB 4KWUA 4ZO7A 1E6OL 4MZ2A 1OCWH 1OHQA 1C5CH 1QUNA 1KTRL 3VXQB 4PJ5A 2B1AL 1DZBA 5DC0A 1SJEB 3GJFB 5T1LB 2F53B 3QG6A 2BSTB 3P77B 3HKFA 3DBXA 3JWDH 1ZLUH 2QSCH 2UUDH 1EJ6A 3ARXA 4Z7VE 4P57B 4U6XB 3DX7B 3SQOL 4JZNA 4YBQC 3T0ED 1LK3L 3F7PC 3QNYB 4X6EA 5D7JD 1JRHI 2ZUQC 1PBYA 3ZTNH 4LVNB 4R26L 4PJ9B 2ATKA 4P4KB 3IS0X 4K9EC 3DUUB 3MLXL 4KUCD 3GHBL 5BMFL 2NY4B 4Y4HD 2GUOA 3NPSC 2VXUL 4RWHA 5D93C 1MCLA 4DCQA 3QPXH 2ITDB 4IDLA 2DOCA 3TC9A 3P0YH 4F9PA 3TPUB 2XKSA 4XCYA 5ICZA 4HUKB 4ZS7H 4MWFB 3UTZA 2QR0A 4OLEA 3QUYA 4L3CA 3DO3A 1VFAA 4GG6A 1I8MA 2HYMA 1R3LB 2EXWC 4HWBA 4HKJB 4I4WA 5IGXH 4U6HA 1L9NA 5AZEL 4FXKA 4B7LA 1AGEB 1T1ZB 3RY4A 1OD7A 1UFUA 1IKFH 1KJ3H 1RZ8A 2LVEA 5DR5L 2X7LA 1RZFL 4HC1A 4K71C 4LDLB 4ETYA 1MFEL 2VTFA 4MB3A 4HDIA 5DLML 4PV9A 1RUQL 4MA1C 4DVRL 2OBGA 1AC6A 3FOMB 5B4MD 3DARA 4WTXA 1PY4A 3SY0A 4Z18A 4OF7A 3VU2A 3S5LA 4FA8A 3MBED 3BIAX 2MKLC 3KPRD 3DVGA 3KPRA 1I8IA 1NLBL 1IRAY 2V7HA 2GUOB 3LPFA 4OQTL 5GRJH 3TBSA 5M95B 2QKIA 3RDTB 1FFRA 2FB4L 1AP2A 5MI0B 1G7JA 3BEVA 1I3GH 2FX8L 5KSVB 1MRDL 3BAEH 5IB1A 1OPGL 4HFUH 3DHMA 3HZVA 1E6JH 4R4FL 4G6JH 1HYSC 1YUHB 1FO0L 1NGPL 3E2HC 4XH2B 4EXPX 3L7FA 4JFXB 4JFFB 1KF9B 2IBBA 5J7CC 1JWMB 5F9JB 5FB8A 3NVQA 3OR7B 5TDOA 5GGSY 5I76B 1UB5B 4MDJA 3ZKNC 5EIIA 2X4SB 3TO4B 4JDTL 2VLJA 4BM7A 1AGCB 2W0LA 5EORH 1M7XA 5F6IB 5L9DL 4LLDA 1S7SB 3PHQA 2VLLB 3MLZL 1YEJH 4UNUA 4Y4HC 3IDGA 5JDJA 4JM2B 1NGXB 4MJIB 2XY1A 5T1KA 2DLTA 3M1BB 3NZHH 3KLDA 5E00A 5JA8B 3U0PB 4UBDC 4H26B 3D85D 3ZTNL 3CGTA 4XAWH 1U8IA 1D6EB 1CGTA 3VFRB 1YNLH 5I1EL 1BFVH 1NMCB 4U33A 4XPFL 3KLAB 5HI4C 1C08B 3HE6A 4KVCH 5EC2A 25C8H 2X4PB 1PG7W 1SJXA 2QSCL 3C6LA 1T1WB 2DF3A 3HPJA 5DJCB 1MHCB 2BVYA 5TDOB 4DFHA 3GSVA 2W0FB 2Q76B 5GS1A 5ID0B 3MA9H 3ZSTA 3GI8H 1AC0A 3RVWD 5E95B 4KK9C 2R2EA 5DWUH 3NTCL 4NJ9H 5SWQB 4MA8L 3UDWC 5HGAB 5GJSL 4LCIL 5SV4A 5IBTL 4LLAA 3WFHB 4KROB 4LKCA 3LZFH 1IZJA 1JZ3A 4TNWK 4JFFD 5MERB 1A6PA 2X4QA 4DK3A 1F6AB 3H9SD 5IVXE 1KIQA 4QF1B 1A7QH 3EYUH 5D93B 2A9NH 1HCFX 3OKDB 3BWAB 1BQUA 2AKRB 4KQ4H 2PYFA 2VXTL 3KJ4C 4Y1AE 1U91B 3QFJA 4NN6B 1EHNA 4Z77B 3RQ3A 1FVCA 5GZOD 5FYKL 3WUWB 3BKMH 1WT5A 3Q1SH 3QQ9D 2KZWA 2Y36L 3N1FC 5KOVC 2BY3A 2DLGA 1ND0B 2XOTA 5I1IH 1VCAA 2EKSB 2HT2D 4YHIB 5F93C 1TQBB 3JZ7A 4S1RH 2HRPL 5C0DB 4NKOA 2DS4A 2CK2A 4W6YB 1HH6A 4LVEA 3O6MH 4HXBL 4K3HA 1NLBH 4OQTH 4LBEB 2DIJA 4NM4H 1QSED 32C2B 3TYFA 4JG0L 1A5FH 4W6WB 5C0CE 3LKOA 4PJ7A 1EDQA 1N2RA 3CLFH 4NZRL 4ZOEA 3L9RA 1WICA 4B0MM 4PJBB 2B7DT 5HHNA 5D2NB 2YD6A 4LSVL 4DN3H 2BNUA 1SJVA 5HGHB 15C8H 3U6RA 1A7RH 4OLZL 4ONGL 4OJFL 1GAFL 1W0VA 1WIOA 3RKDC 1MLCB 4NKIL 3NCJH 3ARWA 4PPTA 5C9JA 1T0MB 4LLYB 4P46B 2XA8H 4LOUC 1N0LA 1CXEA 3CZJA 3QSKB 5E8NA 1NCBH 3CXDL 2DQDH 5J1TC 1Q1JH 3GB7B 3L5JA 1U8JB 3MYJB 1NJ9A 5ILTH 5D7LB 2WUBH 3NZ8B 1TVBA 3HR5B 3DVGB 3KPRB 1I8IB 2V7HB 5E4EB 1IKNC 4NQVB 4N8CL 5A2FA 4NO0B 4LMQE 5DGQA 1G7JB 3BEVB 2AJXH 4ISVB 5BRZA 5ISZB 3L9RB 3QCUL 4Q0XH 4WGVB 1MJ7L 2NZ9D 4Z9KB 5IG7A 1RZ8B 3C09C 4HCRA 2A0LC 3MLSL 4U1GB 1UWGL 1H15B 3KYOB 2IMNA 4JREB 1SBBA 2RAMA 3EYQD 2P5WE 2NPLX 4U1HA 3P4OB 2WAHA 4MZ3A 5GPRA 3MCLL 4BJLA 2I25N 5EBWB 5IKCB 4OV5A 3UTPE 3RUGA 4QHKJ 3HUJB 1A4KB 3VFMB 3AAZA 3LS4H 4HT1H 2P8MB 2VZSA 4XBPA 2DAVA 3CZFA 2DYPA 5D2NC 1MWAA 4DOHB 1AP2B 4XVUC 3O3UN 1B4RA 3GB7A 4YDIH 2D03L 1ZGLB 1Z0MA 1F6LL 5E5MA 5F71A 3CD4A 1PVHA 3LZFL 1BECA 1I85C 4M1CD 3VWJB 3TZVC 2NY4D 4Y4HB 3F8UB 4H0GA 4KPHL 3HAEB 3L3DA 3HPLA 2Z4QA 3T8XB 4OFYD 4PRID 3NFNB 4DTGL 4FQLH 2IAMC 5FUCC 5DWUL 1CG9B 3T08A 3INUH 3L7FB 4JFXA 3SGDI 5HHQA 3MOQA 1A9BA 1FZJB 2HLAB 2HP4A 4GH7B 3QP3A 5C0FA 1ZHNB 4UILH 4O2EB 4JZNB 5CJQH 4O51B 4G9FD 1FVDA 1I9IL 3MRRB 3WMSA 4BUHA 5C92A 2AEIT 5IHUL 1N5AB 3DECA 5C9KA 3HMWH 5DFTA 4F7TA 3OKKA 4PJFA 2CIKA 5IIEA 2SEBB 5JA9A 4M03A 1CLYH 4NQCD 3K0WA 2AABH 2ID5A 4YNYA 5FGRA 1NMAL 5T1KB 1FORL 1W72L 1G84A 3KLSA 1V3KA 4X7DC 2DMKA 5D2LE 4ZUTA 3CSYB 4JFYB 2X44D 3EDDA 4WO4A 1ORSB 1URLA 2IH3B 3S4SG 3BUYB 4N90D 5DJ0B 1NMAH 4Z5RA 4G8GD 1CLYL 4XPHH 4RFEB 4PD4J 5FAAA 1JUFB 1OGTA 3EOTL 3QUKB 2QHRH 3UYRL 2EYRA 1G9MH 4NQCB 3TZVD 3HI6L 3PWPE 4YXHL 2GTZB 4DN3L 5LXGH 1F4XH 1UQSA 4QYOA 2F5BL 1OF2B 1CQYA 2YEZA 1WZMA 1V05A 1U8KA 3DGCR 1J1OH 1UXWA 2X70A 4DKEL 2JIXD 2ZP0T 4IRSB 1A0QL 4WTZG 4CN6A 3WFHA 3C08L 2BDNH 1A6VH 3BGMB 2QTEA 3OXSA 2WLZA 5D8JH 4PRNB 5T3ZH 5ECJE 4NSKA 3VGAC 4TRPH 5FHAL 5FYJD 3QXTA 1MCPL 4M1GH 2CLVB 2YD4A 2D7QA 2ZUSA 4G6ML 4YDIL 2WNGA 1K2DB 1LEGB 3SE4C 4D9LH 4E41A 2CRZA 3X11A 4OAWA 4TSAL 1S7QA 1EMTL 4R0LA 2NTSP 1U92B 4X83A 5IHBA 4XP4H 1T83A 3KHQA 3NACL 4F8TA 3LEYL 1V7MH 4CMHB 5H2BA 4Y16D 4X6DB 1X5LA 1GHFH 3WSQH 5D2NA 2VLKB 4MNGE 3MJ7A 2VE6B 1EXUA 3G5XB 5TH2A 1MCBA 3UJJL 2JK5A 5GGRY 5T3ZD 5DI8A 3PHOA 2ORBH 2EEDA 4UINL 1WZ1L 4YK4C 2P42B 2AERT 1RURH 2FWOA 4PRIE 3BGMA 4WW1A 1U8PA 4JM2C 4RNRA 1WISA 1JPSL 4K7PY 3C08H 3QEGH 5L2KA 2OXHA 3MNZA 1JGUL 4JGJA 4LHUB 4EIZC 3GMQA 2YWYA 2AK4A 4GRLA 4R0LB 1IGYA 2OK0L 4M4RA 4UV7H 2DMCA 1XZ0B 3DLQR 3DX6B 3SO3C 3MA7B 5K9KA 3JV6A 3PIQA 2YS4A 5GS0D 1OQOA 1KJ2L 1MCRA 1HHKB 3RPIA 3QQ4B 3TCLA 3P4LA 1IEAA 5D1XC 4OKDA 5IQ7L 2Q1EA 1KB5A 1XIWD 4OCRH 2XTJE 1LK2A 1FFQA 4JG0H 5JHDB 2BNRE 3PWJA 4K8RD 4IOFC 4QRRE 3RIAK 4Y4FA 3MLPA 4KTDL 3JV4A 1I4FB 4XNQA 4MD5B 2EDYA 4JAMA 2AABL 2Y25A 4FN0A 2XZAL 3EYVB 4LNRB 2J6EL 4MA1B 4R8WH 5KN5B 2XQBH 1IGMH 1YNTA 3OHXA 2P8LB 1CR9L 4XCNA 2Y36H 1HE7A 4NNYB 3WNMA 2PXYB 2YBRB 3FQXA 1ES0B 1NEZA 3EAKA 3QH3A 5JIIA 3HNVH 4LFHD 3DXAB 4JJHA 5IFJA 2IQAB 2ICWB 4WDIA 3TEUA 4I18C 1T3FB 5MEOA 1IM9B 1NGPH 3QFJE 5ICXB 4WI4A 1J8HE 4R4FH 3HS0A 4PJ9D 5GRVL 1A7BA 3VGHA 2MFNA 4NKDA 1VDGA 2ZSVA 5FDYA 4JVWA 3VWJA 2SEBA 5DQDL 4H8WC 4N0CD 3ZHLA 3OG4B 5HGBB 2HN7A 4TTGA 3BRGC 12E8H 1X5KA 4U1JA 4F7PB 4QRTA 1FYTE 4HS6A 3CX5J 4KQ3L 1QR1A 3G04B 4RIRB 3HRZB 4RAUB 2PNDA 4QTHA 4AIOA 1I8KB 1TNNA 4FXGB 2IH1B 1J0KA 2IALA 4EEEA 4J3XA 4L5FL 4S0SD 2RIKA 1AD0B 4NQSA 5CIPH 1PJ9A 2ZUQB 5C0IB 4X0KA 1QSVA 1YPZB 3D0LB 3GI8L 4W70A 3IFNH 1CXLA 5F9AC 4O2CA 3CPLB 2KBGA 3MCLH 3QIUD 3SE9H 1JGDB 3DV6B 3GMNA 1VENA 5GSRA 2E8ZA 2VZUA 1NEZG 4ZFOA 1UCTA 1YMMA 1DQLL 5J89A 4HGWA 3QG7L 2GJJA 4YX2H 3IVKA 2W92A 1KT2A 1ZKAA 4MQ7B 5J13B 1Z9LA 5F1IB 3VI4F 1UCBL 5E7BA 3VGFA 3MV11 4ODVL 4ONOA 5D7LA 3RNQA 1I7UB 3BGFC 5ESVB 3GJFA 5T1LA 4R7DB 4OFKA 1WAAA 2FYYA 2UY7A 4ZQKA 2J8UE 4ETQB 2X4OB 2MNUA 1R0AH 3P4MA 1X5ZA 5CZKA 3WHE0 3B4NA 3QNYA 1MCSA 2X4RB 3EZJB 5IB2B 5FO7B 4WEUD 4OKVA 5JR1L 3O3EB 4LCWA 1T89A 1INEH 3C2AH 1E28A 2Q20A 4XGZB 3IDJB 3NGBB 4C57C 2J4WH 2H9GA 5AUMB 2WBWB 3OKNB 5TF1L 4XPAL 1AXIB 1CL7L 5FM5M 3MRNA 1Q9KA 1A1OA 3QA3B 5BZWA 1VGKB 4NQEA 4NIKB 1LEIA 5LBSH 3IGAA 2FX8H 3TIEB 1MF2L 5DEGB 5TDNB 4ZXBB 3I6LD 1A6AB 1TZGL 2R0WH 5FHAH 4CNIA 5HHQB 2WBJB 3WE6B 5MERA 5D8JL 4PGZA 5DD6B 4ZYKA 1CICB 3VRJA 4RMTA 4BUGA 3OJMB 3QDMA 4M9PA 3BN3B 3MNZB 2FR4A 4RISH 1XGPB 3GMQB 4KK5C 5I73C 4WVRA 2A73A 5EU4A 3DYMA 1NMCC 3V52H 5GS0L 1MCCA 1DDHA 3Q3GB 4MAUL 1KIUA 4XWGL 1RZJH 1GGTA 1DP0A 3QDJB 3G5YA 4BFGA 1AO7D 5KS9B 5DVMA 4I1NB 4YGVA 3NIGF 4D0CB 3DWTA 3JV6B 5T33L 2JJVA 5JQHC 4GAJL 3LD8B 3Q5YA 4JO3H 3FQUB 1MFCH 2BSSA 4NYLA 1LVEA 1BREA 4ZTOH 4IBLT 5B39G 4RAVA 2R29L 3UTTB 2QQLH 3PWVA 4P99A 3BDXA 5FOJA 2RJMA 5I1LB 2XRAH 1EEZB 3KPSE 5E8EA 2V2XA 4JRXD 4OTXL 2BFVH 2BXYA 4MD5A 5I76A 5CLTA 4G42A 3WO4C 3H3PL 1XR9B 3ARFA 2AEPL 5JXEA 3REVB 3OF6D 1FNGB 3QO1A 4WU5A 1KLUB 1LK3H 4WHCA 3SEPA 3TF7C 1MLBA 1WAAE 2J3SA 5CINH 3MUZ1 1KGCE 1JPTH 3OR6A 4N0UB 3U6RB 3DSFL 4KY1L 5FA4A 1OTUC 5TGBA 1OSZB 3L95A 1RIUL 4IRSA 5F88A 2HKHL 4YAQB 3FFCE 2Z35A 3MJ8A 2AGJH 3H2WA 3C6LD 3GSNL 1A6UH 1INQA 3F7QA 3FTGB 5IK3A 4FQLL 4AIXA 1QBLL 4KVNL 4M43L 4X9HA 2FZ3B 3WFEH 2JJTA 3CFKA 3D69B 1NSNL 2JCCB 4NWUL 2HRLA 5DA0B 1DBAL 3S5LB 4JM4L 3MV8E 5C6PB 3UPRA 2VABB 5I1LA 1E4XI 5BV7H 1MPAL 5JDSA 5SWSB 3QIUC 1LWRA 1LO0H 3VXOB 4X6DA 4A2MA 3IDUA 4E41E 4X6FB 4WTWA 2UVEA 3IFOA 3EJYC 1KELL 1WJ3A 4EBQL 4RCAA 1IEBB 4GKOA 1MY7A 4PJ9A 3RWJA 2EC9T 3ULVC 3WJLA 2XKUA 3QUXC 2VO5A 4KC3B 3WKNA 3QYCA 1MAMH 2GK2A 1ZHLB 2R8SH 4BKLB 5FV1L 1MFBH 2EDFA 3OZ9H 3V6FB 4FABL 2D0FA 4LSQH 4U1JB 4B50A 1T7WA 3BPCB 4NNPL 2IJ0C 4JKPL 3FTGA 5IK3B 1L6XA 1DTUA 5C08D 4D9RD 4PGJA 1N4XL 1M7DA 2DQCL 3F7YB 1GGYA 2EZ0D 1YEFL 2VDPL 3HCVA 4CJ0A 4MXWH 1AGFB 5FHBH 2R9HC 1CDIA 2AEWA 1UA6L 3T8XA 1YYLH 3SBWA 4PLKC 1F4WH 1ADQL 1NFDB 3K4ZA 3HUJE 2BCKA 3H3KA 3WFZA 5ABDE 2VB5A 4HULB 1QBBA 4LPYA 5F3HB 4OF0A 3RY6A 3OKOA 1UC6A 2HH0L 3DV6A 3GMNB 1EV2E 1AXTL 5TPWL 5A1AA 3TBTA 4PJEE 2XNAA 4KZDH 3QI9C 3AGVA 4LCCB 5A16B 4Q2ZB 3KS0J 4MQXD 1P6FA 2AJYL 3UMTA 3OKKB 4PJFB 4TVPD 3KLAA 1K8IA 4LSVH 5FUZH 3QXWA 5EOQL 3TBSB 5KVFL 2R2BA 4P2OA 4JQVA 4JDZB 3LSOB 4RQQB 3TJEL 2YUWA 1RZKH 3CFEB 3QIBC 1UZ6F 1CGUA 4ODTL 4PR5A 4JRYE 1CGYA 4UNTA 3P4MB 4H20H 4Z76A 3OG6B 2ZUXA 5EBLA 4JRXE 1G0XA 2GK0B 3U46B 3CC5A 1X6NA 4Q6IA 3GMMA 1D5ZA 4G8GE 3FT4A 1ES0A 3QH3B 4HJ0D 4PG9A 4X98B 2ILLA 4PTUA 3NABH 5GGRA 5F1KC 1KLGB 4JN1L 3WNKA 3SCMD 1ZXQA 1DE4A 2VLJB 2P4AB 1U8JA 5ITFB 4GKZB 4POUB 3ULVE 3NH7L 3E8UL 4FNLL 4P2CG 1BOGA 4LDOB 1X3DA 1NAKH 3RA7L 3VFPB 1EGJL 4L8BB 4JM2F 5ACMA 1S9WB 5E9DB 3IKCA 2OQJA 5GRZA 5DD0L 3U7YH 3QUZC 4LARL 4U6YA 3RWCA 4X6BA 1CXFA 3K1KC 2WP3T 4HMCA 5FA3A 4OD1H 1H3WM 3NPSB 1NSNH 4PLKD 4E41D 4LHUD 4HXAH 4KVNH 3LAFA 3H0TA 2V9QA 4G43A 2XG4A 4WEBL 3TM6A 1NAKL 3RGVC 5TDPB 5EC2B 4PB0L 1KC5L 1T0NB 5I16A 3VFWA 3VJ6B 3K46A 4XBPB 4XP1H 4CW1B 3CH8A 5GS3A 1KEML 2F58H 4K3EL 3O11A 1BQHG 2B4CC 3TJHD 1HQ4A 3UBXA 5I1GH 5IFHH 3NABL 2V5TA 3FQUA 2AV7A 5FA4B 1SM3H 2W1NA 2FJHA 1K85A 4Y1AB 4RMUA 3QHFH 1UM6L 2NY6C 3MX0A 5FKPA 4M7JH 1SYSB 1CDCA 2ESVD 4Y4KC 2B2XH 2NY5L 5SV3A 5DJYB 1FNEB 3EDEA 4K3GA 5DO2C 4YWGH 4LVOB 3SQBA 2AKRA 1SEQH 3E3QC 3S3SA 1MIML 2JCCA 4ZFGL 1I3RB 5E1AB 1II4E 1ZGLM 1CE6A 1RHHB 3VXSA 1N64H 2UVFA 2G5BA 1AGBA 3MMEB 3HLAB 2E7CA 3G6JA 1F58L 1I9JH 4NN6C 4OIAA 4W4OC 1N3NA 3B9AA 4Z7UB 2EH7L 2JELL 2P46B 4JR9H 5CGYD 3VJ6A 3KJ4B 1A3QA 4OIIL 3RTQB 3P30L 5FCUH 3FO2B 1FL5A 4YEFA 1LO3H 4JPIB 2Q7YA 3VA2C 4RMVA 5BOZG 3T2QA 2G9HA 4QHNA 3OKMB 5DGRA 5DVKA 3VG0H 2YZ8A 4XI5D 1O0VA 1MCDA 5HBBA 3H9ZA 1W2KT 3X3GH 3OB8A 5C1MB 3JXAA 3QEQE 1ZHLA 2E9JA 5AZ2L 4G6AC 2F54D 2PTTB 1I1YB 2XTLA 5KTEH 4HEPG 3R06B 2DM2A 2AV1A 4PBWD 1E4WH 1BVZA 5KSBB 5SWSA 5L88L 3VH8A 3P4NB 4WUUD 3VFGH 5JOPE 3S35L 2GSGA 1CFTA 3V6OC 4PP2A 3P0VL 4XNZC 4IDJH 1F00I 2F5AH 4APQD 1BEYL 4PYGA 1RK1B 4X6CA 2EKJA 2DM7A 1E4XH 1C12B 2J4WL 3BISA 3MLWL 1N6QL 4UQ2A 3DXAD 4EI5A 5GQBA 5F7MC 2ZSWA 3GJEA 1BX2B 4IIQB 4OT1L 4J8RB 2G9HB 4QHNB 3I6GA 1ZT7A 3RKDD 1MQKL 4UAOB 4ZPTA 1VSCA 3BT2H 4LCWE 4GKSA 1SY6A 1IGTB 3QDGB 2X4TA 1LO5A 1MH5A 3NCMA 3AS3A 3MPCA 2I9TB 5IM7B 5F9OL 1HSAA 3F5WA 2EH8L 3DGGB 3FZUD 1CLZH 4Q9BA 3WS3A 4NC2B 4ORZC 3MGAA 2XTJC 5CZXC 2CMRL 4F7EB 2CQVA 3TO4C 2EC8A 5HYJA 4M1DL 1KCVL 2A6IB 2FHFA 1B3JA 3QUZB 2NXYC 3NTCH 5KSVA 4EUPB 1Q0YL 4PB9H 2CD0A 3D2UD 4XPTL 4WU5B 2GFBA 3HZVB 1CTOA 4MXQC 4ODVH 4TUJA 1FC1A 1OAQL 1ZSDA 4ZXBC 2R0KH 5HTSA 3KYMB 2QADC 3PHOB 1DQDL 4IEFB 3T0EC 3ELAT 1U8HA 2J2ZA 1G7LA 2O26U 5DYOB 4L9LC 2VDKH 4MDIB 4LNVA 3HZYA 4G8FA 1U8NA 3ULVL 4P23C 1FRGL 1OAQH 3WIFA 1B0GA 3IDYC 1SEBB 3RJDA 1R3LA 3RX7A 4F2MA 1G0YR 4YZFE 1C7SA 4TNWF 1IMHC 3FOLA 4F57H 4PJDA 5D9SA 4OLWL 2HVJA 4YFLF 1AD9B 3MNVB 4XHJD 4EDXB 3MV7A 5CEXB 5F9OH 3MV8A 2VLRB 3L3JA 5T33H 3OWEA 5SX5H 3VXRA 1CFSB 5TDPA 3GDBA 1IEAB 3QUXA 2Z8SA 2X89A 1Q9OA 4N0CC 4CVZA 1KACB 2YPLE 4D9RE 3L3HA 3QEUB 4BZ1L 1IGIH 2EE2A 5I8KH 2V5SA 5K9OA 3PL6C 3HNVL 5MENB 3O3BB 3O2DL 5CBAB 5EUOE 4LPXA 2LQRA 4FHBD 4MJ2A 1MJ8H 4M6ML 1NANI 1C5DA 5D1XA 5EOTB 5JXAH 4Z7WE 4LCUA 4P5TB 4RZCB 3CVHH 3VRIB 1OB1A 4JKLA 1MSPA 2AP2A 4LVNC 4DGIL 4UTAH 2DIBA 1U95A 3UTQB 4X7CC 2ZUYA 1RFDH 4OZFH 1ZT1B 3CDGA 4PGEB 1H3XA 3BJ91 4EOWL 3KYNB 3KPMB 4I3SH 4WDIB 1ETZA 2BHUA 1I3RA 3SGEH 5FKAB 3MBEA 1PG7X 5L2KB 4P23A 1YY8A 5HYJE 3VXSB 5E2TH 3QUXB 3MUHL 5EOQH 1VKXA 1NCNA 1RAMA 3NIFF 3PG2A 3UBXI 1HKFA 2X1XR 1YQVH 4YBLB 2VZVA 4GG6B 4JPVL 3ARDD 3B6SB 3CH1A 4MJ5A 5D7SL 4M6OH 3X12A 4MJIA 1WC7A 5I8CA 4P3DA 4GJTB 4AM0A 4JN2B 2GW5A 3CFEA 4HWZB 1CFVH 4XPGH 2R0KL 2E7LC 1CFQA 3DETC 3PWPD 3OKEB 4K8RL 2RR3A 4ZUSA 2X42A 2R1XB 2I9LB 2E27L 4MNQB 4EQ2A 1PDKA 5T3XH 1XGYH 1BM3L 1JNLL 1NH6A 1CT8B 2AV1B 1ZE3C 3CX2A 4ZNEA 2NW3B 2BERA 4HAFA 3VFVA 3HPJB 4R26H 1YEDB 2OR9L 1CFVL 2YK1L 3RZWA 3WYRA 5A2JH 4JKPH 2HTKC 4ODHL 4KJWC 3QAZC 4U7SA 3W39B 2VRAA 3WO3B 4P23B 3WJLC 4YBQD 5GHWL 3MRQA 2JK5B 4P59H 3MRGA 2I07B 2EDEA 2J1KA 1KEMH 4KDVA 4QRSA 1DCLA 5HHOA 5J0BA 1CTNA 5SWZA 1S7TA 5C09A 3FQWA 5EIVA 4Y2DB 3MUGB 1FE8H 3SKNA 4RNRB 4C56D 2DMBA 3CFIC 3QDGA 1IGTA 2YMXH 2R56L 3AROA 2Z31C 4K3JL 3MLUL 2X41A 5DEFA 2VDMH 4CMMA 5JMRA 3ZKXB 4LP4A 1J5OH 5D1QA 3BO8A 4GG6E 2E3VA 4NNXA 3CK0H 4NGHL 1VFBB 1PGRB 4LSUH 5EFIA 5DFVD 4JRYA 4QXGH 3E6HB 2NX5B 5H35B 3V7AG 4K7PX 4OM0H 4QHLA 3QUZD 3WL9B 5ID1B 5JNYB 1W72A 5MP6L 4A2LA 3K81A 1F02I 3IJSA 2H9GB 3T0EB 1T4KB 1Z9OA 3WKML 5C0DA 4NKOB 1GGIL 5F7NC 1M4KA 4YHNA 3BIKB 3RZCD 3MV01 4IIQC 3KPRE 5DMKA 4QGYA 1G9ML 5F72S 1JPTL 3UZEA 4LRNL 1XAUA 3UYRH 1LK2B 2NY2C 4A6YA 3FQWB 4MAYC 1AQKL 3LKSB 5INDA 1CXKA 5ACLA 2GJ6D 1F13A 4Q7DA 4RBPH 3LEVH 4ZS6C 3MCG1 3O3DB 5I9QC 5I1HL 4YHKL 4AH2A 1KPUA 3QWRD 1G7PB 4C83A 1BWMA 4FQ1L 2FR4B 4GXVH 2W0PA 5I1CL 4J12A 4GSDL 1RULH 3AXLB 5GJTH 4JFDA 1NC4B 2UY6A 2P5WB 2GCYB 4GRLC 5J11B 1AO7A 5HD8C 2R29H 2CK0L 4GW4A 3MRCA 4HMDA 1FORH 2V2WA 3MRMA 5HDOA 2Z8VC 1T0MA 5EO0B 4FXKB 1ZT4A 4Z0XB 2R2HB 3I75B 1KIQB 3T4YB 5FYLD 5T5NF 5I8EB 1T3FA 3Q6FB 2CRMA 3LKPB 4HIIB 3UTOA 2YN5A 2ADGB 1QSEE 4ZFFB 3UYOD 1EAPA 4CU7A 1PG7H 3WLBA 5HSFA 2J6EA 1N59B 1KB9K 1QNZL 1GGIH 2AJSH 3KWWA 2OK0H 3B9DA 1BFOA 3Q6GH 3AS2A 3UTTE 1RZGA 3ZE2F 5JPNB 5HVWA 3RAJH 4P5MB 4L4VB 4FXGA 2AJUL 4HG4J 4HF5H 4K8RC 4Z78A 4OD3L 4KPHH 5FF6B 2BMKB 1MHHA 3QXDA 4F15B 4XB8A 4M48L 5JHDD 1TZGH 1A9EB 1YDPB 4XB7A 3FN0H 2VDML 3WJJC 3GSXA 3TVMA 2ORBL 2YC1A 4XBGA 3MLUH 2AEQH 2YN3A 1QLFB 2W9DL 2LV4A 2YMXL 5J06A 2AJVL 3KLHC 5DFVC 2NZ9C 4ORGA 5IW3A 2APBA 1FL3A 5BW7C 5CEYA 2EDKA 5HJ3B 4JO2H 1HZHL 2J8UB 3QIWC 3B43A 1J12A 5F9WB 5IJVB 4KUZL 2BOCB 4JRXB 4S1DD 1L9MA 2XN9E 5LQBL 1C5DB 3O3AB 5B38A 4UMGA 2GEEA 2RBLA 4IRJA 4E42A 3OGOE 5IQ9B 2DQIL 5SWZD 2K1MA 1QEWB 5D5MF 1FV1A 2W9DH 3LKQB 2P7TA 1A9BB 2HLAA 1EUTA 2X70B 2OQJB 2UYLA 3MLVL 4FQJH 7CGTA 3SDXA 5JQ6H 2X4OA 3T2NH 1KUMA 2L4OA 4YXKH 4BQ6A 4JHWH 3TVMD 4ZUUB 3WIIH 5JORA 1WQVT 2IANA 4I0PD 5EO1A 4YDVA 1A21A 2X40A 1R5WA 4OKVB 5HHVH 3OJVC 2QKIB 3VMNA 1BOYA 4CVXB 5I15L 2NLJB 3IDJA 5DD1L 4J23A 4BZ2H 3QG6B 5HDLA 5DRZA 3O11B 2R4RL 1OGAD 3AM8C 3CFJA 3FT2A 3LQMA 4N0YL 5BW7A 5BV7C 2H8PA 3PHSA 4ZUTB 3CSYA 4JFYA 4XPBL 3R0MA 2PXYC 3P30H 5FCUL 3GSRB 4IHOB 3HZKB 1GC1L 3IXAB 3C5ZB 2C4FU 4JY6A 4XC1H 1BLNB 1CXIA 5CP3A 2VDQH 3QULB 3GKZA 3IFNL 3MODH 1C1EL 2A6DB 4JREC 3NIDE 5JHLL 3KYKL 4OB5L 2YA1A 1IM3B 1EVTC 3DMMA 4PJGA 3QUXD 5DF0A 4EOWH 1F4WL 1NL0L 2BNQA 3HR6A 1DEEB 3LS5L 3MBXH 4YDLC 5IBLD 5DK0A 2NY5H 4BH7A 1VACA 3QQ9C 1NUFA 1CBVH 4FQ1H 5EG6C 5BVPL 3LKRB 4LCCA 5A16A 5I1HH 2XN9D 1AGDB 4NO5A 1UXSB 2CGRL 3HMXL 4S1QH 1S7WB 4DUWA 5JXAL 5GGTH 5F6HJ 4K7PH 4GOSA 1G1YA 4PV8A 5SWZB 3E6FB 4JPIA 1OLZA 3CFJB 3AFLA 5HYEA 1D9KD 5DD3H 4NBYB 3FB6A 3JWDC 4Q58C 1DQML 2PYEA 1HDMB 3PNWB 3IT8D 3PQYE 4P5TD 4RZCA 3NCFB 1CR9H 4PGBA 1U92A 2O5XH 4OV6F 4GRMB 2PW2A 4U1MA 3X11B 3T2OA 5DJCA 1ZVYA 3KJ6H 1J7VR 3RL1B 4F58L 3NN8A 3G6AA 2I5YH 4GBXA 4GFTB 4LARH 4PRAA 3R8QA 3U2SA 4GRWB 2RFXA 3BW9B 3RIFK 3IJSB 5GJSH 4RAHA 5IR1B 4LIQL 3V6BR 2YPLD 1AH1A 4UIMB 1KEGL 1R24B 4UDTA 4HT1L 3GMOA 3O2VL 4NRYA 1ZLUK 3NH7H 1U8MB 3O6FD 1Q72L 1BD2E 3QUYD 5AD0A 4OZFA 1YN7B 4GXUM 4R3SA 1EFXA 3WV0A 2FHBA 4Z7QF 1F11B 4BK4A 2B5IC 4HWZA 2P43B 4WY7L 3DO7A 4KVCL 2ICWA 1S7VA 4UT9L 1F42A 3UTZB 4I13B 3N9GL 3IDMB 5EUOA 4GRMA 2OR9H 1K8IB 3CFBA 1ZTXH 2EDBA 3LMJH 4WI2A 5IVZA 2R2BB 4P2OB 3FT3B 3AMLA 3RP1A 4KJQC 1B0RA 5D70L 3VWJD 3RVXD 3ARZA 3NFPB 3HC4H 1L7IL 1K8DB 3HC0B 5DA4A 4PJ8B 3H9SE 2OYPA 2DQDL 4KJPC 4AEIH 4LLVA 3L5WA 1VPOL 1J8HB 5HYJD 2EDXA 1Q94B 4PJDE 4U3CA 4XBGB 4WFGE 4Z7OE 1EAPB 4U1NB 2HKFL 4K55A 2BVQB 1IJ9A 4PJ5D 2AQ2A 1TJHL 2C1OB 4DAGL 5FM5O 4YDKH 3MTRA 3O8XC 4ACPA 4R6UA 4GRWE 4XWGH 3GSWB 4Y5YC 5FK9B 4P4RB 3S4SA 3ILQC 5GS0H 3H42L 1DBJH 4H1LA 3TO2B 4WWID 4MD0A 5CIPB 1UENA 4TUKH 1CE1L 2DD8H 1FCCA 3H7BB 3RHWF 1UKTA 2ADIB 3STBA 1IAII 2IPUG 3EFDL 4M5ZH 1UH3A 5C08B 4XCYB 1OPGH 1FIGH 3FQXB 4HFUL 2UV3A 3L3DB 1EAJA 3D1MC 1U3HA 3IDXH 4LU5H 1GYAA 3VWKD 4YE4H 12E8L 2H2SC 1P4BH 5J12C 3ZT5A 1WBZB 4LK4A 4OFVA 5E9DD 5JORB 4FABH 2EEBA 1GH7A 4P2QA 2BDNL 3GSOB 3MRLA 4ZS6D 1JP5A 5IW6A 4HQQL 1CL7I 4LASL 3G5ZA 4I2XB 2EIDA 4GAFB 3AREB 2QSVA 5DLMH 1V3MA 3FOMA 3O6FC 4L4TE 2YKLL 3DRTB 3QXAB 4U1KA 3N06B 3LCYA 3F7RA 3ARFC 3R06A 4P4RA 2DLHA 2NR6D 3TT1L 1B6UA 2CSPA 4MJ4A 3CLEL 4YDKL 4DAGH 5GRXG 4L9LA 5I73B 4BK5A 3GKWH 4ENEC 4OCLC 4JFQB 2Y6SD 4LCUB 1A1MA 3SDCA 1AD0A 4JFDB 4NQSB 1NC4A 1HHJB 2PO6C 4LHJB 3P11L 4LVHB 2EDJA 1L6ZA 1ORSA 3C6LB 1PKOA 4X9GA 5IBTH 5MENE 3CCHA 4M43H 1KN2H 1I1FB 1PY9A 2OMBA 3RNKB 1WWWX 2RCSH 4FOMA 5KVGL 1BD2B 4PBXA 2PTVA 4D8PB 4XVJL 3GSNH 1KB9J 4Q9RL 1UM5L 3QUKA 4HKXA 4JANA 4PLOB 5EO9A 2DJ4A 3MA9L 2CUHA 1BFTA 1CE6B 1OAKH 3QHFL 3TV3L 3AY4A 3UO1H 2H41A 4TOYL 1AGCA 1P5UA 4PJCE 5MEND 1UYWL 2YD3A 4OLXL 3O6FA 3B6SA 3CH1B 4MJ5B 4UT9H 4Y19E 1IGJB 3DTXB 5DJAA 3D3VA 1DQDH 4Z8FH 1AGEA 3PE9A 5EN2A 4PRHB 3ZT7A 1HK6A 1WF5A 3H9HA 1JF6A 1PKQA 1HKLL 1R3KB 2FCBA 4ELME 1UM5H 3S37L 2GT9A 1HILA 3QCVL 5AG9A 1NDMA 3BP7A 4UB0L 4NHUA 4JKKA 2GITB 1RJLB 4O2FA 1M71B 4H5SA 1AY1H 1J0ZA 3UTTA 4FFWD 2R4SH 2VMFA 3NCYS 1RIVL 5ERWB 2LVCA 1QLFA 2V9RA 4JFOB 3VDCA 3DRQB 3MLTB 4JDTH 3RGVD 3SOBL 5ISZA 4LF3B 4PJ8C 5KSBA 3KHOA 5JW4M 2UZIL 3BKYL 4ODSL 1RMFL 4X7TB 3ARED 3MRQB 3S34L 1N5YH 4DZ8A 1YEIL 2FH8A 4NCC1 2FATH 2DI8A 2WINA 3LQAH 4Q9CA 3EYOB 4U0RB 4MJ6A 4HIHA 4ESKA 3FHAA 1P6AB 3P2TA 1ZWIA 4YAQA 4HUXB 2CLRA 4LFHG 3CFCH 1P9MA 2J6EH 1MWAB 4IMLB 1ZT7B 2E5EA 1UQSB 3P0VH 3HMXH 4KK8D 4MLSA 3BHBB 1K9TA 1QLRB 3PJSB 3ZE0F 5JMOC 4X9FA 1AIFB 3G9VA 5IMLA 2G5BB 1F3DJ 3HAEA 1R3JA 3T0AA 1FIGL 5H35A 5ESVA 2A9MH 4Z77A 3GFUA 4C4KT 3CXHK 4Y5XB 1RZ7H 5CP7A 1J87A 4YGVB 4D0CA 2LTQB 5AD0B 1U8LB 4WO4D 1RUQH 1SY6L 1C1EH 4MNGA 1FNSH 5ITBH 1OW0C 3BN9D 1H8OA 5MEPA 3QI9A 3CX5K 4OD2B 5DRXB 3QHZL 2ENSA 5K33A 1I1CA 3V95A 3GBLA 5CZVH 5B22A 4KZDL 3HNTH 1ITBB 5CD3B 3GSWA 3SGKC 5I74B 1KXTB 1X9QA 1N64L 4GQ9L 2UWEF 3O9WC 3ORJA 1WZLA 4X6EB 4YPJA 1JWSA 4JZOB 5D96C 4OCYH 3HI1B 3SDXE 5HY9B 1PQZA 1FZMA 5BMFH 5ENWB 3AUVA 1JWUA 1J05A 2YWZA 3GUTB 3CAFA 4LKCB 3H9YA 4UDUB 3QIWA 4M7JL 1T6VN 4OFYA 4OZIF 2HRPH 3SDCC 2AXHA 4QF1A 4HC1L 2VR5A 3U7WL 5I1IL 1P7KB 3HMWL 3KPOA 1I75A 4LLYA 2DKMA 2DQIH 4IS6A 4U0QB 3S96B 3OXRB 3KS0H 3HPLB 5ISZD 2GTZA 1MRFH 1LP9B 3MRFB 1KELH 5I1KH 3OKLB 2HTLD 4NJAH 5GSVB 5DDHA 3LH2L 5DHVB 4R0LC 4DVBB 2ZOLA 3FB5B 1MCEA 4P5MA 2A6IA 4GBXD 1AE6H 5B39A 5BRZE 2BVPA 4M93B 2K3TA 3EFFB 3HRZA 4OLVL 3WHXA 3ALXA 5BV7L 1IEBA 2DTML 1T1XA 1WTLA 4NN7C 1OY3B 1HYRC 4OGAC 4LBEA 1AY1L 3BSZL 4QRUB 4P4KD 2PO6B 1TCRB 2Y4SA 3I02A 1U95B 4WJ5A 1RIHL 1HWGB 2Z0BA 4C58B 5BXFA 3CVIL 4U2YA 3KPMA 1FQ9C 3TGXA 4NDMB 1LE5B 5EO9B 4BSVB 2D4DA 1AGFA 5GRVK 3BZ4A 3EOBB 3WXWH 1FFPB 2NY7H 1GZPB 1QSFB 1D9KC 2Y7QA 1FGVH 5CAYB 2GY7B 4R96B 3LQZA 1XEDA 4X4YB 3OHXB 4U6TA 4U1IA 4K7PL 2V9TA 3BZDA 1W0VB 1R3HA 5HGAA 5DK3A 2A0LD 2R0LH 1A3LH 2XV6B 1UWXK 2W9EL 5F9WC 1H3TA 1KCUH 5JW4R 3S98A 2EZ0C 1YQ2A 2XRAL 2A1WH 1OM3L 4U6YB 3PWPA 3BP7B 2F19L 4PJHA 2RCSL 5KVGH 3MV8B 2VLKE 4BH8B 1BZQK 4GSDH 4OLYL 1Y18B 4PG2C 3ZE1F 4YLQT 5J9PA 2VYRE 3IFPA 1JPST 5L9DH 1T7ZA 3HAEG 3NFSL 3FB7A 3JTSA 3RUGE 4IRJC 5DMYA 1KIRB 2W9EH 3QUMA 2BSTA 4KTYA 4RAUA 2Z91A 2VDLH 5FYLH 2ADFL 1QRND 4JFEB 1GCFA 3SGJC 1OGAA 2JJWA 1U8OB 5JW5B 1EO8H 4JZJA 3DX6A 5CZVL 4OF5A 3PL6D 3QCTH 3B83A 3MRHA 3CDCA 5KSAD 1MCQA 3EBAA 3QIUB 4FTVD 2GK0A 3U46A 4G8EA 2ADIA 3ARUA 1ACZA 3RJQB 1XF3B 1QFWH 1I1RA 2OM5A 4NBZB 1RU9L 3CC5B 4LSPH 1U36A 1S7TB 3JWNC 2OP4H 5DFWH 4R2GC 5DUPH 3EO1A 2DLIA 2X1WL 4XMPL 4OBRA 4YPGA 4DTGH 2KL6A 2OZ4H 1QA9A 3SJVB 1FNEA 3N85H 3QXVA 4QXGL 1MRDH 5TQ2L 4JFDE 2AW2A 1EXUB 3CK0L 3EOYG 3G5XA 4NGHH 3VXTB 3IJHB 1T2JA 2VH5L 2D03H 2YR3A 1CICD 2DJSA 3ROLA 3I9GH 4N5ED 3HI5H 3OGCB 2DWEA 4XWOD 3D3VD 1KIRA 3DX9A 4JQXC 3UJTH 2BCKB 4F3FB 2VC2L 1LO2L 2NW2A 1MAML 4KAQL 3VFPA 5JHDE 4WWKD 1UXWB 3RWCB 4PLJC 5HHPB 4HUUA 1RZFH 2FHCA 3X17A 1IKFL 2J5LC 1A7OL 5LGJA 1RPQA 4JO2L 3ULSA 5ICXA 1DBKL 1K4CB 2VC2H 2W91A 4LLWA 4YHOL 4UOW1 4ZOAA 1B90A 1BIIB 3SOBH 4ODHH 1SJEA 3HZMA 1AFVH 1ZA6B 4PJAA 5LWYH 2FD6H 1KN4L 1I8LC 3SKMB 3P0YL 4KI5C 4I48A 1HXYA 5FIEA 4M48H 3W5NA 4Y16A 5D7IB 1RUAL 2IQ9L 3MOBH 4J3WA 3G04A 4HZLA 4YC2C 4CW1A 3OB0K 2ICEB 3IJHA 4H0HB 4YUEH 3ZDXE 2GSGB 3O4OC 4U1SB 5AYUL 1FJ1A 1NCBL 3CXDH 3R4DA 4K8RH 2CO6B 5INCB 4OI7A 2JF1A 2V17L 3QUML 5EOCL 1T5XA 3LHPL 4K94H 5J56B 1GGBH 4KI5E 4NQDD 4ONGH 5DJ2A 2PKDA 2ED7A 5GGRB 4GAGL 1MCNA 2FJFB 4MDJB 4P2OD 2A73B 2X4SA 5DEFB 4ZPTB 4M7ZB 3GSUA 4XTRD 2AEPH 1Z2KA 3NA9H 1JBJA 5AEAA 1EVUA 1K6QH 4HGKC 1WCBB 2ZCLH 3AS1A 4LPUA 5B8CC 3U1SL 5BZDA 1C5CL 1Y6KR 3VWKA 3TYGL 1OCWL 2WV3A 5B4MC 3OMZA 5DVLA 1T66C 1NAMH 3QAZB 5DJ8A 4J3VA 1GOFA 5IB5A 3SPVA 4ZTOL 2X4UB 4UTAL 4I5BA 1FGNH 4XCFL 4XNYL 1MFCL 3BRDA 1T22B 3ARRA 1DBBL 3BH8B 1C5BL 3LRSB 2V7NA 4M9OA 4U1NA 1YJDC 4NO2A 3WN5B 3QQ4A 3TCLB 4WUKH 1YECL 1EEZA 3WDJA 1OSPL 4POZD 1KOAA 2GQHA 2J8UA 2VXTH 5CP3H 2AXGB 2OR7A 4R4BA 3GBML 4PJ8D 4G6FB 2VXSL 5FXCH 2GIYA 1MOEA 1S9XB 3M8OH 5IKCA 1W0WA 3CUPA 3F7VB 3AAZB 4HW6A 3H6JA 2PO6A 2H2PC 2DTMH 4P46C 1UH2A 5I74C 1QFHA 2AXFA 1NCDL 4ODWB 3ET9F 3UDWA 4NO3B 3B9KD 3OAUL 2R56H 3MV9E 3D9AH 4H88H 1XIWC 4Y8DC 4ZO8A 5D7LE 3IFPB 3TYGH 4RGMB 5EIIB 3IFLH 3RNQB 4PJXE 1FLRH 5I1KL 4G80B 4Y19D 3QRGH 4KU1A 4WI9A 4LHQB 3FONB 1GZQB 3FRPA 5DXWA 1H0DB 3EO0A 4RGMC 1JYNA 3H3BC 5IGXL 1DN2A 4RGNE 1J0JA 1MRCL 2XQYK 4MQTB 3C5ZD 4NT6B 2XTJD 1ZLSL 1HOCA 2WK2A 2OXGA 1H8NA 4S1DC 4HJ0C 4QEGA 1N5AA 5I15H 1IC7L 3T3MF 5IT2L 5HHVL 2UUDK 43CAA 5H94A 3WCYA 1EFXD 4PB9L 1YPZA 5L2JB 3RDTA 2AK4D 4GRLD 2C3WA 4CDGC 2MHAB 5F89A 2BVEA 2HT4C 2X4PA 2IQ9H 2ZPKH 5ICYB 4KHTL 2IF7A 4M93C 1T1WA 4N0RA 1UWEH 2G5RA 4NZTL 3ZYJA 5D1QC 5DVOA 4QRQB 4KRMB 1YMMB 4YX2L 2B1HH 3D48R 4NQXB 3PDOA 3OAYH 1XR8A 2VZ1A 5HI4D 3N1MC 4OGXH 4M6NH 1UACH 4JY5L 4NNYA 1NFIB 5CJ5A 1KG0A 3FRPG 3JWDL 1RZJC 1MNUH 2JB5H 4PRHA 5HI3D 1FNSL 3BP6B 4URTB 4RA3A 1JHTA 3R0NA 3LEYH 2XPGB 4MX7A 3GMPB 2DL9A 1B2WH 2DQEH 7FABH 1HQRB 4LLWB 1BEYH 1PD6A 4FQXA 4D0BA 1QFWI 2BP3A 4DUXA 4F9PC 5HPMA 1IQDB 1HWHB 4YE4L 5E8PB 4KDTC 3FKUS 5D1XD 5B8CB 3UAJC 1Z3GH 1PEZA 1HHHA 3SDAB 1X4XA 5I1DA 4HUVA 5DQDH 3H7LA 1TJIH 2B20A 4ONFH 3BDBA 5AZ2H 4M3KB 2QSTA 1IT9H 4PS4L 4QRRB 2C7UA 5DURB 5E6ID 5AUMA 3A6BL 3S88L 3UX9B 3PGCA 4KMQA 4MNQE 1V3JA 2WINB 1ZGLP 1RJYA 1KG0B 3TBVA 2FO4B 1YEIH 4TQEL 3I2CL 4X98A 5M7QA 3ARGA 4LP5A 2FX7H 3V2AR 3BKJH 4EZMA 5K59F 4PJGB 2C3XA 2YPKA 3LRGA 3E2HB 4R8WL 5IWLC 4HPOL 1UEYA 4YC2B 3WFBH 2R2EB 4HIXH 4GKZA 4DZBB 1FGNL 1X5GA 4YFLI 4BSWB 3BKCL 1S3KH 3NA4A 2PR4H 5BVJB 1ZMYA 1L7TH 4KHXH 4OGAD 3HUJF 5T3ZE 3HFML 2CO7B 5ALBL 1U8LA 3MJ9H 2B2XL 3V0AC 3V5DA 3ZTJH 3D0VB 3G6JF 5MHSE 3G5YB 5AWNH 1W72B 3FQRA 4X4ME 4EDWL 4HUWA 2O5YH 3MRHB 4I77L 5GGQH 3SHSA 4XC1L 4PY7B 3NCBB 1MI5B 1XH3B 1VFOA 2XNAB 3FCTB 1U91A 3WBDA 1OWWA 2P45B 5J6GB 5I16B 2EDOA 3W9DB 3O4LA 3A67H 2O61A 2BOBA 4KI1A 1NPUA 4JB9L 5LGHH 1RK0B 4WHDA 1I1YA 4NQTA 4OM1H 3RDTC 4X6DE 3Q5TA 2AXGA 2FNBA 3OKNA 5CMAB 4D8PA 3O2VH 1BQHA 2ERJC 3IFOB 1JWSB 2BY2A 5IB5B 1NDGB 3DIFA 5IR1A 1KCSL 1B4JL 1EEYA 4Y8AA 3U0WL 3LEXA 2EE3A 4LSUL 3MOBL 3RZCB 4KJWD 3OPZH 4X0KB 2EYTB 3WLWC 5KW9L 4KKCD 5FOBA 4P2RB 3V6FA 4PRIB 2IEPA 3MLVH 4MD4A 1ZANL 1FLTX 1MFDH 2A38A 5EU7E 1DR9A 3O8XB 4ZFOB 3I75A 4K23L 2H3NB 4KK8C 5IVXA 1JGLH 1INQB 3NAAL 5ETUB 3LKNB 2YKLH 5HGHA 5E5MB 5FYJE 3BPLB 2BJMH 2D7PA 2F15A 4M5YL 3SKJH 2FLBT 5HXMA 1L0QA 4HKJA 3E6HA 3A6OA 1N8ZA 1M7IA 2GKIA 3D25A 2OS7A 1NCUA 1INDL 1ZEAH 5DZNA 4G6KH 3QJHB 3I9GL 1P4BL 1D5XB 4NO3A 1R5VB 2NY3C 4GS7C 1E27B 4UT7H 1JNLH 1WGOA 1NL0H 2B0SL 4KXZI 2WMPA 4M5ZL 3IU3B 1GRWA 4F33B 1WFOA 3AC0A 2OP4L 1BHGA 3VI3E 5BRZB 4IMKA 4AENA 4OCWL 4PREB 5FUOL 1FAIL 2J88H 5FFLA 4HS8H 4HUXA 4XPGL 5C6TL 2DQUL 1U58B 3JSSA 4MA3B 2YSSB 4YNYB 5IB1B 1G7PA 5TE6L 5ETUA 2E6JA 3D0LA 2BK8A 1NQBA 1LO3L 5EU3B 1ZVSA 5E94B 2P5WA 1DSFL 2I07A 3MRGB 4IOIA 5C0NC 1JN6A 2FO1A 3WIHH 3HUJA 5C6TH 5F88B 1XGRB 1NFDA 3RRQA 4OCWH 1FNAA 4V1DD 5TFSL 2OSLA 2NCMA 1EA9C 1LD9B 3I3BA 4MA7H 1UKSA 4JPKL 2GT9B 4G8IB 3QZWG 5HYIA 4C56A 1JGVH 5MEPB 3K74B 2A1WL 1OM3H 1EPFA 3L3JB 1IQWL 1RY7B 1LDSA 2Z4QB 1RJLA 4OCNC 3T2NL 1WAAF 3L5XL 1I8MB 1HHHB 1VFBA 5A2LH 4JHZA 2H32A 4G6KL 3S6CA 2VAAA 2F53D 3QNZB 3VXOA 3WL9A 5ID1A 4I0CC 3C5ZC 4LL9A 5I1GL 1ZS8B 5IFHL 4L9LB 5EWIH 4LKXB 1P84K 3NBNA 5D6CA 3PGCB 4XHQA 4WI5A 2HFTA 4O4YH 1D5IH 1G1CA 4P9ML 2NXZC 2RB8A 3GM0A 1A9EA 1YDPA 3BMWA 4CL7A 4CGTA 3KPNA 1OARH 4X5XA 4RGOH 2LE9A 4P2RE 5C07A 1JPGB 5K59E 2ZG2A 5IF0A 4YO0A 3NMEA 5KW9H 4FFYL 3B5HA 3L3OB 3ILPB 4WI6A 4DKDC 3K2MC 4Z0BL 3OGCA 1LP9A 3VXME 2YPLA 2LU4A 2WANA 4YIQA 5CJXA 4NC1C 1VKXB 2ZOKA 2EYSB 5CFHA 1EZVX 2H6PB 3RGHA 2DQGH 1BQLH 3TBVB 1GIGH 3EYSH 1QNZH 2A6KB 1ZT4B 3MXVH 1S9WA 2H2PD 3MJ8B 2Z35B 3QDME 4ZUUA 2YD5A 1YMHA 3U83A 4YBLC 3OKDA 2CXKA 3B2VL 4XAKD 3UZVB 4LHUA 2Y06L 4NHUB 5CINL 5GGTL 3QCUH 4Q0XL 2YEZB 5L0QC 5E70A 2R1XA 1KIPA 4LGRB 1P5VA 3TZVA 1G7QB 3O81A 1TXKA 3U0TB 4MNQD 3MGTB 1X5HA 3GZKA 3FHQA 4Z95H 2D7OA 4FFWC 4FXLA 3TVMC 1FH5L 3U4BH 3FT2B 4ELKA 3VFNA 4OCYL 3IXAA 1MHPH 4EUPA 4P2QD 2BSRB 5D7KD 5I1CH 5E24E 1D6EA 4J3OC 3VFRA 3VW3H 5EBLB 1HQ4B 1DUZB 4KZEH 4LPVA 3LEVL 2PTTA 3ARGD 3ARSA 1IL1B 5C0BD 4D3CH 4Z7OF 4Y1AA 4HPOH 2GSIB 2A6DA 4JQXA 1P4LA 5FGBC 4P0DA 4QTIH 5HVGB 1G6VK 4G6AD 2ERJB 4JPVH 3VXRD 2FX7L 4PJXA 1MQKH 2R39A 1HHIB 4TNVF 3IDYB 4FQQA 2Z92B 3RBGA 4V2CB 4C59B 5BQ7A 3D18B 2N7BA 2NTFA 3O45A 5F1IA 4UOJA 3BGAA 2HH0H 4JFDD 4LRIA 3TO4D 4DKAA 5GGSB 5J9PB 5E6IC 4I3RH 1A6TA 4YZFF 3FB7B 3JTSB 1JNJA 3MGTA 5CGMA 1DJSA 1AGBB 3OKYA 3TP4A 3C87A 4HUVB 4HBCL 2XWBA 2ZCHL 2FGWL 4FQXD 1HDMA 3OKOB 4DGIH 1K8DA 3LPGA 2FRGP 4PFEA 4WFFD 3IDXL 4LU5L 4QRRA 5GRJL 2QQKL 3GO1H 3O6KH 1ZHBA 2OI9C 4ODBD 2WZPD 5CWSA 2YA0A 3THML 3L5IA 1SHMA 2P8PB 3R1GL 5IB2A 1B2WL 2CUIA 5JIKA 2GSIA 4FZEH 4U1MB 4HG4K 4L4JA 4LCWB 1CIDA 5EB9A 3QWRA 1BVLB 1I7TB 4F7PA 5DD5H 4AT6A 1JNHA 3O6LH 3KXFB 4OZHB 1IGIL 4OZ4A 3D25B 1MI5E 3UBXB 2ZKHL 3UCRA 1KPUB 1RMFH 4PLJD 2DQJH 1Y0LB 5IEHB 5L8KB 5FYJU 2A9NL 1AHWA 3H7BA 1CIUA 1JE6A 1IZKA 5DEGA 5TDNA 1A1NA 3QULA 1R0AL 4ZPVB 4UTBH 4UDUA 5D7KE 4ODXB 5C0AA 1QVOA 1G6RA 1WIUA 3MUGA 4OLWH 3EW3B 3UTQA 2DRUA 3BEWA 2LABA 1YEGL 1LD9A 5GIRA 1G7MB 5C7XH 1BM3H 1L7IH 4R2GD 1R3IH 1I7ZA 2CUMA 4IRZH 1JZ7A 3VFUB 2GJZB 3VG9B 5EZJA 1CGWA 5FO9A 3QCVH 4RBPK 2GAZA 2NYYC 5CZXD 5F70A 4Z7NE 1JI1A 4CU8A 1QQDA 2NQCA 4NM8L 3RTQA 3HZMB 4PJAB 4GG6F 3C9NA 2ZZUT 1B0RB 4AK1A 1TZHB 4LSDA 3L5WB 1N26A 2IPKA 2X4NB 4RSVA 1FLRL 5D7JB 5C0JB 4PJIA 4FQPA 1A6ZB 1HHJA 3NZ8A 3MR9B 4L5FH 2HLFD 4H1LG 4NFDA 5L2JA 4LIQH 4N8VB 2R1WA 2E7BA 5KZCB 3BEWB 4FQXC 2IGFH 3V6OA 4NC1E 3L3OA 2WSKA 4FMFA 5DD0H 1QSEA 3U7YL 4Y5YB 2VDRL 3J8F7 3VXNB 3B2UC 4ALAL 5I75B 3GSUB 1CK0H 1U3HC 3MFGB 3SDXF 3BKJL 3BT2L 5DZOA 1XF1A 2IFFH 1KTLA 3N0PB 2IH3A 1G9NC 2NXYD 4X4MA 2FJHB 4Z7WF 4KGLA 2AQ1A 4E42B 1D5IL 3LB6D 1GC1C 1D5MB 4Z7VB 1OSPH 4WNQA 3D3VB 2BNRD 3MLWH 4X8XA 5L0QB 3L6FB 1A7PL 4X8JB 4TVSa 4PJEB 1YMME 2HVJB 3W11C 4MSWA 1ZK9A 4RX4D 3HG1D 4M7KH 1JFQL 4GLRI 1HSBA 3CSPA 3TWCH 5EU4B 4LHUG 4P4KC 4LLDB 3KGRA 3LN9A 1CG9A 4YHMH 1XF4A 5EFIB 5FM4A 3RGVB 3SKMA 1M6OB 5GS0C 4TUOB 5HGGS 4L1DA 3VXSD 5K9OB 3D39E 1ZHNA 3SJVE 2PCPA 4K7FB 3SE3A 3PWUA 4EN3C 4WFGD 5TF1H 1U8QA 1BFSA 1DN0A 2N4IA 4PJIF 3X14B 4G8EB 4M62H 1FDLH 4LAQL 1F3JB 3ESVF 5EOTA 1KJ3L 2LU7A 2N56A 1FVEB 4YQXL 4OAWB 5CEZL 5T1DH 2C1OA 4OGXL 1TCMA 1OB1B 1N0XH 3CNKA 2A83B 3LKSA 4ZAKC 5HJ3A 3W39A 3BP5A 4CADB 2C4FT 1IFHH 1VPOH 2H1PL 1CFTB 3T0EE 4M61B 1HI6B 1NBYA 1MHPL 3SE8H 1UGNA 1FFNA 2HTKD 4KMTH 2ATKB 1P84J 4P4KA 1JTTA 4JM2D 1LQSR 2EDHA 5EU5A 1R3KA 4KDTA 4XCEB 3VXUB 1U8PB 2CIIA 4L8SA 2ZSWB 4I8DA 1WBZA 5KSAC 4QT5B 5F3BB 1ZGLA 3QIBB 4HIIA 4YDVB 4YH6A 3UP1A 2FZ3A 4G7VH 4WHTB 4ZFOL 1CWVA 1UB6B 3SGJA 4JRYB 2Y23A 2C5DC 4OZHF 8FABB 2VABA 1CS6A 4HKBA 3FO2A 4N1HB 2HWZL 1J11A 1A14H 1FG2A 1MJUH 1TVHB 5IJKA 2XI9A 3V5HB 4I3SL 4LCCC 1A2YA 4PUBH 2XWJA 2YRLA 3QO0A 1K4DA 1JZ2A 4LAJH 3HI5L 5IV2B 5F96L 5KANI 2IMMA 3GMLA 3UTPD 4Q6YA 4FTVE 1DQJA 3EYOA 3OV6A 2Q8BL 5CGTA 1KYOJ 4KGJA 1NC4D 2XTJB 3STZB 3D2UA 3O4OB 4HBCH 5CILH 1CU4H 5DJDB 2AJUH 3AY4C 4B5EA 5DUPL 2VXSH 2FEEI 4H0IA 5E99L 4NCDA 4XMKL 5FO9B 1J86A 3Q6GL 5IW1B 1YEEH 3GBNL 3DO7B 2AS5M 5KSAA 5HI5C 1CQKA 3GHEL 4Y19B 4NZJA 2EIZB 4D9QE 1AJ7L 1MUJB 3D39A 1Y0LA 3R8BB 4WO4B 1QRNA 5IEHA 1F97A 1Z6JT 2ADJB 1I1AD 4ZNCD 4EVNA 3I50L 5HVHB 3KPPB 4CRPA 3PABA 2IBZX 1TZHA 2DM3A 1BX2A 2VUOA 3A6CL 4IIQA 3QI9D 2VDLL 3QJHA 1ZLVH 4XPHL 5L7XH 2F54A 1DANU 1NC2B 2BSED 1JMXA 4G3YL 2OI9B 3MNVA 3TBTB 2BVPB 5DMIH 3VW3L 2AQ3A 1MCIA 5C0CA 1V7NH 3V9FA 1MIMH 2X9XA 3WFCH 3T0BA 1FZKB 3HFMH 2AI0H 4J1UA 4XZUB 1T7XA 1KTDB 1L7TL 4KHXL 1T0PB 2F19H 1BPVA 2Z31D 5J6HA 1V7NL 5JUEH 4ONHB 3G6AB 1EHLH 5DRNB 3U48A 1YN6A 1K5NB 5L7XL 2F9BT 3NOIA 5C0BA 1S9YA 3UZQA 3MV9B 2DJUA 2N7AA 3BZ4B 2CLVA 2VDNL 1SBSL 1A4JA 2CDEA 4L3CB 4POZC 5KVDH 4PJ7F 5D6DC 5FUCE 1RZJL 5D7JA 2VXVL 1L0YA 4MAUH 3GRWH 1J05B 3GHEH 1YEHL 4L4VD 4E9LA 4HIJB 1R3HB 1AO7B 3ULUF 3FT4B 2MPAH 4XMKH 3M45A 1XIWA 5ID0A 3EKCA 3DMMC 4RFNC 2XPGA 2HJLA 4MX7B 4UI2A 4F7MB 5DQJA 2D7NA 3DVNA 4P2QE 3WS6C 3SY0B 4YXKL 2CXGA 2MMXA 4IRJB 1Z3GL 2HT3C 1RUAH 2D7MA 4R90L 2VDPH 2YUVA 5EZIH 3TBYB 3CFBB 3T0DA 2W38A 1CGSL 2EH8H 3VA6A 1CLOH 1N4XH 4UU9A 1JTOA 1J5OL 3ZE2E 2UYLB 4NNPH 1KNOA 4MWFA 1RUML 1TIUA 3ZZ1A 2PXYA 1OAZL 3ZLQC 4DVBA 4WW1B 4OZ4B 4U6HB 1ACYL 3LV3B 5EA0L 1IILE 4P3DB 3ALPA 3SDDC 4NJAL 1UEMA 4WRLA 5C0AD 4OT1H 4PJEA 2IANB 4DGVH 2VLME 1N6QH 5E5UB 5EA0H 3WUZA 4CVXA 1KJVA 4JN1H 4KAQH 3QEUA 3MROA 4K2UH 1EMTH 1HNGA 5F9JA 1WSST 3VFSB 1QVOB 2F5AL 2CR3A 3MZTA 4R97B 3KPSD 3TVMB 4GAYA 1GGCL 3FN0L 4JFEE 1T0NA 3RNKA 1J88A 2DBLL 1ONQA 1H3PL 1XCQB 5JOEA 4QNPE 1VEOA 1F4YL 2IALB 3TLRA 2RFXB 3BW9A 5DO2D 5JIPA 3N85L 5TQ2H 2DI7A 1GZPA 4HKXB 4QHKI 2ITCA 5C0IA 4IOSD 5C0AE 4MVBC 1AR1D 2EYSA 1UJ3B 2MPAL 5E2UL 3MRBB 5HHOB 1UCBH 2AJSL 1IGFH 5DJAB 4Z0XA 4ZNEE 2YXMA 4Z7QE 4P2YA 1CD8A 4KRNA 3C60C 4LOUD 5DJYA 4ELMA 4IS6B 1EO8L 1OTTC 1T04B 4HGMA 1MH5B 2XWTB 1RUKH 4D0BB 4OSUL 2EO9A 5DVNA 3S5LG 3ARBA 2HMID 2UWEA 2APFA 2Q87A 4H5SB 2AK1H 4GAYB 3ES6B 1U6AL 3WFDH 1GPOH 5JW5A 2JJTC 3G6JB 3I3DA 1NFDF 1NEZB 1J0HA 1FN4A 2VXQL 4Z7UA 5EPMB 4WFFE 2IQAA 3SDAC 4NKQB 2VLJD 3ARQA 4NM4L 3U9UB 3WFCL 1CDYA 2D31A 4YHML 3ARBC 4Z95L 1NGYA 4HKZB 5DMIL 3FJTA 1TPXB 1DUZA 1CDGA 3GSNB 4OZGA 1CGVA 4MLIA 1UM6H 2YC1B 1OVZA 1OQXA 1SM3L 3VFWB 3VXUD 4J4PD 5FECA 1JL8A 1FG2B 5KBNC 2NY7L 3BUTA 4HK0B 4MYWB 4KV5F 4N9GB 3VH8B 5DJXA 3H8NA 5IMMA 2XYCA 4H1LB 4EN3D 2CDFB 3LQZB 3S34H 1N5YL 4QXTB 4WUKL 2EDRA 4XBEL 2UZIH 3BKYH 4XXCC 1CK0L 3S9DB 5DJ6B 4XMLL 4GMSH 1OLLA 1R3JB 3TESA 4M02A 3D2UB 2IAMA 4PP1C 3IAPA 2R0WL 2XZCL 5LCVL 4APQC 3OPZL 1OTTD 3MV7D 5TE4H 3OTTA 3C60A 4P9HH 4P2RD 5L8JB 2E7LA 4XWOC 4AEEA 2DQEL 7FABL 3T1WA 3RA7H 4TVPE 4Y4HA 3F5WB 5J57B 4O9HH 4LRIC 1UM4H 3GIZH 4MHHG 2HG5B 2I9TA 1I7UA 2ZG3A 3L3HB 4XNUL 1BVLA 1I7TA 4P9MH 1IGYB 5T1LD 1P9MC 1OAYL 4I4WB 1AI1H 1TTUA 1HXYB 2J5LB 2FYYB 3BP5B 1Q9LA 5HHXL 1BZ7A 1T4KA 4ZFZA 3RBSA 2Q86B 4X7TA 3MNWB 1UYWH 4FP8H 2CDEB 4P5KB 3E1F1 4UV7L 3WXVH 1YNLL 4PV9B 5I1EH 5C0CB 2WQRA 1CFNA 4GO6B 5HVFB 4PGCA 5TF0A 1XF3A 3MV9D 3WDHA 2BFVL 5FYJL 4ODXA 5C0AB 3PUCA 1BAFH 4XC3L 3ZSSA 3C5JB 5D1ZA 5I19H 2HJFA 4ODTH 1KBGL 1S5IH 5J1AA 1UZ8B 3QRFM 1U8NB 1CVRA 4ZG1A 3PQYA 1KJ2B 4XXDA 1RURL 2BC4B 5C8JA 1TVBB 5EBMB 4HFWA 3B8SA 3ULVD 1ZHKA 1IARB 5ESAA 4M6OL 4XTRC 3P77A 4AEHL 3SPVB 3QHZH 5DJZB 3F65A 3ZDYE 3VRJB 1IC5L 3QRGL 3QO0B 2E9BA 1YY9D 3PNWA 4PJ8A 1RVFL 4QO1A 1LP9F 3RZCC 1HILB 3HA0A 4FZEL 4HH9A 3MV7B 5EUKA 1LO2H 4NQDE 3VXRB 4R7NB 4BELD 1OF2A 2G75B 1ADQH 3UJTL 5D7IE 1S5HA 3U4AA 1TETH 2XZZA 4W68A 3CDFA 3ZYOA 5DJDA 2NW3A 2D9CA 3T65A 4H25A 5JW4N 5DT1H 5J1AB 4JQVC 2VDOH 5T3ZL 5I1AB 5IOPB 5IMKB 4EXKA 5IHZB 4JO1L 3LV3A 3D18A 4M7KL 5D1XB 4O58L 1MFBL 4XMPH 5GRWA 2M26A 4WW2C 1A8JH 5HDBE 1MUJA 2QR0B 1SMAA 4Q9QH 1XR8B 3P9WB 3V4PL 3CUPB 4Q6IB 2DIAA 5EOCJ 3KPPA 3QDMD 4F7CB 2VISA 3PWNB 3RUGF 4X6CE 1NFIA 4OFDA 3FN3A 1OL0A 4Y5VC 1G6RL 2A6KA 2HFEB 5GZND 2W59A 4AL8H 4XP5L 5FDWB 2OCFD 3KYNA 4BH7B 4F7TB 4FFVC 5E8OA 2ITCB 1J8KA 3B9KC 4J3SA 2R1YA 5IVZB 3TZVB 1B4JH 4TUOA 1MJJB 5TE7L 1JNHB 3DRTA 4NJ9L 4PJCF 3UPAA 2PUQT 2ZUVA 4LEXL 5I19L 2X4UA 1ZTXL 3LMJL 1MELA 1KCUL 1F3JA 2HFFA 1YUHA 1M71A 1M05B 2FDBP 2PYEB 1NBQA 4GW5A 1KPVB 1MRCH 1ORQB 2Y06H 3KR3L 4NM8H 5LG1A 5CBAA 5BXFB 2F53E 3C6SB 4K94L 2P47B 1E28B 3JV5A 5GIRB 3OL2A 4AH2B 2B39A 3CFDA 4WUUE 5JOPD 4QY8B 5IB4A 4Q9RH 1EJOL 1TMCB 1PLGL 4OQ1A 3NZHL 4NUGL 2CKBH 1WITA 4M61A 4JPWL 1U8KB 1U0QA 1KNOB 4KQ3H 5FKPB 5IBUB 4G9FB 3TCXA 3N1QC 4I0KA 5JHDA 4B7IA 4F58H 3WFBL 1WWBX 2DTSA 4M7LT 3T2PA 4B41A 2XFXA 4UINH 1H3UA 1ODAA 4FTVA 1CICA 3GKWL 3G6DH 2DKSA 3UAJD 1T20A 3CLEH 3H9HB 5EIQA 3TT1H 3V0WH 3CMGA 1REIA 4XP6H 2P44B 3RTQC 1MFAL 2ICES 3WLBB 1NDMB 3MR9A 4N0UE 1FNHA 2X1PA 4YR6B 4JE4B 5D1QB 1RUPL 3BO8B 4CUCA 4Y5XA 3NCCB 5F1OB 5DD3L 1YECH 5JZ7D 1RK0A 3IKCB 2JJSC 5B3JF 1MCOL 4RISL 5C9JB 4HQQH 2HFGH 2XWJB 2P5WD 2VIRB 1U41A 2LTQC 3HC0A 2VITB 4LLMB 3VGGA 5C0RH 1T2XA 1I3GL 1MCWW 3FRUA 5DUBA 4OI8A 3HC3L 2FB4H 3RWHA 3W11D 4KTDH 4KROD 5LBSL 4QRPA 4FFVD 1PZ5A 4WUUA 4KRPD 4NQVA 3MRIB 5I1JL 2FO4A 3V6OE 4OUOA 4YBHA 1OP5H 4MA7L 3RVVD 1X5AA 4I3RL 2X9WA 3W81A 3MXWH 4QKXB 5CEYB 4JZOA 2ZCLL 4PJFE 2BC4A 5C8JB 2IH1A 4BSWA 4N0FB 1Q8MA 4YHZL 3B8YA 1QRNB 1UACL 1A7RL 1MQ8A 3BHBA 4NQED 3OSKA 4OLZH 4EVNB 1CDUA 2X6MA 5BVJA 2I24N 4XVSH 3ECBA 1AXSA 1EHAA 4NUJB 3LHPH 3ARYA 2DQUH 2Z8WC 4HX1B 4LGSB 5CHNA 4P46D 3BP6A 4LGPB 5T5FL 4H8WH 3PV6A 2ZUTA 5E2VH 2E6QA 5C0CD 3QDGE 2D31B 4AIZA 4LSSH 3EO9H 1A5FL 1UJTA 1X6LA 2DI9A 4BA8A 5IW6B 3LPWA 2H2SD 3D69A 1FVEA 1N59A 3LRSA 1YEFH 3W9EA 1MVFA 4I48B 2BOBB 3VMOA 3EJZD 4AT6B 5IOPA 2MSPA 3SDAA 4X4XB 1ZLSH 1GGCH 3O9WD 1SYVA 3WXVL 2F8XC 4JG1L 1J0IA 5KZCD 3STLB 4MS8C 5DQ9A 3N1PC 1P7HL 4YHNB 2BJML 4ELMF 3H0TB 3G5VA 4HH9B 3KYMA 4PIRF 1NMBH 1BBJB 2YD9A 6FABL 1GIGL 4MD4B 3WNPA 4DGYH 4FQ2H 2FATL 1I85A 3MRDB 2YBRA 3QIWD 4P2RA 3BN9C 4XP4L 5D72L 1NLDL 4BKLA 4XP9H 5C09E 4LSRL 1G9EA 2BNQB 4HXAL 2AEQL 2V5MA 3BSZH 1A7QL 3EYUL 4C83B 2GJZA 3HS0B 3QISA 5C3TA 1IAKB 3VXTA 1T66D 1OP3H 1TFHA 5ANMA 2OJEA 1LDPL 3O9WA 5EU7C 4M7ZC 4HF5L 4LNRA 3LKQA 4MAYA 3DJ9A 4TULL 3HN3A 5HHOD 5IQ9A 1X44A 3QJFB 3LH2H 4XCNB 5SWSD 3U36B 2B8OT 5DDHB 1WIPA 1D9KA 2OMNA 1JZ8A 1S7UB 1JUFA 2F74B 2JJSA 5B21A 3DXAA 4EI5D 5IFJB 2OTWA 5C0EB 3FMGL 5I18H 4NQUA 1RIUH 1MRFL 3A67L 1MREH 2DLFH 2DDQH 3ZTJG 5EWIL 3TO4A 3L7EB 1P4IL 3TN0D 3RWFB 3MRDA 6CGTA 2XQBL 4TOYH 3T3PE 43CAB 4RGNC 2P24B 2MCPL 1KB5L 1ZA3A 4MS8D 3D3VE 3JUZA 3NFSH 2MWCA 3RWIA 1AHWC 3WLWD 2VZOA 2Z9TA 1IQWH 3QWQB 2C3HA 2VL5A 4JFQA 5LAXB 1U93B 1BF2A 5E6IA 4JPKH 5BS0B 4PR5B 3BVNB 4DN4L 3ILPA 4W6XB 1R24A 2HFFB 4HFWB 2HVKA 4WWKB 2ZCKL 4BZYA 3BZFB 3B2UD 3L3IB 3QT2A 4O2CB 1QA9B 3SJVA 1KB5H 3GMRA 3HE6B 3QFJD 35C8H 4RFNB 4Y4FD 5E8DL 2E7MA 3DMMB 4X8JA 4GAJH 1GAFH 3VXUA 4AL8L 4I18B 1N7MH 5DSCA 4OZGE 1KLGA 1PSKH 4QRPE 5I30L 1P7QA 4Y2DD 1UG9A 1GGBL 4QHUA 1MVUA 1WCQA 2LAAA 2WWMD 4P9HC 4PY8J 1OP3K 2V5RA 3MJ9A 3X3FL 3T04D 4EI6A 3CMOH 4HWBH 1RIHH 5HHPA 3SE4A 4GW1B 1ND0A 1AD9A 5I1JH 2EXWD 1JIBA 1U3JA 3DUSA 4ENED 4WFEE 3ZDZE 1F90H 1D5XA 2DBLH 5LJYH 3L3GA 2UZXB 1BQSA 3QQ3A 4IJ3B 1TENA 2CPCA 4G9DB 4Z5RB 2VSCA 4XP9L 4PUBL 4M8VA 4X99A 5DD6A 4ZYKB 5MENA 4HZLB 3LVEA 1JYXA 2IADB 4YHYC 4K94C 4PJDF 1DBJL 5I9QB 4EBQH 3MV8D 3NN8B 5CJXC 2VIRA 4OLUL 4WENB 1RHFA 4JY6B 3RPKA 3JWOC 4MVBD 4NN5C 1S7SA 3PHQB 4WO4C 2OTPA 1PQZB 2V6HA 1JN6B 2IPTH 3TIEA 2IAMB 3BE1H 3S36H 1I1AB 4ZUWA 3MRIA 5I6XC 1FCGA 4NWUH 3QPXL 5C07D 1XCTB 5F3BA 2FBJH 4UUJB 1C16A 2DN7A 5IMOB 3DVFA 1B0GB 1U2HA 3FO1A 4QCIB 3TH4T 4HH8A 4YK4B 1A6UL 4JFPA 4OZFG 1UXSA 1R6VA 3MREA 4LEOB 1K3IA 4QHMA 5FYJH 5H8DA 2E7HA 4HKBB 1TNMA 4O5LL 2P8LA 4ONHA 3VGDA 4DW2L 1YC7A 3HI6H 4YXHH 2Z31B 3HNTL 3SDAD 3KXFA 4OZHA 3MNWA 2ED8A 4C4KO 1T22A 5IB3B 3P3YA 4ZXBD 1CFQB 4I3GA 3BIBX 3AREC 3FB8A 4K71B 3ILQD 3U30C 3SDDD 4L1HA 5BS0D 1NUGA 3IETB 3VWJC 3KPTA 2EXYD 3K8KA 5E9DE 4PRDA 1A1NB 4HUMB 1E6OH 1DLFL 2HJFB 5SX4H 5J3HC 5HYSA 4PJCB 3VFOB 5GJTL 5A40E 2EDLA 3S4SB 4ZD3L 5EORL 1I8LA 3CFKB 4W4OA 4HIXL 3P4NA 5ANMB 4JKMA 2APWA 4NQXA 1FNGA 3QO1B 3TBYA 2A2QT 2GCYA 1VFAB 1MWAH 3BDYL 4QRSB 1NBVH 3G5VB 4JKWA 5EDXA 3CPLA 4OZFB 1D7FA 2DDQL 5KS9E 4OI9A 4KJYB 4V1DB 2CKNA 1C8PA 1DEDA 5BJTA 1VGEL 5LGJB 1NBZB 2R69H 3CVHB 4HDIB 1AKJD 3Q6FA 2HJKA 2UWEE 2IFFL 1BGXL 4U7MA 3PWPB 5MP6H 1P53A 4OGYH 5SWSE 3CXHJ 3RWFA 1MWAL 5CWSB 1W8OA 4O2FB 2O61B 2D9QB 3UJIL 2P24A 4Y5XC 2O5ZL 3DSNA 2KQMA 3FT3A 3F58L 4ZDHB 5E8PA 2FIRT 1D5BA 4Y89A 5B39B 5JNYA 5KOMC 1I3VA 1TJGL 3EYFB 1IC4H 3LS5H 3MBXL 5F96H 3QB7C 5D5ME 3T0VA 3HCVB 4D94A 1HN1A 2BHYA 3EFDH 1AHWB 1U8OA 2F74A 3LEXB 4GG8A 5TJWK 3QIBD 3KDMB 3DV4B 4E0RB 4X6DF 2HWZH 5EUOF 3RY6C 1IL1A 3RTQD 4WJ5B 3V79C 4GMTH 2YXFA 3OAZH 3UXFA 1G6RB 4JY5H 2Y9RT 3ARGB 5HGDB 4HK3N 3U9PL 4WNQB 5F21B 3O41A 1BD2A 1XIWB 2Q7NA 3QEQA 3HZYB 3MYZA 4R96A 4JHBA 3KXFD 1NGQL 1QBAA 1SVZA 5D1QD 4DZBA 1UWEL 1Z0NA 1KPRA 1NEUA 2ZPKL 5C70A 3O0RH 3P9MA 1JGUH 4HV8A 2WUBL 2QQNL 3IGAB 4ZTPH 3UTSB 2P5ED 4APQB 3IKKA 3O0RL 5A3ID 5HI3C 5JLZB 4FQIH 3WNNA 2AJ3B 3RVVC 2MTPA 4TVPL 3T4AB 4FQXB 1A6ZA 3UTTD 4ZFFA 1DQLH 5HPMB 4ZO6A 3UJJH 3GK8L 3IU3A 1RHHA 3FO0L 3G9AB 2ZUWA 4M00A 3EDFA 4OFIA 5JW3H 5I1DB 5CD3A 2D7TH 1R5IB 2OL3B 3GSVB 3O41B 4U1GC 3DROB 3ULVF 4LPWA 2B1AH 2W65B 4ERSL 4QY8A 5D6DA 4HPYL 2X2YA 1FO0H 1G0DA 1F3DH 1RZ7L 1CXHA 3DUSB 9CGTA 3UROR 1I7RB 5SX4I 2AJZA 4AYFA 3THMH 4D9QD 1KPRB 1TPXC 4JDVA 3DMMD 1MI5D 1YY9C 4NWTH 1BLNA 3NFNA 4HXBH 4WCYL 4YHPB 3PWVB 4J6RH 3V4VH 1UJ3C 3QJFA 5INDB 2AXFB 5CSBA 3JTTA 5C0RL 1T5XB 3RY5A 1WLHA 5GZNC 3T0WA 3KPOB 4FG6D 5GGVH 5F7FA 3FO1B 1KXVC 4QCIA 5GGUB 5IJVA 3SCMA 4L3EB 1J1OL 4IMLA 2NY2B 3C5SA 3DPBA 2YD1A 2WWMC 5IVOA 3O2DH 3LQAL 1QLRA 3PJSA 4HJGA 4BZ1H 4KKBD 5I30H 2WWKT 3ES6A 2CJUH 4WFED 5TQ0H 4PV8B 1TJHH 4ZOBA 4L8BA 1IGML 5IB3A 3V5HA 4N5EC 2EH7H 2JELH 4JR9L 2VITA 1U93A 3GEWB 3FRUB 1K4DB 4GKSB 5BVPH 5F6IC 4DOHE 3KYAA 5BO1L 2GITA 1NCWH 2BRQA 3W9DA 3K80A 5F7EL 3FQTB 4HHAB 1IBGH 2KDGA 4MNQA 4DK6A 2ZNXA 2BRRH 2HAZA 2AAVA 2VXUH 5F7LB 4UB0H 2MHAA 5F89B 4NUGH 1RULL 4MAYD 4PTTA 3MLXH 4YO0B 3KPQB 1CDJA 3L5HA 4CADA 1GVIA 1YEDA 3TA3A 5E4IA 3RU8H 3EOBA 1U58A 1FFPA 4MA3A 3S36X 4FP8L 3TPUA 1DVFC 1EO5A 2Q3AA 4S11A 4PJEF 3QIWB 1FNFA 4LLUA 1SMOA 3QUMH 4IJ3C 3O8XA 4UILL 5CJQL 4XCCH 3VCLA 5I71C 4AZ8A 4Z7VF 3CVHA 4F9LA 1QR4A 5K93A 5E2UH 3UC0L 1UVQA 5EZLB 4PB0H 4Z7WB 1NGWA 1Q0YH 2APXA 4JFFE 2LU3A