4LBEA

Structure of kcsa with r122a mutation
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein, membrane protein
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lbeA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lbeA02
1KV3A 2HN7A 1WFNA 5IMKA 1AHWC 5IJVA 2X4UA 1QR1B 5J6HA 4ZFOB 1SM3L 5JO5A 1HNFA 3T0EB 3GSVB 3SJVD 1AXSA 1AR2A 4MD5B 3L6FB 2EYTB 3CFKA 4UIKH 2WLYA 3AVEA 4GG6E 1CFNA 5JNYB 2NTFB 4F33B 5I1CL 3MCLH 1I8MA 3EO0B 1I9JH 2V5RA 3S98A 1FH5L 2R1YA 4UQ3B 1HKLL 5A2FA 2Q86A 1RK1A 5C92A 5LQBH 4UDUB 3WHXB 3TZVD 5GHWH 4PJDA 5BS0E 3KPMA 5TQ0H 5D1XD 5FUZH 1NCDH 3DRQA 4NCC1 1JN6A 3IKCA 2DKSA 1I9IL 5HD8D 3D25A 3RGVB 1A9BB 1SY6L 4B41A 3V7AE 3P11H 2NX5B 5EC2A 4HEPG 3GSOB 4YDIH 3EOBB 1U8OB 4FXKB 2YBRB 1IEAB 3QDJA 1RUKL 2YK1H 5FB8B 1NAMH 3BQUD 4PJIA 4LPXA 4C57C 1G84A 4NZTL 2CDGB 2VLRE 5EZOL 4JO4H 2P5EA 2HMIC 2QQNH 1ITCA 2AS5M 3HAEH 1LK3H 2NXZD 5JMRA 1IQWH 2RFXB 4YHPB 3N9GH 1OPGH 2XTJD 3ARYA 4LSPL 1HCFX 3QAZB 4Q74A 4LLAA 1AKJA 3H9HA 1U8KB 3CVIH 2JKXA 5DD5H 3N1PC 1TQCB 2W1NA 5GS1C 4WV1A 5ITBL 4UOW1 2BXZA 3R06A 4P2QE 3RTQC 1D6VL 3VFSA 1JGVL 3PWLB 1KIQA 4HHAA 1AD9B 5DJ0B 5ANMB 4JR9H 2PXYD 4RAVB 3C8KA 4KDTC 4CNIB 4EI5D 3ULUC 2Q76A 5IVNA 4LNVA 4RGND 3FN0H 1F4HA 3QQ4A 4GRMB 3MLXL 2Q8BH 5JDSB 1AR1C 4HPYH 4L29A 3CZFB 1LDSA 3VH8G 4YHZL 1WZLA 1PX3A 3TVMB 4FFZH 4XC1H 2UZXB 3U79A 2DQEL 3ARDA 3O2DA 3RKDD 4KK9D 4MGXA 4YDJB 1WWWX 2VRAA 1CDCA 4L3CA 4WHTA 4X4XB 5CEXA 1A1NA 5E9DE 1JRHH 3O11B 4JZOB 2FH8A 1HDMB 3QZWA 2C7UA 4KI5D 4XI5D 4OGYL 3V79C 1PSKH 3NFSL 3GMQA 4DN4H 1KJVB 4LAJH 3IRPX 5E2UL 4TSBH 2J7LA 5E99L 3T4YA 4HEME 2BX5A 1KPRB 4OKDA 5FGRA 4R26L 4OLUL 3DMMB 4ODUA 1AE6L 2B4CC 5F7UA 2R39A 1CFQB 4LP4A 4R97C 2IBGA 1UJ3C 4LF3B 4OD2A 5TE6L 5MHSD 2I9LA 3FL7A 2IQ9L 1ETZB 3QHFL 4MJ2A 3B83A 1P7QA 1XF2B 1JNLH 3B6SA 3FO2B 3REVB 4OQ1A 3IFNH 2A73B 3G6DH 4NKDB 1DBAH 1W0VA 3RIFF 3QDJD 4LCUB 1LK2A 1XF5A 3WXWH 5DC4B 5T1KD 3EFDH 4G7YL 4F8TA 5DQJB 3QJFB 3CUPA 2H2PD 1QR1A 2P5ED 3MV9B 5C71A 5HYSB 4WRLA 3LEVL 4DZBB 1R3JA 3WKMH 4B0MM 4MD5A 3BSZH 3L6FA 5DUMH 5KS9E 4X8JB 35C8L 4Z0BH 1AKJD 1L7IH 4JG0L 5JNYA 2NTFA 1BM3H 4LSTH 5DGRA 4KPHH 4KVCL 3EO0A 4ELKA 2LFGA 1ND0A 3HA0A 2KZ1B 1JZ3A 3WNNA 4UQ3A 3PWNA 2EH7H 3IJSB 3V6OA 1FCCA 5BRZE 5IB5A 3RL1B 4L1HA 5GRUH 5EPMB 2OXGA 5DO2C 4AL8L 1BWMA 4UDUA 2E7HA 5I8EB 2VLJA 2FD6H 5I2IA 4NQVB 3RL2B 1AQDB 4ZODA 4MNGE 4PJ5E 4KRNA 3BD4A 4M3KB 5CIPH 1GHFL 1AGCA 4PJGB 1IZJA 4ELMF 3BFOA 5MENB 3DX9B 5D70H 1LO2H 2Y07L 1A9BA 2NY0B 4N0YH 32C2B 1T7XA 1JPST 2FEDD 2KL6A 2FATL 3ARDD 2MPAH 3GSOA 3EOBA 1U8OA 4G8EB 2YBRA 1IEAA 5DD0H 1OAZH 1KUMA 5FB8A 5KVFL 4O02H 4XVSH 3QUMH 4AQ1B 3IDGA 2CDGA 4JE4B 3KPNB 1WK0A 1FZMB 3D18B 4HZAA 5FDYA 1VACB 1EAPB 2RFXA 4PD4J 4YHPA 1Q0YH 4HCRL 1CE1H 3T04D 2FECL 5TH2B 5BV7B 4L3EA 2DKUA 1U8KA 1CDGA 2MQCA 1QLFA 2E6JA 5D7LE 1DBMH 4HC1H 3RDTC 5E5MA 4TVPL 3PWLA 1AD9A 2YMXH 5DJ0A 1TTFA 4YQXL 5ANMA 2BRQA 4ZFFB 4OZGB 4RAVA 4CNIA 2OZ4H 3DROB 5GSRB 3HCVB 1EEUA 3Q0HA 4JZNA 5F9DC 4GRMA 5DJXB 5FHAH 2GFBB 2FBOJ 4JFEA 3ROLB 3C9NB 3HR5B 3MBEC 5JDSA 5CEZD 5IJKC 4U1SB 1P7QD 1GVIA 3CAFA 3BPOC 1F4YL 1EBAA 1U3HA 2EDDA 1CICC 3B9KA 1FDLH 4IRJB 3CZFA 4BSWA 5DD3H 1QA9A 1ZTXL 1G9NC 1MFAH 1XGTB 4HKBB 4ZUVA 4ZOCA 1KLUA 5C0DB 5JHLH 1WWAX 4YDJA 3VXPB 4X4XA 4HXAL 1QLRB 3QXAB 4P2RA 3WFHA 2XV6B 4UT6L 3MRIB 4FZEL 3KS0H 2IGFL 4E5XB 2ATPB 5ISZE 4PJXF 1LP9F 4JO2H 3L5XL 2C1PB 1KJVA 3GNMH 3INUL 4JQXA 4HMCA 5DDHB 4X5XB 5A1AA 1C5DB 4OZFB 4YK4C 5DJ8B 4GG6B 2EDXA 4HV8B 5I9QB 2NY5C 4UNTA 2OSLB 4JRWA 2VLJD 4P2CG 1B4RA 1NL0H 1MLBB 4J8RA 4LLYB 4M7LT 3KPLB 4Z7VE 3F8UB 1ACZA 4LF3A 4HK3N 4JPWL 2R2HA 2HT4C 4JDZB 3ES6B 3RGVD 5BS0B 3P0VH 1ETZA 3P9LB 2MQ0A 4MCZB 4KK8D 2BERA 1XF2A 2NX5D 4YWGL 4KKAD 2G9HB 1A6VH 3FO2A 4DTGH 4NC1C 4NKDA 1KB5H 5ENWB 3WN5A 4L4VE 1J8KA 1AGDB 4CMHC 1WT5C 5DQJA 5H8DA 3QJFA 4O58H 4YX2L 5KVEH 4N8VB 1G7JB 4C56A 5HYSA 3SDXA 4DZBA 1NMAH 2JIXB 4NQXA 1HI6B 5EO1A 5T3ZL 4P3DB 4FQIH 2QV2A 4KRPC 2VLRB 3HS0B 4M7ZB 3PV6A 2Y9RT 4JPVH 4NBXB 1TJIH 3WFDH 2UZIL 4W70A 4OJFH 3KPPB 2DQJL 5DVLA 3IJSA 3UO1L 1YYML 4UB0L 4WJ5B 4WU5B 4LKXB 3CDYA 3MUZ1 4BUHA 5D7IE 1C5BL 1L7TL 1S7TB 4PB0L 4HWBA 4P2QB 2ZCHL 1AQDA 5J8OA 2DLFH 5ADOH 3IYLW 4JQIL 1W72A 2NNAA 4PJGA 1ZS8B 3RWHB 3DX9A 2P47B 1TJGH 4HS6B 1CG9A 2E5EA 32C2A 2C3WA 4ERSH 1MH5B 3HUJA 5HHQB 4G8EA 1HWHB 4P57B 2BXYA 4L8SB 5JW4M 3U1SH 1MFBL 3MLWH 4P23A 1I8IB 5F7KC 3KPNA 4O4YH 3X3GL 5DUBA 3T2NL 3R8BB 1FZMA 3D18A 3OXRB 1S5IH 1VACA 1R3KA 5EBGA 1EAPA 5M7QA 4AEEA 5E9DB 5TH2A 3VXTB 4MXWH 5FF6B 2ZCKL 4WO4B 4FRWA 3H3KA 4JM2F 4OCSH 4ZAKA 1F02I 4KJQC 3UJTL 4OSUL 4Z76B 5C6TH 3DMMD 5KSUA 5C1MB 3CSYB 5E4EB 2H3NA 4ZFFA 3AREB 4OZGA 2P1YA 2GITA 2DQFB 3G5VB 1LDPL 4M6NL 5GSRA 5GGTL 1NGQL 2J88H 2GFBA 1MFEL 1N2RA 3OAUL 4TRPL 3ROLA 4I3RH 5F9JA 4U1SA 2DLHA 3MLVH 4PUBH 4Y2DB 4KJWC 3HC3H 4IRJA 3C08L 3EO1A 1F13A 5ID1B 1XGTA 4HKBA 4PJFE 3S88H 5C0DA 5E1HB 3MRHB 2W9DH 2IEPA 3HC0B 4JM4H 2VDKH 4YHOL 4LPTA 5ESAB 3MV9D 1QLRA 2J8HA 3CIQA 3QXAA 4CMMB 3HNTL 3NIDE 1WTGT 3JWOH 3MRIA 3VD7A 2V2XA 2P24A 4E5XA 2ATPA 3HAEB 2YEZB 1V3MA 5DD1L 2Q7YB 3UC0H 3VRLF 3BP6B 2C1PA 4CVXA 2Q3ZA 1TQBB 1MCQA 4X5XA 4OGZA 3LAFA 1NFDA 5KS9B 3S8WA 1C5DA 4PJ8B 3W5MA 3TJHC 1A6ZB 5E7BA 2EEDA 5IFJB 5DJ8A 2BMKA 2EH8H 25C8L 4LARL 2BDNL 3ULVH 5FYJL 1K6QL 1KFAL 3TYFB 1PD6A 4Y5VB 5C2UB 4LLYA 5BRZB 2ZUUA 4ZS6D 1LO5A 2ZWLT 3BP7B 3IGAB 3ARUA 5MEND 3ES6A 4PYGA 2NY0D 5E2TH 5DWUH 4MCZA 4JFZL 5BO1H 4MNGB 3SO3C 2G9HA 3ZKMD 2NY1B 1HIMH 4DKDC 3QRGH 3X13B 3GI9L 4CN4A 1BEYL 3NIFE 3WIFB 1CI5A 1FNHA 3TO4C 1FFNB 4PPTA 3ZDYE 2P8LB 4TPRL 5HI5D 3TJEH 1J1XL 4LHQB 3UYRL 1F58L 3IDMB 4N8VA 1G7JA 1P53A 2EDBA 3EO9H 4FFVD 4D3CH 2Q3AA 2JIXA 1HI6A 2PUQT 2YSSB 4P3DA 1RZKL 4LLMB 4U2YA 2VLRA 4G6ML 4KQ3L 4XAKD 4LDLB 5CGTA 2VXTH 3OR7B 3IJYA 1VESA 2F58L 4ZAKD 1KNOA 4M5YL 4R9HA 1KCUH 5DC9B 3KPPA 3NGBB 3PF2A 5DK3A 4WU5A 4KKLD 4LKXA 4RNRB 5DEZA 1I1YB 2D9CA 5CILH 1S7TA 4BZ2L 5B39B 1DL7L 4P2QA 5D7LB 2IFGA 3U7WL 1T03L 1MREH 2VH5H 3VGAB 3WJLC 1L4IA 1ZS8A 4Z7NE 4IRJD 5JA8B 3HLAB 4FMKA 4Z5RB 4HS6A 3NZ8A 1CTOA 3I50L 3BD3A 3HG1E 1MH5A 3ZYZA 4GKZB 1HZHL 5HHQA 1YY8A 3Q2CA 3ZDZE 1LHZA 4YDLB 3U30C 4L8SA 4DGIH 4BFIB 4EXKA 1RURL 3I02B 2FZ3B 3OXRA 3QFJE 5IBTL 1DANT 1XF3A 2WQ8A 5HGHB 4ALAL 5E6IB 3MREA 1R6VA 3I84A 4K23L 5D1QC 5FF6A 3GUTA 5I1GL 4WO4A 2E7MA 4LSVL 5H35B 1GJIA 4ZO9A 5ISZB 3ULVE 2B2XL 4Z76A 2GSIB 3ZDXF 3BXNB 3CSYA 4BZ1H 2XA8L 4R3SB 1KJMB 2C1OB 3AREA 2DM3A 3MODH 3BAEL 1E27A 2DQFA 3FQXB 4RGOL 3D3VE 2DTML 3T3ME 3GBML 3TH4T 1H5BC 5KVGL 5C0RH 3HMXH 4ZYKA 3ALPA 2MKWA 3R1GL 4ONFH 4RWHA 4HT1H 4Y2DA 3NMEA 1HN1A 5DJAB 2ICWI 3WL9B 1UXSA 2A9ML 1NCWH 3ZE2F 3KG5A 4H0GA 3HC0A 1BVZA 1HH9B 4JCLA 1F00I 5ESAA 3T8XA 3WIHL 4HIJB 1FRGH 2F5BH 2C3VA 3QUMB 4CMMA 4L4VB 1Y6MR 2DKMA 3CSPA 1YUHA 4CU7A 4POUB 2JIXD 2VLRD 1DP0A 2YEZA 4CAGA 2K7PA 4M62L 1TETH 1QBAA 2Y1VA 4XNMB 3BP6A 4Z8FH 2ZUXA 5J6GB 2HKFH 4NGHL 3N1FC 3GSXB 4HSQA 1P4LB 2X4NA 2AP2A 5KS9A 2IPTL 5I1AA 3LQZB 5ILTL 4LSQL 2VSDA 2E8ZA 3DETD 4UNVA 2R1XB 5I71B 1RVFL 3EZ8A 1ZHBA 3VFVA 3K4ZA 4OV5B 2YPLE 1PG7H 1KJ2L 3U7YH 4GLRH 3RVUD 1ED3B 4P2QD 3ZL4H 1RIUL 3ARFC 4LVHC 5KTEL 4X6DE 4Y5VA 5BRZA 5J89A 4AIXA 2VAAB 1YMME 4OAWB 3IGAA 5D7IB 2DWEB 4KGJA 2BVYA 3KPQB 4HQQL 4MLIA 1NGZB 3GMOB 4G3YH 4OTXH 1D9KC 4MNGA 1JFQL 1YEDB 5C2BL 2RJMA 1QO3B 5IVOA 3X13A 5BW7C 4U4BA 3F58H 2VXVH 3RY6A 4ZTOH 4BH8B 1AY1H 5DMIH 1FFNA 4U1JB 1RZFH 2A74A 2YD8A 3IDMA 2R1WB 1NUFA 4FZ8H 1AGFA 2X7LB 2E9JA 4I18C 3HR6A 2XN9E 3HRZB 2B5IB 1RUPH 3OAZH 3GO1L 5E9DD 3WS3B 3PP4H 4L8BA 4WO4D 3OR7A 4ONHB 3WFZA 3LZFL 5F8QC 3MXVL 3UZEA 3TH2T 1Z6JT 3AS2A 1QBLH 1OAXH 1VADB 2CXKA 3LKQA 2DF3A 2G5BA 4PLJD 1R0AL 4M9OA 2B1AL 2ESVE 3OHXA 3ARED 4RNRA 4GUPB 3AS0A 1I1YA 3KLDA 3VFMA 3BP5A 5B39A 4KK6C 1WFTA 2FYYB 1T7ZA 4MB3A 4ODSH 2VE6B 3C87A 3L95B 3IB4A 4Y2DD 4AIZA 4J12A 3HLAA 3MRKA 3MV7E 1YZZA 3UZQA 3NCYS 4CN6A 2AEQL 4GKZA 3OB0H 4KUCF 1KB5B 4OCWH 4F58L 1QKZL 2NZ9D 2IADB 4WCYH 1V3JA 3BJLA 2FECI 2BK8A 2UWEE 4N0UE 4TUOB 1KYOK 1KEGH 1V5JA 3I02A 4U3XA 1IC5H 3LHPL 3BIKB 2C26A 3O9WC 5C0GB 1HHIB 3OTTA 3VRIB 4TQEH 1T20B 4WTWA 5E6IA 1UWXK 5F1OB 4FXLA 4LSUL 3P73B 5I6XC 4LNRA 5FO8A 1UEMA 1JMZA 5H35A 1KEMH 5DHYA 1IL1B 5FYJU 3EKCA 2CMRL 2GSIA 1LWRA 5FA3B 4AEHL 3KJ4B 1MCNA 3EYQD 4R3SA 4JO3L 1KJMA 2C1OA 3HAEG 3PL6A 5BRZD 3FQXA 1QD0A 3UTZA 3FCTB 2WBWB 3D39E 2WZPD 4YDVB 3TA3C 5IB2B 3P0YH 3JVGA 1IM9B 2NY1D 4YFEA 4DCQA 3OX8A 3ARPA 4P4KA 4QGYA 3QIUB 4LVEA 3RPIB 5DJAA 3WL9A 2YXFA 3CC5B 4MSWB 2YS4A 4Y4KC 1EVUA 1HH9A 1G9MH 1WZ1L 2MCG1 3WO4C 4JRXE 1P1ZB 1U0QA 3TGXA 4HIJA 1FAIL 5D6DC 3QUMA 3UPRB 2H45A 4OZIA 3EJZD 4X6CF 1BD2E 3KLHC 4XXCC 5CEYB 5DMJB 1T7VA 1EBPA 2DIAA 1HWGB 4M5ZH 4XNMA 3RWGB 1YNLH 3O3UN 3ZKXB 4PD4K 3W9EB 3MNWB 4P2OB 2FBJH 1BJ8A 1P4LA 2WUBL 1JE6A 3LQZA 3GJFA 4S1SL 3VD4A 1FL3A 5I0ZA 5BMFL 2X1WL 2WBKA 5F6HI 2G2RB 3SKJH 1DEDA 2FX9H 4NN6B 5KANI 2G5RA 4TUKH 1ED3A 1DDHA 1G7LA 4IRZH 1FV1B 3AM8A 5JQ6H 1BJMA 2XRAL 1BJ1J 3N1QC 1YEEL 4OAWA 3O3BB 1NH6A 3NZHL 3VJ6B 3LD8B 1H8SA 1H15B 3SGJA 5ADPL 1NGZA 3GMOA 4NKOB 4G9DB 1CU4L 2Y06H 1QO3A 4R90L 2YZ8A 1T2QL 4UI2A 3GKWL 3I2CH 1FG9C 5I8OH 4U1JA 1FP5A 3RU8H 2BNQA 4D8PB 1S7XA 3HG1B 1KCKA 2R1WA 3QEGH 2X7LA 4HWEH 2BJMH 5E6ID 5CMAB 4MJ5B 4HIEB 3WO3B 3WS3A 4BQCA 3OZ9L 3CNKA 3RVWC 1KGCD 3KYAA 1KT2B 3QFJB 4OB5H 5ISZD 3PNWB 1LE9A 1KIRA 2GKIA 1VADA 4DGYH 4R8WH 1X5ZA 3NA9L 2EE2A 3D9AL 4JHWH 5E8NB 3IT8D 3LKRB 2VDNL 1S7UB 1ZLWK 3SBWA 4I0PB 3RIAK 2FYYA 3NIGF 4DJMA 1X6LA 1J0HA 2VE6A 3BH8A 3L95A 1MHPL 4KY1L 3MLPA 3F7PC 3D3VB 2A83B 1GGUA 1IILE 4P4KD 4EN3C 1YN7B 5SWQA 3FO9B 3MV8E 4RAUB 2NW2B 4GKOA 4M6OL 3O6LH 1MCRA 2DJ4A 5I19L 2B8OT 4I1NB 3CSGA 4EBQL 3L7EB 4P3CL 4U1KB 4TUOA 3DUHA 1OVZA 1TCRA 3JWDH 4ZPVB 1ORQB 1CXIA 2B0SH 5CZVL 2F19H 1HHIA 3BN9D 4N8CL 1IAKA 4MVBD 2CDEB 3MNVB 2HH0H 1OAUH 3BN3B 4OCXH 3P73A 5ELIA 1KC5L 3AS1A 3QIBC 4XP4H 1HYSC 1XCQB 2VC2L 4DKFL 1IL1A 3FN3A 3G5XB 3LSOA 1FVEB 1U9KA 5F93C 5FA3A 3UJJH 2NMSA 1H3TA 2BVEA 3QT2A 5KVDL 2WM0A 2EDTA 3SDAA 1EO8H 2R0LH 2H9GB 3IXTB 5D93C 1CF8L 1F4XH 1BIHA 4XGZA 3FCTA 1K4CB 4OLWH 2YPLB 4YDVA 1BQUA 1RJYB 4JREB 5IB2A 1KPUA 4K3DH 3TIDB 4K8RL 1B0GB 4X6DB 4NPYB 2FHCA 2OI9C 1CGXA 1YMMB 3Q3GA 3ZYOA 4UTBH 3QIUA 1DBBL 1FORH 2EDWA 2VWEC 3CC5A 4HIIB 5B4MC 3CLFL 2R0WH 4APQC 2QTEA 2BSSA 4GMTH 4PP2A 1P5UA 5CP7B 3UPRA 1XZ0A 3NOIA 1UC6A 4JG1H 5E2WL 3L3JB 4UAOB 5HDOA 2H1PL 2XN9B 3GSWA 2VQUA 1U93B 2E6PA 4JB9L 3FQRA 1XT5A 3QIWA 4RDQF 5F3BB 5CGYC 2X4SB 1T2XA 4Y16B 4LASL 1YEKL 1GGCL 3CMOH 4NUGL 1L9MA 3TYGL 5HHVH 1FV1A 1I7TB 5GZOD 2ERJC 3MA7B 4KHTL 4PB9L 3U0WH 2ESVB 5F7NC 3WJJC 3F65A 1H15A 2CO6B 1OARH 5AG9A 3O8XB 4NKOA 1C1EH 5FYKL 4XX1G 4G9DA 1MJ8H 3HB3D 3D87B 4WI7A 1A0QH 1XH3A 4PJAE 5J7CC 3MV7B 1AQKL 4OLVH 4D8PA 3HG1A 5T3XL 1T22B 1XGYL 3ILQD 3RIAF 3QUYB 2A6IB 2E7LA 3J7HA 2UWEB 4N0UB 1R5WA 5CMAA 4HIEA 2ATKB 5E2JA 3UBXB 3CXDH 3VCLB 5GJTH 3CK0L 3QFJA 4QHLB 4DKAA 3PNWA 1IGIL 1X7QA 4WFGE 5FKAA 4LCIL 3Q6GH 3D48R 4NRZA 1CK0L 4P99A 3WUWB 5HI3D 1PFCA 2Z8VC 2J5LB 3IU4H 2W9EH 4JFYB 1DBJL 1S7UA 4I0PA 2VN7A 1VENA 4P4RB 1Q9KB 4M6ML 5F6IB 1JYNA 4UV4H 4ODTH 4XP1L 5SV3A 1DQLH 1CGSL 2PTVA 2A83A 5JDJA 1YN7A 3QIUD 2BVOB 3FO9A 4RAUA 4QRPE 2NW2A 3D39B 4F15B 2F54E 1LEIB 3QG7H 1S7QB 4XCFL 1UQSB 1QR4A 3IFPB 5T5NF 1ULVA 5E5UB 1ZEAH 3V5HB 3L7EA 2PETA 5HI4C 3Q48A 1PVHA 3Q5OA 3C8HA 4YLQT 1OAQH 2VZUA 3IDUA 1ORQA 3RA7H 2ILLA 3BHBB 2CDEA 4JRXB 2F74B 3MNVA 2WBJC 3BE1L 2B1HH 4FQHA 1INEH 4P2OD 3I75B 5I73C 1JF1B 3LPGA 1BD2B 2QSCL 1T21A 1YEGH 3G5XA 3H6JA 5D7KE 4B7IA 4F7CB 3HNSH 1BREA 4UT7L 2D7OA 4NNXB 5A2KH 5GS2D 1LGVA 1GGBL 2A6KB 3L3KA 3IXTA 2UYLA 4QHKI 1ZT1B 3G9VA 4LFHG 1UZ8B 1K4CA 4F57L 2B4CH 5D1ZB 3VG0L 5BVPH 3TIDA 1F4WH 3G6AB 1CDHA 4PJ9C 3S37L 4X6DA 2NLJB 4NPYA 5AWNH 5E94A 5FAAA 3V0VA 4MAYB 3HG1D 3RBSA 5JLZB 1PLGH 1DLHB 3BT2H 4LU5H 4OFVA 4JZJC 3SE8H 2FR4B 1KN2L 1SJXA 2K1MA 3L3JA 5GPRA 3QFJD 4JFOA 1SM3H 1TJHL 2XN9A 3QUZA 1DVFC 4QNPF 1U93A 1I8LC 5ITFA 1NSNL 3MR9A 4X9GA 2X4SA 3F7RA 4Q6IB 4DN3L 1HKFA 4JLRB 2BOBB 5I1CH 1M71B 4RQQB 2JJWA 1UB6B 1WC7B 4I0PD 1CLZL 4DKEL 4QF1A 1OTSC 1PG7X 5BCAA 4PRHE 4R0LB 3GK8L 3D3VD 1UT9A 3MJ7B 5F1NA 1MY5A 4U31A 3GM0A 1FZKB 2E27L 4E9LA 3O8XA 5EUOF 5J11B 1QFWI 1MHHB 5FUCC 2EDOA 2CH8A 5LWYL 3IRZA 4JO1H 3OGCA 3K74B 3MRFA 3F5WA 4RZCA 2H2SD 5BZWA 1I9IH 3MV7A 5HDBE 3MV8B 5CBEB 1CDIA 2G75B 1SY6H 4K71B 3VGDA 4NUJB 1T22A 2FO1A 1LO0H 3VFGL 3QUYA 5FA4B 1CD8A 2UWEA 4HJ0C 4N0UA 1RUKH 1YC8A 2ATKA 4MS8C 4OGXH 5C0EB 1MFDL 4TSCL 1KSRA 5HHOE 1DANU 1MCHA 4LMQI 1I85A 5EZOH 1LVEA 3GGWA 1D5IL 3K2UL 4QHLA 5IM7B 3VE0B 3VXSE 1EGJL 3FQWA 4PJBF 1GGIL 2OK0H 5GGSA 1RPQA 1HHKB 1RU9L 4NO2B 1FL5B 3WUWA 1F2QA 2N56A 2XT1B 4PIRF 1X5JA 4JFYA 2VDOL 15C8L 4P4RA 1D6VH 1L0QA 4ODXB 1QFHA 2Y7QA 1YMMD 4XP5L 3NPSB 1WBXB 2BVOA 2W07A 1WWBX 4FMFA 2EC8A 1K2DB 5GISL 3UDWC 5DJDA 5LGJA 1LEIA 1S7QA 3IFPA 4IS6B 3PIQA 4MDJA 3QXUA 1H0DB 3V5HA 1FLRL 4ORZC 4GRLB 5FKPB 3HZVA 3B2UC 3QFDB 4RSVA 4ZO7A 1CL7L 1TZHB 1G9NH 2DQEH 1YN6A 2ZP0T 3DUUB 5GS0C 2BOCA 4NNPL 2V6HA 4R96B 3BHBA 4JRXA 2QADC 4F8QA 2HFFB 5DYOA 2O5XH 1I7ZA 2QSTA 2OL3L 4LQFL 4OBRA 1RULL 2XN9D 3QUZD 5JUEH 5F7MC 2X4TB 3I75A 1JF1A 2HT2D 4S1QL 1BD2A 2ICCA 4WTZG 4CGTA 1UENA 4MZ3A 4X99B 3NFSH 4Y16D 12E8H 1UWGH 4F7CA 1GC1L 2J6EA 3EDKA 2A6KA 3GSRB 2NY7L 5E2UH 3LS5H 1ZT1A 4PJ7E 1UZ8A 5FECB 2APTA 5FYKU 5HYIA 2NY5H 3FRPA 4R26H 4OLUH 3BKYH 5D1ZA 4KK5C 3O8XD 2MQ3A 3G6AA 3P3YA 3BVNB 5HYQB 2E3VA 2X4PB 1QFUL 3E2HC 1AGEB 4PY7B 3MV7D 5GRWA 2IQ9H 1ZANL 3QHFH 4MMXC 2WIMA 4LLVB 3QJHB 5C0IA 3KPOB 1TTUA 4UINL 1DLHA 3QUYD 4PJAB 3HE7B 3IDJA 4HKZA 3CZJA 4ZSOE 5DR5H 4JN1L 1UZ6F 2ARJQ 2CRZA 1RFDL 2AJ3B 1QLEL 4KI5F 4XMPL 3VDBA 1MEXH 4XVTL 4CADB 4AH2B 3EYUL 4OI7A 5JW3L 3A0OA 1JTOA 5J3HD 3U2SA 4ZD3L 35C8H 1KLGA 1ADQL 4Q6IA 2HVJB 1HOCA 1CFTA 4Z77B 3B3IB 2BOBA 4OZHB 2R9HC 1M71A 2AGJL 1UB6A 1WC7A 4KVCH 3UBXG 4PJDF 1P7KB 2Y5TA 4D0DA 3PABB 1QNZL 3WIHA 2LQRA 2HFEB 4MQTB 1N7ML 3IS0X 4NQUA 4OF7A 3MJ7A 4NCDA 4GH7B 1GZPB 3TT1L 1CXLA 3T65B 2IANE 3LEYL 4LCCC 3D39D 4LGPB 5D96C 3LKNB 1MHHA 2HYMA 5EU4A 3LDBB 4HLZG 5A2IH 3LRGA 3C6LB 1GHFH 2BRRL 2M1KA 3MV8A 5CBEA 2Y07H 4PJIF 2GCYB 4QRPB 2JJTA 4AEFA 2F54B 4NUJA 4KROB 3FQNB 2D7PA 5FA4A 4JRXD 1EVTC 1RAMA 3O3EA 4XZUB 1KTKE 1YECH 2HLAB 2P42B 2HT3C 5C0EA 1VFOA 2FX7L 1BD2D 4H1LA 1P4BH 3PP3K 4DQOL 3W0WE 5CJOL 5BXFA 4C83B 1E4XH 1YEHL 2VXQL 4HCRH 1FL5A 1E4JA 2IAMA 3RWJB 4DFIA 5K59F 4EUPB 4NJ9L 1F8TL 2XQBL 5IQ9B 3BMVA 1CXHA 4GW1B 4NHUA 5MI0C 5D1ZD 2D7TL 2O61B 1C7SA 1T66C 4ODXA 2E6QA 4PLOB 3QQ9C 3MRNB 3WD5L 3HFMH 1DQDH 1WBYB 3U9PL 4NC1E 5I1LB 3KGRA 3U6RB 1OWWA 3QFDA 2YRLA 4YDKL 1ZLUH 5GSVB 1TZHA 1EJOH 4K94L 4HKXB 4FQ2L 3I3DA 2PR4H 4R96A 4Y19A 3QHTC 1MWAL 4ZOAA 4CU6A 5IW3A 5I1EH 4PRIA 2V2TB 1UCBH 2X4TA 1UG9A 2V9QA 1I9RL 1FFQA 4FZEH 5DRXB 1H3WM 5HGBB 2IGFH 4QXGH 1A7RL 1H8OA 4JKPH 1QHOA 3L7FB 4X99A 3BZ4B 3L5XH 4U05A 4MQXD 3U36B 1YQVL 3G5ZA 3GSRA 4OQTL 2F8OA 4NNYB 4ZXBC 3QYCA 1A6UL 1DQJB 3KS0J 2MMXA 5GS1B 2R0ZL 5FECA 5DI8B 2J3SA 4HXBL 3RTQB 1UVQB 2AEWA 2OTPA 2AJVH 5D9SA 2FX8L 3BVNA 5KW9L 5HYQA 5I76A 2X4PA 3FJTA 4PRHB 5JTWA 2V7HB 1AGEA 3MXWH 5SX5K 4CDGC 2ZCLL 3MV8D 2YHGA 3KPSE 5CCKL 3K81A 4LLVA 3QJHA 5DSCB 3KPOA 4YWGH 4EDXB 4PJAA 5CJXC 2NYYD 4QXTB 2HA1A 2XXCB 3IXAB 5J57B 4OLEA 2GW5A 3H3PL 3CFBB 4RA3A 4XBEL 2DQDH 4LGSB 4CADA 4YX2H 4AH2A 4PY8I 2AK4E 1PEWA 5CHNB 3PQYA 5F7LB 5HHOB 3GIVB 1KPVB 2ZG1A 2IAMD 3ECBB 4ZNEA 4Z77A 1DN0A 4HUWA 4OZHA 3VXSB 3MX0A 3CX5J 2C4XA 2E9IA 1P7KA 2UZIH 2V9TA 5T1DH 3N85L 4JANB 1SVCP 3UO1H 1YYMH 4UB0H 1TCMA 4EOWL 4F3FA 1C5BH 1L7TH 4D9QE 3X3FH 5LVEA 3T65A 4GMSL 3BX7C 4R97B 4WU7B 3NTCH 1WICA 4L8DB 3UTPE 3N06B 1UJ3B 5E8DH 4JFHE 4GRLD 3UCRA 5TE4L 1Y18B 3C6LA 3DYPA 4WFEE 4BZYA 2GCYA 2F54A 1NEUA 4X7TB 3RX7A 1JWUB 3HPLB 5DS8B 4JPKL 2PF6A 4DGVL 3FQNA 3H7BB 1TVHA 4Y19D 3MYZA 2ZUYA 4G8GE 1S9WA 2EO9A 3MRRB 1F3DH 1MFBH 4PRID 1U6AH 3WIIL 1AHWA 3X3GH 4W6XB 2YD3A 4UBDC 5ABDE 1CDUA 3MNZA 4C83A 1VKXA 5FV1L 4XNXH 1H3PL 3GSNL 3KLSA 4N0CC 2JJSC 1TMCB 2QL1A 4U6YA 4EUPA 5IQ9A 3RWCB 4Q58C 4GW1A 1P5VA 1IGFH 2ZKHL 3MRNA 1CFSB 4PJ7B 4C59B 3BYYA 1Q72H 1NCAL 1LDPH 3QHZL 4M6NH 4MNHB 3DTXB 3L3HB 4MAUL 2GK0A 4QTHB 1JYVA 2RCSL 1WBYA 5DHVH 1MFEH 4Z7OF 5GJSL 5D7SL 2IH3A 5FGSA 5I1LA 4MLSA 1PBYA 5D2LE 3EGSB 2Z4QB 1OTTD 3C08H 2VDPL 1M7XA 3B8YA 4RBPH 4HKXA 5E4EC 3UJIL 2DMKA 3DI3B 3NFPB 4YHOH 5A3IC 4AM0B 2CLVB 3VGHA 1NCBH 3TWCL 3HNTH 2DI8A 3RNKA 4A6YB 1XGPB 1A6TB 3IDYC 5DRXA 1JI1A 3PQYD 4IRSC 5HGBA 3L7FA 4LAQL 5KG9B 2WWMD 3P4OB 3BPCB 4WFGD 1T1YA 2EDQA 3NABH 4KJPC 2Z0BA 1S5HB 1HQ4B 4NNYA 4DW2H 3RVVC 1W0WA 3OG6B 2EZ0C 5JW4N 1DQJA 3V4PL 5GS1A 1W0YT 5DF0A 25C8H 3RTQA 3RDTB 4P48A 5IK3B 1UVQA 5F6HJ 5FYJH 1I3GL 3S3JA 4N68A 1K6QH 2KKQA 2GYSA 5DK2B 3QDAA 4KDTA 2APVA 4PRHA 2V7HA 3C6LD 2W65A 3PHOB 4Z7UE 4ZNCD 2O5ZH 3BWAB 2IANB 3MBEB 2F54D 5DSCA 4KROD 3BPOB 2YWZA 3O6KH 1CICB 3WBDA 4EDXA 1WBZB 3DO3A 3GI9H 1B6DA 4RIRB 1BF2A 3O0RL 3SDXF 4PBWD 4QXTA 2YD9A 1WV7T 3IXAA 1IMHC 3LQAL 4WFHE 3MLRH 4K3GA 1VA9A 1ORSB 3NPZB 4TPRH 3SGDI 3UYRH 4W6WB 1F58H 4UOJA 2FEEI 5CHNA 1RZKH 2D0GA 3GIVA 4NZUL 4G6MH 4KQ3H 1A9EB 3ECBA 1LEKB 5ALCL 3W0WB 2F58H 3MUY1 5D7KD 1F90L 1UACH 4FOMA 2PKDA 4M5YH 5FYLL 4F80A 4JANA 1FFPB 4YK4B 3MRBA 3M1BB 2P43B 3QDME 4MJ4A 3HI6L 4IMKC 4PJGF 4N5EC 2YZ1A 1LILA 3IDXL 1SJEB 4IDJL 3IAPA 4BZ2H 4JGMA 1DCLA 4WU7A 3NCJH 4PJHE 5D7JA 3U7WH 4F7EA 4L8DA 1UJ3A 2WW8A 3HUJF 4O5LH 1Y18A 4LDEB 5MERB 4X7CC 4BQ6A 2YKLH 3G6JE 4AMKH 1OT1A 3I50H 1JWUA 3HPLA 5DS8A 3ET9F 3W9DB 1HZHH 3OJ2C 2VZOA 4XP9L 2V5TA 3MRRA 2V5MA 4CMHB 1KLFA 4KV5E 1OD7A 1IGJB 1Z5LA 5F7YC 4JKKA 3MTRA 4I2XE 2HMID 4OKVB 1JPSH 5IBTH 2X41A 5IEHB 5H2BA 4FQLL 1A2YB 4M6AA 4PGDB 1KCSL 4ALAH 4K23H 4KRPB 3OF6A 5I1GH 5FM5M 2XZCL 4LSVH 3TNMB 4OZGF 5CS7A 5D72L 2YD6A 3RTQD 2CDFA 3ARRA 4X4ZA 2XWBB 1VFBB 2MHAB 4FG6C 2XA8H 4F7TB 1R5IB 1CFSA 1KCVL 4OLXH 4PJ7A 3ULUD 1WCQA 3BUYB 4PRHD 4MNHA 4RGOH 1WLHA 1FSKC 5I8CB 3L3HA 3GBMH 1QEWB 4QTHA 4X9FA 3GMPB 1BHGA 4DAGL 2XWJB 1QBML 1AR1D 3R1GH 1CVSC 2GIYA 2Z4QA 4K3JL 5JPMB 1MLCB 1EH9A 1S9XA 4RRPA 2A9MH 3KPSB 2Q87A 1UH3A 4WEBL 2CLVA 2B39A 4Z0XB 3FB7B 5ETUB 4A6YA 1XGPA 2NW3B 2NPLX 5LBSL 1NFDF 1X5YA 5HHOD 2C3HA 1N59B 2CRIA 3VWKC 2XXMB 5E7FA 3P4OA 4H25A 3BPCA 1R3LB 1EPFA 5CD3A 3C5ZC 1CXEA 3AMKA 5F97E 5GRZA 3ZT7A 2AK4B 1S5HA 3KPRE 2VUYA 4GXUM 3QXWA 5ILTH 5TJWK 4YFLF 1RVFH 2LVEA 5IK3A 2I9TB 5EO9B 5C0CB 1C5CL 4UZGA 2P5WE 1EMTH 4OF5A 4UDTA 4JHBA 5D2NA 2FDBP 5DK2A 4U7KA 3K7UA 4UQ2B 1GSMA 1EXUB 5CUSH 4ODVL 3QNZB 1JNNH 3BWAA 5LCVL 2IANA 4HQQH 1U8NB 3NN8A 5IJKA 5IBUB 1NUGA 4YO0A 1CICA 3W2DL 2O93L 2Q6WB 1WBZA 2A2QT 3C6SB 1T83C 4RIRA 1JTTA 5I71C 1U8LB 4POYA 3MJ9L 4I48B 1CD0A 3P9MB 1ORSA 5EA0L 1IC4L 5CJQL 1N6QL 43CAB 1N64L 9CGTA 3VMPA 1M7IB 4K3EL 5SWZA 2ZPKH 4G8GB 4BUGA 3TLRA 2R8SL 5CBAB 3QXDA 5L0QC 3TCLB 3V5DA 1IEBB 1A9EA 3OF6D 1LEKA 5MEQB 3K1DA 4NQSB 2W0FA 1HINH 4ESKA 1QVOA 4KZEL 3RWIB 3O3DB 1NC4A 1R0AH 2W92A 2B1AH 5C0JA 3RFZC 5DO2D 2E7BA 1BPVA 4BFEA 1OCWL 4X9BA 3AS3A 3FFCA 2B5IC 4E41E 3KR3L 4Q9RL 1INDL 2D7QA 5TF1L 3MLTB 4OLZL 1WJ3A 5E8OA 3SO3B 3SKMB 1T0PB 2EEAA 1JGDB 2EXWC 2VITB 4IJ3B 3WFEL 4F58H 1SMAA 5D2LB 2A9NL 3TT3L 3TO4B 5JOPE 3V4UH 4RFEB 1WT5A 4YGAB 1IGJA 3LHPH 3SQOL 2GSGB 4OKVA 3OWEA 4PRAB 5IEHA 3HN3A 3PXHA 4IOIB 1A2YA 4KJYB 4PGDA 1Q9WA 3ISWA 2R0KL 1KIPB 1Q9OB 3ZSTA 4LSUH 2AV1B 3PHQB 1EHXA 1J12A 3LEXB 3IFOB 2ZUTA 3OV6A 3ZKNC 3F7QA 3W11C 1JCKA 3QPXL 3RDTD 1RIHH 2VL4A 1VFBA 4GAYB 2MHAA 3PJSB 5K93A 1NANI 4F7TA 1R5IA 4JO3H 1ZGLP 1BFTA 3GRWA 3BUYA 1N5YH 5I8CA 1VGEH 3C09C 4QHKJ 1RHHA 1T0MB 3V8OA 2IAND 1D5MB 3MBED 4Q6YA 2X4OA 3P4NB 1CICD 3V6ZB 4R7DA 1MLCA 3UPAA 1JUFB 4J6RL 3B5GA 1T4KA 1FNSL 3CXHK 5GRJH 3DLQR 2OM5A 4Q2ZB 4D9LL 1WZ1H 2KQMA 1FYTE 3U30B 1MAML 1FAIH 2OR9L 1EZVY 2DRUA 3O2DL 5LGHL 4Z0XA 3FB7A 1I1AA 5KS9F 1GAFL 3LMJL 2J12B 2ZJSL 1IM3B 1E6OH 2ITCB 1N59A 1FGVH 1PZ5B 2Y6SC 3T08A 3W0WD 2IF7A 1AIFB 1FN4B 5D1QB 2AK4A 4B5EA 2Q20A 3QEQA 1NC4D 4S1SH 5J0BA 1AJ7L 5BMFH 4HFUH 1Y0LA 1FZJB 3BD5A 4KXZH 4X80L 1PGRB 5C0CA 3AB0C 5B21A 5K9OB 4AY0A 2DQHH 3FFCD 4PGCB 2EDFA 2OMNA 2XRAH 2VUOA 4UQ2A 1S8DB 3QDMB 1BAFH 1YDPB 1EXUA 2HT4D 3QNZA 1H5BB 3NZHH 2WP3O 5DHVB 1EHLH 3QPQC 4LIQH 4G80B 5ADPH 3GHEH 5IUSA 4PJHB 2C4FU 4OCLC 2Q6WA 5J1AB 2ZOKA 3C6SA 4MX7B 1ZMYA 5CEZL 2VR4A 3GKWH 4ELME 4I48A 3RUGE 3G6JB 1CS6A 2XKNA 3P9MA 3NCFB 5HDQH 1NFKA 1UCTA 3ZT6A 5EBLB 5JW5B 5C0BA 1GIGH 1J88A 1QSVA 4G8GA 5CINH 4OCMC 5FOBB 1JGUH 3D0VB 4XPFL 5CBAA 1U3YA 4HS8L 3TCLA 4ZFOL 2IMMA 3KNBB 3MOQA 1PW3A 3OZ9H 4XB8A 4FXGB 1IEBA 4I2XB 5MEQA 4MYWB 4NQSA 5HVHC 5C3LD 1RJLA 3MFFB 3RWIA 3O3DA 1B4JH 3TBVB 4MD4B 3MPCA 1BBDL 3D9AH 2A77H 3V8CA 5CZXC 3S36L 3JBG7 3ARFB 2VDNH 3FRUB 4LVHB 3T09A 1E4KC 4PG9B 2CGRL 3C60C 1YNTB 5EO0A 3MLTA 4H5SB 3SGKA 2VWEE 3IETA 1D9KB 4XCEA 3KPSD 4HKJA 1JGDA 2VITA 1JHTA 3VGFA 3MUJA 4G6KH 5EOTB 2HAZA 5D2LA 3WFCL 3TO4A 3TNNB 4EBQH 4RFEA 5F7FA 5F3HB 3DGGB 4Q9CA 3L3IA 3UTTE 4ZFGH 1T5XB 2GSGA 3BESR 1CDJA 5CZVH 4I18B 4PRAA 3V52H 2QQLL 4N8CH 4IOIA 4HG4J 4KJYA 5JIIA 4PRBB 3NAAL 1KIPA 1Q9OA 4OD1H 3R0NA 3MZGB 4AYFA 2AK4D 1T3FB 3LEXA 3EOTL 3IFOA 5E56A 3MACL 3WFBL 3BW9B 3O4OC 4FNLL 2X10A 4KJQD 4PRPE 4H26A 1LP9E 3CX5K 4GAYA 5C0CD 5IHLB 5K9JL 1C12A 8FABB 5KSVB 3KPRB 4YHML 5KZCB 3KYOB 5AUMA 1NMBL 3OKNB 1CF8H 4IHOB 4LIQE 2R15A 4LDOB 1T0MA 4D9QD 1NLDL 4GSDH 5HHXL 2P5WB 5EIIB 4FS0A 3P4NA 1S78C 3UTPD 4KJWD 4JFHD 4NO0B 3CU1A 3BPNC 2JJVA 4WFED 1DBBH 1HCVA 4OZIF 2VDRH 3OKEB 4Q2ZA 3O3AB 1NKRA 2VZTA 5BVJA 3CLFH 5IHZB 1JYWA 3DBXB 4G8GD 3LH2L 5D5ME 2EIZB 5IOPB 5IBUG 4G7VH 1KIUA 5SX4I 3WXVL 3SO5A 3O9WB 1IM3A 2ITCA 5E2WH 1PZ5A 4OF0A 3F7YA 1AIFA 1FN4A 4M48L 5D1QA 5I6XB 1X5KA 1CQYA 4J4PA 4I3SL 3TJHD 1OTUC 3SEPA 5TE7H 4TUJB 1T80A 2WWKT 4M02A 5IMLB 3DV6A 3VFOB 4LASH 4KMQA 5F70A 5C8JB 2DBLH 5K9OA 4NUGH 3DWTA 1Z9LA 1MWAA 1MRCL 4PB9H 1S8DA 1ZXQA 3MLUL 1YJDC 5ERWB 1H5BA 3BH9B 5DK0A 5MP6H 2WMPA 4GW4B 3TA3B 4G80A 4PJHA 5FYKH 3BI9X 4E41B 5EULV 2KBGA 3QDGE 1H3VA 4GAGL 5BZDA 1JPFA 1PYWA 2BVPB 7FABL 4MX7A 2AJYH 3QO1A 3TO4D 5FGCE 2J4WL 1SBSH 1BOYA 2VIRB 4Y4KB 1IGTB 3WO4B 5EBLA 5JW5A 5T3XH 5KOMC 5E6ZA 5FOBA 3D0VA 1NC2B 5E8PB 2AKRB 5L8LB 3OKKB 5A43C 1I1RA 4FXGA 4XPAL 3DIFB 4I2XA 3CK0H 4LCWE 4HJJL 4LSRL 1IGIH 5F88B 2V2WB 5KAQF 4DK6A 4QEGA 3MFFA 4LCIH 3TBYA 5I18H 3TBVA 1QSFE 4MA1C 4NRXB 1CK0H 2AJZA 3STLA 2YWYA 5IF0B 1E0OB 3ARFA 1DBJH 1WF5A 2VXUL 3FRUA 5DJCB 1K8IB 3BDYL 4OFYA 1BFVL 1FZOB 4HWUA 1VPOL 1YNTA 2D7NA 4HWBL 3ARQA 1PKQE 4Q0XL 4GFTB 4H5SA 3WDJA 4LP5A 1KTRL 1A3QA 1D9KA 1W72L 3KDMB 5DRWB 3PGFL 1BQHB 4JY4B 5EOTA 1DUZB 1ZT4B 4B7LA 2CLZA 3TNNA 1HH6A 2X05A 5ALBL 2L4OA 5F3HA 3DGGA 4QXWA 3NIDF 1ES0B 1C16A 4H0HB 4PGJA 1T5XA 2FIKB 4OBSA 1MCWW 2AABL 4WFHD 5GS0H 3UMTA 4ZUSA 4M7KL 4M1GL 1UM5H 5L8JB 1FYTB 1UYWL 4PRBA 4U6HA 3AY4C 3FQTB 1MCOH 5D1QD 4KKBC 1T3FA 5HHPB 1KELH 3S5LA 1XR9B 5I15L 3BW9A 1KJ3L 5BV7L 4NKIL 3O6ML 3VRLE 5LXGH 8FABA 5KSVA 3KYOA 1NGWB 3BO8B 1GGBH 3OKNA 3BPLC 4X4YA 2R56L 4IHOA 1J86A 1VHPA 5FYKE 1MIMH 4FP8H 4WUKL 5I1JH 2P5WA 5FUCE 4QWWD 2EEBA 5F71A 5EOCH 2JELL 3GMMB 3HI5L 3VMOA 5FUOL 4EN3B 4YXHH 2XZAL 2DLTA 1U3HC 4HAGA 3B9KC 1EX0A 3OKEA 5T3XE 3O3AA 2ADGB 3QCVL 5IHZA 2HJFB 3DBXA 1QRKA 2EIZA 4ELMB 3RUGB 1JPGA 3KAAA 3IU3B 3NBNA 1S3KH 1TJHH 4G9FE 3QIBB 5T1LA 2B7DT 1NSNH 4PY8J 2QJDA 2R2EB 4JKMA 4CRPA 4JQXC 4TUJA 4DN3H 3SE3A 3OKDA 4P5TC 5IMLA 5C8JA 4X9HA 3NACL 5GGVL 5JR1L 2IALB 3ARFD 3CD4A 1CLZH 4Y5XC 1TXKA 4ETQA 2AJSL 4OFYD 4DKEH 2UY7A 2K7QA 3C5JB 4XH2B 5H94A 1A5FH 2YA1A 3BH9A 4Z7NF 3GK8H 3M17B 4LSSH 4GW4A 3TA3A 5IQ7L 1D9KD 5JXAH 2C3GA 4E41A 3GJEA 2OI9B 2BVPA 3OR6B 1ZE3C 4DZ8B 5CP3H 3MRGA 4KTDH 3TESA 2H8PB 5IG7B 3MZTA 2VIRA 5IGXL 5F21B 3WN5C 2DAVA 4S1DC 5TPWL 3ARGA 5EZIH 1X5LA 4APQB 1P4IH 2WIIB 5D6DA 3VFGH 1NC2A 2AKRA 3KXFE 3VH8B 5C07E 2HTKC 4ZOBA 2FIRT 3RWDB 2CPCA 4XXCA 2R23A 4GO6B 4YFDB 4TSCH 3DIFA 3UTTB 4F7MB 5IKCA 4G43B 1A7PL 2AJXL 1D5IH 2V2WA 4F9PC 2Z8SA 1IJ9A 1EGJH 3KJ6L 4MA8H 4N9GB 1GGIH 5I1DB 3FO0L 1RU9H 2R4RH 4TYUA 3KPRD 5GGUB 5KZCD 4NRXA 1RHFA 1F5WA 1M6OB 3AXLB 1NEZB 2EIBA 4KK6D 4PRPB 5IF0A 3BKJL 4E42B 2J2ZA 1LP9B 4L9LB 5DJCA 1EK3A 2VDOH 1FZOA 15C8H 2P5WD 2ERJB 1TVBB 3QG6A 3GMRA 3DSNA 2EC9U 2DBJA 2KZWA 2V5SA 4QRQB 5GISH 3KDMA 5DRWA 5EBWA 1BQHA 3KWWA 1AI1H 4JY4A 2JCCE 1DUZA 1ZT4A 4F2MB 1FLRH 2ADFH 4PG2A 3CDFA 1CL7H 3MRJA 2FIKA 3ZE2E 1KOAA 4RISH 1I7UA 4NNPH 4P23C 1OSPL 1TVDA 2OL3H 2VO5A 4XHJC 3FQTA 5D5MB 2HVKB 4BKLB 4UUJB 5HHPA 2MWCA 3MQIA 2HJLA 4N8PA 1XR9A 1ZGLM 4JFFA 1YQ2A 2FGZA 4LBEB 4CU8A 3C5SB 4PR5B 2V7NB 1MPAH 3MCLL 2IPKB 4ZAKC 1NGWA 3BO8A 5JIKA 1I9JL 4CJ1A 4X6DF 4LCYA 2DICA 3VXME 2VKXA 5E70A 3H8NA 4MWFB 3TA3D 3O4LE 5TQ0L 4E41D 5I1KL 1VFUA 3GMMA 4WGWB 5FUZL 3OGOE 1NCDL 1JNHB 1NDGB 3ARVA 4NCC2 5L7XL 4EN3A 2CUIA 4MQSB 4ZUWB 3SJVA 4Z95L 4P46C 3ZE0F 1IAII 1ZANH 3W82A 2ADGA 3QDGB 3P11L 4WNQA 2HJFA 5T5FH 3K1KC 1EEYB 1NC2D 5FGCB 3WLWC 5JOPD 3RUGA 2QR0B 2IFFL 3QCUH 2YK1L 3WCYA 3KLHD 4JN1H 5DMKB 1YNKL 3L5WB 2N4IA 2WBJB 4XMPH 3RRQA 3OB0K 4HWZB 3D1MC 3FT3B 2QQNL 3EYUH 3L9RB 3DHJA 1LK3L 3LV3A 3QIBA 2CJUL 1A7OL 1IQWL 5I73B 2OR7A 2A0LC 5JW3H 2ED8A 5F89B 3N9GL 1N4XH 4WDIB 2R2EA 1ADQH 3QWOA 2FL5A 3P4MB 4OF6A 2H32B 5DD5L 3HE7C 4XCYB 4BYHA 4F9LC 1FJ1A 1QNZH 1KTDB 3C5JA 3PGDB 2D2OA 4XH2A 4YHIA 3HKFA 4PJEA 1EEQA 2ZSVB 2NR6C 4JR9L 4WHYH 3M17A 2WV3A 3TT1H 4JHZA 5GRVK 2CKBH 3CFJB 4PBXA 1PKQB 2Q8BL 4DZ8A 4HDIB 2H8PA 2NQCA 1DBKL 2BRRH 2UWEF 2AJUH 5IG7A 1J0IA 4HZLB 1KTLA 4FFZL 4XC1L 5T33L 4XT1C 5I1HL 2WIIA 1DSFL 3VA2C 1FYTD 5EN2B 2X1XR 4JZJB 3VH8A 3V6BR 1WIOA 3RWDA 4QHNB 5DJYA 3DVGA 4EI6B 3RVWD 1A6AA 1JRHL 4OT1H 3L3DB 4G43A 2FX7H 1ZLSH 2I5YL 1OGAE 2VISB 1IKNC 1IBGL 4JFFD 4ZUUB 3LDBC 4DQOH 3T2OA 4KTEL 1DVFB 4N9GA 5CJOH 3IDNB 4JY5L 2VXQH 3BEVB 1CFBA 5GGUA 1BX2A 3OKOB 4NKQB 4R4BB 5IFAH 1M6OA 1Z9OA 3AXLA 4AK1A 3B2VL 5D8JL 4PRPA 2XQBH 4E42A 2D7TH 5DLML 4BFGA 1TVBA 2FH6A 5GGRY 1MUJB 2NY4C 3CLEH 2AQ3A 4OIIH 5INDB 4RAHA 4WW1A 3AU1B 4U7MA 4WVRA 2ZUWA 3WD5H 4EN3D 1Q1JL 3DX8A 4WTXA 2DQGL 1CWVA 3ABZA 4QRQA 4XNZC 4LLWB 4XRCB 5AD0A 1BWWA 2EKJA 5A40E 5CJ5A 4XMKL 1EDQA 2DS4A 3UAJC 1FG2B 1DBAL 3LIZL 5F9OL 2RGSA 4JY6B 4J1UB 3EFDL 4K94H 4FQ2H 4QOKE 3ZHLA 4J3OC 3GSQB 4U6XA 3MUGA 1A6WH 3OB8A 4NKMB 5K9KB 1A7NL 3CFCL 3EYVB 5D5MA 3K80A 2HVKA 2Z9TA 3QIBD 4GKNB 4LHUG 4UUJA 4BKLA 1HYSD 3WKML 3SGEH 4LBEA 1L7IL 3C5SA 3EBAA 4NZDA 4PR5A 1NGXB 4LSTL 4G9FB 2IPKA 1ACYL 1YQVH 3LQMA 4HFWA 4D0BB 4U1HB 3DURB 2DOCA 1D5ZB 4ZTPL 2R0ZH 5GRUL 1KENL 4HXBH 4MWFA 5T1KA 1MRDH 2FD6L 3K8LA 3ARBA 1U8PA 5B3JF 2GUOB 5DA0B 4GRWF 3VG9C 1IQDB 4G8FB 5DRZB 5MEPB 4EJ1C 4JVWA 1FIEA 3EFFB 1ZSDB 3FFDB 4OM1L 2IG2L 2CSPA 2ZCLH 1LO2L 5B4MD 3TF7C 1V3KA 4APQD 2IC2A 2BFVL 3QDGA 3RGHA 5JW4R 2MPAL 1EEYA 5IB3A 3P30H 1QSEE 2CR3A 5DMKA 5E5RB 4XVSL 3QUML 3L5WA 3VGEA 4GQPH 3UTTD 2QADB 4EQ2A 4DUXA 2WBJA 4XBEH 2WNGA 4HWZA 4L9DA 1FHGA 3FT3A 4HG4K 4X7SL 2I27N 1K3ZA 3KXFB 3KLAA 2HWZL 1M7DB 5I30H 1B0RB 3CVHA 5BQ7B 1CE1L 5CGYD 3AROA 5B38B 2VNCA 5DVOA 2H32A 5HPMA 2VDLH 4PRPD 4XCYA 2YN3A 1DBML 4HC1L 2ID5A 3PGDA 1N5AB 2YMXL 2ZSVA 3L1OH 1VERA 4DUVA 4IIQC 4PJ9A 4NP4L 4GMSH 4I9WE 4WI9A 5D71L 3CFJA 3I6KB 4MD0A 1JWMB 3NIGE 1W8NA 1PKQA 3E2HB 1NEZG 1ZA3A 5F7HA 2AXHA 4HZLA 5DD3L 2DQUL 2PTTA 1MFAL 1SJHB 3ARSA 4JPKH 4DGVH 1I3RB 2JCCB 4MCYB 1QSZA 1G6RH 2M26A 3VFUB 5EN2A 5A16A 4KU1A 1DJSA 2O26U 5DTFB 4D2NA 1MFNA 4J3XA 4EI6A 4WIQA 4X4ME 3L3DA 3RAJL 5ID0B 4ZUUA 1DVFA 1I8LA 1MAKA 3F6IA 4JO2L 1S9VB 3RX5A 1J9CT 1ZLWH 1L0YA 4HF5L 1H3PH 3GSNH 2X4RB 1D5BB 3OKOA 4KAQL 3X12A 3SKNB 2JB5L 3DUSB 4S0SD 4HGMA 2O5YH 4HPOL 1J1OH 2J8UA 1KYOJ 3PWUB 3DO7A 4K7FB 5B8CC 3LS4L 2IMNA 4YUEL 3UTQB 1SYVA 1MUJA 3ARBD 5INDA 3AU1A 5DMGC 3ZHKA 4TOYH 1DN2A 4O51B 3VXMB 4ZFOA 1NCAH 2MCPH 3QHZH 4LCCB 5F1IB 4P9HL 3GSVA 3T0EA 5D96B 1FIGL 4MAUH 5LJYH 2GK2A 5HSFA 3O4LB 2EYTA 3J8F7 4LLWA 5GJSH 3VW3H 3P0VL 2R69L 5D7SH 4GBXC 1EEZB 3QDGD 5FO7B 3DVIA 5HI4D 4F33A 2PYEE 3B43A 3WNOA 1IT9H 2GTZB 4JY6A 1JF6A 3DSFH 4J1UA 2B20A 1UM6L 3VI3E 2WBJD 4NKMA 5K9KA 4I77L 3EYVA 3WHXA 5KVEL 4GKNA 3JUYA 2BNRE 3TWCH 3U0TB 1OAKH 5JQHC 1I4FB 3MJ6A 4LAQH 4JFPB 2OJZL 1NGXA 3RGVA 4PS4L 3H7LA 3MJGX 1U8QB 1FO0B 3BIAX 2ZOLB 2DQCL 1CLYH 2NX5A 1R3IH 3DURA 1D5ZA 4FXKA 3PWPE 5MI0B 3PL6C 3S35H 2MNUA 4MMZC 1XAUA 2EDJA 5CD5C 4PJ9D 5JZ7D 1VFAB 1FL6B 4H0IA 5DUPH 1MVFA 1M1SA 4MDIB 5DRZA 5L2JB 5HGDB 4J23A 4EDWH 5MEPA 4PJAF 3EFFA 3JVGC 3FFDA 5J56B 1OQXA 2PCPB 1IGCL 1BQLH 4Z9KB 1TJGL 4I0CC 2BVTA 5IROC 4QRRE 1DLFH 4W68A 2AVGA 3RZCC 3OG4B 4UIMB 3EYOB 3QR2A 6FABL 2PO6C 3O0RH 3VRJB 3RNQB 3MLWL 5E08L 4NHCL 5KN5B 1RMFL 4O4YL 1S5IL 2OL3B 4OZHF 1DVFD 4NDMB 1EZVX 3SE9L 4J3UA 3JV5A 1B0RA 4HH9B 4MA7H 4O2CB 3BZEB 2H6PB 4Y5YC 2NY3D 2VZ1A 4NZUH 4MXWL 2L7UA 4YFLI 2UUDH 1OGAB 3MGAA 3F6LA 3FZUC 5ALCH 4QTIH 3TVMA 1KCRL 1F90H 1OTSD 4ZXBB 1N5AA 1KXVC 3HI6H 1CXFA 1L9NA 3AM8C 1P69B 3ESVF 3T0ED 1WAAA 3O11A 1S7RB 5FYKD 4JZOA 2J88L 4K9EL 2DD8H 3I6KA 3B5TA 1HDMA 1LO3L 4ZO8A 2GY5A 2N7AA 4FQXC 2ZUVA 4I3RL 3SGJC 3UX9B 3MLVL 4ISVB 3PV7A 3HC3L 4PV9B 1WCBB 3V2AR 1SJHA 5T3XD 1I3RA 1OB1B 2JCCA 3GDBA 4MCYA 2W9DL 1KPRA 5FCUL 4HJ0D 2VDKL 4RA0C 4MS8D 3DMMA 1BP3B 4P2YA 5DTFA 3X14B 2YUVA 4YHLL 3D85B 1HXMB 1VDGA 3L5IA 1CFQA 3JWOL 4QOKB 3P4LA 4HK3J 4U1IB 3SDDC 1NPUA 4M1DL 4FQLH 3UC0L 1MHCB 3S3PA 3QDHA 4G9FD 4XB7A 5F96L 1IE5A 3UYOD 2X4RA 1D5BA 1N0XH 3DUSA 3ELAT 1E4WH 5JXEC 3REVA 2XZCH 1ZGLB 3I6LE 1F6AB 2A73A 5IWLC 4LCUA 4K7FA 5D72H 5FO9B 5F1SA 1ZVSB 3P9WB 1NJ9B 4XVUC 3HC4H 1BGXH 1KCVH 3MV9A 5JMOC 1A3LL 5EZLB 3CX2A 4LCCA 4OUUB 3RX8A 5F1IA 4G6AC 3VFTB 5M95B 4DAGH 2CKBB 4N9OB 4X8JA 3OAYH 5FEBA 5AYUL 1EEZA 5BO1L 5FO7A 3B2UD 2D0HA 4U0QB 1EJ6A 2XZQL 2AQ2A 5GS0D 3MCKB 3PXJA 2OXHA 2EO1A 2FJFB 3RL1A 2QADD 5EPMA 3TJEL 4WEBH 1S7VB 3QULB 4X9IA 1CVRA 5I8EA 1QSEB 4NQVA 3RL2A 3EO9L 4D3CL 3U0TA 5LBSH 4HUUB 2C9AA 5J1SC 1FVCB 5FM8A 4IOFC 4OCNC 4NWUH 5MENA 2XYCA 1SYSB 1CD1B 1EAJA 1JNJA 3TVMD 3EW3B 1U8QA 1FO0A 2ZOLA 1JTPA 1A47A 3IF1B 3SDAC 3ULUF 4KK5D 1MRFL 4JN2B 1VFAA 3BIBX 4HMDA 1EIBA 5B38G 3D6GA 1T7WA 5AYQA 1WFUA 5HGDA 2VH5L 4HUNB 4NRYB 1FPTH 2PCPA 5HDBF 2ZNWA 1TIUA 4I13B 4XX1E 4ZMAT 5EUOE 1JBJA 4Y8AA 4UIMA 3EYOA 4PREB 3VRJA 3RNQA 4QRTB 1MCSA 3HZKB 5KN5A 1IC4H 1QTYT 1N6QH 1N64H 3DROA 3HCVA 1GL4B 3FT4B 2GI7A 5DJXA 2EXYC 3IDYB 5EU3B 4HH9A 4O2CA 3C9NA 3HR5A 3GKZA 4IRSB 3GEWB 1OGAA 2DB8A 4U6VH 1U95B 2R9HD 4WI4A 2VKWA 1N26A 3U4EB 1JHKL 3QIWC 3OKYA 4PJBE 4QYOB 1JGLL 4OFKA 4ZXBA 3DX7B 3ARTA 4PGEB 3VXPA 1N6UA 2J1KA 3VXMD 1NAMB 3EIFA 4NM4H 4ORGB 3DX6B 1I1CA 3LKSB 2VLKE 3O4LD 3KR3H 1JZ6A 4Q9RH 4JVUA 2D03H 4ISVA 4YZFF 4ONFL 1JRHI 4GXUN 4OLZH 1BFOB 2CRYA 2FGWL 5DDHA 4EKXA 1NCWL 4OZFA 4JEGB 1BLNB 1OB1A 5CFHA 3K2MC 4GG6A 5CJXA 4HV8A 4PRNB 2OSLA 2PYEB 5LGKA 1P6AB 1FRGL 3X14A 2F5BL 2HT3D 3WNLA 3D85A 1W8OA 2OX5A 2HTLC 3WV0A 1MLBA 2DM7A 3I3BA 3SQOH 2A6JB 4QOKA 3KPLA 5JHDE 1YMHB 2X70B 4U1IA 1W2KT 3B9VA 3Q1SL 1UB5B 2HKHH 4N5UA 1MHCA 4JDZA 2R0KH 5BS0A 3WYRA 2COQA 4Z8FL 3P9LA 4PRDB 2BNRB 2HKFL 3SHSA 5EWIL 5FM4A 3QUXB 4JPIB 1CBVL 4PJ5B 1YYLL 1ZGLA 1F6AA 4UT9L 2IPUK 2X9YA 4PJ7F 4IJ3C 5ENWA 1SVZA 4IOSD 3QPXH 3MOBL 3CMGA 1PG7L 1T66D 5DD6B 1AGDA 1RK0B 1ZVSA 3QQ9D 3T4AB 3A67H 3ZL4L 1NJ9A 1JZ5A 4LRNH 4EEEA 1A4KB 4NFBA 5A2LH 4OUUA 5TFSL 4HUVB 3PWPB 1BZ7B 1TNNA 3HS0A 2DL9A 4KZDL 4UU9B 2VLLB 1D5XB 4YE4H 4WEUD 4ZTOL 3MCKA 3JUZA 4QRRB 2FJFA 4WJ5A 1RZIB 2XI9A 4BFBD 1G6RB 4D9LH 2NY2C 3FO1B 1MAMH 2OR9H 1QSEA 3TN0C 1WEJL 4H88H 3RQ3A 3E6FB 3PGCB 3LMJH 1N8ZB 1UZ6E 1OGAD 1FVCA 4KI5E 3RWHA 2YPVL 1SYSA 1CD1A 1XMWA 1BVKB 3NFNB 2JJSA 3STZB 1OAXL 4ZXBD 3IF1A 5FXCH 1AJ7H 1VEOA 2J6EL 5GGVY 2CKNA 4P57A 4WW2C 4X80H 4H8WL 3IAQA 4JN2A 4J3SA 1I8IA 5F9AC 3N1GC 1IGYB 3T77B 1U42A 1FSKB 5HYFA 1YJDH 2XKUA 3FN9A 2ED9A 3BP4B 1J8HE 1G6VK 3H9ZA 5E9DA 3VXTA 3ZE1E 1E6JH 2Y5EA 1NCTA 2Y36L 4OCWL 4P3WA 1T89A 5CEZH 4UNUA 3C2AH 4KMTH 3QDJE 4I3GA 4C58B 1KEGL 3D85D 1G1YA 1ZHKB 3HZKA 4FFYL 4QOKD 3G5VA 3ZYJA 1OHQA 3FT4A 4XWOD 2P5EE 3OJMB 3QA3B 4M3JA 4XPFH 4TQEL 3MRLB 1A02N 5DQDL 4C54A 4HS8H 5EU3A 3GMLB 3MGOB 4BM7A 5BS0D 1IC7L 1IFHL 4IRSA 1ZLUK 4X4MA 2OR8A 5CIPB 3VWKB 5AZEL 2DDQL 1U95A 4Z7VB 3V0WH 3C5ZB 1KEML 3P77B 4L5FH 5ID1A 4QYOA 5GRVL 3DX7A 1T7YA 1X44A 1TTGA 3MRHA 5EZJB 2HJKB 4GXVL 2DTSA 4JVPA 4NJAH 4PGEA 1NAMA 5DA4A 4MNQE 5ESVB 3TH3T 4ORGA 3S36H 1RZJL 2DQIH 4NO5B 4TSAL 3TBTB 4OZ4B 2ADIB 2CGRH 2Q7YA 3HAEA 3P0YL 3BKML 2EE3A 2VDML 2R2CA 4YAQB 4XC3H 1BFOA 1RSFA 3HI1B 4PJ8A 2CLRB 4Z7QE 1A6ZA 1CQKA 5IFJA 3DRTB 4WHYG 5AAMA 1HSAB 3WFCH 2PYEA 4HLZH 4TNWK 1QSED 4Y8DC 4M8VA 5DRNB 2Q8AL 3TYFA 1A21A 1F2XK 3KHOA 1QQDB 4UBDD 2X70A 2Z8WC 2QQLH 3BP7A 3U83A 1UB5A 2DI7A 4PJCE 4M5ZL 5L0QB 2ZG3A 3NAAH 2ICEB 1QOKA 4N0CD 3GHBL 3QCTH 4PRDA 3OBAA 2FBJL 4JPIA 4PJ5A 3CFEB 1FLTX 5DEFB 1RV6X 4FNLH 2OS7A 2XG5A 1L0XA 3WIFA 1Y6NR 5JOFB 3EHBC 3SKJL 1O5DT 3DYOA 4NZJA 1RK0A 4OF3A 4U33A 4EQ3A 2P8LA 5K9JH 3IDIB 4YHMH 3RWEB 4AENB 4IMKA 1A4KA 4H20L 1K85A 1QFWL 4HUVA 1RJCA 3SQBA 1NMCC 1BZ7A 2YSSA 4N1EA 5HHXH 1CGWA 1JWSB 4LLMA 4I9WD 1RZKC 1OOAA 4UU9A 2VLLA 2BY1A 1D5XA 4YIQB 4KRMB 1T1WB 2IH1B 3ZKSD 5I8OL 1RZIA 5EUOB 3RWFB 2DM2A 5A3ID 4AQOA 1Q94B 3QEGL 3SDYL 1QPXA 1AC6A 3S96B 1CN4A 5D7LA 1WITA 5JPNB 1RZ7L 4IRSD 4JKLA 3PGCA 4DEPC 3WXVH 5EB9A 1RUMH 4HAFA 4QGTA 1IGMH 2VZVA 4QRSB 4DUWA 3MLZL 4Z5RA 1BVKA 1ZK9A 4KJPD 3NFNA 5EU5B 3STZA 3ZO0A 4MZ2A 1RZ8B 4DGYL 5ICZB 2EZ0D 4XPGH 3ARWA 4X0KB 2EKSB 1IRAY 4FQ1H 4LPCA 3B8SA 4PV8B 4JHWL 4O00A 4BFIA 2JJUA 4AT6B 4RFNC 4PJBB 1QG3A 2VLJE 2FZ3A 4PJFB 1IGYA 1MRCH 3T77A 3S35X 3BP4A 3C09B 5HGHA 2BHZA 4S1RL 2VLKB 4PJ8D 5J12C 3K46A 1G7QB 4F37K 4GAGH 5ISZA 3SDCC 1H9VA 4G42B 3K4DA 2PYED 3BXNA 1ZHKA 2BHYA 3PDDA 3S7GA 3JWDL 4QT5B 2WUCH 5LKNA 3CCHB 1F4AA 1MJUH 4HJGB 2F19L 4QY8B 4OGAC 3QA3A 3MRLA 4QHMB 5AZ2H 3GMLA 3MGOA 2BNRD 1OAUL 4TVSa 4X7DC 2XY2A 1QZ1A 3FKUS 5CIPA 3VWKA 3CH1B 4PJ5D 4XPAH 4RBPK 4KGLA 4Z7VA 4LSRH 5JHDB 4L3EE 3C5ZA 4HX1B 4OCRH 4I5BB 2OBGA 3P77A 4I8DA 4UV7H 4ONGH 2NXZB 2HG5B 3DYMA 2HJKA 1HNGA 2QQKH 1EO8L 4TNWF 5I8KL 2R0LL 4P59L 4N5ED 1ERNA 5J9PB 3AB0B 3V6FB 4L4VA 5ESVA 1MSPA 3LN5B 3PWPD 4M43H 4NO5A 1BFVH 3TBTA 4OZ4A 4PTTB 2LVCA 4JFEE 1JHLL 1FGNL 1G9EA 5D2LF 1T6WA 5J6GA 3Q5YA 4R2GC 3GSXA 1W72H 3O2VH 4M8QB 4PP1C 3T0VA 1OW0C 3DRTA 3PGFH 4RDQG 1HSAA 2R1XA 1TLKA 2YXMA 4OV5A 2JJTC 3MOAL 3G9AB 4HC1A 5EOQL 4QLRA 2R0WL 4XP6H 4GMTL 2OQJB 5D7LD 4P2RE 2Z93B 1KF9B 4Q9QL 1PY4A 5FK9B 1J5OH 2AABH 4XWGH 4JG1L 2VAAA 1AFVH 4QCIB 2OZ4A 4M7KH 3S5LG 1GZQB 5D7IA 2DWEA 3R4DA 2HN7B 5IMKB 3S9DB 3KPQA 2QBWA 1DE4B 2ICEA 5JO5B 4XXDB 2AEPL 3CFEA 3WUZA 1YEDA 5I15H 4YXLL 5HVHB 3CFKB 5ECJE 4JQVA 4LVOC 5JOFA 5IESL 2I24N 1NBZB 1DZBA 3K0WA 4AEIL 4BH8A 3HMWH 4NKIH 1CGVA 4OLYL 4FG6D 3CMOL 3IDIA 1NAKL 4AENA 4TTDC 2CIKB 3U0WL 1ZVHA 4P5KB 1RK1B 1I8KB 2P8PB 3HRZA 4FQJL 2OTUB 4WUKH 3C60B 1OARL 3KPMB 1C1EL 3HI5H 4ONHA 4D9RE 1A0QL 1N0LA 5FUOH 3RBGA 1T1WA 3DRQB 2CRMA 1J8HB 1JN6B 2MSPA 2XZAH 2Y25A 2Z31C 3D25B 2APFA 3RWFA 5EOCJ 4GUPA 1Q94A 3QCVH 3ME0A 1AH1A 2RIKA 3S96A 5SWSE 2VDQH 4C56E 3S3SA 4KQ4H 4PGBB 4YH6A 3SDXE 5ACLA 5GRYA 3SN6N 1UJTA 5IFHL 2XA3A 1KN4H 3KYKH 4M00A 4P5MB 3VWKD 3OPZL 4UMGA 3C5ZD 4KMLB 5EU5A 4F37F 4MQ7B 1RZ8A 5ICZA 3JSSA 3Q6GL 3PDOB 4M93C 3O4OB 3LB6C 2EKSA 1KB5A 1YPZE 4PV8A 2IADA 5T5NG 2LAGB 3WE6B 3I6LD 2EDYA 5GRXG 4L4VD 3IU4L 3S6CA 4URTB 5GGVH 4AT6A 5JR1H 1C8PA 2FB4H 2A1WH 2W9EL 3FHAA 3SKOB 4PJFA 3BIKA 4PJHF 1SHMA 3R06B 3RVXC 3VWJC 4MJ6B 5C0GA 1KIQB 4UV4L 3VRIA 1MJ7L 4HHAB 3QUKB 1DQLL 1T20A 4NN7C 4NC2B 4MNQB 4PJGE 3ULUL 3C8KB 4P0DA 5CKAA 3QQ4B 3QG7L 4G42A 4G6JL 4WY7L 3BPNB 1ZEAL 3HUJE 4S10A 5IW1B 4WI5A 4L29B 3DI2B 4MXVE 1OTTC 5FFLA 5IGXH 3I3EA 4P9MH 5TPWH 4KHXL 4CJ0A 4HJGA 4EZMA 2APXA 4UILL 1INEL 1A1NB 4LLUB 4XPHL 5LG1A 3CH1A 1IM9A 1A7PH 2AJXH 5JHDA 3QZWB 2C7UB 3RPIA 5EDXA 1A4JB 4I5BA 1T04B 1QP1A 3KJ6H 4PJCB 5HPOA 1JYXA 1YEGL 2HG5A 3FO0H 5IEKB 1S7SB 4MSWA 4X5LA 1P1ZA 1NCCL 4B53A 3JV6B 3T4YB 3V6FA 1X4XA 3BKJH 3LN5A 1MOEA 1H3GA 1S9YB 2B4CL 4ODUB 5CEYA 3GSUB 2AV7B 3QQ3B 3TFKC 3RWGA 4KVNL 3W9EA 1A14L 1X4YA 3MNWA 4P2OA 5AWNL 3UBXI 1OAYH 3BUTA 1FBIL 4Y4HC 4N0FB 2EXWD 1J0KA 3MA9H 2JTDA 2G2RA 2X6MA 5IHUL 1PLGL 2A6DB 3DV4B 2EECA 2OQJA 3WKNA 3BT2L 2QSVA 4L9LC 2X09A 1CZ8H 5HTSA 5FK9A 4C55A 3SE8L 3MLSH 4M1CC 4WWID 1I3VA 3O3BA 1CLOL 1GZQA 4GLRI 3CUPB 3VJ6A 1OSPH 3A6OA 2PTUA 1DE4A 1EUUA 4XXDA 1MCEA 4R4FH 2X44D 1OL0A 1R3JB 5C7XL 3T3PF 1NFDE 3ZKND 3W11D 2GTWB 1J11A 1NBZA 5FGBC 1PX4A 4U1MB 3MSPA 2P46B 4MA1B 1C7TA 4ELKB 1OWRM 3HE6C 1ND0B 5F9WC 2CIKA 3RIFK 5CSGA 5C0NC 2ZZUT 3PWNB 4P5KA 3V5KB 1FFRA 1JPTH 5IB5B 1SEQH 1I8KA 2P8PA 4UTAH 4Y7MA 1E4KA 1CDYA 4MJ5A 2OTUA 3C60A 3VD3A 2VLKD 2VLJB 5KSAC 5I2IB 5I1KH 1KT2A 1OP3K 1X5AA 5L7XH 4JO1L 4XNUL 1J8HA 2UZYB 4Z95H 1AGCB 1RY7B 4YXKL 1V7MH 4RWYH 3S4SG 2EDRA 5E8NA 2BNUB 2ICES 1LO0L 1WVZA 2GY7B 1DR9A 3LKRA 4PGBA 1NBVH 2IFFH 1JF5A 3BGMB 1YNKH 4OGXL 1MAJA 2NCMA 2EDEA 4P5MA 3MYJB 2OP4L 2Y6SD 1IM9D 2YA2A 3IDGB 4A6YL 5JHDD 4HUXB 3D3VA 5J1TC 4AIOA 4RFOH 4MQ7A 2CJUH 1A7OH 2OK0L 3PDOA 3LPWA 5FDWB 3VGGA 3MV11 2GJJA 2I60L 4KKCC 2XACC 2X1PA 3WE6A 4YPGB 4U1KA 4L3EB 2R29H 1QLFB 3SKOA 4ZPVA 3X11B 2F9BT 3BPLB 4MJ6A 5E5MB 3QUKA 4LFHD 4MNQA 3QPQD 4JZNB 2H26B 4WUUE 4LPUA 1XCQA 1V7NL 4XVJH 4JFEB 3GBNL 4MHHG 1U8MB 5IW1A 1FVEA 1UWEH 1DBKH 1U3HB 4XAWH 4TULH 3B9KB 3UYPA 5C9KA 4BSWB 1A1OB 43C9B 1G9NL 2H9GA 5T33H 1QA9B 5I1HH 4ZUVB 1DSFH 1KLUB 4AJ0A 2YPLA 3TPKA 2O5XL 4JM2C 1RJYA 3QWQB 2ZG2A 4OI9A 4P2RB 5JUEL 3TBWB 3WFHB 4LLUA 1B0GA 4K8RC 3V95A 2CO7B 2I5YH 5E6YA 4HIXH 1YEJL 1YMMA 1IBGH 4B50A 4NFCA 1A4JA 1T04A 4PJCA 4KTEH 5C09E 2YUZA 4EIGB 5IEKA 12E8L 2D7MA 4JY5H 1S7SA 1UWGL 4HIIA 2Z35B 4L3AA 4PLKC 1IC1A 3JV6A 4K7PL 4WTZA 5CZXD 3LS5L 5KOVC 4P5TB 3B2VH 3DXAE 5F7EL 5D8JH 4Y5XB 5CP7A 3C8DA 2NY5L 3JTSB 1S9YA 5DLMH 3C60D 3BKYL 2LAAA 3GSUA 2AV7A 3QQ3A 5D7JC 4LRIA 3S36X 1K3IA 4J8RB 1Q1JH 1FAKT 4U7SA 1UH2A 1J8HD 2DQGH 3EYSL 1EHNA 2R2HB 5GGQL 4N0FA 5F3BA 3GB7B 4W81A 4XMKH 4Y16A 5DC0A 3ULVD 2A6DA 3DV4A 1NGYB 3LIZH 5F9OH 3WN5B 1I7TA 2FEEL 5F44A 1FH5H 1MCKA 5DR5L 3MA7A 2ESVA 1HKLH 4PTUB 1F42A 1A7NH 4R6UA 4X5WB 3MJ8B 1MEXL 3CFCH 3HMXA 2EIDA 5SWSB 4C56B 5FIEA 3SDXB 1X5HA 1XGQB 1R5VB 2CUHA 1MF2L 4NQXB 1UFUA 2P7TB 5EO1B 2GTWA 3VXUE 5EORL 1MNUL 3PV6B 5HHNB 4U1MA 4KH2A 4X6EB 1RI8A 4POZC 1ACYH 4JDVB 4JAMB 1O0VA 2D31B 1QHPA 1YPZB 4HMEA 3V5KA 2A6IA 4ZTPH 2EYRB 3WS6C 3U48A 1KENH 4MNQD 3GRWL 3UBXA 2JK5B 3VCLA 4M4PA 1S78D 4NZTH 1F6FB 2YD5A 4OM0L 1KACB 1W72B 2NNAB 4OM1H 2IG2H 5AEAA 3RUGF 1FNGB 5IBLC 4LSPH 1F11B 3F7VB 1CG9B 1X5IA 2BFVH 4ENEC 5CSBA 2BNUA 2F5AL 3HUJB 3BOVA 2YPLD 5ITBH 4Z6AT 2FCBA 4NN5C 1Q9KA 5IMOB 1JGVH 3BGMA 1PJ9A 1YECL 4P23B 3MYJA 5E24E 4CKVX 4HUXA 2VERN 5DUBB 3AY4A 3T0XA 1P4BL 2XNAB 4X7SH 1R3KB 3D39A 3VI4F 2HWZH 1E4XL 1OTUD 1UQSA 4GS7C 1XIWC 5FDWA 1DTUA 3MLXH 4FFWC 1CR9L 4PJEF 4YPGA 4GAJL 5DFVC 3O2WL 3GJFH 4YHZH 5HGAB 4ZAKB 4HBCL 3WNMA 3X11A 3GI8L 2L7JA 5HBBA 4X6BB 3JTTB 3P40A 1BFSA 5KSUB 2F74A 3QZWG 2H3NB 5D2NC 4BK4A 2GITB 1I3UA 1G0XA 4NP4H 2H26A 3DOSA 4BH7B 3HFML 5D71H 4E0RB 4EXPX 5GZNC 1DQDL 5CLTA 1N2RB 5J13C 3E8UL 4OGYH 1U8MA 2LE9A 5F9JB 2NXYC 2YPKB 4P46B 3RVTC 2VABB 4Z7WE 4Y0GA 4NNXA 3U46B 1A1OA 43C9A 3EO1B 2BSTB 1EJOL 2DQUH 2NY6C 4ODBD 2ESVD 5E99H 1WWCA 5KVMC 2PR4L 5E00B 4ZQKB 1EFQA 5I1EL 2WK2A 1AE6H 4XHQA 3TBWA 3UTSE 1TENA 4Y1AE 4LSDA 4AZ8A 1UCBL 2NLJA 3F12B 3RAJH 2V2XB 3SCMC 1KGCE 2R4SL 2P24B 4QXGL 4JKPL 5T1MB 5GGSY 5TE6H 4WHDA 3HNVL 4HF5H 4CVXB 4MAYA 4S0TD 5DJ6B 2UY6A 2Z35A 5K9QI 4KAQH 5JLZA 1YY9C 2JB5H 1NFDB 4P5TA 4HPOH 2ZSWB 2BMKB 4Y5XA 4EIZC 3D69B 1NGPL 3JTSA 3LS4H 4NYLB 2FR4A 4YUEH 4CUCA 1R24B 4G7YH 1JGEB 3IFLL 2AJVL 5GQBA 1M4KA 4MB4A 5KJRL 3MV01 1OGTB 1LO5B 3LEVH 4P9HH 4KFZC 3MXWL 5L9DL 1FIGH 1JV5B 2D4DA 5ESQB 4KDVA 4RGMC 4OD3L 5INCB 2R69H 4U1GC 3GB7A 4BSJA 3W81A 4JG0H 4JLRA 4HGKC 1NGYA 4RQQA 4ZS7L 5D5MF 4NBZB 4OZIE 1UM6H 2P4AB 4PTUA 3BKCL 1X9QA 1DEEB 4R0LA 4X5WA 4AL8H 3MJ8A 2DQDL 4I77H 5SV4A 4DVBB 1FZKA 5SWSA 4KKBD 2E9WA 3EYFB 1XGQA 1R5VA 1QACA 2P7TA 4F9PA 4XPTL 2C4FT 4L3ED 5HHNA 4X6EA 2OJZH 4RMUA 5E2VL 4PS4H 3IJYB 3CXHJ 2G75A 3EJJX 4JDVA 1KNOB 4JAMA 2DQCH 4YBQC 2D31A 1GOFA 5T1DL 5KSBE 2FATH 1YPZA 5FV2A 3ALWA 4NIKB 2EYRA 4LPYA 5C3TA 5KVFH 2JK5A 2YUWA 3X3FL 2NY4B 2LABA 3NTCL 3VE0A 3BDBA 5IM7A 2YRPA 3CH8A 4JFED 3L5HA 5E8DL 3U7AA 1URLA 3DPBA 4XNZB 3CJJA 1U3HD 2LU3A 4NO2A 1HHKA 1CXKA 1IGCH 3B9KD 1FNGA 1F45A 1F11A 4WUUB 3NZ8B 3F7VA 2XTLA 4PBVC 2BNQE 2IWGA 4ODHL 6FABH 1YY8B 4OF8A 2LU4A 1P9MC 4TVPH 5IMOA 4P2RD 4RMSA 4DK3A 5E08H 4NHCH 1U6AL 4YQXH 1I1AC 1JZ2A 1RMFH 2DJSA 1T2JA 1WBXA 4X98B 2XNAA 1Q8MA 5IVZB 1K2DA 1XF3B 5IT2L 4RCAA 3SE9H 4YHNB 1AXTL 4IS6A 4XNXL 4MAYD 3MREB 4CDHA 1H0DA 2G60L 1GOGA 1F4YH 1ROWA 4GRLA 3GUTB 4P5TD 5FKPA 5C09B 5HGAA 4K3HA 1KCRH 1I7RB 2FJGB 1ZTXH 3DUUA 1LE5B 1IGFL 4X6BA 3JTTA