4LBEA

Structure of kcsa with r122a mutation
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein, membrane protein
molecule keywords Fab light chain
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lbeA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lbeA02
1E4JA 3AU1A 1MFBL 3NFNB 4M1CD 4LAJH 1NSNH 5GJTL 1EBPA 1AXTH 2AJVH 4JN1L 3O3UN 4Y5VB 1RPQA 2APFA 5F3BB 3PHQA 2O93L 3Q0HA 5EC1B 2FEDD 4X9BA 4AK1A 3QCTL 4D0BB 1RZ8B 2R4SH 1CDUA 3R1GL 4KAQH 4LCUB 2YSSB 4G42B 4I1NB 3D39B 5JIIA 4XVSL 2VDNL 1Q9LB 4PJ9B 4NQTA 3EDEA 1DQQB 1QHPA 4ZO6A 5T1KB 5E0QA 4ODTH 5F8QC 3LKRB 1IAIL 2A2QT 3NPSB 2PW2A 1QFHA 5IG7A 5EU6A 3BH8B 2QADC 4MVBC 2Q1EA 1HNGA 4XCYB 1B0RB 4YHPB 4K23L 4FQPA 2JJSC 1E4XI 3QRGL 3S6CA 4Z77B 4NNYA 3RWJA 1MSPA 5EO1B 4D2NA 1I1YB 1R6VA 2AEQH 5JNYB 3P2TA 4K8RL 3MJ9H 4H1LA 5FB8A 2FIKA 1TTFA 1NAKL 2B1AH 4NO0B 4GQ9H 4ONHB 1OTSC 4M1DL 5KSBF 5M94B 1LK3L 2E5EA 5D8JH 5ESQB 3VWJA 2HLAA 4LRIA 2ADJA 3QXAA 5DFVC 4GW1A 1EEZB 5T1DH 1AH1A 2DQJL 4J6RL 4K9EL 1YY9C 4H25A 5KG9A 4D8PA 1XIWC 2AEWA 3B9EA 3LS5H 4ZFGL 1W0WB 1V05A 3OMZA 4JO2L 1XZ0B 5CJBA 4YFDB 5B39G 3FO2B 1KCUL 3NA9L 4NC0B 3VRIB 4UINH 5GGQH 4JRYE 2DBJA 3K0WA 5HDBE 4NFCA 4DN4L 5I1GH 4JFPA 5C0DA 3CFDB 3OL2A 3OHXB 1LP9A 1NFDE 4R7DB 4U1HB 4XWOC 2KL6A 1U8JB 4CVWA 1S5HA 4XPFL 4HWNA 1SY6H 5F1IB 1OAUL 4KMLB 4ZUSB 1EAPA 1HDMA 2GJZA 1X5GA 4Y8AA 4KK5C 4MHHG 4U1IB 5D96B 1J87A 5T3ZD 5MEQB 1T1XA 1JL8A 3I2CH 1G9NC 2OP4L 1LK2B 1P9MA 5E7BA 4XMLH 1MLCA 4ENED 1WAAF 3HZYA 4UNVA 1T4KB 1D6VL 4L4VE 4I13B 2R15A 2WBJD 4S1DC 1C08A 3WHXA 2Q6WA 4KQ4L 4HC1H 5LWYH 1UJ3B 5ITBL 1NCTA 4HFWA 4JCLA 4DQOH 4PGCA 1UZ8A 3MRRA 1I3UA 4XP4L 1MF2L 5F72S 3G6AA 1BAFH 4Y5YB 2OL3H 3JTSB 4J3XA 1LEGB 5HYSA 1N3NB 1V3KA 1T04A 3KLHC 2CUHA 15C8H 4DKEH 2AV7A 1MPAH 1T21B 4U1JA 5IV2A 5ERWB 1N59B 2X2YA 1JF1B 4XCCL 4PJDA 1GYAA 1T1WA 1CQYA 2BDNH 2PCPA 5IQ7H 3ELAT 5BZWB 2XG5A 1K8DB 2AEPL 4NYLA 2ATKB 1M7IA 4RGNE 3L3JA 4Y4KB 3T65B 5DJ8A 4Z7UE 3TZVA 5HVWA 2O5ZL 1BM3L 4JRYB 3QI9D 1HHKB 4FXKB 4YNYB 1KTDB 3BWUC 4JM2D 2NY6B 2FR4A 1NFDB 2IPTL 4O2FB 5DD1L 4ERSH 4HIJA 3LKQA 1EEYB 1RHHA 3U30B 4Q9QL 1WLHA 1AXIB 2E6QA 5E00B 3WEXB 1QACA 1S9XB 3BGAA 1CBVH 2AK4D 1WQVT 2BRQA 3IDIA 3ZL4H 1DJSA 1QZ1A 4FZ8H 4KGLA 1YC7A 4AH2A 2CDGA 2ZCLH 2HYMA 4U31A 5FDYA 1UEYA 1SHMA 1H8OA 4JFOB 5J12B 3MV7A 1JGUH 2C4FU 5DEZA 4ODSL 4L4VB 2ZUYA 1T7WA 2YA0A 5DR5L 5D2NC 1XH3B 4TVPE 3GBNH 1T6WA 5E6IA 3A6CL 4L3CB 3G08A 3DBXB 3S4SB 3NFSH 3S36X 5C0CD 3VI3F 1VEMA 1R3LA 3MRDB 4O4YH 2J8UE 3RIFK 1J05A 2R69L 4PFEA 1JPSL 3SJVD 4OZHF 1U8KB 3TV3H 4JVUA 5TE4L 4YFLF 5EIIA 3MRQB 4P5TD 5D7LD 4WV1C 1T22A 2W9EL 3S5LG 1MLBA 4ZNEE 1A7NH 4RGNB 1NGXB 2XKUA 3GFUA 3MBEB 3F7RA 4Z7UB 5DUBB 1P53A 1FL3B 5DVMA 1K3IA 5GRVL 1OAKH 1WFTA 2EE3A 2YEZB 1SMAA 4QHMA 1JYXA 4NQVA 2E6JA 1X5AA 4XCEA 1AQDB 4YHNA 4GXVL 1RUQH 5IT2L 4Y16B 1B90A 3GB7B 5KVGH 4JPVL 4YR6B 5GRJL 3SDXE 1PLGH 1HH9B 4CRPA 1NEZG 1UM6L 1UVQB 1A0QH 3H0TA 2R0KH 4JJHA 4RFEA 2ICEA 1XGRA 3GJEA 4Z76B 2OZ4H 4LSRH 3HUJA 2MNUA 4HD9A 2DYPB 2RFXA 2VR4A 1S7TA 2HFEB 4JLRB 4EN3C 5IWLA 3EYQC 1MRDH 3QP3A 4MNHB 4HJGA 3H3BC 2NLJB 3MGTB 4N90D 3W2DH 5C0RH 1L0YA 1S5IH 1NMCC 1OHQA 1BQHB 4NOFA 3OKDA 1WWAX 5FO7B 4CADA 5DUML 1VGEH 4GRLC 1F00I 3GSVA 4LKXB 4DVRH 4BUGA 2J8UB 4RFOL 1U58A 2VB5A 1ULVA 4KI5F 4C4KT 25C8H 3OXSB 1CDJA 5B22A 1T03H 4IRSB 4FQIL 4LVNC 5BQ7B 2HT2D 5L9DH 2HN7A 4NZTL 4X7DC 3G5XB 4YHML 5TJWK 3SN6N 3HAEH 4P2CG 1IKFL 1WTGT 4J8RB 4NQCE 5F7FA 4K3EH 3K4DA 3MRKB 3DARA 4KK9D 1E6JL 1L7TH 1ZVSB 5JW4Q 3B2UD 5FKPB 2BNQA 1FFOB 5GGVY 2JCCE 2YUWA 4D3CH 2GSIB 2NY5H 4G7VL 2YPLA 3FRPG 3O9WC 4HIXL 3QG7H 3TA3B 7FABH 3DTXA 4H0GA 1OB1A 2IG2H 3ZO0A 2I07B 5HVGB 5KVFL 4HK0B 1FVDB 1IM9D 5DEGB 3RVWC 2MPAH 4J3TA 3O6FB 1DLHA 4LSPL 3SDXB 4MLSA 3U46A 1NUNB 2CKBL 4HUNB 4X80L 5C86A 3MGOB 2ZP0T 4RGMC 3QPQD 4XBPA 3WSQL 1LWRA 1ZGLP 3KPTA 1K85A 5KW9H 4B7LA 5KSUA 7CGTA 5JHLL 2DQHH 3GSWA 1MWAH 5LQBH 5HTSA 1N7MH 4HX1B 1ADQA 1HHHB 3QXVA 5DO2C 1S9KC 4OLYL 4YHLL 4YHIA 2WWKT 2V2WB 3UTTE 1SJEB 3IJYA 3NBNA 4HZLA 4HUVA 4NUJA 1AIFB 2VC2L 3DYPA 4NC1E 3ULVE 3MODL 4B41A 1A1NA 4QXGH 3G6DL 3GSUA 1UZ6F 2ITCA 1QPXA 1RZIA 4MB3A 3MRNA 4WGVB 1AY1L 1U8IA 5ALBL 1WZMA 4OLXH 4URTB 3V0VB 2D2OA 4C56E 1K4CA 4L4JA 4XPHH 2DI9A 3ZHKA 4PRAA 1I4FA 4D9RD 3FB8B 2M1KA 1XF5A 1NCWH 3EJYC 4LSQH 4Y2DB 4U1LA 4NO0D 4HUMB 4LCWE 1A7QL 5IMLB 2JCCB 5SX5K 1JGLH 3S3JA 1J1OH 5INDB 4PGDA 3H9SE 4I77L 2OMBA 1DQTA 1T2JA 3QJHB 3IJHA 1QSVA 4N9GA 1UKSA 2V17H 4OFIA 2VR5A 3OZ9L 1ZT4B 1DTUA 1TITA 3CU1A 5C09A 1EMTL 1UWXK 4NUGL 4LLUA 2BHUA 3L3GB 4KC3B 5DYOB 3E0GA 1XGPB 3C5JA 5I1IL 3PV6B 1HIML 5JORB 3T0DA 4NM4L 1TZGL 4JN2A 3P4NA 4IDJL 4JHAH 3IDMA 2FJHA 3L3IA 3P0VH 1JYWA 5IB3A 5D1XD 3GKZA 3GSNB 3ILPA 1NBYA 3J8F7 4G6AD 4JY4A 4M6NH 1X7QA 4H88H 2YUVA 3EGSB 3UTTB 2OM5A 4YIQB 4M3JA 1X5KA 3KPPB 5IEKA 1KUMA 3DSFL 3K7UA 4CJ0A 1FNHA 2ED9A 1AHWC 1FFNB 5CILH 3BJLA 4ZS7L 4P23A 3FO1B 2NNAB 4FQCL 2B2XL 2PW1B 4OZ4A 4OLUL 2EDYA 4JZOA 3S7GA 2JF1A 5EU6E 1CICA 3PWJB 4HS8H 1Y18A 4OKDA 4C56B 1Q0YL 1LEIB 3I3BA 4KJQD 4XBEH 1WZLA 2ZUQB 1D9KA 1F58L 4X8XA 3ARBB 4IBLT 3RA7H 4UILH 4LCWB 3T0EC 5HHVL 1FPTH 4MNGE 3OR7A 4P9HL 1DBKH 3H9SB 5EG6C 1UB6B 1IAII 4WUUD 5J6GA 1UM5L 3QUZB 3C2AH 1H9VA 3OSKA 5DF0A 1NC4B 1G6RL 4ZPTA 4BM7A 2OTWA 3CVHH 3P11L 3DIFB 2O5XH 4LASH 4BUHA 1JPFA 5JR1L 3ULUC 3LKSA 1EVTC 1MJ8L 5GGUA 3E6FA 5TF0A 1GGIL 4XNQB 3B9KB 4OGYL 1MUJB 1BIIA 1M1SA 1AR2A 3V5HB 2YC1A 4JRYD 4WHYH 4H5SB 1VKXB 3VGHA 1X4XA 5GISL 1A14L 2NY6D 3QO1A 5F6HJ 4YXKH 3VFGH 1W8OA 2WW8A 3VXRA 2V2XA 2YRZA 3LKPB 4LKCB 4I48A 5BV7B 4HKZA 4XNMB 1LP9E 1FIGL 4L9LC 1R3IH 2C26A 3CPLA 3HG1D 4MA1C 5IBUB 3VG0L 3D2UA 2OX5A 3U82B 3CFJA 5H37H 1X4YA 1NJ9A 4A2LA 4YEEA 1TJGH 3EO1B 1RQ5A 1DUYB 4FFZH 4L4VD 3JWOC 4KUZH 5DD5L 5JQHC 2AJSL 1T5WA 1KCRL 2OXGA 5C0GB 2EC9T 1KBGL 4XPGL 3HC3L 5I1CL 4OIIH 4XHQA 3P9MA 4OGXH 2EXYD 4MNGB 4OZGE 1BFOA 1DANU 3JWDC 1S78C 2VXTL 4S1SH 5JMOC 4DZBB 1HSAB 1ZMYA 4DGVH 4H1LB 5L88L 3RU8L 1F8TH 3T3ME 5EOTB 2FX8H 5D1QB 1R3JA 1TZHA 4GSDH 1FAIL 5EORH 3CDFA 1I7RA 3VMOA 3H8NA 2HLAB 3VWJB 5CIPH 4YDIL 4NZRH 4K94L 5JXED 4DVBB 4RGND 5BS0D 1NFKA 3A0OA 1RZGB 4J3VA 1RZJL 2R2EA 1EJOH 1OGAE 2YA2A 1YEHL 4PJDE 5BZDA 5FYKH 5KG9B 1PBYA 4D8PB 4MXVF 5FIEA 1DQLL 4LARH 2NY1C 4G9DA 1INDH 3R0NA 2EDKA 5JUEH 3EKCA 2EIZA 3IRZA 1MCDA 4XVJL 4Y16D 4EUPG 1MCWM 4RX4A 5C2BH 1EV2E 4J1UA 1KLUA 5E8DH 5HHME 5CJOH 3QIUD 1EXUA 1ORQA 1YEFH 4GBXA 3SE8H 5C0DB 1PEZA 5KSBA 1LP9B 3BUTA 1UM4L 3OGCA 4LSUL 1ERNA 4NHCL 3TIDA 1MAKA 2VDOH 3VFWB 1EUUA 2CGRH 2Z4QA 3M17B 1EAPB 1JI1A 2VDLL 4NO2B 3SDDC 2XWJB 3FQRA 5FUCC 3HZMA 3MRBA 3VXSA 5DK0A 3C8KB 1UXSA 1JV5B 4XRCA 5EZLB 3QJFA 2MHAA 1NLDH 3TH4T 3ARXA 2ED8A 2NTSP 3QDJD 4UDUA 5HGDA 4K3DH 1VERA 1X6LA 3BEWA 3SDAD 1MLCB 4MAYA 4OZGB 3KR3L 1PSKH 4EI6A 3STZB 1U8MA 3WHXB 4IRZH 4N1EA 1MHPH 1RFDL 2DQGH 3VGAB 1WT5A 5JXAH 1UZ8B 2BOBB 4R4ND 4AENA 2Z31D 3G6AB 3WNNA 3Q3GA 4U33A 2NX5D 3QIBC 4LLVA 1P7QD 3EFDL 1TJIH 2J5LC 2J8HA 3MO1A 1NUGA 1T04B 4LLWA 5SX4I 1Y0LB 5IV2B 5EZJB 3E2HB 1OGAB 1S7UA 4PJDB 1T1WB 4KKNA 5CUSH 3N85L 4B53A 1FO0L 2CRYA 4JCMA 3X3FH 3ARDD 4LPWA 2VDKL 4ISVA 3TA3D 5MENA 3BIKA 4NYLB 4TTDD 4MD4A 3L3JB 1WAAA 2BVOA 3Q1SL 5DJ8B 3WFCL 1NGZA 3TZVB 2F5AL 3O6FD 3CNKA 4ZUVA 1QBBA 5HHMB 2QJDA 3A67H 4J4PC 3SO5A 4H0HB 2V5TA 5C8JA 2FR4B 4LMQE 5F97E 5F7LB 5DD6B 1XF4B 3SPVA 3TN0C 1B2WL 3DI2B 1DBBH 1FIEA 2ZUTA 2W91A 3SY0B 3S3SA 4BJLA 3VGEA 4EOWH 3DYOA 1XGTA 3L7EA 3NZHL 3IDIB 4JKPL 5F7MC 4JO1H 1I9JH 2E9WA 3GJFB 4AH2B 2CDGB 3CK0H 1ZLSH 4IHOA 4UIMA 4JQIL 35C8L 1CD9B 4FABL 1EH9A 3HUJE 4U7SA 1D5MA 3RJDA 1K2DA 1QNZL 1G7PA 4P3DA 3E8UH 3VRLF 1PGRB 5T3ZL 3EYSL 3W11C 1MJUH 5D93B 3RNQA 1XGQA 4HWEH 2PUQT 1F4YL 5EBMA 5IHZA 2NY0D 5JQ6L 3CSBA 2R8SL 5HXMA 4UBDD 1PKQA 1BF8A 5C6PB 4XAWH 1R3LB 5DJ2A 1J05B 2X4PB 3PXHA 1MOEA 3BDYH 4E0RA 3THMH 3PG2A 1KEML 4JFHD 5HYQA 1T22B 3JV0A 1E0OB 2DLEA 2ADFH 3REVA 4CDGC 1CDCA 1UFUA 3MUGA 5TDOA 1SM3L 2BNQE 5KTEH 4AG4H 3DVNB 3CFEB 2R9HC 3N1GC 4UT6L 3BWAB 3O3EA 4NQXA 5KSVA 4OZIB 2C1OB 2HJKA 5FAAA 1F4WL 2NXYD 3MXWL 3L5XH 2PNDA 2DQDL 1U9KA 1OVZA 2DRUA 5DJXB 4YHNB 1LILA 1YNKL 2FCBA 3NCBB 4G5ZH 3MYJA 1G7HA 4JB9H 4B0MM 5CEXA 1T89A 3GHEH 4NSKA 3V4VL 3EJZD 5K59F 4JZNA 2APWA 2D03H 4QRUA 2YKLH 4OZHA 4JFFB 4HKBB 2Y06L 4RFEB 2ICEB 3GJEB 3L7FB 3MV8E 3UTTD 5DUPL 1I9RL 2E9BA 1R5VA 1OCWL 4F3FB 5B4MC 3B9DA 3HNTL 2EH8H 4QHLA 5L0QC 3ULVD 1HHJB 1S7TB 2WBKA 3GI9H 3F7YA 3ARVA 2P5EA 3ET9F 3VFUB 5T3XL 4HJGB 3MA9H 2AV1A 1KIPB 4ZFOB 4NJ9L 1EO8L 2CIIA 4TSCH 1WSST 4QGTA 1D5XA 4C56D 1CK0L 2WIMA 4CADB 5HVHC 3CZFA 2HJFA 3ARBD 4NRZB 4JY5L 3IKKA 3ME0A 3MXVL 3B5TA 2OZ4A 4NFDA 4LCWD 3T04D 2VAAA 5B8CA 1UCBH 2I5YH 5EUOF 4N68A 4M7KH 4MDIB 2VXQH 3H9SD 4HIEB 3KYNB 3QUZD 3BEVB 3MROA 1PYWA 3GMQB 4NZUL 4AZ8A 4ONFH 2BNQB 4GRWE 1N4XL 1HSBA 1NC4D 4OCWL 1U91A 5CJXA 1J0YA 2C9AA 5F9DC 3CZJA 5FGBC 3DTXB 1OB1B 5JO5A 4MD0A 3B9KD 4JHWH 2ICWI 4DN3H 2CRZA 5BMFH 2VDPL 3MRMB 2G75B 1JHKH 3L3DA 3UDWA 2ZUSA 3GGWB 5C09E 5IK3A 3TEUA 4L8SC 3WKML 3IKCB 2B1HH 4UOW0 3ARZA 3HAEA 3LD8B 4WUKH 3HR6A 3EHBD 3MV8B 1TVBB 3OKMA 4H8WH 1IQWH 2LABA 1U3HB 3N9GH 3ZHDA 1WFNA 1A47A 3EYUL 1FL6A 4FFYL 4YBLB 4R0LA 3EW3B 5EBLB 4NN5C 4RZCA 1KC5L 3TVMD 3AAZA 3IJYB 5F7EH 4JG0L 4HZLB 4HUVB 1DBMH 1IGYA 2VLRA 2EEDA 1MJ7H 5KN5A 4KU1A 32C2B 3MOBH 1LO2H 2ESVA 1I85A 4P5MB 2K7QA 4GG8A 1F6AA 3UO1L 2XYCA 2FJFA 2DJUA 4J12A 1AE6H 1MWAA 1RMFL 5EU4A 1K4CB 3K80A 5EPMB 1I1AB 1NBQA 2XTJC 1I4FB 4KKLD 4X4ZA 1F90L 2QSQA 5SWZE 1P4IH 2EYTA 4U1LB 4XHJD 1W72L 5D1QD 4ZDHB 5F9OL 4GRWB 2A9MH 2YPVL 5C0BE 4YDKL 4WFHD 4PGDB 4BKLA 3AROA 1XCTA 4HGWB 1NANH 3O3DA 3IJHB 2D7NA 2WNGA 3ISWA 2GCYA 2YD2A 1ACZA 2YBRA 1SBSH 4OCRH 1YYML 1H5BC 3JUYA 3VFTB 5C09B 5I19L 2OK0L 1VDGA 2YK1H 5IQ9A 4M61B 4HFUL 5I9QB 5IIEA 1CD8A 1QP1A 5MEPA 3LKOA 4Q9RH 1FBIL 1I7UA 4ZTOH 3H2WA 3C5JB 4S1RH 5EZOL 4PJCF 5ICXA 2V7HB 2I27N 4JN2B 5E8PB 3P4NB 1NGWA 4OM0H 3IDMB 3L3IB 4PRIB 5L7XH 4K3GA 1C5DA 2C7UB 3ILPB 1HH6A 4JY4B 4Y4FC 3VXRE 4E5XA 3I9GH 5IEKB 2FZ3B 3C87A 5E4EB 1AXSB 6FABH 1CCZA 3SGJC 4P23B 1CE1H 3TP4A 1C12B 1EFXB 1GGBL 4JZOB 4WW2B 1CICB 4KK6C 5J7CC 2BNRD 1KTRL 1VFBA 5FA3A 1Y18B 4M8VA 1PG7L 3ARYA 5E9DA 1QRND 2XA8H 4I3SL 1WZKA 4NN7B 1FNGA 5SWZB 1J8KA 5IGXH 1MFEL 5GS3A 5CFHA 1I8KB 4MJ5A 2WUCL 5C0BB 3QFDA 1WUNT 3KVQA 4QRQA 4V2BA 5J6GB 1MQKL 3KS0H 3MRLA 1H8SA 4LLYB 4Q0XL 3P4MA 8FABA 2AQ1A 4Q6IC 1OGAD 5I1JL 4OSUH 2Q8AH 4NRXB 2UZIH 1UQSA 3EYVA 4ORZC 4P4RB 4ZD3H 1INQA 1FJ1A 2NQCA 3E6FB 5D2LA 3K8MA 5DD0H 4Z18A 4OUUB 1Z9OA 4ZO8A 3NIDE 2E7CA 4RMVA 4OLWH 3GUTA 1H0DB 3WDIA 3GMOB 4XVUD 1Z0MA 3PP3H 2N7AA 3RVVD 2BOCA 4NKMA 1OAXL 2CLVA 2AGJH 2VLKE 2DQUL 1V7NH 4RMTA 3VXRB 5L2KE 2YN5A 2DDQH 2V2XB 3KYOA 1DFBL 2DTSA 3B2VL 3QA3B 1KGCE 4HKZB 1F4XH 5KSBE 1CG9A 1K4DB 2PO6A 1MRFH 1QFUL 1KEGH 3CPLB 4JFQA 1LNUA 4NHUA 3SKMA 3D2UB 5GS1B 1F4AA 1HOCB 1JWSA 4JKWA 3MREB 1NJ9B 4HKJB 1R0AH 3RPIB 4HUXB 4PJ8D 3C6LB 3U48A 3UTZB 1ZHKA 2VDMH 3LB6D 4BZ2H 4QRRE 5KSAC 3VXSE 1N6QL 4N5EC 3RTQD 3TO2A 3X14B 4XP9L 1Q72L 1L4IA 1CVRA 5GRUH 3HHRB 4KH2A 1J0IA 1BEYL 4HKXA 2R1YA 4YXHL 3VG9B 2J3SA 5IMMB 3G5YA 1JWUA 3UTSD 3W81A 1MHHB 4YGVB 1ZHLB 4IM8A 3OJ2C 3HS0B 3QIWA 3TBWA 4IOFC 1TZHB 3U4BH 4HJJL 5IBTL 3QHFL 1I7RB 3FO0H 1NL0H 3BQUA 5IR1B 1JRHI 3GMRA 3ZSTA 4BSJA 3F65A 1AGBB 5DDHA 3D69A 5BZDB 3D0VA 5F88A 4GW4A 3SEPA 1EEQA 1GZPA 3AVEA 5IJVA 3MMEA 2HG5B 1WAAE 5KVDH 1FZJA 3PDOB 4F8TA 1TJHH 2VLKB 1LO4H 4N0YL 3CDGB 1G0YR 5L2KB 4MX7B 2R1XA 1T7XA 1ORQB 4GBXB 4EBQH 1A7RH 4MQXD 2YRLA 1K8IB 5KSBB 5CIPA 4JFFD 3VD4A 1WITA 3VD9A 3MLRL 2HFGH 3TIDB 2HTKC 1VGKA 2IPKB 5M7QA 2X1OA 2YD1A 1W8NA 5E8OB 1NCCH 2NY4C 3BPCB 1EGJL 3IU3A 1UB5B 5FGRA 3SO3C 3V2AR 3GRWH 3FQRB 2YD5A 4F9LA 4QRRB 5DK0B 1G9NH 4XRCB 4X6CF 2MHAB 2BK8A 2P5WA 5JW4N 2P8PB 1YN7A 1LO5A 2KBGA 4G6FB 4UDUB 2VXUH 2DKMA 3BEWB 1RUML 4A6YH 4MAYB 3WXWH 1A6WH 1HZHL 4EI6B 2QSCL 1OGTA 1G9ML 3NA4A 4YC2C 3KPNA 2BJML 5T1LA 1MFAL 1QSEA 2X9YA 3P77B 3QQ9D 2VTFA 1GAFH 4NNPL 4PRPD 3MO1B 4Z0XA 4HQQL 5CJQH 3VD3A 3GMLB 1TTUA 1B4JH 4HIHB 4X5LA 1X5LA 3WHE1 1CTOA 4GKSA 1BD2A 1A7PH 2DBLL 1ZVHA 4U0RB 3AC0A 1ZVYA 2OQJB 3BRFA 4Y19A 4BYHA 5CCKL 3FJTA 3LS4L 3OJDB 2NZIA 3QZWB 1XF2A 4AEEA 3B3IA 4ISVB 4X7SH 3DOSA 5CZXC 4V1DD 3BIKB 2NPLX 4MD4B 5F9JA 2BVOB 4F9PA 6CGTA 3FRUA 4MWFA 1CLYH 1URLA 3RWFB 3UYRH 2WWMD 2XY1A 4ZUVB 3BKYL 1MRCH 4P3CH 1E4XH 4Z0BL 3F5WA 3NN8A 1QA9B 4K07A 1FG9C 1EA9C 1MFDL 2HWZL 4MA3B 2C1PA 4UB0L 1E27B 3SPVB 3MV8D 3VI3E 1CIUA 1QVOA 1U3HD 2FEDC 3S35H 1RUKL 2HLFC 1ONQB 2HKHH 4R2GB 4OZHE 4W4NA 4F33A 1P1ZA 3R8QA 1JIBA 1A6VL 2G60H 4U1SB 5D9SA 4IHOB 1MJJA 3T2NL 3IDGB 4NBXB 3IFLH 1FL5B 3O4OB 3HPLB 5KS9F 1K2DB 4NKIL 4P3DB 4YHKL 3T4YB 2RAMA 2H1PH 3FAWA 3FQNB 1A4JA 4I0PA 3RTQA 3H3PH 1TVHB 3ABZA 1MFCH 4TVPL 5TE6H 4N8CH 3RNQB 2WQ8A 3CSPA 1Q0XH 5JOPD 1FVCB 2Q76B 3BPOC 5HI4D 5EBMB 3MNWA 5A2KH 5IHZB 1O7VA 3ZHLA 4F15C 1I1AD 3QB7C 1G1YA 2YPKA 4OLZH 4I18C 5E6IC 2H41A 3KLSA 4YUEH 3TPKA 2EDRA 2UUDH 2D9QB 5EU5A 3OKEA 1U8QA 3G6JF 4MXWH 3GKWH 4HPOH 4R6UA 1KCSH 2R4RL 2ZOLA 1ZLWH 2D4FA 5BW7C 3FTGA 2VMFA 1VPOL 5FF6B 3KJ4B 2FD6L 3FB5B 2HRLA 1SMOA 4CMMB 4BH7B 5KSVB 3MLXH 1ZEAL 2V5RA 2HJKB 3WJLA 1GOFA 3PWPE 3U9PH 1WEJH 3BHBA 4U3HA 3MRIB 4JGUA 1G7HB 3VXUA 2FNBA 5CEXB 5EN2A 1UGNA 4IMKC 3AS2A 3QUMA 3VFOB 4JZNB 4PRID 4QRUB 1X5XA 4OZHB 4PB9H 3E6HB 5C9KA 4PTTA 4WU7A 4OV6F 4ETYA 4RIRA 2DQFA 5HSFA 3MLZH 3VRJA 1KG0A 2CD0A 2J88H 4QHLB 5HDQH 3OAYK 3UJIL 1SJXA 4U4BA 4UTAL 2Y6SC 4YAQA 3LQMA 1OM3L 1FC1A 5CEZH 1JFQH 1L7IL 3F7YB 1VENA 3O45B 4ZOEA 3KPLA 5DZOA 1EFXD 4BK5A 4YDLB 1CXKA 3CVIL 4CDHA 1A1OA 5JTWA 2CIIB 5IWLC 5H8DA 3FO9B 2ESVE 4QTHA 2KPNA 3C5ZB 4PJBF 2BP3A 5F6IB 2EDXA 4KVCL 4GOSA 1M71A 5SWZD 3L3HA 4YH6A 3TNNA 1BJ1J 3MUJA 5B8CB 3QEGL 4LCCC 2NW3B 2WBJC 5MEOA 5C0BD 2ICWJ 1CIDA 3S37H 4G9FD 3PHOA 1MI5A 5D6CB 3F7PC 5TE7L 2B0SL 1YEGH 4NO3B 1JZ6A 2HT4C 1HSBB 1YEDA 4K71C 3SKUD 4PJIF 4XNZB 4R4FL 2R29H 3CLEL 4KXZH 1GIGH 2YUZA 1V3JA 3OR6A 3PWPB 3OAYH 4PG9A 1JNHB 4MD0B 4CBPA 1QFWL 1UZ6E 3AB0C 1H3UA 3O8XD 2C3HA 2KZWA 1SEBA 1JNJA 4RMUA 4KFZC 2XWBA 4HF5L 5D1ZD 3L3DB 4NZJA 5B21A 3ZKXC 4KQ3H 2HT3D 5MP6L 1H3XA 2XQBL 4J2XA 2YR3A 4XVTH 3DX8A 1AC0A 4GJTB 5J13B 5EUOA 5L8KB 4HCRH 3QI9C 3RZCB 1KIUA 1MAJA 1YJDH 2UYLA 2MCPL 3RGVA 4NC2B 5KANG 1NEUA 4JM2C 4EQ3A 5JLZA 3QEHB 1FE8L 1YEIH 4LLQA 3GNML 1MEXH 1ZHNB 3GO1L 2OJZH 2EC8A 3GSNL 2X4TB 5BCAA 4YWGH 4XZUA 1GOHA 2VSDA 3BUYB 1LO3H 5FCSH 5HHPB 1OAZL 3AAZB 3EO0B 2EDEA 3PGCB 1IGYB 1OSZB 3C6LD 3ULVL 1JZ7A 3FKUS 2F53B 2ICCA 3WUWG 4P2QE 5F3HA 3STLA 2HP4A 4KWUA 2X1QA 2CSPA 1C7SA 2EKSB 2ESVB 1HYSD 1X3DA 4ONGL 2FEEL 4QY8A 4F7MA 4CUCA 2MQ3A 5C0AD 4OF0A 1F6AB 3S88H 4PLJD 2FJFB 3NFPA 1PEWA 4O9HH 2HKFH 1CXFA 4JDVB 4Q9CA 3QG6A 5E9DE 3PNWB 3NPZB 12E8L 2XZCL 4HXBL 3TPUA 5TGBB 1IQDB 1A7OL 4JDZA 3QEUB 2EYTB 2IAMA 1IEBB 3GBMH 1MHCB 4AMKL 2LFGA 3TM6A 3DMMB 3GK8L 1CN4A 1GGCL 1AP2B 3O3DB 3RWEA 4XWGH 1YEKH 3QDMA 4P5TC 3MUHL 1XGYH 5ITFA 3MJ8A 2J12B 3HR5B 4O02H 4D0CA 2JJVA 2E7LC 4AM0B 5D2LE 2XV6B 4RRPG 1NMBH 2AABL 3EOBA 4OBRA 1BQHG 5MEPB 1ZGLA 1S3KL 3RWCA 1DEEA 2VLKD 5ICXB 1RULL 3MZTA 5L2KD 4X7TB 5FECB 1GXEA 1KGCD 2L4OA 4P9MH 1J10A 4UOJA 4DGIL 1C5CH 1C5DB 4GS7B 5LJYH 2DTML 1QPPA 4AIOA 3P9LB 2VLJA 2ZUUA 5BV7L 1J7VR 2NXZC 2CLZA 2W0KA 4NNXA 4RWYL 3A6OA 4P2QB 2V6HA 2DLIA 1ZTXH 4QRRD 5K9QI 3VXQA 4ZXBA 5IVZB 1AO7D 4ELKB 1INEL 2YWYA 4G6FD 5JW3H 4GMSL 4OQ1A 2IALA 1AQKH 1VFBB 3T08A 3HE6D 4JPWH 2BY0A 4PJCA 4Z8FL 1WIOA 4OCYL 5E9DB 2F74B 5DGQA 2W9DH 2XZQL 1FNGB 3IU4L 4P4KA 5CMAA 1T3FA 4QRPE 5CGYD 3L5IA 4MB4A 4MJ5B 4POYA 1UEMA 1QOKA 2Y4SA 4YX2L 5EDXA 3PF2A 4MXQC 1FV1A 4G8IA 4QRQB 3F62A 3DX9A 3ULUF 3O2DL 3P4MB 4Y8DC 2D7QA 2GJ6D 3T3PF 3IDUA 3MRPB 5E24E 3QQ4A 2CO7B 4PD4J 5BVPL 3JV4A 4G7YL 3AS0A 1T1YA 4FHBD 5D2LB 2AJYL 3MBXH 5DQ9B 1I1FA 1JP5A 4F57H 3GUTB 1RUPL 1PG7W 4NPYB 4P46A 2FBJH 4NKMB 3KG5A 4LEXH 1ODAA 4RFNC 2CR3A 5F7UA 2G9HA 3KPSA 1MREH 3MLVH 4Y5VC 3W9DA 1HXYA 3GSRA 3WCYA 1FGNH 3KYOB 4NM8H 3QPQC 4TULH 4X9IA 4R2GD 1SQ2N 2PXYB 1RUAL 2PO6B 4LP5A 2F54E 1LNUB 3PUCA 3RNKA 4BSWB 1KJVA 4JFXB 2MJWA 3ZDZE 1BFVL 2BRRL 3WLWD 3UBXA 5GIRA 3ZZ1A 5FYKE 1DL7H 2QSVA 3KYAA 5C92A 2IAND 1WWWX 2BSTB 4M00A 2FLBT 4MXVE 4QCIA 4PV9B 5I8EA 5MERA 5J1SC 1WK0A 4P5KB 3V95A 3TO2B 3LN4B 1CU4L 2BY3A 4ORGA 1P84J 3W82A 3TF7C 4QRPB 2Q8BL 1T2QH 4X6BB 2IGFH 1ZS8A 3LCYA 4YJZL 4MDJB 2ERJB 3CLFL 4XNXL 3QWRD 3LQAH 2CKNA 5GS2H 1X6NA 2NY3B 2VR9A 4HHAA 3D48R 4PRBA 3QIWB 3O2VH 3PGFL 3EOAB 1IC7L 4W68A 5TH2B 1FNEB 1DCLA 1GC1L 1YYLH 1IEAA 1EHAA 1FZKA 2JJSA 5FYKU 3TT1H 4QXWA 2R23A 3GMRB 4UT6H 4LHUA 1MFBH 4KJPD 2Q7NA 3ARQA 5GJTH 3D0VB 1CFBA 4Z7WF 1CFSB 1GZPB 4LVHC 4JN1H 3MUZ1 4OF5A 2YD3A 2XRAH 4HULB 4U6YB 2EIBA 1FZJB 3U4AA 1D6EB 3QCTH 4ODHL 1U41A 3R1GH 5DHXB 3BRDA 5J3HD 5DI8A 4CU6A 1WBXB 2VDNH 2F54B 3PWNB 1XIWA 4NQUA 5AYUL 4Y4HA 2VQ1B 3L3KA 1OAQL 5D1XC 4TNWK 1IAIH 1MCPL 5D4QA 3X12A 2VZ3A 4TSBL 1NC2B 1REIA 3I85A 5JPNA 5FM5O 2H3NB 5CZKA 4K23H 1YN7B 1LO5B 3QEQB 3QRGH 4I2XE 1UJTA 2MWCA 2GTWB 3FHAA 1JF5A 4HS3A 3RUGF 3C5ZD 3W39A 1OGTB 2FGWL 4NQDA 4HK3N 4K8RH 1YMMA 4ODXA 2FATH 1D5BA 5T1LB 4HJ0D 4KJQC 1NAKH 5DC0A 2C4XA 3GSQB 3RWDB 2Q3ZA 4Z0XB 1BVKA 3SKOA 4OAWA 5GGVL 4PJEA 1KB9J 2DQJH 3MRGA 4J6RH 4K9EH 4X6CA 2FBOJ 2HMID 1S7SA 3FQUB 4A6YA 2XN9A 3CUPB 2MSPA 3BESR 2HFFA 3B3IB 1HHIB 5IW3A 3PWPD 5E56A 5J6HB 5F9JB 2DM4A 4S10A 3VRLE 3FRUB 5DVOA 2X4SA 1EBAA 2FX9L 2C3WA 4JO2H 4WHYG 1WIPA 3WFHA 1KCUH 2X4QB 3NA9H 5HGBB 3TJEL 3NN8B 1PX4A 4ZUTA 3SE9L 3W0WA 2DWDB 4DN4H 5I2IA 3RZCD 1TQCC 4ZO9A 1QHOA 3DX6B 5IF0A 1Q1JL 3VXUE 2GSGA 4XPFH 3Q5YA 3JTTB 1QSZA 1OAUH 3WN5B 5D9SB 43CAA 2N7BA 5F96L 1N0XL 3VWKD 2PYFA 4NO5B 2F53D 2FHCA 4I2XB 2FSEA 5AUMA 5FUOL 2XQYK 4NP4L 2EEBA 1MFNA 4KDVA 3IRPX 1KPVB 3KWWA 4ZFOL 3LOWA 4XI5D 2AKRA 1QO3B 2YS4A 3E3QC 1D6VH 1LDSA 1KLGA 4U6HA 5F9AC 2FB4L 4KRPD 4KQ4H 2ZNWA 2GKIA 2BSRA 5TDPB 5ITBH 4XAKD 3DNKA 3V52H 2VN4A 1L9NA 3IVKB 2AVGA 4XP4H 1DN0A 1MF2H 2JJTC 5K59E 1QLFA 4F7EA 3IXAB 2EXYC 4MNQA 4JFYA 3DMMD 4XCCH 2IBZY 2ZOLB 3GIVB 5D2NA 2AXFA 1Q94B 2P7TA 3VE0A 5KS9A 3KDMB 2H2SD 4JZJC 3I02B 4U3CA 2AEPH 3FTGB 1C1EH 4KKCD 1ZE3C 4TRPL 4WFGE 5JXEC 5D7IE 5HHNB 5D7JD 1T7VA 3UXFA 3MRHA 2O5ZH 2Z35B 1BM3H 5CWSA 4K3HA 3GI8L 3O6ML 1HE7A 5I8KL 2IQAB 3BHBB 1U92B 2IPTH 4HEPG 5EO9B 1XGUA 1QYGL 3VXUB 4WV1A 5ANMA 2A6IA 5HI5C 4M43H 3TWCL 1KV3A 3ZKMD 4UTBL 3QUMB 3GM8A 3DURA 4Q9QH 3G6JA 5EUOE 2YOCA 1U6AH 4PTTB 4KJWC 4WU7B 3QIUC 1T89C 5GRVK 2EEAA 4P2QD 5SX4H 2FL5A 1UA6H 1QFWI 4LLMB 5ADPL 4YDVA 3OPZH 4ODBD 4ODSH 2SEBA 2HTLC 1BZ7A 2E27L 1DE4B 2IF7A 3LQZA 3A6CH 4QTHB 3ZDYF 4CU7A 5INCB 4QEGA 1HINH 3UX9B 3SDAC 5FYLE 1M71B 4X9GA 3HI5L 2K9UA 4K3JL 5JOEA 1VESA 1JNLL 5A1AA 3F8UB 3ROOA 2R69H 2JE8A 1JPSH 4HEME 2COQA 1OSPL 2R56L 4AIZA 5TE4H 3NMEA 4PB0L 3RHWF 2OSLB 1DBJL 2ZPKL 4R4NC 2Z31C 3T0BA 1NDMA 2W9EH 1HQ4B 5KVEL 3HE7A 2XPGA 5D7IB 1T7YA 3C8DA 4HLZG 3EZJB 4GRLA 5AAMA 3C60B 3TGXA 3DGCR 3DUUA 5T1MA 3OR6B 2VUOA 3STBA 4PG9B 5JIPA 2IH3B 3QDME 3BGMB 4IRJD 3ARDC 4PJBA 2DQCL 2XWBB 4GXVH 1NAMH 1CQKA 5IT2H 4JPVH 1OAYL 4N1HB 3OKNA 4W81A 5GRJH 3G5VB 5EUOB 3LAFA 1BREA 4PJ7E 2G5RA 3RGVB 1UM6H 3SKJL 2L0DA 3UDWC 3BKML 5HGHA 3MJ7A 4KI5C 1A6ZB 3O9WA 4ZOAA 2PXYD 3QDAA 4OF6A 1KENL 4PJIA 4XZUB 5ACZB 4G3YL 2EYSA 1J8HD 4KROC 2ZSVA 3T2QA 3U2SA 2NY5C 1J12A 1UH3A 2BSSA 4NWUL 4XTRD 4R0LC 1FDLL 3H7LA 1VACB 2OJEB 5F3HB 5FHAL 3STLB 3TFKD 3BPNB 5DEFA 5ABDE 4PJ5A 1A3RL 2W38A 1IL1A 1G84A 4F7MB 3R06A 4HCRA 3RDTD 2OS7A 5DUMH 4YPGA 3ARGA 4JO3L 4QRPD 1MIEL 3IF1B 4RFOH 2QHRL 2OI9C 3IXTB 3S34H 3QG6B 2VITB 2PF6A 4FQIH 43C9B 3TPUB 3VMPA 4JDZB 4NZTH 3QNXA 2NY0C 1BQLL 2IAMB 3OAZK 4YHMH 4LDEB 2GY5A 1IKFH 5JA9A 1MCQA 4ZTPL 3WO3B 5J1AA 1I3RA 3TT3L 4M6OL 1B0GB 4G7VH 3B6SA 3CFKA 2W65A 2NR6D 3VFSB 1G6VK 3RWEB 1CFTA 4HIXH 3QDMB 4KRLB 1Y6MR 3MJ8B 3RBSA 4D0CB 2DLFL 2GITB 5GSRA 5KVFH 5FYJE 5ISZD 1OT1A 3M07A 4AT6A 4LSPH 4PV8B 3GIZL 3UAJD 4L4TA 3AREB 2CKBH 1FG2A 4X80H 4PJ7B 3I6KA 1DEEB 2UWEF 4F37K 1Y6KR 3DUHA 1DUZA 2NXYC 1MCOL 4U1NA 5EBWA 1GRWA 1R24B 2N1KA 4G6KL 4XNUL 5JHLH 3RL2A 5DMKB 5I1DA 1F3RB 2OMNA 2F54D 3RX8A 2A6KB 4G8EA 4XXDA 3EJZC 4YHLH 1XCQB 1RJZA 3FFCA 1E4KA 2X4UB 3DJ9A 4NNXB 3OAZH 2UVEA 5HHOA 5C07D 2PR4L 1NC2D 2I25N 2B20A 2VC2H 4EDWL 3I6GA 4JEGB 4ZXBB 3MODH 3G6DH 2E7BA 3D85B 3QEQD 3C09B 3L9RA 4DTGL 2Z8RA 5C0FA 4I8DA 1BJ1H 2IALB 1N5YL 4KK8D 1HEZA 5ALBH 4EUPH 1KF9B 4HIIA 4TQEH 5B3JF 3PIQB 1OTUD 4P4KB 2CDFA 4NFBA 1TXKA 5FA4B 1AHWA 4ZAKB 4GXUM 4X98A 1OQXA 1A7QH 1RIHH 4FQ1L 3PL6A 4PJXE 3L95A 1ZA3A 1FV1B 2K1MA 5D7KD 4I77H 5K9OA 5ESVB 4MZ3A 3VFRB 5B39A 3QUZC 3T09A 1TPXC 3KAAA 4LEOB 4XP5L 3T0EA 4FQLL 4JAMA 5DHYA 3OKLA 3UTPD 4K8RD 4BQ6A 2AEQL 2L7UA 3KPMB 4P46B 1KNOB 3G04A 5K93A 1CDGA 4YQXL 5I1IH 1HIMH 3HN3A 4NM4H 2G9HB 1DVFD 1TZGH 2G2RB 4FG6C 2VZUA 2BC4B 4MB5A 4PTUA 4M7ZC 3BSZL 3LHPL 3VU2A 1ROWA 1HI6B 3GSRB 3TO4D 2E8ZA 1H3GA 3AM8A 2DKUA 1KFAL 1XFPA 3RIAK 4XXCA 3EHBC 3LV3A 5T1DL 2RHEA 3UEZA 2EDFA 2MKWA 2LAAA 4B7IA 2X89A 4KKAD 3RNKB 4E41E 5GS0L 1KJVB 2DD8L 2FDBP 3UBXB 5H35A 5LXGH 4FQCH 2ATPB 2B2XH 4R96A 1BHGA 2GAZA 4KRMB 3TVMC 4LFHD 2D0FA 1NCNA 1SJVA 4QCIB 5I8EB 5MERB 1QBMH 4UINL 1Q0YH 5E5RB 2IQ9H 2BXZA 4ORGB 5FK9B 1J1XL 4L9LA 1F58H 4C83A 1FYTA 1KIRA 1ZS8B 2M8XA 3RL1A 5HHVH 4PJXB 4P9HH 1AGFA 1MCJA 1YMME 4PRNA 3V8CA 2QADB 5DLML 1UM5H 3QDGA 4KKLC 5FUZH 5IVOA 3SOBL 3MV9E 3EUUA 2R23B 3RIAF 1G6RH 3RVTC 3BD5A 3P11H 3PE9A 1NMAL 3RI5F 5JR1H 4PJEE 1MJ8H 3BQUC 3I2CL 4L5FL 1KELL 2Z8WC 4X6CE 1GGIH 3OB0H 4FTVA 4XMLL 4OGYH 1R3HA 2XN9E 5E8NA 1ES0B 1AGEB 1RZKL 5GISH 1A14H 4RISL 3HLAA 4PD4K 4PJFF 1N2RB 5E99L 4PLOB 3DXAA 2A6JA 4L3EB 1KN4L 3T4AB 3OBAA 5SWSA 4C55A 5ACMA 3W0WE 1YN6B 1FCCA 4JPKH 2A1WL 4DKEL 1KLFA 1U8LA 1FIGH 4E41B 1JN6B 1M05B 3CMOL 2CH8A 3L3KB 1S9YB 5F7YC 3VG0H 2X7LB 3RX7A 2M2DA 1IAMA 5JW5A 3X12B 4D94A 4OFYA 3SCMD 5DURB 2MQ0A 4Z7WA 4HUKB 2AI0L 5F70A 2VRAA 4X6DE 3H42L 5DD5H 1GGUA 2AJSH 4F9LC 4I5BA 1KCRH 3KYKL 4LMQI 3HC3H 5I1CH 1R5WA 1KJ2A 2ENYA 3W39B 3OV6A 1U8HB 1SJHB 3WO4C 1WTLA 4LF3A 2VXTH 3QFJD 1YMMB 4ODXB 3SDDA 5I75C 3ARFA 4LQ1A 5L88H 3RU8H 4BZYA 1IGFL 3ZL4L 1J11A 3LSOA 3IT8D 3MV9B 4FZ8L 1FAIH 3QCUL 1WVZA 1P84K 4OAWB 2ADGA 4MNQE 4YDIH 2F8VA 4PJEB 5DMIL 3V0WL 2X09A 3HCVA 5JHDA 2H45A 1RZJH 4OF7A 1YEHH 4A6YB 2XN9B 5D2NE 1BF2A 3C60D 2HFFB 4WJ5B 4XBGA 3D18A 3ILQD 4RBPK 3I6LD 2C3VB 2ILLA 1DQLH 3RUGA 1YZZA 1BBDL 3QUYB 1NEZA 4PRHA 3QIBA 3WFHB 1F5WA 2X5PA 4XVJH 1YPZE 5I1EL 2F9BT 4F9PC 3W0WB 5I2IB 1NGQL 5IF0B 3MACH 1UM4H 5CP3A 4LSUH 1HNFA 2FRGP 2HJLB 4NHCH 1ZT7A 3OXRA 1KJMA 3X11B 2X10A 2VE6A 3DYMA 4M62L 1ZV5A 1RAMA 1YUHA 1S9WA 3CCHA 5IFJA 2VDLH 4F80A 4R90L 3OF6D 3C6SA 3QPXL 4J4PA 4X6DB 2PYFB 3KLAA 5DWUL 4LHJB 2YZ8A 5CJ8A 3VXMD 5GQBA 2FSEB 1TFHA 3G5ZA 1U93A 4LHUG 3HMWL 3TN0A 1P4BL 2GK0A 4RGOL 5GGTL 4PJ8C 8CGTA 3KR3H 5H94A 2AKRB 3SQOH 4QOKA 5CSGA 2EYRA 4P2RD 4WWKD 4RBPH 1KLGB 1PLGL 2X70A 2WV3A 1P7KB 2Z0BA 1DEDA 1IGCL 1A8JH 1A64A 2QBWA 4I0PC 1RFDH 3RTQC 2A9NL 3TYFB 4RMSA 4WW1A 5MI0C 4ODUB 1MCFA 2R0KL 5CZVL 4NWTL 1DN0B 1QLFB 2P24B 2OZ4L 3EFDH 3WV0A 4MNQB 4MJ2A 1R5IA 3FRPA 4S0TD 5DRXA 2QQNL 5FCUL 1F42A 3INUL 3S96A 4AY0A 5J0BA 5D2NB 1SYSA 5CEZE 3N85H 1FO0H 5LGHL 1CGVA 2IFFL 2VDKH 3BN3B 1Z3GH 3WFCH 1T80A 1KJ3L 2F5AH 1YPZB 2CMRH 2LVCA 3MRHB 4JDTL 4MD5B 1F13A 3CXHK 3BKJL 1FN4B 2GYSA 3ARED 1IAKA 1KB9K 3OX8A 1EZVY 4WO4D 25C8L 4J23A 1T03L 3WJLC 4WV1B 3TIEA 4WGWB 1B2WH 2XACC 5T5NG 3DURB 3SDCA 3NVQA 4K3EL 1FYHB 4YZFE 4Z7QF 1KB5A 4QLRA 3NZHH 4JKPH 4MQXC 1U42A 3RPKA 2I60L 3FFDB 2AXGA 35C8H 1JZ4A 5I1LA 3KPRE 4ZODA 1IE5A 4PJIE 4P49A 3QXWA 2X44D 1ETZA 1QNZH 4YDVB 4BK4A 3D85D 3ZMRA 1JPGB 2MPAL 5T3ZH 3SGDI 3MC0A 1BZ7B 3EYSH 4HW6A 4IDLA 1H15A 1CGTA 5HJ3A 1J86A 3DO7A 3OQ3B 2JELL 4WI4A 3NH7L 1F4YH 4PJ5E 1PAMA 1Z5LA 5DZLA 5JQ6H 2R8SH 3DGGB 3FCTB 2V9QA 3BVNA 3UTQB 1KXQE 2RJMA 4I3GA 3ROOB 4ZAKD 4EN3B 3CH8A 3PJSA 1KEMH 4AIZB 2IFGA 1NMCB 1IM3A 1VADA 1P6FA 4ZO7A 5KJRL 2NW2B 1IFHL 4GAGL 3BPLC 3CFBA 2XPGB 3LEYL 1EIBA 4X8JA 1SM3H 1AKJB 3WJJC 4PJAE 4UI2A 4OI7A 1IC5H 4ELMA 2H8PA 2XKNB 1F4WH 4LVNB 2R0LL 3MXWH 1XF1A 4FQXD 2DQDH 1YNKH 2EXWC 2YXFA 1CXHA 1A1MB 4M1GL 4XPHL 4JM2F 1MIML 4EDXA 4UQ2B 5BRZA 1I75A 2WWMC 4L4TE 1N5AA 1TZIA 1CZ8L 1YNLL 4W6XB 2XXMB 5HGHB 3MJ7B 4R97C 2Y06H 1B88A 5DUPH 1BLNA 1I9RH 4ZSOA 3RWHA 1OCWH 4WI7A 3HNTH 3KPRB 1BVZA 1CDYA 1Q8MA 5LKNA 1TCRA 3LDBC 4PJIB 4GUPA 2BVQB 2EYSB 3AS1A 2NTFA 4ODWA 4OV5A 2BSSB 5SV4A 2VOTA 5T3XH 2OR9H 1SVCP 4L8SA 2X9XA 5HHOE 1NAMA 4NJ9H 4RGMB 1EO8H 3EDKA 4PJ5B 1CK0H 3R06B 2OTUA 4Y1AA 2DL9A 5B3NA 4UDTB 5EA0L 5FM4A 2XZAL 4YPGB 1R3KA 3SKNB 3P0VL 3HFMH 3MRJA 3MXVH 4GAJL 5F89A 5I6XC 2E9IA 1MVFA 4M6NL 3WL9B 5HI4C 2D7TL 3Q6GH 4H8WC 4LCIH 4XP1L 1FZOA 4GW5B 3WFBL 1E28A 1I3RB 1ZT1A 3QULA 4NZUH 3LMJL 2YD4A 4JRXD 5CILL 5F44A 2VL5B 3V6OA 3U0TB 4UV4H 1H3PL 3MRFB 2N56A 3IDJB 4OCWH 4PJAB 1Q9OB 3B6SB 1JVKA 2W65B 4PG2C 4U6XA 1AD9A 5GSRB 3JBG7 2VDPH 2NYYC 4AT6B 1ZXQA 1FRGH 3ROLA 4L4TB 3T0EE 3RKDD 1KSRA 1WFOA 3RA7L 4POUB 3I6KB 3WKMH 4CVXB 3QSKB 4U1NB 5GPRA 5EBWB 3DV6B 4L3ED 5IROC 3BZEA 4F7PA 3C2AL 3MCLL 1BOGA 2KH2B 2PTVA 3EYUH 4N0UE 5I71C 4E41D 4G8EB 4RNRA 1H5BA 3M8OL 4JQXC 1RJZB 2X4RA 3ULUE 2EO9A 4OTXH 5EOCH 4LASL 3MYZA 1KC5H 2O5XL 4RAHA 4UUJB 5HHOB 5JW4R 2N4IA 4G8FA 4BH8A 3I6GB 5A16A 4KVNL 4POZD 1JI2A 4PR5A 5ID1A 1I3GL 5EUKA 2UWEA 4R3SA 3UO1H 2DIAA 3DRQB 4HS6A 4XWOD 1PKOA 3VDBA 4Y4FA 4YXKL 3P73B 1QLEL 3BP5B 4OLVL 2Y7QA 3CSYA 1ZA6A 1F90H 4WEUD 1FYTE 5GRZA 3UJJL 4WU5B 1W72H 4OD2B 3MV9D 4KK5D 5F9OH 5AZEL 3TYGL 4QHKI 3IETA 2YPVH 4YDKH 3CXDH 4TN9A 3IFNL 3VXOB 2H6PA 1MELA 2H32B 5B38B 5ICZA 1LD9A 4FQHA 2AQ2A 1TJGL 5CLTA 3CH1B 3NCYS 4ZFFB 1DQDL 1LEKB 2D0HA 4S1DD 4HUUB 1YYMH 4Y5XA 2FJGB 3PABA 5I30H 2ICWA 5E94B 4FQ2L 4EUPA 3VXNB 2J6EL 4JJ5B 1NBVL 3T0EB 5I19H 4JAMB 3NCMA 4OF3A 5I66A 2ZUVA 3QUYD 4FTVE 4AQ1B 1C16A 2BHZA 3G04B 4S1SL 3KLHD 5EZOH 4NRYB 1OP5H 3O8XC 4H26A 2PYEA 4J3SA 3VXPA 1VEOA 4Q6IA 4X5XA 1NKOA 5D1ZC 1BP3B 2KZ1B 2FX8L 3GM0A 4N0UB 3S37X 4PGJA 4YHYC 3UPRA 4GSDL 3KPQB 5EULV 5EORL 5E08L 5DJDA 4OKVA 4APQD 1G7QA 3DXAE 5SWSE 5DT1H 1VA9A 3LV3B 5JOFA 1JK8A 4RAUB 4WI8A 1I7TA 5FYKL 3MLUH 3BE1H 1BPVA 5HPMA 3WIFA 3CIQA 3LRHA 4CNIB 5DRNA 3BMWA 4R96B 2GAZB 1QR1B 2V2TA 1WBYA 1PG7H 3C6LC 4QO1A 4X5WB 4YDJA 5C2BL 3L6FA 2Y5EA 2YRPA 3MA7A 4FOMA 4I3SH 1HYSC 4O51A 1KXTB 1YEFL 2EDJA 4L9LB 5HYJD 4OZFG 1OLZA 1EAJA 1NCAL 1MFEH 4MA1B 4PLJC 2WUCH 5I16A 5L8JB 4KRNA 1AGFB 2CGRL 4PRNB 3D1MC 4HV8A 3U6RA 1MQKH 2NY7H 1MHEA 4Q0XH 4MQSB 5FUCE 5IW6B 1L6XA 5KSAA 2HH0H 3K4AA 4MA8L 5I1JH 1ED3B 5F6HI 3ES6A 5SWQA 2XWTA 1J0JA 3V7MA 1Z9MA 3QRFM 5DA0B 3T0WA 4TUOB 5JHDE 4K3DL 5AEAA 3WNLA 4FTVB 2PKDA 3SE4C 4I4WA 5J9PA 5J11C 1Z9LA 4NKDA 4XGZA 3O3BA 5K9KB 5IB2B 4LNRA 4F2MA 5I76B 1OAXH 2CIKA 1M6OB 2CDEB 2WWKO 4U7KA 4PRHE 4U1KA 5DVNA 2DQUH 2QR0B 3EYFA 3O4LA 5SWSB 4PGEB 1DFBH 4HMCA 2VZ1A 1G6RA 4KKBD 3B2VH 3PDDA 2WM0A 1U8LB 3UC0L 4G6JL 3REWA 4Z7NF 4NQEE 1WCBB 2Z93A 1QFUH 5DQDL 3V6FB 4BFGA 1A4KA 4MJ6A 5CUSL 2NY1B 4K7PY 2BVPA 1FZMA 3HKFA 3QUXA 5IMKA 1OD7A 4QRSA 1XR8B 2AP2A 3MOAH 3HB3D 3QXUA 4YHZL 4EZMA 4Y4HC 2AJ3A 3OKOA 3QNZA 2W0PA 3NIGE 5DGRA 3V9FA 5C08D 4PBXA 9CGTA 4I5BB 4MJIE 3X13A 2DKSA 4PJFA 4XP9H 1R5WB 1D5ZA 1EHLL 1WBZA 1Q72H 4S0SD 1KJ2B 3IJSA 4BQBA 1BEYH 3DVGA 4QOKE 4L8DB 5CINL 2P46B 4JFED 4YXHH 4TTGA 1CLOL 3HE6C 3SDDB 4HWZA 4YFLI 3S5LB 3LN9A 4TNVK 2QTEA 4EN3D 3EYQD 1I9JL 1RD6A 3K2MC 1ZLSL 4HJJH 5IBTH 3QHFH 5CGYC 1QQDB 4JO4L 2ADGB 2R1WA 1D3CA 3DV4A 2OYPA 1F3JB 5I1AA 4FP8L 1LE5B 1KPRA 2R0ZL 1QBAA 3PQYE 4DKAA 1A2YB 3CX2A 3E8UL 3GMMB 1AKJD 4MZ2A 1P6AB 1I7ZA 4S2SB 2ADIA 1JTPA 2DF3A 3FAXA 1FSKC 3I3EA 3L5JA 3OTTA 5IB4A 1JUFA 4BSVA 5CHNB 4PRHB 5I1KL 3CC5B 4J3WA 1T0MA 4N0YH 4AQOA 5E5UB 4XAWL 1KT2A 1NBZA 1IKNC 1JMZA 4ZMAT 4NQEB 4YHOL 3THML 3MLRH 3IB4A 3LRSA 2AERT 3TBYA 4KZDL 3QUML 3T1FA 2VE6B 5F7WC 5J89A 2ADFL 3KPRD 3CCHB 3TESA 1EGJH 1U8PB 3TNMB 3M1BB 1T5XA 5C0IA 3KNBB 4HZAA 1F11A 4X6FA 3C6SB 1FP5A 1JGDA 5F7NC 1CGUA 4WDIB 4MJIB 1U93B 5F71A 4GG6E 4I9WD 4NJAL 1RUMH 3TN0B 2QKIA 5H94B 3L3OA 4XP6H 2ZJSL 1HZHH 4G5ZL 4QOKB 2EYRB 2QSCH 2OR7A 1YMHA 4HH9B 1LO0L 5DS8B 1G9MH 2A73A 4B50A 5DO2D 2YKLL 3U0PA 1CXLA 4GRMA 2BJMH 2ARJQ 3W9EA 3V79C 1MFAH 4UMGA 3VCLA 1P4LA 2WIIA 3VXTA 3ZKQD 3VFNB 3K2UL 2H26A 4Q2ZA 4O2EB 5CP7A 2W0FA 4NNPH 4XNYL 1CWVA 1R5IB 4HQQH 4M6ML 1B3JA 4GO6B 4HG4J 2DBLH 3ARSA 3PQYB 5T3XD 1Q9KA 5TDNA 4LCYB 2KQMA 3S96B 3GI9L 5ID0B 5CCKH 2ARWA 4PGBA 3LS4H 5C70A 4D9QE 2JIXD 4TUJA 1GGYA 5C0JB 5D71L 1RK1A 3E1F1 4QTIL 3FB6A 4P2OD 1CF8L 3RWIA 3GMNB 5TPWL 1X5ZA 4I18A 4PRDB 3Q48A 3EJYD 1JPTL 5F7DA 1X5JA 2EIEA 3KJ4C 3LN5A 3BKYH 4Z0BH 3ZDYE 4ELME 1CXIA 1MFDH 2HWZH 2EH7L 4UB0H 1UCBL 3RWGB 4JFDE 3BX7C 4DCQA 3UMTA 4M7KL 1AGCA 3HC4L 3ZE2F 1OP9A 5IBLD 1KPUA 2VJXA 5BW7A 1RUKH 3MQIA 1GPOL 5DSCA 1KCVH 1KB5B 1XMWA 4KTYA 2ENSA 1FO0A 4XPAH 3LZFH 4G8GE 5J3HC 4MCZA 1A6VH 4MSWA 2KKQA 1RSFA 1L0QA 5IEHB 3T2NH 4Y7MA 4ZSOE 2UVFA 2BERA 3ZE1E 4X6EB 4GG6B 3QNYB 1ETZB 4NKIH 3PGDB 2YN3A 4YHKH 1JHTA 4L8BA 5E70A 4IMKA 2EDDA 1H15B 5HJ3B 4IIQA 5TQ0L 4TVPH 5EFIA 3V5DA 1WC7A 2A0LC 3LH2L 3DO7B 1GCFA 2VZOA 1U3ZA 4FS0A 4B5EA 3TBVA 1AR1C 5FYLL 1TETL 4Y1AE 1BVLA 2J8UF 4KHXL 2YD8A 4GKNB 1JHLH 5L0QB 3C5ZC 4JG1L 5DJCB 1CFNA 1G7JA 5F6IC 1NCBL 1S7QA 3RIFF 3D3VE 1E4WH 2DJ4A 5IFAL 1IM3B 1VADB 2VDRL 3K8LA 4PJGF 4OFVA 1IGTA 1VPOH 3MOBL 2FD6H 4EIZC 3MFFA 4LL9A 3HE7C 4PREB 1T6VN 3NGBC 1ZEAH 4P3WA 4ELMB 4LCCA 4AEFA 1J18A 2WBJA 2IH1B 2LV4A 4LFHG 1A9EB 1EZVX 3HI1A 3HZKA 2XTJE 4JFDB 3KXFE 5A3IC 4CGTA 2CLRB 2D7PA 5IVXF 1QSFE 1I8IA 1N5AB 4EI5D 1YQVL 2WUBL 4G8GB 2CK0H 1W2KT 2VKWA 5J13C 4N0FB 2EE6A 3RZCC 1BLNB 4ZSOB 3RWHB 4X4YB 5I18L 1BWMA 1HN1A 4X99B 4IEFB 4UTAH 2GT9A 2VWEC 4PJHE 1OM3H 5HY9A 1GZQB 5FKAB 4IMLB 2MTPA 2YD9A 1NAMB 2ZG1A 2IBGA 5F7HA 3QI9A 5ESAB 1BBJA 1KIQB 3VWKC 4FZEL 1T0PB 3LVEA 4JM2A 5D6DC 1NUDA 4FXGB 4Y1AB 5JPMB 2AAVA 3KHQA 4ZYKB 3NCYP 2UWEE 4KVCH 1QKZH 1R3KB 4XI5C 3BZFA 4OM0L 2DWEA 3D39D 3MRJB 5LGJB 2P49B 3IGAA 3D3VB 3DUSA 4NN5B 3QEGH 1YJDC 3FZUC 3T0VA 2AK4A 4PJ9D 1G7IA 4KRPC 3ARGC 3V5KB 1CLZL 2OCFD 5DK2B 2W1NA 1EK3A 5T1KD 5GGSA 1E28B 4ZUUA 1T20B 3TCLA 3QULB 5EO0A 5TE7H 2B0SH 3G9VA 4OJFL 4WTZG 3SGEI 3X17A 4RDQG 3GBLA 5IMOB 3P4OB 3CLEH 5GGRA 3DMMC 4KTDL 5AD0A 5FYJL 2UY7A 1S78D 4KI1A 1AD9B 1QFWH 5DZNA 2H2SC 4U1GC 3G9AB 3KXFB 4JQVC 3TBTA 4F7TA 2B5IC 1OARL 4HF5H 1Z9SA 4OT1L 3ROLB 2XQYG 4YK4B 3RP1A 1QSFB 4OCNC 4YXLH 5DJ0A 5D7JC 5MP6H 2XQBH 5C0CA 4GAYB 5B3JE 1QLRA 4NQCB 4NT6A 4XPTL 2LE9A 1YECL 2MCPH 4CW1A 2X42A 3SJVA 4WCYL 4F7PB 3HMXH 2B7DT 4P5TA 5D7LA 5HVFB 3GNMH 1FNAA 3GO1H 4QXUL 3GSNH 3ZKMC 4PJHB 1H5BB 3MRCB 2X4RB 3L5WB 3O11A 2O61B 2E7LA 1OAZH 4ZD3L 3ULVF 4LLDA 3ULVH 4BH8B 4BQ9A 3QWOB 1E4KC 5A16B 1S8DA 3FQTA 4XH2A 4ONGH 4QHKJ 5L2JA 4PR5B 5EUKB 3BP6A 4R3SB 2JK5A 4HS6B 4EVNB 4Y4FB 2E3VA 3I84A 12E8H 2XZCH 4HXBH 3EOYG 3DECA 4KGJA 3DX7B 1A7OH 2Y7QB 3BT2L 3DRTB 1ZA6B 4OCXL 3WFEH 1JTTA 4OF8A 3R4DA 4KTEL 3FT2A 1PDKA 5DRWA 4AMKH 3GK8H 4XPBL 5ICZB 1LD9B 1JTOA 1NDGB 4FQHB 5DC9B 2JLLA 5SX5H 1R0AL 4RA0C 3UPCA 5GGSY 2BVTA 3PL6C 2VDML 3BFOA 1IBGH 3F58H 4HWBA 1KYOJ 1M7DA 5FOBB 2DAVA 4MA7L 4EUPB 5EC2B 1G0DA 4G6ML 2HA1A 5GGRY 4HDIA 5FGCE 3DSNA 1N64L 2AABH 1S3KH 4PBVC 4D0DA 1UWXH 5CD5C 1C16B 4EXPX 1CFVL 1EEUA 2FYYA 4IRJC 2VERN 4Q6IB 3VD5A 4QT5A 4UT7H 1FFPA 2VLLA 4DGIH 4NQED 3T8XA 3D5OF 4NN6C 5DJDB 2DTMH 3O4LE 3FONA 5BV7H 3P4LA 5IESL 4NUJB 4RWYH 3RGHA 4BELD 2JJWA 3AU1B 3AM8C 4OGZA 4EIGB 3WXVL 4Y4KD 1MCIA 4XXCC 2APVA 2P45B 1IM9A 3PWVA 4U05A 1VFAA 5DRNB 4MJID 4GMSH 4Y5VA 4RQQA 1WBYB 4XTRC 4IS6A 3PHQB 4PS4L 4YDJB 4Z8FH 3TC9A 4WIQA 4D0BA 1FNSL 1RZ8A 2LAGB 2YSSA 5BJTA 4WY7L 2XZQH 3IU4H 3U83A 1Q9LA 3N0PB 3RDTC 3WE6A 4DKFL 4FFWC 2VL4A 1DQQA 2P47B 5I74C 1PD6A 2NCMA 4H1LH 2FH6A 1IGIL 1QBLL 3U6RB 2VIRA 5F7KC 3O2DH 3PWLA 3PQYD 4R8WL 4O00A 2PW2B 3UZQA 5IG7B 3BH8A 5EU6B 2GY7B 1IT9H 1G9NL 3ARWA 5BVPH 3O41A 4XCYA 1B0RA 1FGVL 1PFCA 5DMGC 4G7YH 4WHTA 3EYOA 2VXUL 1FLRL 5FGCB 4A6YL 2AJYH 3IS1X 4NNYB 5EO1A 3RWJB 2NR6C 4I4WB 4TSAL 5J9PB 1RUPH 2EDWA 4NKDB 4H0IA 3BN9D 4F2MB 4LPXA 2CIKB 3GEWB 2CUIA 3ESUF 4NO0A 4ALAL 2FIKB 5FB8B 3UAJC 3LQAC 4ONHA 3O4LB 4KHTH 5CJQL 5ESQA 5F9WC 3UTOA 4WFEE 2ADJB 3QXAB 1RUAH 3QDHA 4GW1B 2DN7A 3EIFA 1A4KB 2ARJA 3MBED 1BFVH 2BRRH 4H25B 5E2WH 1ZKAA 2AJ3B 3QNZB 4NKOA 1XZ0A 2OLDA 5T5FL 3FO2A 1G9EA 1X5YA 3MJ9A 1CU4H 3VRIA 1DBAL 4OZGF 3X13B 4LLAA 3B9AA 2D7OA 1WBZB 1EO7A 1HKFA 2Q8BH 3CFDA 4JFPB 3OHXA 2W0LA 2NY4B 3I50L 3RQ3A 5D1XA 3CLFH 4U1HA 4XNXH 3T3MF 3U4EA 1DP0A 3RBGA 1AC6A 1WV7T 2XOTA 1S5HB 2HKHL 3PGFH 1IC7H 2BVYA 3GJFK 4ZUSA 1OTUC 2G60L 1GC1H 5C7XL 4RMWA 2DYPD 1HDMB 2GJZB 4C54A 1GH7A 3ESVF 3ARFC 4JKMA 3S97C 3B8YA 3DV4B 4DW2L 2O26U 2DMCA 2FX7L 1KPRB 2GTZA 1JRHL 3F7VA 1WWCA 1T1XB 4TVPD 1FORL 1DQMH 1I7ZB 2ADIB 3MV7E 1ZGLM 4YC2B 3HZYB 2IJ0C 4BSVB 1C08B 2Q6WB 5IJKC 4QWWD 3BZ4A 1LHZA 4JFDD 4HFWB 1IGJA 4AEHL 1SY6A 4PGCB 4OLZL 3MRRB 4IRSD 4K8RC 3ALWA 3JTSA 3MJ6A 2WSKA 3DPBA 4HPYL 1NBZB 1N3NA 5HYSB 4WUUA 4G8GD 2ORBL 1DVFC 3TBYB 2AV7B 4U1JB 1N59A 4Q97A 2R2HA 1JF1A 3T1FB 5JZ7C 1HILA 4MJ4A 5AYUH 1OAQH 1QUNA 4K7PX 5BZWA 3TJHD 3TO4C 2PCPB 1T5XB 1CD1A 1MCPH 3GJFH 4TSBH 4HLZH 2ATKA 4X6FB 4K9EC 2YMXL 4M93C 1M7IB 4HUWA 4XMPL 5C6TL 4HC1A 4JRYA 1H3WM 5AWNL 3F6IA 4FXKA 4YNYA 1KTDA 4PLKD 2QKIB 2OL3A 4DAGL 3HRPA 2V5SA 2A73B 1EEYA 2QV2A 3KHOA 4AEIL 4HIJB 3LKQB 5HDLA 1RHHB 4GRMB 5E00A 3WEXA 3D3VD 1S9XA 5DJAA 5LBSL 1EGJA 1P4LB 2WIIB 2H26B 5CP7B 3HG1A 4HWUA 4X0KA 5HGAA 3O6KL 5GGVH 2B39A 3CFCL 4JFOA 5CEZL 1G7LA 4PGBB 5EU7C 3MV7B 4TUJB 3IDYB 3BPOB 1RK1B 4L4VA 1JCKA 3FB6B 4F15B 3RWIB 4JM4L 5IB5A 4OZIF 2FX9H 2JJTA 4I18B 2WLZA 5E6IB 3KXFD 3DBXA 3G08B 1DDHA 2J4WL 1QSFD 4YFEA 1CL7L 3TJEH 1JNNL 3BDBA 3MRDA 3SE9H 4NQCD 4Y2DD 3C5SA 3V6ZA 1UADC 1AGCB 1Q1JH 1U8KA 4JZJA 2EDHA 3HI6L 1KPUB 3MRQA 5EIIB 3IDNA 5JXEA 3WUWA 1MLBB 5BS0A 1NGXA 3SDCC 4D9LL 1FL3A 5F96H 1N0XH 4K2UL 2YEZA 3GDBA 5DA4A 4QHMB 2GQHA 4NQVB 4XCEB 2YPLE 5FUOH 1AQDA 3P30L 4NP4H 4BFIA 2HVJA 3MNVA 3C08L 3MTRA 3AMLA 4OD3H 3SCMC 5HHXH 4Y16A 3GB7A 1WC7B 3V5DB 4YR6A 4QKXB 2FB4H 3QIUA 3K74B 1HH9A 5DJZA 1GL4B 3U7WH 1UVQA 3BIAX 3H0TB 5HD8D 1XGRB 1CFNB 2P43B 1MEXL 1S7QB 3VH8G 2OJZL 5ALCL 3HUJB 5C0ND 4YWGL 4LPUA 2AK4E 2EE9A 2RFXB 4JLRA 1QFOA 2AXJA 2NLJA 3MGTA 3O2WL 4RRPA 4YBQC 3QDJA 4TRPH 3FHQA 1BQHA 3BGFC 5CD3A 3OKKA 1HK6A 5IP4A 3SDAA 3EZ8A 3MFFB 1FNFA 2WANA 4ZOBA 3OKDB 3BOVA 2C4FT 3CAFA 4HG4K 4LCCB 4QNPE 3BRGC 4LKXA 3L5HA 3GI8H 3GSVB 3O6MH 5DHVH 2J8UA 5I8KH 4RAVA 1U58B 3OXSA 3QXTA 1QYGH 5BQ7A 4N8VG 2Z31A 4P59L 2NX5A 1P7QA 3TWCH 1W0YT 2HN7B 3G5XA 3I75A 4UTBH 4YBHA 1CR9L 3GBML 4J8RA 4ZNEA 4K71B 3MRKA 1ZVSA 5D7SL 4LPVA 4TYUA 2AQ3A 3SJVE 5BOZG 1J1PL 5C3LD 4PJGA 1EX0A 3AB0B 1T2XA 3ARDA 2YPLB 2GT9B 3TA3A 5HY9B 4R26H 2I07A 3ZKXB 3BXNA 1MVUA 4HK0A 4N0CC 1FVDA 3O6FA 3QI9B 1DLHB 3U46B 1B6UA 3EDFA 4JM2B 4N1CA 5IVXA 1CGSL 4P99A 4XBPB 1JGEA 4LSSL 4U49A 3BZFB 2Y36H 3HI5H 3VA6A 1S7WA 4K3JH 4KY1L 5E7FA 1JNLH 4WWKC 5KSUB 1C5CL 3IGAB 3GSWB 4HX1A 2AK4B 1G7IB 1HHHA 5I17A 2R56H 3IYLW 4PB0H 4YHIB 1W0VA 5GGSB 4XX1G 1CT8A 3TCLB 2GK2A 5EO0B 5KVEH 3UBXI 5EU6D 3QQ3A 2I9LA 3W5MA 1A1NB 5BXFA 5GGRB 3GSUB 5AD0B 4N90E 2ITCB 1IGML 4NDMA 3RVXD 3V6OC 1RZIB 2O5YL 1LDPH 3D9AH 3MRNB 1U8IB 2XG4A 1A7BA 3TBTB 2DQCH 3NCFB 4W6WB 3AFLA 3SGDH 1DQJA 1K9TA 4IOFD 1OAYH 3FB8A 1SEQL 4PRAB 1XF5B 1CYGA 4NT6B 1O5DT 1JJUA 4KMTL 3U7YL 3ZDXF 5IMLA 3BKMH 3FQXA 4CW1B 4HMEA 1YC8A 5E8EA 4WO4C 3SJVB 3QBTB 5INDA 1NLBL 2C3GA 4P5TB 3VWJD 4KV5E 1UH4A 2DQEL 3QJHA 3ULUL 1KENH 4G3YH 1J0ZA 4N9GB 4Q9BA 4ZG1A 1EDQA 1KTKE 3WD5H 4LLDB 1UYWH 4NWUH 3KGRA 4UU9A 3MBXL 3AGVA 3IS0X 5FHAH 5EWIL 1S8DB 4W70A 4WW2F 5JDJA 3L3GA 4LLUB 5L2JB 4OM1H 1U36A 2H2PD 3KJ6H 1XGPA 2JK5B 5JORA 4JO3H 5E2JA 4JGMA 1UWEL 1MIEH 3HMXA 3BKCH 2QHRH 3MOQA 2VABA 4UIKL 2UZYB 2FJHB 5T33L 2NXZB 5IB3B 4O5LL 1AD0A 1NBYB 3UTTA 1X7QB 4YIQA 4FXLA 1BQLH 3KPPA 5EIQA 1WGOA 2YA1A 4ZTPH 2XKSA 3UP1A 5LCVH 4M6OH 3HNVH 4WEMB 3FO1A 2NNAA 2EC9U 4DGYH 3JWOL 5CJ5A 4OZ4B 3PWJA 1HXMA 2DLFH 5CLWA 1Y6NR 4C56A 1LEIA 2XXCB 3JWDL 3PP4L 4HMDA 4JREC 5DVKA 4Y5XC 2W60A 3ARBA 1D9KB 3OAUL 2VKXA 4LCWA 3S36L 3NABL 1LGVA 1MCOH 4DOHE 3R8BB 1UT9A 4FQXC 3OR7B 3H9SA 4WFED 1UB6A 2VISA 4XNUH 1FFPB 1CGXA 3QUZA 4LGPB 3MV01 4JE4B 3RJQB 3SBWA 3FONB 1NC4A 3FOMA 1RURL 3DIFA 4ZPTB 4ZQKA 5I73B 2OTWB 2VLME 1JPFB 2PR4H 3LKSB 5GGUB 3ZKND 1ZOXA 4XNQA 5TQ2L 3WNPA 4EDWH 3B9KA 1MUJA 1DSFL 1IM9B 3PWVB 4RFNB 3TZVD 1VFAB 3V5HA 1BIIB 4DTGH 2YC1B 4Y88A 1N5YH 4RQQB 4H5SA 2XRAL 5HHMD 1VKXA 1EHNA 4IS6B 2JB6A 3CU7A 4YE4L 1HQRA 4KUCD 2HLFD 3QO1B 5BJTB 2ZCHL 2DMBA 1J0HA 4MQTB 4PY8I 1KJ2L 4PGZA 3LKPA 3WE6B 4LKCA 1LE9A 4XNMA 4I48B 3CVHA 1BGXL 1IC4L 4ODVH 4FQ1H 1RZFL 3TVMA 5HHQA 2VIRB 4BQ8A 4Z7NE 4HT1L 3PWLB 3CFJB 1EJ6A 1FAKT 2BFVL 3NCJL 4HK3J 4LVOC 3EO1A 2QHLA 3NAAL 4S1QL 1DUYA 3MV7D 3NTCL 1C7TA 3O41B 3UPAA 1DZBA 4AIXA 3NIDF 4LOUC 4WHTB 4XP5H 3EYOB 1X5IA 3UZEA 3MLSL 5KAQG 5C0GA 4TUKL 5EOQL 3K46A 1T5WB 4FQLH 1BJ8A 5E6ID 4MNGA 3P9MB 4DOHB 1BFOB 2D0GA 3VFPA 4DZBA 4YQXH 2FATL 1HSAA 4BA8A 1KYOK 1OP3K 4J3UA 4YLQT 5EOTA 3BSZH 3Q5TA 3LHPH 4OGAD 5D1QA 2XFXA 2XTLA 3O2DA 5TFSL 3RKDC 1A02N 3P0YH 4M7LT 1R3JB 4P9HC 4Y2OA 4XB8A 1KFAH 4WUUE 2NY2C 1E6OL 4DVBA 1U2CA 5I1HL 1RZGA 3M45A 2ARJB 4MAUL 2EDBA 5GS0H 5FM5M 2R2EB 2DD8H 4LVHB 4P57A 3WDHA 1GHFL 5B38G 3U0WL 5ECJE 3WIHL 4F58L 1BQUA 1GSMA 1LQSR 4G9DB 4NKOB 5MENE 3QUXC 4EJ1C 1A5FL 2EIZB 4LQFL 3AS3A 4CU8A 5GHWL 1J1XH 4J1UB 4POZC 1KLUB 5ADOH 3C9NA 1EXUB 4N8PA 5T5NF 3BYTA 5HBBA 2FHFA 5D1XB 3U4EB 3OGCB 1U95A 2Y6SD 5KZCB 3VFWA 1HWHB 3M17A 2QQLL 2Z4QB 5DLMH 3ZYIA 1OP3H 4NO2A 1T66D 1C5BL 1JYVA 3MSPA 2XWJA 3SOBH 2YD6A 3HG1E 1A3LL 2AEIT 3C8KA 3HZMB 3MRBB 1JV5A 5EZLA 3VXSB 1N26A 1NMAH 1UXSB 2GTZB 1HKLH 3QJFB 2FO1A 3F7VB 2UZXB 4L5FH 1KELH 2BNRA 5HGDB 3E3QE 2I26N 4OZGA 1OPGH 4OD1L 4NZDA 4BFBD 4FQJL 1QRNA 3STZA 1RIVL 3V7AG 2C5DC 1U8MB 4M9OA 1UACL 1NCDL 3BZ4B 4JVPA 4CVZA 1RZKH 3V52L 4RISH 4JY6A 1IGJB 2BOBA 5E99H 3QUYC 4AENB 2JKXA 3Q3GB 1KN4H 3TLRA 4LLVB 1DANT 2HT4D 1C8PA 1PKQE 3MZGB 4WUUB 1KXVC 1IJ9A 1Y0LA 2A1WH 2FWOA 4LLWB 5IHLB 5EZJA 3U9UA 1OGAA 2R2HB 4F7CA 2BNQD 3CMOH 1A6UL 1HILB 1S7RA 1S7UB 1KB5L 4K94C 4APQC 1CD1B 2YPLD 1C1EL 2R0WL 1ACYH 3HC0A 5BS0E 5MENB 4S11A 1RZJC 2NZ9D 4HUWB 2F15A 1NGZB 2AI0H 1OWRM 2D9CA 3H42H 4M1CC 5IOPA 1CL7I 1TQCB 4ZUWA 3KYKH 1ZLVK 2OL3B 1UWGL 5C8JB 1OTTD 5FGSA 3HTLX 5DD6A 1XF4A 1CDHA 3BISA 4M43L 4IOIA 2A6DA 3SY0A 2P8MA 1ZK9A 3CGTA 2BMKA 1U6AL 5ETUA 5DJAB 3ZE2E 1IGFH 1XGTB 4BFEA 3L7EB 3GJFA 3HG1B 3IAGC 4Z95L 3QCUH 4X0KB 3QHZL 3EOTL 5HGAB 4UIMB 3BIBX 1KTLA 3HNSL 4KXZI 2VYRE 1L9MA 3EDJA 5DMIH 3V0WH 1UA6L 3BAEL 4PJ8A 1G7LB 1BIHA 1D5MB 3OPZL 1G7PB 3PHSA 4FMFA 4PBWD 3RVUD 2P5EE 3DLQR 5K9QG 1PG7X 4K55A 1BBDH 3QDJE 5IB5B 1XGQB 3IFOA 1OD9A 1HINL 1DDHB 5I1EH 3UTSA 1PX3A 1PKQB 1WICA 1ZLVH 2X4PA 3C5SB 5DJ2B 3V6ZB 1NGQH 2IBBA 3VI4F 4JZJB 4J3OC 3MR9A 5FHBL 4E0RB 4N5UA 2NX5E 4M62H 3IDNB 5HYQB 3WUWB 1ZANL 1T83A 3REVB 5BS0B 1BZ9A 4R90H 1J0KA 3MUGB 4KKBC 5TDOB 2LTQC 1PY9A 3DVNA 3CFEA 3QPXH 4PLNC 4PJGE 5DWUH 3BWAA 1V7MH 4OZIA 2DQTH 2C1OA 3O3EB 4NQXB 1NH6A 5C09D 2K7PA 4BFIB 3HMWH 5DTFA 1T0NA 2HVJB 3B4NA 1RU9L 3MNVB 1P4BH 5DJXA 3HB3C 4RGOH 1NAML 5GGTH 5E2TL 2D7MA 5DVLA 4MS8D 3T2OA 3MLWL 3MYJB 4DZ8A 1IGCH 3F7QA 3QIUB 4X7EC 5DJZB 4KI5E 4NSKB 1CXEA 2A9NH 4IIQC 4JFFA 4HKBA 5CZVH 2NXZD 5IVXE 2Q20A 4NWTH 3L7FA 5BO1H 3RAJL 4JPIA 5J06A 4PUBH 3B8SA 1R5VB 4F3FA 5CSZA 5C9JA 4X7CC 1A6PA 2B8OT 4H20L 2QQNH 3A6BH 2A38A 5FCUH 1HHJA 3INUH 4U6VL 1NGYA 4P23D 3VFUA 2P5EB 2GIYA 2X1XR 1KIPA 5LGHH 4ZFOA 5A2JH 2AV1B 5IB1A 1NGPL 4WENB 2IFFH 1N8ZA 5CD3B 3QDJB 2VLRE 3OKKB 1CICD 2HRPL 5JIKA 3SDAB 3QCVL 1D5XB 3SQBA 5CS7A 1KJ3H 2F58L 4LK4A 2F8XC 5AZ2L 4JDTH 4FFVD 3BKJH 3CZFB 4NRZA 2HJFB 1B9ZA 1A21A 1D9KD 3AXLA 4ENEC 4RAVB 3S34L 4MXQD 3LEVH 2BZDA 2VAAB 1PW3A 2Z31B 4MDIA 2NX5B 1P7QB 3I75B 4HIEA 4PRPA 3KYNA 2DM7A 3MCKA 4K7FA 4HBCH 3BEVA 3GMQA 3MROB 1PYWB 3WJJA 4LAQL 3ARUA 4JFHE 5I8OH 2I60H 4PJGB 3FMGL 2EDNA 2VAJA 3ARDB 4M3KB 1U91B 4V1DA 5BVJA 3KS0J 5A2LH 3BXNB 1MVUB 5JO5B 5DHVA 3MRMA 2G75A 4NQSA 3GGWA 4RSVA 3H9ZA 1CDBA 3H9YA 5IK3B 2JELH 2XZZA 3IKCA 3NH7H 3NCCB 5IVXB 3HAEB 1IAIM 1JGEB 1SBBA 1KACB 3MV8A 1TVBA 2P8LA 3P3YA 1EO5A 3S4SG 1S7WB 1U3HA 3RRQA 2CO6B 3VXRD 3OKMB 4EQ2A 4M8QA 3OJVC 4KROB 1QG3A 3QXDA 1BECA 1FL6B 4R0LB 4MHHI 5I17B 5LGKA 5EBLA 4XCFH 1W0VB 3O6LH 3D2UD 4RZCB 1CT8B 5KJRH 1IFHH 1WISA 3FN0L 3OG4B 4GAGH 2VLRB 1TVDA 3LEYH 3QQ3B 2I9LB 3ZT6A 32C2A 4QYOA 5KN5B 5BXFB 4U7MA 3O3AA 4P5MA 4TOYL 5C71A 1K6QL 1I3VA 2OI9B 4NDMB 4GG8B 4DUVA 3MLTA 2R0LH 4X9FA 4TQEL 2NY0B 1MWAB 5IFHL 3FN9A 4P2OC 5EU4B 1DQJB 5EPMA 1H8NA 1I1AA 4M1GH 3QAZC 1JZ8A 1MCHA 1MIMH 4OZFH 4CN4A 1TQBC 1MAML 4CMHB 2ZG3A 1CZ8H 1YNLH 4O2CA 1RIHL 2WP3O 4ZDHA 3FQXB 5E8EB 4PG2A 1KN2L 4OFKA 1UENA 2VLMD 3BYYA 4BKLB