2Z4QA

Crystal structure of a murine antibody fab 528
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
b'DILMTQTPLSLPVSLGDQASISCRSSQNIVHNNGITYLEWYLQRPGQSPKLLIYKVSDRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYYCFQGSHIPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPRDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti egfr antibody fab, light chain
publication title Thermodynamic consequences of mutations in vernier zone residues of a humanized anti-human epidermal growth factor receptor murine antibody, 528
pubmed doi rcsb
molecule tags Immune system
total genus 48
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2007-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z4qA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z4qA01
5HTSA 1WZMA 3QIUA 2YA0A 4X6EB 1TNMA 3ULUL 3MFFA 1KTLB 5CKGA 4HBCH 2EE3A 1QBLH 1TIUA 3P9LB 4QF1A 5AD0B 4WO4A 1SYSA 4JLRB 4U2ZA 4M93B 4LRIA 1CFVH 3G6JB 5CSBA 3QHFH 3DO7B 4G3YH 1GGIH 1YEEL 4IBLT 2IPUK 2P24A 5JW3L 1TJIL 2FJFB 2VKXA 5FOBB 2Y06H 1T20B 2NW3A 5HDOA 1MJ8L 4NRZB 3PUCA 4M6NL 3F7YA 3WXWH 3D3VE 5J56B 1E4XH 3KWWA 3O8XD 4Z95L 4X6CF 4LPUA 4XCCH 1BM3L 4PJEE 4RWYL 3ARZA 3OQ3B 1BVKB 4MJIA 5E0QA 1IGFL 3WN5C 2EECA 4PJ9A 5E00A 1OPGH 4UNTA 5FO8A 5E08H 1T0MB 1DBKL 3V0WH 3UTTE 6FABL 4Y5VC 4XVUC 5JPNB 2X5PA 1BVLB 5JA8B 1PSKH 2FSEB 4OZGA 1CE6A 4M9PA 1ZLUK 5FUCC 3B2UD 1CBVL 1XIWD 1QSED 2VDQL 4X9IA 4XVSL 4H20L 1YNKH 4QTHA 1KYOK 3BW9A 3IDMB 1WCBA 5LAXB 1O7VA 2QR0A 1J0HA 4FFWC 3EOBA 5GRVK 2BFVH 3GSQB 3MGTA 5CJXA 2A77H 3T4AB 2EDHA 3UTSE 4I2XE 2W9DH 4LEXH 4MQ7B 4EI5C 4YAQA 4NNYA 2OBGA 3BSZL 1AGEB 1W0VB 3MLUH 4MSWA 4QY8B 3L3DB 1LEIA 3CPLA 4EUPA 4RFNC 5I1JL 5C0CE 2DBLH 2O5YL 4JQIH 2ICWI 1KXTB 1L0YA 4FQ2L 3TF7C 1EEYB 3TN0C 2OL3H 2OQJB 5ACZA 4Q6IA 3MRCB 4R2GB 3GSUA 3QDGD 5HGDA 4ONFH 4UT9H 5D71L 4F7PA 1MCFA 3MLSL 3F7QA 1WLHA 5HGAB 3ARUA 5DS8B 5JW4R 3OV6A 2V2TB 2WW8A 1BQHB 4KU1A 2NNAB 4X4YB 3B5GA 2RB8A 4EEEA 4X6DB 3NABH 5FCSH 4FQCH 3EYQC 1IGJB 4GRMB 3ZDZE 4MJ5A 5HDLA 3VD5A 4OCMC 5IVXB 3MRMB 4X4XB 1ZVYA 4DWHA 1LK2B 1A2YB 3P11L 2JCCA 3WO4C 5BXFA 1MFAL 5K9KA 1ZT7A 4WJ5A 3WFHB 5F3BB 3ILPA 3U9PH 1FSKC 4RISH 4JY6B 1IFHL 5JW4Q 2MFNA 5KS9E 2C4FU 4KUCD 3MJ9L 3U36B 1IC5L 1EEUA 4HXBL 1GGUA 3HZYB 1D6VL 3MCKB 2GJ6A 5C9JB 1K5NB 1I4FB 5AUMA 4Y0GA 2GSGB 1CDUA 2GW5A 4QOKA 1LNUA 1QFUL 3CFIC 2AXFB 5IB1B 1BP3B 2FIRT 4X98B 5HGHA 5FO7B 3ARDA 3O3DA 1D6EA 3RWDB 1FNEB 1PZ5A 4V1DD 3IU3A 3GBMH 1HZHL 3H9ZA 1P4LA 2CLRA 3VA6A 1T03H 5D5MB 5ILTL 2X1PA 2RBLA 1WITA 2D9CA 4BFIA 2ZG3A 5TDOA 3DURA 4UOW1 1U8KB 2AI0L 4CU8A 1RJLB 4NZJA 5DQ9A 3CUPA 3GO1L 3HR5B 3VD7A 2BJML 2BP3A 2DIAA 3QT2A 2A6IB 4IDLA 2OR9H 5F97E 2HTKD 4IIQB 2NYYD 1CF8H 3UTQA 2X89A 5FYKH 4QRRA 4N0YH 1FG2A 5DJCA 1S9VA 3QUMB 4QNPE 1U3HD 4HUXB 4IOFD 1LE9A 4WUUE 1V8HA 5KANG 2ZP0T 2VLLA 4HJGB 3DGGA 4FP8H 3CX5K 4Y8DC 3DUUB 3CLFH 5IB4A 3ORJA 2EKSB 5CJ8A 1AE6H 3PP4H 2WWMC 1EIBA 3FO1B 3RWIA 5C0JB 1T1WB 5JR1H 4U6YA 3LKRA 2VN7A 4QXUH 4Z78B 2CLVA 3RY5A 3ULVC 5GGTA 5SV4A 1JK8B 2EYSB 1T21B 4KQ4L 5E9DE 5EUKA 2F54D 4L4VD 2XKSA 5FYJE 3N50A 1PW3A 3PWJB 1INQB 5C0RH 4PR5A 3QDJB 2F9BT 2ZJSH 5MP6H 5C2BH 4EVNB 2P46B 1ZHLA 2ICWA 3Q5TA 4MDJB 4POZC 3GKZA 3HPLB 3OKKA 3LV3A 5EC2A 5HHQA 1WZLA 5KSAA 2K7QA 5HYFA 4XP4L 4Z76B 1T1YB 1EH9A 3QWOB 4KJQD 1AQDB 5FGBA 4MNQD 3WJLC 3UYOD 3DRQA 1W8OA 3T09A 3WE6B 3FZUD 2ZUQB 4D0DB 4JANA 2ZCHL 1XCQB 2FO1A 5TPWL 3UYPA 1OQXA 2HT2D 2BXZA 3F58L 5DMIL 5KVMC 4HUVB 1NMCB 2CDGA 4KJYB 3AY4C 3MRPB 4I8DA 4JDVB 4U1NA 3MRRA 3IJYB 2HT4C 5FB8B 2ATPA 1NGPL 3LRGA 1VFOA 2GJJA 4JRXB 2NY3D 5D7KE 1A3LH 4P5TA 3PXHA 2X7LB 1MCEA 4APQA 4JM2A 3UTTA 3MV9A 4CGTA 2RFXB 2PR4L 5E5UB 3ARSA 5CP3H 2P8LB 4I4WA 2EDFA 4ODUB 1Z9MA 4FNLL 3Q1SL 2UUDK 1ZLWK 4G6JH 5I74C 2H2PC 4MX7A 1X5HA 4I0PD 4K8RH 3OG6B 5JOEA 5GSRB 3QG7H 5IESL 3UTSA 3HLAA 1G6VK 4JVWA 4D0BB 3N1PC 3VXQA 4S1DD 1F4YH 2GK2A 1HWGB 3HE6D 4NQEB 3EFDL 2JK5A 5J4MA 2WLZA 2VAAA 1CT8A 5A43C 4K3EH 3BRGC 2IBGA 3OXSA 2ZNXA 3BZEA 1HEZB 3D5OF 3TESA 1NH6A 1P7QA 2J88H 4IRJB 3BP7B 3MV7D 5SX4H 2VDNH 5F7HA 3UXFA 1DLFL 2QV2A 3KAAA 3L3JB 3M8OL 4E0RB 3KNBA 4JPIB 5C70A 1LO0L 2AQ1A 5I18L 4LIQL 1NJ9B 4F15C 5DVOA 4P9MH 4PJ5D 4MS8D 1MAKA 3CVIH 1ZT4B 3QDMA 1QBML 5CBEA 2DQFA 3W9EB 4LF3B 3HFML 4HIHA 1K3IA 3A0OA 5I76A 1HIML 2UY7A 5IKCA 2FB4H 3ZTJH 3MUJA 1JPFB 1QHOA 4OJFH 3U9UB 3QEQD 3U30C 3MO1B 4H88H 3GIZH 4U1LB 1S7VA 3X11B 4GAYB 1Y0LA 2VH5H 2LE9A 3QH3A 2WIIA 1AD9A 1JRHL 3B9KC 1I1AC 3QZWA 5KS9A 1UH2A 1XF3A 1S9XA 3KJ4B 3SDAD 1QYGH 5SWZD 1NGXA 3DBXB 2EYRA 4ZOEA 2ZOKA 4JHWL 3O0RL 1JPTL 1T2QL 4GXUM 1HINL 2VUOA 4WFEE 5DQDH 2XT1B 1RK0A 2HP4A 3KLDA 2GCYB 2J4WL 5CZVH 1XGQB 3MV8A 1PG7L 5CEZH 1JNHB 5J1AB 1L0XA 1MFDH 5FECA 4S10A 1RULL 1C16A 3BZFA 3FFDB 4CDGC 2VJXA 4DVRL 3RWHB 4XNYH 1CG9B 5IHLB 2DQUL 5DMGC 1MCOH 3I50L 3L3GA 5F7EL 2BRQA 2Y5TA 4HEME 4LHUB 3G04B 5EWIH 3JWOL 1ND0A 1OF2B 2X10A 3L3OB 1FVEB 1KCUL 4PRPB 4XPBL 5FGCE 5C0DB 2KL6A 4HQQH 3T65A 1YY9D 3OJVC 4FQQB 4YDLB 1LDPL 2VL5A 1S3KL 1UB6B 1Z9LA 1ZWIA 1G7JB 5LBSL 1T6WA 2ZCKL 5J89A 1WC7B 4PJ7E 5M95B 3HZMB 1G7QB 2OJZL 4JZJA 3AU1A 1AP2A 1UWGH 2MPAH 4WUUA 3TBYB 3CDGB 4KROC 3CFDA 4UU9B 2V2WB 2X4TA 1S5IH 3FQNB 1OTSC 3QJFB 2ZUSA 3TJEL 5I1HH 5E94A 4XNUH 4JHAH 1HI6A 4C56E 3L7FA 1IZKA 3BAEL 1A9EB 2HLAB 2BDNH 1WFOA 1NCCL 1R24A 3T0EC 1RVFL 4DAGH 4UT7L 4PS4L 4G6MH 1JWMB 1OTTD 3WS3B 2OSLA 43C9B 3IXTA 5E9DA 1MVUA 4XP1L 1UXSB 3HE7D 3NIGF 1NGZA 5T33L 3QRGH 3HMXA 1EUUA 4XGZB 1Q9KA 3FN0H 3S3JA 1CDYA 1OGAB 4JR9L 3RUGB 2MNUA 4WW2F 1MVFA 3D25A 2ZSWA 1AHWC 4NO0A 3QUML 3Q48A 5F7KC 5T3XL 3IS1X 4LASL 5J57B 3MLZH 2PXYD 4PPTA 4Y2DC 1JMXA 4HF5H 2AAVA 1AFVL 3RY6C 4JZOB 4U0RC 2WSKA 1AY1L 4R90H 3KYKH 1V5JA 5ICYA 5D7SH 2VDML 3S5LA 4NKMA 4NM4L 1AO7E 3MLXL 1OHQA 3GMRA 3IDUA 4UDTA 5BS0D 4OLYL 4WCYL 2ILLA 4IJ3C 5FYKU 1YNLL 3MA7A 3BKCL 3LEXB 3QIBD 3QWQB 4JFED 2QADC 3GSXB 1YEKL 2R1YB 2DAVA 3H9HB 1VFAA 3MR9B 1YEGH 3BIKA 3IDJB 1LO2L 1B9ZA 5I2IB 2HYMA 5DR5H 3CU1A 1KGCD 2ED8A 3VCLA 5I16B 5MEPB 3P4NA 3T0DA 3QEHA 4HW6A 4D8PB 2RQ8A 4WW2B 4WO4D 5HDBE 4C59B 1YY8B 2E6JA 1EFQA 1RMFH 4JKPL 1L7TL 4IRSA 3VG9B 3SE3C 2X2YA 2H26A 3ROLA 1I75A 4TUOB 5CINL 4OV5B 1LE5B 5L2KE 4PRHD 3QULA 1IGIH 1NAKL 4KTDH 3B9EA 1N6VA 2OCFD 3CMOL 1Y18B 1OAXL 4HUUA 4KRMB 5DO2D 1DBAH 4ODXB 5ALBH 4DFIA 1A14L 4KKBC 2BNRB 2VXVH 4K3HA 5J13C 2IFFL 4LLDA 4JN1L 4YXLH 4RX4A 5IMMB 2C3VB 5ACMA 2IJ0C 2H32B 2NY6B 4OBRA 3SGJC 3LKOB 1QLEL 1I9JL 4LDLB 4Y4KA 1RZ7L 3SCMB 3K1KC 3UTOA 1GXEA 3P9WB 1INDH 1MJ7L 1Q1JH 5CD3A 1QSZA 3MLWH 2QQKL 3UP1A 4H26A 1NGQL 3Q0HA 1OY3B 4PRNB 1CICC 3EOTH 2NXZD 1DDHA 3ARQA 3P77B 3IB4A 4NQED 4YGVB 5FM4A 4OUUB 3W2DL 4U05A 3RI5F 1A7NL 3AAZA 3G6JE 3PP3K 3D85B 3SBWA 5L2JA 5HJ3B 1JPSH 4H25B 3MBEC 4LVNC 1P7HL 5J1SC 3O2VH 3NOIA 5F72S 5TDNB 3MRBA 1VB9A 1V3JA 3WKML 4XBEH 4K71C 3KPNA 5B3NA 5B8CB 3NCCB 4XZUA 1S5HA 4QRSB 3MNWA 3RZCC 4LLMB 3MROB 2NY4D 4RDQG 2AEQH 2AK4B 3MRFB 4UV4L 1GCFA 3F62A 3UZQA 5DVLA 5AG9A 4UDUB 5E2WH 1PLGL 2P42B 2BMKA 2EXWD 4B7IA 1YUHA 4R3SB 1A6PA 1A6UH 4DVBA 1D5IH 3QXDA 5TFSL 4NWTH 4C83A 1HK6A 2OZ4L 3OAUH 4MQTB 3BP6B 1BQSA 3O11B 1U8PA 2HVKA 3CFCL 3MJGX 3SKUD 3ULSA 4Y5XA 3EO9L 4NNPH 4BH7A 1IC7H 4HWNA 1FRGL 4H0IA 3DHMA 3CDYA 4JJ5A 4YWGH 5E24E 3EKCA 1QOKA 3D9AL 1UH4A 3WNNA 1CFSB 1OM3L 5DJYA 1JGLL 1XGTA 4W4NA 2HFGL 3G9VA 1QNZL 4FQIL 3TBVB 5BRZB 5HD8C 4N8CH 4YO0A 3SE8H 4WV1B 1ZA3B 3PV7A 4YE4L 1YECH 3FOMB 1JNLL 5HHOD 3S35X 4P3CH 4Q0XH 1BX2B 1UM6H 1B0GA 4PREA 3GMMB 3OF6D 1BIHA 4P2RB 3O2WL 5JHDE 1UQSB 4Y1AA 4XMKL 3HMWH 2J5LB 2NZIA 2Z31A 3RWGB 2RIKA 4OD2A 1NPUA 3C5JA 4PGBB 4YHNA 1ZK9A 3OR6B 1QD0A 3MACH 3LVEA 5T1DH 3SQOH 4I18A 5ADOH 2PYEA 2NY5C 5ENWA 1P4IL 2VZUA 3T4YA 4X7TA 2GEEA 4X7FC 3HNSH 2R23B 4QRRD 5IFHH 1Q0YL 4MZ3A 4I9WE 1FFRA 3IKKA 3WDHA 4OUOA 1P5UA 3I75A 3I6KB 4LKCB 3V79C 3F5WB 5GQBA 3QG6A 4H8WC 5TE7L 5IGXL 1SHMA 1SJEA 5DRWA 1IGML 1BPVA 3K4AA 3EDJA 1SJHA 1A4JA 2A1WL 3Q5OA 3V52L 4H1LG 2WUBL 2AEPL 3PHQB 4KV5F 3O2DL 1AO7A 1DVFC 4M8QB 4UTBH 4ELMA 2NCMA 1M1SA 3MREA 1JMZA 4KMTL 2E3VA 4LARL 3E6HB 2BRRH 1OGAD 2D7TH 1JNNL 3QIWC 5GZND 2Q6WB 1JRHI 4QRPB 3SDDD 4I3SH 1FGNL 3EJYC 2NR6C 2XNAB 1W72B 4GRLD 4M62H 4PY7A 5BV7B 3PXJA 1P9MC 3EJZD 1NC4D 4OI7A 2YSSA 3MRKA 4Y88A 4XP9H 1XGPB 4JPKH 5CEXA 4Y5YB 1AGDB 5DT1L 7CGTA 5KAQF 5ANME 1WK0A 4CN6A 3QJHA 6CGTA 1MFBL 4QHMA 5L0QC 5A2KH 1F11A 1EJ6A 5J12C 1KEGL 4RMVA 3C2SA 1XF5B 1HOCB 4XBPA 3RNQB 2HJLB 5D9SB 3VFMB 5D6CA 5GGUA 3V0VB 3N1QC 1G6RH 1ZANL 5HHNA 1CLYH 1XH3A 3D3VD 4MJ6A 4KY1H 3RWJB 4CMMA 4LLUB 1A1MA 4CVWA 2NW2B 2XG5A 1Z6JT 2CSPA 3BO8A 2W65A 2GTZB 3FFCA 1YEHL 5D7JA 1UEMA 1IBGH 5KOMC 5DMYA 1DQJA 3O3AA 3QDHA 4PJBE 1IC4L 2ADJB 4TVPH 3DMMA 3GK8H 1V7ML 3DLQR 3ZTNH 3SO3B 2DWEB 3K4DA 4UUJA 4ACPA 1HHKB 1E6OH 3VGGA 1U6AL 4PLJC 2C3WA 2I9LB 4YDIL 3MZGB 2JF1A 4QXTA 4NRYA 1KC5H 1AJ7H 1I7TB 5D7LB 1E27B 1IZJA 4WEBL 2MWCA 4J1UB 2X9XA 1A3RH 2R9HD 4OZFH 4UQ3B 5FK9B 3QO0B 4DKFL 3BX7C 1KTLA 1NFDB 4NO3B 1U58B 3UTZB 3P9LA 4L3CA 5AD0A 4AEHL 3C08L 3G08A 3G6JA 3IF1B 1R0AH 3DO7A 4LLVB 4I13B 3UO1H 1YC8A 2NPLX 4P59L 5DZNA 4S11A 5FOBA 5C0CD 3CK0H 1KPUB 2AW2A 1KPVB 4M48L 1RZIB 3EHBC 4NRZA 1MFEL 3ILQC 5DDHB 3C5ZC 2I5YH 1FPTL 4ZFFB 3IU4H 4MWFB 1HDMA 4G6AC 1WVZA 2CXKA 4PRIB 3CZFB 3U7YH 1BVKA 3I9GL 4PJ7F 1UCBH 2D03L 5T1KD 4YR6B 1HE7A 4LAQL 5DEFB 4Y4FA 2YXMA 3ETBF 4KI5F 2DQEL 5F6IC 3VI4F 1J05B 5EOCH 3AB0C 1T0MA 3IFNH 1FN4A 1BBDL 3NZHH 5B38B 5GRJH 1RUKL 5JPNA 4JN2B 3UC0H 4EZMA 2Y1VA 2FSEA 1CLZH 4J4PC 5DZLA 3PWLB 4M6OH 2DTMH 2OXGA 1QPXA 1NEZA 5AAMA 2IGFL 3IXAB 4R4NC 5LAXA 3ME0A 4ZS7L 1QKZH 2AK4D 3GSQA 1PFCA 4MQ7A 2VXUH 2YEZB 4RRPG 2YPKB 1MRDH 1JHLL 4QY8A 5I1IL 2NXYC 4ZO9A 5HYJB 5K9JL 3BGFB 4NZRL 4YHOL 1TETH 1NMBL 1W0WB 1EEYA 1FIGL 3ULVE 2OQJA 2RCSL 2F58L 2R1WB 3GKWL 1F4AA 3CDFA 5DRNA 5C0IB 1TQCC 1X4ZA 3CFBB 4PJ8B 5DUMH 1JZ6A 2R39A 2CLZB 3P0VH 1EAPB 2NZ9C 1XGYL 4P2QE 5DS8A 5ADPH 2BNQD 2NNAA 4L3EE 4P0DA 2XQBH 5HHXH 1FAKT 4X6DA 2HFEB 3U6RA 3UMTA 5F7LB 2P5EE 4Z7VE 1ORQB 4PJGE 4G43A 2IH1B 2EDXA 1UWXH 5BRZD 5ALCL 2BK8A 5IEKA 4YIQB 5IVXA 3MJ8B 2A6DA 3TVMC 4AL8H 1GGYA 2W07A 5GS3A 1GYAA 1MFCL 3I3DA 1WZKA 1BD2B 2ZPKH 4PV9B 4XWGH 4KUZH 4LCIH 4MJ2A 3WFHA 2Y9RT 4JGJA 4TULH 3SGDI 1T83A 2N1KA 4ESKA 5H37G 1J87A 1A9BB 2XPGB 4D3CH 4BSWA 3MCKA 4P2RD 3SJVB 5C9JA 3FN3A 1CDBA 1CQKA 1T7XA 1IQDB 2DQIL 1K2DB 3WSQL 1HQRB 1FL6B 1RZKL 1SJVA 2WAHA 2AXFA 4MA3A 4X98A 5FO7A 4HIEB 5I1CL 2YBRB 4KXZI 1FNEA 4WWKB 5FYJD 5D70H 5D5MA 4ORZC 2IPTL 1JHTA 1AD0A 2OX5A 2Q86A 1MHCA 3H42L 4NYLA 1D5MB 4PV8A 5FYJL 1U8KA 2VZ1A 1RJLA 1S7TB 1JJUA 2UWEE 4JKWA 4NO0D 3HR5A 2WWKT 3IAQA 3NTCH 4EI5A 3OAZH 2B4CL 4OSUL 5FYLH 1ZA6B 4PJFE 4J3UA 1KPRB 3T3PF 4PJCF 2YUWA 4IIQA 2QSCL 5JOFB 2WQRA 5DJ2A 1PX4A 2X1OA 3MTRA 2YPLE 2R8SL 4HUXA 4X5LA 3NPSB 1KUMA 3BH8A 4H5SB 5F7YC 4JY4B 4HJGA 1UWEL 3V4UH 3VXOB 4D9LL 1WUNT 1N26A 4NRXB 3MOAL 4OCYL 3QNYB 4LGSB 2A38A 3NA4A 5MERB 1FNSL 1SEQH 3FO1A 4U1KA 1T1WA 4BJLA 1FFQA 5J06A 2VKWA 1HN1A 3GHBH 1WGOA 4PJBA 4TNWK 3DHJA 5D7KD 3WIIL 2XACC 1JK8A 2EYSA 1T21A 3RU8L 4NCC2 5EO9B 4XNXH 1W72L 5T3ZE 1SBSL 2Y07L 3DRTB 1KJMB 1LVEA 4YHIB 5GGRA 4YDKL 2FX8H 4HBQA 3PWJA 1INQA 3CAFA 3GJEB 4LLWB 3U1SL 1EO5A 3QDJA 4OCRL 2KPNA 2VDKL 3O6ML 4EVNA 1DP0A 3F7PC 4KKCD 5IB5B 4DJMA 3IAPA 3HPLA 2HLFD 5F7DA 2LAGB 4PJCB 2DB8A 1Z9OA 4WU7B 3VXRB 4Z76A 4PY8I 3FT2A 5ESAA 1T1YA 4F58H 3QWOA 4OCLC 2HJKB 1EX0A 1TCMA 1NLDL 1IKNC 1GPOH 1YYLL 1II4E 1H5BB 1NMAL 1BEYL 4D0DA 1BAFH 3FO2A 1E28B 1XCQA 3EOYG 3TEUA 2VSCA 4JG1L 3GIVB 4YBQD 4Y16C 1MNUH 4OD1L 2VE6B 4X7SH 4Q9BA 5DHVA 5KVFL 3MUGB 4S1RH 3T0AA 4RX4D 1QR4A 2C3GA 3U0WH 2PW1B 1KF9B 3MRPA 4JDVA 1TMCB 2EC8A 4LSTL 4YX2L 2XFXB 1YEFH 3MRJA 1D5BB 2VNCA 5EZJA 4JRXA 1U8QA 2DLFH 1EJOL 3J7HA 3S34L 2NX5E 2IAMC 1VFBB 1C5CL 4ISVA 1CZ8H 1J88A 1BECA 1RFDL 5D2NB 5JDJA 1WWWX 2APWA 4D2NA 5ECJE 5C0BB 2KUTA 2MQCA 2P8LA 3FO0L 4DN4H 4MD0A 4YFLF 5DK0A 1KTKE 3QNZB 2CGRH 4ODUA 3MRDA 3GMOB 2X05A 4FABL 4M8VA 5FIEA 2AABH 4FQJL 4TQEL 3C6LA 4P2CG 1MLCB 5JW5B 1P6FA 4WEMB 3C60C 3QISA 4OTXL 5E6IC 3MRIA 1OAQH 4HGWB 4U6TA 4WHYH 4RFOH 4QCIA 3PWUB 4S1SL 2FCBA 3HPJB 3IRZA 5F6HI 4I0CC 1L7IL 3K2UH 1R5IA 4IRJA 3BP7A 4A6YH 4M1DH 5DD0L 3KPLB 4E0RA 3M45A 4JPIA 1OAYL 3UDWA 4JQXC 2YD7A 4IOIB 1RUAH 1NANI 1NJ9A 3KPOB 1JYWA 4BFEA 3R1GH 1KCRL 3LD8C 4N8PA 1CR9L 2A0LC 3KXFE 1UB5A 2LU3A 3W9EA 5I8KL 5T1LD 4OF8A 2P5EA 1UZ6E 2R0KL 5GS1B 4Z7VA 2Y7QB 4NQSB 4CMHC 3DECA 3AS0A 4R0LB 3MO1A 4U1LA 2Z8VC 1H3UA 3FB6B 3P9MB 3X11A 3W5NA 4FFYL 4I77H 2YMXL 3CH1B 3GJFH 4G8GD 5DEGB 5AWNL 1GGTA 3NGBC 5JHLH 1C7SA 3VD4A 3GSNB 5DK2B 5JXAH 4OQ1A 3DXAE 4KFZC 4C56D 4JG0L 2BSSB 4JQVC 2O5XL 4FG6C 4LDOB 5J1AA 1JNHA 3LKNA 2W9EH 3WD5H 2GKIA 4XP6H 3VU2A 2KKQA 3WFDH 1GH7A 4Z7UF 3RWHA 2JB5H 1CG9A 1MRFH 2XXMB 1OSZA 1GZPB 2VLJE 2OK0L 1UGNA 1ZS8B 1BD2D 3DVGB 3DYPA 2V17H 4LHUA 3NA9H 3LQZB 4LSRH 5DYOB 1X7QB 1OF2A 1XGUB 4XP5H 5J11C 3L3OA 5EA0H 1FVEA 2UWEA 4G7YH 2R0LL 5C0DA 4NN5B 4FQQA 4PJFA 3O3UN 4F7CA 1UB6A 1WT5C 4OF3A 5BMFL 1G7JA 4KKAC 1SBBA 5FDWB 1WC7A 4TOYL 2IBZY 4IMKC 2GAZA 3PL6C 4ZPVB 3HZMA 1G7QA 2ENSA 4ZTPH 3TBYA 1MHEB 3P0GB 3CDGA 4OF0A 3SDYH 2HRLA 4GXVL 4RNRA 3QJFA 2YR3A 5KJRH 4HPOL 2IADA 4GAJL 2JE8A 4HXAH 3QUKB 4FTVD 2HLAA 3E2HC 4NN7C 3O6KL 3RFZC 1NL0H 4Y19E 1WFNA 4JFDD 1CDCA 1D9KD 5IEHB 4OLEA 1U92B 5JOPE 1JWMA 5IW1B 2PO6B 1E4WL 1J0KA 5IW6B 1ADQH 1UCTA 43C9A 1TQBC 2NY7H 3IYLW 3PGFH 2P1YA 4RWHA 1GOFA 3L5WA 1GSMA 1KJVB 1XMWA 4JFZL 3O8XC 1P4BL 3QQ4B 3IJSB 3UCRA 4BQ9A 1FZKB 3LZFH 3B43A 3PIQA 2V6HA 1SJXA 3RUGA 4M7KH 1U93A 3BPOC 1JPST 1NBVH 4W70A 5JUEH 3CLEH 3P30L 4XC1H 2PKDA 5L2KD 4MB4A 4ZUWB 1QBAA 2G60H 1IAIH 1F4WH 3B5HA 4O58L 4OFVA 4EDXB 2R2BA 1BOGA 1IVLA 4U33A 1K6QH 3BD5A 2YD2A 2DI9A 4OZHF 5GRZA 2EIZB 1RUQH 3D0VB 3CU7A 1XIWC 4JRYB 4KRPB 1BQLH 2X41A 3K8LA 2GJZA 2R29L 1ZVSB 1EMTL 3TA3D 1BJ8A 5C08B 3ZDXE 2QJDA 1R3IH 3LEXA 5HYQB 5BO1H 3OTTA 3TYGL 1RZJL 3O3BB 4M43H 2YD1A 3GSXA 4JFPB 3U4BL 3WDJA 4XPHL 2FR4B 3H9HA 2VLRB 2E9WA 3VXRD 3MR9A 2GTWB 4UNUA 3QSKB 3WMSA 4ZD3H 4BM7A 1YQVL 4Y2OA 3RWEB 5I16A 1EO8H 4NZTH 3S88H 3H7BB 2VZOA 4HIXH 4WI7A 4D8PA 3VRLE 3ZL4H 2VXSL 4YJZL 3S37H 3IFPB 3ECBB 2CH8A 1LGVA 1FH5L 5DQJA 1IL1B 4OV5A 4UBDC 4P23C 3N06B 4EN3C 4AMKL 2VYRE 3T2NL 4RA0C 4PJGF 1BFVL 4NM8L 3RIFF 4OZHB 1BGXL 3I6LE 1YPZE 1KXQE 4UQ2B 1J8HB 3CVHH 5CZKA 5HYEA 4HIJB 1YNTB 4L29A 4ODXA 4PJHF 4CVXB 2BNRA 5KSBF 2CRYA 4M7ZC 3RKDD 2GT9B 4W68A 4AK1A 3U2SB 5IMMA 2C3VA 1FORH 4OCXH 2H32A 3LKOA 2HKFH 4X6FB 3MLRL 4MA1C 3CSYB 1LHZA 3FRPG 4TSCL 3TT3H 5D7LE 4R96B 4JCLA 1RHHB 4PRNA 1MI5E 3KXFA 1A6TA 1NFDE 4YDJB 2PYFB 4NZDA 4AH2A 4YGVA 1QRNB 4OUUA 4AIXA 3LQMA 3V8CA 4XWOC 1YEJL 1F58H 1G6RB 1HH6B 3BESR 3D85A 4QYOB 5HJ3A 3REWA 1NLBH 4H25A 2VLKE 3BHBB 2IQAB 1CTOA 5LQBL 2DKSA 4HKZB 4CADA 1WBZB 5B8CA 3T0WA 4PJHB 4QRSA 5GZOC 3E8UH 2AJUH 1D5ZB 4LLMA 2OLDA 2ZWLT 5ITBL 4NBZB 3DXAA 4XT1C 3TCLB 1V3MA 4UDUA 5EH1A 1S7WA 4NGHH 4NQXB 3HG1B 4V2BA 2HMID 5HGGS 4R3SA 5DMGD 4HMEA 3PQYB 2NYYC 5DA4A 5JHDD 3RPIA 1I7RA 3FL7A 3BP6A 1U3HC 3H3PH 1GOHA 3F12B 4EBQH 3ZLQC 2VSDA 3O11A 2LTQB 2NY0C 5HI3C 3VD3A 5MEOB 4ODVH 5E4EB 3SE3A 5E99L 3HCVB 2B5IB 4POUB 3NCMA 4HGMA 1C12A 1G9MC 3N1GC 4Z5RA 1T5XB 1CFSA 4I9WD 3GUTB 1KLGB 1ZLUH 1MIEL 3DUHA 4YC2C 3U0TB 4M61B 3UPAA 2BOBA 3VFPB 2E27H 4WTZG 3MODL 4QRTA 2CDEB 1J0IA 3GSNL 5FKPB 3TBVA 4TTGA 4J8RB 4Z7NE 3V2AR 4WV1A 4MXQC 3OPZL 1NCDH 4HSQA 2E8YA 4GG6E 3FQTA 3WLBB 3TBTB 1FV1B 4XVUD 4HJJL 1DQDH 3UJTL 1M6OB 4DGIL 4XNZC 2W0LA 2V9QA 4YHKL 3GMMA 3JUZA 1KCVH 3OAYK 4L4TB 3JXAA 4XVJL 5C07E 4LCCC 4PRDB 3GB7B 1H0DB 3BKYL 4MNHA 5ESQB 4FFWD 4WI2A 2UVFA 2W0FB 3P40A 5EZIL 3VFTB 3RWGA 2BVQB 2WINB 4PGBA 5B39A 2J12B 4DUVA 3OR6A 1ACYH 4EI5D 3B2VH 2HKHL 1Q38A 1ZHBB 4JY5H 3STZB 5C2UB 1A8JH 1WWBX 1A6VH 1KFAL 5FO9B 5T1MB 1T0NA 2MCG1 4EJ1C 5MEQB 3IDGB 1UC6A 3U30B 1F3RB 3WFCH 4LKCA 3TN0D 4UILH 1CI5A 2PN5A 5DI8B 4XHJC 1B0WA 3H3BC 2OL3A 1I1AB 4Q9RH 4I0KA 4X4ZA 1FJ1B 1MJJB 3ARGB 2PTTB 2DM7A 2DM4A 3QUYA 3PHQA 4RCAA 4YZFE 4PBVC 4AM0B 2F74A 3ABZA 2FX9H 4LSUL 1CD9B 1A6WL 4M8QA 3HNTL 2OMNA 3AREB 3NN8B 3SKOB 1RV6X 3EYQD 2MMXA 3E6HA 1TPXC 4N90E 3VXPA 3M1BB 3WXVH 2BVYA 1DQQB 4LVEA 3I3EA 5CHNA 1FBIL 4M7LH 2Q6WA 4QRPA 4X0KA 3QFJB 3BWUC 1QPPA 2UY6A 3HUJF 3WEXB 4U6HA 4U1JB 1WFUA 1YMMB 5D1XC 4W6YB 4BQCA 4Y5YA 1A5FH 3BPLC 4MHHI 5CJOH 2B1HH 5TQ2L 5J8OA 4OLVH 1NUFA 4KKLD 4WWID 3L5XL 3H8NA 2DQTH 4OM0L 1HOCA 3FQRA 5B3JE 4F57L 2HJLA 4PFEA 2C1PB 3VFMA 5EUOB 1RIVH 2VC2L 3OHXB 3V0VA 1RIUH 2BHYA 5IB2A 1EVUA 4LNRB 1I8IB 5I8EB 5EORH 3WUZA 4JPWH 3RWJA 5FKAA 2NW2A 3KJ6L 4YXHL 5KAQG 3W0WE 4RGOH 2GTZA 2B2XL 2DJ4A 3O6FB 2FHBA 2K1MA 5ID0B 4KZEL 3T0EB 4Z8FL 2DWEA 3DSNA 1HHKA 1K4DB 1WWAX 3LAFA 3TO4C 1MAML 3LIZH 1UJ3B 1MCLA 5E56A 4GFTB 5C09B 3I84A 1A7RH 2VABA 5D1ZB 1I7TA 2ITCB 5D7LA 3SDAC 1DEEB 3RA7L 3U7WL 2DDQH 4ZFOL 3K2MC 4J1UA 1MI5A 2EH7L 2VL4A 1F3DH 4WU5B 3QO0A 3KYOA 2W1NA 4GRWE 1NFDA 5FUZH 4DN3L 4NO3A 5JMOC 1H8OA 1U58A 3UTZA 3C6LD 4QO1A 1CE1L 1G9NH 1AHWB 4G9DB 3LS4H 2J8UF 2YUZA 2WWMD 3WV0A 1ZV5A 2AJ3B 5F89B 1TZGL 4L8DB 3PNWB 1KPUA 4LRNL 1KPVA 5FUOH 1QSFE 1RZIA 3T0BA 2B1AH 2FJHB 4FMFA 4RGNE 5CSGA 5DDHA 3ZE2E 4GBXC 5GJTH 2D4DA 4MB5A 4TYUA 1TJGH 3ULVD 4HS6B 4ZFFA 4U1GC 4G6KH 1VFMA 4MWFA 2R69H 2FBJH 4HGKC 3CZFA 3HZVB 3L7EB 3TBWB 1ONQB 1A7QL 2AK1H 1MREL 5MI0C 2FRGP 4IJ3B 4U31A 3E3QC 5DEFA 4P2QD 3ZMRA 4L3ED 1OAUH 4PG2A 2QADB 1CLOL 3QUXB 3KPRB 4KJWC 5E8OB 3PWLA 2DICA 5JNYB 3QEGH 1OB1B 4OQTH 1KJ2B 2YS4A 5HYIA 4NC1E 5F8RC 4KZDH 1DBBH 4H0HB 1A7PH 2D0FA 3O4LD 4L9DA 3EYUH 1KBGH 1X4XA 2UUDH 2YEZA 2YPKA 4P4RB 3TZVC 2HT4D 2CJUL 3VDAA 3D1MC 5MHSE 4N5UA 5D2LE 5K33A 2CKBH 4LKXB 5KSUB 1IRAY 4LEOA 5HYJA 1GL4B 5J1TC 2FEEL 2FLRT 4YK4C 5FF6B 4YEEA 3ZDYE 3SO5A 5C0FB 1JV5B 1F4HA 1G7MB 1MPAH 3ZKXB 4JO1L 5C0IA 2CK0L 1R5VB 2D7NA 2P48B 5J3HC 4K3JL 1JGEB 3LHPH 5AEAA 4XMLH 5SX5H 5CP3A 5L9DH 5I73B 2H2PD 4DGVH 2UYLB 5TE6L 2HFEA 5M7QA 4YQXL 2JIXB 2XWJB 4UT6L 1CICB 1ORQA 3MLVL 2IH1A 2VDLL 4QHLB 5L6YH 3VXME 4EXPX 1FFOB 5CGMA 3SKNA 2AEIT 5A3ID 1CXLA 5DMKA 4GMSL 1OAZL 1DQMH 5TQ0L 3HC0B 5CUSL 4PV9A 4P2YA 3MBEB 2YPLD 3QQ9C 5IFAH 3U4EB 2DQGH 1DN0B 1TTGA 4IS6A 3K74B 4G8EB 4BK4A 5LWYL 3QIUC 2H3NB 2Z4QA 4ERSH 5I9QC 1A9BA 2XPGA 3MRQB 2ATKB 3ULUH 3BUYB 4LRIC 1K2DA 3QCUL 1T1XA 2C1OB 4YHML 4WIQA 4LVOB 5KSVB 1FL6A 2BZDA 3VWKA 1IM3B 4HIEA 1YPZF 5T3ZD 2F53D 5C0AB 1YEEH 4R7DA 5JW3H 2CR3A 2CDFB 5HI5C 1T5WB 4WWKA 4ZPTA 3MYZA 1PDKA 4IOSD 2I9TA 2UZIL 4PP2B 3TIDB 3WIHL 1MJ8H 5ISZB 1ZGLA 1G0YR 4M6NH 5T3ZL 4P3DA 1FZOA 4X80L 4MA7L 5KTEL 1S7TA 5D4QA 4RWYH 1BM3H 2NY1B 2A83A 3B9KD 4PJ9C 5GIRB 2YA2A 1I1AD 1RK1B 1X5ZA 2IANB 3VFUB 1IGFH 1V05A 2JKXA 4F33B 2P7TB 1GRWA 1KPRA 1HYSC 4WVRA 3T3ME 2AKRB 5ICZA 4JO3L 1RZGB 1DBKH 5CCKL 6FABH 1Q9WB 4YXKL 4NZUL 2XZQH 2AEWA 1N64L 4H5SA 4CJ0A 4JY4A 2VOTA 3A6OA 3LKPB 5CJQL 3VXOA 4NRXA 4HKXB 1KLUB 1CBVH 3QNYA 1EZVX 1MUJB 5MERA 4TRPL 1ZHKB 4LLYB 4XVSH 4K55A 5MENB 4H20H 4BSJA 1NC2A 1WBXB 4Y8AA 1NGWB 3ARTA 3W0WA 5DD5L 4J3XA 3TGXA 5FAAA 4S2SB 3KYMB 2AJXL 2NX5D 3BSZH 5EO9A 1ZHNA 5H94B 1UFUA 5IQ7L 1KJMA 4POYA 4YHIA 5I1JH 2DWDB 2O5YH 1IEHA 3L95B 2JTDA 4Q6IC 4FQ2H 4R97C 3PABB 1KEML 3UZEA 3N9GL 5IB5A 3ZSTA 4PJIB 2DMBA 5D71H 3KPSB 4XRCB 3ALXA 5IFJB 4KROD 1KSRA 3CXHK 3MLSH 2HJKA 1OTSD 4UAOC 3BEVB 1MH5B 2A74A 3FQUB 1GC1C 2VDRL 1B4RA 4NQDB 4S1QL 1OLLA 3T0ED 1Y6NR 1QSFA 3AROA 4BKLB 3DX9A 2VR9A 3GIVA 2OTUA 1JN6A 2VE6A 1B88A 1U42A 1RY7B 2DF3A 2PW1A 1QQDB 2YUVA 1DVFB 1UKSA 5C08E 1SVZA 4UB0L 5EOCJ 2XFXA 1T2XA 4X6BB 4G9FE 3P11H 1EHAA 1MFAH 4J3SA 1NEZG 1HXMB 3OB8A 1EEZA 1IFHH 3QIWB 1DJSA 3MRLB 4GG6F 4NT6B 1IC5H 3EW3B 3KXFD 2W92A 4HXBH 1KB5L 3T04D 4C58B 1D6VH 1BMGA 3DV6B 5D2NA 4AEFA 5C0BA 5CIPH 4PJDF 4Y2DD 5DFVC 4OIBA 2OP4L 1F90L 2I07A 3ARDC 3GMOA 5F71A 4BUHA 1UM4L 2F5BL 3BWAB 3RGVB 1QFUH 4Q6YA 4NN6C 5J12B 2XQYG 5EIIB 1MLCA 3ARFB 5E1HB 4OF7A 1HZHH 1EA9C 3Q2CA 4FZ8L 4RIRB 3RVWC 4HGWA 3BUTA 4IMLB 1LO3H 4BQ8A 5BVJA 5D2LA 3PWUA 3DXAD 3HPJA 1VFUA 4MNGE 2AI0H 2QADD 4Q9CA 3GO1H 3ES6A 3JV6A 1YEIL 4HG4K 4QHNB 2BJMH 1FFPA 5D8JL 3TNMB 3N1FC 3T2OA 3KPLA 2V7HA 5DWUL 4U1HB 4JM4L 2VLJD 2LVEA 3KVQA 4OZIB 2XA3A 1FYTE 1YEDB 4RFEB 1OP3H 3JV5A 4PJDB 1KJ2L 5GS1A 2IMNA 5DJ0B 1QRNE 3VXMA 1NGYB 3RWCB 3TNNA 4NQSA 2B0SL 3QHFL 4G3YL 1GGIL 4OV6F 4MMXC 4R0LA 1JUFA 2W9LA 4KKBD 4NPYB 2Z35B 4KQ4H 3CH1A 2KH2B 43CAA 5DEGA 3PP3H 2QHRL 3WXWL 3Q6FB 4JVUA 4Z0XB 2JELL 2XKUA 3GSNA 3LQAC 4TVPE 5I75B 3PHOB 1GHFL 4LSVH 3C9NB 5DK2A 3VXUE 2CUHA 1INEL 5KSAC 5GGSA 5HHME 5J6HB 3RVTD 1OGTB 4N0FB 5EO0B 3OX8A 5B3JF 2FGZA 5FGBC 5JXEA 4R6UA 4XP4H 4CW1B 4Y19D 4Z6AT 5F9OL 1CICD 4PRBA 5JOPD 2O5ZL 3F6LA 1WWCA 1IAKB 5J6GB 1IM9D 1FHGA 5I1LA 2GSIA 2ZCHH 4WI8A 2D4FA 3BPCB 3MBED 3F58H 1CGYA 3LQZA 4WFHD 1YNKL 3CIQA 3P73B 1PJ9A 1XGUA 5IMKB 5DJDA 2BFVL 2DI7A 1NGPH 2YD4A 3RZCD 2W9DL 5F1IB 4P5TC 1FVDB 4APQC 1VADB 4JM2C 1SQ2N 3STBA 4UINL 4ZPVA 1AKJD 2XTJC 1D5XA 3VFVB 2NXYB 4GRWF 4OFYA 1I1YB 2PR4H 1LP9F 5FCUL 4KMLB 3IRPX 1AC6A 3IDNA 1RPQA 1IAMA 3QUKA 4FNLH 3Q1SH 3TPUB 5GGQL 2CO7B 3GMNB 1TQCB 2EE2A 4I5BB 3DIFB 2KQMA 5IEHA 2V5TA 5IESH 2H9GB 1U92A 4GMTL 3TO2A 5F21B 1FDLL 2ZG2A 1S7XB 2PO6A 3ARRA 5IW1A 1PD6A 4B7LA 3EYOB 3EFDH 1F6AB 2FEEI 2EZ0C 3VGAC 3PWPE 3QQ4A 3QI9A 1FZKA 5HD8D 2W0KA 1LILA 1DLFH 3TVMB 32C2B 5I17B 3M8OH 3VWJB 1LO0H 35C8L 4ZUWA 5HYSG 4MQSB 4LIQH 1H15B 1LMKA 1MF2L 2PNDA 3EO0B 3DV4B 4EDXA 3I6LD 3VH8B 5E03A 1LP9B 3O6LH 3HAEG 4NO5B 1QBMH 3JV4B 1DANU 3VGDA 3HFMH 4ZO7A 1Q8MA 3D0VA 4RZCA 2FECL 1T1ZB 2FX7L 4FQXB 1PBYA 4JRYA 5H35A 2GI7A 1G1YA 4ORGB 4I48B 4NNXB 1ZVSA 4ZXBB 2YA1A 1EXUA 4QXGL 5C08A 4G6FB 1UH3A 2BC4B 4XMPL 2Q76B 1KCSL 5IOPB 4G9FA 3O3BA 4HZLA 1EPFA 3HRPA 4JFPA 1JRHH 3D87B 1N8ZB 4R4BB 2FR4A 2VLRA 1VPOL 2GTWA 4FFVC 1I85A 1MY7A 1MI5D 4W6WB 2XXCB 3RWEA 4XNQB 2VB5A 2NY5L 3H7BA 2R2HB 4JHWH 1V7NL 2VDOL 2Y36L 3O0RH 1JPTH 1T2QH 1HINH 2H45A 4HV8B 2J4WH 2OR9L 1PG7H 3IFPA 3ECBA 5EZLB 1CF8L 1H3PL 2VLKD 4YHYC 4N0YL 4H8WL 1RULH 4HK0B 1IL1A 4TUJB 4DVRH 1HNFA 2DQUH 4PGCB 4OZHA 3I50H 5DTFB 5F7EH 1NAMB 3IKCB 4UQ2A 5K9QI 4HIJA 3JWOH 3PP4L 1YNTA 4XCFL 2AXGB 4CVXA 3V5KB 4FRWA 4M5YL 1MLBB 1MWAB 1UM5L 2XIDA 3B6SA 3QIWD 4GT7A 4NBYB 2DLTA 4ODTL 5F7FA 1KCUH 2GT9A 4XPBH 4MXWL 1K4CB 4R8WL 3EJYD 2NR6D 3U2SA 3OL2A 4L9LA 4E9LA 1QLRB 4HPYH 4NSKA 1LDPH 3G5YA 1S3KH 4PJAE 3HZKB 5LBSH 2Y72A 2Y5EA 2FATL 2ZCKH 4DOHE 4X6FA 1OOAA 2HG5B 3CSYA 4OB5H 4R9HA 2W91A 2YOCA 5C0RL 2OJZH 5BJTA 5FYLE 2ZJSL 1VACA 3I2CL 5EZOL 4O2CB 1S78C 1I7ZA 1DBML 3UZVB 1RD6A 3TJEH 3IS0X 4QRUB 4XTRD 1HQ4A 1UWXK 3IFOB 3BAEH 3SDCA 2Q20A 1QRNA 2OR8A 2IF7A 5CKAA 1FIEA 3SQBA 5E5RB 1NCCH 1RVFH 4UT7H 1G6RA 4PS4H 2DQHL 4QYOA 5K93A 2WZPD 3BHBA 5IM7A 2IQAA 3EDKA 4HKZA 4NFDA 4XP1H 4EOWL 1FGVL 2CMRL 5T33H 3VFWB 1D5ZA 4O9HL 3VXTA 5BQ7A 3LSOB 2R0WL 5DD6B 4Y16B 4PLJD 2HH0L 3TCLA 4JR9H 1NCAL 4BK5A 5INCB 4HWEH 3HG1A 4HC1L 4OCWH 3QUMH 1AIFB 5T3XH 4LASH 4LCWE 4M7LT 5C07D 5D72L 1GGCL 3NAAL 1AFVH 4ZODA 1KJ3L 1AY1H 4OZFA 4ETQA 1X5YA 5MEOA 2VDMH 2NLJB 4ZS6C 4NM4H 4F8TA 4ZAKB 3ZE1E 3OKLB 4EN3A 3QQ3B 4OLYH 1T5XA 4WCYH 3EHBD 3GUTA 3ILQD 1KLGA 3C8KB 1YNLH 3BKCH 4M61A 4M4PA 3C5ZD 3VFPA 3SOBL 4G6AD 2CDEA 2AJVL 4JB9L 1YEKH 4K2UL 5FDYA 5FKPA 4EIGB 1MCCA 5EBLB 3RDTB 1LO2H 1KIQA 4K3EL 3MQIA 3OWEA 1EGJA 4IRSC 3WLBA 4KKCC 3H9SB 1MCRA 4JKPH 4P5KB 1L7TH 3ARYA 3S96B 3BDYL 1M6OA 1MY5A 2P8MB 3B8YA 4J4PD 5CINH 4JFXB 4PG9B 4J7RA 2QL1A 3ARBB 4L4TA 3EYSL 2H1PL 1TVHA 1JNJA 4NUGL 3GB7A 1NAKH 2QSQA 1H0DA 4R4ND 1T0PB 2W0FA 3VFTA 3CMOH 2WINA 4MAYB 1OAXH 3QEUB 2AJZB 2EC9U 1CIUA 4YBLC 2Q7YB 4TPRL 1BFOA 3V5HA 1EEQA 4JHBA 1A14H 3DJ9A 3H9YA 3NFNA 3RTQB 4NOFA 4KMQA 4BQ6A 1JFQL 1DEDA 3PWPA 1ZHBA 3STZA 2IFFH 2WWKO 4JN1H 1G7IA 4Y4KC 1B0RA 4P2OA 5BVPL 5L88L 4UIKL 2CKBB 1QLEH 3QUZB 1Z5LA 1CFQB 4NQCB 4R26H 1RZ7H 2X4NA 1OD9A 3SGDH 1ED3A 2FL5B 3HA0A 2V5SA 2QQKH 3SPVB 5KVEL 1NGQH 3NGBB 2PUQT 3PWVB 5IBUG 1F3JB 1NCBL 1D7FA 4EIZC 1FJ1A 1MJJA 3ARGA 4D0CB 4NFCA 2NZ9D 3W0WD 2AJSL 2I60L 4AM0A 4NJAL 5GGVY 5CBAB 3LDBC 3SBWC 4E41E 3W2DH 3BD3A 1A7NH 5EU3A 3AREA 3NN8A 5D1QB 3T8XB 2BSED 3SKOA 3K8MA 2VQUA 4KK8C 4KXZH 4X9BA 3M1BA 3WKMH 1DQQA 1DQTA 1TTFA 4ZTOL 1JHKL 4QHKJ 3TVMD 3QFJA 3BQUB 4OLXH 5CP7B 3S4SA 5LXGL 1ZOXA 4JKKA 1YMMA 2AQ3A 2XKNB 4UV4H 3FQXA 5I1EL 1OSPL 2D7MA 4OCNC 1FNLA 4AQ1B 5D6DA 5DK3A 5J11B 1PLGH 3P2TA 4HLZG 1HHIA 1OP9A 1NDGA 3ZT5A 2CKNA 3SKMB 1A7OL 2BERA 1NBQA 5TFSH 1QZ1A 2QTEA 4A2MA 2OZ4H 4HDIB 2FHFA 4K94C 2C1PA 4Y5XC 5EUOA 3OHXA 1UYWL 1OCWL 4RGND 3CFCH 4LNRA 1I8IA 5I8EA 3EO9H 1YQ2A 5CAYB 1FRGH 5IF0A 3KPMB 2FYYB 4Q7DA 5IWLA 4L8CB 3OZ9L 1A6ZB 1QFOA 3D9AH 3CSGA 3LPFA 3KHQA 1XF4B 2K9UA 1VGEL 3GRWL 1KTDB 4N1HB 2YN5A 3O6FA 5BCAA 1OM3H 1JGLH 5HVWA 5ID0A 4NN7B 5EBWB 2ADFL 1JZ5A 1JF1B 2HFGH 3DTXB 1QNZH 4FQIH 4PJAA 2BY0A 3VGHA 2D31B 1UJ3A 2DYPA 1VDGA 1TQBB 5C09A 4ZDHA 5DSCB 4QT5A 2FEDC 5D1ZA 2ITCA 3C2AL 3IDIA 1YJDL 1FFNA 2ERJB 3EOAB 3O8XB 3VFSA 3BE1H 4YE4H 4ALAL 3P0YL 2EDJA 1JNLH 4RAUB 2OM5A 3DX6B 3QB7C 1T89C 5ESVB 1TENA 4DKEH 3CCHA 1Z3GL 4JFQB 3O2WH 2Z31C 1NAML 2XWBB 2AJ3A 5F89A 3HC4L 4L8DA 4MB3A 3FQWB 3S36L 4XMKH 3U79A 1IEBA 3L3KB 1NSNL 4I18C 4PJXF 1MWAL 2R2EB 2IFGA 5C1MB 4ZFGL 1G0XA 1XIWB 1QSEB 5DJ8B 4IRZL 1P4IH 4JDTL 3HZVA 3L7EA 2HA1A 1ONQA 1TZHB 4AT6B 4G42B 4U3HA 1Q0YH 1WTGT 1AR1C 4YPGB 2BVEA 1L9MA 3U82B 4MJIE 1YEGL 5TE7H 5IGXH 2M26A 3O41B 1IGMH 3G5ZB 1RUML 4HKJB 3KPRA 2A1WH 4O00A 2VQ1A 3V52H 1DANT 1MSPA 5E8OA 3UBXA 1XR8A 2WUBH 2AEPH 3O2DH 5JNYA 1OB1A 4HAGA 1SEBA 5DJXB 3R4DA 4OZGE 3QDGB 1JCKA 4PUBL 4KMTH 1KYOJ 3O9WC 4LARH 5GRWA 4Y16D 3STLB 1CN4A 4XAWL 1JNNH 1FAIL 1OWWA 4GKZB 1YMHA 2X40A 2ICWJ 4PJXB 1FGNH 4C55A 5C8JB 3VFOB 2YD8A 4LKXA 3MNVA 3MRNB 5I1GL 1HXYA 1OP5K 5C0FA 3WLWD 5DXWA 1JV5A 1FCCA 3WHXB 3X3GL 1EFXA 3QWRD 4AEEA 2XV6B 2IAMD 1MFBH 5B39G 1B4JL 1DTUA 1KEGH 2FO4B 4PGZA 2VXQL 4GQ9L 2B39A 1KXVC 1M7IB 1NANH 4OZIE 4MA1B 2HRPL 2EH8L 2X4SB 4MCYA 2UYLA 3EYVA 3H0TA 4RAVB 2JIXA 2EIDA 4HH9A 3VRIB 4EDWL 5D7JC 4QHLA 3VFNB 4TVSa 1FFOA 5IBTL 3C60D 3DMMC 1AH1A 5JLZB 1KIPA 5E6ID 1YEHH 5T5NG 1IC4H 1X6LA 1V7MH 3HC0A 3DX8B 4FXKB 3MRGB 4K7FB 2D3VA 1U6AH 1WEJL 5ICXA 3EGSB 4FMKA 4LVHC 4V1DB 4J23A 1I3RA 3HHRB 2JCCE 2H3NA 1KN4H 3D2UB 4WEBH 5FOJA 3AM8C 3NPZB 5IP4A 3T1WA 4LHQB 2ATKA 4RBPK 1VGKA 1MQKH 3BUYA 4DKFH 4M93C 1VKXB 4ODHL 5SWQB 1BZ9B 1C1EL 4L8BB 5KSVA 2GJ6E 4E41A 4AEHH 2A0LD 3D39E 3C08H 2R15A 4HFWB 1IM3A 5CS7A 4WGVB 4FXGA 5C0AA 1CDHA 3WL9A 2CDFA 4QOKE 3FHQA 1T5WA 2R4RL 3AGVA 4CN4A 15C8L 1U3HB 2F19L 2X09A 4P59H 5E7FA 3TIDA 4NNPL 4M48H 5ISZA 1CGSH 1QG3A 2JJUA 1MFEH 1PKQE 4P9HC 4YWGL 5A2IH 3BJ91 3IDXL 1GZQB 4XPFL 5CJBA 1FPTH 5IQ9B 4Q74A 2ESVE 3P4MA 3GMPB 4Y4FC 1GGBL 2IANA 2G5BA 3I9GH 4NQTA 4HS8L 4K07A 3VFUA 2D03H 2P7TA 4Z77A 4LAQH 2DQEH 4H1LB 4Z0BL 5DFWH 1BF8A 5M94B 1S9KC 2BVTA 2AKRA 3FRUB 3GMQB 3D6GA 2NQCA 1BBDH 3REVB 4N8CL 2F54B 1IGYA 3I6GB 1Q9WA 4QGTA 2EDQA 1A4KB 1TJHL 5SWSE 3UJIL 4HKXA 1KLUA 1MQ8A 4LHJB 3GMLB 5DEZA 1ZHKA 4LLYA 3CX5J 5MENA 2IGFH 4UI2A 1NGWA 3S37X 1X9QA 1OLZA 4G9FD 3KYMA 2E5EA 2CIIB 1NKOA 4MNQB 3FTGA 3SGKA 5EOTB 1JHLH 4LCCB 3SGEI 2JJWA 5A2JH 5IR1B 3MACL 2HVJA 3L95A 5K9JH 5F1NB 4F3FB 3RWFA 4NZRH 4YHOH 1F3DJ 4R2GC 5E6YA 2X1QA 1N4XL 1NMBH 3PABA 4JFYB 4NIKB 1FIGH 4P4KA 3EFFB 4KKAD 3E0GA 5KW9L 1WAAF 3PL6D 3BP4B 2J7LA 2RCSH 4K7PY 2F58H 3GKWH 4LPYA 4MDIB 3BISA 5F3HA 2AV7B 4PJIA 4YHZL 1GJIA 3KPSA 4DZBB 4XRCA 5GJSL 4U49A 2XA8L 2NY3B 1XGYH 2VQTA 3BEVA 1S8DB 1MH5A 3GI8L 3FQUA 4JFFB 1KN2L 1C5DB 4NQDA 1MCPL 3ZE1F 1N2RA 2QLVB 1YYML 4NO2B 4BKLA 1S7SB 3JWOC 3RX8A 4XCYA 1QQDA 4MD5B 5L8JB 2OS7A 3MLTB 2VIRA 1ADQA 1MFCH 5GGVL 3O4OB 3OKMA 2D7TL 1PGRB 4I0PB 3UAJC 4YBHA 1T83C 1QO3A 3WNKA 2C7UA 1HXMA 4ODSL 2QEJA 3MRLA 4NT6A 2EYTB 1FYTD 4X5XB 1P7KB 2QQNL 1FP5A 3HE6B 4OGYH 5C6WH 3B5TA 5KN5A 5HHPA 4BELD 1VENA 1EHXA 4KHTL 2FIKB 5F88A 1F6FB 5D1XB 2DQIH 4F9PA 2P5WB 3VDBA 3MV9E 3WSQH 3RGVA 1RZKH 2XTJE 3BWAA 3MV7B 2J8HA 3NCBB 4PB0L 5ITFB 3TM6A 1I3VA 2EIEA 1ZKAA 4GKSB 5I1CH 5EIIA 2G2RB 3T0VA 3ARFA 1U8OB 25C8L 1MELA 4PJ5B 5EU6B 3AUVA 2Z91B 2IPTH 4TVPD 1R5WA 3TBSB 4IMLA 3VXUD 3WFEL 4M5ZL 1MIML 2VZ3A 1BBJB 4OM1L 3H42H 3OXRA 5HHMD 4Z7WF 5FYJH 5KANI 3RKPA 5JMRA 2ADGB 4LSQL 1OW0A 4TVPL 2FD6L 1BJ1H 3DSFL 2B4CH 4OSUH 1IGTB 4IIQC 4QHNA 4X6CB 5AYUL 1J8KA 1A6AB 3TNMA 3QEQB 2QSCH 2QQLL 5J0BA 4HC1A 1DR9A 4ELKB 4U1HA 2R8SH 3TO4B 4Y4HA 3SDXF 3QXVA 1AJ7L 4DCQB 3RHWF 5DJZB 3BN9C 4GUPB 4OZIA 1YEDA 4RFEA 5IMLB 1UWEH 4D9LH 3SDAB 4OCYH 4UBDD 5SWZB 4P23D 4EN3D 3HNVL 5EU7C 1FNSH 5DJ0A 2VMFA 5DD1L 3DX7B 3QDME 1NGYA 3HI6L 5BZDB 1P1ZB 1FVCB 2UV3A 1IEAB 3TCXA 5IMOB 5E2UL 5DHYB 1QFPA 1U95B 2E7LA 3K1DA 5DJAA 3WIIH 1X5XA 4NPYA 2Z35A 3RU8H 3CVHA 5BV7H 1W72H 1SBSH 2Y07H 2V9RA 1DN2A 5K9OB 4RQQB 4YDKH 4G80B 4DTGL 4O02L 4Z7WB 4Z0XA 3WS6A 5FA3A 3U1SH 3PHOA 4OCRH 3Q6GL 2VDKH 4HH8A 3O6MH 4JPVL 4U1GB 2C3HA 4UIMB 2X4PB 1OGTA 4N0FA 4HHAB 3J8F7 1I3GL 4KKLC 4CW1A 5E8PA 5J7CC 3L3HB 3D39A 3RVUC 3QR2A 1NLDH 3QXAB 1U91B 2H2SC 1YYLH 2ZUQC 4LOUC 3SDXB 3B3IA 3MV8E 2MOVA 1BEYH 5TH2B 4XWOD 2FGWL 1JYVA 1NMCC 1VCAA 3PWPD 4MD4A 4OGAD 1PKQA 4OD1H 4YLQT 1URLA 5KVFH 5F96L 3P73A 4X7EC 5IMKA 4KTYA 3S36X 3KHOA 4JEGB 2ESVA 4L8SA 3D2UD 4LSTH 4YX2H 5GZOD 3KPPB 2NTFB 5F1IA 2VXUL 2VISB 1FVDA 4ZO6A 1EJOH 1LO4L 3S34H 1VADA 4K3DL 2FDBP 3VFGL 1FNFA 1MHHB 1QHPA 4ONGL 3HE7B 1RFDH 3U7AA 4O51B 4M7JL 3HS0B 3FO0H 3MGOB 5SWSA 5E1AB 2APVA 2BCKB 1G7PB 5D7IE 2XN9E 2NY0D 3C6LC 1S9WB 5HI3D 3UX9B 2VLMD 3P0VL 4FABH 4JO4L 3GMNA 1ZLSL 3H2WA 3MLYL 4TQEH 4I5BA 3DIFA 2DIBA 2X6MA 2R56L 4CBPA 4V2CB 2PXYB 1S7XA 3UPCA 4NKDA 4OTXH 3EYOA 1DFBL 5EC1B 2CRIA 1F6AA 3OAYH 4LP5A 4LBEB 4S1SH 2DN7A 1LEGB 1MCHA 1G9ML 1I1CA 1LK3L 4IRJC 3IETB 2D9QB 1L7IH 1JWSB 3OJMB 1AGFB 3BXNA 5BS0B 2FJGB 3I85A 5FM5O 3UDWC 1FL5B 2ZUVA 1KCLA 4MXQD 5DD0H 4HMDA 2OYPA 1ZEAL 3VWJA 1OAYH 1S9YB 3RX5A 3QIBB 5INDB 1ZSDB 4JFEB 3DV4A 3VH8A 3GM0A 1DE4B 3HI1B 4NO5A 4EKXA 3JV4A 1CR9H 4OZGF 5I9QB 5I8KH 1ZMYA 4FQXA 2R0KH 3U46B 2EDWA 4WO4B 1XEDA 3DWTA 1WIOA 4NNXA 4NHUB 2XZAL 5F7NC 1DBJH 5FHBL 2BC4A 2WNGA 2DYPD 3MYJA 4FFYH 4PRHB 4NKIH 2YMXH 1E4KA 2X4UB 3KJ4C 3T77A 5AWNH 3ZYJA 3KWWB 4N9GB 4XNQA 5E5MB 5C86A 2R2HA 4JFFD 3CFEA 3L9RB 4JG0H 1ULVA 2DI8A 3GM8A 4XHJD 2O5XH 3LRHA 1I8LA 1OT2A 5KG9A 4OLUH 2LAAA 3TH4T 5FO8B 1AGBA 4HK0A 4TUJA 4MYWB 2R1XB 4OFIA 3ULUE 3QPXL 5KVGL 2HFFB 4PGCA 3V4UL 2OK0H 4OIIL 5DTFA 1NAMA 3IKCA 2LFGA 2AXGA 5JQ6L 1G0DA 2WP3O 4QTHB 2IPKA 3BW9B 4Z7QF 2NXZB 1MLBA 2QR0B 3AMKA 4ZG1A 2DJUA 4OGXL 4YDLC 5A3IC 1K4CA 3MGTB 2R0LH 2MTPA 3NIDE 4NNYB 4LCWD 3INUH 2JLLA 3W82A 5BMFH 3HZKA 2JCCF 5D1XD 4MSWB 2P5WD 3CPLB 4TOYH 2HG5A 2YK1L 5SX5K 3FOLA 4D9RE 5F9JB 4B0MM 2WLYA 3FB8B 1UZ8B 4GXVH 2IG2H 4O2CA 5FM5M 4Q6IB 2NY4B 3GSUB 3QYCA 4Z7OF 4QRUA 1YN6A 4HPOH 4GAJH 5EU6D 3SHSA 3LH2L 3G6AA 3IFOA 4F7PB 2XWTB 4JAMA 1J86A 4C4KT 3O6KH 2DKMA 4K7PL 5GPRA 1K9TA 2Q8BL 2ZNWA 3CFJB 1XT5A 1B6UA 1E4WH 1ETZB 2D7PA 4N9OB 1PQZA 3ESVF 3GFUA 4ENEC 4JFZH 3VFWA 5BW7A 1P4BH 1QSEE 3LSOA 4MJ5B 5DD6A 3V8OA 3TO4D 1M7XA 3EIFA 5IHUH 5TE4L 2C9AA 4U6VL 5CWSB 5INCA 1MHPL 5ETUA 3P30H 3S97C 5BXFB 2H6PB 1AIFA 1MJUL 4CVZA 2ORBL 4LU5L 3FCTA 2VDPL 1OL0A 3W9DA 2ZCLL 5I0DA 4KTEL 5FYJU 1W2KT 5HDQL 3FB5B 4WFGE 5AUMB 2X1WL 1BOYA 1DZBA 2OI9B 1OAKL 3DVNA 4X83A 2ENYA 4HCRL 5IJKA 4P46A 4ZAKA 4F7EB 2C4XA 3JWDH 2R29H 1EMTH 3QQ3A 5HHOB 3KYNB 3C8KA 3O3DB 4GBXD 5B21A 3BZ4A 3T1FB 4MXVF 3TYGH 1RZJH 3IU3B 1UVQA 3ZYZA 1CGTA 1P4LB 3V0AC 5EG6C 3QCVL 5DUPH 1JF6A 7FABL 4ZSOE 5HGBB 3U4BH 4XPHH 3K81A 4WHDA 5C3TA 5TGBA 3NCJL 4BFIB 5EBLA 5TDOB 3RDTA 1YQVH 4WW2C 5E4IA 5DQ9B 4P48A 5GS2H 4O5LL 3K2UL 1K8IB 1LEKB 4KQ3L 3VG9C 2VXSH 4A6YL 3CNKA 3S96A 3MNZA 5D7IA 2F15A 2XN9A 4KJWD 3VXSE 4QRRB 1UA6L 1FH5H 1FG2B 1S9VB 1EBAA 3QAZC 4JFXA 3RZWA 4AMKH 3ARBA 3T2NH 4PIRF 3MMEB 1CTNA 4NM8H 3BP5B 5A40E 1BGXH 2XICA 5JZ7C 4N8VA 3BT2H 2WUCL 3NIFE 4OQTA 4MAYA 3QEUA 1KG0B 4Y1AE 3V7AE 1N3NA 3TZVD 4QLRA 4OFDA 4PJEF 3ESUF 2CLVB 2WBJA 2X4QB 1MCSA 1HKLL 3GGWB 2IH3B 3V6OE 3VXNA 2PYEE 4TNVF 2CKBA 3QUZA 4CNIA 1CFQA 4NQCA 1BQUA 2HTLC 5I30H 2FL5A 4TSCH 1B2WL 2ZOLB 4JM2F 3SDDB 3SPVA 4GRLB 1AI1L 1F3JA 4QXWA 3HI5L 4M1GH 5J3HD 1NC4B 4D0CA 3JV0A 3MCLL 1ROWA 3LV3B 1TVBB 4LAJH 3ZKNC 1I8MA 5CBAA 4FFZL 3CDCA 1JGVL 4N0CC 3T8XA 1YEJH 3OKOB 3GZKA 4PBWD 3X14A 3DRQB 3PDOA 5B8CC 5F44A 5LQBH 4ELME 4X8XA 4LGRB 3KLHC 3BVNB 2CXGA 4P4KD 1MFNA 3D3VB 3BQUA 5CP7A 3U48A 1PG7W 4D9QD 3QQ9D 2D0GA 2XKNA 2LVCA 5ITBH 4PJEB 1HHGA 4F7TA 3DI3B 4OAWA 2R0ZL 2C4FT 5D93B 1SY6L 3QIUD 5DD3L 5IT2L 4KHXL 4P5TB 4HDIA 2C3XA 4L4VE 5DRXA 3ISWA 4PBXA 1N6QL 5E99H 3KPMA 4NP4L 2VUYA 4L8CA 5HI5D 1MCNA 4HXAL 5E8EA 4NDMB 3LMJL 4MX7B 1A1NB 3UEZA 3ZDZF 1XF4A 1BFTA 5C7XL 1X5KA 1U3ZA 3WJJA 4ZYKB 1ZGLP 5EBWA 4I2XB 1FNHA 3MODH 3HB3C 4MJID 3FFCE 3DTXA 1RUPL 4PJ9D 3GSNH 2D31A 5TF1L 3QA3B 5JQHC 4WV1C 2ICEA 5C0CB 2A9NL 5KS9F 2VAAB 5DSCA 3BRFA 1CGVA 5JTWA 1HYSD 3OXSB 1OP3K 3OPZH 3LZFL 1VHPA 3RVTC 5JUEL 4PGJA 4HJJH 3UJTH 4KK9C 4RAUA 4DGIH 3DX6A 2V7NA 3UTPE 4YHKH 5T1KB 4UTAH 3IJHB 2DBJA 1OTUC 4JFQA 4XVJH 2J5LC 2XWBA 5TDPB 5ID1B 1QFWL 3BKYH 3DETC 3FQWA 4AJ0A 5CBEB 4AG4L 3L3KA 5EZIH 4HIHB 1U0QA 4P5MB 2O93L 3UJJL 5BZWB 1BZQK 1BQLL 3EDFA 1UKQA 1QSEA 2HKHH 3GSVA 1X5IA 2F8OA 4OZFG 2B4CC 5EBMA 4NJ9L 1KFAH 2XRAL 4OF5A 5DJ6A 2E6PA 4AT6A 1S7VB 4TUKL 3OKYA 1AD9B 4G7VL 4YPGA 5I8CA 4IHOB 2I24N 5KS9B 2DM2A 4QNPF 5GS0H 3O41A 1FLRL 4E5XA 3RIAK 4HKJA 1X44A 3QUYC 3E6FB 4HIXL 1MRCL 1UXWB 1JGUL 2Z9TA 2YKLL 1HILB 1O0VA 2CQVA 4GS7B 3K80A 2E7HA 1T66C 4LSUH 4RGMB 5DJXA 2P45B 4LIQE 1P84K 1A6WH 3CFKB 3HNTH 2A73A 4KJPC 5FECB 3QDGA 1C16B 3VGEA 5C0EA 3M17A 5C6TL 4X8JB 3STLA 8FABA 1GC1L 5BV7C 4GKZA 4HIIB 3BYYA 1FBIH 5L8KB 2Y5TB 3MFGB 2BNQB 4IM8A 4ZSOA 5C8JA 2BY2A 3LN4B 4Y5YC 1SYVB 3F65A 4N0RA 5HVGB 3WHXA 3T65B 2GJ6D 3H3KA 3K4ZA 1KIRB 1ZTXL 3D39D 5LGJB 3MOBL 5TQ2H 4QGYA 3L5XH 3MJ9A 4KI1A 4PGDB 3VXSA 5TF0A 2X1XR 4OM0H 3QP3A 4QOKD 5DFVD 5IHZB 4F57H 1M7IA 1S7QA 4JZJB 2VC2H 3CD4A 1AP2B 3ARDD 4LPCA 4WUUB 5CIPA 3CFDB 4DKDC 2X4SA 1AR2A 2B7DT 2X4TB 5SWZE 4RAVA 4L4JA 3V4PL 3CC5B 1HI6B 1T89A 3VRIA 4OLWL 3KJ6H 3L7FB 3VFNA 4YXHH 5JLZA 1HNGA 3RVWD 4X6DE 1R24B 4ZNCD 3ZKQD 2B2XH 1NLBL 3IGAB 4LL9A 1OVZA 4KZEH 4Z8FH 4FXKA 3GSRB 5IV2B 3V6OA 2P4AB 5E9DB 1MVUB 5IVXE 2IQ9L 1MAMH 3IDYB 4HWBL 3LEVL 4V1DA 2DS4A 2X89D 4ZFZB 5SWSD 3P4LA 3U7WH 3RA7H 4DKAA 4YFDB 2EH7H 3GBLA 2DOCA 5E8DL 4WI9A 4U2YA 3D25B 1MEXL 2ZSWB 4DN3H 4NO0B 5SWQA 3QHZL 1VKXA 1BZ9A 4L8BA 3S8WA 4XAKE 1CE1H 1XAUA 4PGEB 3S4SG 1XF2A 3MCG1 4KH2A 2M2DA 5LCVL 3VA2C 5EFIB 4KDTA 1TZGH 4LRNH 3CSPA 1J0JA 3F7VB 1CFTA 4GQPH 4MVBC 2F8XC 4U4BA 3VMPA 2E7BA 4K7PX 3O9WA 1IAIM 5D5ME 5GGTL 3KPQB 1D3CA 3GMPA 5E2TL 3MA7B 4FZEL 3RBGA 1A7QH 1AQKL 1MREH 3AS2A 1QFWM 2E27L 2WIMA 4PG2C 5KSAD 4NWUL 5GRVL 3BIKB 2F54A 4L4VA 3LQAL 1CLOH 1A4KA 2XZCL 1DUYB 3QEHB 5C6PB 2EXYC 1TXKA 2F5AL 5T3XE 3GMLA 4XTRC 1NKRA 4IRSB 2H26B 1PG7X 3FT4B 3QPQC 1O7SA 4FQPA 3QULB 1Q72L 3WHE0 4JZNB 3NMEA 4EI6B 2P47B 5I15L 3F7RA 4XCEB 5EU7E 4C57C 4X9HA 3BGFC 2CJUH 4KAQL 5IR1A 4P5TD 5F1NA 4F3FA 2X4OB 3RHWK 4APQD 4JFYA 4JM2D 3UTTD 3EFFA 5CEYB 4DZ8A 4KI5C 4DW2H 3MV9D 5FGSA 4PY8J 3BP4A 5BS0E 2XTJD 4MDIA 2AV7A 2PETA 1K8DB 3V5DB 4JO1H 1UADC 3QDJE 2CK0H 2KZWA 3PV6B 4LDEB 4K3JH 4X6EA 4K9EL 3MBXL 5ERWB 5CD3B 3AM8A 1FO0B 1BJMA 4Q9RL 4KGJA 4PP1C 3AFLA 3UTSD 4JLRA 5IVOA 3BKML 5TE6H 4NO2A 2YD5A 1KGCE 4YQXH 4K8RC 1DDHB 1F4XL 1S7SA 4UT6H 1YC7A 3BJLA 3MLVH 2VDLH 3JVGA 2FX9L 3QNXB 4IDJL 3V6BR 5I6XC 2FJFA 2WM0A 4GSDL 1T20A 4BZ1H 3LDBB 4MD5A 1OAZH 3MLTA 1S7RB 4DUWA 5TQ0H 5CUSH 3UBXG 4XPGL 1P7QD 2EZ0D 3MRBB 5CFHA 4I0PA 2EO9A 4NC0B 3KPNB 3VE0B 3FO9B 4LSDA 4YH6A 5LWYH 4X5XA 1P7KA 1EGJH 4JRXE 3VG0L 1RZFL 4GAGL 4K23L 3QDMD 2Q8AL 2BMKB 1B3JA 3VWKC 4OFPA 4OLVL 3QCUH 5AZ2H 2EDEA 4YHMH 4DVBB 1BVLA 3MV7A 2KZ1B 1WBYB 4WWKC 4Y89A 3NIFF 2G2RA 3O3EB 1U8PB 2HFTA 3ULSB 2P49B 3IDMA 2UZIH 3WIHH 5I19L 3TBSA 4JJ5B 5T3ZH 3WUWG 1BBJA 3T4AA 5F1KC 4X80H 4MA7H 3CZJA 5T1LB 5KTEH 1AGEA 1W0VA 2ADGA 5FGCB 4NQEE 3V4VL 3L3DA 4LMQE 4FFVD 5DJYB 4FQ1L 4X6CA 2DD8L 4OD3L 1A6AA 3QEQA 1KTRL 4P3WA 3MV8D 4JO3H 4PJ7B 4ELKA 3MRCA 5E95B 5CCKH 3R0MA 4I3RL 4YXKH 4DCQA 4NZUH 4G8GB 5DJZA 1Q9OB 1N64H 4GUPA 1SMAA 2CO6B 5CJQH 1J1PL 4WHYG 4NUJB 2ED9A 5HGAA 5SWZA 3MGAA 2CRZA 2P44B 4TRPH 1BQHA 4RRPA 4C56B 5KVDH 2V2TA 4X4YA 1B0GB 4PREB 3JWDC 5BZDA 4ELMF 3WCYA 1P1ZA 1IEAA 5IMOA 3NCEB 5DHYA 2AJXH 1IGJA 1U95A 2CUIA 4GRMA 2FWOB 2ED7A 2Z31B 4G5ZL 2E7CA 3BIAX 5IQ7H 3MRMA 4X4XA 5K9OA 1MCDA 5GJTL 5GISL 1N5YL 1LK2A 1A2YA 2YZ8A 2DMKA 1KEMH 4HX1B 3HKFA 5F3BA 4WUUD 3N9GH 4JY6A 4RSVA 2X4PA 4LSPL 5HDBF 3U36A 4HHAA 3I75B 3HZYA 4OKVB 1NBYB 4M02A 1SMOA 1H5BC 1S78D 2MHAB 1K5NA 3RBSA 3QXAA 1U91A 1I4FA 3SDXA 1SJEB 3QDAA 1FC2D 5H2BB 2GSGA 2VDRH 5K59E 1QFWI 4RGNC 1BZ7B 4S1QH 5TH2A 2J3SA 4B41A 5J9PB 5IB1A 5FA4B 2AV1B 4CVUA 1G1CA 5E9DD 1AO7B 1DQLL 3RWDA 4LCYB 4RMUA 4HUNB 1XR9B 4FTVB 4FQHB 2JJVA 4UB0H 5F7WC 4KZDL 3KPPA 2NTFA 2VISA 4JFDB 1MCWW 1D9KB 4PRPE 4JREC 4OBSA 4PY7B 3HMXL 1MHHA 2A9MH 5D2NC 1Q0XL 1BVZA 1NUNB 2SEBB 4QHKI 2A6IA 2DL9A 3HE7A 2BY1A 5D96B 3BKJL 1NQBA 3HS0A 4HT1L 3UPRB 3KLAB 1J11A 5E1AA 3QUMA 3BIBX 1G7PA 2OP4H 4WDIB 1F90H 4QHMB 1UM4H 4UNVA 3ZHKA 8CGTA 4NC1C 4XBPB 4GW4B 3DUUA 4ZS6D 2EDRA 3G6JF 5D6CB 5L2KB 4NOBA 2EKSA 5GGUB 3DARA 4ZOBA 2ZKHH 5C0JA 1FL3B 4FZ8H 5HVHB 1ORSB 4CMMB 2GITB 1A1MB 4Z78A 1JZ3A 1I7UB 1J1XL 1JTTA 3TJHC 1LEGA 1MCWM 1FYHB 3BO8B 2W65B 2IEPA 3IETA 4HS3B 1F00I 1AXIB 1YEIH 3FJTA 5BS0A 3RL2B 3TA3B 5FGRA 5D8JH 3FHAA 2DQJL 4OCSL 3MXVH 1SY6A 5GRUL 5DWUH 1S9YA 4IRSD 4WUKH 5EO1B 1OGAE 3RUGE 3QIBA 4NRYB 2UZXB 4MDJA 1AXSB 4JM4H 1ZSDA 4JFEA 1LQSR 1YDPB 1BWMA 3HI1A 5GS1C 1CK0L 1WJ3A 1AQDA 3BDBA 1KJ2H 4ONHB 3U46A 2VXTL 4L3CB 3WE6A 4R0LC 4GAFB 1G7LB 1HWHB 2B0SH 3G08B 4NHUA 3GSWB 2H8PB 4HUVA 1REIA 4KJYA 4PRHA 4D9RD 2X4UA 3IJYA 5FB8A 2QHRH 3OSKA 5DVMA 2J2ZA 2JELH 4N9GA 5LGKA 4Y4KD 1GHFH 4KGLA 5E5MA 1HDMB 1INEH 4PLKC 3WLWC 3NIGE 3L9RA 5JXEC 2X7LA 2BVPB 3FONB 4Y4FB 4XB7A 4KC3B 5F9OH 2RFXA 1FO0L 4DQOL 2XTLA 2O5ZH 4M6ML 1DL7L 1J1OL 1FN4B 1BFSA 3WO3B 1J10A 2R1XA 2XZQL 4EUPG 2CPCA 1X6NA 2P43B 4TSAL 2EDLA 4MLSA 2HFFA 4X6DF 2QHLA 5GSRA 4KK8D 1NEZB 3OB0K 3FT3B 1BJ1J 1U8HB 1CXIA 4D0BA 4NN5C 3RQ3A 3KR3L 5IVXF 4NQEA 1R3LB 2BNRE 4PD4K 3R06B 4WFED 3DOSA 4YEFA 1HEZA 4UINH 4AIZB 2AJYL 5GS0C 5F9JA 2DTSA 4WFGD 3FB8A 3SE4A 1UZ8A 3L3JA 5IK3B 5FCUH 4X99B 3TT1L 4XVTL 5CD5C 1KACB 5JORB 1M71B 5DRNB 2OZ4A 2XWTA 3C09B 5GGQH 4CN1A 1ZT4A 1KOAA 1GIGL 3MA9L 4LF3A 2PO6C 3B9VA 4K94L 5FM8A 4GMTH 5JHDB 3CFJA 1FDLH 4TNVK 1ETZA 1JPFA 1M7DB 3U6RB 1DSFL 5D5MF 1CD0A 3U9UA 5IROA 4G43B 3QI9C 1TFHA 2JJTA 1T4KB 4GAYA 4AY0A 5IEKB 5CWSA 2A6DB 1T04B 3VXSD 2FEDD 2AK4E 1KB9K 2H6PA 3DBXA 3FAXA 35C8H 4QWWD 4W4OA 1A0QL 1MF2H 5DVKA 3SE9L 2GCYA 1XGQA 4BSWB 3WN5B 3ALPA 1I9RL 3VRJB 3FB5A 4Y1AD 4KRPC 3FFDA 2FX7H 2IPUG 2Z31D 3WFZA 5GGRY 4F7EA 4OLZL 3H6JA 4MA3B 5HHOA 4Y5VB 3KYNA 3BN3B 4QXGH 1JBJA 2PYED 4PJBF 3G04A 4XMPH 4L5FL 3T1FA 1KCSH 3OF6A 1PKOA 1X5GA 4KPHL 1JTPA 2ICCA 1I85C 1O5DT 2J6EL 2BNQE 4PRPA 5HGBA 1LO3L 1JHTB 1VPOH 1AD0B 3DUSB 2Q86B 1MHCB 4NYLB 4PV8B 4HWUA 1AR1D 4HWBA 2NY5H 1A22B 1OQOA 3OKNB 1NUGA 3JTSB 1V7NH 2VDOH 2Y36H 1K8IA 3OG4B 1LEKA 4EI5B 5BRZE 1NCTA 5ANMB 3JZ7A 3RJQB 5JA9A 4RFNB 1OP5H 1H3PH 3EO1B 1AO7D 4UU9A 4H8WH 2PTUA 5DJ2B 2V2WA 2VTFA 3FQNA 3TN0B 3BH8B 4Q9QH 3MMEA 1A9EA 4WTWA 3BP5A 4Z7UB 3O2DA 2Y6SC 3TV3L 3NFSL 3O9WD 4P2RE 5CLWA 2D7OA 4XCFH 5EIVA 1KG0A 3KGRA 3WS3A 4KWUA 4M5YH 5AZEL 4U1KB 1UM5H 4ODTH 5I66B 3VH8G 3ARWA 4L9LC 4MXWH 3N1MC 4R8WH 4PJBB 1AC0A 1UXSA 4ZOCA 1ZXQA 2X4QA 4LLQB 3GGWA 2IH3A 3W81A 2FATH 4XGZA 5E70A 4X5WB 5GGRB 1OGAA 4MAUL 2ZOLA 3AMLA 4LSVL 3C8HA 5DFTA 3SDDA 4GRLA 1P5VA 3I2CH 5EZOH 1NC4A 4NKOB 3RI5K 1M4KA 1DBMH 3SDCC 3WO4B 5F7DB 1TVBA 4PRAB 2GYSA 1FSKB 5DC0A 4UV7L 4JZOA 3FT2B 5ESAB 4WW1B 4FQLH 4MGXA 1JGDB 1QRKA 3OKOA 1HCFX 2DQHH 1FG9C 4OZ4B 4JKMA 3FFCD 4RBPH 5D7JD 2Z93B 3DMMD 1ZVHA 4ZO8A 3VW3L 3FO2B 1JPGB 2AGJL 4EOWH 2JJSA 3C87A 3BVNA 1FGVH 2CMRH 3D3VA 3TIEB 5IVZB 5DHVB 4O9HH 5L7XL 2R0WH 1DUZB 5I1DB 2CK2A 5HYSB 4QRPE 3AS1A 4PJEA 2HH0H 2R1YA 3ULVF 1NCAH 5DC4B 3UTPD 3IDJA 3MRJB 3HAEB 1WIPA 5EZJB 4HC1H 1U8QB 5I2IA 4WNQB 2DJSA 5MEPA 1WISA 1JWUB 3S35L 1WFTA 4WW2A 3MC0A 2LTQC 1GGCH 5D72H 4ZFOB 1YY8A 3NAAH 3GI9L 1N6UA 1KJ3H 4ISVB 4PTUB 5E4EC 1F8TL 3TWCL 2B5IC 3CGTA 4TUOA 4MD0B 4Z18A 2D7QA 3VJ6B 1LE5A 5DK0B 3A6CL 4KVCH 3X17A 2GQHA 1VA9A 3MRDB 4Z7VF 4MCZB 2O61B 4NDMA 1A1NA 4KV5E 1Y18A 3C6LB 4U3XA 3D18B 2I26N 2V5RA 4QRQB 1F5WA 4ZYKA 4I2XA 3SKJL 3SOBH 3MRIB 4I3GA 2ZUXA 4JB9H 2AJVH 4K2UH 4Y4FD 3HR6A 3QA3A 3SGEH 4P9HL 4UOW0 4QCIB 5C0CA 4CRPA 3BEWB 3PGCB 3AS3A 1CGUA 2X44D 3NFPB 1IGCL 1R5IB 4J6RL 1U2HA 4TNWF 5CSZB 3SCMA 2ARJB 4MA8L 3BDYH 1RJCA 5K59F 1BIIB 1CVRA 5DRZB 5T1KA 1RU9L 3IJHA 4P2QB 3EYSH 5FYKE 1GAFL 2H1PH 4KRLB 3QZWG 4NUGH 3O6LL 4L3EB 3P77A 5TDPA 5ID1A 3Q5YA 2APXA 1CD1B 1UB5B 4KKNA 2APTA 1NBZB 5JW4M 4H0GA 4P5MA 3LOWA 2P5EB 1T7ZA 4Z7VB 4OGAC 4PJGB 4TPRH 5BZWA 3T0XA 2VERN 5L8LB 5TDNA 4M1CC 4RAHA 1JFQH 3LY6A 3FRPA 4XC3L 2UWEF 4P2OC 3WFBL 5KSBB 2LQRA 5A2FA 2J8OA 3D48R 4R2GD 3MROA 3V6FB 5BVPH 5L88H 2AK4A 3MRFA 1KNOB 4PJFF 4UIKH 4XNMB 4PRIE 4IHOA 4LFHG 5HI4C 3O4LB 3ARGC 4XXCA 4XXDB 2AQ2A 3GBNH 4NHCL 3R8QA 3L1OL 2BX5A 5KVEH 1RJYB 1NCBH 3E6FA 2FZ3B 1UXWA 4XPAL 2AJSH 1HILA 1WZ1L 4UOJA 2I60H 4F9LA 4NJAH 3AREC 3LKNB 3CFKA 1EHLH 2WV3A 2BVUA 3MXWH 12E8L 1ERNA 1RURL 3PG2A 4X8JA 3LPWA 2Z92B 1OSZB