2Z4QA

Crystal structure of a murine antibody fab 528
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
DILMTQTPLSLPVSLGDQASISCRSSQNIVHNNGITYLEWYLQRPGQSPKLLIYKVSDRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYYCFQGSHIPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPRDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti egfr antibody fab, light chain
publication title Thermodynamic consequences of mutations in vernier zone residues of a humanized anti-human epidermal growth factor receptor murine antibody, 528
pubmed doi rcsb
total genus 48
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2007-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z4qA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z4qA01
3I02B 4DKAA 5GGQL 1G6RH 4BZ2H 2WSKA 3R8QA 5DZLA 4YE4H 4X4ME 3ZLQC 2L7UA 3TESA 4RGOL 5B3NA 3WS3B 1EBPA 2F54E 3KLDA 1WCBB 4ZPVA 1RK0A 1D5BA 2XQBL 5SWZA 4RFEA 3QO0A 5KVGL 3QUZD 2UVFA 4R6UA 3KVQA 4BSWB 1A4KB 3B83A 1DL7L 1VFMA 1YEIL 4GKSB 3FHQA 2IPKB 2P42B 5CZXC 1KIQB 4RA3A 4TUJA 2Q87A 4PJGF 3OJDA 2CUHA 5FM4A 4HWEH 4GW5A 3H0TA 5FHAL 1K5NA 4P2QE 4HXAL 1QEWA 5GGSY 1CZ8L 3TZVA 5B38A 4KQ3H 4C56E 3BZFA 5E24E 4P0DA 3FAWA 1MEXH 3RDTC 3BQUA 5JZ7C 5EC2A 4OD2B 4ZFGL 2UWEB 1KCVH 4KU1A 4XAKE 3HUJF 3QUKB 4FQHA 5IB3B 1ACZA 3CX5J 4PLOB 4PREB 2R2EB 2VLKA 4U33A 3GMMA 4ZO7A 5I1IL 3UPRB 4YHML 3PDDA 1NCDH 5I18L 2A0LC 3LRSA 2W9DL 1J1XL 3IS0X 1HOCA 5GS1B 3QJHB 1YEHL 2EO1A 2G2RA 4P48A 5MENB 1UM5H 5GS0H 1TPXC 2O61A 1JFQL 1RJCA 4WU5B 3MLXH 3O6KH 3RRQA 5AG9A 4L8BB 1T1WB 4KQ4L 4W81A 3QNYB 4P46D 1FC1A 1FZMB 3ECBA 4NQSA 4WI4A 1NCAH 1QRKA 1KPRA 2PR4H 4GRMA 4JG0L 4HSQA 1MHHB 2CO6B 1OGTA 3FQTB 1Z5LA 4F2MB 4HF5L 1VKXB 2PXYB 3GSOB 4J6RH 2VC2H 4JREB 1KB9K 3CD4A 2LTQB 2R56H 4NZUH 3SJVA 1R3IH 2B2XL 1A9BA 1BQHA 3O3BB 4LLVB 1A1OB 4RWHA 2YMXL 1ZV5A 3FN9A 4LOUD 4OLYL 2DS4A 1GXEA 2BSSA 4N8VB 1ORSA 3FB6B 5KTEL 2ZUXA 4A6YB 1UXWA 5E8PA 5JPNA 4ZUWB 3FZUD 1QG3A 3PP4H 5HPMA 1ZANL 3VXTA 3L3KB 3Q5TA 4F7EB 3T0XA 1KGCE 1NMCC 2J8UE 1ES0A 2P7TB 2A6KB 5IQ7H 3V8OA 4ZOEA 2Z92B 4NZDA 2HJFA 3P73A 3QBTB 1F58H 3LQZB 3WFDH 3WHE0 1KEGL 1CIUA 3TO4A 1A3RL 4K8RL 4QHKJ 4QRQB 5I8CA 3HB3C 1QBAA 2HFFB 4NO0A 3EYFB 2IALA 3MJ6A 1N59A 3TBYA 2EYSB 1C1EH 1RD6A 3PABA 4R90H 3GSNA 4I4WB 4NKQB 5JO5A 1CK0H 1MHEA 3B9DA 1KCLA 1GYAA 4YX2H 3DX8B 4XCYB 1JPSH 1L0YA 3O8XD 1ZLSH 4X7TA 5EULV 3N1QC 3V5HA 4HMCA 5DJ2A 3WFBH 4WHYH 1IGCL 4QGTA 4ZTPL 1FH5H 5K59E 5ESVA 2NXZD 1AP2B 4PRPE 1KCSH 3NN8B 3T0BA 1M6OB 4NIKB 1O0VA 1T89A 4XCFL 3SBWA 3HE7D 4K3EL 4M6ML 4R97B 2I9TB 1TZGH 2R9HC 5I15L 4HWZB 3MLVL 5J6HA 2EDJA 3IDMB 4POUB 5IMMB 2VXVH 4PJXB 4ZPTA 4TVPE 4N0FB 5D5MB 2ZOLB 2IADB 4M1CD 1NEZA 4KRLB 3KYOB 1KEML 3O2WL 3IDXL 4M02A 5CZVH 2H6PA 3ARBB 3LEVL 2ZWLT 5C0BA 3MRRA 5I6XC 3QDJE 4G7YL 1KENL 1ZMYA 1CT8A 2VAAA 5KSAC 1MCIA 1AD9A 2H32B 1ZVSA 1MREL 2OJZH 4JO3L 3V6BR 3ZL4L 2ADFH 4FABH 2X09A 1YDPB 4LKCA 3DSFH 1T22A 1RZ8A 3H9HB 3LQAC 2CR6A 4LSDA 5EU3B 2PCPA 3U0TB 5BQ7B 1EXUB 1VFUA 1RHHB 4U1MB 4HWBA 4M43L 5MEQB 3QZWG 4LHUA 3VXPB 2NY3D 4JZOB 4NN5C 4KPHL 4NQDE 5CEXB 4Y5YC 1ADQH 4JHWL 5EORL 5D71H 3AY4C 3PL6D 3T3ME 1JI1A 3ILQD 4ENEC 5F7UA 1TETH 4JJHA 4OI9A 4D3CL 2H3NB 1KYOJ 1URLA 4XTRD 1ZT4B 1Q0YH 3NGBC 1KIRB 4MQXC 1EUTA 2A77L 1I7RB 3G08B 1X6LA 1LEIB 4GG8B 3IJSB 3QULB 3DMMC 4M5ZH 4LARH 4FQIL 5J6GB 4OZIE 3MRBA 1CD1B 2CDGB 1J0JA 5LWYL 3FQUA 4OZGE 5JHDD 3SQOL 1I4FB 1U8OB 2EXYD 5EDXA 4YWGL 3LS4L 5GISL 5GQBA 4R8WH 4QYOA 3QA3A 2A6DB 2J8UF 3HE6A 1QSFD 1HHJA 4R2GB 2GITA 3C5ZD 5ESAA 5I1HL 3BW9A 1BOGA 3E8UL 35C8L 2FJHB 4HJJH 4YPGB 1S3KL 4O2EB 4XI5C 1L7IL 1RJZB 2DLIA 2CDFB 3GMLB 3SPVA 3LD8C 4M9PA 4RAVA 4OFVA 2R0ZH 3VXUB 1M7IA 1Q94A 3PGFL 3Q5YA 3U0PA 1UM4L 2OJEA 4Y4HB 4TSAL 2VDPH 5SX5K 3QI9A 4OGYL 7FABH 4G43B 5F7FA 3O6FA 4PBVC 4XCNB 1I3RB 2AJZA 1IILE 3BWUC 4K8RD 4HQQL 1ORQB 4M1DL 5T1MB 2GTWB 1ZTXL 5AYQA 2HFTA 2IANA 4RSVA 4Q9CA 4CW1B 3RBSA 5F7WC 1NDMB 3EBAA 4JDVB 3T65A 1F2XK 5HHMB 4MCYA 2C3HA 4OQTH 2BRRH 4NJ9H 2A6JB 2WUBL 5EC1A 3NABH 5D1QD 2IPTH 3SDAB 3LHPH 4PYHA 4KUZL 2BNQB 5LVEA 3V79C 3V4VH 2NTFB 5I17A 5F9OH 1VFAB 5JW4R 2BOCB 5A1AA 3GUTA 1YEKL 4KK5C 4NZTH 1WBXA 5IBTH 3T8XA 1KCUL 3PHQB 1KELH 2ITCA 1YPZE 3JWNC 4UV4L 4JDTH 3NIGE 5LGHH 1JHLL 1YC8A 1CFNB 4OM1H 4M7LL 4PJDA 5E6IC 2VQTA 1NAMB 4TPRL 1C16B 1MFCH 2FJGB 2VLRE 3LN4B 4P5TB 4OLXL 5ALCH 1YMHA 4MA8L 4HZAA 3TNNA 3KPSA 5TQ0L 2E9IA 4NWUL 2CKBA 4NPYA 3MA9L 4MGXA 5EO9B 3MRMB 4ETYA 5EZIL 5KAQF 2X4RA 3ARUA 3VRIB 4L3EA 3B2UC 3T1FA 2VQ1A 2OYPA 4D2NA 4FZEL 3L3HA 4YBLC 2HMIC 3OKLB 2X9YA 1I9RH 3QDME 3RWGB 3U30B 1NPUA 5BRZB 3T3MF 1MVFA 1E27A 3LMJL 5DEZA 1NUDA 4OF8A 5GGTH 3OMZA 3OHXB 5E2UH 1T0PB 5DD1H 3KYNB 2JB5H 1FFPA 2AQ1A 1ZSDA 4EDWL 5BXFB 4PY7A 4U1JA 1IQWH 4R7NB 4QY8B 5TPWL 4JM2B 4OZGF 4LLUA 1AJ7L 4EXPX 4DW2L 4PJ8A 4PJ9D 1Q1JH 3QIUC 3PJSB 3SKJL 1R3KB 4G9DA 1CXIA 3VU2A 2VDKL 1GIGH 3G6JF 1XGYL 4G7VH 1ZA6A 3I50H 1T4KB 1NBVL 5E2WL 1CDJA 3FQXA 5HY9B 4UOW0 1C08B 4PRID 3T2NH 5HJ3B 3CDGA 1Q9WA 4P2RA 3CFKA 3IU4L 2W0LA 5CJOH 3QNZA 3O3EA 1JVKA 1FZOA 3BX7C 1MPAH 1OARL 1KB5L 1T66D 2BJMH 4GW4B 2LAAA 3AUVA 3W9EB 3WFHB 8CGTA 1CN4A 4OTXH 32C2B 4XP1H 4AIZB 1SJEA 2EDDA 2QHRH 2NLJB 3FFDA 5I1EH 1PZUB 3FONA 3U9UA 1T0NA 1QBLL 3JV6A 1BBDH 2FSEB 5DRZA 4J1UB 4Y4FD 2MFNA 1AGFB 4RX4D 3RVUC 1RU9L 4YBQD 5ICYB 1M05A 5I76B 5F3BA 2EKJA 1IC7H 1KLFA 4RBPH 1P84K 1EGJA 1RIHH 4NC1E 5IVXE 1XCQB 5E70A 3VXSB 3IGAB 1AY1H 3S34H 4TUKH 2VDRL 1HEZA 2YUZA 1TJHL 2QSQA 3HB3D 4LSVH 4MNHB 2ZG3A 1G7MA 1HZHL 1AO7B 1VEOA 2ZG2A 3I6KA 4KHXH 4U6TA 4WWKA 4X6DF 3RWDB 3VXMB 2PYEA 4X8XA 5IF0A 2XWJA 5MHSD 3TBTA 5D4QA 1ZT1A 1DBAH 5K9KA 1IGTB 1YPZF 3V95A 3H3BC 3NIGF 1K4DB 4HS6B 3ZDYE 4Y19A 1JGDB 3MV8D 1ZGLM 3GSRA 1X5LA 5DJXA 4PBXA 1MSPA 1NCCL 2IWGA 4MXQD 4PJIB 4QXGL 4AMKL 1MJUL 2EYRB 4PP1D 4FQCH 4YHLH 3OAZK 5AAWA 3TF7C 5ETUB 3S96A 4H26A 2O5XH 1U3HD 1U8HA 2QBWA 2WIIB 4G5ZL 1RULL 4G6ML 4M7JH 3WYRA 4CDHA 5TGBB 5KOMC 3ZKQD 1ED3B 3UTSD 1I7ZA 3FMGH 3MRQA 4Y2DA 2R1XB 1JTTA 4NKMA 3SDXA 5LJYH 4XWGL 1NL0L 4I0PA 4FOMA 1XGUA 3I6GB 4PV8B 4G6AD 2KUTA 2YRZA 4H1LB 1OAUL 4WCYL 2FWOB 1YNLH 2ERJB 4TTDC 5IHUL 1MUJA 1S7RA 3K46A 4XPAH 4NSKB 4W6YB 4KV5F 2VLLB 5DO2C 4LSSL 3BIKB 5CJQH 2RBLA 2Y7QA 1FDLL 4WHDA 5D1ZC 1P2CB 5A16B 2OP4H 5HSFA 4WFGE 5I8KL 2GKIA 2IAMD 1IT9H 3UX9B 1CG9A 5DWUL 1UWGH 1J18A 1WVZA 4UBDD 3CLFL 4F9LC 5FYKH 5CP7B 1Z9LA 2CQVA 1OAXL 1A0QH 5C0CD 4HKBA 1MCWM 2V5YA 3FCTA 1ZK9A 2CIKA 3P0YH 1NGXA 1NCBH 5HI5D 3VE0B 1BQUA 4P9HH 1B90A 2P1YA 2APVA 3T2QA 3DUSA 3RBGA 1JV5A 3BHBA 1MNUL 4GLRH 4QLRA 1VESA 1LEGA 1G6RL 2YUWA 4ENED 4XCEA 4NUGH 1XEDA 5JHDE 4YE4L 3UZQA 2WMPA 1O5DT 4ELME 3RJDA 2ICWB 1LK3H 4NFBA 1QSFE 5C09B 3TFKD 2NR6C 1FL5B 4C59B 1HILB 3UTZA 3I6LD 1RZJH 4LAJH 3LPFA 3PG2A 4IMKA 3QJFA 4NRXA 3C6LC 3QHZH 1BWWA 2HAZA 1I8MB 3FKUS 3KDMB 2KH2B 1MH5A 4Y4KA 3B8SA 2DIAA 4PG2A 4OZFG 3A6OA 2MQ0A 2N4IA 5DK0B 5IVXF 5KSBE 3CFCL 4ZFOL 3O41A 1DBMH 3GMOB 4JFQB 2C1OB 3EDJA 3IDNB 4HWEL 1MLBA 4AENB 4HS8H 4GW1B 3BE1H 5BJTB 2CDEB 5J89A 4Z5RA 4MJ2A 5IQ9A 2Y23A 4LNRB 1TVBA 2YEZA 1A7BA 3N06B 5FO8B 4JFFD 4NWTH 4KQ3L 4JPKH 4XXDA 5K93A 5D1XB 2IMNA 3FQRB 4F33B 3DUHA 2F53B 4ZYKB 1MEXL 5KOVC 3BPNB 1Y6MR 2DQGH 5TQ2H 4FN0A 1UGNA 3F7VB 4M62H 1KCVL 3B9KA 2P47B 4LCCB 5H37H 1KLUA 2DM2A 3FB7B 1BJ8A 1S8DB 4IBLT 4UDUB 2AQ3A 5DEGB 3H9ZA 5L0QB 4NDMB 4Z8FH 3MRIB 5IEKB 1MCBA 3QAZB 2VXUH 2G60H 2IFFL 5GS0L 4B41A 1V7NH 1P4LB 3MMEB 4H20H 4B0MM 3C9NB 4OAWA 1PG7X 4O2CA 4P5MB 2BOBB 4NQTA 4J12A 3MLXL 3O6KL 4LKXA 1U8NA 2CLVB 4FXGA 1NCAL 1X5JA 2PR4L 4FQJH 3I02A 4P4RB 1CXHA 2UZIH 1JP5A 1T7VA 3KPRD 2VC2L 4J6RL 5GZOC 2R56L 4NZUL 5DRXB 5D96C 3Q6FB 5DQJB 2UZXB 1A1NA 3VFOB 1CWVA 1EX0A 1HHHB 3WHE1 3QQNA 4LCYB 3KJ4B 1AI1H 3QUMH 3ES6A 4BSWA 1JRHL 3PP4L 4Y5VC 1KXVC 4PJBB 1S7XA 5EU5B 2VRAA 3ILPB 4GKSA 4JFYB 4LPUA 5GGUA 1CDIA 2IPKA 3GMPB 3HC4L 3JWOH 5IQ7L 4TSCH 1LVEA 5E95B 1IAIM 5IT2H 3B2UD 1GGTA 1WGOA 2PTTA 2B5IC 2XXMB 4BKLB 6CGTA 2ZUUA 1KCRH 3WFDL 1A4JB 3TH3T 12E8H 3ZT6A 4NO3A 4RDQG 4U3XA 4AQ1B 5C8JB 1HKLH 2IBZY 1C1EL 3TYFB 4LCIH 3RGHA 1G9MH 2BNRD 3NZ8B 1LEKB 4PRHB 4R90L 4KKAC 3CUPA 1CK0L 4YX2L 2BY2A 2HRLA 4Y16B 4IHOB 1CYGA 1ZLSL 1JRHI 1K85A 5I74C 3DYPA 3MGOA 3O4OB 4I5BB 4PREA 3Q5OA 3WFBL 5AZ2H 3WV0A 5KS9B 1FH5L 3UPRA 5DMJB 3BDBA 3RL1B 5CD5C 3BYTA 4PRIE 4NHUB 3HZMA 5MEPA 3QIUD 9CGTA 1B6DA 5MENA 4NQXB 4C4KT 1TZGL 1E4JA 4OIIH 5KSBF 4M03A 3QXAB 1CFVH 2X7LA 2VXVL 1U8QA 1F2QA 4L8BA 1T1WA 1GGYA 1FZMA 3F58H 4H25B 3EYSH 1MHHA 2EC9U 3FQTA 2DMKA 4P2OC 5CZVL 1BLNB 4S2SB 3WKNA 2P5ED 5D70L 3C87A 3GSXB 3DPBA 4FQPA 2A38A 3BIAX 3MLZH 2KKQA 3O3BA 4LLVA 5TH2B 3MRKB 2XZZA 4MNQA 5GRJH 4MDIB 2OJZL 4KRNA 4LVNC 3FB6A 1WK0A 2ADFL 4A6YA 4FABL 3CCHB 2ZSVB 5EZLB 3DSFL 2BVQA 4ZUWA 4WHYG 2HFEB 3EW3B 3LKSA 4OCNC 4F7EA 3RVUD 4M4PA 1PW3A 2R2HA 2A6KA 5DT1H 4URTB 4P4KB 4KKNA 4QRPD 2Z92A 3EYOB 1ZLUK 1F4AA 4E9LA 5MHSE 5EOCJ 5F1NA 4XC3H 4XT1C 2O26U 4FTVB 3LPWA 4M3JA 3QPQD 1PKOA 5HGDB 3RU8H 1ADQL 3QDGB 3K1KC 3RWJA 5D71L 1FJ1A 5KJRL 2R1WB 2YC1B 5EUOA 2EYSA 3DV6A 3MV8E 2VERN 1I8IB 2Q1EA 1KJVB 5EZJB 4UU9B 1BD2B 1TETL 2DIBA 3QFJB 5GS0D 4K7PY 3CFBB 4W6XB 5JHLH 1FAIH 1KXTB 4GT7A 4JO4H 4MA3B 4XCYA 2ADIA 2J12B 5T3XL 4Z7OE 1R3JA 5FAAA 2YN5A 1KLGB 1G7HA 4F15B 3PP3H 2CUIA 3G04B 4M5ZL 4LARL 3IFOB 3CX5K 1ZAGA 1AP2A 1P4BH 3NN8A 4R0LC 1M6OA 4M48H 5ANME 1I3GH 3GFUA 2I24N 1H5BA 4JGUA 4DFHA 4R8WL 2I9TA 5I8OL 3TA3D 1S7QA 4HIXL 4B50A 1PQZB 5EO1B 1F90H 1MCOH 4HJJL 4PJXA 1DE4B 2EDLA 4NQCB 3BIBX 2IADA 3C8DA 5I0ZA 4KI1A 1AHWB 3HNTH 2R0ZL 4RAUB 4UINH 1EEZA 3SHSA 1KPUA 2HKHH 3VG9C 3X14B 4PRNB 3HUJB 1DVFD 4YHPB 1ZS8A 5E1AB 2BVTA 4QKXB 2ZZUT 2VDPL 4Y5XA 5GPRA 7FABL 4EDXB 3P9LB 3GB7A 3VWKB 4YC2C 5HGBB 3RZCC 1A7PH 5BCAA 1MJJB 1MCKA 3VFPB 5DO2D 4EJ1C 1QNZH 1QLRB 3NCJH 5C0CE 3GEWB 4KHTL 2J6EH 2ARJB 5L8JB 5EU3A 2E9JA 2LAGB 4TRPH 1JNJA 5JMRA 1JWMA 4L4VA 2LE9A 2LV4A 4CVZB 1RHHA 4LRIA 2IH3A 4UT7H 2XFXB 4U1MA 4OQTL 3SCMD 2BRRL 5IW3A 2V17H 4NJ9L 3MJ8A 4FQXC 4XBGB 1IJ9A 2D4FA 4IRJD 4CJ0A 3NABL 4K94H 4LCWD 4E0RA 4OCWH 3UBXG 4NRYA 3O2DH 4H0GA 2UY7A 3NH7H 3C5SB 5HVHB 3V4VL 3ULVH 5F9OL 1QFOA 5JR1H 4ALAH 5C07B 3VXRD 3I6LE 4M6OH 3GSUB 5IBTL 3VFUB 4QCIA 1WWAX 5FOJA 1KELL 1KIRA 5D2NC 1I7RA 4L8DB 3OKEA 3QUYB 1NFKA 1MFBH 3G08A 5LGHL 4OM1L 3IJSA 3QULA 4GOSA 5B22A 4DN3L 1QVOA 1MFCL 2XYCA 3P3YA 2X89A 1I4FA 1U8OA 2YUVA 1G84A 1UVQB 3MUZ1 3BRGC 5ICZA 2UVEA 4KMTH 4UTAH 1KULA 4YQXH 5D7LA 2ADGA 4F9PC 4JFFE 4NJAH 2FJHA 5CIPB 5D93B 3AREC 3FFCB 1PGRB 2O5YH 4UNTA 4YPGA 5EU7C 1YQVL 5FO7B 4O2EA 4PJEF 1RJZA 4LPWA 3ARDB 1I9RL 3IXAB 5I75C 1HDMA 4K3GA 4MQSB 5CS7A 4PGEA 2B4CH 1DUZB 3WMSA 2F54B 2BC4B 5BVPH 4HC1H 5FB8B 4Y4HA 2FATL 1TZIB 2SEBA 5GGTL 4AYFA 2HT4C 1SY6H 4IJ3C 5J1AB 1I3RA 1NLDH 5E2UL 3F6IA 1IL1B 1K3IA 4ZDHB 4P9HC 5DD1L 2JB5L 5CSGA 4UOW1 3VGDA 1ORQA 1IQWL 1T6VN 1TTGA 3GSWA 3UAJC 1S9YA 3IU3A 1CIDA 4G6FD 3NFPB 1A3LH 4LEOB 2WBWB 3P4OB 5IB5B 1S7TB 4JKLA 5TDPB 1Q1JL 1NDMA 3LV3A 2HH0H 5E0QA 3GIVB 1R0AH 3Q0HA 4ONHB 3ULUC 1FSKB 4M7ZC 5E00B 5T3XD 1IE5A 4LCUB 4P2QB 3I50L 4ZUSB 2OSLB 3IXTB 4XC1H 3X17A 4JFXB 4HAFA 4OCLC 4AH2A 4C56B 1MQ8A 2Q86B 3T2NL 3KPRE 3RY6A 5CBEB 4MZ2A 2NTFA 2A73A 1SEBB 5HHOD 4JZJC 3QIBA 1MPAL 5DHXB 3KG5A 1A6UH 3PHQA 2BJML 1J1PH 1IEBB 2DQIH 4OTXL 3GGWA 1KYOK 3DOSA 2QHRL 1DP0A 4PJFE 1A7NH 2Z8VC 3GJFB 1NAMA 4WGWB 3MBEC 2FJGA 4X7DC 3LN4A 1BBDL 2EH8H 2DLTA 1MJ8H 2FL5B 2PTVA 2Z91A 1JGVH 2XACC 1ODAA 3H9SA 2YS4A 2YXMA 4LSQH 3O4LD 5EIIB 3MRMA 4YFDB 3VXQA 1WICA 4RWYL 2IG2H 3MC0A 5DJ0B 1IC7L 2F5BL 5JXEC 4DOHE 3VRIA 1E4XH 1RIHL 2BMKB 1XF3A 3OKLA 2VDMH 3WUWB 2GK2A 1N2RB 1AY1L 2DBLH 4TUKL 3C08H 4JN2A 3S5LB 2DL2A 5BRZA 4EUPG 1C5DB 4LSVL 1MHCA 4KHXL 4M7KH 1KJ2A 1MCLA 1RZIB 5C3TA 2FIKA 1UC6A 2P8PB 3PV7A 3OHXA 2FX9H 4OFYA 3T4AB 3OXRB 3VD5A 4K23H 1IKFH 4MQ7B 1YJDC 4U0QB 2DWDB 2DWEB 2ICEB 3B6SB 3JVGC 4KVNH 2O5ZH 2X1QA 4R7NA 2J8UB 3TVMA 4HEPG 4JM2A 3IKKA 3T2OA 4WW2F 2C3XA 4QTIH 4GS7C 3QUXD 4FQCL 4YHLL 3IYLW 5CD5D 1BX2B 3G5VB 3L1OL 1WFNA 1DSFH 2ZUVA 5IWLA 2O5XL 4F58L 1YUHB 1UEMA 4X6EB 4YJZL 1OAYH 2P5EE 5HJ3A 1EIBA 1FLRH 2JIXB 4CUCA 4S0TD 1ND0A 3TH4T 3BPLB 1K4CB 4J4PD 4N0UE 4EVNB 3MROB 1KNOA 3FO0H 1VSCA 3ZYJA 5AWNH 2NZ9C 1OW0C 3W9EA 4HUWB 3GSVB 3NCFB 4HFUH 1YNLL 3QG7H 3QEHB 3GSQB 4WU7B 1HWHB 5FKAA 1WZLA 4JPVH 4XPAL 3UCRA 4PRPB 4RMWA 3KPMB 1UYWH 2ICCA 1M1SA 5CJQL 5BS0E 1IARB 4QRPE 2FSEA 1CFTA 4NUJB 2OP4L 3CVHB 2AXGA 3ZHDA 3HLAA 1AGFA 4JN1H 5D7IA 1MWAA 4DZBB 4OZHE 1H3TA 5ICYA 1XR8B 1IT9L 3GK8L 1CXEA 1UWGL 1H8SA 1XIWD 4GMSH 2PO6C 1JTOA 1EVUA 1U3YA 3VWJB 5FYKL 4BFEA 1FFNA 1A0QL 4HWBH 1E6JH 3BUTA 4MJ4A 2JJTC 3P0YL 1UB5B 1NCBL 2EEDA 2NMSA 3P11H 1X5IA 4P9HL 3QDJB 4XCCH 1RZGB 3H3PL 1UKSA 5IW1B 2Z31B 3WIFB 4UNUA 3VXMA 4OGAD 5H8DA 2L7JA 2X4SA 1FO0B 4E41A 4NUGL 3GJFK 5EO0B 2YD5A 4KROD 3ULUL 3OKMB 1LK3L 2YBRB 3HI6H 5DC0A 4MD4B 1QQDB 1JZ4A 4PJIA 2LFGA 1RZJL 4JVWA 4YEEA 2EYRA 1CGUA 4GBXD 2E3VA 3QHZL 2VXSH 4NCC1 5F7NC 4NQDB 5MI0C 2VTFA 4BH8B 4POZD 4QT5B 5INDA 1RI8A 1NLBH 3ROOB 4GMTH 4ZNEE 4YDLB 5C70A 1PY4A 5EU4A 1DBML 3RPKA 1ED3A 4RFOH 1J1OL 4Y1AD 2X4UA 3PIQB 4HS8L 2ILLA 3BE1L 5DRWB 3B2VH 2QLVB 4U1LB 2HRPH 5ACMA 4JO2H 5CD3A 4NWTL 2FWOA 4JPKL 5D2LE 2ESVA 2IEPA 2XKSA 3EDEA 4OZIB 1UCBH 2DQGL 2WP3T 4KRPC 2DJSA 4OZGB 5TQ2L 3ARFD 5FF6A 4M62L 4N5ED 3PNWB 3BIKA 1KIPA 4Z76B 5EOTB 5C6PB 3Q48A 3B43A 2QR0B 3RTQA 5ECJE 1P2CA 5A16A 4LEXH 4EKXA 4JQVC 3UTTA 4K71B 2XZAH 1UA6L 1A1MA 1GOFA 1XGPB 4LCWE 1OB1B 4Z8FL 4N90D 5DURD 2MJWA 3I3DA 2VXUL 2G60L 3QCTH 1V7NL 5JPMB 3VXRE 2A2QT 1AQDB 1NC2B 3VE0A 4HH9B 1E4WH 1XT5A 4YZFE 2EDEA 5BW7C 2ID5A 1JCKA 2VXTH 2RQ8A 3BOVA 4DK6A 4FQJL 5C0ND 2IMMA 5F9WB 2VXQH 5D7JB 4ODXB 5I1DB 4U2ZA 1J8HE 1W72B 3RWHA 2ICWA 4LSPL 3UJTH 4U05A 1MCCA 5H37G 1PKQB 1ZHLA 4I1NB 5I1GH 1AI1L 3S88H 2QQNL 3QUML 5CMAB 5IEHB 4OV5B 4YGVA 5HI3D 2F9BT 3KDMA 5BV7B 3T09A 4OLEA 3DO3A 3BGFB 5E7BA 1VGKB 2Q8AH 3JWOL 4HS3A 4TSCL 2GI7A 5IT2L 3E2HB 3GMOA 3K74B 2C4FU 2C1PA 2C1OA 1ZGLB 3ARED 3IDNA 5I73C 3BXNA 5AZEH 4GW1A 4N0YH 12E8L 1FFQA 1NUFA 5E94A 1H3VA 1YPZB 4PJHE 2NY1C 1YEGL 5FO8A 4RDQF 2FEDD 1E28A 4NM8H 1RMFL 3CXDH 1G9ML 4LCIL 1B2WL 1GCFA 4F33A 1DEEB 2F53A 4ZYKA 5FYKD 4ONOA 1TCMA 2VLRB 3IDYB 3QDHA 1MELA 3F7VA 1JUFB 5IB2B 3D9AH 1WF5A 5J4MA 1P53A 3V6FB 4BK5A 3OG6B 4JFZH 2X1OA 5T3XE 3CZFB 2FECI 2FO4B 1S8DA 3QEUB 5T1LB 1Z9OA 4UDUA 3C60C 1HNGA 3DTXA 3VFRA 5EFIA 5DEGA 3RDTA 4W68A 4U0RC 3MRIA 2H2SC 4WUUD 5IEKA 4GKOA 4JFOB 4P3DA 3QDMB 5EBLB 3ULUD 3OZ9H 2BY3A 2YD2A 5IK3B 4OIIL 1CFVL 4JKKA 3QCUH 7CGTA 3QP3A 4XVJH 3K8LA 1P69B 4U6HA 1KC5H 3KPNB 4WTZG 2CLVA 3N50A 1IAOB 4I9WD 3HAEB 3A67H 3F58L 3X12B 4P99A 3EYSL 2AV7B 4JFDA 1S7VB 5DUBA 4P4RA 4O51B 5D2LF 1F6AA 4Z9KB 3HG1D 3PWUA 2B39A 5DRXA 3Q6FA 3KLSA 4NN6B 3O4LE 4ODWB 2X5PA 5GRJL 4KZDH 2I5YL 3ROLA 3RHWF 3MRGB 4LCYA 4P46B 4YAQA 5ILTH 1Q8MA 3QO1B 3TZVC 4FMFA 4OLVL 3NPZB 3PDGA 1AGDB 1S9VB 1FRGH 1N7MH 4JRXD 5M95B 4HFWB 3KNBB 3WO3B 3JUZA 5DT1L 1LO2H 1OLZA 5J9PA 4RMRA 5DA0B 3PWPD 1YNTA 2GJZA 5E4IA 1RVFH 4XC3L 4HEME 2HG5B 2QSTA 2YOCA 5C6TH 1BF2A 3VMOA 3P4NA 1T5XB 4MD5B 2WLYA 3QYCA 3KYAA 2RJMA 4ZUUA 3TYFA 3VGBA 4BSVA 1LEKA 3MV11 3BH9A 1TDQA 5JHLL 1FAIL 3Q2CA 4JO4L 3KPPB 4F7TB 2RFXA 2DL9A 5HYQA 2HJLB 1AGBA 2OMBA 1G9NC 3LDBC 4HW6A 3WJJA 3IFPB 1U8LB 5KS9A 4PJ7A 3D39D 1HH9B 1A64A 1P4BL 3RL1A 3GHBH 2J88H 4M48L 4E42B 1YYMH 5IVXB 5IHBA 1I3GL 5CSZA 5F9DC 3D2UD 1PX3A 4L3AA 4CMHB 5ISZD 3O8XB 3G5XB 2BSTB 2FD6L 1F90L 1MCOL 2GFBA 2RB8A 3Q1SH 5F7MC 4YFLF 4PYGA 5A2FA 3HNTL 4R4FH 4D9RD 4UINL 2HKHL 2OQJB 1BLNA 4S2SA 2FZ3A 4U6XB 1MHPH 2NZ9D 4J8RB 1JYNA 1SM3L 1G0YR 5TH2A 5F97E 5ERWB 2N7AA 5CJBA 1GGCL 1BM3H 4PLJC 4MNGA 1I9JH 3CCHA 5HTSA 4QRUA 5EZLA 1QNZL 5K9QI 3NCJL 2HFEA 1IEAB 1N0XH 2J8OA 1X5KA 3GJEA 2J6EL 5KSAA 3GIZH 4XVUC 4TRPL 2WZPD 3CAFA 1JTPA 3GO1H 5I1LB 4P4KA 4UT7L 4XP5H 4LVEA 3VJ6B 2V17L 2R15A 5K9QG 4DEPC 2YHGA 1S9XA 4ZD3H 4KKBD 4K94L 3P0GB 4OCWL 5IR1A 3QDGA 3O2DL 1D5MA 4X5XB 3NH7L 1CGWA 1I1AD 2NNAA 1D6VH 4NP4H 2YC1A 3WFZA 3W9DA 2CIIB 4DN4H 1T89C 3ULVL 3SBWC 1JHTB 1I8IA 4ZFZB 1KJVA 4ALAL 5EZJA 3KPQB 4MB5A 4UU9A 1SYVA 4MMZC 4M6OL 3QFJA 3PF2A 3CFBA 2PYFB 2EDRA 4MA3A 4Y5YA 1G7QA 2NY3B 2M8XA 4WEUD 1FYTD 1KLGA 1MFBL 2XZQH 3OF6A 4MAYD 5FDWB 4GXUN 3G04A 3QXDB 2IJ0C 3HPJA 3IFOA 2AJ3B 1MRDL 1HINH 3SDCC 3BMWA 4IMLA 1D5XB 4PJGA 1T1ZA 4Y1AE 4PD4J 4KMTL 4UTAL 1HKFA 1XGQA 4YQXL 1CLZL 1XR9B 1WFUA 3DMMA 3WFCH 5F72S 3TT3H 4NJAL 1VADB 2O5YL 4QHMB 1IGYB 3BN9C 1ZKAA 1MCDA 4GKZB 1DBKH 1AHWA 2ZUTA 3T0EC 5JHDB 25C8L 2B4CL 4ELMB 3STLB 3VH8G 1F8TL 3HUJA 5BVPL 4HHAB 3P4LA 1QSFB 1VERA 2DMCA 4HJGA 5GZNC 3C5ZB 2FRGP 5EBMB 4EDXA 5DI8B 2P8MA 1SY6L 1T21B 3RVWC 3DO7B 2KZ1B 4P23D 1NLDL 5HGBA 2XWBB 1T7WA 3RX8A 1MJJA 4N90E 2XTJD 1VGEH 3S3PA 4D94A 1FFOA 1YEEH 1X7QA 1QLRA 3EYQD 4LGPB 1A3LL 2ARJA 5KSBB 2PTUA 4ZUTB 4QHNA 2YUXA 4CVZA 2F8XC 2HH0L 3JTSB 1DN0B 1R0AL 4B7LA 3MRDA 4AM0B 4XBGA 4XC1L 1QRND 3G5ZB 2YWYA 1EHAA 5AEAA 1C7TA 3ARGD 3C5SA 1FHGA 5JOFB 4PGCA 1QUNA 4RFNB 2EDYA 2A6IB 2XN9A 5LGJA 1EJ6A 5C07A 1SJHB 1FNLA 5DMYA 3PV6A 1J1PL 5B38G 4M8VA 4GG6F 2DQIL 3HI1B 1OGAD 5D1QB 1PY9A 3MCKB 4I3GA 2DYPB 1A7NL 4NFCA 5F70A 3O9WB 3ALPA 5MEOA 2EH8L 3U2SB 4N9GB 5DK2A 1JPGB 3K4DA 1JGVL 3QZWB 4M7LT 1WIOA 4LSQL 2YKLH 4X7SH 5E6IA 1G7JB 4WNQB 3O6FC 1EO5A 2IG2L 4IRSD 2EIZB 3ZYIA 1E4XL 2VQUA 2OX5A 4Y2OA 5FO7A 3F7YB 4P3WA 4OF5A 4EI6B 5FYKE 3MOQA 2DBLL 5ITBL 3C08L 2CLRB 1DQQA 3FT3B 3MLYL 1DUZA 4HDIA 2BC4A 4M7KL 3BH8A 2CUMA 1ZWIB 4I48B 3TIDA 2YPLA 2FX9L 3TN0C 1IKFL 3NA4A 1CFSB 4IOFC 4K9EC 5GGVY 4ZDHA 3EFDH 2AJSH 3BKMH 3UZEA 3LY6A 3NFPA 3G6DH 4KVNL 2O5ZL 1BQHG 3ULUE 3ULVD 4LEOA 3U46A 5IB5A 3S35L 3V4PH 5TDPA 4QTIL 5AD0B 3LKPB 4YPJA 4Q58C 4PRDB 3TO2B 4I9WE 4JDZA 4ONHA 1DSFL 4X9HA 4ZUSA 2IFGA 4JFXA 2APTA 4YK4C 3KPLA 2Q86A 2H26B 3HG1E 5DTFB 1FLRL 5EOQH 5KG9B 5SWZD 2E9WA 4QRSB 4LHJB 4PJ9B 1ERNA 1U91B 3FO0L 5C0GA 4PLNC 3CK0L 2P8LA 3V0VB 5AWNL 1NSNH 1Q9KA 1CD9B 4XPTH 4HFUL 2XQYG 1DDHB 1IEBA 1DLFH 4JY4A 3NAAL 3ZKNC 4JRXE 4JPVL 4LPVA 5IOPB 2EICA 4YHOL 3JXAA 5I9QB 3GJFA 2X2YA 3NIFF 1UYWL 5INCA 4UT6H 1NUGA 2WAHA 1MFAH 1S9WB 5E8NB 3PWPE 1FV1A 1RUKH 3HMXA 4JN1L 1DFBH 3D48R 2UV3A 4RGND 3VD4A 5DDHB 2BX5A 2BMKA 1QBMH 3BQUD 3PHSA 4HWBL 1E6JL 1LO3H 2DM7A 4X0KB 3WUWA 4KK6D 4N1HB 1QHOA 1RHFA 2VLKD 1X4XA 4Y4FB 4XCCL 3MQIA 4PJ8C 1LP9E 1MCFA 3L5WB 1RZIA 5LBSH 3ESVF 1NEZG 4ODUB 3RVTD 1I7TB 3D39E 2FBOJ 3T4AA 3OXRA 3HZKB 2C3GA 2ATKB 2DQFB 4MQ7A 4O5LH 2ADJB 5BZWA 3VA2C 2DWEA 3HI6L 5SX5H 2IGFH 4I0KA 4RMVA 2J8UA 3ULSA 4UQ3B 5ISZE 1NANI 2VXSL 4RQQB 5DVOA 1BX2A 2E27H 4PJEB 2PKDA 2AJYL 3BKYH 4D9RE 2E9BA 1OAZH 1G7LB 2WK2A 3DI3B 3C8KA 3DX6B 3SJVD 3MCLH 5D72H 2J5LC 3OG4B 4RFOL 1GAFL 4TSBH 5DMGD 4LHUG 4WFFD 4Y8AA 5DD6B 2DICA 3GDBA 3B2VL 2HRPL 4Z7UE 4JO2L 3VW3L 4CL7A 1T2QH 4HUWA 2ZPKH 5F9AC 1U3HB 4GSDH 1EHLL 3LKOA 1CU4H 4PRPA 1WV7T 3HCVA 3HPLA 1HQ4B 4TNWK 5ANMB 5JLZA 4CNIB 5CHNB 5DUMH 1INEH 3TO4D 1GRWA 3RGVC 2BFVL 4GRWH 2LQRA 3O6MH 3CVHA 4WWKC 1QFWH 2XZAL 4NO0D 2IBZX 3K4ZA 4DZ8B 3GMNB 4JEGB 4ZQKB 1AIFB 5F88B 3VWJA 1D9KB 1J0KA 3QIWC 2BXYA 3S98A 5D1ZA 3UJJL 1J10A 1D5ZB 4QTHB 4ZOAA 3N85L 1F97A 5FHBH 5HGAA 1E4WL 3QDJA 1RZGA 2VE6B 2Z31A 4KY1H 5KSUB 2V2TA 3WIFA 2VXTL 2AJUH 3AS0A 2IAMB 2QADC 3BD4A 4X6CE 2BVOB 1FO0A 4YLQT 2VXQL 2XRAH 1A6ZB 3BZ4A 5EO0A 1Z3GH 4YXKH 5C0CB 2V9QA 1KN2H 2UWEF 5F1IA 3HI5H 3OKMA 2YBRA 3WLBB 3UJTL 3TBWB 4JJ5B 1F5WA 3V6OC 1JGEA 4K07A 4Y2DC 2NY6C 3U7WH 2CXGA 5I1GL 1FAKT 1S5IH 2JCCE 3PDOA 3S88L 3T0AA 4FG6C 1GH7A 1ROWA 5C0BD 2Q8AL 3LS5H 1BIIB 1XAUA 2EDKA 5IUSA 4RZCB 1JWSB 3T77B 2ZCKH 4L4TA 3WNOA 1A6TA 3C6LA 4YIQB 4MD0A 1ZHNB 4ZO9A 2H9GB 3VG0H 3PIQA 3BN9D 5AZEL 4F7PB 4L1HA 4N0YL 5DRWA 4Y8DC 1IMHC 2K9UA 4YHIB 2XTJE 4KK9C 2HT2C 4NM8L 3CDCA 2Z93B 4C57C 5C2UB 5CFHA 3JTTB 4OFPA 5FYKU 1B0GB 4LPXA 3KPOB 3LH2H 4XWOC 4WW2B 4LHUD 1JF1B 2FCBA 3D9AL 4GAGH 1KACB 5EOTA 2N56A 4JFZL 2QR0A 4XBEH 4P5KB 2VZVA 1E0OB 1UJ3B 3G6JA 3HZYB 4JFFB 4R4BB 1OB1A 3PWNB 2NY2D 4K7PX 3CU1A 2D03H 5DD5H 3GRWA 1A7OH 3Q3GA 5A3IC 2EEBA 2W0FA 1GZPA 1EHXA 3OZ9L 1OAKH 3RWFB 2V2XB 1RZKH 3QCUL 1P7KB 2JLLA 5DC4B 4XVJL 1KG0A 4HH9A 1KC5L 4GKNA 2OTPA 1OGAE 4NZRH 1VPOH 4KFZC 2V2WA 3DGCR 3CFEA 3MO1A 3FB8B 5T33H 3A67L 2GAZB 1T6WA 3MA7B 4Z7UF 2EZ0C 4PUBL 2WBJC 4JAMB 5D7JA 4KJYB 4PG2C 3FQNB 3HE6D 5DJCB 4ZS6C 3E6HB 1T0MA 4I18B 5JMOC 8FABB 2BY0A 3QQ4B 5HVGB 4KZDL 5JOPD 4AZ8A 2D0HA 1F3RB 1UXSB 1KN4H 5LGKA 1PKQA 4KMQA 3L3OB 4G80B 3NA9H 5ILTL 5CMAA 2A1WH 3OV6A 4LSTH 1QHPA 3U4BH 1N7ML 5DVLA 1VGKA 5EWIH 5B8CB 3KPRB 3QI9D 3O6FD 1CL7H 3B9KC 1BF8A 1ETZA 4X6DA 1EGJL 1U8PA 1ZGLA 3HFMH 1RVFL 5C0AA 2EO9A 3V5KA 4Y5VA 2OXHA 3M17A 1Z2KA 3HRZB 1YPZA 1LDPL 2E6PA 4ZSOE 2Z8RA 2YPVH 1AXIB 4J3XA 4X6CF 5JDJA 1JF6A 1D6EA 2GSGA 1AFVH 4PJFB 3ULVE 1KJ2H 4JFEA 4NQVB 4PTTB 3MXWH 3KS0J 2VLRA 2HVJB 3TGXA 3GMQA 1G0DA 3IB4A 5F6IB 1PVHA 4WI5A 1CGTA 5IB2A 3V6FA 4Q9QH 5T5FL 1GL4B 1YEJH 4IOFD 3W11C 3QCVH 3DLQR 3MZGB 4K55A 1IQDB 2ZUQB 5KANG 5T1LA 1HH6A 4DOHB 1OP3H 1S9KC 2JCCF 3DRTA 4OZFB 3SE8H 3GHBL 2J88L 1JPST 4J3VA 1YYML 4F37K 5SWZE 4JFOA 3U6RB 2YD8A 3QDMA 1KF9B 5EBLA 5E4EB 1AE6L 4BQBA 4PR5A 4JHAL 2PW2A 2H2PD 2AVGA 3KPNA 3Q1SL 4DKFH 2VISB 3M8OH 3HAEA 3RY4A 4APQB 1EEYB 4R4FL 2DQUH 4R96A 5C7XH 2AV7A 5DRNB 1G6RB 4O51A 4HGWA 3KPSD 3SKMA 3UMTA 1B4JH 1MHPL 3QWRD 4FQ2H 4DKEH 1NMBH 4DGYH 4JPIB 4JCLA 4L3ED 4RGNE 3FOMA 4ODWA 4WI6A 2P4AB 2CLZB 3MRGA 4HK3J 1I9JL 1J8KA 4HUXA 4P2OA 5JTWA 1AGDA 1S9VA 1INQB 3GIZL 4HFWA 4TQEH 3KNBA 2VLKE 2MKLC 1CICB 2P5EB 1MWAH 1BHGA 3GO1L 4ZFOB 4XP5L 3EOBB 2YD4A 4PGBB 5AYUL 3VI4E 2D3VA 4ZD3L 2NY4B 3SO3B 1TXKA 1QLFB 1VFBB 1D6VL 2CXKA 2DQHH 4NP4L 1Z0MA 4DN4L 3P4MB 4M8QA 4PJ8D 5GS1C 2AV1B 5GS3A 4OBSA 4NYLB 5BS0B 4QRPB 1XF2A 3KPPA 4F7TA 1ZLVK 4X4ZA 4KJQC 1EMTH 3MR9B 2BNUB 3QQ3A 1DJSA 5I18H 4OZHB 2W9DH 1J1XH 1NFIA 1CLCA 3ALWA 3MUGB 3EAKA 4KH2A 1YYLH 1HH9A 4P2RD 3SJVE 1HINL 3DXAB 2R1YA 5HDOA 4N0CC 1JFQH 2PXYC 4AQOA 5FK9A 4WFFE 3V5DB 5E5UB 4JREC 2LTQC 4YXHH 1G7PB 3G5XA 3WFCL 2BSTA 3BWAB 1PDKA 3TT3L 4R0LA 4JG0H 2HVKA 4G9FA 4GQ9H 1DBKL 4HF5H 3IJYA 5FM5O 4LAQH 2DN7A 5HYJE 1A22B 1L7TH 2MSPA 1CDYA 4OLYH 4J8RA 3TA3B 4BM7A 2CR3A 1GGUA 1C8PA 4B5EA 2Y06H 3DX7B 1I8LA 3NZHH 3K1DA 3KR3L 2CRZA 1ZANH 1T1YB 3L7FB 1VGEL 4ELKA 4U7SA 1P7QB 3HR6A 1YEEL 2NTSP 1RJLA 4KVCH 3L7EA 2GY5A 4KDTC 3RVVC 1DVFB 4WWKD 4H0IA 3VCLB 4OLUH 3RAJH 3UP1A 1F13A 3DROB 3RZCA 2EDFA 2NYYC 2V9RA 2GJJA 4HKZA 3VJ6A 1OSZA 5SX4H 2V7NB 4JR9H 4Y19D 1A7QH 4X5XA 5D2LB 3ZZ1A 2DRUA 2DKSA 2WANA 3U4EB 2CIIA 1Q9LA 3JWDH 4YDVA 1X6NA 4C58B 5IM7A 2ATPB 3KPQA 1OWWA 3QRFM 4R97C 2QADD 4FQXA 2XKNB 3W5NA 5F3HB 5J1SC 5I8EB 4TVSa 3SCMB 2UY6A 1IGCH 3KLAA 1C12A 4IRJB 1RQ5A 1U93A 3VD9A 5FDWA 2I07B 4LCWB 2A74A 5C0BE 4K3EH 3QXDA 2DLHA 4D0CB 3L5JA 2NY7L 3REVB 5I15H 1I8KB 4HX1B 2AXFB 4L5FH 3VFWB 4I2XE 3ZYOA 5HYIA 3VXRB 4XH2B 5D2NA 3ARBC 3FQWB 4I0PD 4FZ8L 2YKLL 4X7SL 2BSED 1XR9A 4XBPB 4G8GA 1UH4A 1V3JA 4PJCF 2KQMA 4U1SB 4QHMA 3ARXA 1IGYA 4V2BA 5C08E 1GC1H 3IFNH 3PGDB 4HWNA 2ITDB 5B21A 1NGPH 2HJKB 1J8HB 3STLA 3MGTB 2D7OA 3SE4A 1S5HA 3X3GL 4HHAA 4KK9D 4LPCA 1CFQB 2NQCA 4N68A 5DI8A 2EEAA 4C83B 1T21A 3DO7A 2XWBA 3LN5A 4CN4A 4XWOD 4TUOB 2AJSL 1UCTA 2J2ZA 3BKML 3D3VA 1JPFB 3G6DL 2AK4E 1N5YH 1YY9C 4WENB 5ID0A 3LB6C 3V4PL 2VDOL 5DEFA 3OXSB 4DCQB 1LNUA 1OAQH 4JHWH 4UILH 4E5XA 1HNFA 2J4WH 4PJHB 5J57B 5CJXC 4U4BA 1B6UA 5FO9B 3G5ZA 4G6FB 3WUZA 5EOQL 5JOFA 3V7AG 2A6IA 2A77H 1WIPA 3W0WB 1SJHA 5JOPE 4OCXH 1MAMH 3MV7B 3QXWA 5GSRB 4R2GC 5KSVA 4Y4KD 3ZT7A 1IM3B 1NSNL 4XPTL 5JW5A 3HI1A 1DLFL 5D1QA 1ONQB 2ED8A 2G5BB 1IGIL 1YQ2A 3MCKA 1TIUA 2MCG1 3LS4H 2DYPA 4JZJA 4S1QH 3O9WA 4MWFB 1BZQK 4UT6L 1ZT7A 5GRXG 1MFAL 4N9GA 1JPGA 4DVBB 4G8IB 4RNRA 4Y4HC 3DBXA 4EN3D 1DFBL 5JW3H 1G7JA 2EIZA 4PD4K 3UBXB 1S7UA 1QBML 2Z4QB 3F7YA 3P9MA 1LO3L 4QNPF 3B9KD 1BEYH 4EI6A 1A6AA 3PQYA 2V7HB 3FN3A 1DQDH 3RHWK 5H94A 3IETA 2BVEA 5JXEA 1JYWA 1XF1A 4GFTB 3O4LB 4D0BA 1ZWIA 4I48A 4HQQH 2Z9TA 4M1DH 5L6YL 4X5WA 2IBGA 4UQ2B 3SDAC 4XP9H 4KWUA 1SQ2N 5CJ8A 2XIDA 3MNZB 1D7FA 3FB5A 4M93B 2IGFL 3RPIA 3MLWH 5DSCB 4XNUH 5L2KA 1FLTX 4Q6IB 3AM8C 4KAQH 5GGSA 1JIBA 2BCKB 4PJDE 4PLKC 3BVNA 3LKPA 3MREB 2X4QA 2ENYA 3D5OF 4M5YH 3Q6GH 4U1HB 4PRDA 3LRHA 2E27L 3TO2A 5DQDH 5EN2B 1OAZL 3CSYB 3DX9B 1WTLA 3OSKA 2X6MA 3KPSE 3MCLL 5D72L 1YEKH 4CKVX 1I3UA 5DTFA 2GEEA 1EV2E 3L3IA 4TSBL 4P5TC 1SYSB 4HIJA 4L3EE 2R39A 4RAHA 2X05A 3QUXB 3E6FB 1LO4H 3V0VA 1LHZA 1Y6NR 3PUCA 3WE6B 5B39A 1VACB 1T2QL 1LDSA 1IVLA 2ZPKL 4HGMA 4LLMB 1GGBH 4LLYB 4GSDL 3A6CH 3BP4B 4Z6AT 4K3DH 1CU4L 4HUUB 4RIRA 3RWEB 5IOPA 3FOLB 4MA8H 4JGMA 4WHTB 4XB8A 5DUML 2Q20A 1INEL 3U30C 5E8NA 2WINA 1GZQA 3O6ML 5DHYB 4O00A 3KHOA 3LAFA 1FBIH 4FQLH 4Z7VA 1W0WB 4LMQE 5I16B 3JV4B 1LILA 4ORGB 3AMLA 2VWEC 5IB1B 2UYLB 2B1HH 3QNXB 5J0BA 1H0DB 1A6WH 3LQAH 4UI2A 4JM2C 5FHBL 1TNNA 3I2CH 4KKCC 1UZ6E 4Y4FA 1FG2B 4KKLC 2W1NA 5TDOB 4GG6B 4KY1L 4RGMB 4Z7WF 2PO6A 4QOKB 2AJUL 2EDWA 2Y6SC 1ZHKB 3TH2T 1YN7B 3WSQH 1JF5A 4ODUA 5FA3A 2GK0B 2JJTA 1XIWB 4P2RE 2XRAL 3WIHA 3LKQA 5MEND 1Z3GL 5TPWH 2ATKA 2DQFA 1Y0LB 1KN2L 4DW2H 3HI5L 4RMQA 2ADJA 5CGYC 5I1JH 3DVNA 5DJZA 3OB0K 2LU7A 5IBUG 5KVFH 3GHEH 1GVIA 3E0GA 3BD3A 2VDKH 5HDLA 3U7WL 3QH3B 1S5IL 3GBMH 5IBLD 2HTKD 3LN9A 4RQQA 1ZLWK 4PJEA 4CBPA 4N0CD 4W4OA 5GRWA 3G6AB 5SWQB 1MCPH 3DX6A 4KROB 4F8QA 2UUDK 4X99A 2ZCKL 1Q9OB 1RV6X 3NIDE 4MNQD 1T20A 3VG0L 5CEYA 4ONGH 4KJWC 3QT2A 4GBXB 4LF3A 4LQ1A 4OLZH 1OTUD 4FS0A 3MLTB 2AKRA 2FGWH 4MDJB 4XVSH 1NEUA 4D8PA 3LH2L 3R0NA 3CFDB 4OM0H 4GAGL 1FL3B 3CSBA 4G8EB 5DUPL 1RU9H 3UTQB 4YXLH 4D9LH 4Y1AB 3X11B 2HKFH 4XBEL 1CGVA 4GUPA 3EOAB 3EFFB 3CIQA 4LL9A 4Y19E 4OKVB 4PJBF 3F8UB 3MRFA 4XZUB 3IDIB 3GMNA 4AY0A 2WIMA 5F7HA 1D9KA 1H9VA 5DD5L 3FRPA 2VB5A 1A7OL 3ARFB 5A2KH 1TJHH 5L88L 1M71A 1X5GA 4QTHA 4JQVA 3D18B 4XNXH 1XZ0B 1RZKL 1R5VB 2CK2A 4NZRL 1VPOL 5KVMC 5KSUA 2HP4A 5C0IA 1N64H 4JANB 2HLAB 1R3HA 5J11B 5DURB 1A6ZA 3CX2A 4AMKH 5EPMB 4LSRH 4HZLB 1IM9B 3MOAH 5DA4A 3GKZA 3TBWA 3K0WA 3MRHB 5DJYA 5F44A 1KN4L 1WSST 3SE9H 3VDCA 1NAML 3NA9L 3VMNA 3BP5A 3EUUA 2A1WL 4LSTL 3U4BL 2ERJC 5IB4B 3PGCA 4OI8A 5EWIL 1TZHB 4OIBA 3DGGB 1EPFA 4G42B 1EDQA 2NW2A 4RZCA 1JWSA 2L4OA 1CL7L 1R5WB 2Z35A 1NL0H 1NCTA 3T3PE 2FLBT 4YIQA 2ICWJ 1N5AA 3HFML 1FVCB 4Z7NF 3QSKB 1A02N 2VIRB 4S1DC 4F7PA 1DANU 1UZ6F 3BP7A 3VRLE 5DJ8A 1NCNA 2F8OA 4NN7B 5E6YA 2YPVL 4LLQB 4X98A 2VYRE 3HA0A 5DJDA 1U9KA 1AFVL 4IS6A 3WJLA 4L4VD 1KJ2L 5FV1L 1B0GA 4CN6A 5BMFH 5FEBA 4YHZH 3W5MA 5F21B 3KPOA 3MFGB 5L8KB 3LEXB 4WW2A 4O02H 5IHZB 3MX0A 1YEJL 5IV2A 3QCVL 4XNYH 3OKKB 5TF1H 5FUCC 3AB0B 2FO1A 1YY9D 4R4BA 1OAXH 1CL7I 3IDGB 1F3DJ 4QO1A 1JZ6A 3L3JB 3IJHB 3RWIB 5D9SA 1UQSB 4XMKH 1U8IB 2E6QA 3B3IB 3C60A 1RPQA 4HJ0C 4ODBD 4JGJA 4QHUB 5T1KA 4DKFL 4CDGC 3M8OL 5JUEL 1BVKA 1JZ3A 2X89D 2GAZA 1F42A 1XGRB 2DQUL 3MA7A 1OF2B 5C7XL 1JGLH 4OD1H 3SKUD 4BQ6A 1HK6A 4KJYA 4HPOL 1OTSC 1B4JL 3FQNA 5DJCA 1QTYT 1YZZA 4FQ2L 4R2GD 1KTRL 3E6HA 1NMBL 5D7LD 4DKEL 4DGYL 5F96H 1GC1C 3EHBC 2RCSH 4O2FA 5D7KD 5DF0A 1AR1C 3WD5H 3L3OA 4ERSH 15C8H 2X4TB 2D0GA 2HT3C 1F3JB 3PWLB 4CMMB 3VI3F 3CFCH 5D1XC 3VA6A 2Y5EA 3GBLA 4TQEL 5EIQA 1LWRA 2I26N 3HMXH 3VFTB 2AABH 3BPNC 1MWAL 5B8CA 2OTWB 4XNQB 1O7VA 5IG7B 3NVQA 3IDJB 1HQRB 4LCCC 3FO9A 3HR5B 2RR3A 4NOFA 1A2YB 2RHEA 4LBEB 1R24B 3CSGA 4XPBH 2DQHL 4WV1B 5L0QC 1GHFH 3S6CA 2BVUA 1CDUA 4PJAF 4EI5B 5J06A 4WW1B 3QAZC 4NQVA 5C71A 2VR4A 4CU8A 3D69B 5IIEB 2HVJA 4WDIA 2VJXA 3TJEH 3PWPB 3LVEA 3C09B 1EMTL 4ZMAT 1MRFH 4ZFFB 3BGMA 4JFPB 4DQOH 2C4XA 2C7UA 4Y88A 1YYLL 2OTUA 2YK1H 2IFFH 3NOIA 4OGZA 1CS6A 3QIBD 5J7CC 3FO2B 2NY0D 4P59L 1K8IA 2VITB 3D0VB 3SGEI 4YXHL 3RWCB 3WN5B 3U36A 1ZE3C 1H3PH 3S36H 4XNMB 2D2OA 5CCKH 2OCFD 4JY6A 1FNEB 1S7WB 4WO4B 5D6DA 5IMOB 1RUMH 5B4MC 1QZ1A 4WVRA 1A21A 1NDGB 2GJ6A 2VISA 3KJ4C 5E2JA 3D39B 4GQ9L 4APQA 4LAQL 5DRNA 5F7KC 3V7AE 5CJ5A 4Z0XB 3WNPA 4ZAKB 2A83B 1L7TL 3D2UB 4XAWH 3H9SD 3I75B 1A3QA 1IGJB 1MOEA 4L8CB 5IVZB 3LKNB 5F9JA 5ISZB 3QR2A 3V0AC 2Y06L 1LMKA 3HZVB 4Z7QE 3NZHL 1S7SB 1Z9MA 2J3SA 1JRHH 5GIRB 2CLZA 3FN0H 4YNYB 4CU7A 3PHOA 2XG4A 5EBWB 1IC1A 3QUMB 3HC4H 4KVCL 2ZG1A 5BRZD 2QKIB 4LSUH 4QRRA 1INQA 5HHQB 1WTGT 3MRPB 4XP6L 1CICA 3O11B 1EAPA 4MS8D 4OLUL 3RAJL 3W39B 3GBNH 3ZSSA 3EOBA 4Y16C 4BFIB 4DGIH 4OFYD 2YD7A 4PGBA 2EYTB 5E9DA 3O4OC 3RNKB 3WJJC 4Z7UB 3AS3A 4JR9L 3KPTA 5C0FA 5MENE 3UEZA 1A7QL 2HLFC 1VFBA 4H88H 3TVMD 4JM2D 1JNHB 4I8DA 4WUKL 4Q6YA 1NCWH 2KL6A 3JWDL 1I9IH 2PW1B 5E03A 1MFDH 3VDAA 5C0EA 1X4YA 2Y6SD 3MRNB 1NBYA 3DVGA 4HIHB 2AAVA 1ACYL 4FXKB 5MP6H 2NW3A 5BS0A 3B4NA 5I66B 2FJFA 4OBRA 5BZDA 4FHBD 1JN6B 3AAZB 4NM4H 1I1AB 5CGYD 2QSCH 3DXAA 3P0VH 4AIXA 1CD0A 4NKIH 1A5FH 4L5FL 4MNQE 1ZA3A 5SX4I 1WAAA 4H8WC 3IFLH 3MLSL 1G7PA 1UZ8B 2OZ4A 3EYVB 4XNZB 4HV8A 4I77H 1QA9B 3TCXA 1VCAA 3SDCA 4MAYB 2X1WL 2WQRA 3KGRA 4X6CB 2MHAB 4MJ6B 5C0JB 1F4YH 1JGUH 1GC1L 3AU1B 3IFNL 5D70H 3G5YB 1EA9C 5DHVA 2K1MA 1NGPL 4AL8H 4KC3B 2R2BA 3DIFB 3H7LA 2ICWI 1EH9A 5JXAL 2X70B 2DAVA 4P4KC 4U2YA 3DJ9A 5IFJB 1WBZB 4Z77A 3QISA 4KI5E 5EUOE 3RUGA 3DX7A 4I0CC 5J12B 4F7CB 3T0EA 1RJYB 2EECA 2JCCB 5TE6H 2HN7B 5F7EH 3P77B 4XHJC 1P7QA 4KK8D 5FECB 1YEFL 3O3DA 3QEGH 2JJVA 1N5YL 3D85B 3OQ3B 1MCJA 3VXMD 3K81A 3OWEA 4E41D 1OAQL 2VABB 4UILL 4P23B 5KJRH 2J4WL 3WO4B 3EOTL 1IGFH 3GRWH 2XTJB 4F15C 2V7NA 2VZTA 3ZKMC 2GYSA 2EKSB 3IKCA 4OUUA 4QHLB 5D2LA 1W0VA 3U4EA 3BAEH 1BFVH 3PWJA 1K9TA 3RKDD 4PJXE 3OKOB 2ATPA 1HYRC 5L2JA 2OL3H 5T3XH 1WFTA 2YD6A 3MNWB 4OCXL 1MAML 4HLJA 5EU6B 5F3HA 3DYMA 1V3MA 5I8EA 3SCMA 3FT2A 1JWUB 3QPXH 4WWID 4UV7L 4M61A 3NPSB 1L9NA 4NT6A 2M2DA 3U7YH 2ORBH 1L0QA 1V7ML 3MRJA 1PD6A 4S1QL 3ARGB 1TJIH 1AHWC 2VLJA 3SGKC 4Q0XH 1OSPH 5I8OH 1QFUH 3P9WB 1KPVB 2JKXA 4HIXH 1I8KA 3VFWA 4UIKH 3P30H 4GRWE 4CAGA 1T80A 4QXUH 5JW3L 2DM3A 2ESVD 3SKOB 3VWKC 3OR6B 3ARPA 4XBPA 1OGAB 1T7YA 3GNMH 3WEXB 2ZOKA 5JNYA 5HYFA 4L4VE 1BEYL 1T1XB 1CE6B 5ESQB 5TDNB 3RTQD 3PGDA 1JZ2A 1MVUA 3E3QC 4JRYD 4BZYA 3UTTD 1J8HA 4JO1H 3S9DB 1DQDL 4X6BB 4GO6B 3VXNA 4WJ5B 4IRSB 3O6LH 2R29H 5K59F 3IF1A 3AS1A 2BHZA 4U1NB 1AGCB 3KAAA 4JHZA 4KHTH 4XP9L 4N8CH 2V9TA 1JPFA 5GRVK 4PB9H 5HVHC 3MLWL 4XNUL 4KAQL 3O45B 3MYJB 4RCAA 3RL2B 2X1PA 4YHNA 4NKDB 3TN0A 2F19H 4M5YL 4AEEA 3Q6GL 4H0HB 1FVEB 5DQDL 2H41A 1R3LA 2EIEA 1I1CA 3KXFA 3BP6A 1NC4B 3QUYC 1HSAB 1DQJA 4ZSOB 5FO9A 2ZJSH 4WI3A 3VH8B 5D7LE 3VFNB 5K33A 5E56A 5IW6B 4NCC2 3R06B 3W0WA 4FXLA 3KLHC 3MV7A 5D7KE 1LO4L 5GSRA 4AIOA 5LXGL 1IM3A 5E5MA 4DN3H 1GGBL 4KI5F 3C2AL 3A6CL 1OTSD 4K3DL 5D93C 3OKNA 1JI2A 3ARDC 3TBVA 1S78C 1OP9A 5SWZB 3QO0B 3BEVB 4YFEA 4KTYA 4DVBA 1AR1D 1WZ1L 2ZKHH 4G8IA 4NRZA 3QXVA 1U41A 5CZXD 4WI7A 1FBIL 2HT3D 1NGYA 4FQLL 1YQVH 1WIUA 1DUYA 5SWSA 4LU5H 3UBXA 2F53D 1PBYA 3OGOE 4ETQA 4XRCA 3GI9H 1F6FB 2B1HL 4MSWB 5EUKB 2JK5B 1A6WL 3LQAL 4IIQB 4BUGA 2FATH 4GW5B 3H0TB 5HI4C 3I2CL 4N5UA 4JKMA 1HXMA 4QHKI 3T08A 1QEWB 4IOIB 5B38B 1WUNT 2GSIA 1FZJA 4RGNB 4YHYB 4MLIA 3RDTD 5FFLA 1Y18B 3WSQL 5JZ7D 4ESKA 1QACA 1FSKC 1HXYB 4EEEA 3ARYA 3U0WH 4OZIF 3BQUB 1MF2H 4UQ2A 1V5JA 2AI0H 3BYYA 4EZMA 1JYVA 3ME0A 3HN3A 4FQHB 2YA0A 2Q3AA 1TVHB 5I1JL 3W2DH 1XGTA 5KVFL 2VLKB 5DSCA 3GMMB 4Q6IA 2A0LD 3GHEL 1BWMA 4LLWA 4M3KB 2BCKA 2DLEA 3GBML 4OFIA 4PJCB 3MREA 1CDGA 3ZKXB 1EJOH 4GRWF 4IDLA 4JFDD 1HOCB 5FM5M 3TT1H 1FPTH 3CSYA 4EUPH 3DX9A 3X13A 1UFUA 1CGXA 1MCPL 5F89B 4TNVF 3H9SE 3RFZC 4LDLB 3ZHKA 2QL1A 2I60H 3S37X 4ONGL 1EO8L 4TOYL 1QFWM 1QD0A 3QUXA 1KPRB 3E6FA 4LLDA 3WE6A 4OLZL 1OGTB 4ODSL 1Z5LB 3UZVB 2OR9L 4LLYA 3MFFB 3BP4A 2DLFH 1MQKH 2FGWL 4P9MH 3SJVB 4XVSL 1WC7B 1A9BB 4PB0H 4OSUH 4EXKA 3FOLA 1QR1B 4HGKC 1HE7A 4MB4A 4JLRA 3DV4A 4OM0L 1R5IA 4D9LL 2BSSB 4YXLL 1ORSB 3NFNB 2HKFL 4FFYH 4RWYH 1UXWB 5E8PB 5DHYA 2F5BH 3RNQA 3BZDA 3QEQA 2H1PH 5HPMB 4WGVB 3VXTB 1W0WA 1YN6A 1YMMB 3JV4A 4R26H 1ES0B 1FVDA 4KTEL 5KZCD 2CRIA 2IPUK 3CPLB 3D0LA 1OVZA 4ORGA 3RGVA 5HYJB 5D6CB 5IB1A 3P73B 2FIRT 2UYLA 1ZHBB 4XNXL 3TO4B 3S4SB 5F7DA 2CGRH 4GG6A 2HLFD 2X4NA 4QOKA 3CFJA 1N59B 3TBYB 5GGTA 1OT1A 1N64L 3QIWA 1YN7A 3PABB 4X9BA 2BP3A 2GK0A 4XB7A 1SBSH 5C0RH 5JO5B 1MJ7H 3SY0B 4LSRL 1EFXA 4KJPC 1Y0LA 1IAIH 5T5NF 3MOAL 5DJ2B 2P5WA 3DHJA 5H35A 1P1ZB 3BPLC 3L1OH 5ESVB 3EJJX 3SE9L 3UXFA 1I1YB 4YHKH 4F58H 5KVEH 2R9HD 1GGIH 2CD0A 3BI9X 1A6VH 3VD7A 3G6AA 5SWQA 4DKDC 3V6OA 1BBJA 5D7IE 3STBA 1TENA 4ZPTB 1Q9OA 3UC0H 3AS2A 2X4PB 5ACZA 1K8DB 1NEZB 5JQ6L 1IAKA 4GBXA 2ZUYA 3WLWC 2G75A 5I1KH 2QTEA 4PRAB 4JKPH 1YECH 5KSAD 3IT8D 3UO1L 3MLTA 3MRRB 5DFVC 5C0BB 3VWJC 2BY1A 2W07A 1KUMA 5BMFL 4YHZL 1CXFA 4P4KD 1CT8B 2VAAB 1CLOH 1P7HL 1CD8A 3VXME 4TULH 1ZVSB 3CFDA 4O02L 4I2XB 3NCBB 3X11A 4E41E 3GK8H 3F12A 3QDGD 4XNYL 5TF1L 2Z31C 1I85C 4IEFB 4OKVA 1XF4A 5C92A 5GSVB 2NX5A 5C08B 4U1GB 1WEJH 3TJHC 2R8SL 3ARFA 3L3GB 4XMKL 3H3PH 4LHUB 5F8QC 3OKDA 3VFMA 1AKJB 4KGJA 1XZ0A 3L5HA 3OF6D 1JJUA 5ICXA 2BZDA 4ZUVB 4HBQA 1JGLL 2HLAA 3ULUH 4OD1L 5HPOA 2NY2B 4MQXD 3F7QA 5E99L 4YDLC 2P44B 2A9MH 1WFOA 4L4JA 5EPMA 2AK4B 1IM9A 1C5CH 2V5RA 3DMMD 5F96L 4HMDA 3SE3C 4N9OB 1CXKA 5GGRB 2D0FA 2E5EA 2ESVE 3MRHA 2RCSL 1MIMH 2LVCA 3N1GC 3OJVC 3MRBB 1LE5A 2WBJA 1RZ7H 3FRUA 3WD5L 4ERSL 15C8L 3W82A 3TV3H 1QSEA 5IB4A 4L3CA 3HMXL 3HE6B 4BYHA 5E1HB 2AABL 1J1OH 1PZ5B 1HHJB 3S7GA 1EAJA 2GITB 3DGGA 4JRYE 5ESAB 4G42A 3UTTE 4XI5D 3BW9B 5HHXH 1SEQH 1T5WB 1BOGB 2D7TH 4F57H 4OF0A 4Z7WB 4GQPH 2E7LC 1FVCA 3U79A 5TF0A 3SPVB 4RAVB 2V5SA 4NQED 5HYSA 3QWOB 4K71C 2JE8A 4XPBL 1Q94B 4L29B 4LLQA 1GHFL 1P4IH 4FQQB 3ZDYF 2PUQT 4NBXB 2OJEB 4P2YA 1T03L 3QI9B 3DHMA 2XPGA 5CINH 3F65A 3LKRB 3TJEL 4FFVC 5IHZA 1UA6H 1MRFL 3MUHL 1L6ZA 4DQOL 5E8EA 3OKKA 4GRLB 5BVJA 1YA5A 4PG9A 2YK1L 3U82B 4JY5H 1HHKB 2XN9D 4ODHL 1J05A 5F9WC 2B0SH 3UDWC 5D7JC 4WIQA 3T65B 4MCYB 5JORA 1RURH 1G6VK 3RWIA 1YJDH 1UQSA 3B3IA 5CWSA 2FR4A 5D7IF 1H3PL 1XH3A 3S36L 4PJ5D 5CCKL 3V4UH 3HC3H 1RUML 4QHUA 1AGEB 3WBDA 4FFWC 4KK5D 5E6ZA 3WUWG 3RI5F 3GUTB 1OF2A 5BV7C 4IDJH 3WS3A 1QFPA 1WCBA 3BGFC 4LSPH 4XAWL 6FABH 1J0IA 3T8XB 2VAJA 3KLHD 5HHVH 5E6ID 2ITCB 3ZHLA 3E2HC 5M94B 1CVSC 1R6VA 2QQNH 4PJDB 1A4KA 3WKMH 4CVWA 3L3DB 4KRMB 3MOBH 2F53E 1JNNH 3FN0L 5F93C 1S78D 1V3KA 1F3JA 4CMMA 1KIQA 1JK8B 4AJ0A 3TNNB 4LSUL 3CVHL 4NPYB 4RA0C 3OAUL 2OTWA 3IDYC 2HMID 5IG7A 1CFBA 3GBNL 4TVPL 2YPLD 3T1FB 4DGIL 2VQ1B 4MVBC 5ADOH 1MAJA 1YEGH 3L3HB 3N9GH 2NCMA 4U6VH 3HS0B 1RMFH 3HR5A 3K80A 1B2WH 1A2YA 4LBEA 3VFGL 4H88L 5HYEA 3MSPA 4WV1A 1IFHH 1NCWL 4OD2A 1I9IL 2UWEA 4MHHI 4ELMF 1MFDL 4EI5A 3QUKA 4PGJA 5IB3A 4KUCD 5MERB 2R2EA 3D69A 5MP6L 3NCEB 1FO0L 2RAMA 3WIHH 4JFDE 4F80A 2ED9A 2HWZH 3OBAA 1DTUA 4DVRH 4JFPA 4PY7B 4Y0GA 3IAGC 1BVZA 3P40A 2AJVH 4NM4L 5GS1A 3QJHA 2QSCL 3R8BB 3P0VL 4NKIL 4YDJB 3QXTA 1A5FL 2VO5A 4WU5A 3FO2A 5ACLA 2DQEH 4G9DB 4U6YB 2VITA 1UH2A 3IFLL 3RWCA 2EE9A 3QNYA 1ZA6B 4NN6C 4HK0B 4I77L 3MV9D 4MJID 1FNEA 4WO4A 4P46C 1NDGA 3CDGB 4Z95L 1Q9WB 4F2MA 4P2RB 1F4YL 1JGUL 2PXYA 1VKXA 3CFKB 3GSOA 3O3EB 4ZAKA 2A83A 1A1OA 3I75A 4AL8L 3NCYS 1IEHA 1IGJA 4L8CA 4N8VA 2I5YH 5ISZA 3F6LA 1IBGH 4EBQH 3UPAA 3ZDZE 4OLVH 1VEPA 5TE6L 5F7EL 3L3KA 5DD0H 3FONB 3U9UB 2DQDL 1KIUA 3QUMA 2Q7YB 5DC9B 3FZUC 3QEGL 2P7TA 1JZ7A 2XICA 1KT2B 5HGGS 2QKIA 5C9KA 3INUH 3MRPA 5KAQG 3LQZA 5F3BB 1HIMH 4PJ7E 4QRQA 4BFIA 2EYTA 2HFFA 4ZOCA 1BECA 1IGFL 3EYFA 4UAOB 3GRWL 1X4ZA 4KDTA 3SDDB 1JYXA 1E4KA 4I4WA 2DI9A 1HEZB 3ZTJH 1JNHA 3BFOA 3BAEL 1BFVL 4NC1C 3DX8A 2BHUA 2PW1A 1M7XA 3I6KB 1CI5A 4CN1A 2OL3L 3MRNA 2XWJB 1CF8H 5ELIA 2VZOA 5I66A 5K9KB 4CMHC 3QPXL 3MGAA 3O8XC 1J9CT 1B0WA 2W59A 4GXUM 5A2LH 3CC5B 3U7YL 1DCLA 2ORBL 4KJPD 4L8SB 4Y19B 3AXLB 5CKGA 3AAZA 3UTSE 1TJIL 3GSRB 4Q0XL 5DJXB 1OSPL 1QFUL 2D7MA 2J8HA 4HWZA 3SQBA 3IDMA 5IMMA 2FD6H 4UIKL 3P30L 4MNGE 3S96B 5BO1H 5D5MA 2VOTA 4N0FA 4QXUL 2ZOLA 3STZB 3MODH 1DBJH 2OK0H 1UACH 1WZMA 1U8HB 3EYVA 1I8LC 4ORZC 3GNML 3KYOA 4MAYA 4YH6A 5C0JA 4M1CC 2MHAA 4X6CA 4PJAB 3ARBA 1OQOA 1I7ZB 1OP5K 2N1KA 4LIQH 4PTUB 5DQ9B 1SM3H 4TTDD 4JO1L 2H32A 4I0PB 1XGUB 3WLWD 3UTPD 1GGCH 4TVPD 3O6LL 1WBZA 1MUJB 1K3ZA 1YDPA 2R29L 3VWJD 3H9HA 1X9QA 3B9EA 1REIA 1KOAA 5D1ZD 1FP5A 4N8CL 4QEGA 3P77A 3CMOH 5DLML 3U0TA 5TJWK 5BQ7A 1EXUA 4PB9L 5KW9H 3D85A 4AK1A 5MEQA 3VXPA 4X83A 4JZOA 5CEXA 2F19L 1UEYA 4YFLI 2QQKH 2VDQH 2NY3C 2W0PA 4OZ4B 1U0QA 2D9CA 2WBKA 3WNNA 1DQLH 3FCTB 4PJGE 2CIKB 3SGJC 1F4XH 2ZJSL 3DRQB 1NH6A 4BQ9A 2H3NA 1ZT4A 5T3ZH 3ILQC 3DUSB 3OKOA 5DMKB 3H8NA 4Q7DA 4XTRC 5EU6A 5CJXA 1LEIA 1JWUA 4GG8A 4P49A 4XCEB 2VH5H 5J6GA 3MJ9A 1MRDH 2NR6D 1CD1A 2CDGA 2BVPB 1MI5B 4L4TD 3C6LD 5EBGA 2A6DA 5FYLL 2EXYC 1ZLVH 1CLZH 5DVMA 5E8OB 3QJFB 5FUOL 1D5IL 2ZKHL 1SJXA 2E7MA 1OD9A 4V2CB 3SE4C 1X5XA 3K3QA 1GSMA 3C5ZC 1MH5B 4Y4KB 4NQEE 4XHQA 1UKTA 2IBBA 3OR6A 2CDFA 3GMLA 4PJ7F 4LU5L 4XP4L 3VXUA 2AEWA 25C8H 3GI9L 3O41B 4J2XA 4LQFH 5HDBE 3LCYA 4U7MA 1F8TH 4M1GH 1X3DA 1CE6A 1MLBB 5ESQA 2BDNH 4G43A 4XCNA 4Z5RB 5IQ9B 1H15B 4EN3B 1TVBB 2YEZB 3X3FH 4Z7OF 3BT2H 3HAEG 5LCVH 3TP4A 4IM8A 1HWGB 1TCRB 5T1MA 4OV6F 2GTWA 4U1NA 1NBQA 3MUJA 1MF2L 2XN9E 4K8RC 2AI0L 3B5GA 4HK3N 4CW1A 3QHFH 1TVDA 4RMUA 3W2DL 4JDVA 5DR5H 2X9XA 4RFNC 5J3HC 3EO0B 1RZFH 3MYJA 4PJ5E 2A6JA 4ODVH 4NKDA 1EJOL 3SDAA 3OAYK 1FVEA 5D7JD 3TT1L 1FPTL 1G9NH 5D1QC 5A40E 2BNQA 4PIRF 1NC4A 4UZGA 3AM8A 1VFAA 2BOCA 3DURB 5CGTA 1TTFA 4O2CB 3O9WC 3VH8A 4W70A 2I60L 4M6NL 3SEPA 4FXGB 5IESH 4FFWD 5GZOD 1CFNA 5EOCL 4UUJB 2XKUA 5FYJH 1C16A 1MCSA 2DLFL 1EUUA 1MQKL 2MCPH 4P9ML 5IMKB 4P5TA 4PB0L 4G6JL 4TTGA 4OSUL 1U36A 1YY8B 1A1NB 2RGSA 4W6WB 5C0AD 2R0WL 2YPLE 3BEVA 5EO9A 4FFYL 5F71A 1ZGLP 3ES6B 2H1PL 1S7XB 2BNRE 4N0RA 4ZXBB 3H42H 1H3WM 2OBGA 2ED7A 3C2SA 4R26L 5GGUB 4JFED 4YBHA 2P49B 5ITBH 2VLRD 1NCUA 3RWGA 3MLYH 2PTTB 4MVBD 2WUCH 5EUKA 4MSWA 2JK5A 3KYKH 4IIQA 5F7LB 1WZKA 4NO3B 4HC1A 5T1LD 2CGRL 4RRPA 5TE4H 4IOIA 3GSNH 4KKAD 3PXHA 1NMAH 1Y18A 3KYNA 2VLMD 1SY6A 5BXFA 5C3LD 1HXYA 1SBSL 3T0VA 3CUPB 5C0RL 1MJ7L 4QY8A 2DI8A 3QDMD 5HGHB 5HVWA 1IAIL 1ZVYA 4Z0BH 1TVHA 3EO1B 3L5IA 3S35H 3MGOB 3PJSA 1J0YA 1R3KA 4V1DD 3MV9E 4MJIE 4CRPA 1V05A 4PJ9C 4G6KH 4YHKL 4PJCA 3RKPA 1T4KA 1WWCA 5KVEL 5HY9A 1TQCB 3HZMB 1GGIL 1C08A 5MEPB 1A6VL 2XWTB 4KDVA 5F6HJ 5F89A 5I9QC 2OZ4H 2X7LB 5HDBF 3UC0L 1U8QB 3CK0H 1I9EA 5FYLD 1A8JH 4Z78B 4GW4A 3WFHA 1W2KT 1DZBA 2W0KA 32C2A 4P2OD 4AIZA 3NAAH 5I1KL 1IAII 1T66C 5DHVH 4JKPL 1YECL 1W8NA 2NLJA 4YHOH 3JBG7 2MQCA 3MFFA 3VGGA 2P43B 2X44D 1RUPL 4JPWH 1WC7A 2WWKT 1CLOL 4J1UA 1QR1A 4TULL 4MNQB 2GTZB 4N8PA 4Y4FC 3NFNA 5I76A 5M7QA 2BVQB 3CH1B 1NANH 3OL2A 2VDLH 4YBQC 3LKSB 4MA1B 1XCQA 1YMMA 3VXSA 3QXUA 3IGAA 3SDYH 3ZKSD 2R2HB 4OCRH 3CPLA 1WEJL 3L9RB 5HYJA 4MNHA 5D6CA 1AO7A 5F1NB 1ZHBA 3RWDA 4YEFA 1UWXK 4MJ5B 3S4SA 2CRYA 3RWJB 1WT5C 1ZXQA 1FJ1B 1IGTA 5EUOB 1X44A 4MXVE 1K4DA 3DV6B 4HS6A 4DFIA 4K7FB 3TEUA 4PJFF 1JGDA 4W4OC 2MNUA 3SY0A 1J5OH 2A9ML 5C0DB 2ADIB 4RMSA 1C5CL 1R3JB 4XPGL 1G7HB 2ZUWA 4MXQC 5ETUA 1MIML 1P1ZA 1NGWB 1RK1B 2AJYH 4G9FD 1TJGH 1QP1A 1I1YA 4NCDA 4PP1C 1RZ7L 3BEWB 2WIIA 3B8YA 2ZCHH 4PS4H 3ALXA 3TV3L 5TGBA 1VFOA 1OM3H 1U3HC 1H5BB 1GAFH 1S7QB 2D9QB 1MY7A 2C5DC 4X7EC 5HHXL 1SEQL 3UTPE 2R1XA 2D7TL 4KUCF 4F57L 3BO8B 4OCYH 3WS6A 4PV8A 3I6GA 3VW3H 4H1LA 2X4PA 4JQXC 2YSSB 1K8DA 2XY2A 4POYA 2MWCA 3TIEB 1EEZB 4G6AC 1EHLH 1BGXH 1KPUB 4NSKA 2WW8A 1L9MA 4PRAA 1P4IL 2VLLA 1ZS8B 5D7SH 4Y5XB 1D9KC 2NXYB 3RZCD 4OI7A 5IBUB 3GB7B 2BFVH 5CINL 2GW5A 5TE7H 2Y07H 4I2XA 4MYWB 3M1BB 4GRWB 1DR9A 2EIDA 4AEHH 1U8MB 3UTOA 2MPAH 2EXWC 2IAMC 4HULB 1EO7A 4JY5L 5CP7A 1Q72L 3UJJH 4BUHA 3D25B 5GJTH 2XV6B 4UBDC 5A43C 2B0SL 1JWMB 4LVOB 4ISVB 3N85H 4L4VB 5GSVA 2Y1VA 4FQXD 5C08A 1RURL 2IH3B 2R23B 4H5SB 4K9EH 1YJDL 3L3GA 3DARA 4KXZI 3MJ8B 2VKXA 3N1FC 5HI5C 1AKJA 4WFGD 3V4UL 1I1FB 3HC3L 4E0RB 4HUNB 4LVHB 4NRYB 1F00I 1EEUA 1J87A 2AP2A 5JW4M 2JTDA 4ZUVA 3T0DA 4L4TE 4IDJL 3NACH 4NHCH 5C09A 6FABL 1FL5A 1HILA 5HHVL 4QCIB 4I3RL 2AK4A 3VGAB 1PAMA 4HCRA 3TFKC 4G8GD 3OKEB 5GGRA 3WKML 4NNPH 4LP5A 1I8MA 4OZHF 2DDQH 2P48B 3MOBL 1QVOB 1OWRM 1JNNL 2APFA 2FECL 2CKBH 3UJIL 5DK0A 3SGDI 5ICZB 3OB0H 2VUOA 3WJLC 4JFQA 1KTDB 1PZ5A 5D7LB 3G6JE 3QUZB 4AENA 3BPOB 2ADGB 4WW2C 5FCUH 1T5WA 2EC9T 5BJTA 2CDEA 5A2IH 4WTXA 5I2IB 4YUEH 5DJ6B 5ADOL 3QDAA 4Z7WA 1BFOB 4LNRA 1ZLWH 3GM0A 3N9GL 4NBZB 4WI2A 4U6VL 1UJ3C 5D1XA 2EDBA 3FQRA 1HI6B 4FP8H 3D3VD 1HDMB 4FQ1H 1M7DB 3CSPA 3QWOA 2EH7H 1IFHL 2UUDH 4L29A 4PGEB 4MXVF 4FQQA 2HT4D 4LPYA 5CILH 4LCCA 2SEBB 1FCGA 1EERB 1NGZB 3FB7A 3LKRA 3NCYP 2IQAB 2VL4A 3UAJD 5B39G 5DK3A 3WIHL 2HWZL 3QFDB 4DVRL 4NDMA 2Q6WB 1EFQA 1DQMH 3GSWB 1TTUA 1S9YB 3IU3B 2AJVL 4GRLA 4O4YH 5HHOE 1HHKA 5J3HD 3U1SL 1P4LA 3MMEA 3C9NA 3TNMB 5IKCB 4P5MA 2BOBA 3LV3B 3WDHA 2DQEL 1JHKH 1PKQE 4I18C 1CGSH 3JV0A 4DAGH 4AH2B 4PUBH 2DYPD 1AGEA 4NC2B 3O9WD 1BREA 2DQTH 1V8HA 2A73B 5F6HI 2IC2A 4XGZB 4X6DE 3CGTA 1PYWB 3QIBB 4O9HH 5C0AE 4NBYB 5DQJA 2NY0B 3VFOA 5B8CC 3DUUB 1HHHA 3BDXA 1Z0NA 4ZODA 1IBGL 3GGWB 4EBQL 3MBED 3MUY1 1FL6B 5FUZH 3L3DA 4PJBA 5EU5A 4JFEE 5DD0L 3ILPA 4TNVK 3NCCB 3OR7B 2X4OB 4JFYA 3PQYD 3GMPA 1JK8A 2Z91B 3CJJA 5JXED 3H9SB 4ODTH 3INUL 1EGJH 3QWRA 4BKLA 3VXQB 1TQBB 2ENSA 3JUYA 1HIML 4MXWH 3WHXB 1A4JA 4YZFF 1XFPA 1MY5A 5F6IC 3K8MA 1LDPH 1NKOA 2VLME 1B88A 1XF3B 5C8JA 3HS0A 4GAJH 2ZUQC 3IAPA 3NZ8A 4PRHA 4U49A 4JN2B 5L2KD 4Y89A 1H3UA 1MHCB 3L5XH 4Y16A 4IHOA 1KJ2B 3SOBH 4V1DE 2FIKB 5MERA 5T5FH 4I5BA 4ZO8A 1CF8L 5E4EC 2BHYA 2NY5C 4JHBA 4KV5E 5I30H 5D6DC 1NBZB 4NHUA 1Z6JT 4APQC 3TVMB 3WCYA 1FNHA 4NQXA 3S3SA 1QBBA 5GS2H 4YDJA