2J2ZB

X-ray structure of the chaperone papd in complex with the pilus terminator subunit paph at 2.3 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
150
structure length
150
Chain Sequence
RAAFHGEVVRPACTLAMEDAWQIIDMGETPVRDLQNGFSGPERKFSLRLRNCEFNSQGGNLFSDSRIRVTFDGVRGETPDKFNLSGQAKGINLQIADVRGNIARAGKVMPAIPLTGNEEALDYTLRIVRNGKKLEAGNYFAVLGFRVDYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/surface active protein
molecule keywords CHAPERONE PROTEIN PAPD
publication title Molecular Mechanism of P Pilus Termination in Uropathogenic Escherichia Coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 18
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 2j2zB01
4XOEA 4AVKA 5FWRA 5LNEA 4AV4A 4CSSA 4XO9A 2UY6B 4LOVA 4X5QA 4AVHA 1ZE3H 2VCOA 5AALA 4XO8A 3ZL2A 1UWFA 5IQMA 4AVIA 5F3FA 3MCYA 5AAPA 1TR7A 3JWNG 4AUYA 4CA4A 3SQBB 4AV0A 4XODA 4BUQA 3ZPDA 5FX3A 4J3OH 5JQIB 5F2FA 1KLFB 4X5RA 1KIUB 4AVJA 2JMRA 5IQOA 1PDKB 1N0LB 3JWNE 5AB1A 4CSTA 2JTYA 5CGBA 3ZL1A 4AUJA 4XOBA 5FS5A 2WMPB 5LNGA 2J2ZB 4XOCA 2UY7B 1N12A 3BFWA 4AV5A 5ABZA 1QUNB 2XG4B 3JWNH 5FLUA 2W07B 2XG5B 4ATTA 4J3OG 3BWUF 4X5PA 3RFZA 4X50A 3BFQG 4J3OF 3ME0B 4AUUA 4XOAA 5IQNA
chains in the Genus database with same CATH superfamily
2XN9A 1DBMH 5TE7H 4MASA 4XE0A 3UYPA 4Q97A 2X4NB 4FC3E 3QCTH 2XBDA 1INQB 1DEEB 1FUNA 1QSFE 3C12A 2GCYA 3FQUA 3QIUD 4ZSOE 3HR6A 4DOHB 1RZ8B 4JHAH 1T4KB 1WBYB 3T65A 5C2UB 1SLXA 4Y5VA 1VFAA 3QEUB 1ADWA 1BD2D 3T6XA 4DGIL 1OWWA 4BSWA 1PW3A 1ZT4B 5J89A 1JTTA 1M1XA 2BIOA 4HJ0C 5I17B 3A3YB 3CFCH 3BT2L 1G43A 4MDJB 2FWUA 4ODVL 2NXZC 1G7HA 5BVJB 2G75A 4KXDA 1MLCA 2YD2A 2NX5A 3BC9A 1RK1B 3FYIB 5EU7C 1CGXA 1AJ7L 5ALBH 1GHFH 4ZDHA 4NM4H 3VWJA 3HZMA 5DVNA 3A47A 2KQMA 1J0IA 5JW5A 1EK3A 4Y2OB 1JDAA 3NK3A 3VXSE 1CLZH 2H32H 3MKKA 4E42B 3CN4A 4XMPH 1ZSDB 2WLYA 3VCLA 2IANB 5CU5A 4H0IA 1T20A 3HFMH 1E4HA 3MRMA 5D9SA 3LD8B 5EU4A 2V8MA 2YXFA 2AANA 4E9VA 1SYVA 1FWXA 1XT5A 3L6FB 1OF2B 2Z0BA 2PWDA 3CFJA 3DDFA 2WQWA 3EJZC 5IBTL 1PNCA 2WY3B 1A47A 1CLVA 1VFMA 1DBML 5TE7L 1E65A 4WEBH 2F5BL 4TTDC 3QCTL 6CGTA 1YLBB 2WSKA 1GGCH 1TQBC 4JHAL 3H1ZA 5ALCH 4BKLB 1ILUA 5FM5M 4H0LC 3O3BB 1SUHA 4XCEA 5FGCB 1B2WL 4OGXH 4XR8C 3CFCL 1WZAA 5F0LB 1XGPB 1SLUA 4DVBB 3OX8A 3DMMB 4MWFB 3FH7A 2Y7SA 5GJTH 4RSVA 1HC1A 3ECBA 5EDSA 4KKZA 5I1AB 2CO2A 3E9UA 1BGXL 5IJKC 2Y5TB 3NPZB 4PAZA 1GHFL 1IAIM 4MXWH 3CVCA 2B2XH 4NCC2 5I76B 5I18H 5IJBC 3ULUD 1CK0H 2J4WL 1U58A 3E80A 1JJUA 4I3SL 1JAEA 1CLZL 4GO6B 3ZKSD 5CD5C 5JXAH 4UV7H 2H9GB 5HYIA 4XMPL 2XNAA 5C9JA 4WFED 3FTYA 4MD0A 2DQFA 4MLIA 3HFML 1X9QA 5JIMA 5EU5B 2OCJA 4M29A 3BX7C 1TKWA 1JF1A 2AP2A 2O6EA 3WLWD 3DHJA 1U42A 3CZJA 2F7PA 3MKGA 4WEBL 1FA4A 5BQ7A 4DUVA 2FJUB 5IVXF 1A6TB 3ZRFC 1GGCL 5K9QG 1PZCA 5ALCL 4HULB 5BO1L 4DP2X 4QAWA 4HLZH 4PD4J 3FTWA 1TCRA 4XBEH 4LOUC 4M3KB 5I16B 2ZWYA 4GNKB 2YD1A 5FYJE 5T8IA 5EC2B 2QPUA 5JIQA 2MEJB 1G9NH 3FB7B 4QTIH 3RWJB 2BP0A 5GJTL 3IMWA 5DJCB 1JWUA 1DJSA 5HHNB 1T5KA 4IOFC 5GGSA 2E3VA 2KZBA 3ZKQD 5HDBE 3CFTA 5J7CC 3T0EB 4PLKD 3N42B 4FLRA 3CXHJ 3O4LD 4K55A 1KPVB 2JI1A 2XQBL 3VFWA 5FK9A 3DX9A 3H7LA 4KKAC 2CLRB 1TO5A 5B39G 3T3MF 3WKPA 4YDLB 4UV7L 1U36A 4K8RH 4M02A 4UDTB 1KLGA 2BSRA 2CM5A 5DK0A 3KXFB 3IRCA 3QQDA 2FEEI 1ADQA 3T77B 3DYPA 2AAAA 3JV4A 5DJAB 4Q4IA 4CW1B 2JXMA 5T1LB 5ID1B 5JOPE 1AGCA 2E9BA 3QUZB 2RH0A 4E41E 2YKLH 1YG9A 3LKSA 4XBEL 4JGMA 3VXPB 1JZ7A 1HWHB 4I7ZC 1J8HE 4Q0XH 1U8KA 4DP6X 1AZCA 5B38A 3ZUCA 4PHXA 4QTIL 1E28A 4LXFA 2L4OA 3UTQB 5IROC 3UBXB 3FFCB 4P59H 4HIIB 2XZQH 5E9AA 1CDCA 1WBZA 1P84K 5IJKA 5CBAA 1DQVA 1MFAH 4P2YA 1LD9B 4P04A 3RNKB 1VGKA 3HKZA 4NP9A 3G5XB 1KIPA 2X4PB 2DJ4A 3ETBJ 3TBTA 1DCLA 1WAAE 3SOTA 3F7PC 4JREC 3SDXE 4F33B 2B1HH 1ULVA 3BWSA 4GIPD 5BW7C 5CEZE 1E8YA 2BCKB 1MCOH 1U30A 4AXWB 4NUGH 3HRZB 3P0VH 4YZFE 2P9RA 2HN7A 1UCTA 4NKOA 2EZ0D 3VH8A 4Z3TA 4DAGH 4HKXA 4OZGA 2H41A 3Q1SH 1M9WA 1SN5A 2H1XA 5HYSB 4MS8C 2DTSA 1B0RB 4Z7NE 3EFDH 2R83A 2Z7YA 2VB5A 5SWZD 4ZMTA 2HTLD 3C8HA 4I18A 3RZCA 1FL5B 2VLRD 3U4BH 2R1YB 4Q0XL 2YAMA 3F62A 3JSSA 4U4BA 4BFFA 5C7XL 2E27H 4LZKA 4NQDE 3MRPA 1URZA 2A77H 3HE6D 2CO6B 1UKQA 2JKIS 4KJQC 2OMVA 3ELAT 4JB9H 4P59L 5DO2C 3REWA 1W0VB 2XZQL 2CDFA 3GJFH 3LYRA 2CMRH 2V9RA 4EIBA 1OK0A 1MFAL 3MLXH 1IGMH 3IDJA 1I9RL 5ES4B 4PY8J 3FHAA 3SDAC 2AJSH 1EJOH 2R4SH 43C9B 4HK0B 4KNSA 2QGEA 3LKQA 1U95B 4BE5A 2WK2A 1E30A 2IDCA 1WGOA 2B1HL 4WNQB 4HIHB 4X2UA 4F9LC 3ILQD 1MCOL 5IB2A 4P5KA 2ITCA 4AL8H 1VB9A 2EIJB 2B9BA 3GIZH 2WV3A 3ZTJH 4JY6B 4CKQA 3GPEA 1T5WA 4DAGL 2WXKA 3BLPX 3Q1SL 3SPCA 3CFQA 2ROXA 3VRLE 1KXTB 1SVBA 4RIRA 5GS1C 4PG9B 5T5FA 1S5HA 1SQ2N 3V7AE 1OGAB 4FFTA 5ESQB 2R9HD 4BFBD 1XCTB 2GC7C 3AWGA 3B3BA 4NQCD 1H5BC 3MBEA 5E6IB 5K59E 2A77L 3OKNA 4OKDA 4R0LC 3HTLX 4UNUA 3CLEH 3GSQB 3PPEA 1TSHA 4JB9L 5D2LB 4ELMA 1FLRH 4EXKA 1BECA 1ACXA 3LPOA 1OAQH 4GS7B 4QXTB 3U7AA 1IAKA 1BMZA 1UZ8A 3MLXL 1IGML 1FO0H 2H1LM 2V5TA 3A4AA 1A7BA 4PRIA 1CFQA 2NZ9C 3FTZA 4WCYH 3MRBB 3TEYA 1OGSA 2AJSL 4HT1H 4YSOA 5IQ7L 1BXVA 1CDYA 1FFPA 3PF2A 4AK2A 4NAQA 4KBPA 4KC3B 4QRRB 3QIBD 4Q52A 2ARJA 1NDMB 1NGZB 2YIHA 3D39B 2RFXB 1IILE 2BO0A 2AZAA 3JZ7A 5DEFA 5I75B 2IPTH 3OJVC 3QVAA 3QIUC 1T1YB 3WUWA 4AL8L 4ODBD 4DP4X 3GIZL 4NLHA 1UXSB 3DRQA 3TXAA 4IS6B 4YE4H 4AYGA 2M26A 2VZSA 1FZOB 3EUDA 5GZOA 3K6SA 4KDTC 3D51A 3S3CB 4JFYA 4PJCB 4XZ4A 2IALA 1ZS8A 3MZGB 3DJTA 4YHPA 1L7IH 1OL0A 4MZIA 2W0PA 4JQVA 4ZUTB 2JKLA 4NP4H 4Y19B 4PJ6A 2HPTA 4QTFA 5GSRB 3U2JA 3V4UH 1OLZA 4UNIA 4U1MA 3ULVF 3KGTA 3CLEL 5IIEB 4UU9A 1ETB1 2VCOA 3D6GA 3KPNB 2P26A 4FRWA 1FLRL 3WG7B 4YSSA 3H9HA 4L4VB 1OAQL 3QG6A 4Z7VF 5KG9A 1AC6A 3ZJAA 4JY4B 5F9JB 1FO0L 3ZDYE 3TEZA 4WCYL 5LDSA 4B9KC 5JW3H 1SHWA 1FVCA 4HT1L 4NSKB 4OKVA 2DQTH 3WE6B 4NC0B 5E9DB 3SDAA 4F57H 4N3UA 1U8HB 15C8L 3FTVA 3BMVA 1KFAH 1BF2A 4JZNB 4PTUB 1J1PH 4XHQA 3OXRB 5CXPA 1FH5L 2IPTL 5IB4B 5L4IA 1F58L 3UAFA 2F2HA 5BJTA 3LPFA 4PW4A 4JANB 3VH8G 3G6JF 1T7XA 3LQAL 2KYIA 3MDJA 2BSTA 2AJZB 3QORA 4YE4L 4AQ8A 3UTZB 3GWJA 3BSHA 5FLVA 2XFXB 1KULA 1AXIB 1L9QA 2HVJB 5I19L 5BZWB 3TPUB 1O6SA 2EUWA 2FB4L 4FG2A 3BKJH 3IFPB 4D9RD 1DQTA 2DW5A 1KTKE 3TL5A 4OJFL 4RX4A 2XN9E 3D0LB 1ZGLP 1CDIA 5AVZB 4CSZA 3GMQA 3P02A 1H5BA 1OPGH 5D7SL 1D5ZB 2HLEB 3BW9A 3DYMA 3JWNE 4LQ1A 4HIEA 4KI1A 3ULUC 1OIOA 1G6VK 1FYTA 4R0LA 1CF8L 1FAIH 1J1OH 1IBHA 3ZYOA 3MX0B 4KKNA 1YEFL 1SY6A 4PJDE 5AW9B 2OQJA 5CGBA 1R0AL 1Z3RA 3AWEA 5LGYA 2J5WA 5LNDA 3F58H 4BDVB 2CDGA 5E51A 5FO7A 2P5EB 1U92B 5JW3L 3S96A 3VD5A 3PP3K 1UZ6E 4HH9A 4F8OA 4DKAA 5KYYB 5J11C 4F57L 4QYAA 2ARJQ 3WLWC 5KSUB 1IKNC 1UFUA 3QYCA 4JFED 2OLDA 4PJEE 5IMKB 3QI9B 5DC2A 1J5IA 5GRXG 2WD0A 5MEND 2Q3XA 3QIUA 4E5XB 2UXFA 1BFSA 1VZHA 4IRJD 5K1JA 4X4ZA 4HOWA 3BZDA 1AZUA 2EDOA 1BD2A 1IM3D 1OALA 2W92A 2EDDA 3DNKA 3OJ2C 4KGJA 5D71H 5FEBA 4J3OF 3QA3B 1G6RA 4W9JC 5HD8D 3BKJL 3QFJD 5DUBA 2O6DA 1JHTA 4MJ6B 5JHBA 4WTQA 5F9OH 1LO0L 1SHSA 1IC0A 3NGBC 3D18A 1DCEA 1V27A 3TIDB 1EMTL 3EOTH 5JNYB 1HK6A 2BS71 3IFNH 4PLKC 4OFKA 1MVYA 2A6IB 2X4QA 3VI3B 3STLA 4LOVA 3V4PA 3PGFH 2NY3D 2OP4H 3BUBA 3V0JA 3DIFA 4F37F 4Y8DC 5KVMC 5CEYB 2JJWA 4BQCA 1CPUA 5D5MA 4A2FA 1D2PA 1Y0LA 3D69A 3HRPA 4OCYL 3BWZA 4GKNB 4WU5A 4L3CA 4N1HB 5MEOA 4HBQA 5TDOB 4PGZA 4W6XB 3K6NA 3OTTA 3FT9A 5C0DB 4JHWH 1PD6A 3NCWA 5DJXA 3RDTB 3KS0J 1L0QA 2EAEA 3A23A 5C0ND 4G6JH 4JFDB 4NO2B 4RMVA 1GYVA 5KBNC 3X3FL 1J05A 1YDPB 5D71L 2FSDA 4XO3A 1XMWA 1C1EH 1RLBA 1BXAA 1UJ3C 4IK7A 4AT6B 1KZQA 1A1OA 5F2FA 5C0AE 1QLRB 3UPCA 2F08A 1NBYA 5FOJA 4JG1H 4MNQD 3ROLB 1F3DJ 1FZMA 4ZNCD 3EOTL 2DD8L 3QDJD 3IFNL 1MHPH 1ANUA 1WBXB 2EO7A 3EYVB 5AKTA 2ICEC 4IU2A 4LLWB 4KNUA 3ZDWA 4Z3EA 1UD2A 3OLGA 3CSBA 3ZMNA 1JMXA 2FJGA 1I8IA 3GTVA 3QJQB 4L3ED 4P46D 4R7NB 3PGFL 2E74C 2B5IB 3I50H 5DQ9A 2OP4L 4BZ2A 1EZUA 4HS6A 4Z7OF 2YSTA 5AG8A 3HC3H 2JKJA 3IU3B 1B2YA 3HNTH 4NHUB 2AXWA 1QHOA 1RURH 1JV2B 3O3AB 1YEIH 3JQOB 2YXWA 4PG2A 5DZPA 2I24N 1OSZB 3TGXA 1BSIA 1NFDA 2CJUH 5ITBH 3MXWH 5EU7E 1IKNA 4JHWL 5DD6A 4ODWB 1NCGA 3E1ZA 3Q5TA 2VDKH 4G6JL 4J6RH 2QQNH 2HTLC 4AIEA 5AVQB 3S4SB 3WEOA 3VQLA 1O6TA 3O8XB 4Y88A 4FFWD 2EO1A 5HHOB 3HG1D 1C1EL 4LDCA 4JFOA 2NY6D 5IWLC 3V0IA 5C08B 4QYOB 3S98A 4RFEB 1PY0A 3QDGE 5E2WL 3WEMA 3HE6C 1J5OH 3FONB 4H8HA 3VGBA 5AD0A 1O9WA 2NZ1A 4GI8A 4GKOA 5F6HI 1MHPL 1U8OA 3AACA 5LNEA 2EXTA 2YO3A 3O4LA 2WXPA 2RAMA 1SXNA 4DCQB 3I50L 1I31A 1FRGH 3NN8B 4K5OA 1MI5D 4U1KA 5I1CH 2IH3B 4G8AC 4WF7A 4B50A 1BAFH 2APFA 2F8IA 5IFAH 3HNTL 2AVGA 3ILQC 1RURL 4ZS7L 1SMDA 1F00I 1YEIL 5TFSH 2LVEA 2WLIB 2CJUL 4RQQB 5C0EA 5ITBL 3RNQA 5D1XD 4HPHA 1LK3H 1T2QL 3HEIB 4WW1B 2M2DA 5KS9F 2PR9A 5HGDA 2BH0A 2VDKL 4H26A 4J6RL 1MCDA 2QQNL 1TEFA 4NZRH 3ZIMA 4X6FA 1LWRA 2R9HC 1JVLA 1M7DB 4JKLA 1H3GA 4PLOB 1NANH 1BXXA 1E43A 2YAEA 3GSOA 1OM9A 1N3NA 2VR6A 3QUKB 4Y4FD 5ICYB 1J5OL 3B7YA 4PLNC 1RUKH 1AMXA 3OKEA 4OZGE 1BDYA 5GHWH 5ID0B 1IL1B 3QXDB 4LLVA 4MNHB 2WXIA 2VXQH 3MBWA 3PDOA 3NFNB 4JK0D 1KN2L 4G5AA 3EGSA 5T1JA 1M6OA 3F5WA 3HB3B 5F1NB 1GZQB 1DO5A 2YRPA 5DJ0B 2HSIA 5TK2A 4DPAX 1FRGL 1GKOA 3QIBC 1UACL 3BN3B 3MUZ1 3ZHNA 3TZVB 1WFUA 1BAFL 1HVXA 1OAXH 5IFAL 1BX2A 2V4LA 1A6AA 2OTUA 4ETQA 1FH2A 4X5LA 4PCSA 4GSQA 3OKOA 2XVLA 1MREH 1LK3L 4HWZA 4AQAB 4F2MB 2HT2D 4R4FH 3FQWB 3RGVB 4PBVC 4W9GC 4NZRL 1F13A 5F88A 2GTQA 3B6SB 3DHUA 1D9KD 4X6DF 2LV4A 4AKOA 2BZ7A 4OCXL 2A9AA 4PWGA 4CJ1A 5L4FA 1MUJA 3FQNA 1WFNA 3ZE0F 1KTDA 3HC4L 1CN4A 3ZN6A 3JT0A 3L3HA 4Z7WB 5K9KB 3EBIA 4ODXA 4JAMB 3HE6A 3DURA 4HGWA 1RUKL 2Q8AH 4JO2L 2CK2A 5GHWL 4CJ0A 3DX0A 4BCYA 4J1UB 2VXQL 2J8UA 3VA6A 1KF9B 4PJGB 3LZPA 2CA3A 3MJ9H 1Y07A 4ZUWA 5IR1B 1LWHA 1OSEA 1H8OA 2XXFA 3VQMA 1ETZB 1NEZG 5CINL 1OAXL 1XB6A 3U7WL 2ZG2A 2AK1H 2R8SH 5FKAB 3TFKD 3D4CA 2DV6A 2EH8L 1LP9B 4HJEA 2F61A 5D6DC 2MCPL 1MREL 4W9DC 2P1YA 3CXFA 3OJMB 1FNHA 2DQHH 1IBYA 3FUEA 4NQUA 5KYUA 4C4KO 3IE4A 3V0EA 3VO0A 3MLTB 2BP8B 2JLLA 4CN4A 3GGWA 4XPAL 1UEMA 1G7LB 1NC2D 4NQCA 3BUYA 4YBHA 1FL6B 3LNGA 2JB5H 3DVGA 3DOSA 1OP3H 1FO0B 1ET5A 1O5DT 3DX4A 1IEBA 4KQ3H 4WV1A 2Q8AL 3ZKXC 3IGAA 5HGHB 1OTSD 2YBRB 2PO6D 3EG9A 1AMYA 1XZWA 5I8OL 4YFEA 3IB4A 4GAJH 4Q6IA 2JCCF 3MJ9L 3QUYA 1OOAA 5KN5B 1ZHBA 1RFDH 1NAKH 1BFOA 4NDMB 4LCYA 5JPMC 3ESMA 5GRZA 4PGBB 3M17A 3MRQA 2F54B 5EBMA 3IMVA 3UZEC 4A2MA 5EBLB 1SLWA 5JYMA 2OV0A 3PWPD 3MNZA 5JDSA 1QA9A 3K2IA 1S8DB 3IMTA 3T3PF 3FN0H 1B0GA 2A3TA 2OSLA 1D5MA 1QSFB 3DGGB 4IRJC 3S88L 1K8IB 5CSGA 3RWIA 3JVFC 4U1HB 4AI7A 5KBDA 5GJSH 5DF0A 1KCWA 3ZHKA 5E4EB 5HD8C 2DQJH 5DEGA 2IAMA 3I9GH 5EZPA 1IARB 5BZXA 2R56H 3SQBA 5BMFL 1EZLA 1XD1A 5E70A 2LQRA 1OB1A 1ZLWH 4JM4H 3CDGB 4MA3B 1NGYB 5KBLA 2YPLA 2BP5M 5AVYB 3NIGE 4KQ3L 5HPOA 1Y18B 2NY3C 3LEYH 1OY3B 3IJ9A 3OZKA 3SZ6A 3PJNA 2OXGA 4XOEA 3VXSB 2LTQC 4GAJL 1U8JB 3I84A 3Q01A 4H8QA 1MOEA 1TYEB 4HF5L 4N86A 5DD1L 5T1KD 2DJUA 3JWOC 1OE2A 1RFDL 3ZDZF 1NAKL 1QAWA 3X1GA 4H1LH 3SKMA 5D7LA 5DURD 4AYSA 3DV4B 3Q8AA 4P9ML 1VSCA 1NPNA 5IG7B 4AMXA 2YD7A 1IGTA 4JE4B 3WJMB 5FR3A 1VFBB 5KSAB 2ZCHL 4NQEE 4X5WB 3KWWB 1T22B 2HRPL 2WVVB 1FYTE 4RZKA 2GG1A 1EJ6A 5C0NC 4CU7A 1S7QA 1VA9A 5I66A 4E9RA 2DI8A 4DN3H 5I1KH 5JTWA 1S7RA 2IH1B 4JKNA 5GRJH 2ADIB 4B0MM 5GJSL 1XR8A 1R24B 3Q5OA 4WHTA 2DQJL 4HKBA 3I9GL 2OSYA 2R56L 3GDBA 1UXWB 4RGNB 3ARUA 3UO1H 3UROR 2SEBB 5I71B 2VZVA 2X9ZA 5CFHA 1WV7T 5L0QC 5T1MA 3N1MC 3IDUA 4K07A 1ETA1 4LVEA 1U3NA 4JM4L 1ZLVH 1FBIH 4HS8H 3GBLA 4YL9A 5DS8A 4HLJA 4IIQB 4I3GA 1NC4B 3DROB 3D34A 3CAFA 1BIIB 2AFNA 4P46C 5AOMA 1U8IB 4U6TA 4LHUA 3P73B 3LEYL 1T1XB 3HMWL 4E9LA 5IREA 1BD2E 4P48A 4YHYC 1E40A 4Y8AA 1IMHC 4ZT1A 2B16A 2E76C 4ELKA 3U4EB 5HHME 4BCZA 3CZLA 3KGSA 1HL9A 3AQZA 4Y1AB 5BQDA 4YFDB 5DI8A 1F5WA 1T0NB 1E6JH 2C9AA 2P48B 3HPJA 4KKBD 4ORGB 5BUGA 3SB3A 1A3ZA 1UT9A 2G30A 3KDPB 1JPTL 3QQNA 3QUXD 5JW4M 5JPMA 4F7CB 1HHKA 1JHLH 4DQAA 1RIVL 2ZKHH 2IBBA 1CFBA 4JFEA 5C07B 2CRMA 1FFOA 1WLHA 3C5SB 5I1KL 4NRZA 5AW6B 2BNUB 3BT0A 4MMZC 4PEEA 1NCIA 1U8NA 2IO5A 3D85D 3O3EA 4IRJA 4FFWC 5IB3A 1ONQB 5GRJL 4HFUH 2JIXB 3UTPD 43CAB 1EZSA 1P69B 1IM3A 1Q94B 2NY6C 2OXHA 4HUKB 4KKPA 4PJ7F 5ABZA 2IDTA 2X1OA 5F7AA 4Z7QB 3FTUA 3HPLB 4U6YA 1A9VA 1E5UI 5IMMA 4F58H 3SQRA 3H8NA 2CBQA 3QFJA 1BWWA 2YN5A 4D9QD 3WU1A 4HS8L 4KRPB 4NN5C 4DESA 2OSXA 3GLDA 5F44A 1KT2A 4GMTL 3P2BA 3GRBA 2A9CA 4I85A 2C4XA 2QQQA 3PABB 4Z77B 5F6HJ 4UNVA 1LJMA 1SF3A 3G9AB 3I6SA 3RVTD 2ZQKA 4C54A 3VTTA 4QO1A 1GVIA 4X98A 1B0WA 5CSZA 7CGTA 5JOFA 3FAWA 3VXUA 4YNYB 3CK0H 1UH4A 3I75B 1JHLL 4HUMB 5D1XC 1G7QB 2ZKHL 1IKFL 3TEWA 4JZOA 1AG0A 3D7PA 3DX8A 2D7PA 3HS9A 3ULUE 2ZKWA 3MRFA 3N0AA 1KXHA 4NQSB 4Y2DB 4BWUA 4QRTA 3E3QC 1BBDH 3EDDA 1AGBB 3CZEA 4GRWF 4YMPA 4E41B 1MCWM 3MLUH 4HFUL 1F11B 4WFEE 3RHWK 4WI0A 4B7IA 4DTGH 3KJ4B 3BLBA 3KLHD 1F6AA 4I77H 1J8HB 4M5ZH 4Y4FC 4Y5YC 5DR5H 1NFDE 1I9JH 4RH4A 2E9WA 4BH7A 2JKTM 2VISB 3LN4A 1Z9OA 2O6CA 3UTTA 3P40A 3OKYA 1NJ9A 4N2AA 2FYYA 3QDJA 5ICXB 1MCKA 4AIZB 5T3XH 2ZKMX 1ZLEA 4UZSA 5H37G 1DJYA 3P9MA 3ILPA 1KLUB 2OAAA 4L3EA 4P46A 1I7ZA 3CZNA 4ELDA 3II2A 4WO0A 5DQJB 4BFOA 1A9EA 3MAWA 1F42A 2HFGH 2R59A 2Y6SD 4BZ1H 2Y06H 3VG9C 1FG2B 5A2AA 3CK0L 4KQ4L 2CLZB 2VM4A 3FTXA 2VN6A 2QZQA 2YQGA 4G8GA 4NT6B 1GYAA 5ERWA 2HT2C 4G8IB 4MHHG 3H3KA 1U3YA 3QGVA 2GJZA 1T7VA 4HA1A 2R0KH 1NMBH 3CSFA 3KPPB 3O4LE 3V4VA 2FR4B 4K94H 4L8SA 3KYOA 2KH2B 3DTDA 2K3TA 3AZUA 4TKWA 4JR9L 4XZUA 2EVJA 4PWEA 4Z7NB 3LIUA 1D9KC 1RIHL 1QUPA 1JZ5A 4F8PA 4MMZA 4JPIB 5I0ZA 1R47A 2O6FA 4I77L 4M7LT 4N2NA 2XKNB 2Q6WB 1E9OA 5DR5L 4WWKB 1I9JL 1CXEA 2QADB 4D8PB 3IWUA 4N6QA 3AU1A 3KH4A 5G2NA 1GY2A 4YX2H 3OZLA 5CZKA 2BNRB 3BP5A 3SE3A 1GC1C 5T3XL 4YEFA 4Z3IA 3I6LD 1UWGH 2WXQA 2Z7ZA 4P23D 1CLOH 2RCSH 4LHUG 5FYKH 4XXCA 1FORH 2Z3FA 3H9YA 1C8QA 2I85A 3CSTA 3IDYC 3JXAA 4R7LA 2IV8A 1MI5A 4KQ0A 1E5AA 1NCUA 3W0WB 1BZ9A 4DPCX 1JD9A 3U30B 4BFNA 3WEAA 4BZ1L 5F1KC 2Y06L 3TFKC 3V6OA 2VIRB 3CHXA 4P2CG 2Z35B 4K71B 3WMQA 3L7FA 4NZ8A 1L9NA 1I3UA 5D1XA 3LN5B 1V55B 2EYSA 1NMBL 2R0KL 3OR6B 4X4XA 4XH2B 2ZXGA 4Q6KA 3WDIA 2F8VA 4R7DB 2C5DC 2I5YH 2IFFL 5A6LA 3MRIA 1JPSH 4UM8A 5MEPB 5EU6B 3UDWC 4MD5A 4P07A 3TO2B 1SLVA 2VDOH 4XVJL 3TJEH 2OL3H 3MRLA 2F74B 4FFYH 2PTTA 1CYXA 1COBA 5LN4A 1P7QD 1AIFB 1JN6A 1M42A 4IJ3B 1OTSC 1Q72L 3IF1A 4YX2L 1MHEB 2PO6C 3DTXB 1SBSH 5EF0A 1QATA 3QWQB 4WI5A 4EI6B 3LKPA 4DWHA 5CIPH 2A83B 2BOCB 4OLWL 4CVXB 2WKLA 4GEJA 4BXVA 1H0DA 2UYLA 5SWZE 1CLOL 1WS8A 2RCSL 5E4OA 5FYKL 1CR9H 1J9QA 1FORL 3IAPA 5IQ9B 3I6GA 3MFFB 3O6FA 4EIUA 2NW2B 2W95A 2NCEA 1SDYA 2VLRE 4XXDA 5CLXA 5ISZA 1M53A 2CGRH 5D7JA 1T2JA 1XF4B 2K0RA 3BP6A 5DHVB 1CG9A 5BZDB 2L04A 2J12B 5GPRA 4AEHL 3UBFA 3CC1A 1QPKA 2J8UE 4HJIA 3A22A 2HJLA 4ABVA 4NNYA 2I5YL 1PBYA 3QEQD 1JPSL 1HCVA 3BH9A 3NJKA 4MJIA 2HLAB 2VDOL 1R5WA 2F1EA 4WJKB 1MJJA 5CGMA 4EPSA 2H6PA 3TJEL 2OL3L 4LSVH 2HJKB 4FFYL 5DUML 4OLEA 2DWDB 3UABA 3PL6B 4JFZH 4XVOA 3ARBA 4R90H 1NBZB 3HG3A 3L4XA 4LDOB 3PLYA 4LSRH 1JGIA 5F7NC 1GOGA 5L4JA 5LG1A 4LKXA 5LO7A 4LCWD 1SBSL 1TIUA 4WW2C 1LEIA 1IQWL 1FGVH 1MFBL 2AV7B 1LK2A 2NNXA 5D1ZB 3RAJH 2Z8WC 2H4EA 4XXWA 1WIPA 3ZDYB 4HAFA 3ZRSA 1DQQA 5I23A 2AQTA 3EOBB 3K72B 1D5XA 4NQCE 1VERA 4WUKL 2CHWA 2QV2A 2W0FB 2CGRL 5AEAA 4RMBA 3PV7A 2OZ4A 3ULVD 5CD3B 3BVUA 5AOKA 1R19A 1HAUA 5IF0B 1PKQB 2V3EA 1DJWA 2JK5B 3SGEI 5GS0H 4GO9A 1CB4A 4WI8A 1XX9C 4E9QA 3VD9A 4M7KL 4MMYA 2E7BA 4QNPE 3TTYA 4C83B 4IU3B 4F9PC 4IMKC 4NPKA 3CPLA 1GZPA 2M8XA 4LSVL 2DJSA 1KYOK 2Z1PA 5AOIA 4NPJA 3EYFA 3HNSH 1OSPH 4JFZL 5INCA 5J12B 4R90L 3TV3H 2PUQT 4HC1H 3K46A 2ZCZA 4LSRL 4BJLA 2N3JA 1IC7H 1WT5A 2YA2A 4EBQH 1NQBA 1ZSHA 3A67H 4Q14A 1FGVL 3HAEB 1GCYA 4PJDB 1SQMA 1KB9K 2P5WA 5CP7A 4KKBC 1AD0B 5AVUB 2Y6TE 4HKZB 1T3FB 2ED9A 2VC2H 2HKAA 2RD0A 4WFHD 4I88A 4PJAE 4M00A 4EI5D 2C4FT 3GLZA 1NOAA 2YPLE 4HQQH 5GS2H 4JRYA 4PJEB 1HILB 3HZMB 4M8RA 5AYTA 1FSKB 2UZYA 3BKCL 1FFTB 1UA7A 5CN2A 4BRVA 1A3RH 2HCZX 3AB0C 2E0PA 3HLAA 3X13B 3Q3GB 4PRPD 2NTFB 5GIRB 4LMQI 3P77A 3AGVA 4N8VA 1S46A 2QPFA 1BM3H 4ATWA 2IPUG 4HLEA 4XO4A 5D7IE 1XGRA 4OZHA 1RV6X 4OD2B 1AY1L 3HNSL 1OSPL 5TGBB 4WKZA 3SKNA 3W81A 4OT1L 4AGMA 3TV3L 4PV8A 3UCRA 4W93A 3NT0A 3H3PH 3MO1B 2N7AA 2OJ1A 3EYUH 4XCEB 4EBQL 3EYOB 4W9CC 4TM9A 3QXTA 3A67L 3HC0A 3OF6D 4WW2A 1XR9B 3RVTC 3IMRA 2AEOA 2D2CC 4N24A 1RH8A 4KY1H 4HZLA 5T1KA 1OP4A 4J3OD 4D9RE 2A38A 12E8H 2VC2L 4J7RA 5EBWA 2ALAA 3JVGC 2BVQB 5BVPH 2I27N 1DQDH 4MB4A 3BFQG 5LAXB 5AENA 2QPDB 3RQ3A 4I0KA 5B8CC 5DC9B 3L2LA 3L5XH 1KGIA 4CN1A 1MAML 4LMQE 2RR3A 1G5GA 4GW4B 4F8TA 1XXFC 1IGJB 2X2JA 5E1GA 5FO9A 5C0FA 1A1NB 1A3RL 4LSDA 2L8AA 5DLLA 2NY5H 2P8LA 3RIFK 3JBG7 3GRGA 2XNAB 3KLHC 5EPMB 5F7DB 1G9MC 3EJJX 3ARFD 2AJ3A 4E0RB 2WVUA 1BQKA 5C3IA 3FRUB 5C0AB 4MRCA 2VN7A 2WLJA 4JFEE 2GTZA 3IJEB 1QFWI 4F9PA 5EF2A 1M2VA 4R2GB 4KUCD 5FHAH 4MKTA 2AMGA 5MENE 2XVGA 3D09A 5HI5D 4ENED 4PJXA 1KJVA 1GR7A 3QDAA 4RZCA 3TESA 5EBGA 4N0UB 8CGTA 2YLHA 2CALA 3EYUL 5HY9A 3TBSA 4XAKD 4J4PA 2W94A 3VFUB 1AR1D 3FB6A 4NHCH 5JZ7C 2YC1B 4L1SA 3VG0H 2Y6SC 4KY1L 3PAYA 1W6LA 1ZAGA 3QFJE 2BSSB 3IVKA 2BP0B 2V2WA 12E8L 1I1YA 3EH2A 4FULA 4HK3N 1LVEA 4MAYD 2I9TA 1KYFA 1JWUB 3O3DA 3K74B 5FIEA 3ZR5A 3IXAA 2NXZB 2VDMH 5BVPL 1G94A 3VACA 4XP5L 4FF9A 4PWJA 3CVIL 4JG9A 1HWWA 5IBUB 4DEPC 4GT0A 1GJIA 5E08H 1FCCA 2Y72A 5H2BB 1NAMA 4WGWB 2JJVA 2WKOF 3AABA 4R96A 2NY5L 3L9RA 4W4OA 3H4HA 2YGOA 1K72A 4KI5F 3HJEA 3NJVA 3TCLA 4OZIA 5JPNA 1TVHB 1KGXA 4HSCX 3M88A 1UXMA 3QDGB 3LH2H 1P4LB 4DKDC 1A7RH 2WTRB 4AC2A 4NBYB 1N2RA 4GH7B 1MZZA 1RZFH 3D2TA 2YGVA 3T09A 4P23C 5ICUA 4QHPA 2NY7H 4JDEA 3QEHB 1ITBB 3HE7A 5IVZB 5K93A 1TQBB 2DWSA 3ROOA 1FJ1A 3QARA 4UZGA 1YC8A 3C87A 2XHNA 1NIBA 1GOHA 3BVXA 4NHCL 4YHNB 4XX1E 2AQSA 1G1CA 3RI5F 1E4WH 4XVUC 2BVOB 1WGVA 4GRLD 2CIKA 4MNQE 3O9WD 3BUIA 4X9BA 2VDML 3FHEA 3MV7A 3JVGA 3QDJE 1MFVA 2EIZB 2VXTH 2HG5B 5EEXA 4M43H 1TZ8A 4N0YH 3RX5A 1EAPB 1SBBA 4L3EE 4LBAA 4XP4H 1U4FA 3LRSA 3CC5A 5E08L 5JIPA 1A6UH 1S5IH 2IWEA 3SEPA 1JL8A 2BINA 1PSKH 3WL9A 4M7JH 3FB5A 2M83A 4JUTA 2YAFA 3WY4A 4UQCA 3F7KA 4N2BA 4NCDA 2WINA 5ETUA 1CGVA 3H0TA 4ZYKA 5L4MA 1HQ4B 3LH2L 3ESUF 4J28A 3VRIA 4YSPA 1A7RL 1PFCA 1LEKA 1MFEH 4MMXC 3VXNB 4XWGH 4TS6A 2D9QB 1ZPUA 3AREB 2HX8A 2N01B 5KVEH 1QSED 5F9WC 4FFZH 4B9FA 2NY7L 3NJXA 1IGFH 4HALA 4F3FB 3HI6H 4M5YL 3HNVL 3LKNA 2YGNA 3VXOA 3WD5H 5G5DA 2EDQA 3PNWB 1QWHA 3HG1E 2DWEB 3T1WA 4TQEH 1FV1A 2WB7A 2C3VB 3WJLC 2ZYSA 5JA9A 3CFKB 4XNAA 1V05A 5FAAA 4XMTA 5GSVB 2VERN 1QRNA 4HH8A 3P2TA 3T71A 5L8LB 1DUZB 2IEPA 4DGVH 4LPWA 1KENH 3ZHDA 4N0YL 3HUJA 3WELA 2LAAA 1X5YA 4XP4L 3LQMA 2VUKA 2GT9B 1PQZB 3F05A 3NEXA 4YXHL 1A6UL 2ICWA 1UM4L 1S5IL 1MI5E 1PSKL 2ZPKH 1JG9A 3IKKA 4AEFA 4M7JL 2E4FA 3RP1A 3FT0A 4HUWB 3QZNA 4H0GA 4JX0A 1CUOA 1HI6B 5I5IA 1EWHA 4V2BA 1FGNH 3LZQA 3GF8A 5JO5A 2B14A 3T5WA 3UGEA 7PAZA 3TONA 5EEUA 4MJ4A 5D1XE 5EU3B 5KJRH 4XWGL 2BY2A 1CL7H 4M8VA 5IFHH 5KVEL 2MOGA 4G11A 4AQEA 1F2QA 1K8DA 3FQXB 4FFZL 3G5ZB 1IGFL 4QXUH 2BJML 4HUVB 3E3QE 2XJKA 3HI6L 4P23A 1XL4A 2E7CA 3NIFE 3WD5L 2PYED 2P28B 4L2YA 3T2PA 2ZOTA 3HC2A 1I85C 3WIIH 1AE6H 2ADJB 3L7EB 4FLOA 1A4CA 1CI3M 2XBTA 2ERJB 2WANA 4YGAB 2FEJA 4ONGH 3ULVC 2FSEB 3GBDA 1PZBA 1T89A 4LLUA 4LIQH 4M8QA 1QPPA 2JFCA 1WPCA 3TP4A 4DGVL 1BZOA 1KENL 5L8JB 3LB6D 5FUCC 5I26A 1OO2A 3DK0A 2HX7A 1D3CA 3WKYA 4N8PA 1LYQA 2D7NA 4JRWA 3BAEH 2RJMA 4G43B 1ACCA 3MV8A 2ZPKL 1TYRA 1LWJA 1I3RB 4U1NA 5DVOA 1JZ3A 3I9PA 1Y6KR 2ARJB 2ZOKA 4R5TA 4WK0B 1MHCA 1NOLA 4JREB 5IKCB 2Q0ZX 2G9HA 1WH0A 1PVHA 4GKZA 5C7ZA 3WUWB 4OCSH 2OZNA 4O9HH 5IVNA 2B0SH 2BRRH 5KJRL 3ARGB 4PJHA 2UZIH 2YEVB 1YNTB 4QF1B 1CL7L 3ZL2A 1TLKA 1FDLH 1W15A 5IFHL 2Z31B 3GKWH 1U91A 4QEGA 5CWSB 3MREA 4LARH 4QXUL 1UGKA 1YNLH 5KSBB 5J0BA 2QL1A 3OLIA 3VB9A 3KL0A 3CN3A 1BJMA 3D2UB 3QS3A 4U49A 3M6DA 4EI5C 1MW2A 3NJHA 1AE6L 5H94B 1NIEA 4HUXB 3RWFA 4KZEH 4QRQB 1P1ZB 1SGKA 4NKDB 1FIEA 4A2GA 4JFPB 1EVUA 4ONGL 5I0WA 4LIQL 4UU9B 3G6DH 5D7EA 1K4CB 2X4RA 4MB1A 5E94A 4GUPA 2D7MA 2EP6A 2L7UA 3WHE0 4YDVA 3WNIA 5KSVB 3GRWH 2YD6A 1MNUH 4BWWA 2HTKD 4DQOH 4Y4KD 2WWKT 3DA0A 2X4SB 3P9WB 4IRZH 3BAEL 4JFXB 4PREB 1RHFA 1UWXH 5DMIH 1ZT1B 2R1XB 3OMZA 3ZQ9A 3ZZ1A 2EVGA 1OQXA 4OI7A 3IDMB 1UUSA 2G2RB 4U3XA 3NJJA 5GGUA 1I1FA 3FT1A 3QPKA 4O9HL 4A68A 2BOBA 4OUUA 5DD5H 2BRRL 4FQQB 1XF5A 3NIGB 1E9PB 3T8VA 1FNEA 4LCWA 4XT1C 2BHYA 4HD9A 4ZO6A 1FDLL 4FAAB 1V8HA 4LARL 1EHLH 1YNLL 1E4XH 2FT8A 4J3OC 4PRBA 3OHXB 2CD0A 2X9XA 4MTMA 2V7NB 3ZSTA 5GS1B 1IEAB 4PBXA 5IB5A 3WIAA 2VDNL 1S2EA 1PG7W 1QI3A 3VXQB 4B96A 3OKLA 1I85A 2X44D 2OYKA 4NQEB 2UX7A 2R1WB 5IHZB 3QC6X 1L6ZA 3GSXB 4R4BA 1CICC 4KUZH 5BV7H 4PV9B 1R3LA 3QC5X 3WCYA 3DGDA 4LESA 3GRWL 1MNUL 1WFIA 2NNRA 4DQOL 2CDGB 3QCVH 1OHQA 2Y3AA 3MRCB 4IRZL 3ARFC 2H3NA 3DTUB 1OGTA 4X6CA 2CK0L 1JCKA 3PHOA 5DMIL 4A6YL 3GSNL 3SDCD 2VJ0A 1ZVNA 2E9JA 3C9NA 1TU2B 2K45A 2GBTA 1MRFH 2DMHA 4A38A 1EQWA 4ENEC 5HI5C 3AUVA 2Y2YA 4YHKH 3MV01 1BYPA 2DTMH 4YHIB 5J06A 2BSED 1JZGA 2K3HA 2UY6B 2DWYA 1J8RA 3LVTA 1I1AD 2YMTA 3BYTA 3KXFD 5I9QC 2VC2B 1AR1C 3U46A 2N0MA 1K85A 4GT7A 1EHLL 5T1LD 4FXLA 5EOTA 5DZVA 4GYBA 4MAYC 1KG0A 1T2XA 4AYID 4KV5F 1JHTB 3QQ4A 4XNDA 4DZBA 2NLJA 4OZHE 2UY7A 3WNPA 4YSUA 3GI8H 5IEHB 3RWGA 4O02H 4Z9KB 1QR1B 1UQSB 5KVGH 1OE3A 1JXDA 2FH6A 3LH9A 4TQHA 5D72H 4BSVB 1EO8L 1NGPL 4KUZL 5BV7L 3ABGA 2F8XC 2UWEA 2KI6A 1DVFD 1HSAA 3FFCD 2XV3A 2OJEB 2C7FA 2AJUH 2DL9A 4M6MH 4TUKH 4F7PA 5L88L 2GAZB 3IJHA 4FI6A 1Y0LB 2JELL 4PRPA 2HFFA 4NN7B 3W11D 2XKUA 1J88A 2FWSA 4EDXB 3KLQA 2VLJA 1NUNB 4P0DA 4YHKL 2YA0A 4H0HB 3OAZK 3ES6A 1U93A 2DTML 3GPSA 5FYJH 2GBAA 1N0LB 1IM9D 3WXWH 1MY5A 2NSQA 4CSTA 5I6NA 4UT9H 4FLSA 1QHQA 2N7SA 3BHBA 4RLDA 4MNGE 4MJJA 4IYKA 3ZGHA 4EKJA 1E7UA 1G4MA 3MACH 1AD9B 4GRLC 1RJYB 3G6AA 5FS5A 3O9WC 1TENA 4ZW7A 3BPOC 3NH7H 3GI8L 4LNRB 3CUPA 4RETB 1SMOA 4O02L 4PJXE 5LBSA 4D0DB 5KVGL 1SJXA 3EO1A 2JLPA 5D72L 5EUOA 1KYOJ 1IC1A 2ZG1A 2ZXBA 5F3BA 2CO4A 5MI0C 1CICA 4A2DA 4HS6B 5F3HB 2W65B 2Q10A 3TCTA 4M6ML 4TUKL 2AJUL 5E6SB 1TTAA 2YRLA 5C0BD 3VX0A 4EJ1C 5C3TA 5DGQA 2Q7YB 5D96C 3ARFA 1CO1A 1BZ7B 3TF7C 5A2FA 3O6KH 5EFIB 3BCDA 1T04B 4RNRA 5J11B 3FU7B 5E8NA 3BPNB 4PRHD 2EUXA 5DD6B 3BDBA 4ZZFA 2V9QA 4RA3A 4ZFOB 3WN5C 3KPRB 3BIAX 4G8FA 3WXWL 1PX3A 1P7HL 1CFTB 4HX1A 4UT9L 4FDWA 1BIHA 5T3ZH 3UTPE 3GZOA 1KXVA 1A3LH 3IWVA 2GJ6D 1RK7A 5AL8A 4HHAB 3MACL 4X99A 1DFBH 1R3HB 1M3IA 4H2AA 3KPQB 4JGJA 5IQMA 3ETTA 2P7TB 4UMGA 4MAYA 3KS0H 5J3HD 4AYFB 2Q86B 4D9QE 4X5XA 4OZFA 5DMJB 3N43B 3NGBB 5G4NA 1HU8A 3TJPA 3MNVA 4OGAD 4U4IA 5IVXE 1LO5B 2FJSA 5E6ID 2YD3A 3O4LB 4OFIA 1DSWA 2PCXA 5LXGH 2GFBB 2PCFB 5TDNB 3T0AA 3NEOA 4P4RA 4FZEH 1F3DH 3U83A 2EACA 2VRKA 3MV7E 3NCFB 3O6KL 3IETA 3FQ2A 3POHA 2K8QA 2WZAA 2DF3A 4JM2F 2CU9A 3MNWA 3ZE1F 3WTUA 4PJBA 3AG3B 3D39D 5JIIA 2IAAC 4GP5B 2FJFA 2M1KA 4JKWA 4X6FB 4HVBA 3LV3A 1DQLH 4AX3A 2DM3A 2KDYA 3HG4A 2XN1A 1A3LL 4M1DL 2RGSA 4FS0A 4AH2A 4DW2H 3DX6B 4EUPA 1AZZC 4TSBH 1JDDA 3F7LA 2JNZA 1UJ3B 5HHVH 5CKAA 1GGBH 4KTDH 1VACB 2ICWI 1MH5B 3BDXA 3K2UH 3NIDB 4L9DA 2WLZA 5DHYB 1ZVHA 3O9WA 4RA0C 1IUZA 4OZ4B 2VL4A 3LB6C 2PPDA 3GMLB 4NO5A 5PAZA 4QHNA 4Y19D 4NZFA 2ICEB 1E42A 1DUYB 3VFTA 1JVOA 1ROWA 5LXGL 4A7GA 4JLRA 1ZWIA 3HKFA 4U31A 3ULAB 1FAKT 2P5PA 2C3WA 5DK3A 1HFUA 4L4VD 3QRLA 4FZEL 5I8EA 3LEVH 3NRQA 1ECYA 4O4YL 3W9EA 4R84A 4W9LC 2P80D 3GUTB 3CX5J 2NR6D 1KCUL 3WKNA 4ALAH 3RX8A 2QBWA 2EXYD 3OG6B 5JQ6H 4KRNA 3ARDD 1EEYA 1EH9A 1YQVH 3WN5A 1KV7A 5SWZB 2OM5A 3JV6B 1XGUB 3CQPA 3RL1B 4NQTA 2OA9A 4DW2L 1L7TH 2VLRB 5JDJA 3V0VB 5GGVH 2X6UA 5DU7A 3SPVB 1KTDB 5GISH 2NNAA 4LKCB 1GGBL 4KTDL 3L3HB 2AEWA 1ZTMA 1JZDC 3K2UL 1UG9A 4Y9BA 3JTTA 3R4RA 1J0HA 4NBXB 3R06A 3BGMB 1KGWA 1RI8A 2FX8H 2JB6B 3FSOA 3I6LE 3T8MA 2HTKC 4Y4KC 4JUSA 2A5UA 4J3SA 3N9GH 1C16B 5ANMA 2YEZA 3WNOA 3VSQA 5IV2A 1GS6X 2QR0A 2X1PA 4DPBX 3WNJA 3LEVL 3P1VA 2TRYA 3QCUH 2G5UA 2R7EA 4XBPB 5I6KA 3IDIB 2B20A 1ZHLA 5FFGA 3QJZA 5CN3A 2B7DT 5L2KD 4ALAL 1WA2X 2B59B 3LAFA 2VM9A 4AYMC 5JQ6L 3JUZA 4OI8A 4WTXA 4R83A 3E8VA 3A5VA 3ZTCC 1YQVL 3IMBA 4KXZH 3QI9D 4Z7IA 2X4NA 3NJNA 5FM4A 5EZJB 3DO7B 3F04A 1INQA 1QW8A 1RZ8A 1T4KA 1WBYA 1YNKL 4NWUH 4XPHH 2FVNA 2F19H 1TQSA 5GGVL 4NQCB 4ZNEA 5JLZB 1ERNA 3QEUA 1A6WH 3UMTA 5GISL 2E86A 3DVGB 4KFZC 3SPJA 2WSPA 5I17A 4IBWA 3EH4B 4RBPK 1GA2A 2RTTA 4PJHE 3FL7A 3ZT6A 1FI8C 2KQNA 4MDJA 4BFJA 2A4ZA 2WMPB 4F15C 4KAQH 4AOFA 4FERA 5JUEH 5ABDE 2DQUH 1GJUA 3MVSA 2AABH 3N9GL 1RK1A 2VN4A 3LNHA 4FEMA 1GMEA 3W9DB 1QACA 5B7EA 1CTNA 4ZFQA 4LCYB 1AGFB 3MJ8B 1WP6A 3SDCC 2OMUB 3OPZH 2DLHA 1S3RA 3QIBB 4Y2OA 3FT4B 3QCUL 4KXBA 1UOKA 1EEZB 2QSQA 1V3JA 3MNZB 1E3FA 2Y2TA 3P3TA 4E42A 1ZSDA 2IANA 4UTBH 4N5UA 1I1AC 1MFCH 5KBMA 3W1ZA 1BZQK 1OF2A 5EIIG 4KKCD 2VDNB 2J44A 3MLZL 3U9PH 5C0CD 3E1F1 4YBLC 4Y0GA 2QPEB 5DEGB 2PMZA 4JCWA 4M1GH 4DNLA 3KZ8A 3BAIA 5CJ5A 4NWUL 3ZVVA 4XPHL 4BKLA 5IT2H 4PJAB 3AU0A 2QPSA 3OC5A 1A6WL 2MHAB 4FHKA 4UYPA 4GG6B 1E9QA 4Y1TA 1OWRM 1QO3B 2XWRA 2E4TA 1XGPA 5D8JL 4LCWE 1DVFC 4DVBA 3MR9B 5DJDB 3DMMA 4MWFA 1MCJA 1AXTH 4A6YB 1E90A 4KAQL 5JUEL 3GSNB 4HJUA 2NW3B 2DQUL 2FECL 4JPWH 4NNPH 5I1AA 5A2LH 5AKVA 5FO8B 2CPUA 2Y5TA 3W11C 4LCCC 4XHJD 2IH8A 1WS7A 4FJZA 4UOW0 5I76A 2GSMB 2WLLB 4DP9X 3OPZL 1XF2B 4M4RB 2VQTA 4JDTL 4LEOB 4LHQB 3WDHA 2H9GA 1O7VA 5D7IB 2GK0B 4ISVB 3ULVE 1S7QB 3VAEA 4XPTH 1IEHA 1MFCL 1JFQL 1MF2L 5EU5A 2DKUA 1F3JB 2G3ZA 4HWBA 4MZ2A 2KPNA 4Z7VE 3UO8B 3VWKD 4JFHD 4LRNH 5FUCE 3UPRB 3U9PL 1CTOA 2OR9L 4K7PY 3MU3A 4A2LA 2BLFA 2BY3A 3DC0A 4M1GL 2AQPA 2VR7A 3MRKB 1BFTA 4KY2A 1A6TA 1BFVH 1KN4H 3I3DA 3QO0B 1MFUA 1HYSD 2A4CA 5IT2L 4XCNB 3O8XD 5DJYB 2C9XA 5KBPA 2VKXA 5K33A 3U0PB 5I16A 1R46A 4KDVA 5EC2A 4HDIB 5C08D 4JJ5B 2NY2D 4JGNA 5JR1L 3DBXB 3FB7A 1QR4A 3V0DA 4P3WA 3RWJA 4WI9A 3G6JE 4WI7A 3STZB 3ZKXB 5DJCA 3WTXA 5HHNA 4POZD 4NNPL 2WBWB 1QFOA 3GSVB 4OJYA 2WNXA 1JI2A 2ZWKA 3T0EA 1YEDB 2V2TB 3FW6A 5E56A 4K8RD 2J43A 4WFHE 3TS8A 1KPVA 3OSVA 1UVQB 1UCBH 2AW2A 4G9FD 1NUFA 1W2KT 4KMQA 2CLRA 3K0WA 1JTOA 3B2PA 3I3BA 5JIHA 4PSPA 3QP3A 3HN5A 2UWEE 2GSIB 4UDTA 4EOWH 5MENB 4XPTL 1N0XH 4JS7A 2CHZA 2V0AA 1PEWA 2BSEA 3LDBB 3KXFA 4LRNL 3T77A 6FABL 1K3ZA 3EO9H 5AUMB 5DJAA 3CSGA 4PRPE 3MGTB 3CHQA 4CW1A 5T1LA 3VD0A 4OIFA 2CR6A 3R19A 2PNDA 5ID1A 1THAA 3W57A 3SE4C 1BFVL 5J3HC 4X9IA 2AVFA 3QUZA 1NGQL 3BSZA 3EDJA 1KIQB 2DYPB 2MPAH 2VE6B 2D73A 4QOKD 3VXPA 2DQGL 4OGAC 5D4HA 3N41B 4N0RA 5E6IC 5E1HB 1YEGH 2EKSB 1DP0A 2Y1VA 1MCPH 4JG0H 2YD5A 2BXYA 4NKQB 1R6VA 2VGLM 3UTQA 3L54A 1AYRA 3FFCA 3B2XA 3UBXA 4PP1D 4B41A 4HIIA 1D5RA 2ITEA 2YSSB 4CC1A 1MEXH 2BP3A 3TVMD 1UCBL 1ZCRA 4UM9D 3RNKA 1P6WA 3U9WA 5SV3A 2WUCH 1UM6H 4N20A 3G5XA 5EUOE 3TZVD 2X4PA 4CL7A 5ANHA 1FZKB 4EOWL 3AW5A 5I6LA 5DD3H 2BCKA 2PWHA 2Z92B 5HGBB 2J88L 2PP8A 3HRZA 3L1EA 1ADQH 3EO9L 1HNYA 4ICWA 4UINH 4KI5D 3RGVD 1EJ8A 5G4MA 5HYSA 1RVFH 1B0RA 5A2BA 3RRQA 3F84A 3QHFH 1UJTA 2MPAL 3D33A 3EZJB 4MNQB 4PIBA 3MRNB 4Z78B 5L0QB 1I1CA 3QDJB 1CDGA 4WVRA 1G7PB 1FL5A 1QNIA 1YEGL 2R1YA 1KTLB 4Z3JA 3WKQA 4G42B 1MCPL 2OMBA 4JDZA 3CFNA 4YSRA 2ICWJ 4JG0L 4P46B 1XL6A 5CJBA 4XAKE 4RMQA 3G5YB 3D12B 5TPWH 4BIKA 1NICA 4LFHG 2CO6A 3H9SB 4YHYB 4K5LA 5K39B 1W0VA 3ZU8A 1A5FL 4D94A 1MEXL 3BFWA 4BKSC 4AV5A 4MQTB 5FB8A 4FNPA 3ZO0A 2BSCA 3X1NA 2NR6C 3LNDA 2G2NA 4Y2LA 5FECB 3O2DH 2EXYC 4IBLT 2WUCL 1UM6L 4UILH 2R0LH 43C9A 2JTDA 3ARDC 2YKKA 4HK0A 2E7DA 1U95A 4UYQA 1JZ2A 5IB1B 1N7MH 4WNQA 1ZK5A 4HIHA 1DYZA 5DD3L 1CXFA 4JRFA 4XAWH 4XNXH 1ASQA 1PD1A 2FLRT 5AZUA 4Z7OE 4MMZB 4JY6A 4UINL 3LKRB 3HG1B 2GJ6A 3VU2A 1B90A 4M4PA 2H26B 1EBPA 3QZPA 3TCXA 1ZA6B 3OGCA 1KXTA 3KR3H 4KU1A 4OLUL 3QHFL 4PG9A 4TXVB 2F7IA 1OGAA 5ESQA 4PJBE 4NN5B 1XCTA 3D06A 1JGDB 1JGVH 3BESR 4YR6B 3LVEA 5E6IA 3ARTA 3M1OA 4K3DH 1MJ8H 1QTPA 5TPWL 4CMHB 2X89D 2A9DA 3GSQA 1MI5B 5D2LA 1YUKB 1A14H 1BP3B 4QXTA 1A7NH 4LGRB 2PPEA 3X17A 3D52A 4ODHH 1NCDH 4IM8A 1K2DB 3GZPA 3L5IA 3GXNA 3N85H 1B6UA 2NDFA 3L08A 4PW3A 3O2DL 1PZ5B 1WZ1H 2RA1A 3OBAA 4OLZH 4HIQA 2F54D 5FW6A 4PVLA 1J10A 2R0LL 5CSBA 5JOEA 3WLBB 4QRRA 3QRFM 3QI9C 4FKHA 1N7ML 2IQAB 5E0QA 1NDMA 1NGZA 2KBGA 3D39A 2RFXA 4WRLA 2FX7H 3LIZL 1T1YA 1I8MB 4XNXL 1TTRA 3NIFB 1A6ZB 1EBAA 1S7WB 5AAWC 2E7HA 4UTAA 1UXSA 3SZKC 4LVOC 4LASH 3UJIH 4IS6A 3DOIA 3S3PA 3BPCB 1I9EA 4FNQA 4Y4FB 1JF6A 4Y5YB 2X6MA 5KOMC 3FO1B 3KR3L 4K23L 3UL4A 3DVFA 5T5FH 2DL2A 4PJCA 1MQKH 4YVNA 1QSEE 5I1EH 1MN4A 4ZUTA 1H0DB 4Y19A 3ESOA 2XWTB 5TJWK 2F58H 3A0OA 4H8WH 4KXAA 5IIEA 3UBXG 3KPNA 2YWZA 4L4VA 2ZX6A 1A14L 1WC7B 3LZFH 4GQPH 1A7NL 3QULA 3ZYJA 5A16A 4ERSH 4JY4A 5F9JA 9CGTA 1CG9B 1NCDL 3DUUB 4S1QH 3VFNB 3VG9B 5HYFA 1BZEA 2P80A 1Z9MA 1WITA 3N85L 3UOAB 3P3UA 2FBJH 4OLZL 4Z95H 3WE6A 4ZMOA 1BVKB 1NCWL 1MAJA 4KKCC 3UJJH 1EA9C 5DC4B 5KSAD 1U8HA 1ZANH 4IKLA 2KUTA 4JZNA 5DA0B 4PTUA 1J0ZA 3V6FB 2IWGA 5F9DC 1HHGB 5IB4A 4Z3GA 1FYHB 3E2HC 1OM3H 2V3FA 4NN6C 1D9KB 5TTRA 3M86A 4X5PA 1KCVH 4JANA 2YJLA 4HU2A 4LASL 4XPGH 4Y5XC 3UJIL 2AJZA 1MFDL 2LHAA 3L4CA 2K9UA 3UTZA 3APCA 5C2BH 2XFXA 4H25B 3LS5H 1NPUA 2HVJA 4PGDB 1JPST 1ZD6A 5BZWA 3TPUA 3K5RA 4PV1C 4GXFA 4RGND 2GY7B 3IFPA 4PRDB 3WI9A 1CQKA 1MQKL 4X0KB 3WBDA 3B5TA 3D0LA 1ZA3B 1XH3B 1GSKA 4FQXD 2R29A 1AXSB 4KKQA 1NC4D 4XHJC 1D5ZA 1FVDB 3BUPA 4OD1H 2DLEA 2F58L 2UXTA 2QDVA 2VO5A 3QR1A 2JKNA 4IHOB 1IGYB 4OTXH 3V95A 2BIIA 4BQ6A 2B5IC 4ZNEE 2LLGA 3MX0A 2WP3O 3CZUB 1RU9L 3ZE0E 1TJHL 4FA6A 4ERSL 3UIYA 2CKBB 1BYOA 4J3BA 2BWQA 4S1QL 4Y1AD 4BDVA 2WOYA 2WNKA 2OJZH 2ZP8A 2AXHA 3GM0A 5F6IC 2P5EA 2I7SA 4JFWA 1U92A 2A9MH 3FU5A 5DSCB 2C26A 1LNUA 1YYMH 2FBJL 4HPYH 4Z95L 1T0MB 3VWKC 3ALWA 5E03A 4WUUD 3ZMEA 5KSUA 3VXRB 1OAUL 2ADYA 3GSRB 2O5XH 1ZANL 5HHXH 5BS0B 5IMKA 3QI9A 3RY4A 2XRAH 3FHQA 1G9NC 5ACLA 1HYSC 1YECH 1NKRA 2H1PH 4E5XA 1ZVSA 3O8XC 2AERT 1KCVL 3HBZA 4XPGL 1JS4A 2YWYA 1NC2B 4P5SA 1XH2A 5C2BL 1FE8L 2HRHA 2NY2C 3LS5L 5DMYA 4UQAA 5I6MA 3D9AH 4PY7B 3D0AA 3QA3A 1W0WB 2X3BA 4Q9RH 4MJ6A 4POZC 2D7QA 3FCBA 4N2IA 5EB9A 1G7JB 1SOXA 2PO6B 4QGTA 4CBPA 2J25A 3N1FC 4LP4A 3FQ4A 3TIDA 2XI9A 5JNYA 4MXVF 1XSIA 1XXDC 4K8RC 3VSTA 4OD1L 2A6IA 1TFHA 1B4LA 4OTXL 3VI3A 4OIIH 4A7UA 3LMJH 2X0WA 3M7FB 4TQIA 4LE8A 1SY6H 3MUUA 3VGGA 1SFDA 1IGIL 3KBHE 4FP8H 2C9QA 3PWPB 4OQTA 1OAKH 5CEYA 3ELQA 2OJZL 1XAKA 2A9ML 1GW0A 1QBBA 2VDRH 3NSJA 1YYML 3NK4A 4HPYL 1ZPLA 2VZTA 4GKNA 4PJIF 1T5XB 2O30A 4DP8X 1YSOA 5TDOA 4QJ5B 4RGOH 2ZXCA 3WSQH 4I2XE 4A67A 5C0DA 1NFAA 2W0LA 2VMFA 5DFWH 2XRAL 5FM8A 3PXLA 1YECL 2H1PL 4JFDA 4NO2A 5KVDH 3PAVA 2YGQA 3FOMB 1I7UB 4QHMB 4F1ZA 4LP5A 1YDPA 3FRPB 4PJFF 4LGPB 5F8QC 2N4IA 4L05A 5JMRA 4K9EH 1FC1A 4AT6A 3GINA 4Q9RL 1QLRA 2JI3A 1T83C 4NZJA 3U36B 5JMOC 4PP1C 5DFVD 1NFKA 3EFOB 3O3UN 3VM7A 5LKNA 4HJSA 3ROLA 4IOIB 1HEHC 2W0KA 4HZLB 4TUUA 1HZLA 4CN6A 3EYVA 3TX4A 4E9TA 4LLWA 3TVMC 3F7VA 4OIIL 4N6RA 4R7NA 1WWAX 2D0HA 3V4PH 4A04A 1SY6L 4IBQA 3TZVC 4FP8L 4DETA 1R33A 5AW1B 4P5RA 1HWGB 3IU3A 2DI7A 4X4YB 5A6IA 5I74C 1NZRA 4NHUA 2E8ZA 1WFJA 1JV2A 4AWJC 3O3AA 5FO9B 2RIKA 1HINH 1HN1A 3TA3D 4NUMA 1OSZA 3B5HA 4OI9A 4P8QA 2IBZY 3VWKA 4K2UH 1YO4A 4KI5C 4RGOL 3RGVC 3ZGIA 3PHAA 4B53A 4LOEA 2WQSA 2PP7A 4MNGB 4U7MA 4ODWA 1YMMD 5ESVB 1P9MA 3AY4C 5A2KH 1BV8A 1CZ8L 3S4SA 3O8XA 3VFGL 2UXGA 3PWLB 3VJ6B 1EGJH 5HHOA 3PV6B 4K9EL 1JGEA 2VMEA 3FT2B 4QYOA 4QXGH 4RFEA 3KXFE 1URIA 4GG8A 4WWKD 1JGLL 3FONA 3FUIA 1AQ8A 2CLVB 3HMXL 4LF3B 3NABH 2O61B 2BNRD 2K9FB 5MP6H 3ECWA 4H88H 2A74C 5E1AB 2HLFD 4ZFGL 4OV6F 3VFPB 3HIZA 1JRHL 1L6XA 1E5YA 3WY2A 3QUXB 4HUNB 1H3TA 2PP9A 3J8F7 1S7VB 3H9ZA 4DCQA 3TBBA 2I9LB 3NN8A 1I7TB 4AL8C 4YSCA 3ML8A 1BA9A 3SSGA 3W0WD 2UVFA 1TZHB 4ZS6C 3TLRA 3FFCE 4J5VA 3D85B 1D6VH 2CZNA 2WLIA 5HVHC 4RQQA 5I0DA 4K2UL 3DO3A 2JQAA 3AB0B 3CVHB 3D05A 4WW1A 4GFXA 3AWFA 4TYUA 2C4FU 2CH8A 3K8LA 2CNYA 4Q9BA 5EU6D 5AVVB 1N2RB 3NJFA 1I53A 3RWCA 2FH8A 1M7DA 1Q9LB 4RMWA 1E27B 1EGJL 3APNA 4JDEB 2Y5QA 3BSGA 4G7VH 4QXGL 4AUUA 5IVXB 5JHLL 3CFIC 3SGKA 1KC5H 2QT6A 5ICYA 5EORH 2FT6A 1LO2H 3GJEB 1T83A 3NABL 4FGMA 4PJ7E 4IEFB 4P4KD 1JD7A 4PJ5D 1IL1A 3GEFA 5ID0A 4M3JA 3QXDA 4MNHA 3EOAB 4PH8A 2ZX7A 3NFNA 4W9FC 5TDPB 1IQDB 5F1NA 1MRCH 5DJ0A 2VERA 4NWTH 3TH3T 3ZK0A 2D7OA 1U8CB 5BPPA 1HKFA 3TZVA 1P5UB 5GRWA 5K9JH 2Q8BH 5B8CB 2P8PB 1XV8A 1XF3A 3ETBF 5AVRB 2ZE0A 3VSUA 4LL1A 2YLKA 2X4OB 3FB5B 1CXHA 1LILA 3KWXA 4MDRA 3T3MB 4AUYA 1TT6A 4AQAA 2XQYG 4DKEL 2XVKA 3FQWA 2ZYRA 2ZWNA 3RGVA 1EAJA 3BDYL 5D2NB 3K81A 4V11A 2ENYA 4NFDA 3BWAB 2X53A 3C5ZD 4KH9A 3AC0A 2EYRB 4P2OB 4PRHE 3G9VA 3AY4A 5BOJA 3B6SA 4CDGC 2NNFA 1QSVA 2QSTA 1DANT 4Y16B 1OZUA 3CV5A 3GMOB 1E7VA 4G7VL 4XO5A 3PL6D 5JQIB 1KC5L 5EORL 5K9KA 2XU9A 1LO2L 3BGAA 2F0CA 1N10A 4JAMA 2Y7QB 5KZCD 2GJ6E 1IZKA 1FV1B 4F24A 1CFNB 2FO4B 5IOPB 4J1UA 5D1ZD 1XAUA 1SOKA 4I9XA 4PJGA 4Y7OC 4LAJH 3QQXA 1KDJA 1MRCL 4KGLA 4NS0A 5IR1A 1T66D 4NWTL 2XICA 4JRXB 2IQ9H 1ETZA 2VAAB 1IBDA 2NQDA 4OCWH 4EAEA 5KSAC 4JN1L 2R2EB 4DEPB 2Q8BL 5K9JL 5I1DB 2RB8A 3QZLA 4KO5A 1A4AA 2WIMA 4FJ6A 5FKAA 2QELA 2P24A 4RAVB 2YPVH 5D2LE 1QLEL 3QUHA 5KVFH 3QJHB 4HEPG 4NFCA 1TZIA 2BHFA 4Q89A 4GSUA 1QP1A 3CFDB 1W0YT 3L3OB 3FPYA 2K6WA 3P3YA 5JW4R 1YC7A 4RGNC 1MWAB 5I71C 3C2SA 2AITA 3MLTA 2BP8A 2HKHL 1XWVA 4JMNA 2CJTA 4QRFA 4N2GA 3D39E 1UZGA 3I02B 1G7LA 3EHBB 2VDPH 4WJ5B 5E00B 1FL6A 1WAPA 1OKEA 2WXRA 3O11A 4HG4J 2XWJB 4HJGA 1FO0A 2J1KA 1EANA 5HGHA 1T6WA 1ZTXE 4YXKH 3TO4D 1M7XA 2Z9TA 3AQYA 5IOKA 5T1DH 3LNFA 4LK4A 3T4AB 4PJCE 1TJIH 3UERA 4B27A 5KN5A 2CR0A 4NDMA 1BBJB 3JV5A 1N8OE 4PGBA 3K0YA 2IQ9L 2A2QT 2F54A 4LQFH 4OCWL 5DFTA 4Y19E 3NQKA 1DVZA 2C9RA 3IRPX 5EBLA 4AG4H 2VYRE 4P3CL 1VKXB 4IGBD 3JZYA 1SUJA 1O75A 2YPVL 2IOOA 3B43A 1S8DA 3UP6A 4L4VE 1F3RB 2OKMA 5KVFL 1ASOA 2VLMD 3LS4H 3T4YB 1QSFA 3DGGA 1QRKA 1N4XH 4KHXH 1K8IA 4LLMB 3OKKB 4U1HA 1O5PA 2X10A 2G9HB 4O5LH 4Z7UF 1P7QB 3KBEA 5DWUL 1FLTX 2XPZA 4UDUB 1QQDA 1KNOB 2H45A 3A4EA 2VQUA 3MCLL 4MMXB 1G1YA 5J6SA 3T0WA 1HJCA 2VDPL 3FTGB 3CDGA 5F9WB 3P4LA 5IZ7A 4MA3A 1NGYA 3E0GA 3QPXH 3L48A 3LQZB 3D3VB 4PGCB 2ENPA 2VQ4A 2YFOA 1Y18A 5I0YA 2I25N 1IJ9A 4YXKL 1X3DA 4DF9A 1F02I 5T1DL 3VXSA 1U8JA 3L2MA 4KK9D 1WFOA 1H9VA 1TJIL 2X09A 3D07A 3LTVA 4X9HA 1AGDB 1W80A 2VW4A 3WS6C 3DV4A 3NCMA 4UUJB 2YMXH 3ZDXF 3KAAA 1OAZH 3UJTH 5IG7A 4WTZG 5DHDA 4BWTA 3WJMA 4AG4L 1VFBA 4NRXB 5KSAA 3BAYA 4X5WA 3KWWA 4BK5C 4HSAC 4GSRA 2FWOB 2WVVA 2H0JA 3QUMH 1RLWA 3QEQB 2H2SD 3EIFA 1OV8A 2NPLX 3PU7A 4P5TB 3PS6A 4KTGA 2UX6A 3LS4L 3BUTA 1NCBH 1N4XL 4G71B 1IC5H 2J21A 4WI4A 2AJVH 2ADIA 3ISWA 1E5BA 3KJ4C 2XT1B 4EQ2A 1R24A 4LNVA 5E2VH 3GIVB 4M9OA 4NO0D 1E2VA 4KK6D 1UXWA 4M6OH 4OF5A 3F64A 5DFVC 5ADOH 3O41A 4R5XA 4FG6D 5KYWB 1FP5A 3Q48A 1ZV2A 3RUGF 1QI5A 4IIQA 2QGCA 1NC4A 3DROA 3QPXL 3U0TB 1IBGH 1BIIA 1R5VB 5DLMH 1DLFH 4CC4A 1U8IA 2WXHA 2OW6A 3P73A 1T1XA 1P7KB 2E7MA 3CH1B 1N64H 3L5HA 3KYKH 1CYWA 2QKSA 1FN4B 1KBGL 1X44A 4Y2NA 5DZNA 3U4EA 3MRJB 4Y1AA 3WEBA 4AM0Q 3DVIA 1YPZF 4ORGA 3NACH 1NL0L 3TA3C 5IUCA 2FNWA 3IYLW 5DJZB 2YMXL 1OAZL 3UJTL 4F7CA 4Z7VB 3N2JA 3RI5K 1HHIB 4PWKA 5F96H 3ARZA 2WIIB 4IBZA 5C07A 3QUML 3VI3E 4AVIA 4K3JH 4HJ1A 4U1JB 5HDBF 2J1XA 1X4YA 4YBQD 3C5SA 1NCBL 2BNUA 3MV9D 1IC5L 1LE5B 1ONQA 4RMSA 2JIXA 2LFEA 43CAA 1XGZA 4TVUA 5CILH 1Q94A 2N7BA 5E2VL 2Z7UA 1MPAH 2I32A 4FQ2L 4WWKC 5HJ3B 4JKKA 4RRPA 3SDYH 3WUZA 1Y1UA 2X6AA 4M6OL 1M71A 3U46B 5I1IH 1BG9A 1U3HD 3G6JB 1WA1X 4WGKA 4L18A 4XODA 3BKYL 1U21A 3NCYP 2HLFC 2FNBA 3MGOB 3VD4A 2MCG1 5DLML 2OW7A 4FADA 3OXSB 1PX8A 4K7FB 3PABA 4EQ3A 3BEWA 4EI5B 2ATPB 4Z77A 5JHDB 1N64L 3MCKB 3KYKL 2GHZA 3CVDA 2C1PB 3SO3C 1DDHB 3U30C 1AACA 5IK3B 1HNFA 4PWIA 2I26N 4N2EA 2DIAA 2EINB 4BKTC 3NACL 4K71C 4TPRL 1NCAH 3UIZA 3WS6A 4YNYA 3W2DL 3I75A 2E9IA 3KCPB 1G7QA 3P4MB 3C6EA 3GMPB 5F96L 3IGFA 3C5XA 4PRPB 3C75A 4NQSA 4Y2DA 2KMWA 3BVDB 1CGTA 4AUJA 2ZUXA 1VHPA 1AGBA 4U1SB 4XN1A 4B95C 1UOLA 1SJHB 3AT9A 1X5MA 4E41A 4XBMA 1DVXA 3ATDA 1F11A 1ZXQA 1CIUA 2NY1B 3MROB 3GS4A 5CILL 5B3SB 4QTHB 5D4JA 1B3IA 1TQCB 1MPAL 2NY4D 3BQUD 1J8HA 2Y5EA 4MBRA 3SDYL 5T3XD 4AJWA 2VXUH 4IJ3C 4RFOH 4JFHE 3DDGA 5I1IL 1DZ0A 2XYCA 4P4KC 3RVUD 3SDXF 2Z8RA 4TLUA 1RJZB 3ARED 5ICXA 4AIZA 4U7SA 1ZGLB 4U1GC 2IMMA 3G6AB 5H4YA 1KBWA 1JUFB 4YOKA 5DZAA 4P2QD 1KLUA 1VADB 1O7DC 1V54B 5FDYA 1S78D 2GUYA 3ABKB 4N5EC 4LSUH 2YD0A 2WVSA 2FRGP 5DQJA 5LGJB 1EXGA 3KPMB 3MLVH 5I8KL 5C08E 1JI1A 1UATA 4Z5RB 1WO2A 4HHWA 2OCCB 1EUUA 3KVPA 1WAAA 1FG2A 5FWRA 5I1JH 3W56A 3RY6C 1NCAL 2EICA 1XD0A 3EH3B 2OR8A 4NUJB 5IHHA 1CVRA 2CLZA 4NT6A 5J57B 3TA3A 4UB0H 4LVNC 4JPKH 4FYTA 4G8IA 1ZKAA 5DRXA 4MSWB 5GRYA 4LLAA 1CD0A 3KPPA 2FR4A 4G9FE 3C5ZC 4LEEA 4AJVA 5CAYB 1XTMA 2OMYA 5FWQA 2J56A 4WI6A 5C09D 3S8GB 1KB5L 2CDEB 5E8NB 4FQJH 5D7HA 4ECNA 4F8NA 1E3XA 4JPIA 2D9CA 2PCYA 3PL6C 1UURA 1OCRB 3CU1A 4KMTH 2XKNA 1QHPA 4XRCB 2Q6WA 4NERA 4WWKA 1C5DB 4RFOL 4OAWB 3N5AA 4X9FA 4MD4B 3WTWA 2BY0A 4MJ5B 5FYKD 4KHTH 5I9QB 5HTSA 1H3PL 2X6BA 4TV3A 4W4NA 1AR1B 4P3DB 5IJVB 5D1ZC 4A55A 2BNRA 2X4UB 4URTB 4X83A 1YRKA 1NEZB 3PREA 1H19A 2CBTA 4GRWH 1NCTA 4G6KL 4WSKA 1DQML 2OX5B 1T66C 2ZWLT 3KYMB 4QOKE 1IO4C 4LSUL 3CN0A 2NCMA 3MLVL 5E6YA 3U82B 1JV5B 1NH6A 3W0WA 1XGTB 1BQHB 5GXBB 1DVSA 4PMFA 5EDXA 5I1JL 3ZTNH 2VIRA 2XETA 5AW7B 4CSPA 1NWOA 2Z35A 2ED7A 1P1VA 5K59F 2PTUA 4Z7OB 5JXEA 4JPKL 1J5CA 2ZZUT 3LN5A 2C9PA 2DBLH 3QK0A 4QHUB 3OR6A 4UZUA 4OW6A 4XH2A 1DJHA 3V4VH 2V5SA 4OF0A 2R4RH 2YK1H 4R7DA 1DQJB 1A22B 4OLXH 4XOBA 5MEPA 3IRZA 1QZNA 2WYZA 5EU6A 4FQJL 2PYFB 3TO2A 2ZF9A 2P4AB 3MNWB 3E38A 1DSFH 2ZD0A 4KMTL 1RZGB 2F74A 2AQ1A 5LHDA 3SE6A 4RRPG 3CIQA 2FQFA 2VXQA 4BSJA 1AIFA 5DD0H 4KHTL 3ARGD 2W07B 4KI5E 3TO4C 1MHEA 3B8SA 4NUPA 1N6UA 4EI6A 5CN1A 2A83A 4CVXA 4GRLB 3IXTB 32C2B 1J9RA 4TNVK 2D3NA 2WBXA 3ERXA 3MFFA 3D2UD 3T0DA 2NW2A 1QLEB 2B4CL 2FE0A 1U2YA 2HKFL 2ICCA 1RP8A 4IGBC 4ZOAA 3VW3H 2G5RA 5I2IB 4M03A 1NEUA 3ZTNL 1XF4A 2QSVA 5DHVA 1EFQA 1D7CA 2G0LA 5BZDA 1M7IB 1SOQA 4PWHA 3RY6A 1M6UA 3VNYA 5I8EB 4X9YA 3BOVA 4J8QA 3GUFA 2JJSA 2BS8A 3PWNB 4PJ9B 3V4VL 4ZG1A 5CUSH 2LU7A 1NM4A 3TC9A 1UWFA 3BZFB 1HCFX 4OLXL 1S9WB 3C5ZA 3BLKA 5EIVA 2HLAA 5DRZB 4LBEB 1CBVH 3DX2A 5KS9B 1QSEB 3MPCA 4KRMB 1RPUA 1DSFL 1PTZA 2HJKA 3S97C 2DWDA 3PL6A 4OBSA 3PRZA 1NBZA 5DD0L 1J86A 2VH5L 3JV0A 3MJ9A 4I5BB 2NT0A 2PABA 4GRMA 1J0KA 4DKTA 1FFNB 2QVTA 2YXVA 1V7NH 1BHGA 1P4IL 2AV7A 2JV6A 4KK9C 1SF5A 4L48A 5D1ZA 1ZV9A 1GH7A 3RVXD 3DO4A 5FX3A 1FNGA 3VYPA 1SVZA 4XN8A 3PAZA 3U0WL 1L9TA 3EOBA 3K72A 3EJRA 4PQXA 1IAIL 3VW3L 4FG0A 3APMA 2W0FA 2YEZB 1QFWM 1OCWH 5GS0D 2H2SC 5ICZB 2BVUA 4MQ7B 1GYCA 3GLAA 4NZUH 3WDJA 3QWRA 4PBWD 1DSYA 3DV6B 1FNLA 5CD3A 1IZJA 3HFFA 3SY0B 5AW4B 5IF0A 2GKIA 5B1JA 1PKQA 4AMKL 4OUOA 1EV2E 2JK5A 1U8QB 1YY8B 2FIKA 1SDDB 3Q2LA 5KW9H 2HUEA 2N1KA 3NOIA 2BIHA 4KK6C 3GMNB 1LO4L 2F54E 5DJ2B 3TT1H 4C83A 4FG6C 4IU3A 1T7YA 3K3QA 3NYKA 3FU0A 1PMYA 3WNMA 1YY9D 3TN0D 1C7TA 2XTJD 4KMLB 4V33A 3WKMH 4WK4B 1HH6B 4G1MB 2PYEB 1QKZH 4P9HL 2AGJH 1YEEH 2GBUA 4NJAH 4GLRH 1HXMB 4X6DB 2DEYX 1V7NL 1OAYH 1MY7A 1IU1A 3HZYB 1VPOH 2WGXA 4PJDA 3HAEA 1Z9SA 1IFHH 3ZE0B 4NOBA 5I73B 5GS2D 1AD0A 4MYWB 2Y25A 4HKZA 2Q5BA 1LXMA 4ZMAT 1T3FA 2CO1A 5DRNA 2F1AA 1TETH 4OM1L 3K71B 4AEEA 1A4KB 1FNFA 4AYDC 5JIKA 1P5VB 3DSNB 1LEGB 1OCWL 3NZHH 4PJEA 1HILA 4E9WA 3CHRA 4YBQC 3TNMB 3FSWA 3FF7A 3QWOB 3TIEB 4KJWD 3RZWA 4WY7H 5KBKA 1BVOA 1MCIA 2VR3A 4HXAL 5D7KD 2GIYA 3J2PA 3QG7H 3C60D 2EXSA 3X13A 4EIGB 3NCXA 5KW9L 2A7BA 3Q3GA 3QS2A 2A6DB 2NTFA 1JIBA 2HMID 3TT1L 5GIRA 3G7TA 1YYLH 1U3HC 3OQRA 3B9VA 3V7AG 4LHJB 4DN4L 2YD9A 1KJ2B 1U8LA 4KRLB 4OD2A 5TGBA 1JZFA 4DEWA 4N2LA 4HK3J 5JW4Q 1LM8V 1QKZL 3EJYD 2AGJL 1YEEL 1IAMA 2XWXA 1JPGB 1ET8A 3MO1A 5K69A 1IAOB 1AI1H 3EYOA 1VPOL 4HXBH 5IMOB 1E9QB 1KOAA 1XR9A 4U1LB 3N55A 3WO4B 2BX5A 1K5NB 4K5NA 4EI0A 3IU4H 4RGNE 3QYNA 1WE5A 3QDMD 1SXSA 4QLWA 3QUMB 3VDCA 2MNJB 2BVQA 3L1OH 5AZEH 3HS8A 4I87A 1OVZA 2WQXA 1PZSA 2ZXDA 4Y4KB 2ODIA 5LAXA 2TAAA 5ALBL 3ECUA 4NM4L 2JCCB 2YAOA 1E5CA 4I2XB 2DWXA 5FA4B 3KM1A 4YDZA 4GW4A 1SXAA 5I5RA 3B2UD 1IGJA 4WY7L 1A1NA 1F18A 3V5DB 4Y1AE 4FTVD 3QG7L 1AYOA 4ZPVB 2NY4C 1JCVA 5EPMA 4NQVB 5BCAA 3RL2B 2H3XC 2YGPA 5F7DA 4NO0A 3T3PB 1HHHB 4E0RA 1YYLL 3TU6A 3HBQA 4E9SA 3RVUC 3FRUA 5C0AA 5C07E 3IJEA 4RAHA 2BWDA 3AREC 2BCMA 3FF8A 2XTLA 1KTBA 4FZ8H 4KJPD 3KPRD 2D3VA 2YUXA 4N0UA 1AI1L 5B4MD 4DHLA 4OVVA 2LU5A 4HXBL 5B1KA 2NYZA 4OGXL 4LEBA 4U2YA 3VFUA 4Z7QE 2YC1A 2W38A 4G59C 2Q7AA 3IU4L 2VSMB 1DFXA 4EO5A 4BQ9A 2BSSA 1TVBA 3L1OL 4HV8B 2Z1KA 3LY6A 4F15B 2W81C 3ME0B 3P69A 2YOAA 3AQXA 4B97A 4MXWL 2ZUVA 2B2XL 1SYSB 5DEJA 5I18L 3ZDZB 1T1ZB 1SOSA 2H3KA 4NAJA 5F8RC 5AZ2H 1CK0L 3REVB 5LXVA 3SDCB 5SX5H 1AHWC 3K7UA 1CQYA 5H2BA 1IX2A 5CZXD 1BF8A 3MV9A 4HMCA 1LMKA 5FUZH 5JXAL 3KW8A 2XV6B 2HVKB 3S3JA 1IVLA 2AQNA 1LL1A 4ONOA 5KUMA 5I8CB 1TVHA 2AXGB 3P11H 1W8OA 1Q0YH 4HGKC 3P54A 2WXOA 1I1AB 3Q2CA 3QDGA 1WVZA 1P4LA 1R1CA 1F90H 4PCYA 2WTRA 5EN3A 4ZPTA 3SKUD 3WE1A 4OFVA 4YXLH 4JKPH 4NKIH 4YBLB 1H6FA 4PVBA 4FZ8L 5DRWB 1ZVYA 4GW5B 4N2HA 3JWNG 3OD3A 3QEHA 4ZMLA 3G3LA 5IVZA 4XB3A 1CF1A 2K1MA 4H2CA 3PG2A 4GBXB 2TSAA 3CDCA 3ATAA 1A66A 2V6HA 2BVEA 3GD1C 4Y7MA 4YHNA 2ERJC 2UUDK 4PS7A 4I9WE 1G9NL 3QYMA 3WXVH 2QLYA 3SY6A 2BVOA 4S0SD 2Y07H 1DVFB 1PLGH 2BRQA 1KCRH 1MJUH 4E9XA 2Y0SA 2EIZA 2EEDA 1KB5B 2HG5A 3HG0A 4KV5E 1EAPA 3K4AA 4LCCB 4ZOEA 4OZGF 1OP5H 4BUHA 1ZXKA 5C70A 1FFQA 2WXNA 4I4WB 1NAMH 1PKOA 4TSAH 4K8RL 3NZ8B 2WAHA 4FA7B 1IM9B 4L5FH 1Q0YL 4YAQB 4RISH 3FFDA 1HQ4A 2B8OT 3ARGC 1ZLWK 4WJG3 4PB0H 4JCLA 5B3NA 3VXNA 1TTUA 2Z31C 1T6BX 4JKPL 5C0IB 4EVNB 4NKIL 4PJ7B 4CAGA 1YMME 3AREA 5CP3H 2KERA 4I1NB 3S2CA 1KBBA 3VFRB 1W6WA 1GMIA 2CGZA 4H4NA 4G1EB 4F3FA 4LDLB 2VLKD 2YKLL 2ZOLB 2H2PD 3PNWA 4JHZA