2J2ZB

X-ray structure of the chaperone papd in complex with the pilus terminator subunit paph at 2.3 angstrom resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
150
structure length
150
Chain Sequence
b'RAAFHGEVVRPACTLAMEDAWQIIDMGETPVRDLQNGFSGPERKFSLRLRNCEFNSQGGNLFSDSRIRVTFDGVRGETPDKFNLSGQAKGINLQIADVRGNIARAGKVMPAIPLTGNEEALDYTLRIVRNGKKLEAGNYFAVLGFRVDYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE PROTEIN PAPD
publication title Molecular Mechanism of P Pilus Termination in Uropathogenic Escherichia Coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/surface active protein
total genus 18
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2006-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 2j2zB01
4XOCA 4J3OH 4J3OG 3ZL2A 4CA4A 1PDKB 5F3FA 2VCOA 2J2ZB 4CSTA 4X50A 2JMRA 2UY7B 5IQNA 4XO9A 5FWRA 5CGBA 3RFZA 5IQMA 1KIUB 2XG4B 4AV0A 4AV4A 2WMPB 5AALA 5FX3A 4AVHA 4AUJA 3BWUF 4CSSA 1N0LB 1ZE3H 3JWNH 5AB1A 3JWNG 4XOBA 5FS5A 3MCYA 5LNEA 1UWFA 1N12A 4AV5A 5FLUA 4AUUA 4AUYA 4XODA 5LNGA 3JWNE 4AVKA 2JTYA 1QUNB 4BUQA 4X5PA 3ZL1A 4X5QA 5AAPA 4ATTA 1KLFB 5ABZA 4XO8A 4AVJA 2W07B 3ZPDA 5JQIB 5IQOA 2XG5B 3BFWA 1TR7A 4AVIA 2UY6B 3SQBB 4J3OF 5F2FA 3ME0B 4XOAA 4XOEA 4X5RA 4LOVA 3BFQG
chains in the Genus database with same CATH superfamily
2DYPA 3P9MB 3LB6D 3KPSD 4D2NA 2N59A 3KNBA 4GUPB 4FFYL 2VXTL 3I2CL 1IGTA 3W82A 4W9LC 1UXWA 2D03L 1YY8A 3PDOA 3I6KB 3RPBA 2SEBB 1ADWA 3DSFL 4PJBF 4E42A 1HT6A 4I1NB 1JNNL 4MA8H 3KBHE 3QUHA 3CTTA 5CGBA 1V05A 1OLLA 2GSIB 3BD3A 1DUYB 1R6VA 4PEEA 1AKJA 4YSEA 4KZDH 4PJFB 3MRMB 4NN7B 2HFEA 5ICYA 3O41A 1AHKA 2KZ1B 35C8H 3ABGA 2AQTA 1KIUA 1RUQL 4OI7A 4ODXB 1XBDA 4KTEH 3UAFA 5HYEA 4JFUA 5B1BB 5DEFA 4YUEL 4L5FE 3CDZB 5AAWC 2FYVA 1CI3M 1AD9A 4LP8A 4NJ9H 3L3HA 1EHLH 3MJGX 3QSKB 3FZUC 4F7MA 5FECA 5KVGL 1A64A 3WJLA 1B4LA 1M7DB 4YDJA 5EV7A 5C1MB 1JYXA 2BM3A 2P7TA 2VSMB 1LO4H 2JJSC 5DD0L 5JHDA 1XSOA 2XXGA 4MJID 1KB9J 2E9BA 4S1RL 4JO1H 1XCQA 4PR5A 5FYKL 1SXAA 3SDAB 3ARGD 1JZ5A 3OHMB 3EFDL 5I0XA 2C3XA 4CVZA 2ICWB 3A4DA 3INUL 4LPVA 5FFGA 4OIIH 1ONQB 3NDZE 3CX2A 1FWXA 3T0EB 1AGBB 4X5PA 4K3JL 4TNEA 2CJ3A 1R3IH 1BX2B 1XH1A 5C09A 1KJMB 1HQRB 3N9GH 4PRPA 5SWQB 4U4BA 4CJ0A 2X53A 4XX5A 1EEQA 5I19H 1JGEB 1HH9B 3F7LA 1BW8A 4YXLL 5GGVY 1XIWC 2FH8A 4HS8L 4KRMB 1OY3B 5E24E 3TBWA 4XTRD 2PYEA 3D07A 4M6AA 3W81A 2UYLB 4L29B 2A6DB 2CIKA 2H3NA 4XMPH 4AMWA 3DX8B 5I2IB 5IOPB 3VXOB 1QW8A 4OD1H 1AQMA 3ESVF 3ALPA 1E9PA 3OXSB 1E8WA 5BW7C 3OM3B 4GSDH 3GSQB 1UD4A 2AEQL 2WVVB 1A1NA 3BMVA 4OTXL 4ENZA 3U0WH 1YEJH 3K4AA 5FA4B 1BVKA 3B7UX 1EJ6A 3MCG1 3O9WA 2ZG2A 4PLKD 4PW3A 4HBQA 4XCCH 1L9PA 4JN1L 4LZKA 5EUKA 4NM4L 4ZDHA 4APXB 5I1LA 2W9DH 3CFDB 1KLUB 1CDHA 1LVEA 4ZTOH 2XVBA 5I1EL 3OWEA 4UT7H 6PCYA 1O5PA 2G60L 1E6OL 3HC0B 1AGEB 2B2XH 3QFJA 3QIWC 1KEMH 2ZOOA 1WQVT 2LLNA 2RA1A 5KS9E 4WJ5A 2QQLL 3Q2LA 4QF1B 3FCUB 3QWOB 1I31A 4L8DA 5FUCE 3BD5A 4WFGE 1JRHH 4NO0B 1JXKA 1WE5A 1BZ7A 1WBXA 1U8NB 1RK0A 1YYMH 3O2DH 4MCYA 5EEWA 2BNRE 5J1SC 1JF5A 4H20L 1H15A 4NX0A 3LNFA 3MREB 3SJVD 3QJZA 4TS6A 3TL5A 5E08H 4Y5XC 3C5JB 1FAIH 2P8MB 5IMOB 3D2UD 3P30H 4XNXL 4TVPL 3ORJA 4LEXL 3Q9PA 1IZKA 3NZ8B 3O2DA 4Z5RA 4UANA 2VXVL 3RPKA 5EBLB 1SLVA 2HUHA 2YPKA 5EZOL 3V9EA 1DVQA 1NEPA 3AQDA 4M00A 4WO4C 3BWZA 3MO1B 1F4YL 2X0WA 5INCB 1VZHA 1XF4A 1OGPA 2IH3A 1TCRA 1YHPA 1ZLEA 5EMYA 3L7FA 5I71B 2X3AA 2FEDD 1PX3A 1E43A 2IANE 3FHQA 5DWUH 4U1GC 3JTTB 4NDMB 1L7IH 1VPOH 2YD8A 3AWGA 4KDTA 2V17H 4QIRA 3S35H 4PFEA 3ZR5A 3RI5F 1AFVH 4JG0H 2J71A 2BCMA 2H2PC 5L6YH 3CH1A 4BFEA 3SE4A 3ENEA 1NFDF 3MRRA 2AEIT 3GK8L 3RVVD 4XMUA 2MWCA 1J7VR 1F1GA 3AB0C 3UCQA 4Z76B 4HGKC 1JPGB 1DUZB 1X5KA 4BSWB 3D9AH 1G6VK 1USZA 4EI6A 4V2BA 4JFZL 5E2JA 3EJPA 4XBGB 4BWWA 3CZSA 2KI6A 2ZYRA 1CGUA 3OC8A 2F54B 5C08D 2K45A 5J5EA 1MHCB 3BQUD 5K1NA 4CC1A 1KTBA 4GBXC 5T5NG 2A6IB 2EO1A 4HJTA 4V1DE 4U3SB 3D25A 3ZW3A 3IJEB 3Q8AA 3T1FB 5HVHB 4NUMA 2MQCA 3MUZ1 5IJCC 4HZ1A 3QJVB 5HDQL 2EIMB 4Z7NB 5HHPA 1FVCB 4KJQD 1UWXK 4X7EC 3WHXA 3FU8A 4LMQI 4F58H 4ZFOA 3GRWH 3FW6A 2ADGB 4G43B 1KCRH 4U1SB 4EI5D 1OW0C 3DUUA 3RHWF 1B2WL 4JJHA 2Y22A 1KEGH 4RGNC 1FORH 2X4SA 1HYSC 2A9CA 1OP9A 4M03A 4FOMA 4QXUH 2NXYB 5DXWA 3GRWA 4GKLA 4LOUD 4ZW8A 1AG6A 4DKEL 4KNUA 1WC7A 5CINH 2D2CC 2NY3B 1A5FL 4NRXB 1UA6L 1KXHA 3QR2A 3T04D 4JAMA 2WSPA 3N1GC 1JZDC 5IM7B 1SPDA 1A7PL 3TBYA 4UTBL 5FHBH 5AW6B 4PD4K 5ITBH 5GS1C 3MNDA 3HC3L 4NBXB 3S5YA 3FTUA 3KYOB 4I9WD 2C8NA 2HUEA 2ZG1A 1G9HA 1PL3A 1FYTB 1LK2A 3HG4A 2MSPA 2ZE0A 1TZHB 3I3DA 3LDBC 3F2LA 4M6OH 4F3FA 4RAVA 4NKOA 5E6ID 3D3VA 4JY4A 1Y07A 3TEWA 2FX8H 3MV8A 2BCKB 3GMOB 3OL2A 4R0LC 2XVKA 5IMLB 4HIJA 4U2YA 5IBTL 4Z7QE 1WZKA 5JXEA 4XRCA 5HHQA 3MROA 5GRUH 3LRHA 3WL9B 1UEYA 4ZFZB 5IZ7A 4XNUH 4D7BA 3QDMD 1KGCD 1UM4L 3CZJA 4NM8H 5HGDA 1M9SA 2EDYA 2A73A 2Q20A 7FABL 3PP3K 3MRIA 4XXWA 4ORZC 2EVIA 1IAIM 2LLGA 2DQCL 5EH1A 3FN3A 4N86A 5F9OH 5CJOL 1U21A 1GZPA 2EIZB 4NP4H 2IPKA 2VL4A 3U9PL 4QHNA 1CIUA 4W9EC 1MQKL 4FYSA 2ZWKA 4KHXH 1NFIA 2DIJA 3HPJA 4X5WB 4LLQA 5C0AE 3QUMA 1QR1B 1CD9B 2CM5A 1FN4A 3L7EB 1NEZA 4X80L 3WI9A 4AVJA 3IFLL 4F2MA 4U1IA 3W1ZA 4PREB 3QB7C 4HS6A 3KLAB 2CCWA 1JZFA 2XN9A 2BWQA 4U6XB 4KMLB 5CGTA 1AIZA 3LKOA 2J21A 1GIGL 4HUVB 1UYWH 5E8OA 1W0WB 2H0PA 1ZE3C 2YR3A 4AEHL 3FQUA 1SUHA 4KHTL 1HINH 2D0FA 1MY7A 1JMXA 2ZUQB 3IDXH 3BUPA 3IDIB 4JQVC 4M4PA 1RZFL 2DZEA 3AJ7A 4G6FB 2YAFA 1ITBB 2X6MA 3TLRA 4I8DA 1OAJA 4MB1A 4XVUC 1AYOA 3VMPA 5D7IE 3O3DB 3FQWA 2FO8A 4XPTL 1VSCA 2R0WL 1AZRA 2A99A 4H4NA 4K3GA 4X50A 1OSPL 5I8OH 2LTQB 3PL6B 2ZCHL 4P9HH 3MX0B 3UROR 2BH0A 2YSSA 2VR9A 3RWJB 3SIKA 3BGMA 3MODH 3ZTEA 4FNLL 1AXIB 3IJ8A 3WIHA 4BZ1L 4OSUL 2I07B 2VLKD 4JKLA 2A1WL 2IH1A 1JJUA 1IU1A 1MCIA 1GYWA 2VZ3A 4FXKA 4GAYB 4OKVA 1CBVH 3O3AA 4OFQA 3SOBL 3JTSA 1BJ1J 1OTTD 4JFDD 3AUVA 3QUZC 4ZTPL 3S3DB 2QDVA 5HI5C 4PTUB 1UUNA 4Y19A 3KXFB 1S7VB 1XAKA 4EZKA 1MFCH 3PGCB 2H6PB 2XN2A 4YEEA 4PRAA 1PMYA 1QG3A 4BFRA 1JI1A 3H9ZA 1SF3A 1IFHL 5F1NA 5I0WA 2QLVB 4J3TA 3L1OH 1T0MB 3PUUA 5TQ2H 4DPAX 1A4BA 2VGLM 4FZ8H 3KH3A 1AVAA 5LGHL 5F7DB 4KK5C 3PWPB 4BINA 1R47A 5FUOH 4S1DD 3RWCB 4QOKB 1RZKH 4PRID 2AK4D 4LRNH 4RAUA 5HHOD 1A8ZA 3TNNB 5EN3A 1NGPH 1WRFA 3FT3B 2DLHA 3EBAA 4N2AA 1OCRB 1QYGL 2YQGA 2D7TH 3EFOA 5F88B 3ECVA 1AO7A 4J1UB 1ASPA 3GKWL 1LO3H 5HGBA 1FO0L 2ZNXA 5ISZD 3RJQB 1UWEL 2XTJE 4HWEL 3BDYH 2Z8VC 5MEOA 4LDEB 3IETA 4FTVA 3N41B 3ZDZE 4Q0XL 1V7NH 4ZUWA 2EDXA 2CBTA 4MQSB 3D1MC 3KS0J 5AOKA 4OLYL 4QRRB 3WNMA 2V5YA 5SWSE 5D7SH 4ZXBB 1FGNL 2PETA 3FTZA 3V7AE 3E8UL 1FZMA 1J18A 4WEBH 4KRLB 4PYGA 2F5AL 3FT1A 5ALCH 4G80B 4R8WH 2IAMA 5CEXA 1VAHA 3G7TA 4QI3A 2BIPA 4DVBA 1DDHA 4N9OB 3WFHB 5DCCA 3QDAA 1WH0A 5HVWA 1OPOA 1K8IA 2J56A 5HYSA 1YNLH 3VFPA 3VFRA 2AC0A 1ZT7B 4FA7B 3VACA 5CSGA 4X9FA 4NZTL 4N5UA 3GXFA 1MAKA 2HPTA 5IT2L 4APQB 2VLJA 4IU2A 2ARWA 5EIQA 4S1QL 1KWKA 3BUYA 5FGSA 1SYSB 3TVMC 4ELKA 3PHOA 3MGTB 4UB0L 4WW2A 2V9UA 1NGYB 3EUDA 1HIML 1JV2A 3TJHC 5IMKB 1BMWA 1SJMA 4YHLH 5HDWA 4PGEA 3LKPB 3SDDC 1IC7H 1GKEA 1HXMB 3C6EA 4RBPK 2R1XB 4OVUA 5FCUL 4URTB 5IQ7H 2VDQH 4NZRH 3MRDA 2OZ4H 1U95A 3GDBA 4NO2B 4LCYB 1NH6A 4WI5A 1R3KA 3RFZA 4QRQB 4FDWA 1NMCC 3P4OB 3RDTD 3WTUA 2BIOA 3FPXA 1IGMH 3I9GL 3WBDA 3IE4A 5CLYA 2XCMC 3DETD 1B88A 4M8VA 3QRFM 2XBTA 4M48L 2ID5A 4I4WA 1S2EA 4IIQC 3DJSA 3FONB 5EOQL 3GSUB 4GQQA 1FC1A 2WBXA 1E7VA 5CNHA 4J8RB 3ASWA 1MFDH 3OJDB 1NAML 4I18C 1A3QA 2Z8WC 3FMGH 3DSNA 4XOBA 5JZ7D 3KPPB 3C75A 5LNDA 4IMLA 1Y1DA 1E8YA 3V0GA 3UTTA 4NCDA 3HE7C 2NLJB 4Y4HC 3ETBJ 1UWFA 5GISH 5C0RL 5C09E 5EEXA 3G04A 1MUJB 1FQ9C 5I8KH 3HMXA 1U8OA 1YZZA 3DVGA 5L4IA 4D0CB 4I2XA 1TTCA 4QXWA 3HW7A 5CR8A 4DZBB 3QUKA 2P1YA 1JTTA 1CE6B 1M4KA 2XZAL 1BQSA 4PJ5E 1WO2A 3U9UA 4LDOB 3DPBA 1MRCL 5IEKB 3B6SB 3MJ7A 3LXBA 4JRYB 5CSZB 4EN3A 2P5WA 2YGNA 3OGOE 3TM6A 4ZMOA 2KDGA 2QLYA 4Y4KA 1ZK5A 5H4ZA 3ZL1A 1G1KA 3CGTA 2ZCLL 3VG0H 3LIZA 2FB4H 4NENB 4MDJA 1IM3B 1R46A 4P57B 5D1XE 3VFUA 3RB5A 4Z0BL 3ARUA 2FX7L 5KZCD 3QO1B 3ELQA 2R27A 2VZTA 5I8CB 3HC4H 2KUTA 2QSCH 1OD7A 3QXVA 1KOAA 1N0XL 1A1OB 3SKJL 3T2LA 4YZFF 1HHJA 1WFMA 1Q9OA 2QHRH 1MG2C 1T04B 1E2VA 1S7UB 5LAXB 1F97A 1KZYA 1JYVA 1S46A 4UWQB 3BE1L 2DRUA 1AGCA 2OCJA 1BEYH 3TS8A 4C4KO 5JPNB 1MZZA 1QLFB 1CDBA 1OIOA 3FO9B 1R5WB 3IE9A 1X44A 3U25A 5TGBA 3MRBB 3D34A 2Y1VA 1IQWL 4XMTA 2DD8H 5ENWA 3IJHA 2EXYD 3LNDA 1G7PB 4NUQA 1BMGA 2HT2C 3MV7B 2WTOA 2IAND 5AAMA 3NFSH 1TQCB 4FLQA 4KK9D 3AACA 4X4YA 1A3LH 4WFFD 3D08A 4MJ6B 3O6FB 3QZMA 3ZE0E 2Z1KA 4UM8A 3GBDA 5E6UB 3CVHL 4A63A 4AENB 1ROCA 3T2NL 3C09B 1CFMA 1MFAL 1WBYB 2AGJH 4FJYA 2O30A 4ZW5A 4WFHE 3TWYA 5LHDA 4HLJA 2JJUA 1DE4B 3AT9A 2BP5M 1FSKB 1S9XB 4WF7A 1RIUL 3GHPA 1BLNA 1QWHA 2VE6B 1E4XH 4HU8A 3G3LA 2EDNA 1YA5A 4XN9A 3N85H 2J8UA 5L88L 3HHSA 1IJ9A 4C59B 4RIRA 3TJEL 3TOPA 4AXWA 4HC1H 2V3DA 3WDJA 1TVHB 3VXUD 2EIBA 1YEEH 3GT6A 4MMYA 2FQDA 3GJEA 4IRJD 3VTMA 1L0XA 3H3PL 3I85A 3QEHB 1ET7A 2L4OA 4YHML 4HW6A 3D09A 1HH6B 3L81A 2IOIA 3CSGA 2HVJA 1V54B 3C6LD 1M7IA 1P4BH 2AEOA 4V1DD 5EBMA 5F89B 3QZWB 4BRVA 4AUUA 3HJEA 1JCKA 2XWTA 4IRSB 3DX2A 5IB5A 5AOLA 4LEOA 4EO5A 2V7NA 1GTNA 5DQDH 5DT1H 2HKHL 3KEDA 3EFFB 4FQCL 1XCXA 2R83A 1YG9A 1ADQL 3KPOB 2AJVH 2EIEA 3B8YA 4LVOC 4PG9B 2ED7A 4G6AD 4RA0C 4UOW0 1GAFH 1JBJA 3NTCH 4OM0H 4YDIH 2X7LB 2NPLX 5GRJH 3OR7B 2JELH 4P4KA 1EVUA 4FQJL 2HN7A 1AHWC 1I1YA 1UFGA 1NSNH 1MCCA 2JKXA 3DX1A 2JQZA 5AUMA 1M56B 2B15A 1B0IA 2UX6A 3WLWD 4DOHB 2V7HA 3HZVB 3UBXG 3SPGA 4JPWL 5LGYA 3BSZL 2A0LC 4GG6F 3FT4B 4HEMA 5EC2B 3C2SA 3G5VA 1B0RB 2X9ZA 4EUPB 4XNAA 3V4VH 2HJLB 3RVWC 5EUOF 4DH2A 2BRRH 1RL1A 4DGVL 3PNWA 43CAA 2QMKA 2AXGB 4KPHL 2CKBB 5DVMA 3SYCA 3QAZB 2YD2A 2IH9A 1HX0A 3FUHA 4F33B 3D52A 1D6EA 4YIQB 2ZONA 3LMJH 4MCZB 4AE0A 1LNUA 4XC3L 4HBCL 1ZVYA 5HDLA 1I1AA 3TFKC 3LX9A 5F3BA 2MH4A 3CVBA 4Z7UF 1P4LB 2QADB 4JNXA 5EC1A 5FYJH 1A47A 2WWMC 1BBJB 4XBEH 5J4MA 1TZ8A 2IOMA 3CC1A 5IHBA 2Z92A 3QS3A 2M26A 1KLGA 3T0EC 4MXVE 4PUBL 5IHUH 3D3VE 3RDJA 1A6UL 3GMPB 2I7SA 2IGFH 5AOJA 1RHHA 3FDWA 2YRBA 4TTDC 1A6ZB 4H88L 3ZL4L 2O4EA 1QMUA 1HK6A 4UQCA 4XNYH 4HKBB 3ZTNH 4GRMB 2QPUA 2RR3A 5D7EA 5C0AD 1YUKB 1FAKT 3ZRSA 2VERA 3CN2A 4O02B 5F1IB 2N01B 1RULL 3ETTA 4G8FA 1E5AA 1LEKB 2IO5A 3MA9H 3GS4A 3BC9A 4JFYA 1YQ2A 4KRPD 1XGZA 2OTWB 3KPSB 1A3RH 3WGVB 1BZQK 1Z0MA 3KAAA 3TT3H 2RHEA 5L9DL 4UNUA 1UWYA 3U0PA 4JE4B 2X0UA 2ITCA 4ZMVA 2AJZB 1HI6A 2P8LA 1YN7B 1ZLUK 3N3EA 3Q6GL 1MJUL 2EDJA 2EH8L 1N8ZA 3C08L 3LQMA 3PWLB 4X98A 2H47C 4Y2OA 4NRYB 2WLHA 4R2GD 5AAPA 5DEJA 4XVSL 2EADA 4RNRB 5GGRB 3HS9A 5K69A 1UWGL 1ACYL 4YBHA 3FQNB 1QAWA 2DQUL 2DEYX 1GJWA 3F3HA 3HBZA 2NW2A 2C34A 1CFSB 3JUYA 4HDIB 1U2CA 4JDEA 5B1JA 3UYPA 2W0LA 2WQXA 4ZD3H 3HS0B 5JA8B 1IKNA 3PV6B 5GGSA 1XGQA 4M1GH 1LEGB 1TJGH 4LCWB 1PAMA 2ZJSH 1DQML 5BZWA 1JUFB 3V6ZB 2CCLA 5I71C 4PY8J 1S9VA 2B08A 1CR9H 2EKSB 3L8QA 3QUYD 4EVNA 3MLTA 1T5WB 2NYYD 2WZ0A 2YXFA 3BVDB 4HEPG 3X1NA 1RUKL 3OAYH 1J0JA 2QQQA 5DFVC 1GHFL 3WAKA 3ZDXB 3OB0K 3WY3A 4YHNB 1WDAA 3D0VB 3ZKSD 2UXTA 3V7MA 3ARGB 2N1KA 4N8UA 5A2FA 5F7AA 3ARXA 2CK0L 3PWJA 4Y19E 1P6WA 4DP8X 5LDSA 3ZBMA 4LLMB 1P5UA 2AQ1A 5ILTH 4GIAA 4CW1B 2NNAA 2HP4A 1DVFD 5B39G 3TTYA 2W65A 2WUBL 2IPUK 1QLEH 1VZIA 3QP3A 4N20A 4JFEA 3L4XA 4E36A 5BVJB 2I60L 5B7MA 3BCDA 3CFBA 5DS8B 5FGCB 3LH2H 4N1HB 3OD3A 1RK1B 4RZCA 4WTWA 3IT8D 4O51B 3ZZ1A 4HH9B 4GG6B 4FQ1L 3F7YA 3MRFB 2NR6D 3OBAA 2VABA 4OQ1A 4M3JA 3RWHB 1DL7H 3ABKB 1YEIL 2YEZA 5T5FL 1N0LB 3ET9F 4KJWC 5ANHA 5EUOB 3BISA 5BRZA 5IUSA 1YY9C 2HKFH 3BLKA 1FL6A 1IRAY 4QYOB 3ZE2F 2OK0L 4JKMA 3WSQL 1J1XH 4MDIA 4PJAA 2WGXA 4UQIM 3NIGE 1ZLVK 1PX8A 2DYPD 1OAXH 4FTVE 2UUDK 4ABWA 2MRYA 1XGPB 4MXQC 4QHKI 3AQXA 4YHZL 3ZLQC 2J1XA 2Q3AA 3NYKA 1ZOXA 2W0KA 1M1XB 4Z7UB 4PJ7A 4Y7MA 4MD0A 5DRZA 4H8HA 5E8NA 4ZMWA 3KLKA 4ODTH 2G2NA 4S0SD 3KG5A 2NXYC 1MWAH 4ZO9A 2Y0SA 4QY8A 3CZUB 5IVXE 3SE3A 2CHDA 3PP3H 1WBZB 3T77A 3KYNA 4GAAA 3WJJC 5B1AB 3CHPA 1IQDA 2NY3C 1CYWA 3LRLA 4LLUA 4WUKL 4XP9L 2VISB 1CICA 1P84K 3X1BA 3VA2C 1MH5A 1BD2B 1AKJD 1P1ZB 3QI9A 2XPYA 4L9DA 3SJVB 3VSVA 1AMYA 1X5ZA 2JQMA 3RRQA 2D2OA 1JK9B 2PABA 2WIIA 3D2UB 1SLXA 3RL1B 5JMRA 3MV9E 3DPDA 5FGBC 3T65B 1J9SA 3WS3A 4U7SA 2VR8A 4BKSC 5HGAB 1ZVNA 2VLJE 4FNTA 1BZ8A 5T1DL 5IJVB 4HLZH 2B59A 4EUPG 1BQHB 4YWGH 1XFPA 3D6GA 2MKWA 4HUCA 3EG9B 4R7NB 4BK4A 4J4PA 2VC2B 1VERA 3N2JA 2F7IA 1U6AH 3S37H 5EULV 2PPFA 5H2BB 5JW3L 2WY3B 4XNZC 4WY7L 3UYOD 1BQLH 2VAAB 1DN0A 5JHDD 4ANVA 1UXMA 1N59A 2CCVA 2K70A 3VXPB 3QFDB 1T5KA 2F53A 4HUKB 5IBLC 4E9TA 2XQYK 1CU4L 1K4CA 1L0PA 1AE6L 3A67H 3II3A 4YSSA 1YQVL 1IVTA 3LQAH 2YA0A 1Q72L 4G82A 2BVOA 3IFNL 3QPQD 2H1PL 1CT8A 2ZP0T 1TTGA 2C9VA 1AZVA 1EEZB 5CP7A 2XX1A 4QRFA 1RZGA 1R3JB 2LR4A 2WXFA 5C09D 2EDQA 1CXHA 2WKOF 1YECL 3O8XD 1BG9A 2VXTH 3FTWA 4PRPD 3I2CH 5BQ7B 2WQUA 3OZKA 5BW7A 3UZVA 3FSOA 2DWDB 3FB6B 2RFXA 5C08B 2EYRB 2TSBA 3PIQB 4N68A 3BQUB 1JYNA 4Z3EA 1LYQA 3KPLA 1JNNH 2PYED 1S78D 1IBGL 3H9SA 4UIKL 4I2XE 4XPHH 2XNAA 4PBVC 3U48A 4CSSA 3PGDA 2N0KA 2VJXA 4E5XA 5EEZA 1PCSA 1U4FA 5ABDE 4QMEA 1KZQA 4ATWA 4LGSB 4N0UA 3UTZB 3GSNB 4JPKL 4TKWA 1G7QB 3QK0A 3ETSA 2ZCZA 4BA0A 5F0LB 2H1LM 2XZCH 2ZUQC 1SYVB 3O9WD 4TV3A 4F7KA 3SY0A 15C8H 3IJSA 4YUEH 4LF3A 5IQLA 4PHXA 1ZLDA 4EI5B 3QFJD 4H1LG 4Y5XA 5KVGH 4KGLA 4PJDF 2EC9T 4KC3B 5E1IA 4NSKB 1BFOB 2LTQC 3PL6C 1JK8A 4XNMB 3U7YH 4O58L 1ZVHA 3REWA 4R4BB 1Z7JA 1XZ0A 4O9HL 4S1RH 2ZSVA 5HGGS 2I5YL 4X6FB 4XCFL 2OW6A 3LYRA 4TSBL 5FYKH 4A7SA 4PMFA 3N55A 1CLVA 2LW3A 2BZ7A 3K6OA 3MYJA 5IR1B 1INQA 3EFDH 1EO7A 1DZBA 1FZJA 4XX1E 3NQIA 3GMLB 3INUH 3KGTA 1QPPA 1DCEA 3CPLA 4HKJB 4TM9A 4G42A 3T6VA 4XPGL 4K3JH 2FJGA 3P11L 3CVDA 4U0RB 5E6IB 4O2CB 4J28A 3R1GH 5F44A 2XWBA 2J25A 1QTPA 3FT2A 1K8DA 3WCYA 2ADIA 2XA3A 4GMSL 4BYHA 5DHMC 3VSQA 4HMEA 3DVNA 4HWZA 3ZE2B 3TBSA 5D6DA 4RWYL 1TLKA 3U9WA 3CXHJ 2ITEA 4WFHD 3VXNA 4G9DB 2Y3AA 4HS8H 4PRHE 2ZSWB 3GPEA 4XOCA 1OGSA 3QDMB 4RFEB 1XQ4A 2IDCA 1HXYB 2CXGA 4Y8AA 4ES8A 1S6NA 1CTNA 2CNYA 4JGNA 2E7HA 1N3NB 4KY2A 4D0BB 4UAOC 2JF1A 1VKXB 1KSRA 4AZ8A 2GUYA 4QHMB 5J3HC 4NN5B 4POZC 3FC8A 3SKNB 3K6IA 3RILA 3MRKA 4DGIH 1HOCB 4NM4H 1QWUA 1FLRL 5EU3A 2ICEB 1X5MA 1F11A 4N5EC 4QXTA 3T8VA 3KBFA 4W9JC 5I1EH 2XFXA 4XWOD 4PTTB 4RBPH 1KTDB 4IBSA 1RH8A 2E4FA 3EYFA 2Z35A 1OP5K 3L2LA 4KI5E 2DMCA 4MB5A 4ZXBC 2YGQA 2H8PB 1JP5A 1VCBC 2R1WA 1MRFL 5E9AA 3EDFA 1ZGLM 2E3VA 1JXDA 4U6YA 1KGJA 4YH6A 2ED9A 3FYIB 3DO3A 4RESB 4MRBA 3ZYOA 2ZQKA 4H20H 2NNCA 3U7AA 2Z4QA 1A66A 3FOMA 3QEUB 2OS7A 3WFZA 5IHHA 1XTMA 3PABA 4TVPH 1E8XA 4LEXH 1NDGB 3AVEA 4NT6B 1K72A 1U8JA 2VXVH 4JPSA 3LH9A 4C83A 5AB9A 4APQC 2HLFC 2DJ4A 3ATFA 1FJ1B 2YXVA 1S7WB 5JHBA 2J1YA 3W11C 1F4YH 2BSCA 2YKKA 5KYNA 2F58L 1FVDB 2XUWA 4C58B 4HK3N 3F7PC 1ITCA 2X4RB 3FN9A 2OR7A 3R06B 4HEME 1FRGL 2VZOA 2ATKB 1RJZA 1H3UA 4BUQA 1I8IA 5MP6L 3ZSTA 2VLKB 5C07E 5LVEA 3MHZA 1FV1B 1I8KB 4L37B 1J10A 4FNUA 4JFDB 4HPHA 2RH0A 4F57H 2VZVA 4XPAL 4XCNA 4N8CL 3GK8H 2OJEB 5KS9F 2BIIA 2BSEA 2FZ3B 2V3FA 1GW0A 3QISA 2WVTA 3D3VD 4CILA 3WO4B 4MB3A 2CRZA 3MV8D 4LPUA 5A2BA 3EJUA 2EDDA 3X2QB 1GXEA 2F2HA 3OX8B 5G5DA 5JXED 4Y2NA 4KKCD 4KX8A 2YJLA 3BVWA 4W6XB 4XXCC 2J6EA 4PRIB 2AK4B 4WUUB 1Y6NR 5FYJE 4YPGA 1G4RA 2GCYA 3KDPB 3TTSA 4UM9A 1OE1A 4U0QB 1E9OB 5GSRA 4DO4A 3W0WA 1TQSA 1ZJAA 4R90L 5HDQH 2CBQA 2E75C 4PJDB 4B9JA 4G5ZL 4BRJA 3O2VL 3SGEH 3UBGA 1EHAA 2X4PB 3BPOB 1OV8A 5DHXB 4ECNA 4F5CA 4ZPTB 5CIPB 1KYOJ 3U7WL 3FTGB 5ISZB 4OIFA 1X5YA 5DURD 4MZ2A 4LSPH 3L5IA 4OJYA 3TBCA 3WNPA 1AR1D 2EDKA 3WXWL 1OZUA 1CGSL 2Q8BL 1YLBB 3HEIB 2XY1A 4J2XA 4GI6A 3NAAL 1ZGLB 4DAGL 1TXKA 4HV8A 3L4TA 4DP4X 1T22B 3M46A 4YXHL 2DBLL 5MI0B 4OFIA 2GTWB 3UDWC 3WE6A 1KF9B 1QBBA 1J0ZA 1ZT4A 4DKEH 1FH2A 3S5LB 1MCKA 5ID1A 1A5FH 2X9YA 3FH7A 4ZQKA 2XN9D 1UA6H 1T1WA 4HWUA 5F96L 5DWPA 3DVIA 3L3DB 4JO8A 4MAZA 1A7PH 1I4FA 2EXWD 1Z1WA 2FIKB 4UTBH 1F6AB 5IB1B 1NCNA 2WO3B 3DRTB 3S36L 1FI8C 2PP8A 5BOZG 4WGVB 5E6ZA 5KJ7E 2XVGA 1PYWB 2CKBL 1J5DA 3AG1B 4AQ1B 1HSAA 4WTXA 5LNEA 5DVLA 1VJSA 2VZ1A 3P4MA 4E41E 3PY9A 2R2EB 3BN3B 4BUHA 3RU8L 4BQ9A 5DF0A 3DTDA 3JVFC 4YLBA 3WO3B 4HIIB 2JCWA 1EANA 1TQCC 2UVEA 4N25A 4TLKA 2W9LA 2Y1AA 4GG8A 1AGFA 5TTRA 3RIKA 2AAAA 3O6FC 1D5RA 5B38A 3NEOA 3RI5K 1GJUA 2JCCF 4X5QA 3CFQA 4OGYL 5DQJA 3EOTL 2IOOA 3RDTB 1WG3A 4ZX4A 1EXUA 3C09C 4JMXA 1JN6A 5E8EA 3SDYL 1KXTB 3KPQA 3G5WA 2DQCH 1F3DH 1WCQA 4NBZB 5CJOH 1FSKC 4Y19D 3BFWA 3U9PH 5KVMC 2ORBL 1MQKH 1KPRA 2E27L 1BF5A 2TRYA 3DX7B 3FCGA 3TCLA 4X5LA 5GRVK 5I66A 3KPRA 4NO3B 4IBWA 3V4UL 1SM3L 1P7KA 1GGIL 5IQ9B 3IJ7A 3IFLH 3RKPA 2CLRA 4MNGB 4ZX3A 3ZMEA 4NWTH 4BFNA 3U0TB 1I8MB 1JMZA 3BJLA 4M5YL 5AOMA 1QFPA 5FKAA 3ZYZA 4OF7A 1JTPA 5HBBA 3G5YA 1GIGH 4IRSC 3QJUB 4JFEE 1V3JA 4UQ3A 2W07A 2ZG3A 4RISH 1AO7D 4AEHH 4EZLA 4KHTH 2EZ0D 3BSHA 1M05B 2X4QB 3SYOA 3TA3C 3NSXA 2BOCA 3G6JA 2A3TA 1AACA 1T66C 2FGWH 3EJSA 1RZFH 3KLLA 4FTVD 1PSKH 3W9DB 5L4MA 1WCBB 3RHWK 3I6GB 2VUYA 4IGBA 1T20B 3D33A 2RB8A 4MKMA 4K5NA 5KZCB 1LO0L 4XPTH 2LHAA 1E5YA 2R0WH 4RWHA 4YC2B 2R0LH 3P02A 3SGKA 1OSPH 3LAFA 1OCZB 1PVHA 2ZCHH 3TEXA 3D50A 5KS9B 4G1MA 5B22A 5I73B 3BP7A 1YNTF 2DICA 2DTSA 4PG2A 1JERA 4GKNA 2HXAA 4BZ1H 5FX3A 2ZXBA 4ZAKA 2IAMD 3ZKMC 1AP2A 2A1WH 4PJ7E 5I9QB 4OF3A 3W9EA 1CF8L 3ISRA 3Q5TA 5CGYD 3FFCE 4HUUB 4U2ZA 4HJEA 3SOBH 1FZOA 3LN5A 5FB8B 3MACL 5I5IA 4ZTPH 1XF3B 1LGVA 2HT4C 3CH8A 5CU5A 2WUCL 4P2RA 4AEFA 1IE4A 1SBSL 4YFDB 3ARYA 4Y16A 3T6WA 1TKWB 1MLCB 2COQA 2VLJD 4IMKC 4PJ8A 3VU1A 2V2TB 1IFHH 1A3ZA 1L0QA 1ROWA 4KK6C 2UZPA 3QNFA 2WANA 2FWLB 2RGSA 4MTMA 4QAWA 1U8CB 1UVQB 4PCKA 5CILL 4RLDA 2IANB 1J05B 3WIAA 4G3YL 3BW9A 3D69B 1JGIA 1LWJA 4XB8A 5ESVB 2F7OA 3OAWA 4RGMB 1WEJH 2G9HA 3S88L 3WKNA 1QYGH 4U4IA 5LKNA 5D1ZB 3P73A 4WHCA 4OKDA 4GP4B 1ZTMA 2BXZA 1R4XA 4A7TA 4HIXH 2VR4A 3HE7A 2WQSA 3GKWH 1FO0H 5FYJU 2F53E 4KUZH 2KZBA 4F7TB 2B1HL 3FUKA 3NPZB 1A6TB 3TXAA 1LO5A 4GRWF 4LSRL 5B3NA 3BDXA 5HI3D 5DMGC 4EZMA 2NSXA 2QEJA 3MRHB 1FO0A 4OLYH 3F5WB 4MBOA 3S3JA 2NY0D 3EJQA 3FUNA 3CDFA 3SGJA 4L48A 4IRJB 3UTTD 3E8UH 2BVPA 3QULB 1P9MC 2OCFD 5JORB 3H2PA 3SYQA 5IFJB 1ETZB 2P45B 2WB7A 3IPEA 3THML 4YNYA 3LB6C 1PFCA 3C6LB 4H8WL 5BQDA 4I87A 2P42B 2F5AH 4V1DB 3T4AA 2OX5A 3QNYB 4Y1AA 4FXGB 1HNFA 4X4XB 3X11B 4JGJA 4OV5B 3AG3B 5KVFL 3B56A 5LGJA 3OB0H 3K0WA 5BOPA 1NGXB 4HWBL 4WFED 2DWXA 2O5ZL 1CD1B 1MHEA 3BXNB 4EN3D 2P5WD 2GABA 3H9SE 4Z1PA 2FD6L 4HJJH 3EJCA 4Y4KD 5FF6A 3OR6A 3F84A 4ZNEA 3QNXB 5E5MA 3A4FA 3U46B 4S1QH 1J12A 3EJJX 2V37A 1UM6L 3GD1C 1EA9C 1XGTA 2MJWA 4UB0H 1L9QA 3ASOB 4ZSOA 5TFSL 4BZ2A 3MA7B 3S5LG 3HN8A 2AQSA 3NACL 4FG4A 5JW4M 1OAUL 1R19A 4FERA 4OD2B 4UV4L 2DWTA 2FYYA 2Q5BA 5EOTA 2ODIA 1E4WH 5DHVB 5FCUH 4LEEA 3HS0C 5J8OA 3FCSA 2WVSA 4GAJL 2J5LC 3JBG7 2J20A 3VGEA 1FL3B 5I0ZA 5GIRA 4P4RA 1UASA 3M1CA 3JV6B 4J3VA 1GGTA 3T1WA 3MOQA 3I9GH 3FFDA 2VC2L 1LE5B 2P24A 3VE0A 4KOCA 5HJ3B 4M48H 3ZQ9A 3MOAL 3U36A 4JZOB 5ITFB 5KVGE 4N9GA 1Z0NA 1QFWH 3FRPA 5JOPD 1GOGA 3CZGA 4LDCA 4PP1C 3RY6C 5GS0C 3S4SB 4CBZA 2UUDH 3ARGC 2UZYB 1M2OA 4DQOL 3UGXA 1AH1A 1UATA 4X9HA 3GRGA 2CHXA 4KK8D 4Z7QB 6CGTA 1IO4C 1HOEA 1ZHKA 5FYKE 2A4EA 4JX0A 1XHHA 3KJ6L 3RWGA 5C0RH 4RMVA 2QFPA 3L5JA 3D0LA 2EYSA 4DEPB 4UT6A 1DQLH 2LGNA 3QDGE 2BSTA 3HRPA 3OKOA 3L3OA 4ZUTB 2XZAH 4IOFD 1G7JB 1NINA 1QLRA 3MRGB 4H2AA 3NIDF 4LNVA 1SDDA 4XHQA 1T5XB 4UT9H 1BAWA 3TV3H 2BZCA 2DQGH 1Q0YL 1FHNA 4XTRC 3CU1A 4BCYA 3SYPA 4OZHA 2Y7NA 4PJCF 4JZJA 3EGXA 1N7ML 2TAAA 2ZCLH 2XBDA 3CN1A 1HE7A 1U8PB 1CG9A 2YFNA 1CURA 4BQCA 4UT9A 5C0AB 2YGPA 3KPMA 4QRSB 2FX7H 3VXMA 2WOBA 5DD5L 1IAII 2VXSL 1N0XH 3SKJH 3VFTA 3P9LA 4H8WC 2PW1B 2PYFB 3MRQA 5D6CB 3BP5A 3DX9A 2HLAB 3GSNL 3FQRA 4KRPB 4ANKA 3RIFF 3WHE0 4ONFL 1MW0A 4H5SB 3EO9H 2D7QA 5IVNA 4JY6B 3VCLA 3BE1H 3FB8A 2O5YH 5F3FA 4BFJA 3SZ6A 2GTQA 4LL9A 4MLIA 3VI3E 3MUUA 3HNVL 2JMRA 3EOBA 3NFPB 4N6RA 3ULVE 2IBZY 3UJJL 3ZQXA 4H40A 4N22A 4WI2A 5D5MA 4HFWA 4P5TA 2XQYA 1JXGA 4Q74A 4RGNE 4ZYKA 4P4KD 1IQWH 2EIJB 4TL5A 3EIFA 4BFGA 1IBBA 2VDKB 1KPVB 4FZEL 4U1MA 3VUAA 2GQHA 5D7IB 3SKMA 1RZ7H 2AJUL 4J2QA 1ID2A 1R75A 4K9EH 3UBXI 3P77B 5L4FA 3I6LD 2VQUA 1BYOA 3CDGA 4IDLA 2VRQA 5K9KA 5F0PB 1PG7W 2VKWA 4GRWB 1YN6A 1SMOA 1NCJA 3WKML 3GC3A 3LD8B 4ZMZA 5IW6B 4DTGL 4TVPE 3CVHH 3EBGA 3T2NH 1G7IB 3HUJA 4ZRGA 1ZA6A 3VFVB 5I5MA 1MFAH 4E68A 1C12B 2XVLA 4JQXC 2WCGA 4UQ2B 3FB7B 2FEDC 3BD4A 2DOCA 5LUMA 3QUYB 4R83A 1IEAB 1RIUH 1CLCA 5LJYH 2WTRB 3F7VB 1WT5A 1HKFA 3CVHA 3MCYA 4FP8L 4ETQB 3BZEA 3VSTA 2C1PB 3Q8FA 2APWA 4PYHA 1I1AD 5EO0A 1DBJH 1A6AA 1EMTL 3WS6A 3TJEH 3B1TA 4QTHB 4XNQA 5IG7A 2P26A 2LU4A 3DJTA 1IB5A 2QBWA 4IKLA 3I3EA 2Y23A 1KXQE 4DPCX 4WJKB 1ZHNB 3E6FA 3NEXA 3RVVC 1JHLL 1T7VA 2WXMA 2COVD 1N67A 4KXZH 1RURL 3MBWA 3TIDA 4JG9A 4XP6L 2H6OA 3KVQA 5FYJD 5C0EB 1GOHA 1AAJA 2J55A 3ZT7A 4DSYA 2CPCA 1DVFB 4RVBA 2V5MA 3GXIA 5JW5A 3BOVA 4MDRA 2DQIL 2IADA 2RIKA 1ZVSB 3BPNB 4FQCH 2L7EA 3BFOA 3BQUC 1ADQH 4NPKA 4OIAA 1OT1A 4F9PC 4GQPH 3JT2A 5D4HA 4MGXA 3ARDA 2YJQA 4PV8A 1MJJA 3TV8A 1F4HA 3W0WE 3ZDZB 1F6FB 4J3OD 3ZE0F 1ZDQA 2MCG1 3VGFA 1D9KA 2IDUA 3QQ9D 3U4KA 2H0EA 1ZRUA 3M17B 3MZTA 1C5BL 4Q6KA 5KAQG 1L9OA 2Q86B 5SWSB 2NT0A 1HHIA 4KJQC 5FR3A 4OCSH 4Z6AT 2DYPB 3V4PL 3M88A 5AENA 1OHZA 2CDFA 3NP4A 3OZLA 4EIUA 3KNBB 3UPCA 2YMTA 5GRZA 2XV2A 2YPVL 4EI5C 1IGTB 1NIAA 3TT1L 1DQVA 2CGRL 1UXWB 4DGVH 5EZIL 3PDOB 4KPHH 5AKSA 4W9CC 4ANWA 2VH5L 4JB9L 4E42B 4LOUC 5KWYC 3EH4B 3NMEA 1D5IL 3FYEB 3HOGA 3JZYA 5I26A 4QRUA 1V3LA 5FM8A 4HBCH 1Z9NA 3F00A 2HFFA 1AKJB 5ICYB 3GHBH 5J9PA 1A9BA 2GIYA 3O41B 2G5BA 3NIDB 1AY1L 1KIUB 1SEQL 4DO5A 1IFRA 1MFUA 4PUBH 1PD1A 5DEFB 1RIVH 1OP5H 1FFPA 1G0YR 3FKUS 4LCVA 5DYOA 4L23A 5E6IC 2IAAC 5IFAL 3L3HB 5E56A 4Q2ZA 2IMNA 2P46B 3MR9A 5FECB 3VW3H 4B9CA 4YDJB 4G7YL 4PJEA 5GPRA 5F1OB 2P7TB 4ZMNA 4H88H 5BUGA 4ZOEA 4WV1A 3ZL4H 3KYKL 3D12B 3PPSA 1CGVA 1YMME 1XCQB 4PR5B 4R96A 1XD0A 3IS1X 2O61A 4DPRA 5I24A 1FNSL 1JPTH 4NPYA 1EAPA 1UJ3C 3GDCA 4AM0Q 3R4RA 4OGZA 4U05A 5I0DA 4CVZB 2VDLL 3BIKA 3DX6B 1RULH 4NN5C 5EFIA 4PWEA 2N7BA 2LU5A 5C09B 3VXQA 4X6CE 2PF6A 3LNEA 2ICEC 1XGYL 3O8XB 5FW8A 4CN6A 1RHFA 5L9DH 1E2WA 3GZOA 5C8JA 2EINB 3AGWA 5GGTL 4JFED 2Y6SD 4PJ5B 1YDPA 4N2BA 4JFHE 4HX1A 1D7CA 3QXDA 5J06A 1MJUH 3TBWB 3VNZA 1BV8A 4ZMQA 2PYEB 4XCYA 2EH8H 3C08H 2CIKB 2H3NB 2YGVA 5FWQA 5E1GA 1BREA 4OLWH 3BN9D 1E9PB 4XVSH 5BRZD 2AITA 3RJDA 1UWGH 2F18A 4XN1A 1A1NB 1BM7A 1PD0A 2DQUH 5GGUA 1BVKB 5TH2A 5HPOA 3O9WB 4GO9A 4ZDHB 1TVDA 5I1LB 3GSOA 2EYTB 3KPTA 2HKAA 1ZHBA 2MTAA 3LZPA 4TOYL 2OMWA 3MVSA 4PPTA 3QFJB 1DQMH 1KXVA 2P52A 2QJDA 2ZPKL 4AQ8A 5I5JA 3GNMH 5LG1A 3EHBD 4GP8B 4WJ5B 2YD3A 3BAEL 4DQAA 2DKSA 2MOVA 4I3GA 4HH8A 2DM7A 4N2HA 5J6HA 2CO4A 1II4E 2UVFA 1RUKH 4IBVA 4QHKJ 1QI4A 1XEUA 1GHFH 4L0ZA 1WBXB 2RCSL 4LPXA 3GMMA 4MCYB 3FZUD 4L0YA 2VKXA 1KENL 2X1OA 3QI9D 4TVUA 1H15B 2DQFA 4AT6A 4E9SA 2ZF8A 3C8KA 2CJTA 3GS7A 2OLDA 2ZNWA 1OTTC 2E6PA 2CK0H 3L3JA 3NH7H 2X41A 1T4WA 3CZFA 3I75A 4CBPA 5JNYA 4DWHA 4N24A 3QXAA 2YPKB 4YHKL 3NJIA 4BKLB 4A6YL 2JKJA 3ZE0B 3F7KA 1BAFL 3WO4C 5F9JB 1NOAA 3OPUA 2V5TA 2B5IB 3MU3A 1GH7A 4J4PD 3UTSA 1XF4B 1TCRB 2W1NA 3L7FB 4YGAB 2I60H 3DOSA 2W92A 1VGEL 2B39A 3OPZL 4L4VE 1DLFL 3C6SA 4S1DC 3VA6A 1NMAH 3PV7A 2F53D 2E46A 5IMMB 2R4RL 1CVRA 1HCZA 3VXSA 2H45A 1BGXL 1M7XA 5I6OA 5I6XC 2O6EA 3B8SA 3MN8A 3QO0A 5T5FH 1MCOL 4NQVA 1V5JA 3E6HA 3CH1B 2BXYA 1OANA 2EVGA 1Y7VA 3WSQH 3MRRB 5TK2A 3BPOC 4Q58C 1WVZA 4LCCA 5HYQA 4OCLC 3DV4A 3QNZB 1DSFL 5T5FA 1ACZA 1V7ML 4QXGL 1N4XL 4YHZH 4EI6B 5E1QA 3HIZA 4CVWA 1ZS2A 4O5LH 1TJIL 2W88A 4KV5F 2BY0A 2D7OA 3AXLA 3GSXB 3VDBA 2ZOLA 1X5IA 2H5UA 3ZKQD 1VB9A 4AEIL 1F41A 3D25B 3H9SD 4WUKH 4XP9H 4JK0D 4PGCA 2FHFA 5KOMC 4Y1AE 3GYRA 2PTUA 2YOAA 3SQOL 3BPCB 3VRJA 5BS0E 4RGOL 2GY7B 3AWEA 5HHPB 4G8IA 5CFAA 1QD0A 3B43A 3V7AG 3IXTA 1ZXQA 3RLSA 3GBNH 2QVTA 3WHXB 4PWFA 2J6WA 4GT7A 4ZFOB 4D9LL 4D0DA 2LOEA 3VGHA 5T1DH 4NQEA 1TMCB 4YDVB 4QJ3B 2BC4A 3FQ1A 4Z7WA 1UENA 1F13A 2EDWA 2P4AB 4ZSOE 1IARB 1GZQA 3QZBA 1GOFA 1IEBA 2EECA 1ED3B 4NQTA 4FA6A 1BEXA 1WC7B 2PKDA 4JEGB 4K7PL 4KWUA 4NUJB 4X7CC 4XB3A 1KWGA 4DT2A 1YQVH 1M3JA 5AVSB 2KT6A 1I9JL 3TBYB 1Q72H 2L0DA 3RDTC 3H54A 3VO0A 3TO4A 1EJOL 2H1PH 1MIEL 2UXGA 1RSYA 3ELAT 3DETC 1MHPL 3GMQA 3A22A 4M7LT 1LK2B 3NCCB 1AGDB 2VT0A 4F3FB 4YSOA 3IGFA 1OGTA 3D3VB 1NBZA 4I3SL 4JY4B 4LU5L 4F1ZA 1YECH 3MV8B 4JDTH 1YMHA 1ECYA 4HIJB 1CLOL 4KQ4L 2QKIC 4XRCB 1R0AL 3EZ8A 5JZ7C 3NBNA 5HHQB 3MROB 4L3AA 2KLSA 1CFTA 4N2IA 1MLBB 2NY6D 1D5ZA 2AV1A 5DU7A 2EEBA 3QQNA 2V5RA 1JGUL 2BSDA 2D7NA 3WTTA 5HGDB 4UIKH 1DLHA 3MRIB 2WXGA 2WXNA 4YLQT 4J12A 2YRLA 4WW2F 4JGUA 5DK0B 4NXKA 5E2UH 4JPKH 1AQKL 3WXVL 1X5FA 1GZPB 3MCLL 3IDMA 1U93B 4N90E 4QRAA 5DURB 4OZHE 1JPST 3F12B 4I13B 3NCJL 1NFIB 3QG6A 1AR1B 1O9VA 4OH2A 3HPJB 4P5RA 1Q94A 4LLQB 1D6VL 1Z9SA 2JSFA 2BSSB 2OSXA 1DTUA 4OCXL 4WNJA 3WUWA 4GINA 1O6TA 1IC5L 1W0VA 3UAJA 4F2MB 4O58H 4U1IB 1SHXA 4JRXA 4JUTA 4TUOA 1ZV9A 2O93L 5I73C 5JIMA 4HS6B 1TR7A 1G0XA 2FEEI 3ULVD 4LLDA 2I5YH 4XAWL 1EZUA 2XN9B 4XCFH 3TF4A 4RDQF 5EZJA 3LKOB 4PJFE 1KV3A 3T0AA 1DVSA 1YEFL 1Q9LA 5J12B 5HP5A 5C2UB 1TZGL 3FQUB 1BFVL 5FOBA 5KOVC 4G72B 4DGWC 3ZHLA 1TJXA 5DUPH 4NNYA 1L5GA 4XBPA 1DYZA 3P11H 1OWRM 2YC1A 1T1ZA 5DZPA 2WZPA 4NN6B 4TVPD 2YWYA 3SDXA 3FQWB 4GMSH 2EXYC 5D93B 2H41A 5D4IA 1VESA 2YSSB 2LABA 3BGMB 3GEFA 1AZUA 2EO7A 4KK9C 2YD9A 1BJ8A 4OT1L 4P46A 3W38A 5IIEA 4TYUA 4Y4FA 2K8MA 3KM2A 4MCNA 4RGMC 2VL5B 3WKYA 2IH1B 4FMVA 4NJAL 1QEWA 4FXKB 4ZFGL 3CCHA 4OKVB 4K94L 3O3AB 3APCA 3JTSB 4UMSA 3VFMA 5JUEL 4XXCA 2L7JA 3V8OA 4M56A 5AVQB 3QA3A 3T0EE 5IB3A 5T1MB 5IQMA 2LE9A 4Y19B 2BSED 1JDAA 3HFML 1LEIA 4PRAB 1FLRH 1OXYA 4Y2DB 4XMKL 5D55A 5IP4A 4GS7B 4HXBH 3A4EA 3A6CH 4J6RL 2C4XA 2CBMA 3FF8A 4EDXA 5EU7C 4EJ1C 5KYYA 3GSWB 1MRFH 3K46A 3J8F7 4CKVX 2HRPL 4WRLA 3C6LC 4UM9D 1EGJL 3QH3A 1M2VA 3BZDA 4WAFA 3W0WD 1FCGA 4FXGC 2KDYA 2BHUA 4M7ZB 2K4WA 3EFOB 4DFHA 3OKNB 3JWNE 3V0HA 5HGBB 3CFTA 4JE0A 4G6AC 4FTVB 1I7UA 3KGUA 4ZUWB 2HFTA 3MFFA 1AQDA 3ZZSA 1SHMA 3RNKA 1IGCL 3X17A 1HSBA 4U6VL 4BK5C 5D7HA 5CZVL 1L3WA 3WLWC 3HG1A 2EABA 5JQIB 2WLYA 2X4NB 4UU9A 4P2YA 5MP6H 4Q4IA 2FH6A 4CC4A 2J8UF 2QFRA 5F7WC 2IAMB 4F20A 2AMUA 3RGVA 5CEXB 2WYIA 5I17A 4YDLB 3EYOA 1N19A 1HJBC 4IBQA 4I1RA 4DVBB 2WLIA 5C2BL 1DDHB 1KCKA 3G5XA 1K8IB 1IM9A 3LPOA 4LXFA 3VFPB 2C9PA 3VFRB 5HYSB 4N8CH 5EU6A 3BRGC 2APSA 3DA0A 4GLRH 4NRZA 1CL7H 2ZXDA 2VLJB 1WYJA 4IU2B 1BIHA 1U8KA 4QRPE 3BUYB 3Q8EA 4AMKL 4KJPD 4YHPA 3PG2A 4ELKB 2EXTA 3LKNB 4WW2B 4CA4A 5DC2A 3OHXA 5J6SA 2Q2EB 2XZQL 3GHEL 1URIA 2PO6A 1JV2B 4Z3GA 3F7RA 2FSDA 4K71B 4AI7A 3HI1A 4ZO6A 1SZNA 4XNDA 3OLEA 2ZIDA 3MRDB 1U95B 4K94C 4A7GA 3L4WA 3RFZB 4CUCA 1R3KB 5DD3L 2UWEA 3PJLA 4U33A 5FM4A 4ADIA 4JJOA 4PJBE 2XQ0A 2QKSA 1DFBL 3PQYA 3FTVA 3O2VH 4PI2A 2OYLA 1Q1PA 1MCSA 2VDQB 2LAGB 3WTXA 4I4WB 5FV1L 4B50A 3S8WA 4N2NA 2Q8BH 1CGSH 1FFOA 1T7WA 4ACTA 4DP0X 4L05A 4TQEH 3NAAH 1NCBL 3KPRD 3GBLA 5ICUA 4DAGH 2W95A 3TWCL 1NBYA 2EVJA 3DSNB 4YXHH 2DBLH 4IMLB 4Q56A 1QRNA 8CGTA 2XC8A 4JFHD 2HWZL 2WXRA 4PJHA 4JQIL 3G04B 1ZKAA 3IPFA 1U8OB 1UJTA 4NC1C 3BRDA 1VZGA 2I7OA 2C9UA 4TL4A 5F96H 2IDQA 4M6NL 1I7TA 4MMZA 4I2XB 1KBPA 3IJYA 3UFIA 2JVUA 3QUKB 5ES4B 5F6IB 5F7BA 4TTGA 2F15A 4JBSA 2FQGA 3U9UB 1BA9A 5T1KA 1G5AA 4L8BB 3MJ7B 4XMWA 2P5WB 2F0CA 4MA7L 5KSAA 3DARA 2E7BA 1H8NA 4BHUA 4GXFA 4NBYB 3ESOA 4IGBD 3U83A 4YMPA 4JDVA 3VFUB 4MDJB 2FO1A 3RU8H 3SBPA 4R2GC 5L0QB 1ZSHA 3EJTA 3A21A 3VI4A 2W9EL 3NJNA 2P80A 4Y7OC 2YUXA 3DMMA 1OCCB 2VW4A 2XWEA 1HHJB 1Q9OB 1F3RB 1RZ8A 4OFPA 3OAUH 4IMKA 4KNSA 1NTDA 4K3DL 4BFIA 4ZAKD 4GO8A 4NFDA 4U1LA 4J3OF 2Z8RA 1AGCB 4I5BA 35C8L 5IREA 2IBBA 1H19A 4W1TA 2ESVA 4P2RD 2NYYC 4I85A 1IBHA 1X9QA 3SDDD 2ORBH 4FI6A 4Y16D 4XOEA 2ZX9A 1JDDA 2E27H 5TGBB 3BAIA 4I0PA 2ZXCA 3ILPA 4OF5A 4OJDH 2BSBA 4HK3J 4PJ8D 4G8GA 1THCA 1CXEA 2H3XC 1FUNA 3IJHB 4AX3A 4B9KC 1NFKA 3KPNA 4PCTA 1BHGA 3V4UH 3C8DA 1FIEA 4YSUA 4JHWL 3V5HA 4LHUG 3D4ZA 5KEZA 4FRWA 4X4YB 4PRHB 1OK0A 2X4UB 3Q9QA 4Y89A 4JO1L 3PCYA 1UB5A 1N5AA 3QIUA 5C6TL 1JZ3A 4M5YH 1JPFA 1EXHA 1DJSA 3O6KL 4UM8B 2I9LA 1XT5A 3U30B 1JF6A 5JHLA 1DVFC 1KCLA 4UOJA 5JR1L 5DVOA 1T0OA 2O6DA 3PF2A 4P2QA 3TH3T 3NCXA 3VX0A 3V79C 1THAA 4OIIL 3HE7D 1WPCA 1P9MA 1AXTL 3EYVA 1T0PB 1J0HA 1K2DA 2AI0L 3N0PB 3S2AA 1R3IL 1BF2A 2UXVA 1T03H 1A7NH 3VXSE 2DJUA 4ZG1A 1G94A 3ECWA 4TUUA 3G9AB 2JI3A 3N9GL 3HHSB 4AV0A 3E38A 4RIRB 1IBFA 3K6SB 2CU9A 4XPBL 4Z78B 5JQ6H 1LO0H 3OMNB 1W6LA 5I1DA 4MMYB 3VFNA 3GJEB 4ODBD 1JFHA 4R3SA 1OOWA 1KY7A 2XT1B 2XACC 4XMPL 2HVJB 3NQKA 1M7IB 1S3KH 1EFXA 2WQRA 1A9EA 3Q3GA 5EBMB 3ZXAC 1I8LA 2WSKA 4YSCA 2NX5A 2XWTB 3CFJA 4Y1AD 5IESL 2AEWA 1P4UA 1U3HA 3S8GB 5IB5B 3W56A 3FT0A 3FUEA 2Y24A 4LEOB 3SPJA 3X14A 4HHGA 4GW4B 2A9MH 3LZRA 3MACH 4FFZA 4WI4A 2F74A 2WUCH 1SBSH 3HRZC 4QLWA 5BPPA 4MJ4A 2W9DL 1IV8A 1FFRA 3FJTA 2LAAA 1Q9KA 1HC1A 3KGSA 2WWOA 4P4KB 4R5XA 2HN7B 1NFDE 1I1YB 1PBYA 4NKDB 3MLRL 4LAJH 5AUMB 5GS0H 1DBBH 5CILH 3BKCL 4QJ5B 4P59H 3B9VA 5CBAA 2V7HB 4GNKB 2JKTM 2G0KA 1CK0H 4G3YH 4KZCA 2VO5A 3PHQA 4BK8A 1E2ZA 3S9DB 3QZPA 3GSVA 3P2TA 4JANA 4LOEA 3UC2A 3G5VB 2VRKA 2XG5A 1UQSA 4YR6A 3BYTA 4L0PB 5E08L 3WIIL 1MVUA 3PNWB 43CAB 3ESPA 3WJLC 3P30L 3BYYA 1QSFE 3GJFA 2QV2A 4PJAF 3IFOA 4W93A 4JUSA 3QCTH 1D6EB 1TZIA 1X7SA 4P2CG 1LNUB 2B1HH 2PCYA 1I1AB 1M53A 25C8H 5F7EH 5IJDC 3DUSA 5F3BB 4XI5D 1CGWA 4MKTA 4PJ7F 5EC1B 3PWPE 3QPQC 4AGNA 3UJIL 4NQCA 5IJBC 2ICCA 5L2KA 2Z92B 4M1CC 2AZUA 1KLGB 3S35L 2DY2A 1CDIA 1AOHA 4H8WH 1INEL 1BYNA 1RHHB 4AE1A 3NCYP 1MXGA 3IRPX 2QZQA 3AQZA 3W39A 3ILDA 5AVZB 5KVFH 4HIEA 4W9DC 2KERA 3NZSA 5IVZA 1VEMA 4HWBH 1EJ8A 2P8PA 2O5ZH 5JOFA 5L8JB 1RFDL 4YBQD 5C0IA 1ETB1 1S78C 1N10A 5E94A 3ZN6A 2A6KA 2CWRA 4DF9A 5KSUB 2NYZA 1Y6KR 2ZOTA 3GLZA 3L13A 5J0BA 3SHSA 5FV2A 3ISYA 3CFEA 4HWBA 4R97B 1UM6H 3RIAF 1S7TB 5TFSH 4LLYA 3NACH 1OAUH 3OV6A 4JFYB 2L7QA 3N04A 1A02N 2A38A 1CGYA 3O9WC 4UV4H 2AQRA 2HPOA 4N2KA 2ZUTA 2BNUA 4GAJH 2AHIA 3U0PB 1TJHL 3IPBA 1HI6B 3CFUA 5F7KC 2H0FA 2P8LB 4JRXE 5E4AA 3SCMA 1TO5A 3F62A 3MOAH 4UV7H 1N8ZB 1N70A 1X7QA 3GRWL 4AK1A 2EE0A 2GITA 2C26A 4P5TD 4X98B 3T6XA 4Y2OB 1AR2A 3NCWA 3RVWD 1FORL 4DQOH 4QXUL 2IXQA 4ICXA 3SE8H 1UOKA 2XXMB 1AC0A 2NW2B 3DXAA 2OYKA 3M86A 3PE9A 2W81C 2PW2A 5F1KC 3KJ6H 3UYPB 1S9KC 3ALXA 3BKJH 3GSRA 5BRQA 1REIA 4WKZA 3TFKD 3HLAB 1XGQB 1MI5A 3EO1A 3SDXE 2G75A 2IC2A 2VWEC 5BZWB 5FHBL 2WWMD 4PW4A 5IF0A 2QHLA 4XX1G 2X9XA 1MZYA 3QQ3A 4EVNB 3MLTB 5CZXD 2EUZA 4KDTC 4KTGA 1Q0YH 1G0DA 1U8IA 4B97A 1OAYL 1F90L 3KD4A 1P6FA 1N7MH 1IC4H 2BVUA 3B83A 4J3XA 1I75A 3LHPL 5DLML 4DK6A 1KIRA 1RZIA 3L08A 2QQNH 3SE4C 3PWJB 2IDTA 2VXSH 3O3BA 5DK2A 4E9RA 3IGKA 1OP4A 4ZUSA 1D7FA 3GSNH 3PAZA 4Y88A 2J2ZA 3N1FC 1P5UB 1DBMH 3QJQB 4ONFH 1J8SA 5FXCH 4DK3A 2NNAB 4QHUB 5D1ZI 1SOKA 1BM3L 2YK1L 1DEDA 2NY4D 2W65B 3P4NA 3T3ME 4YAQA 4XWOC 4KMTL 4JFEB 3QUML 2NUTA 4PY7A 4X6EA 3CFBB 4JRYE 4OLVL 4N87A 4RZCB 3HNVH 2JKWA 4ZQTA 4AIEA 3ARDD 2HX8A 3BJ91 1KIQA 3F7YB 3UJJH 2CQVA 2VABB 3F65A 3ZT5A 2DI8A 2C9RA 2A4CA 4OCNC 2YEZB 5FKPA 1JS4A 3QS2A 1GVIA 1D9KD 4FZEH 5CD5D 4LCUB 3BMWA 4ABQA 2AJUH 4LEBA 4MDIB 4PJAB 5FDWA 3SPVB 3JT0A 2F8OA 3CN3A 5IW1A 3B3BA 2VLLA 4L8CA 3AY4A 2K8QA 5HYJA 3UPRA 3V0EA 4JO4H 1LILA 2ZUXA 3V10A 4DTGH 4EF3A 3US0A 4PJ7B 3C8HA 1NLBL 4U6HA 4MD0B 5DRZB 5E8NB 3L4YA 3VDAA 3FFCB 2JB6A 3EHBB 4Z7VA 4HXAL 3HG1E 1HINL 4QY8B 4X7SL 3T77B 3IDXL 2E6JA 4CSZA 3KYNB 3RP1A 4ZMLA 4HCGA 3VMOA 1IQDB 1NGWA 3IU3A 4LLUB 4L3CA 1YVLA 3MRNB 4F27A 4POYA 1H3XA 1IAOA 3V0AC 2OV0A 1BG1A 3WIHL 4HAFA 1EMTH 1FNEA 1MH5B 1WAAA 1MWAB 3MJ6A 1AZNA 3QI9B 4QRPD 4D9RD 3I50H 3S2CA 2VB5A 3MV7E 4X8XA 4KRNA 4HCRA 2IJ0C 3DYOA 1ES0A 5EU6E 2WIIB 1LD9A 3H4FA 4Y1SA 4N2LA 3WS3B 4DN4L 2BOLA 1JHLH 1EK3A 3KWVA 1B0GA 1CDYA 4KKAD 2B59B 4XGZA 4XP6H 4P2AA 3ULVF 4ZS6C 2BHZA 1UJ3A 1L9MA 5EB9A 3KEHA 2FUTA 2DQIH 5TDNA 1ZSDA 4KKCC 2QPDB 3SYAA 1XDTT 4JPIA 1DN0B 4UINH 1N59B 1U91A 1UADC 3GMNA 2F53B 4NHCL 4G6ML 1P7BA 1K4CB 4LOVA 1KCWA 1I3GH 2UWEE 3BIBX 2ZX5A 5TQ2L 3PFQA 3SGDH 1U3YA 4CDGC 2BVOB 4XXWC 1WV7T 3PQYE 3MXWH 1C5BH 1XSIA 3UEZA 1CT8B 3EAKA 1L9RA 3IU4H 4KO6A 2WV3A 3V4PH 5HYFA 3VB9A 1RZGB 2WYTA 1NGPL 1S3RA 3DO7A 4W9HC 3HFFA 3UZVB 4DETA 3KJ4C 2D7TL 3TT1H 4MZ3A 2CGRH 2YBGA 1IGJA 1Q90A 5EZIH 4UUJA 2RFXB 4FQQA 4LSSL 4PJXA 3HPLA 2BVTA 4LRIA 2VH5H 4JB9H 3BT2L 3IRZA 5G4NA 4R4FH 1D5IH 3KPLB 1YUHA 3QR0A 5HI4C 3H9SB 4C4KT 2GJ6A 2XNAB 5K9OB 1NANH 4E5XB 2DWEA 2EXWC 3AG4B 5J12C 5A2LH 4N0UB 1VGKA 1YYLL 2VITB 3WJMA 2IQAA 3K6DA 2E7LA 5H37H 2YOCA 1T83A 4OFVA 1KGIA 4WEBL 1A4JB 1W9XA 3GZKA 3SY0B 1KY6A 4UOQA 1H6EA 5ALCL 3GM0A 1DVUA 4LF3B 3VH8G 4D3CH 2JLPA 1UT1A 5IFAH 4CADA 5ETUA 4Z3HA 5FA3A 4NN6C 4J8QA 3EOYG 4Y5XB 2X42A 1NPUA 2YA2A 1JGVH 3IGAA 2DBJA 4PCSA 4QHPA 4G7YH 4NUGL 2Y4SA 5D93C 1XCTA 1JK8B 3X3FH 5L8LB 1F58H 1HFUA 3OGCB 3REWB 1AANA 1BVLA 4B9PA 3AROA 3KYKH 2ZSVB 4KUCD 1KGUA 3M8OL 3B5HA 4HFUL 5KVEH 3TX4A 1FNSH 2G3XA 4K3EL 4AQZA 4DGYL 3PJSA 1K85A 2B1AL 4LESA 1PZAA 1I8UA 4P2OA 3MYJB 1INQB 1QZNA 1FZJB 5D7JC 4U1GB 1S7QB 2VDLH 4ATTA 3ZTCC 3HN3A 3CPLB 1DO6A 4G42B 4PM1A 5IBLD 4H0GA 2FJGB 5D1QC 5PAZA 5JTWA 5CIPH 3GZQA 1OSEA 1XGYH 1XH3A 3FT2B 2ZZUT 4FLOA 2PPDA 1K8DB 3UTSD 4BM7A 3QCUL 2ADIB 3QDGB 4GS7C 1IGML 3DVNB 2HTLD 3QJXA 4QUOA 5GGTH 3LPGA 4TNVK 4YZFE 3ZRFC 4Q9QH 1DANU 4UTAL 3VXNB 1ASOA 3ZHDA 4C56A 2NY6B 1ILUA 1YEGH 3HBGA 4NKMA 4AMXA 1TU2A 5JIQA 3VXSD 1EAQA 5FDWB 1EZVY 1BMZA 3VJ6A 1U8QB 3HMXL 1NM9A 3FMGL 6FABL 4M7ZC 4H2CA 4AZ8B 4L1DA 3M1BA 1YPZA 2OW7A 4OGAD 4W4OA 1QR4A 1KMGA 2EZ0C 4F91B 4GXUN 1L7TL 4JL1A 4GBXB 3KPSE 3MRKB 2J4WL 2GJZA 2P5EA 2V8MA 3EW3B 3QYCA 1HL5A 1X5XA 2XJKA 4NZDA 2G4GA 2V2XA 3U6XA 3EH5B 4E9QA 5H35A 2OR9H 1F11B 1IGFH 4QXTB 2IQ9L 2XFXB 4TOYH 2FTAA 1PF3A 1YEHL 2KHAA 1IKOP 2ZPKH 5ICZA 3ETBF 3LIZL 5I74B 4CMHC 3EYFB 4HAKA 2Z35B 1P0SE 3RAJL 3A47A 1Q1JL 2WXHA 3BAEH 3H1ZA 3K0YA 5ELIA 3A3YB 3UXFA 4GKSA 4K0OA 3VVVA 3HCVB 5D2NA 4NQXA 1T21A 3L2NA 4U6YB 2MCAA 3UJTL 2X1QA 2RCSH 5EEYA 1OQOA 2IAMC 3EH1A 3PRZA 4YDLC 5CGYC 3HC4L 2QSCL 1MCEA 3MKGA 4RMWA 4HAGA 3PABB 2YXWA 1PZ5B 4KDWA 3BVVA 1U8JB 3AU0A 2ZAIA 1MY5A 4NQED 4C83B 1GCYA 3CXDL 1BBDL 3KYMA 4YHKH 2MOQA 4A6YH 1BAFH 2IMMA 4G83A 3SO3B 1HJCA 3MLSL 2KS0A 1KN2L 3KWXA 2OMXA 4LDLB 1RJYA 2R2CA 4WW2C 3U4BH 3VYOA 3K91A 5ECJE 4JG5A 4MJIE 2KBGA 1FNFA 1VGEH 3OPZH 4K71C 4KO7A 3G6JF 4HHAA 1QO3A 1RJZB 5IBUB 3D4YA 4CVXA 1I8IB 2R4RH 5B8CA 5BUPA 3VQLA 2E7MA 4I77L 3UPAA 1U8HA 3QQXA 1MCOH 3CDZA 5EIVA 2QGDA 4L8SA 3TO4D 3ZK0A 1OSYA 5JO5A 4XCNB 3KW7A 1KLFB 3ZTJH 1IBDA 1KYUA 2MQ3A 2ZXQA 3NP3A 3OZ9L 3K2IA 4PIRF 3QVAA 5DJ0B 1DSFH 5CCKL 3ZPDA 4FLHA 1V7MH 4QXGH 5F0JB 1AJ7H 2JKIS 4Z95H 3WN5A 5HI3C 3ZMNA 5HHVH 1TJIH 2CUAA 4KOBA 2AGJL 4HLZG 2VIRA 2BVQA 5G5DB 2LV4A 4NQCE 5I82A 5JW4Q 2NY0C 4JHVA 4Q4EA 3SDAA 3QJHA 4H0IA 4U6TA 1E4XL 4LLWB 1MFMA 1KJ2A 3N85L 4PB9H 2AEPL 1DQJA 1ONQA 4YPGB 2GCYB 5EUOE 4UM9B 3NK4A 2HVKA 5GSRB 3W0WB 4PS3A 3FU3A 2Y2WA 3SQOH 4UF7C 3CMGA 3TEZA 1IAMA 1T1YA 3KBPA 5HSFA 4GAGL 2BSRA 4RGOH 1YEEL 3O2WL 2PPEA 4LCIH 4UAHA 3DX0A 9CGTA 5E4OA 4EN3C 4D9LH 4HSAC 1LL1A 4Y4KC 3TPKA 2WOYA 3A24A 2CO3A 1MAJA 3QRGL 3OLIA 1BOYA 4HG4K 2H9GA 4HV8B 4YXKL 3V5DB 5IOPA 5L0QC 5DT1L 1IMHC 3L4VA 3IDJA 4FQIH 3UAJD 4MQXD 1AI1L 1ZT4B 2IG2H 2E9WA 4JRXD 3STLA 4KKLD 4PV9B 4UIMB 3EYSL 1Q8MA 5ID1B 3NTCL 4ZQKB 2Y9RT 2ZAHA 4KH9A 2WXOA 3CSTA 4JFOA 3SJVE 3BKYL 4UOZA 1I3VA 4N8PA 1UOWA 2KZKA 4F80A 1NSNL 1I4FB 5AVXB 1I9JH 3CFDA 3KL0A 1KLUA 3U6RB 2A7BA 2HA1A 3HAEH 4WHYH 5BZZA 1AOZA 4M9OA 1EJOH 3BVTA 1MIEH 3HC0A 1MHPH 1MJ8L 3MJWA 3LRGA 3FQ4A 4WGWB 3WEAA 1HSAB 3Q5OA 4EBQL 1ZLWK 1D5BA 2Y06L 3H7LA 2MPAL 3P4MB 4I3SH 3P69A 2WZPD 1MFVA 4KQ4H 1CLOH 2WSDA 1MREL 2XIIA 1G7MA 1R0AH 1Z9MA 3DXAE 1P7QA 2CG9X 1LJMA 1HILA 5J56B 4KXCA 1JGDA 2E74C 5IMOA 4P46D 4GG8B 4Z77A 5KW9H 3RBSA 1U42A 1JGUH 1YMMB 3JXAA 4FYQA 5B38B 3NJMA 3MXVH 1F42A 3NZ8A 5DQJB 4KKNA 1J1OH 3U30C 5EBLA 3RUGF 1EXUB 5E8EB 2AK1H 5FYJL 4CRPA 3KPQB 2I24N 3MRCB 3ARWA 5IROA 1TFPA 3SPCA 3WXVH 3HG0A 5F9AC 3MCLH 1AS6A 3O3UN 3HE6A 2AXFA 1KPRB 4NDMA 2KMWA 5AW2B 3TCLB 1IUZA 2HH0H 3JTBA 3ZGHA 5I66B 3KPRB 2UY6A 2XICA 1P7KB 4MASA 1C5CL 4HGWA 4LVEA 2A77L 2CLRB 3UTPE 4LKCA 3V0DA 4AQEA 5E5LA 1OPGL 2JCCA 5FKAB 2FLMA 4MS8D 2B0SH 4H8QA 3WE1A 3EBIA 2UX7A 3G5YB 1OGAA 1MDAA 1SN2A 4J6IA 5BMFL 1I7ZB 4UQ3B 4C57C 2I69A 1GC1L 2JKLA 1E67A 1TZGH 2BIQA 1BFVH 2D4FA 1RERA 5HVFB 4AJWA 1A3RL 3QCVL 1S5HA 3QPKA 1U3NA 3TT3L 1G6RA 2L3BA 4IGBB 5TDOA 5E51A 5IEHA 2A6IA 4P06A 4FKKA 4U3SA 1B4RA 2HX9A 4GFXA 5AOIA 4AH2A 4YSQA 2YMXL 2B8OT 4JR9H 3CZLA 4IBLT 4OFKA 5LN8A 2MKLC 4G1MB 3HG1D 4A2HA 3BP7B 2HFGH 4U1NB 2NYKA 5TK4A 5HGHA 4HCIA 5HYJE 4GKNB 4HOXA 3LEXA 4OZHF 2XQBL 4ZAKB 4OQTH 1AP2B 3RGVD 4NJAH 3V52L 3W9EB 2V3EA 4ZFGH 4XP1L 1CQKA 4B6ZA 2ADGA 4MA1B 2JKRM 4Z7VE 5HVGB 1FZOB 3LN5B 4BH7A 5I23A 1IM9D 1AYRA 3KVDD 3PWNA 4TNFA 5EU6D 3E0GA 4FQ2L 4OQTA 3D7PA 4GB9A 3SDDB 4UZSA 4Y9GA 4Y16B 5I28A 1HNGA 1BWWA 4M4RA 5DC4B 4XT1C 4M1GL 1I1AC 1WAAE 4RQQA 2EUXA 4PJ8B 4F7PA 2XTLA 2N56A 5C71A 4XMKH 3A23A 2CPUA 5IM7A 3IEAA 2J7LA 4J6RH 2PO6D 5LNGA 2MMXA 3FQYA 3BW9B 1IAKA 2WLJA 4DZ8A 1KGCE 5KYUA 3KYOA 5D5MF 1NC4A 1EGJH 2G9HB 4U7KA 3UIYA 3WEMA 3AREA 1L9NA 2C1OA 4N0YL 4LIQL 3P73B 2KZWA 3PQYD 2CR0A 3CSBA 4RMSA 3HE7B 1EZSA 4H25A 4Y4HB 1EV2E 3NJVA 1UURA 4K7PY 5ILTL 5IVOA 1NKRA 4DHLA 2CO7A 1SQ2N 4J3OC 1UD2A 1FO0B 3HUJF 3QQ9C 4KU1A 4R97C 3BUIA 5CM1A 1IGCH 3IYLW 3LH2L 5CZVH 1QRND 3RWEA 2XA8H 4YOKA 5HJDA 2BVPB 2VN4A 5IHZA 2C5DC 1HDMA 5DVPA 4YNYB 3CIQA 3QJFB 1DL7L 1MIMH 5IK3B 2ADYA 2OX5B 5F7LB 2Q8AL 4ETYA 4Y1AB 1RP9A 4GRWH 4OZFG 1GC1C 3ROLA 2HKFL 2VW7A 3IK2A 3ZO9A 1BDYA 2OZNA 1J1XL 4PJXE 5LGJB 3IFPA 1QR1A 5T1KD 4CSTA 1MHEB 5C0ND 4LK4A 1G1YA 1A4KA 5KSAD 3UG4A 4KNQA 5FF6B 3OR6B 4LKXA 5E5MB 1GTFA 3AS0A 4FFVD 5I1HL 4U6XA 1OALA 3FQXA 4ODTL 1XGTB 2CE6A 2J57A 4ZSOB 3LZLA 1I3RB 2HT4D 1GRWA 2CDGA 2P80D 2XZQH 3GHEH 3PXLA 1VFMA 3DMMD 1P53A 3GI8H 3BVUA 4X7FC 4G8EB 4PWHA 5EOTB 5B1JC 3ARQA 4AIZA 5GQBA 1IKNC 3FCSB 3O3EA 2PN5A 3JYCA 1F00I 3T71A 5GIRB 1EXGA 3UC0L 4L3EA 1V3MA 1JG9A 2GVYA 4GY4A 1GMEA 2VMCA 3FFDB 3ISWA 2P24B 4LPCA 3DGDA 3IWVA 2NT1A 2ESVD 3PU7A 3Q6FA 1J0IA 1WWBX 4TSAL 4UI2A 4AJVA 3U36B 4YWGL 3LVEA 3ZZQA 4I0PD 1U2HA 3FRPB 4WDIB 5HY9A 3RWJA 3AM8A 2K7PA 4G8GD 1PNCA 3OC5A 1NCBH 1K3ZA 1EHKB 5GJSL 3TWCH 2HZHA 3T2PA 1DQIA 3MLVH 1BQLL 4XE0A 4DKDC 1ZHKB 4GAYA 5KVEE 3DLQR 3PDDA 4PRIE 4R7VA 5HHOE 1B6DA 5B38G 2HWZH 2X1XR 3RWGB 3P3TA 3QIUD 3D0LB 1P5UC 5B1CA 3VXTA 3LQAL 2X9WA 4ERSL 2BSTB 1AZCA 2GC7C 4PJDE 5DHYA 5DJAA 4AQAA 3ALWA 2B77A 3L3OB 5EG6C 4P2QD 4PS4H 2HG5A 4C56E 5DJ8B 1QLRB 1MF2H 2Y6SC 4Y9CA 1SDDB 2XY2A 4ZMTA 1SXSA 4LFHD 2DMGA 2YAMA 4YN3A 3IAQA 4M7JL 5FLVA 2APXA 3A6OA 4MA7H 1SLWA 4OZHB 4JZJB 6TAAA 5FDYA 5LLIC 3BN9C 1CG9B 5FHAL 4PGDB 3KPMB 4PU2A 3TNNA 4AG4L 1T89A 5GZOA 1DP0A 4IW4C 4MWFB 2ZKYA 4PJEF 2EUWA 2W9EH 3VFTB 4FLRA 4LVOB 4HUNB 2P5EE 3HRZA 3MRQB 3BP5B 3DX9B 3FQRB 1SF5A 4WWNA 1EFXD 4XPHL 3B2XA 3NIFF 4K3DH 1W6WA 2NX5D 4FL4B 1AHWB 2GT9A 3VCLB 1U3HD 3FB8B 4MX7A 1UKSA 4WU7A 3X3GL 2GTZA 4BWTA 3LRMA 3EHBC 2OYMA 2WHVA 3SE3C 2XZCL 4JMNA 1JV5B 5D2NE 2JIXA 3EOBB 4N6RB 1XTLA 15C8L 4YE0A 3C60C 4PJCA 2WN3A 5D5MB 4HFWB 4P5TB 2I32A 4GRLA 1GY2A 1CICC 1U92A 4ZYKB 2DM3A 4O2EB 3KL3A 3UBXA 3QJTB 3QI9C 4U1MB 4AM0A 4JFXA 2ZXEB 4Q9RL 1FH5L 4G80A 3SKMB 1BP3B 4JHWH 5DZAA 3U7YL 2FBJH 3HJ0A 3EF7A 5J1AA 1KCBA 3CDGB 3WFHA 5K9KB 4HCFA 32C2A 3RWIA 1M1SA 4OZGF 3L9EA 2LFEA 1MWOA 1YN6B 5C6TH 2DQ6A 4PP1D 5GS0D 1XF2A 5DRNB 3O6KH 5DO2D 2R9HD 2XETA 3FT9A 5TQ0H 2W38A 3HUJB 4J4PC 2WAHA 1W72H 5JR1H 4N1EA 1QFUH 3EADA 1MEXL 4YHIA 2JNZA 1NMBL 1AXTH 2ZUSA 4B7IA 1O7DC 2NY2D 2AI0H 4FQHA 1F1AA 4LNRA 3CVHB 5JOEA 2G9KA 1NGYA 3BZEB 4Z0XA 1W72A 2CMRH 3R1GL 3P4LA 1S7SA 2BS8A 1COBA 1E8ZA 3EO0A 2CR3A 5B3JE 1FZKB 2OR8A 2ZYSA 2XKUA 1NCCL 3CQFA 4NUPA 4XNQB 4XPBH 5IG7B 5AW7B 4MNGE 4NQCD 3T0WA 4JVWA 3E6FB 5L2KD 3T9WA 4W6WB 4A2DA 2L7UA 3MBWB 4M93B 5EA0H 3FK3A 4EZJA 3TIDB 4DPBX 3DROA 3LQAC 1ORQA 4KUCF 2XV0A 2G5RA 1BFSA 4RMBA 1A7RL 1C1EL 5IESH 5T3ZD 1TCMA 2WQWA 5AOZA 4EIGB 3B9KC 5JW5B 1FFQA 2IADB 2UXFA 5C0DA 3OJDA 2PWEA 3CX5J 1VA9A 3IKKA 2ADFL 2QDWA 2VN3A 1OWWA 3ARDB 1TYJA 1QABA 3H7BA 4PV8B 1MJJB 1RUML 4IU3A 3VAEA 3V6FA 2FQFA 4WI9A 3ULVL 4NCC2 4JDZB 1V3KA 1D9KB 2E47A 2JI1A 3MLRH 2DL9A 3BKCH 1HHIB 1C5DA 4G71B 5JIDA 3S7GA 4DZBA 3O4LA 5AWNH 3SEPA 3NK3A 4O4YL 2YARA 2HTKC 4MD5A 5ADPL 4CC0A 1O6VA 4LSQH 4Q6IA 5IEKA 3DBXB 3APNA 1XO8A 4PGBA 1XXDC 2H2SD 3WIIH 2E7CA 5HHXL 2PMZA 4P57A 2QTEA 5DZOA 2VERN 3SCMD 4HUXB 3QO1A 4Y2LA 1PNDA 5EORH 2F7PA 2JJTA 4DP1X 4GW1A 1PDKA 1JD7A 4ZW7A 3VD4A 2HFFB 3BAXA 3ECQA 4QRPB 1Z66A 2BWDA 3DK2A 1A9BB 2FE0A 5FM5M 4OY9A 4CU8A 5I1CH 4WI6A 3VD7A 3UJIH 3X12A 1PLGL 3DXAD 4WFFE 3QEGH 1ET5A 3CZEA 3WTWA 3CFMA 4RMRA 1FFPB 5DYOB 3TF7C 4P3CL 1UZ6F 4ADGA 1MI5D 2IPUG 1INEH 5J7CC 1KB9K 1KBGL 4HEPA 3MR9B 2MHAA 2FR4A 5E9NA 4AUJA 4F57L 4PJEB 5I8EB 5D6DC 4Z3JA 5TE6L 4PJBB 2MOGA 5DZLA 2ZX7A 2B20A 4WV1B 4UQDA 2AVGA 1G7PA 4IK7A 2NY6C 1RFDH 2J6EL 3G6AA 1B0WA 5FFOA 3NIFB 4R96B 3VYPA 2O61B 1U33A 1ZJBA 3TIEA 3CK0H 3A4AA 3VXUE 3LZQA 4Z7WF 5LQBL 3RQ3A 5EU7E 2AQPA 3WKPA 4A04A 2GPZA 5B39A 1FNAA 2EDLA 3MJ9H 3UTPD 5AZ2L 3VXQB 4G70B 2N7SA 4L1LA 5C8JB 3FHAA 3KWTA 4NQQA 5JPMA 1TJHH 3MLYH 1J5CA 2YAPA 3NSCA 1UKTA 3QWRA 5I74C 2DLEA 4M7KL 1OP3H 5INDA 3MJ9A 1YDPB 1XSKA 4ORGA 3QXDB 4LSPL 4M5SA 1H6TA 1B4TA 3QARA 4XCYB 3WDHA 2CZNA 2JCCE 3ULVC 1VFBA 3QEHA 2OAAA 4IK6A 1OGAE 5E8DL 3KMDA 1E4XI 2MCPL 2IV8A 4O2FA 5F89A 3C9NA 4UDTA 3RB7A 3EGSA 1YO4A 5F2FA 5TH2B 3SQBA