3NA4A

D53p beta-2 microglobulin mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
97
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNYVSGFHPSDIEVDLLKNGERIEKVEHSPLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title D-strand perturbation and amyloid propensity in beta-2 microglobulin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Beta-2-microglobulin
total genus 12
structure length 97
sequence length 98
ec nomenclature
pdb deposition date 2010-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3na4A00
4PJ7B 4PLJD 1M71B 5FYLH 4NN7C 1M71A 2IC2A 1Q0XL 1CGYA 1BLNA 1BM3H 3ZKXC 2C4FU 3ZO0A 3P30H 1WFNA 5IFAL 4HIHB 4PY7B 3VXSD 1MCNA 2XFXB 1HDMA 4U1SA 5K59E 2B1HL 4UTBL 3NFNB 1Q0XH 3WUZA 1NQBA 1JF1A 3KLAA 3BQUC 3IDXL 2WBKA 3SO3C 1SY6H 4FG6D 3GSVA 3UCRA 2DICA 1KIQA 2ICWA 1CD0A 3V79C 1U8KA 3TPUB 3OG6B 1T20B 3L3JB 3OF6D 2WANA 4TSCH 5FIEA 1RZKC 1CFVH 2YD7A 3MV8A 1NAKH 2F8VA 1R0AH 5FXCH 3GK8L 4NBZB 2ICWJ 5T1KD 4L4VA 5DD0L 3SKUD 1ROWA 1E6OH 5I16A 3SJVE 3T4AB 1YN7B 1K4CB 4MA7H 3H2WA 1F3JA 1DBJL 1JV5B 1UACH 4MMXC 2GYSA 2QV2A 3I2CH 5KG9B 4WENB 1P6FA 2R0LL 3B9DA 4KV5F 5J6HA 5IFJB 3IXAA 3QIUA 4P2YA 2AXGA 2H2SC 2EO9A 4WEBH 2D0HA 1S7SB 2IH1B 1CL7L 1CR9L 4HS6A 5F6IC 1ZVSB 4P59L 4PJXA 1CQYA 1MCRA 4FMFA 3UAJD 1K2DB 5IHZA 5SX5K 1TJIH 3LS5L 3O6FD 1YEEH 2HLFC 4GW4A 2AJYL 2YA0A 4U1IB 3QDMD 3TP4A 1H8OA 4NRYA 1XR8B 4LCIL 4GOSA 4XXCA 4PJAB 5F6HJ 5KSAB 3WNLA 5MEPB 2CIIB 1UGNA 5EU3B 3VGHA 2ZZUT 2AVGA 4XB7A 3LPWA 3WNPA 4F57L 4HJGA 3WDIA 1UB5B 3BP7B 4LHUG 4MQXC 1Q9KA 3BPCB 3INUH 1IE5A 3O8XD 3BRDA 4K7PH 1KTKE 5GRJL 5C0ND 1N8ZA 5TDOB 2LFGA 3RWHB 5ANMA 2AJXH 1KIRB 4WU7B 5IFAH 5GGTA 5TH2B 1B0GA 1TJGL 3ARDA 1RUML 2GCYB 2FX8H 2Q87A 3BVNB 1BQLL 1X5HA 4QY8B 5D5MB 5TQ0L 3DI2B 2PYEE 1I3UA 3VWJC 1OP3K 2XY2A 1MRFH 4EKXA 3V52H 4OIAA 4IBLT 1U92A 1W8NA 2GTZA 1DQML 1UVQB 5F70A 4MXQD 4GO6B 1NGQL 1F4AA 5DC9B 2YKLH 1DUZA 2LE9A 5CEYA 2GTWA 3UJIH 5JXEC 5D9SA 5IM7B 1MFBH 4GMSL 2CJUL 4XPFL 4LCYA 4JM2B 4PJ5D 5TE7L 5AG9A 1Q1JL 1JYXA 5TQ2L 5EU6E 3U30C 4ZYKA 5JO5B 2D0FA 1JGDA 2QLVB 3C8HA 1TZIB 1DBKH 3I2CL 4OFYD 2J8UF 1CU4L 2XOTA 4OV6F 1S9WB 5I15H 5INDB 3BJ91 4PJ9A 1S5HB 3HI5H 2IAMD 2PXYA 1ACZA 3BN9C 4O58L 4TSCL 5FHBL 3CLFH 4K55A 4KZEL 4JJHA 4R4BB 1U91A 4PJFF 1UZ8B 4R2GB 3TBYB 3MRPA 3QA3A 1HILA 3MV9D 3UTSD 1P53A 1NFDE 3NZ8B 1H5BA 1XH3A 1WCBA 2ITCB 4GXVH 1HEZB 1OQXA 5EBMB 4HH9B 1N5YL 4OCXL 1QFWM 1TPXB 3UTSE 2WMPA 4WW2A 3FQUB 4JANA 4LF3A 4KKNA 4ODTL 4OCWL 1PEZA 4U7KA 3PXHA 1NDMB 4R7DA 3KPOB 5TFSL 3BHBA 4YHLL 1MI5D 3QXVA 4JFZL 5IQ7H 4LPYA 5CP3A 1EV2E 2YPVH 4OSUH 2UY7A 4HJGB 5C0RH 1KCRL 3EO1B 2HFFB 1FAKT 5DJDA 5A2LH 3LS4H 4N1EA 2ESVE 5GS2D 4FFVC 5GS1C 1E4WH 1YEKH 5C6TL 2DQGL 2V5TA 1JNHB 1EO5A 3M17A 3BQUA 4NO2A 4WWKD 3VXRE 1IAIM 1I4FB 2A6KA 1S78D 5EZOH 2DM2A 1A6WL 1CIUA 3ZYZA 3AY4C 1YECL 4QNPE 4JFDE 4LKCA 5J1AB 1PZ5B 1MAKA 4K8RL 5D7IB 5C0JA 4HFUL 1T03L 2W1NA 1YDPB 4HF5H 4RZCA 1BF2A 1IC7H 4JFDD 1AGCB 1NCAL 3GM8A 3LQZA 2XACC 1JWSB 1J8HE 4PBWD 5E8PB 2QKIB 2NR6C 4AIXA 2WAHA 4D9QE 2EDEA 2B7DT 3K80A 1QPXA 4PD4J 1INQA 1HSAB 2DQHL 5DJ8B 4X98A 1A6UL 3OKDB 3PIQA 1PDKA 4KPHH 2BNUA 4P3CH 3TN0D 3HHRB 4XCYB 5L88H 3EYVB 3EOTL 1DEEA 1ZA6B 3IJHA 4OGXL 3CUPA 3LKRA 2YPLB 4BH7A 1GAFH 4YHPB 2IEPA 3CMOL 4HWZA 1U8JA 3DRTB 1I1RA 3WXWH 5EO9A 5AAMA 5EIIA 2AKRB 4OFIA 1CZ8L 2V7NB 4MNGB 2R9HD 4JFZH 4NQEA 5IQ7L 2GEEA 5SWZA 1R5WA 3ARYA 1EMTH 4S1RL 2FJHA 3RKDD 1X5JA 3NBNA 2IWGA 4KHTL 4R7DB 4XP4H 2EC9T 5MHSD 5DD1H 3RGHA 1LO5A 4GRLD 2R15A 1CFQA 4PGCA 4IIQA 4LAJH 4TSBL 5HVFB 3KLHD 3S88H 3U83A 4Y19B 2J6EH 4UV4L 2NTFA 1JGUL 1CFNB 4BZYA 4BJLA 1F11B 3MYJB 3P4NB 5IMKA 4AL8H 4XBEL 4ZXBC 4PGDB 4AENA 1Q9OB 5C3LD 3MLRL 3DV6A 5IVOA 1ORSB 4PRNB 5DSCA 3A6CL 3I50H 3S7GA 1UXWA 1P4IH 3ARVA 2X44D 1ZT1A 5E6ID 5BV7C 4PS4L 3MCKB 3WJLA 3I02B 2ZUYA 4G8IB 1AGCA 2YWZA 4X5WB 1JZ6A 4PJDA 1P2CB 5DUBB 1U58A 5E00A 5IJKC 3UTQA 3WFBH 3AGVA 3NPZB 3OKMA 2PXYC 3RWGB 1C5BL 1KYOJ 4RDQG 3ZYJA 2DRUA 3G9VA 1RURH 3QUZA 4U1HA 5FA4A 5HSFA 4LCCA 4R2GD 2GKIA 2JIXB 3CPLB 5CSBA 2O5ZL 3DUSA 3BN9D 1WC7A 4GS7B 4PB0H 3C9NA 2BY3A 2FH6A 4NRYB 1FE8L 4DAGL 3W11D 5ESAB 5AZ2L 5C8JB 1MRCH 5DHVB 4RQQA 4JEGB 2H2PC 5C86A 4U2ZA 4OGZA 1U91B 3TVMC 5ADPH 3G6JF 3QIWC 3TVMA 6FABH 4X7TA 3S3SA 1MI5B 4I9WE 1G7QB 1M7IA 3E8UH 2HVJA 3G5XB 3UTZB 3UDWA 5HHVL 4PJGF 3F7YA 4PRHA 3VE0B 4DEPB 5B4MC 1ZLVK 4NRXA 5E70A 1I1AD 2ZPKL 3NIFE 1MCFA 4KY1H 4MJID 3T09A 1IM9B 4AM0A 1A7OL 4I2XB 4JDZA 4LFHD 1NMCC 3CFIC 1LNUA 2VLJB 3TNMB 2F19L 4LARH 3LKQA 3WN5A 3S88L 1T6WA 1DUZB 5CEYB 3SBWC 4NHUA 1TXKA 1X5FA 2BVOA 2VL5A 3FO0H 3TA3A 1WIPA 2Q8BH 2Q7YB 3UYRH 2ATKA 3VFPA 4QRPA 3RGVA 3JWDL 2AQ1A 5K9QI 3QIUC 4L9LC 4JGMA 5INDA 4QXTB 4XPTL 4I3SL 3P11H 2XA3A 2VXSH 1SEBA 2OI9C 3VDAA 1RFDH 3D2UA 4PJEE 5IB4A 5GRXG 4Y2DC 2OBGA 2AJSL 2F5AH 1ZHNA 4DFHA 1YYMH 3BJLA 4U6VH 3P2TA 3S36X 2XY1A 1UM5H 5SWSD 3D25A 2D3VA 3D25B 2FO4B 1LP9B 4ZTPL 1KN4H 4APQB 4KPHL 5FF6B 4LCCB 2EDQA 3QBTB 4PJ8C 4PJDE 3X17A 4LU5L 3BWAB 4ZUVA 3VWJD 1S7TB 1S7TA 1MFCH 5CAYB 1Q9LB 4NJ9H 4ODHH 4QYOB 2IMNA 3LKSA 2YPLA 4BH7B 4TULL 5DRZA 2JK5A 2RCSL 2WM0A 4KHXH 3I6GB 3LPFA 1PLGL 4H5SA 5FYJU 4X9IA 3QUKA 1NAML 2JB6A 3SE3A 1NUDA 2YK1H 3VG0L 1WSST 4PYHA 2FCBA 2QJDA 1MWAH 1KCVL 4JDZB 3KXFB 5KVMC 2PCPB 2VQUA 5D1XC 4Z78B 2FWOA 4XP5H 2DIJA 4R8WH 1BFSA 4S1SL 3DXAE 2FATH 4IIQB 3B3IB 1WK0A 2Q7YA 1F97A 2AJVH 3FB7B 5DVKA 1IFHH 4B41A 4FA8A 1P9MA 4I3GA 3TCXA 3LRSA 4JRYA 2FNBA 3D85B 2GY7B 3BUYB 1EMTL 2NNAB 2YBRB 3O4LA 2D7PA 5IB2A 1YUHA 4PRAA 5IR1B 1IQWH 4NFCA 1JF6A 2P1YA 3U0WL 1EA9C 3CMOH 4BFGA 4HEPG 2MTPA 2AQ2A 5JHDD 4H0HB 2X89D 2JKXA 5IFJA 1FVEA 1S7RB 4XPTH 3KPNB 1QHPA 5EOCH 1KCVH 4MNGA 1SYVB 4RAVB 1QLEL 4DUXA 3L5HA 4LLDA 5DRNB 4WFGE 4MA8L 3JWDC 1ZHKA 5F88B 3ZE0F 4OZHB 1UZ6F 2E8ZA 2K7QA 4PRIB 1VFBB 2RAMA 3ZE1F 2H26A 5C0AB 1HDMB 3QNXB 4WW2C 4IRJD 4Y1AB 2KL6A 1AHWA 4X4ME 3ARGA 3BP5B 2W91A 3NA9L 1NDGA 4YIQB 3ZDZE 3HNTL 1FZJB 4YZFE 4OZIE 1AKJA 3GSQA 4WEUD 4S0TD 3ULSA 2QADD 3PE9A 1QOKA 4UDTB 1PG7L 2BC4B 5KBNC 1M7XA 4WI8A 4LNRA 4Z78A 2E27L 3VXUA 3IGAB 3FQTB 4FG6C 2P24B 5ITBH 3MLXH 4U1KB 1CD1A 1VGKA 2VXUL 5HGDB 2Y1VA 2CR6A 3PHSA 3OR6B 1MWAL 1YYLL 5SX4I 3IF1A 3WFEH 1QSVA 4J3XA 5D93C 5E8NB 5FYKD 1C5BH 1LEKA 3WDHA 4M93B 4NOFA 4WFFE 1UWGH 5I75C 1ED3A 3QDJE 5EN2B 3MRRB 4JQIH 4UAOC 5IMMA 2OM5A 4XCNA 3MV11 4HIEB 4RGNC 5IQ9A 2ICEA 4Q0XH 1JZ2A 4B7IA 1S5HA 1OTSC 3K4AA 4YK4B 1C08B 1YNTB 3ZDYE 5EPMB 4MNHA 1F02I 5D5MF 1RJZA 1AC0A 1RJZB 4WUKL 5HYJE 5DEFB 1K9TA 2ZG3A 2WIIB 5B38G 4OKDA 3DX9A 1U8MB 1WBZA 1CT8A 5E9DE 2J88L 1Q9KB 5DJYA 3N9GH 4UTAL 4XCEB 2RQ8A 1T0MB 5CJOL 3HPJB 5INCB 2FJGA 1T0MA 1JF5A 5HDBE 3BPOB 2AAVA 1OAYL 1TJHL 5JZ7C 1MAMH 1ZV5A 3BISA 1G1CA 5MEQB 1IGCH 4YEEA 3EBAA 2NQCA 5D5MA 1B0RA 5E9DA 3PWUB 4N9OB 4UBDD 1YYML 4U6VL 3V5KA 4LASL 5HYQB 2XKNA 5FA3A 3KNBB 5HPOA 1EJOH 3K7UA 3IYLW 3MGAA 3MSPA 2CO6B 2GSIB 2H45A 4IOSD 5TQ0H 5DRZB 4JO4H 1F8TH 3JV5A 1JZ7A 3QG6B 4X5XA 1D5IL 4I18C 5GS0H 1DVFC 1AO7D 1UENA 1ULVA 4L3EB 3PWVA 4AYFA 1RUPL 1XT5A 4KDWA 3B5GA 2YC1B 4N8VB 3MFFB 3MGTB 3IRPX 3VCLB 1GVIA 1J8HA 2W65A 2HT4C 3CIQA 4QWWC 4Y4HC 4GQ9L 2X2YA 5B4MD 1BFTA 3FFCD 4P2OB 5TPWH 1G7PA 3MJ8A 3S98A 4LBEA 2MQ0A 3OKKB 3BIAX 3QIWD 4JRYD 3BPLB 1MLCB 2VH5H 2VLJD 1N64H 1JI1A 2FEDC 2YK1L 3OSKA 3RL1B 4XZUA 3VFUA 4YAQA 2VL4A 5L2JB 1FHGA 1N5AA 4OLYL 1U8IB 4YBHA 1F00I 1I8KB 3C60D 1BFVL 4UU9B 4RBPK 3T2OA 1I3RB 2XN9B 5FO9B 3KPOA 4W6WB 5E4EC 1YY8B 1MFDH 2IANB 4NUJB 4XNUH 4GXUN 5D7LD 4NJ9L 4HXAL 2DYPA 5BZWB 1T7XA 2DYPB 5DVLA 5ETUB 5E08L 5I66B 4FTVB 2DQFB 2DM3A 5C07D 4BFEA 1UH3A 3TIEA 2AGJH 4JFHE 4G8EB 3ALXA 2DOCA 1PVHA 4L4TA 3B2VL 2ZCLL 2VZSA 4MDIB 4YDVB 4AT6B 4Q2ZB 3LN4A 3KPTA 2VR9A 5ALCL 4U2YA 4NZDA 3GJFA 3HPLA 2VITB 4ORGA 5HDLA 3HPLB 5JA9A 3O3AA 2KH2B 4GT7A 3UZEA 2Y6SC 4EN3A 2VDPH 4PR5B 1FZMB 3LPGA 1XGRB 3HG1D 2DS4A 1EEUA 3UX9B 1BIIB 3JWOC 4KJYB 5GRYA 3GRWL 4JRYB 2RCSH 4KHXL 3ARFD 4EUPG 1OSZA 5C7XH 1DQDL 4OJFH 4R4ND 2WV3A 3VJ6A 2E9WA 1DE4B 2EYRA 2DBLH 3CCHB 3U1SL 3QDGD 3BX7C 4F15C 2LVCA 2B20A 3AM8C 4K3JL 3KPQA 4YFLI 1SJVA 2XXMB 1A7OH 4W4OC 3DUHA 3ULVD 2JF1A 4KY1L 2E5EA 4V1DA 4UIMB 3ZKND 3RGVD 4XRCA 1MCOL 3RY4A 1A6WH 4WUUA 3DNKA 1BEYL 5I6XC 4YX2H 3IETA 5DQ9A 4B50A 1FYTE 1CZ8H 4S10A 2GSGA 1G6RH 4J4PD 4XCNB 5CP7B 5BVJA 2XZCH 1S8DA 4NN6B 2FGZA 4NQSB 3IDUA 4UQ3B 4HK3N 1KT2B 5A2JH 5FK9B 4WI3A 1X5GA 3MTRA 3O11B 5HTSA 5JNYB 1D6VH 4X8XA 2WINB 4MXVF 4YDKL 5KSBE 3MLVH 4OCWH 3C6SA 5T1DH 1A02N 4XCFL 4U6XB 2AJUL 1AXTL 2NY4C 4HH8A 4JG0H 5F6IB 1J0YA 1K6QH 3LEYL 1AR1D 4I77L 4LNRB 3KJ4C 1QNZL 1IKNA 1BGXL 1ZLWK 4J3OC 2ENYA 5GJTL 4LEXH 2OK0L 2OJEB 1G6VK 5ITBL 1DEDA 3IJYA 3FCTB 3SOBH 1TJHH 5FUCC 3UROR 4IRJB 4OM0H 1YQVL 3ZDYF 3QI9A 2X41A 3STZB 3O45B 3VD4A 1D9KD 1HINH 3RGVB 4JGUA 4M5ZH 3KS0H 2V2TA 2XWJA 1P1ZB 1JPFB 5GS3A 4PREB 3ZDXF 2JIXA 3CPLA 4CRPA 4PYGA 1RAMA 4HAFA 1GGCL 2V17H 4MNHB 1BX2B 3PP4L 4PRDA 3K8MA 4ACPA 3B83A 1JFQH 5B38B 4M5YH 3GBNL 4R96A 5TFSH 4XP4L 1LILA 3HR6A 1TNMA 3GBML 1L6ZA 1TZHB 2IFFH 4XCEA 2ARJA 1ORQA 2OL3H 5C3TA 5KSAA 3TF7C 4IOIB 4ZAKD 3HZYB 4TVPL 1IT9L 1GGBH 3RVVC 5D1ZA 3KHOA 1HWHB 1IGTA 2RFXA 2ADIA 2Z91A 3GHBH 1KCSH 5MENB 3CFEB 5ACMA 5BS0D 3HZMA 5HI5C 5F1OB 1MJJB 2K7PA 1I8IB 2HLAA 5HHOA 3VRLE 4JO3H 2HJLB 5HHOB 2ZOLA 1BOYA 4RMWA 4HUUB 3MJGX 2ICES 2R8SL 1JE6A 1BJ1H 3NIDF 3QJFA 4QRPB 1SM3H 1IC5H 5D1QC 4Q9RL 1P7HL 5F7LB 1D5BB 1M05B 2P47B 3MFFA 3MGTA 1M05A 1MEXH 4U3XA 5DWUH 5A1AA 4F58L 3PGDB 3R0NA 4FQLH 3G04B 3S5LB 5F1NA 4ZO7A 5L2KB 1DSFH 2PW1A 2FJFA 1PSKL 1X4YA 5FYJH 3CVHA 4WY7H 4N5ED 5C0FA 1DTUA 2FEEL 3Q1SH 4AG4H 4YHKH 2G2RA 1T66C 3WXWL 4W4OA 5D72L 4GBXD 3DHMA 2VDQL 5M7QA 2FL5B 1VKXB 1NPUA 3DMMA 4O51B 1QKZL 1NCCL 4NO0D 3U9UB 1P69B 2EDHA 3S34L 4JFXB 5CCKL 1SHMA 1DVFA 4WW2B 4KKBD 4IIQC 3WMSA 1U41A 3AS3A 2IQAA 1C5CH 3G5YB 3MOAH 5GZNC 4J3WA 5E94B 3CFCH 3SGEI 5BVPL 3FO1B 35C8H 3RDTC 4HX1B 3IFPA 5F89B 1SYVA 4YBLB 5C2UB 1DANU 1T1ZA 3OF6A 4JO1L 5MP6L 2AJ3B 4OCSL 4FOMA 3QWRD 1ND0B 1A6AB 4GAJL 4WRLA 4RFNB 1EGJA 3QDHA 4U1NB 4C54A 3MRMA 5AD0B 1EHLH 4HKBB 3NH7L 3IU3B 3MNZA 4IMLA 3S5LG 1NFDA 3UPRA 3K46A 1FP5A 3TT3L 1H3PH 2VC2H 5IR1A 3REWA 4M62L 1DR9A 3MODH 1JWUA 1E28A 3MRQB 3WFDH 2AV1B 3CMGA 5E8EA 1FO0A 4L1DA 1UM4L 5HI3D 1QR1A 1S7WA 1PGRB 3FFDA 3TM6A 4XVJH 4ETYA 6CGTA 5HHNA 3O3BB 4M7ZB 3WHXA 3KLHC 1FFNA 4P23D 1UWEH 3IJSA 4OQTL 3QG7H 1LP9E 2F9BT 4PJCF 5KTEH 2J8UA 3C5ZD 1JZ8A 4RCAA 2EYSA 1BBDH 4NSKA 4P5KA 5DTFA 5HPMA 4D9QD 4KI5E 3ARWA 4LSVL 1AQKH 3MFGB 4AQOA 4Y2DB 4XPGL 4LEXL 3HI5L 4XBGA 1FE8H 5FYJD 4QF1B 5EO1B 3EO0A 3GSNL 2DI9A 3HC0A 4Y5YC 1U8HB 2DKUA 1JGVH 1OP3H 3JTTB 4XP6H 5T1DL 1OAKH 2DAVA 3F6LA 3FMGL 1DLHA 2X4UB 4WEBL 2IADB 3ES6A 1FIGL 3MRGB 4FQHB 2YOCA 1CFSA 3G5VB 1MI5A 1OAKL 5D2LB 3MPCA 1GIGH 4AIZB 2XZCL 4G8IA 4QRRD 3FCTA 5C08B 1UACL 5IVZA 1HOCA 3LV3B 4P4KD 5DLML 3MA9H 4X6CF 4O02L 5J8OA 3G6JE 5EZIL 3VI4F 3MXVL 4MMZC 3QI9B 1UC6A 2NCMA 5GRJH 5IEKA 2NPLX 5J11C 2EDKA 3RL2A 1NEZB 2HVKA 1OP5H 3KS0J 2HWZL 5T5FL 5IM7A 5DUML 4ESKA 1OAXL 1JP5A 3F62A 3RWFA 3BEWB 2XZQH 4JPIB 4X7FC 2PR4L 1UH2A 1NBYB 2DBJA 3QFJA 2P5WA 1JHTB 4F7EA 43CAA 4YQXH 4YDJB 5D6CB 5GIRA 3LZFL 4O5LH 1QFUL 3MRPB 3QA3B 2C26A 1X5XA 2R0WH 5AZEL 3RTQA 1MUJA 5ID1B 3HUJB 4OD3L 4I2XA 3U9UA 4APQA 5LGJA 4F7CB 5T5NF 2KDGA 3VMNA 1I8IA 2HLAB 4ONHB 1WWAX 4Z7NE 1N3NA 2R2HB 1KC5H 4LSPH 3RZCC 5GSRB 1NGXB 4JFED 4TPRL 1OTSD 3TCLA 3BZ4B 3QH3A 4XBEH 1FV1B 1ADQH 3CX5K 3RQ3A 5ERWA 4MVBC 4X6BB 3TIEB 4MZ2A 4GAJH 1VACA 1IEBA 1UYWL 4MXWL 5D9SB 1OB1B 4NFDA 3TN0A 3I84A 4QHLB 3GMLA 3H3KA 3U7WL 3U9PL 4HWUA 4YH6A 1A5FH 3G04A 3CSPA 4XVUC 1HOCB 4MB5A 2Y7QB 3PG2A 1JHKH 1JNNL 4WO4C 3ULUL 2H3NA 3TA3D 4HIJB 3VRJA 3GO1L 4MD4B 2FYYB 1IGYB 2NY1C 3OKLB 3QHZH 3RL2B 4F9PA 5E24E 1S7UA 5DK3A 1XGQB 1NCCH 3ISWA 3WCYA 3REWB 1HHGA 4PJHF 3RPIA 3H9HA 1WBXB 5D1QD 3WXVL 4G5ZH 4LPTA 1Q9LA 2AEIT 2MMXA 2Q8AH 3WO4B 3OXSB 2VIRB 4NCC1 1FRGH 4G6JL 5I19L 1HH9A 5GGUA 5DD5L 3H42H 1AXSA 1RJLB 4OB5L 3E1F1 1AH1A 1DZBA 4JM2C 2NW3A 3PJSA 1YN6B 1E4KC 2R2EA 3DVFA 1ZS8B 2KBGA 4YHPA 1LO0H 2FB4L 4OLEA 3OGCA 2W60A 4U7MA 1KACB 2OP4L 5D7KE 5HDOA 3P4MB 3QHFH 4PJEA 3UXFA 4JREB 3C8KA 5F8RC 4JFFA 1ZHKB 5F88A 4K23H 4UQ3A 4F8QA 2V2XB 1FV1A 4X7CC 3ROOA 3O9WB 4POYA 2VLME 4KRMB 4WW1A 4ZPVB 5CMAA 3NCMA 3P73B 3KPSB 3MLZH 4XNZB 3ARED 4ZMAT 3V6OC 1FH5L 1IBGH 3ILQD 5GJSL 3U46A 2DLHA 1JBJA 4U1MA 1L0QA 5GISL 4PY8J 1AKJB 4KVNH 5FM5M 5JORA 4N5UA 2ZCLH 4FQXD 5TDNA 1QR4A 3E3QE 5IB2B 1RFDL 3QDMB 4Q0XL 3T1FA 1HSAA 1INQB 1BQLH 1PKQA 1HQ4A 4JHAL 1OF2B 1Z0MA 3SEPA 4ZTOH 2MCG1 3L1OH 4WI7A 4WNQA 5J89A 2YPLE 3CU1A 4OF8A 1TQBC 3HS0B 3U0TA 3CSBA 5F1SA 2GFBB 1CXFA 2EKSA 5HHOD 2NY6C 5LWYH 4HUMB 5B39B 3RBSA 4WI6A 2IPUG 1FLRH 3I3EA 4LHUB 4QTHB 5ALBL 4MSWA 5B8CB 1BVZA 4NQCE 3KYKL 4HC1A 1I9EA 25C8H 4Y4KB 5L0QC 4QKXB 3L3HB 4OCRH 5LCVL 4EOWL 2PO6A 1FNGA 3SOBL 1MFAL 4Y7MA 2XTJE 1DBKL 1CFQB 3RNKB 2R2EB 2NTSP 5E4EB 1T2QL 1WQVT 2EXYD 1NDGB 5E8DL 1IQDA 1RZ7L 4Z77A 1FIGH 3RZWA 4BM7A 3DROB 3FT3B 1AHWC 2AJUH 1RUPH 1G1YA 5CSGA 2O5ZH 5D7LA 3BEVA 2R29H 4TUOB 4CVZB 3BO8B 1KLUA 1CDHA 2YPKA 1CBVH 4P46D 5TH2A 1B0GB 4YWGH 2AW2A 3GSNH 3CVIL 1I9RL 3IS1X 1F6LL 3DYPA 3GM0A 3STLB 1DUYA 1I85C 1U3HC 3BP6A 2W0KA 4ODBD 4JFFE 4WGVB 1A9BB 2CRYA 1KXTB 2E7MA 2DKSA 2AK4B 3ROLA 5DUBA 5GJSH 1F58L 2FBJL 3MOBH 4Z0BL 1AC6A 1S9VB 4G3YL 1S7VB 5C07B 3WKMH 3GSRB 1YMMB 4HMDA 5BMFL 5IW1A 4LSRH 4DK6A 1TZIA 3QEGL 4JDVA 4ZUUA 2HT4D 1S9WA 3EYFB 3F12B 4YNYA 5D7JC 4PGEA 1FO0L 2CKBH 1QBLL 3OJDA 4KUCF 4KH2A 5ESAA 1E4XL 2B8OT 4OD2B 3HZYA 3QEHB 4JZJA 4K71C 4MNQD 5EU4A 5KJRL 1PAMA 2VDKL 3AREA 2Y5TB 3BGFB 3FAWA 1T3FA 4HBCL 1CI5A 3VD9A 2FGWH 1GOHA 4D0DB 1HEZA 5EBMA 5DR5H 4P4KC 3WLBB 4IS6A 4J12A 1T5XA 1MY7A 4QOKB 5DD0H 3SDAA 1DQLH 1EGJL 4M61B 2JCCB 2NXZC 5E94A 3U4AA 2YSSA 5EC1A 3PV6A 1O7VA 4PGBA 3RWDA 4PV8B 3I3DA 4L8SB 4UNVA 5F71A 2ADJA 2VDOH 2R4RL 3PWVB 1R5VB 4K94C 3LKSB 1R5IA 3NIGF 3PL6D 4KU1A 3B9KB 1TMCB 1MCEA 5D2NC 2IMMA 4ELMB 3VFPB 2QADB 3FKUS 1INDL 4IRZH 4PJEB 4BK4A 1YEIH 1YMME 4PJ5B 4N8VA 1CG9B 1EO8H 1GRWA 1RUKH 3WJJA 2V2XA 3LEXB 2HMID 2W59A 4UILL 1X5YA 3SQOH 4CL7A 2A0LD 1EFXD 4E41A 2UWEB 5T1LD 1WAAF 3WD5H 5BW7C 3OKKA 3EGSA 3SJVB 1FNFA 3RAJL 1JRHI 4RZCB 1RD6A 2O5YH 4MJ4A 2XG5A 3ARBC 4M43L 5IW1B 5DJ2A 2UZIL 2BCKB 4ZS6D 1F4HA 1W0WB 2WSKA 1P5UA 3ARTA 4LOUD 1DQLL 1UG9A 1NGPL 1P7KB 4Y16B 1WAAA 3CK0L 1TZGL 3RU8L 4DCQA 1ETZB 3OXRB 2FGWL 5IT2L 3DARA 4J8RA 4WO4D 3BIKB 3NZ8A 1ZKAA 4F7MA 5H2BB 1MCPL 3EW3B 1FQ9C 4PJIA 2MWCA 4OTXH 2D4FA 3O6FA 2GW5A 2ZCHL 4H5SB 4LLAA 3NFPB 2W9EL 3V52L 1FGNL 2VDRH 5FYLD 1F8TL 2PKDA 3QIWB 3NCBB 4KMQA 4X7SL 4QRSB 4LIQE 4OD1H 1MQ8A 1F6AB 1V7NH 3TFKC 2APBA 3DURB 1I3GL 2GJ6D 2NY2B 3UTSB 3DURA 5D7IA 3UTSA 4ZPVA 3TC9A 5GGTL 4FFWC 4M8VA 4MA1C 3P3YA 3BGFC 1A7PL 2G60L 2VLLA 4Z8FH 2LABA 4MAUH 1IQDB 4PJBE 1XGRA 3DJ9A 1RU9H 3MV9E 1IAMA 2AABL 3I9GL 2D9CA 5AZ2H 5GGRY 1I9RH 4L9LB 1OGAE 3PDOB 2A6KB 4X80H 2BNQE 4OIBA 1IGMH 5I1KL 5KVEL 4FTVD 5HHXL 2CDGB 5GRUL 2QTEA 2DDQH 4G7VL 1FFNB 1EXUB 3D3VB 3ZL4H 1U8QA 2DD8L 4XCYA 5CJ8A 4BA8A 4WFHE 5D1XB 4Y5VB 4D9LH 4JFPB 4FFWD 2Z8RA 3H7LA 1HZHH 1VCAA 1A3RL 1LO2H 4WFEE 4WHYH 4GAYB 1UH4A 1WZLA 1ZTXH 4XHJD 1XFPA 1RV6X 2HG5B 4K3EL 2Y23A 3IS0X 4H8WC 4U1GC 5J13C 4KK8D 2A73A 1I7TA 2XA8L 2FX8L 1I7TB 1YQVH 4Y4FC 5CZXC 4N8PA 4W70A 8FABA 1F4XL 4PP2A 3T0ED 3ZTNH 2WINA 4R4FH 4E0RB 4CN6A 5L9DH 3AUVA 4I48B 4PJ8B 4QT5A 2W9DL 2LTQB 2YD6A 5FK9A 3AMLA 4BSWB 5D8JL 2NY0C 2R0ZH 3RY5A 4L3ED 5DJYB 3TO4A 5JXAH 1WV7T 3HUJA 4AIZA 4ZSOA 5DA0B 4TUOA 4UV7H 2I27N 1KV3A 1KPUA 1LK2A 4FABH 3BDYL 3BAEH 1J1OL 4UI2A 5IW3A 3STLA 2CK0L 4JFFD 4HPYL 4LHJB 5TDPB 4ORZC 2YEZB 5A16A 1FBIL 2VLJA 2RHEA 4YHYC 4XCCL 1RK0A 2VAAA 1U8KB 3TPUA 5CBAB 2YMXH 1CFNA 1EHXA 5FV2A 3C60B 4KTDL 5D7IE 2QQLL 3RWGA 5ISZA 1DBAL 4LPWA 4HUXA 5HGBA 1C16B 4RBPH 4PRDB 4KI5F 4PRNA 5DSCB 1B4JL 1EERB 2C1OA 4J3VA 3KWWA 2NW2A 5DDHA 3T4AA 5I73B 4IJ3C 4QHMA 1LEIB 3CLEL 2FHCA 2DJUA 1U3ZA 2AXJA 2BSED 4M6NH 1HHKA 4J7RA 1J8HB 1A6PA 2W65B 3I02A 2OJZL 5EU5A 1WZ1L 1RMFL 4LSVH 1A6ZA 4Q97A 1T1XB 2BNQA 3U0WH 3CH1A 1FCGA 4EUPB 4LDLB 2P42B 3MLYL 4NKIL 2HH0H 4PB0L 1DQDH 1KTDB 4XC3H 3RUGE 4MA1B 1UJ3A 3R06A 3WNMA 3FQRB 3V6BR 1OAZH 3JWOL 1NGWB 4HW6A 1U8IA 1Z5LB 1NSNH 4MLIA 3M8OL 1W0WA 3K8KA 5FGBA 3S3JA 4QGTA 4Z7WF 5C2BH 1KCKA 4XMKL 1OL0A 3FB5A 1C5CL 4HUUA 4Y5YA 1Z0NA 4OIIH 1BZ9B 4ZUSB 3TZVB 3ZE2E 2J8OA 4WUUD 3KPMA 4JHWL 2RIKA 4TNVK 4CU7A 4OI7A 4C57C 2HFFA 5I1DA 3B9VA 5D7JD 1OB1A 2BSRA 4QTIL 1CGTA 4X7TB 3MRNB 4I18B 3D85D 3CDYA 1W2KT 4D0CB 1DBBL 1MLBB 1Z9LA 2WUCH 5BO1H 4FP8L 3EFFB 1FDLH 5DQJB 2NXYC 3V0WH 5B3JF 3ULUC 4TTGA 3TBTB 2JB6B 5EBLB 1NANI 3SBWA 1I8MB 4P4RB 1X6NA 4ODVL 5CFHA 3HE6D 2Q7NA 1S7XA 3VXMB 4XPAL 1GXEA 1GHFH 2NY3D 3MO1B 1RHHB 5J1SC 1KJMA 3X14A 3W9DA 4Y2DD 3SJVA 5AYUH 1FZOB 4NKIH 3TYFA 2I60L 5F9OH 2DLFH 5FB8B 1D9KB 5DMKA 3ARRA 4IJ3B 3KXFE 2H6PA 1L7IH 4FQIL 1SJHA 1WZ1H 1N5AB 1TIUA 1DVFB 4ZTPH 1UWXH 5IVXF 2CR3A 4ZPTB 2FEEI 3OXSA 4PJ9B 4DN4L 5DD6B 3QFJD 2X4SB 3VD3A 2HN7B 1JTTA 1AJ7H 2LU3A 3QQ3A 1DBAH 2F5AL 4P2CG 1G7MB 4GUPA 1MCCA 5DK2A 1X7QA 4G42B 3BGMA 3HRZA 3PGFL 2J12B 3CSGA 3UBXG 4IDLA 1IT9H 5FKAB 4G8EA 1CLZH 2OL3A 1P7QB 4R26H 3DO3A 1Z2KA 2XICA 1GPOH 2YZ8A 2A73B 1I1YA 2J5LB 4HBQA 3NACL 1W72H 3NCJH 4LQ1A 3GBNH 4ELMF 2EDRA 1F4YL 2W92A 4HDIA 1QQDA 3L3OA 1VEPA 3LH2L 4XNYL 2CIKA 1DLFL 3KXFD 7FABL 1CXKA 5CBEB 2A74B 3HC0B 5C0IB 2CIIA 5EZJB 3U4EA 5IHUH 3I6KA 4Q9RH 1JGLH 3D69A 4QXGL 4Z5RB 3MV7E 5DRWB 3IDIB 5ICXB 1AO7B 4A6YL 2W9DH 3T77A 1JNHA 3D18B 5GGSY 2NY5H 3D18A 5LBSL 1OWRM 3CFJB 1BIHA 4E5XB 1CLCA 1HYSC 3L6FA 1BQSA 4WNQB 2A77H 4XWGL 3BVNA 1MRCL 1P4LA 3BH9B 1OARH 1NKRA 2AEQH 2ZKHH 3MBXL 1X44A 5I1HL 5GS0D 3RX7A 1UVQA 4M62H 4NRZA 1QNZH 1SEQH 4LVOC 5EFIA 5DFTA 2H1PL 4YHYB 4OLWL 3NIFF 4ODTH 4KDVA 1FORH 4MZ3A 1FNAA 1RUAL 4S1DC 4UBDC 1MREH 4PLKC 2XTJC 1JGVL 3T8XA 5F96L 4NZRH 4MVBD 1I1AA 3JVGA 2X1QA 3E2HC 3QCUH 1RZFH 1RZJC 1F3DJ 3MV9B 5I1JL 1R3KA 2BMKA 5FM4A 4WO4A 1HHIA 2OQJB 2Z31C 3BKMH 4GUPB 1U6AL 4DVBA 5GISH 3PP3H 4HWZB 1U8JB 3DRTA 3TGXA 4TSAH 1UXSB 3MACL 2YD1A 1A7PH 2G60H 5TE4L 5F7NC 2D7TH 4P2RD 1D5XA 1LO4H 4OZHA 2FD6L 2P4AB 4G6KH 5TGBB 2XXCB 3RKPA 5IVZB 2OR9H 1BREA 2NXZD 5FEBA 3MBEA 1V3KA 4YHIA 4ZD3H 4HT1L 2FX9L 1MAJA 3G5VA 5D7LE 1HXMB 4P0DA 5IEKB 5I1IH 1BAFL 2GJ6B 2NY2D 2XQBH 2GTZB 2ZOKA 5IGXH 3EO9H 4K2UL 2X1XR 4NQDE 3TA3C 4NM4L 2NMSA 1M7DB 2BSRB 4KTYA 1B6DA 3B9KA 5KVDL 1YEFH 1WUNT 4LGSB 2W0FB 1CXHA 4XNQA 2W0FA 1MHCB 3VXMD 3FAXA 5IEHB 2NXYB 4XC1H 3QPQD 5GSVB 4D2NA 5LAXA 3TESA 4IRSD 4FXGA 4PRPB 4X0KA 4ZFGL 5T3ZE 4FFYH 3DMMC 1GGTA 2HFEB 4P3DA 4JPWH 2PYFB 3CZJA 4DKEL 2DI8A 4PLKD 2WIMA 1F90H 3HC4L 5EU4B 4F15B 2NLJA 3DX9B 2XKUA 2OTUB 3DVNA 1KJVA 3ZSSA 1NBVL 1ZLUH 1WCBB 2FBOJ 4PPTA 4F7EB 5CEZD 4TOYL 4G9FB 4QRRB 4MQ7B 1T4KB 3W11C 1XF1A 1NKOA 5DYOB 3BPLC 2Z0BA 1GZQB 4WEMB 3E6FB 4U3CA 3QCTL 5F9OL 1CICA 3E6FA 1C12B 5E5MB 4O9HH 4LIQH 3H9HB 1WIUA 5C09A 3HUJF 2QHRH 4JFQB 4XMPL 4JFQA 3LDBB 2VXTL 1CXLA 1SMOA 2ZOLB 1G7JB 3KJ6L 2EEAA 3S36H 3PUCA 3FTGA 1A8JH 1SYSB 3VXME 1T80A 5JHDA 5ERWB 4PJIB 3AXLB 1WZKA 4WW2F 2EIZB 1FDLL 5A3IC 3CH8A 1I1FA 1BQHA 1OTUC 4LVHC 5TE6L 3O4LD 5JW5B 4NO5A 1JZ5A 4LQFL 3O6LH 1T21A 5M95B 1SBBA 3UJTL 3VXTA 4FTVE 4ISVA 4NQDB 2H8PA 1RVFL 4OT1L 2GJ6A 2XQBL 1J9CT 3WNNA 1G7LA 3QQ4A 1YDPA 1DQJB 1INEL 2CIKB 4JFFB 2GSIA 2E9JA 4M1GL 2CSPA 3QI9D 4G9DB 5KS9E 4G9DA 5ILTH 1GGUA 3IXTA 3W9EA 2BVYA 3QRGH 2IGFL 4HHAA 1A7NL 1ZGLP 3C5SB 5E8PA 4GXVL 3IKCB 4DTGH 2VJXA 3BW9A 2XZQL 4WV1A 4U6YB 5E5UB 3VGEA 4D3CH 5CINL 4LLVB 5E56A 1RJLA 4GRLC 4KZEH 1T0PB 3SKJH 5T1KA 5D7SL 1J8HD 3MRLB 3QDJB 1U3HB 2VIRA 3DTXA 4LCUA 4UT9L 4OZGF 3FFDB 1GOGA 1B0WA 3THMH 5CWSA 3P11L 5GGTH 2BVPB 4F7TA 1FPTL 4HGKC 1QO3A 4GAGL 4Z7VB 3DO7B 1CICD 3B8YA 3V5HB 3DO7A 2QQLH 4N8CH 5EORL 1XF2B 2G75B 5F9DC 1MRDH 2G75A 1FGNH 3GI9H 2Y9RT 4RNRB 2X4RB 4Y19E 3SDAC 3HUJE 4H88L 4HIIA 3L3KB 5JOFB 3UTOA 3N1GC 4O2EA 2VZTA 2XZZA 2XV6B 3TH2T 4GLRH 1YEHH 3D0VB 4I4WA 4Z95L 3GIVB 3LN5A 1S9XA 4KDTC 5E8DH 3OGOE 4ONFH 3RDTB 3SE9L 3U46B 3JUYA 3VGAB 2YD3A 4UINH 2WBJC 3UPRB 1BQHB 5HHVH 1R24B 1OTTC 5BXFA 3CJJA 3PDOA 3G5XA 4WDIB 4EOWH 4JPVL 5I30L 5ADOH 4TSAL 2BY2A 2QSCL 4KJQC 5IG7A 4POZC 1C7SA 3QQ4B 5IVXA 3H0TA 1MCKA 1FFPB 1MIML 4K3JH 3ARXA 2AJYH 3TT1L 1J5OH 4X4ZA 3C08L 1LVEA 2Z35B 1ZANL 1JTPA 5KG9A 3IJSB 5B39A 3QG7L 4Z76A 1RHFA 4OFDA 2VXVL 2GFBA 4JR9L 4CKVX 4M4RA 2VLRE 1QLRA 1ZTXL 3O9WD 4DOHB 1MPAH 3SDYH 1LO2L 3CVHL 4M8QB 3JV4B 1KUMA 2P46B 4LMQE 4HS3A 4PS4H 4PJAA 4JRXA 2AEPH 4WTZG 3GSWA 1T1XA 2IBZY 4HC1L 1Q94B 1WCQA 2KZ1B 4XXDA 4U1IA 1QFOA 1IGML 1OP9A 3TBSA 3BPCA 3KGRA 5TJWK 4I3RL 3RZCA 3N50A 3SDDB 2HVJB 3UTZA 1K3ZA 4YHNA 4FXKA 2DYPD 1HYSD 2Q76A 5MEQA 1RZIA 3BP7A 1XF3B 3QCVH 1KEMH 1BLNB 5C09B 4NC2B 3KPMB 3T3ME 4EDWH 1ZHLB 4N8VG 4H26B 5CHNA 2O5XL 4L9DA 3WBDA 4JAMB 2XFXA 3VD5A 3BZDA 5GS1B 1XF4A 1TCRA 3WO4C 1F4WH 5CEXA 4CADB 5JXED 2GUOA 4LCCC 3AY4A 4JDVB 4ZUUB 1UJ3C 3W5NA 2YD2A 5T5NG 4KQ3L 3NAAL 1ITBB 1E4KA 3GSRA 1WFTA 4PFEA 2CXGA 2EEBA 1G9MC 3QEQB 3MO1A 4P3CL 3OR6A 4LLYA 3S3PA 1D5MA 2X5PA 1QBMH 1RJYB 3NIGE 1CD8A 3ALWA 1SJEA 2J4WH 2X1OA 3S35L 2MHAB 4KZDL 2MHAA 2R2CA 4YAQB 4AEHH 4PLOB 4FQJL 1XGPA 2ITDA 4RFEB 5F9WB 2EIDA 2XRAL 4ZDHB 3B5TA 2WWKO 3IKCA 5HGAA 3GKWL 5FM8A 3W0WA 2VISA 3MLYH 3FB5B 1IC7L 5FYKL 1A2YA 5HHQA 2QHRL 1JWMB 4EDWL 4JRWA 3PWNB 3B43A 4XPAH 2PYEA 2VLRA 4JFOA 1YECH 2X4QA 2LQRA 3DETD 3P0VH 4PRPD 5CGYD 1JVKA 3VXNA 4M1DH 4MQXD 4WGWB 4TOYH 2LU4A 4PJ5E 3SE3C 4Z7VA 1KG0A 2VN7A 4YO0B 3TPKA 4GJTB 1LDPL 3MV8E 4JFYB 4NPYB 2YMXL 4HJJL 2D03L 2I9TB 4X6EB 3I6LD 5C0CB 1N6QL 4WTWA 1KCSL 1LD9A 1IARB 4LVNC 5DEGB 4OLUL 1A14L 1DQTA 1VPOH 3AU1A 3C2AH 4K3DL 1RZFL 3ARGB 5KVFL 4YE4H 4AH2A 4JQIL 2QR0B 1QSFA 3IFLL 5EBGA 1ADQA 2A9NH 3QPXL 2BZDA 2EXWC 5JHLL 1ZMYA 3IKKA 4P99A 4PG2C 4HGWB 2CH8A 3WFHB 3FT4A 1P7KA 4C4KO 3OKEA 4P2OC 1A21A 4JY5L 5ESQA 1ZA3A 4LASH 2QKIA 5C71A 3RIAF 3KVQA 4LLYB 1F6FB 1JIBA 1I9JL 3EZJB 5TF1H 3ZTNL 5DK2B 3QXDB 2PXYB 5HGDA 1DQQA 3AB0B 5MI0C 1QFHA 3GMOA 1S9YB 4JPVH 3ZZ1A 4X6FA 5TF0A 3F65A 4Z7UB 1UZ8A 4I5BA 2VLMD 4OV5B 5BW7A 2AJ3A 2BVUA 4OLZH 2X40A 2Q6WA 4O02H 5HYFA 4GMSH 4O4YL 4OZFA 3D5OF 4HIIB 5IF0B 3BZFA 3F6IA 3WS6C 4YPGA 4HJ0D 4UNTA 3ULVH 3BT2L 5IB3A 3GJEB 1A6VH 2DQFA 4KKBC 3QPXH 2BNQD 4I77H 2J5LC 1QSEA 4OB5H 4X80L 4G80B 4S1QH 5JUEL 3QNZA 4JVWA 3WIIH 1NLBL 5JW4M 2H1PH 5JLZB 4ZQKB 4GAGH 4Q2ZA 4HWBH 3V9FA 5JLZA 3FN0H 4BKLB 3LB6D 1ES0A 1NLDL 4XBPB 1NUNB 4Z77B 2I9TA 2VZUA 3RNQA 1G7IA 4NKDB 5C0DB 3DUUA 4XTRC 3VXSE 1PBYA 4FZEH 1JZ3A 1T0NB 2EC8A 4XWGH 3SGDH 2Z31A 3T1FB 3BWUC 3RWHA 3ZKXB 4JN1H 4DGVL 2ZP0T 4ZNEE 2JTDA 3RFZC 2C4FT 2MQCA 3FONA 5DHYB 5E2WL 1U2HA 5AUMB 1VHPA 2ORBL 3BP6B 2XQYG 4L29B 3L3IA 5DVMA 1U58B 3A6BL 1M6OA 4YLQT 1FJ1B 5I1AB 5JMRA 4NOBA 3QT2A 1RZGA 5KAQG 2G9HA 5L2KD 1CDBA 1BMGA 3QO0A 1TVBA 4X6DB 4RX4A 3DYMA 4HXBH 1TZGH 3VFSB 1S5IH 5CJQL 5EOTB 1EUTA 3HMXH 1SY6A 1JI2A 3SDCA 2VLRD 5EU5B 1UKSA 3LD8B 4PP1C 1X5IA 1FVDB 4LSPL 4IMKC 4QXWA 1PLGH 1MELA 4NNPH 5JHDE 2BX5A 3P9LA 3TWCL 3FZUD 2D0GA 2ADFH 1T04A 4GBXA 3WSQH 2E6JA 3KYAA 1WICA 4D0DA 1L4IA 3SDYL 1KEGH 1U8LA 4GKSA 1WEJL 2GT9B 1RUQL 3W2DH 5BZWA 1EH9A 4PTUA 1A6UH 3NA4A 1G7JA 4NHUB 5GRZA 5T1LB 2Z31D 1V3LA 3B2VH 4HWNA 1ZLWH 5FKPB 2CUIA 4XTRD 3P9MB 4X6BA 1R3LA 3O9WC 2NX5E 3PWJA 3EYQD 2XZAL 4K07A 4P5MB 4PRHE 4EN3C 4NJAH 4YDVA 4R90L 5IMLB 3DX7B 3RUGF 2I9LB 4PB9L 4H1LB 4UOJA 2XWTB 1H15A 4RGMC 3OZ9H 2CLZB 5EBLA 1DQJA 1ZT7A 1Y18B 3D48R 1UCBL 3FONB 3K1DA 3RVTD 3V0WL 4Y1AD 1FL3A 5C6TH 3RL1A 2Q8AL 1M4KA 2Z92B 5LQBL 5KS9B 3KHQA 4MX7B 1S7QA 3AMKA 4HBCH 2R56L 2RGSA 2ZUXA 3EZ8A 4XGZB 1RZGB 3RTQB 4O51A 3HC3H 3OPZH 3CZFB 5J12C 1YY8A 3QUXB 2H6PB 1X5KA 4IS6B 5HBBA 4OI8A 3EKCA 4ZUVB 3SKMB 5I1DB 1NDMA 2P5WB 2CD0A 1CLOL 2VDNH 1TZHA 1H3TA 2QQQA 1YNKH 4M1CD 4OGAD 5KN5B 3G5ZB 3NGBC 4XI5C 3HB3D 1JZ4A 3PHQA 2HFGH 4YK4C 1AY1H 3IDJB 5BQ7B 5K9JL 2DLTA 4NO5B 2DQIH 3C5JA 1U8PA 4NWTL 1BJ8A 3EFFA 1FFOB 4KROD 4KJPC 3RVUC 4ENEC 4NC1E 4FZ8H 3SKOA 3CFDB 3JV0A 1TTGA 5IB3B 1TQCC 1QG3A 4M7LH 1HXYB 4PTTA 2X05A 3RWIB 1UWEL 4EN3D 3WFCH 4TVPH 3DXAD 3MLSL 5BRZD 3DSNA 2X4PA 2OZ4L 1KFAH 3QWRA 4GG6E 3QB7C 4QGYA 2A9MH 4R90H 4MLSA 3F7PC 2A74A 2VDKH 4PRAB 4P4KB 1H5BC 4BUHA 2OMBA 4XBPA 1L0XA 1E28B 3MRQA 2XYCA 3DX6A 4A6YB 1MVFA 4XVUD 5E2WH 3ZHDA 3CVHH 4XP1L 4X9GA 1G7MA 4KVCH 2CO7B 1LGVA 2CQVA 5JPNA 2PYED 5B8CC 1U8OA 1HQ4B 4OFYA 3UC0H 4W81A 4K9EL 2R69L 4LLDB 5DRNA 3SE8H 1BVLA 3BKYL 4FZEL 4N0CC 3RVXD 1CDGA 2FBJH 3MOBL 1DDHA 2AABH 2GAZA 4RGND 3ZKMC 4XNXL 3H7BA 1E27B 4QHNB 2IPTL 4PJDB 4DGIL 1WBXA 1G9MH 2W60B 4U7SA 5A3ID 2CK2A 1S8DB 3L7EA 3BN3B 4O58H 5FHBH 4HS8H 3MLTB 2Y6SD 4ZODA 4P46B 4LCIH 4LHUA 2PNDA 3BYTA 4HWEL 5K9KB 5K9JH 3N06B 3QEQE 4HIHA 4TRPL 2DL9A 1HHIB 2OQJA 4J2XA 3PJSB 1FZJA 1GC1L 1K5NA 3PHOA 2AXFA 4JM2D 4WDIA 3BP5A 3QEUB 4JVPA 3GJFK 5DEZA 5CEZH 1QUNA 3FHQA 2QQNH 2XG4A 2HJKB 2ZG1A 4Z7WA 2QADC 5ACLA 2UZYB 4F7PA 3ZHKA 1D5XB 3GSQB 1XF3A 1A1OA 2N56A 1A7QH 4OBSA 2Z31B 4MJ6B 2Q3AA 1CLYL 5KZCB 5F7EL 4YHKL 4APQC 1YN7A 3IU3A 3MNZB 4IMLB 2JB5L 4CGTA 2XN9D 1ODAA 4Q6IB 4AL8L 4IRJC 4DN4H 2OYPA 1QBML 4R3SB 3MXWH 1WWBX 4OZGA 1PY4A 2IPTH 4MAUL 4DGIH 3QSKB 3OZ9L 1KPVA 3MUHL 3CFBA 1NL0H 1YY9C 3HZVA 3RAJH 3LQAC 4Z7UF 4ODWB 5JO5A 1N4XL 3NVQA 4UDUB 1T2JA 2DMBA 4X6CA 1FIEA 2ESVB 2EDOA 1CGXA 5DZNA 3IDMB 3ZKMD 1AE6H 1ZT7B 1IKNC 2YPLD 1IEHA 1NBYA 4PJAE 3T0AA 2HKFL 2IG2L 4DN3L 3IXAB 4IRZL 3U6RA 4Z7QF 4YHNB 1NGYA 2I5YL 4V2CB 4OZIA 3MZGB 3IAPA 2PYFA 3QZWA 1KEGL 4Y4FD 4FQ1L 3RX5A 2RFXB 3WSQL 3ZKQD 1D5ZB 4HFWA 3RTQC 4NUGH 1W72B 2K9UA 1EFXA 1EFXB 5T1LA 5HYJB 5GS1A 1NFIA 1SVZA 3LKOA 3T0XA 2W38A 4HKZA 4AJ0A 3ARZA 1OCWL 3BP4B 5D2LE 1U3HD 1G6RA 4Z7WB 2BVOB 5CSZB 5JW4Q 4NJAL 1NMAH 4PJGB 3UP1A 4PJFB 4NZTH 2VLKA 4PJ9D 2EYTB 2N7AA 2FLRT 4IMKA 3BXNB 4QO1A 2LAAA 1NC2D 1YPZA 1CG9A 1IKFH 3UO1H 3M17B 4NO2B 1A7BA 4M6NL 3WS3B 2HJFA 2J1KA 1DUYB 2ESVD 4BQ6A 5F7YC 4U1JB 3QEGH 1Z9MA 4DGVH 5J1AA 3SDAD 4EDXA 1FNLA 2FLBT 1NFDB 1CDCA 4JB9L 4LBEB 3RIFK 3WL9B 2V6HA 5D2LF 4FS0A 2A0LC 4K94H 1MQKL 4LCYB 5TE7H 1C7TA 3SGKC 3VFNB 1F58H 3HLAA 4MD0B 3T08A 3ILQC 2J8UE 1JYWA 4BK5A 2NX5A 1ZA3B 5EA0L 5E8EB 3T2NL 3FN0L 2DB8A 4QOKA 2P5ED 5DS8A 1KCUH 1C08A 1YNTA 1F5WA 1HHJA 5J3HD 1LEGB 2X89A 4EBQL 2P5EE 2YZ1A 4GLRI 1ETZA 5D6CA 3MRIB 1YEFL 4GG6F 1BBJA 3J8F7 4CU6A 1EX0A 1ACYL 5IKCB 2XZAH 5KJRH 3WJLC 4YUEL 3ZKNC 5F1KC 4YXHH 2YUVA 4NNXA 5AYQA 2ORBH 5C0NC 3MYZA 1G6RL 1YEGH 3GMPA 4M6OL 4TUKL 1AGBB 3HFMH 3PWPA 2B39A 3LS5H 3PV6B 4D9RD 1F6AA 2YS4A 3BKCL 5AG8A 2A6JB 3GRWA 4I13B 4RMVA 3GFUA 4O2EB 2NR6D 3OBAA 2ARJQ 5E6IA 3V6OA 4HSQA 3QXAB 1P5VA 2I60H 4PJGA 5KZCD 1TPXC 3KPRA 4YXKL 2I07A 4XAWH 2PTVA 3RDTA 4G6MH 5KW9L 2R23A 5FGCE 5HDQL 4NNYB 1IMHC 3LEXA 2FR4B 4DW2L 5EH1A 2ZUSA 4U33A 1FNEB 5FO7A 3LV3A 3MX0A 5GGSB 4HKXA 2WLZA 4MD5B 5T1KB 4DCQB 1A6VL 1TTFA 4H1LH 3HR5B 4RGOH 5GGRB 5D1XA 3LCYA 2L7UA 4R7NB 5C09D 4JHBA 4Y16D 3W0WD 3VU2A 1MF2L 4X5WA 2X4RA 5CP7A 2H9GA 4APQD 1URLA 3AB0C 3FOLA 5MI0B 2NX5B 2ADGB 3IF1B 2FIKB 1RIVL 2ADGA 3RTQD 5ABDE 4YPGB 2YHGA 4JKLA 4XBGB 2FIRT 4H0IA 1JTOA 1QYGH 3QIWA 5FFLA 2W0LA 3MRDB 1LDPH 4MNQB 4L4JA 4NT6A 1CLYH 2KQMA 1MCWM 3B9AA 4XVJL 5EOTA 4KVCL 5H37H 5I1CH 4BQBA 4E0RA 4J1UB 1J0IA 5I66A 5BXFB 4QXGH 4MDJB 5DHVA 5C0GB 5C0GA 4XWOC 3TZVC 3LAFA 2V7NA 4CAGA 4PJ9C 4JZNA 5DRWA 4JM4L 3CXDL 3VFVA 3QNYB 2FHBA 3P4NA 1WIOA 2BOBB 1ZANH 1VDGA 3L3DB 3VXSA 4PTUB 2NY3B 1X9QA 3ECBB 4Z7NF 3EYOB 4PG9B 1EDQA 3FFCE 5F3HB 2EEDA 1CD1B 4P9MH 1NCNA 1DN2A 4Y8AA 2YD8A 4JRYE 5JW4N 3O2DA 4NWUH 3V8CA 5IW6B 1T22B 2B2XL 2EZ0C 3O8XC 1FLTX 1IM3A 2QL1A 2FX7L 5IBLD 5CIPB 1VERA 3RX8A 1UM6L 3DV6B 2VNCA 4L3EA 4G6FD 2NW2B 3NZHH 1KNOB 5F7DA 1D5IH 3QISA 3SDXB 1VGEL 3IAQA 4XP1H 1XIWB 3JV6B 4NZTL 4ZFOB 1KXQE 5FYLL 5A43C 3CXDH 2OTWA 1FVDA 1Z9SA 3QZWB 5B39G 1HI6B 4P57B 5A40E 5J0BA 2BHZA 4JY6B 4ZFFA 4P9HL 3GMRA 2MQ3A 4Q6IC 3GMRB 1KTDA 5IROA 4G43A 5A2FA 3GI8L 1T1WB 5DJXB 4E9LA 5L2JA 2OR9L 1T5XB 3X3FH 5BVJB 5FUOH 5EO0A 5GSRA 1QRNB 1H9VA 2VISB 1WBYB 3UMTA 1OGTA 2OR8A 4Y2OA 1HXMA 4HLZG 2M2DA 1DBML 4R0LC 3T0EC 1LE9A 5KN5A 1GGIL 1KJ3H 4Q9BA 1NEUA 3C09C 2V9TA 1AGEB 2HTLC 3BDBA 5C9JA 4MA3B 2ZJSH 4UQ2B 3MJ7B 2IJ0C 1V8HA 3KYNB 5I8KL 2GTWB 3O6MH 3HZKA 5DJ0B 1SYSA 4O5LL 4WCYH 1EEZA 4I0KA 5CZVL 3I6GA 3PNWA 3ELAT 4D9LL 2FSEB 4Y5XA 4M7KH 3OKYA 3ZE2F 3VFRA 2YPKB 4NZRL 1AQDB 4GMTL 1TNNA 4MB3A 3UO1L 4KQ4H 3VXPA 4NKOB 5HHOE 4CVUA 5J6HB 4Z7OE 3L9RA 5I8CA 5F1NB 1OOAA 4MD4A 4RMSA 3SDXE 5I71B 2APVA 4KMTL 1MCLA 1XGPB 2AP2A 3HG1A 2BNQB 2ITDB 4AQ1B 5FYKH 4OAWA 3BI9X 1SJEB 5I9QB 1UYWH 2OI9B 2PETA 1CGUA 1NC4D 4R4FL 5DJ2B 1VESA 3LD8C 5I2IB 2V2TB 3DYOA 1L7TL 4KKLC 4PJ7F 4ZPTA 32C2A 2VYRE 4FN0A 2C7UA 2D9QB 2VLKE 2VXTH 5EUKA 1JJUA 4M5YL 4AY0A 2QSTA 3UTTE 4JFEE 4HQQL 3TFKD 1A0QH 2E8YA 2UVFA 4C56E 1XGYH 3NN8B 4TNWF 3TBYA 3NN8A 4M6ML 4KQ3H 4W6YB 3FRUA 4HUWA 4LPVA 4D94A 1ACYH 4YJZL 5K9QG 4ELKA 1DQQB 4DZ8B 3O6FB 4TNWK 2BJMH 1W0VA 1MRFL 4PJ7A 2CK0H 2GCYA 5KVEH 3TJEL 2NXZB 3P4OA 1I8MA 1GZPB 2WBJA 4PV9B 2DTML 2R39A 3SCMB 2EDDA 5EC1B 1U92B 3QIUD 4D0BB 5C0EB 1LD9B 1IJ9A 4M9OA 3PP3K 3MJ7A 1QSFB 3THML 2JJSC 4X8JA 2X70A 5AD0A 1EAPA 2P8LA 4AH2B 5BS0E 2Z93B 2QEJA 1N6UA 3S6CA 3I6KB 4XPHH 1V7NL 4JZNB 2OL3L 1UA6H 2AV1A 3C5SA 4GH7B 1AQDA 4OLXL 5I8EB 3K2UL 3DGGA 1FAIH 2WW8A 4FQXA 1CBVL 2EYRB 2D7MA 5HHNB 1KTLA 2XPGA 4LLVA 1TVHA 1F3JB 1JV5A 4MXVE 5KSBF 2Z8SA 1FYTB 4KRPB 4JFEB 4GW5A 2CDFA 3U7YL 2Q86A 2W9LA 43C9B 4LVHB 5EIIB 5DHVH 2HG5A 1QYGL 1UWGL 3V5HA 1ZVSA 4MJ5B 1PEWA 4PJGE 1KFAL 4PJXB 1U3YA 3ULVE 2ESVA 3PF2A 2OMNA 1HSBA 2JJVA 2H26B 1KENH 2VXUH 3OTTA 2O5YL 3GSOA 3SY0B 2PTTA 5F44A 3EJYC 1KIUA 2WUBH 5AWNH 3U4BL 3C2SA 4Q7DA 4OZIB 1QSFE 3NACH 3VXRD 4HEME 2QQKL 5I1EL 2XT1B 3SQBA 3LHPH 4WI4A 4ZFFB 5ISZD 3TJEH 3OV6A 1VFOA 2WQRA 4RIRB 1EHAA 3EYQC 4K9EH 5L7XH 3W2DL 5D7JB 1OGAB 3MLWH 5BRZA 1BM3L 3U7YH 3L6FB 4YC2B 1V05A 3VRLF 3OJ2C 3FJTA 1RIHL 4POUB 2BK8A 4G9FE 5J13B 5CKAA 4OZGB 1UKQA 4L8SA 3ROLB 4ZFGH 3UTQB 3FZUC 4JFHD 1F2XK 5E4IA 1AD9B 5FGRA 4PJFA 3SCMD 1A1MA 1IGFH 4H25A 3O2WL 5E2VH 2C1OB 1NCUA 5D2NB 4NQVA 4XWOD 1QLRB 4JQVC 4Y5VC 5EU6A 5J4MA 2G5BB 4KJWC 4RMQA 4YUEH 1CQKA 3LQAL 2YC1A 3VA6A 2D2OA 4JKMA 4OQ1A 1AFVH 4YBQD 4ZOBA 4NKOA 4P5TC 3QO0B 2X4TB 5D7SH 4GW5B 4PRPA 1DVFD 3WHXB 5F93C 2CMRL 5EFIB 4LP5A 1FZKA 1WGOA 4LRIA 4MCZA 3SPVB 1H5BB 3RA7H 5F9JB 2YA1A 1A7NH 4LSQH 2C3VA 4IOIA 3MRRA 4PRPE 2YWYA 4M3JA 1N7ML 2X9YA 4JGJA 3V7AG 3EOBB 3EJYD 2BY0A 1I7ZA 3N1MC 4B7LA 5C1MB 4U0QB 3R8BB 5HJ3A 2ZJSL 4WHTB 4YHMH 4Y16A 4M7JL 3HZMB 4NM8H 4TUJA 3WXVH 1YEDB 3UJTH 1CT8B 3B6SA 1U9KA 3I6LE 1AD0A 1A7RL 5J57B 3WIIL 3ORJA 4GRWF 4FFZL 1KENL 2I9LA 3ARQA 4RGOL 3GI8H 3GO1H 3KPPB 5IIEB 1S5IL 5I1LB 1QP1A 1MHEA 3S4SA 5BQ7A 3ARFA 1ZWIA 4XAKD 3TIDA 1W0YT 3LKQB 1P2CA 5I1IL 3IDNA 3CFDA 5DWUL 5H35A 4HT1H 4XGZA 3Q6FB 1JPST 1KIPA 1KJVB 3SKNB 3LQAH 2XRAH 2BSTB 3EYUL 4KXZI 5FUZL 5I73C 1NCTA 1U95A 4NQVB 5EZLB 3D1MC 4JO2L 5I1KH 4IM8A 5HHME 1VA9A 1KPRB 2HRPH 3O2VH 5T1MB 3SKMA 3AREC 4HMCA 4OM0L 4LSSL 1KTLB 4EEEA 4FQCH 1JGUH 1IAIH 3WLWD 5DRXA 2XQYK 5ESQB 3STBA 3GIZH 1KB5A 3GGWA 5I8OL 4MCZB 1S7WB 3QXDA 2YKLL 4PLJC 5CWSB 3IFLH 4LVOB 3G5ZA 4UV7L 3VDCA 2VXVH 4JG0L 1P7QA 5F7HA 4KUZH 2L0DA 1JHLH 4UT7L 4ZOCA 2FJHB 3C5JB 4B53A 2N4IA 5FO9A 3FT2B 3LRGA 2CMRH 4PJBB 1CVRA 1RQ5A 1HCVA 2AEWA 3BHBB 1A4KB 1UB6B 4ERSH 4X6EA 1L9MA 3MBXH 1BZ7B 1UQSA 1YPZF 3C87A 1JGEA 3HI6H 5GGVL 3D0LA 3DGCR 3MRFB 5LXGL 3MRNA 4UT6L 3FFCA 1OGAD 1B4JH 3L95A 4OF5A 4XMLH 2WLYA 3QDAA 5IIEA 1HINL 1I1FB 4OLZL 5IVXE 2CKBA 5HGHB 2BP3A 3D85A 3WFZA 5LXGH 4O2FB 2KZWA 4WU5A 4LDEB 4PBXA 4L8SC 4C83A 2EKJA 1FVCB 4MD5A 2YUXA 4LFHG 4F7PB 2DQJL 3O3AB 3KPQB 3T0WA 4RSVA 1PW3A 2DQIL 2PO6C 4HF5L 3FO9A 1FZMA 3W82A 1OAQH 4KUCD 5DFWH 4ZNCD 2FO4A 3DBXB 4V1DB 4CDGC 2FYYA 3B9EA 1PKOA 4J4PA 4F9LC 1H3PL 2VC2L 3UBXA 1I3VA 5DHYA 1A1MB 2B1AH 4NO0B 1KLFA 1AIFA 4QHUB 1BJMA 1DDHB 1UA6L 4TVPE 2DN7A 1FGVL 1P1ZA 1DL7L 5BS0B 5AAWA 3GUTB 4N9GB 4PRHD 5GRVK 2D03H 2OXGA 1FNGB 4L3CA 4YHOH 1LE5B 2G9HB 2X4TA 3SY0A 2NY4D 3IJHB 8CGTA 2VLKD 5GS2H 4GKZB 3GSWB 3BGMB 3HNVL 4FFVD 1SY6L 2O61B 2HJKA 5KTEL 1UB5A 3EJJX 5D7IF 3SDCC 4X6DF 1PQZB 4JZOB 3HE7D 1MNUH 4NN5C 3NA9H 4XH2B 2R1WB 2CLRA 1UKTA 4AEEA 1QRNA 2BVQB 2H41A 3FT3A 2A9ML 4NYLA 1IGJB 1MJ7H 3EYSH 1D9KC 4JKWA 3E6HB 4LEOA 1L9NA 3SGKA 4PY7A 1M7DA 3T1WA 2CLVA 4UB0H 4YGAB 1RIUH 2VDQH 5L6YH 2D7QA 1A9BA 4UDUA 5CJXC 3K4DA 1KSRA 3MA9L 3VGBA 5IROC 1M6OB 3O2DH 4J6RL 3NPSB 3CGTA 5B3JE 1S7VA 5C07A 2ICCA 4DUVA 5T3ZH 1FFPA 1A4JB 3BE1L 3VH8B 3LZFH 3G6DH 4KK8C 2EE2A 3ARDC 1B90A 2E3VA 3RA7L 1VADB 4FNLL 2NY5C 4JDTL 3ARSA 1R6VA 5INCA 4RGNB 5GS0L 1F42A 4P2QD 4MX7A 4P9HC 5CZVH 2P7TA 1Z3GH 3NCYS 1WBYA 5EDXA 4MD0A 2FH8A 3MCG1 4JM4H 3ZE1E 4XNUL 1K8IA 3Q2CA 4EBQH 3MROA 1H3XA 2OJZH 3N1PC 3ARUA 3B6SB 3BPNB 4LQFH 5FOJA 1T2QH 1LP9F 1NCDL 4UDTA 5DC0A 2IBGA 3F7YB 4HMEA 4PRHB 4QRUB 1QBAA 3PWJB 2QHLA 3VXUB 1YN6A 2ATPA 5HHPB 5D1ZB 4BFIA 4JFYA 1MIEL 1GH7A 1T1ZB 2VO5A 5E9DB 1B9ZA 3KJ6H 3QUZC 3RIFF 3O81A 1FC1A 2IBZX 3CFEA 2BVTA 4JB9H 4H1LA 2Y07L 4ONGL 1UB6A 2BNRD 3TIDB 5BV7L 1JYVA 1RZJL 3CAFA 1FNSL 5CP3H 3BO8A 1X5LA 1OD7A 1AI1L 3AS0A 4JAMA 4KGLA 1RZKH 5DVOA 5SWQB 3ME0A 1GGCH 4X99B 2BNRE 3GSUB 1FG9C 2CRIA 3RWIA 2DQUL 3V7MA 3KYOB 3ZE0E 5F7UA 2QQKH 5I1EH 3UTPD 4MAYD 2F5BL 5CMAB 2WUBL 5IOPB 3U7AA 3SGDI 3HLAB 2FZ3B 1NFKA 3QUXA 1LEGA 4FZ8L 1CDYA 5KAQF 5DRXB 3V4UH 5HHQB 1KB9K 1JWUB 3NFSL 4JY4A 3EDJA 5CLWA 3A6OA 4J3UA 3VXQB 2VLRB 1AFVL 2BOCB 1DEEB 2V9QA 2VDML 3HMWL 3HMXL 2E27H 4HZAA 1X7QB 4G42A 3HPJA 3DX8B 1EUUA 1KULA 1G7HA 4N90E 2DWDA 1KOAA 3UYRL 4NNXB 1E4XI 1X4XA 4FQ1H 5MEND 1X5ZA 2GJJA 5TQ2H 3U0TB 3W81A 1MFNA 2EH8H 5L8LB 3S37X 5FYLE 2XKSA 3EO9L 3T2QA 5C08D 4OZHE 4ERSL 5I76B 5CGTA 3GMPB 1KB9J 3BAEL 3BD4A 3D0VA 4I4WB 1CXIA 3HE7B 2DLIA 5D72H 4H20H 3TO4D 4P2QB 1DP0A 4FQQB 2P8MB 5HHXH 4IOFC 4QRQA 1PD6A 3IFPB 5EUOE 4XB8A 2VMFA 1JUFA 2ADJB 1FC2D 1T7YA 3AAZB 4AEIL 4ZO8A 6FABL 5IMKB 3RVWC 2J8HA 1HNGA 3VXTB 4X6DE 2DQDH 5I9QC 4V1DE 5ICYB 4ELMA 4XH2A 1FNEA 5FO7B 1T20A 3L3JA 5GGSA 3NFSH 1R3HA 1R3HB 4HJJH 4DKFH 2R23B 4LOUC 3C8DA 2B4CC 1YJDC 2Z8WC 3TBWA 1NH6A 1BGXH 3B5HA 1A9EB 2H2PD 2UUDK 3TZVD 4Y89A 3ARBD 4QEGA 1BIIA 2DTMH 2Q1EA 1IZJA 3RVWD 5D1QB 4YDKH 5KVGL 1AI1H 1KELH 5LGHL 4MNQA 1T22A 5C6WH 4M3KB 5D2NE 5CZXD 5IF0A 4WWKC 5FUCE 1Q72H 4JRXB 4MXWH 3EO0B 2P5WD 2EDNA 4Y4HA 3B8SA 2WZPD 4NP4L 1FLRL 4I2XE 4D9RE 3CUPB 3LKRB 5JXEA 5L6YL 5HGGS 4BZ2L 2GSGB 2IQ9H 3MA7A 4NWTH 3EOBA 4PP1D 1SQ2N 2VITA 2Y5TA 4F9PC 5C0DA 2ZWLT 1CFSB 1U2CA 2RB8A 3GJEA 3OAYK 5TDPA 3X3GH 4JFDA 2WBJD 3ET9F 2DWEB 4OD1L 4XMPH 3IFNH 2DWEA 3RJQB 4OFVA 4GG6A 4ONHA 5L7XL 1J05B 3N85H 4KHTH 5E9DD 3PWLA 3QYCA 3SDAB 4G80A 4UOW1 1TCRB 4OM1H 3TCLB 3OR7A 1EO8L 1BVKA 5IV2A 2X1WL 4PGCB 3O45A 3QHTC 3CU7A 5KW9H 1FL6B 1DE4A 2R1XB 5BV7H 3U36B 4XAWL 1OW0C 2JJTC 2R0KL 3MUGA 4HV8B 1KN2H 4QXTA 3A67L 3OAYH 3CFBB 4PJDF 1KNOA 2X6MA 4NGHH 2SEBB 3JBG7 4JM2A 1PKQE 1AP2B 3GHBL 3PQYB 1FL5A 3BYYA 1XR9B 3V4VH 4OF7A 4OT1H 3BEWA 2Z35A 3DWTA 3IDNB 1H0DA 3QJHB 2IQ9L 1BZQK 2DQTL 2R2BA 4GRMB 2GIYA 5C2BL 1MREL 3UDWC 1NCBH 2F15A 3QHFL 3DXAA 3L9RB 2OTWB 2BSTA 3QIUB 4UB0L 1CFTB 4NKMA 1NGYB 5J9PB 1H3VA 4S2SB 2HVKB 2PTUA 4C58B 5ISZE 4Z18A 5JOPD 1LO0L 2FB4H 1U8NA 4PJXE 3TJHC 3VD7A 1Z3GL 3G6JA 1QVOB 4NQSA 1QVOA 4ODHL 2HFGL 3IFOA 2GT9A 1Q94A 4XXDB 4YEFA 1JPSH 4Q74A 1QBLH 4L8BB 5F6HI 1HKLL 4JR9H 4MNQE 5ETUA 1B88A 3V2AR 2NY4B 4UQ2A 4Z6AT 32C2B 5KVGH 1EVTC 1D6EA 1YEIL 1CF8L 1FYTD 1KB5H 3HTLX 4F7TB 5D71H 4ZOEA 3MA7B 1KF9B 4I1NB 4MS8D 1UEMA 4CN4A 3KYKH 4MDIA 2EXWD 3HMWH 1DLFH 2P5WE 3OGCB 2EDBA 4G8GA 5HYSB 1BWMA 4PJHB 1G9EA 5CHNB 4IRJA 5DO2C 4XNXH 3SKOB 1GZPA 2BSSA 1S7XB 4OM1L 4R0LB 3T0EB 4DVRL 2HJFB 1GPOL 5IV2B 2XIDA 3RVUD 1OM3L 3V7AE 4CADA 1RHHA 3W9EB 5IHLB 3CX2A 1IEBB 4RFOH 4O2FA 3VFNA 1A14H 3L7FB 3OX8B 1NL0L 5IMOB 4M7LT 2Z4QB 3HI1B 4OF0A 3BSZL 1HHGB 1XGYL 2VE6B 3VXRB 4M1CC 3VXUD 3MODL 4G6FB 2Y25A 4FQCL 2PW1B 1F3RB 2V17L 1CS6A 5TDNB 2AK1L 3QUXD 4HULB 1C5DA 5E8OA 2A77L 5T3XE 2AV7B 2UWEF 3IDYB 2Q3ZA 3SO5A 2AGJL 2C4XA 1S7UB 3JVGC 4P59H 4RAVA 4K7FA 3WDJA 1JMZA 1IL1A 2DIAA 4NO0A 1SJXA 5EO9B 5K33A 2AK4E 4EQ2A 3IB4A 4D3CL 2HJLA 4DW2H 4S1QL 4M00A 4ZAKB 4ENED 5I1JH 1WFOA 3L1OL 5CBEA 3IDGA 2HKHH 5MENE 3OB0K 4HDIB 1OAQL 3K3QA 5FGSA 2O61A 4HIXL 3DOSA 4KRNA 3INUL 1WT5C 4MNGE 1WTLA 3UBXI 3ULUD 2WBWB 4PJHE 4JZOA 4ETQB 1U42A 1UADC 4AEFA 5HYSA 2NY1D 5HI4D 4JHWH 5DJAA 1G7IB 4NKDA 1GAFL 1AO7A 1J0HA 5T3ZL 4EVNA 3HFML 2VR4A 4JFEA 1IKFL 2R56H 1I1CA 4HKBA 4X7DC 3LIZL 3GSXA 1G9NC 5K93A 3V0AC 3KLSA 4ZUTA 3HR5A 5DFVC 3MCKA 4YX2L 3HS0A 1N0XH 2FL5A 1VKXA 4LLUA 4R3SA 4KROB 3HMXA 5C0CD 1L6XA 3EIFA 4ZS7L 4OZFH 3DX6B 1FJ1A 1RZ8A 4P48A 1QR1B 4HIXH 5J6GA 1TQBB 1XR9A 2A6IB 3O8XB 2VKWA 3HE6B 3ULUE 4ELME 2HKHL 4HX1A 4IRSA 4G7YL 3ZTJH 3BZEA 4WO4B 2VDMH 1NBZB 1BVLB 1NAKL 4PJ8A 4QT5B 4X4MA 3S35H 2M26A 5DJ6B 1NUFA 4K94L 5DXWA 4EI5B 3OWEA 3PGFH 3SDDC 5LVEA 3CH1B 4KTEH 1HWGB 2R0KH 3HNVH 4U3HA 3KDMB 5FOBB 1HILB 4JO1H 1EBPA 5MP6H 1A6TB 1R5WB 3BKYH 3P0YH 4PJAF 2YPVL 2ITCA 1FN4A 5D70L 1QFUH 5IJVB 1CE6A 3VXSB 3P30L 1Y6KR 1LQSR 3ZYIA 4LF3B 1QQDB 4I0PD 3OR7B 1BOGA 4M6OH 3CDCA 5HD8C 3VXOA 1NSNL 3VXOB 4WWKB 1XMWA 1SMAA 1I9IL 4NQCA 5EZJA 1FFQA 1CE1L 2VAAB 4XPBL 4WWID 2ZUWA 5EC2B 3IDIA 1EEYB 5C0AE 1HE7A 3I85A 1X5AA 4NPYA 4ZYKB 3TNNB 3N1QC 4ODWA 1MLBA 1M1SA 4OLVH 5D7LB 5DO2D 1CVSC 3O3EA 1H15B 1I7UA 3CK0H 3RU8H 4PJHA 3LIZH 5F1IB 1G9NL 3K2MC 3C2AL 4M5ZL 5GS0C 2BSSB 4R0LA 3T0EA 2DQTH 1HCFX 1LK3H 1EBAA 1IGFL 5HD8D 3ULVF 3IT8D 1Q8MA 1T66D 1ZHNB 1OY3B 1DANT 4OGAC 5CJBA 1WLHA 5I1GH 4FRWA 2LVEA 3MJ9L 2GI7A 5IBTH 3TYFB 3G6JB 1RIHH 1JL8A 2JJSA 1KN2L 2KPNA 5IWLC 3CX5J 4N0FB 1FG2A 2VTFA 2VQTA 3Q0HA 4X6DA 4BQ9A 3HCVB 3PWNA 4H88H 3ZSTA 4G7YH 5IMMB 4LAQL 3PQYD 4JANB 2DQCL 2OCFD 5DS8B 3C5ZB 5D7KD 4X4YA 1RUAH 1VFMA 3N85L 3TVMD 3QO1B 4OGYL 2B4CL 3BUTA 1AXIB 3NIDE 3LHPL 1IAOB 1PYWA 5IJKA 2BNUB 4PRBA 4WTZA 3R4DA 2X4OA 3MXWL 2D4DA 3KYNA 5J56B 3QCVL 1U8PB 1T04B 2ED7A 2H8PB 3MBEC 4OZ4B 4M93C 1CE6B 2Z8VC 5DJZB 5IESL 1MHEB 3S4SB 5CINH 1IQWL 4P4RA 5T33H 4UUJA 4OZFG 1MAML 2H3NB 3GMMB 12E8H 4JO2H 1A4KA 2VZ3A 4NUGL 4LKCB 2BJML 3VGFA 5JPMA 4R4NC 1OAUL 5JOPE 3O0RH 4XVSH 3VMPA 1MCPH 1FZOA 2FX9H 3B3IA 5FO8A 4LSUH 5FO8B 4ETQA 4X5XB 4L4TE 4F3FA 2F19H 3CCHA 1KELL 3GEWB 4GW1B 3T3MF 3D39A 4A6YA 3MRCB 4G6KL 4DN3H 4DQOH 2IPKB 4YFLF 3PL6C 2D7TL 3TT3H 4DVRH 5EORH 4PGDA 2CDEA 4FQXB 4AENB 4RX4D 3T2NH 3O3BA 4NZJA 4BUGA 3IFNL 1CIDA 4UIMA 3DX8A 4XPHL 1IGYA 3OKLA 1U8QB 4KK9C 1EK3A 4NZUL 2F74B 4KI1A 3GMQB 2NLJB 2ADFL 4V2BA 1YPZE 3BIKA 4F57H 3E0GA 2R0ZL 2CPCA 3I9GH 3VWJA 2EYSB 3QFJE 4NSKB 5HPMB 5FDWB 5DJCA 3HCVA 5SWSE 3IDXH 1QEWB 5L8JB 3RPKA 5DYOA 4FQXC 4QHUA 1AIFB 1HIML 4E42A 1QRND 4X98B 5SWZD 1F4XH 3HE6A 4MHHI 3FO1A 2AJZA 4FXLA 5KS9F 2P8MA 1QRKA 3VFSA 3UPCA 4DK3A 1K5NB 1NAMA 2YD4A 3AM8A 35C8L 2V5MA 3VFMA 4I0CC 4KI5C 4XAKE 4CNIB 1QSEE 1EAPB 3TV3L 3O6ML 4MDJA 4JN2A 3L95B 1RI8A 1RZ7H 1F2QA 3P40A 2LV4A 1CDUA 2DM7A 5DURB 1VENA 2P5EA 3V0VB 4PRIE 1QKZH 2Y7QA 4L4TB 3QNYA 4IHOA 4UOW0 5JDJA 1S9KC 1IILE 4UUJB 4KJQD 3T4YB 1ZGLA 1E6OL 3WO3B 1IAKA 1IAKB 2VERN 4M6AA 4DKFL 5ECJE 4P46C 4QCIA 2VKXA 1AY1L 1RU9L 3R0MA 4JY5H 4ZAKC 1NC2B 4JPKL 4KMTH 2VRAA 4HWBL 3RHWK 1CWVA 1MFCL 1CF8H 1KB5L 3VI3F 3TA3B 3OKMB 3MV8B 4HJ0C 4HS6B 2VDNL 3O4LB 4ODXA 1BX2A 5SWSB 2CDEB 3QQ9D 5JDSB 5DD1L 4YDIL 5HI4C 1JPTH 4GQPH 1BFOA 4JPIA 4CN1A 4N9GA 3KPSD 1KN4L 4Y5VA 5MEOA 2DI7A 2VDRL 2R8SH 1T1YA 1TLKA 5T3XD 3DVGB 4HUVA 1F3DH 4QHNA 4KTEL 4CMHC 3VI4E 1TQCB 3DVNB 3TVMB 5HI3C 3G6AB 3WIFB 4DAGH 3T3PE 2ERJC 1QD0A 1FG2B 5FYJE 3MLSH 4CBPA 4CVZA 2BVQA 2PW2B 3C9NB 2OSLB 1WWWX 2VOTA 5KVDH 2BFVL 4K3EH 3L5XH 3QEUA 4U6HB 3WN5B 2MNUA 2F8OA 3LSOA 4U6HA 1CE1H 4O9HL 4XPBH 4F58H 5C9JB 1IC4L 4FQHA 2SEBA 1XF4B 1ZVYA 1MEXL 2EH7L 2IAMA 2PXYD 3VRIB 1KJ2H 1FO0H 2ATKB 4NN5B 1EAJA 1GC1H 3GKZA 5IB1B 4AEHL 5I1LA 1JPTL 1FCCA 2VWEC 1ADQL 5FYKU 4FNLH 2CRMA 4HWEH 5D70H 4NN6C 1T21B 1MJUL 5JW4R 5F3HA 3BDXA 3OJDB 3KXFA 4KRPC 4NKMB 5J9PA 4JPKH 3QUML 4OD3H 3F7QA 3O4LE 2FEDD 1FGVH 5AWNL 3U4BH 1QA9A 4Z8FL 4U49A 3QXTA 2CJUH 3MLXL 4XPFH 2M8XA 3HAEA 3H6JA 2B1AL 5E8NA 2R4RH 3V6FA 5KSVB 4MSWB 5KSVA 1QPPA 1MJ8H 1U36A 1U95B 4KROC 3AS2A 1K6QL 3W0WB 3BUYA 3GNMH 3S37L 1IEAB 1AO7E 2PR4H 1HH9B 5GGUB 3BT2H 3JV6A 1RSFA 1PYWB 4OLWH 3TJHD 4GBXC 4KVNL 5H8DA 3MROB 2MCPL 4P2RB 3QDGA 4WFHD 4P57A 1A3RH 3TO4C 1VGEH 1R5VA 5DMYA 5AEAA 4RAHA 5SV4A 2JCCF 1N8ZB 5TDOA 5IT2H 4OZ4A 4WJ5B 4TRPH 3RGVC 3VG9B 5F72S 2VH5L 1IM9D 1J87A 1KLGA 4F9LA 3N9GL 3V6ZB 3H9ZA 5A2KH 3PWUA 2I24N 3MRMB 1YEEL 2B2XH 1LE9B 3ZHLA 1BF8A 2X4PB 2DF3A 4MA3A 5ALBH 1MF2H 1R5IB 4CNIA 2DLFL 4A2LA 5KSAD 3S35X 3UJIL 4L4TD 3KJ4B 1S9XB 1J8KA 3K74B 3U4EB 4YIQA 4JHAH 3V0VA 4Y4HD 1YPZB 3GNML 4N68A 2EDYA 5I19H 3L5IA 4PY8I 2DQCH 4L3AA 5EU6D 1N26A 4ZUWA 4HXBL 2AJXL 2GJZB 1Z6JT 2UUDH 3HA0A 4E41B 1Y6NR 2EH8L 3HAEH 1S78C 5CJ5A 1I7RB 4LLUB 5JIHA 4GRLA 1ZXQA 2H9GB 4GKNB 4GRWB 4RFEA 1LO4L 4LLWB 2NNAA 2YBRA 1ZLSH 4E42B 2XNAA 1MCOH 4G8GD 1LWRA 4G6AC 4PJBA 3DIFB 3TBVB 3GUTA 3RWDB 2ICEB 3D39E 2W07A 1U6AH 5MEOB 1XIWC 4OFPA