3NA4A

D53p beta-2 microglobulin mutant
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
97
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNYVSGFHPSDIEVDLLKNGERIEKVEHSPLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Beta-2-microglobulin
publication title D-strand perturbation and amyloid propensity in beta-2 microglobulin
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 97
sequence length 98
ec nomenclature
pdb deposition date 2010-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3na4A00
3LKPA 1IGTA 3O2VL 2PF6A 5IFJB 2PTTB 4JM4L 4S2SB 2XN9E 4BFGA 2PO6C 3CMOL 3ARFA 1I4FA 1M7DA 1RZJH 4U1LA 3TFKD 1ZWIB 5A3IC 1KPRA 1LP9F 2DIBA 1QYGH 3MJ8B 4R4FH 5IQ7L 5E0QA 2NY2B 1T2JA 3ZL4L 3C08H 3FTGB 5E8DL 1A4JB 4L1HA 5FYKL 5HGGS 3WJJA 1FL6A 2DI8A 1HYRC 1HKLL 3QDMA 3HZMA 1YMMD 3GK8L 1AD9A 4HUWB 3MGAA 4ZODA 1A7OL 3MFFA 4PD4J 4G6JH 2XKSA 2BY3A 1D5IH 2VB5A 4JN2B 4BK4A 2BNQE 4ESKA 2H9GB 3P0GB 5JMRA 5IOPB 1FQ9C 5D7LB 1MRFL 1HCVA 3UTSA 3NGBB 5GRYA 4GBXD 3WHXA 3MRQB 2F19L 5GGQH 3TIDA 4D9QE 4EUPG 3PWVA 5J1AB 1DN0B 3ZYZA 2NY0C 3IKCB 4QT5A 3MLWH 2V2TB 4YE4H 4MYWB 1G7PB 1I7RA 2RB8A 2VXSH 1ZS8B 4NNXB 4NT6A 2V5TA 3BDYH 3GBNL 3BH8B 3QUZB 4Y4HC 5CWSA 5DO2C 1BM3L 1ZLWH 4MJ6B 3S6CA 4NQDE 1QKZH 4Y2DB 1S7WA 2ICWB 2FR4B 2YXFA 3INUH 1OAKL 4MVBC 4MWFB 5F7DA 5HPOA 2V17L 1U36A 3RHWK 2FECL 5DYOB 1VFUA 5DJXB 5EZJA 3MFGB 1KJ3L 4NKMB 4LCIH 3V5HB 4E9LA 2YD1A 1L6ZA 1KG0A 1OAQH 2CUIA 4M62H 2R0KL 3MV8A 3GJFB 3TO2A 1EAJA 1SYVA 5SWSD 1J7VR 2FX7L 3BQUC 3X14A 4P48A 3TNNB 1KT2B 1X5XA 2X05A 2NY1C 1IZJA 2EKSB 3LHPH 5HVGB 3FT3B 4U7KA 3MGTB 1F4WL 1IEAB 1N0XH 3DRQB 1CK0L 1U8LB 2H41A 5CILH 1MI5B 5FO9A 3TH2T 2X09A 3SDXA 3KPMA 4L8BA 1IFHH 2MNUA 3IFLH 1Z5LB 2AJUL 1J11A 1WCQA 4LFHG 5EC2A 2BVQA 3QJHA 3QNYB 4HKZA 5GJSL 3AAZB 3RWFA 3ARFD 2P46B 2MCPL 2MPAH 4H26B 4L9LA 5LGHL 3IYLW 1HHKA 2QQKL 2P7TB 1R5VB 1V5JA 4JFHD 4Y1AA 3EZ8A 3QUKB 4IMLB 3WS6C 3MLUH 2ZG1A 5HPMB 2FBJH 1XH3B 3BKJH 3QO0B 1V8HA 1JPST 1WCBB 3L3KA 3DX9A 3O8XB 4LSTH 4HUNB 5FYJL 3RUGF 3A67L 3QDMD 2GFBA 4QGYA 2YPLE 4PV9A 4LQFL 3V5KB 4GG8A 3QQNA 1YEFH 4MD5B 2FBOJ 1ETZA 1I9RH 4JFEA 4JFFE 4X9HA 4P59L 4F7CA 5SX5K 3VRLE 2H32H 4LEXH 4AEEA 5F8RC 4LLUA 3DRTB 3F7YA 3WXWH 3KLDA 1Q8MA 4OZFB 2EE2A 2JK5B 3VFSB 1F4YL 1WGOA 4XPBH 1VSCA 1HKFA 4NFDA 4XAKD 5F7EL 3OV6A 1GJIA 5DJCB 4MXQD 3UYPA 4TOYL 2CLRB 3UTSD 4X98B 3U0WH 4S1SL 1YNTA 3MOAL 5FUZH 2NY6D 3BZFB 2FECI 3MQIA 4HQQL 3LS5H 2ADFL 5C0CB 3BKMH 3JV6B 5F72S 4JB9L 2HG5A 5F9OH 3U0TB 3U7WL 4ERSH 3VWKA 1HZHH 5JOFB 1A9EA 2VLJB 3B9DA 5DRXA 5LXGH 1IC7L 3OXRA 5IW3A 4O2FA 2DKUA 3FRPG 5F6IB 3ALPA 1MCFA 5ITBH 4NQVA 1ZT1B 4JRYB 4QRQB 4Z7OE 2AKRA 4U1SA 4XI5D 3BP4B 1H3XA 1O7SA 3CVHL 3HC3H 1H5BA 3V6FA 1JNLL 2XY1A 4XXDB 3ZDZF 2Z8WC 2NY5L 4U33A 5INCA 1IVLA 4YWGL 3MO1A 5EFIB 4GRWH 5I1DB 5CZXC 1BEYL 2C5DC 5AWNH 3IJSB 1F58L 5JORB 3MV8D 5HDBF 2DDQL 5DRWB 4ZXBB 5C71A 3U30B 4OZ4A 2AS5M 4D9LH 1UM4H 4GLRI 3C5ZB 3E6HA 1S9WB 4M6MH 4K8RH 3QDJB 2W92A 3CFIC 4GAYB 3GSQA 1IM9B 3OG6B 5DI8A 3BKYL 3FN0H 3VGGA 3ECBB 3RTQA 1ZVSB 2YMXL 3QFDB 3ZYOA 1MCEA 3QO1B 1U3HB 3RI5F 2OMNA 3DGCR 2CK0H 3F7VA 3VA6A 3BDBA 1HWHB 1G7JA 4Y5VB 2WSKA 1FVDB 4QRTA 3H42L 5D1ZC 4N8PA 3REVA 4CJ1A 4NM4H 4PG9B 3QYCA 4XMLH 5HHME 2VXVL 1FBIL 4Y1AD 1VA9A 3LRSA 1E4XL 1CF8L 1FYTA 4F7PA 1GHFH 2ZUUA 4NZTH 2Q86A 3B5GA 4HUUB 4X6BA 5I1CH 2FEDD 4Z7VA 1H9VA 4P0DA 3NCCB 5DQJB 5KS9B 4PREA 1JGUH 3T0EB 1AHWC 4XVSL 1EMTL 1LHZA 4JFED 3IU4L 5CJOL 3OJVC 4FQIL 1T0MA 3RAJH 2VDMH 2IALA 1BAFH 5IT2H 2OK0L 1CR9L 1KIQA 3GMPB 4P3WA 4P3DA 5I74C 5HBBA 1MY5A 3DTXA 2DWEA 5ALCL 4A2MA 2G60L 5IM7B 3C2AH 1UXSB 3EAKA 3ZLQC 4B5EA 3SE8L 5HD8C 1OCWL 2J1KA 2E7LA 2P8PB 1BQLL 3Q0HA 1BJ8A 4G43A 5I9QB 2W9DL 3HE6A 2HTLC 1BF2A 4I4WA 2XZQL 1JGEA 3RWEB 2Q87A 1SJVA 1TQBC 4LLMA 3TJEL 1H8NA 4IIQA 3BGFC 1OWWA 3RY6C 4MQXD 3VWKD 2NY4B 3ARWA 5MENB 4YO0B 1VACB 4LVHB 3VXUA 5I66B 4AG4L 3WFHA 1MHCB 4JKMA 3CZFB 4M7JL 3GSRA 1GXEA 2Z35A 1WBYA 4JG1L 2Q8AL 2IANB 2HKHH 1A0QL 3ZKSD 3IS0X 1CWVA 1KXQE 3BN9D 5ADOH 3U0PA 3VXOB 3MLYH 1RZ7H 5EORL 3V0WH 2LAAA 1HI6A 1EHLH 4Z5RB 1MELA 2PW2B 4QRRA 1LO5A 4LSSL 3FB8A 4MJ2A 1DQJA 2WBWB 3DBXB 2SEBA 4KDTA 3QIUD 1A1OB 2ZSVA 1Z9OA 4P5MA 4FXGB 1AJ7L 1ZT7A 3JTSA 5AUMB 5M95B 3LKQA 5EBLB 2ADIB 3GSUB 1EEZA 2ZG2A 1JZ2A 4XX1G 43C9B 1PEZA 5TDOA 4PJ5D 2C3WA 1A64A 5I1GL 5H94A 3MMEA 2VDOH 1MJUL 3B9AA 3CFCL 3W0WA 1NFKA 3ULVC 4OTXL 3ZE1E 3TYFB 2FJHA 3MLZL 5BO1H 2BSRA 4KK9D 3HMWL 1D6EB 1TZGH 4IEFB 3HC0A 5GIRA 4CVZB 4N5ED 1YYLH 3IJHB 4EDXA 4Q9QL 4M93B 4JDZB 1CTNA 3AY4A 3RTQD 2GJ6A 2JJWA 2ESVB 1IT9H 1H3VA 4RRPA 4PB0L 3UBXA 5JO5A 2X1OA 4R26L 1U91B 3HG1B 1GIGL 5TGBB 1XGTB 4RAUB 3QA3B 4UMGA 3QPQC 5FA4B 1DQML 1R5IB 5IFAL 3QQ3B 5E1HB 2O5YL 2BSSB 1D7FA 3EJZC 3U4EB 5FHBL 3WDHA 3MRHB 1T6VN 2BVOA 2X1WL 3QIWC 4KI5E 3ZZ1A 1QUNA 4UU9B 3WO4C 1FYTD 1QRNA 3NZ8A 3TM6A 4GAJH 4QY8B 4TYUA 3QR2A 2GAZB 5B39G 1Q1JH 5IMKB 1SEQH 2OJEA 1S3KH 1KLUA 1SJEB 1VDGA 3UTZA 4UTAH 1FV1A 5TE7L 2HJKA 3LD8C 5IHZA 4D8PA 4A6YB 4YFLI 3NPSC 2R8SH 4JLRB 1BX2A 2Y72A 3MRIB 4HS3B 1OSZA 3QEHB 5GRVK 4EI5B 1HIMH 3MRMA 1FE8H 4XWOD 4X5WB 5D4QA 2LFGA 5JW3H 2F74A 4ZO9A 4XHJD 4XPTH 4NO5A 1MHPH 3CGTA 1Y0LB 3S37X 2DF3A 4R3SB 1NJ9A 1OSPL 3L3IA 4NYLA 1TZIB 1KJVB 4YDKH 4LGSB 1NC4A 3HE6D 3V0VB 5A40E 4JFZL 2DQDH 3RZCB 5FK9A 5DA4A 1TETH 1JNNL 2ATKB 3GSVB 3O6FC 1LEGB 2UYLA 4NUGL 2X42A 4LKXA 3K81A 4D0BB 2L0DA 2OJZL 5IBTH 3VXUD 3MRNA 4OT1L 3TEUA 1RIVH 4E5XA 1VKXB 5DURD 4PRHB 4PRIA 3WUZA 3MX0A 1KACB 4RQQB 3GMMB 2L7JA 3TC9A 3RL2B 1DUYB 3RNKB 4KDWA 4KUCF 4HJGA 3MBEA 3O11A 4NQUA 1YNLH 2ICES 4UUJA 1L0QA 4QRRD 3T65B 5AAWA 1I8MB 3PUCA 1HHHA 1QTYT 3U46A 5FB8B 5ICZB 4U1HB 2UUDK 5K9OA 3C6LA 2EDDA 2DQGH 3ZHDA 3MJ9L 4Z7WE 4HF5H 1F3JB 1W8OA 2OZ4A 5HHOA 5MEPA 4GJTB 4CAGA 4NRYA 4XC3L 3W0WD 5BCAA 2NZIA 2DLEA 2VTFA 1S9YB 4XCYA 1CD0A 1HXMA 2C1OA 4I48A 1E6JL 2R1WA 3OKKB 1RU9L 4ISVB 1XZ0A 2NCMA 2ZWLT 4C56E 3UP1A 1XCQB 2IFGA 4NO3A 2GJ6D 1BOYA 3JUZA 4OM0L 1PG7L 3PQYE 1P9MC 1DL7L 1DLFH 1FN4A 2Q7YA 4IDJL 4WEUD 3I6GB 2WNGA 3GSNA 3BI9X 3GB7A 3SDDA 4TRPH 4IDLA 4LL9A 5D7JC 4QXUH 2QV2A 5JIHA 4K9EC 1C12A 4PLNC 2PYFB 3IKKA 1QRND 3D39D 5B3JE 2R23B 4NIKB 4ALAH 3ARDB 2EC9U 1BJ1H 3L5WA 4ZSOB 3IRPX 1S7SB 4GW4B 3B8SA 4OLVL 2DQEL 1JF1B 1PBYA 1KIRA 4R8WL 3S4SB 3VFWB 5F9JA 4AEIL 3P4NA 4M02A 4WW2C 3I75B 4R7NB 4JN1H 3SE3C 3VG0H 3LKSA 1NCUA 1JNHB 3L5XL 4DJMA 2HFTA 2FD6H 2HRPH 1OGTB 1R3KA 5I73C 5C0AB 5L7XH 3VCLB 1PX4A 3HPLB 4E41A 1FH5H 2GSGA 5IVZA 1XR9A 3T09A 2PW1B 1KTRL 2GK2A 4KXZI 3EGSA 3RKDD 3P4OA 2HMIC 4ODXB 1NCAH 5H2BA 4O9HL 3RU8H 2XTJB 4BM7A 4DKAA 1AGDB 2OYPA 3Q6FB 3OR7A 3WL9A 4WU5A 3S88L 3DIFA 3BPCB 2OR9L 4JPWH 1A6AA 4RGMC 3FO1A 4GOSA 3VD4A 3GHBL 4RISH 2DLFL 1L0YA 4ODWB 2VZ1A 1KN2L 3I9GH 4HZAA 5C09B 1FZJA 3WDJA 4OZIA 4I18B 2UY7A 4LLDB 3RWCB 1TNMA 5EU5B 3IXTA 2WANA 1LGVA 3MXVH 2NY7H 1I3UA 2ERJB 3IFNH 2VNCA 3F58L 3EO9H 4FNLL 2EIBA 4Y4KC 4PP2A 4FFYL 3MBED 1RY7B 4G8GA 1U92A 3JV0A 4U1IA 3V6OA 3WN5B 4AQOA 5TDNA 1UB5A 1PZ5B 3I3BA 5K59E 1ONQB 2A6JB 5GSRB 1VFOA 1BFOB 2P8LA 1P5UA 3D2UA 1T3FA 2GCYA 5CEYA 4PS4L 4DGYH 4GAGH 1FGVL 1U95A 2I9TB 1JFQL 5HHOD 5LCVH 3DUSA 4KROB 2BVPB 5HSFA 1UWGH 3QHTC 4IRZH 4IMKC 3U4BH 2EEAA 3I6LD 3UTOA 1CGWA 3IDGA 4Z95L 1I7UB 4X6FA 2OL3B 3H9SA 1FO0H 1B2WL 4LSVH 2NYYC 2CRMA 3TNMB 2HFGL 5FM8A 2D0GA 1G7QA 2X4TB 5F9WB 3WLWD 4N8VG 5C0JA 4YUEL 4S1QH 5FKPB 3T2OA 1KYOK 1OW0A 5ACZB 5MI0C 4C83A 2CDFA 4XHQA 1T7VA 5C3LD 3MUHL 1G7IB 1NBZB 5SWQA 4H5SB 2B1HL 5M94B 1I9JL 3ULUH 5EBWB 1P6AB 1CFNB 1QSVA 5CEZD 4Y5XC 4P2QA 5IF0B 2YWYA 5B38G 3OGCB 2FB4H 4GO6B 4ODVH 5IHUL 3SDDD 3HUJE 4M8QA 3QHZH 5D72H 1MJ7L 4PJDB 4GXUN 1B4JL 4O4YL 5IROC 1A02N 2AJ3A 4JZOB 5F93C 4JY5L 1AGEB 2CMRL 4F58L 4ZS7H 2QEJA 3RIAK 2F8XC 2IGFH 2WM0A 1S9XA 4JM2B 2W0FB 2FJGB 4RFNC 3QI9C 5EZLB 5F9DC 3K80A 4XP6H 1QFOA 2HWZH 3U48A 4LLWA 3FKUS 4JEGB 1C1EH 3LKRB 3LV3A 5T1LA 1SEBB 3WJLC 5H37H 1H0DB 2YRLA 5F3BA 1I3GH 5SV3A 4GXVL 4E41D 1QNZL 2DS4A 2BNRB 1M71B 3QFJA 5T1MA 4JO2H 4HZLB 2E7MA 5JUEH 4NNPL 4XPFL 1WT5A 2YD4A 4OZGF 5F7NC 3DV4A 3P73A 4X5XB 2VDKH 4J4PC 4XX1E 2D03L 3B83A 3TT3L 5CCKL 3Q1SH 4LSUH 3MUJA 3EZJB 3O9WA 4O58H 3LQMA 5FOJA 2NXYD 1X5GA 5KJRL 5JIKA 4TULH 4FQ1L 3BOVA 3B43A 3HZKA 1P2CA 3IDXL 2NZ9D 1HH6A 2ENSA 3GO1L 4JANA 3MRRB 43CAB 2HYMA 5D5ME 1Q9LB 4H8WH 3MUGB 5E7BA 3SO3C 4YAQA 2XWBA 1S7RB 4HT1L 1TVHB 1FDLH 3HE7A 1DP0A 1QFWI 1RIUH 3RWGB 3E6FA 5DEGA 1VGKB 2BNUA 4K3GA 1I9IL 3G08B 3JTTB 2P5EB 4IJ3B 2V7NA 3NN8B 1IBGH 2VZSA 3MRPA 1T21B 3D2UD 5EZIL 2ADJA 2DL9A 1A14L 2IADA 4MX7B 4HGWA 3OR6A 3QPXL 3KPRE 4OB5L 5HYJA 3KWWA 1N5YL 2VDLL 4WIQA 3DYOA 3QQ9C 2EE6A 4HWEH 4FABL 2AJXL 2IG2L 2VH5H 3CLFH 5EU7E 4N0UA 4X7FC 4OUUA 5GSVB 4ZQKA 1JV5A 3H9SD 5GS3A 4CL7A 3TFKC 3FT4B 5J11C 4XNQA 4L3EA 3LN9A 1X5JA 3FB6B 3X13B 5DD6A 2O93L 4GRLA 5FYKU 1ZGLA 4P2QD 2VR9A 5I8OH 1LEIB 2JJSC 4MGXA 3DROB 3O45A 4ONHB 4GRMB 1XF3A 2DLTA 2PNDA 4RGND 3WMSA 3L3HA 1P7QB 1DEDA 3TN0B 1LDPH 5JZ7C 2HLFD 4OCSL 4M43L 4N9GA 4W6WB 5KSAA 4LSRH 1U8PA 1AR2A 2CLVB 4L8DA 4AM0B 3OKLA 4HD9A 1I8LC 3MXWH 1FVCB 4N0FB 2D31B 2QQNH 5KS9F 2DTSA 2H6PA 5L2JB 2B2XH 1MFCL 3KXFA 1EVTC 1WSST 2D7NA 1P1ZB 4LQ1A 4Y16C 3SDYH 1QVOA 5FDWA 5ISZA 4QTHA 1RZFL 2KZWA 2X7LA 4GBXC 2B5IB 4ODUB 5AYUL 2D7OA 3EYSL 5C8JB 5T1LD 1RMFH 2YA2A 3ULUE 4HBQA 1OP9A 4PGEB 1N64H 2PXYA 2R2BB 5IJVA 3QFJD 1J8HB 4FXKB 3ABZA 1B0GB 1Z0NA 5IBUB 1IE5A 4Q74A 3OKOA 2AJSH 4RMTA 1G7LB 3O3EA 2ED9A 3UZVB 4JCMA 2DOCA 3S96B 4EXPX 4KQ4H 4HC1A 3KYOA 5KANG 4WVRA 3O9WD 4I5BB 2GKIA 5F1KC 4BQBA 3RGVB 2C4FT 1MHHB 2X9WA 4NJAH 5DSCA 2AVGA 2F9BT 2QHRH 1CE6B 3MBXL 3P9MB 4C54A 3B9KB 4OCYH 3MRBB 3QRGL 3EDDA 4S1RL 5M7QA 2G5BA 1MAML 3SDCA 1N3NB 1TCRA 2I60L 2I07B 4D9RD 1U8NA 4WFEE 4P3CL 3PL6A 3IDNB 3FQUA 3IDJA 3HE7D 2AGJH 2I9LB 5IEHB 2Q20A 5TPWL 5DMKB 5C07E 5L2KB 1NGZA 4MSWB 1UJ3C 5ERWB 3VXRA 1A6TB 4LCWA 4LVNB 3QUMB 3T2PA 3QWOA 3MJ7B 3FL7A 5IB4B 1JYNA 1XIWB 1PEWA 1LE9A 2K7QA 4PLOB 5ENWA 3L3JB 1CDIA 2R9HD 2NY5C 5IVXB 5LGKA 3TZVA 4YXLL 5HYJD 3H6JA 3OKMB 1BWWA 3C8DA 2E6JA 5JHLL 3LH2H 2Q3ZA 1NGXB 1P84J 5E8PA 3T0WA 5ID0A 4WY7L 1XF4B 3ARFC 1ADQH 4YHOL 4NJ9L 1NFIB 1IGML 2NX5E 4GSDL 4R90L 5BMFH 3BW9B 4FQHA 3EYVB 4PRPA 2YRPA 2G9HB 1IQWL 4NHUA 1A2YA 2AEQL 1FRGH 4AEHL 4G6AC 4JO1L 4L3ED 3S37H 3T4AA 1XR8B 5IFJA 2GJZA 5EPMB 4XPGH 1HINL 4S2SA 1V7NH 5H35A 1SVCP 4JFYB 3WJJC 3G5YB 4GRLD 2OXHA 3FOLB 2AK1L 1T03H 1LO0H 1LK3L 4J8RB 1F3DJ 1MWAA 4TTDC 3MJ8A 2VSDA 4HBCL 2W65A 5KSAD 1YYML 3FTGA 4OI8A 1NCBL 1IC5H 5L6YL 1MVUA 2BZDA 4OZHE 4WHTB 1ZMYA 1F3RB 3MRKB 4DFIA 3TCLA 1V3KA 5HHMB 1KB5B 5D8JL 1U8HA 3KXFD 1JHKH 3UMTA 5ISZD 4JFDD 1OB1B 1KELH 3WIIL 4FFZL 1E4KC 4X4YA 4PJAB 4OCLC 2AW2A 3TBSB 3MNVB 3HI6L 2PXYD 4D2NA 3MV01 3JWDH 2DWDB 4LSQL 2IAMB 2Y06L 4NFCA 3FONB 2R2EB 1EGJA 3MRFB 5DRZB 5SWZA 5J1AA 4JFOB 1RZGA 1K3ZA 4AMKL 1G7PA 2VAJA 3GI9H 3GMQB 4NNXA 4CMHB 3ES6B 4DZBB 2DAVA 5IG7A 3G04B 3WFBH 4DKFL 1J1PL 4TQEL 2O5XH 5GGVL 1NMAH 2AV1B 4D3CL 4PGCA 3SDCD 1L7IL 3O4OB 2FR4A 1K2DA 3PL6D 3L3GA 4ODTL 1FIGL 1PY4A 3PDOB 2B1AL 1MEXL 3D3VE 3VXRD 2VL5A 3ARGA 3SDAA 4YH6A 1H3UA 4LCWD 3TA3B 3V5HA 1QR1A 3F5WB 2D0HA 4CVUA 3LKNB 3TZVD 3FCTA 3ZT7A 4LIQE 1ES0B 4HWZA 3TNNA 1CL7L 1KT2A 1JVKA 5D2NB 2VLLA 2EKSA 1U8OB 5CIPB 1EPFA 3F6IA 1IC4H 1F45A 3VGFA 5I2IB 1ZLUH 5FUOH 3CLEL 3V4PH 1JTTA 3CSPA 1CFVL 5E2TH 2O26U 4OBSA 4L4VD 1TPXB 2C3VA 5FECA 2BY0A 4PRPD 1KPVB 4L9LC 4Y19A 1RPQA 4NKDA 1XT5A 1BIIB 2CIIB 5ADPL 1Z5LA 3H0TB 4M8VA 3QNYA 1D5MA 2AABH 1YY9C 3AAZA 2DBJA 1I1RA 1AQDB 5AEAA 2Y07H 3HRPA 5BV7L 2HJFA 3NOIA 1KJ2H 1P53A 1A7NH 1R5VA 5E5RB 3UTTB 5EIQA 1CE1H 2NY2D 4Z8FH 1FFRA 4XC1H 3QUKA 1YEGL 2PTUA 3HI1B 1W72L 3NCFB 3VFGH 2EYTB 2MHAB 5FYLL 3NTCH 1FFOB 2CIKB 5I15H 1MFDH 4JQVC 1R0AH 4IM8A 2FGWL 1A6VH 4LHQB 2XZAL 4YQXH 4PRAB 2X1XR 3B4NA 4YE4L 4HC1L 2QKIB 5F3HB 3GMRA 1MFNA 5HVFB 2AK4A 1NAMH 3DO7B 3KPQB 5I8KH 2VXSL 3DRTA 2J6EH 3TT1L 3CX5K 3BWAA 3PXJA 5E9DA 4JDVB 4DQOH 3BT2L 3VFSA 3DURB 4N0CD 4UAOC 2OR8A 4W70A 4WI9A 5A2KH 4UIKH 4MQXC 4U3XA 1I8IB 3CAFA 5DJCA 3SE4A 1T89A 4WFHD 3QNZB 4OZGA 1T4KA 4KK5D 4J6RH 2EH8L 3BEWB 3DMMB 4Q97A 1T2QL 3R06B 1FNAA 5SWZD 1J18A 3JV6A 4XPHH 4PJBB 1YN6B 1DQQA 1P4BL 1YEEH 1A7BA 1IGCH 1C7TA 2Y36L 1U58A 2X4OB 3CXHK 5JOFA 2RBLA 2YPKB 5FDYA 3QUZD 4JAMB 5F8QC 4K23H 4ZTOH 2XQYK 4JRYA 5E1AB 3QIUC 5DJDB 2VUOA 3L7FA 5F1NA 5CUSH 4L29A 2ZCHH 2F5BL 3P77A 4DKEH 2R0WH 5F89A 1LD9A 1MPAH 4HCRL 3WO3B 3QUYB 4NN6B 5JQHC 3ARGD 3SQBA 3SDAD 4LPYA 5I1DA 5FO7B 3O6KH 4MDIB 3NCJH 3UDWC 4P9MH 3U36B 5CAYB 3CSYB 4NQEB 3AU1A 4N5EC 3VRIB 1S5IH 4YHZL 4YDJB 1I1FB 5DRWA 2FO1A 3G5VB 4F9LC 1ODAA 1XAUA 3RTQC 2Y7QB 5GRWA 3IT8D 1DBKH 3VG9B 4KVNH 1MCOH 1S9WA 4O5LL 1X5KA 4XVJH 1F3DH 1ZHLA 5LJYH 4MS8D 3O2DH 4JFXA 5JQ6H 4L1DA 3EJJX 5AYQA 4HH9B 4WTZA 5LWYL 1IM9A 3FQTA 4NZRH 4OFVA 4BUHA 2GQHA 2XKUA 4O02H 5D7IA 4IRSB 3RX7A 1TJIH 5BZDB 3P11H 4Y19D 5IEKA 1LO2L 3QO1A 4ZMAT 2BK8A 5ID1B 4IS6B 2J5LB 1WEJH 3ULVH 5KSBE 1YEFL 5I1IH 1FORH 4EKXA 1S9KC 5IB2A 4PP1C 1F6FB 2IH3A 4GG6E 1HILB 4RA0C 4LP4A 4KKLC 1Z6JT 2FHFA 3EFDH 4G8IA 3U7YL 1O5DT 4KHXL 4CW1B 2H8PB 1H15B 4U2ZA 5KBNC 1GZPA 4PG9A 1NLBL 4P46C 4KJQD 3NABL 1UEYA 2VISB 3RA7L 5CLWA 3DUHA 4LGRB 5F1IA 4PJDF 1F13A 3OKYA 2HT2C 4QRUB 1DN2A 4TNVK 5J1SC 4JY6A 3TVMA 2VLME 5GGRA 1X5AA 3U0WL 2OXGA 2ARJQ 4OM1H 5B22A 3UXFA 4BH7A 4BSWB 4OQTH 4XWOC 1II4E 4DZ8A 1G0XA 3PP4L 4Z76B 5KS9A 3T0EA 1EGJL 2PR4H 3LIZH 1UYWL 4PG2A 4JZJC 3T3ME 4JM2F 2R29H 3NIGE 5AD0B 2AK4D 3L3OB 4TUJB 5FCUH 1BFVL 4RFOH 3VFTA 4LCCB 1CI5A 5E9DD 3S36L 3KR3H 4IIQC 4OUOA 4KQ3L 1XF1A 4CADA 5GS0D 3CH8A 3P0YL 3MV9E 1NCWH 3QEQB 4NGHH 5A2LH 3QXAB 1G0DA 1DSFL 1KTLB 1QHOA 1ITBB 3QDGE 3TLRA 4POZD 1KCVH 1NLDH 5C0CD 1K8IB 3MA9L 5ITFA 3RJQB 5MENA 4HIEB 1RUQH 4YO0A 1HH9B 4F7TA 2AXGA 3TO4C 2QJDA 5KVFH 1CXEA 1UA6H 1DBJL 3VFMA 1OARH 1UM4L 3BE1H 4XCEB 1MHCA 4JRYD 3CZFA 3VXTB 1I1YA 4K8RL 1QSFA 3O3BB 3KGRA 5ETUA 2YZ1A 5CFHA 1J05B 1KIUA 2KBGA 4UT7H 1JCKA 3IGAA 5T33H 3KPSB 3FN0L 1E4WH 4YHYB 4YHPA 3OHXA 2PW2A 4XB7A 1SYSB 4MLSA 3DBXA 3PNWA 4RWHA 2WWMD 5J89A 2AJVH 1ZT4B 1T1ZA 5EU6B 4IHOA 1ZHKB 4LASL 5BRZA 43C9A 5CJBA 3C8KB 5LVEA 3AY4C 4W4OC 4P57A 4M9PA 1YQVH 2UZIL 1J0YA 3C5ZD 3REWB 1CICB 1BOGB 2A77L 2MQ3A 4PJHE 1D6EA 3ARBB 1Q0YL 2AXJA 2M2DA 5K93A 5CBEB 3JUYA 1IM9D 4CVZA 2P24A 12E8H 3IDMA 1QSZA 5DGRA 1QPPA 5JA9A 2FL5B 3HZYB 2EIZB 5CJQL 5L8JB 1XGTA 2F53E 4RAUA 3MOBH 3QA3A 3BJLA 2ZCKH 5KSUB 1LE5B 4X7EC 2VDQH 4ZNEE 1BAFL 1UXWB 3L1OH 2BSSA 3T0XA 3U4EA 3ZTNH 4PGJA 1DVFB 5CMAB 2J8UE 1WVZA 4LDEB 1ORQB 3QDAA 5F44A 1G6RB 5C0ND 3MLSL 1JYXA 4BKLA 4RMVA 4QY8A 3ZKXC 1OAYL 3TVMD 5BS0E 1NGWA 1SJEA 2AV7B 4U6YB 4H1LG 1SY6A 3SJVE 4EBQL 1RFDL 3T0ED 3IVKA 3TESA 1SJXA 5AZ2H 2F54E 4OGXL 4NBYB 5GGUB 2H26B 1U93B 5INDB 3ULVE 5CZVL 4C58B 4JLRA 3MRIA 3QEHA 5TQ0H 5KVGL 4X5WA 5DJZB 4NRZB 3RP1A 4LOUD 3DXAA 4RBPK 2EXWD 1KN4L 1Y0LA 4TNWF 3UJIL 4R3SA 5L9DH 4H88L 2A6KA 4K55A 1JGVL 2OP4H 3EW3B 3ZMRA 3VRLF 4QTIL 1KJVA 5HHQB 3V0WL 3CJJA 3L6FA 2DQIH 5KVEH 1VESA 2K7PA 4KK8D 5GRJL 3VDBA 5J6HB 4GW5A 5JR1L 5MEND 5T3ZD 1YEDA 2JB5H 3LN4B 3DETD 1T0PB 2Z92A 4J1UB 4PTUB 4YK4B 5ILTL 4L8SA 4YFDB 4HXAL 4XVTH 1VKXA 5K9KB 3L9RA 1I3VA 3VXNB 3BD3A 1DUYA 3KYNB 3HNTH 5BO1L 3RNKA 1VEOA 3BDXA 1UWXH 4JQIL 1UEMA 2HP4A 4EN3B 1JHTB 5EIIA 3NCYP 5IMMB 4F9PA 3UYRL 4G6ML 4PJFE 3PWUA 3KPOA 1BBDL 1R3IL 4Q0XH 4YZFE 3FFCB 1RIHH 4Z7OF 1EJ6A 1A3RL 4ZG1A 5FB8A 4PGZA 4FFWD 4UI2A 3ROLB 4OCRH 1BQHA 5IVXF 3KLHC 1GAFL 4JPIA 1BBJA 2JLLA 2XQYG 3S3SA 3BIKB 4JGJA 3NACL 3X3FH 5D7KE 1DBBH 3OKKA 3MROA 1IGIL 4UNVA 5I1EL 4XT1C 1MJJB 4KRPC 1SEQL 2CUHA 5IW6B 1JF5A 4R4ND 3OKDA 4F2MB 5B39B 3BZEB 1F8TL 3WYRA 1X9QA 3CXDH 3SPVB 3VMNA 3C60C 1ROWA 3VFOB 4CJ0A 4P5KB 2B4CL 3FO2B 1AGFB 1NEZG 1MREL 3ZDXE 5TJWK 4EOWL 2QL1A 4TVPH 1HIML 2GW5A 2FX8H 3EYQD 1MF2H 5ICXA 2W38A 1NGQL 1URLA 4GKZB 2L4OA 1MFEL 2PYFA 3BPOB 5FKAA 4P2OC 1YMMB 2R23A 1G6RH 4OBRA 4UDTB 3ARDA 1QLRB 2DM3A 3O2VH 2VQTA 1VENA 1F6AB 4DK6A 3BUTA 1PDKA 5D6DA 3MJGX 3B5HA 4JM4H 4YHNB 1Q9OB 4N0YL 4OLYH 1JF1A 4MNQB 3S4SA 4X99B 3KJ6L 4MXWH 1FCCA 5HDOA 5HGDB 4ENED 1X4ZA 1RJYB 5IQ7H 2JJTC 3VH8A 4APQB 5HHPB 1RIVL 4PJAF 2HAZA 3ZL4H 1OGTA 4AIZB 5D6CB 3FZUD 4C55A 4PGDA 5E8DH 4FHBD 4ZO8A 5FYKH 4X9FA 4K7PY 5GS1A 4NCC2 2FRGP 3GK8H 4LHUA 3SCMA 5GS2D 3Q5TA 2YD2A 4O2CB 1N2RA 3ME0A 1A7OH 4BYHA 1MCQA 2NW2A 4JFQB 2VR4A 3EDJA 5I30L 4ODWA 3ET9F 1EFXA 2YK1L 2APFA 3V6OC 1JUFA 2EH7L 2FZ3B 3HFML 2YD6A 2XIDA 4U1KB 1PG7X 4PRHD 1MRFH 1RV6X 1BVLB 1T20A 2GUOB 3RQ3A 2I27N 1BD2E 1O0VA 4OAWA 1CXKA 3LKOB 4FQ2L 4PJ7B 5CINH 1EBPA 4NQTA 3DSFL 4F57L 4O2EA 1CIDA 4NBXB 4NN7C 1YA5A 3LRHA 1XF5B 2P44B 5DUPL 5JLZB 1J9CT 4RDQF 5DXWA 4XP1L 4IOSD 3GBNH 3JV4A 4AJ0A 5SWSB 1HYSD 3DX7A 1T5WB 1V3JA 5HI4C 1BM3H 2PYEB 3LN5A 1YUHB 3E2HC 3MRGA 2DQCL 2DTML 2I9TA 1NDMB 2RQ8A 2YA1A 1KCSL 2V17H 4HKBB 1LVEA 3WUWB 2CGRL 1DE4A 3GSXA 4FQXA 3ZKQD 1IGYA 3EYOA 3KLAB 3LKPB 2DD8L 1KJ3H 2ZPKL 3K4DA 3WNKA 2JJVA 4G5ZL 2R0KH 5FKPA 1A4KA 1JI1A 4AENB 2YUWA 4FFVD 3BX7C 1M7DB 5ACZA 3PF2A 4K71C 4POYA 2FX7H 4XZUA 4X7SL 4U1LB 2AJYL 2RHEA 2WUBH 1KPRB 4A6YL 1CFNA 2XTLA 5IF0A 2CK2A 4Y7MA 4PJXE 3OGCA 4KZDL 1F4WH 3ELAT 2EDKA 5HJ3B 4MCZA 1CK0H 1HNGA 1OTTC 3RWJA 4PJDA 3OTTA 3QDMB 2XN9A 3HZMB 1RI8A 4HDIB 4JZOA 2AJUH 3ARDD 1RJCA 4NM8L 5I18L 1AGEA 1RUKL 4YBQD 5GJSH 2HJLB 2E7HA 3MFFB 4FXLA 2W0FA 2EECA 2MCPH 5D70L 1WWAX 5EZLA 3H9HA 3DI2B 3GIVB 2GHWB 1AQKL 2QQKH 4M7ZC 1A7RH 1H0DA 35C8L 5SX5H 3HCVB 5C0AD 5LG1A 2X9YA 5E94B 1KGCE 4KMTL 3UTSB 5FYJH 4TVPE 3A67H 1X5LA 4HWBA 3P9WB 3WHXB 4LQFH 4WGWB 5J0BA 2NY6B 4LHUD 3IS1X 3SCMD 3TIDB 2OTUB 4X80L 3PWVB 3TBTA 4N90E 2XTJD 5C1MB 2BNQA 1FZOA 4P59H 1RURL 1I7RB 3C6SB 5J6GB 5HVHC 1EFXD 4Y4FA 4BFEA 5BOZG 5F88B 5CWSB 5C09D 4U4BA 1F4YH 1S78C 2QR0A 2C4XA 4GAGL 3PWNA 3CUPA 4QLRA 5F7EH 3N1PC 3SKMB 4MZ2A 3MRRA 5LCVL 3NBNA 5JHDE 3J8F7 1UWGL 4TOYH 5CP7A 4DUVA 5DEZA 4S1SH 3MOAH 3RWDA 1MCSA 5EZJB 4LSDA 5FYKE 1A9BA 3STBA 3MYJA 4LSVL 4JB9H 3U7WH 3G08A 3WXVL 4NKOA 4B0MM 2P5EA 3TO2B 1WAAE 4KJYA 2CKBB 1IC7H 1SHMA 5CEXA 1F00I 3PHQA 4PJGE 3ZYIA 4XTRD 3HS0A 3X14B 5IP4A 2BVTA 4ZUUA 3A6OA 5J3HD 1A1NB 1IAOA 2FB4L 3OAYH 4YBLC 4Q58C 3QHZL 3CVHH 1JNLH 5C6WH 5IJKA 4FQXD 3SDXB 4R0LC 3KPMB 4L8BB 2NY5H 4YPGB 4G6KL 3JSSA 4YWGH 1DFBL 1F2QA 2BC4B 3AB0C 5C3TA 3GJEA 1BEYH 2BVQB 3FT4A 1FP5A 3QJHB 4HKZB 4KKCC 4IRJA 4DUWA 5D1XC 4HPOL 4Z7WF 2YD8A 3K1KC 2ZOLB 2DDQH 2VZUA 5DJ2A 3RIFK 1FNGA 1VERA 2XXMB 1WJ3A 4KFZC 3SGEI 2NY0B 1EV2E 1LEIA 1Z9LA 1C1EL 5J13B 4Y1AB 4GRMA 4RMWA 1RAMA 5C2BL 1VGEL 5HI5D 1IQDB 2XZCL 1OY3B 2W59A 1F90L 1MFBL 2BVYA 3BKYH 3DX9B 2NY3D 2VKXA 3L3KB 4ONOA 5H8DA 5BV7C 4M5ZL 3MREB 2J8HA 2YMXH 2X5PA 4TUKH 2GFBB 2XN9D 4PV9B 2CLVA 3MRJB 4UB0L 4HEME 1FG2A 2NR6D 3MV11 4JFEB 1HQRB 2XWJA 4PJCE 2D31A 1UZ8B 1QFUH 4F7CB 1MQ8A 5FXCH 3H42H 1DJSA 4JM2D 3DYMA 4LLUB 5EN2B 4HWUA 5DD5L 3H9YA 1FBIH 3LQAL 4FQQA 5C8JA 1E4XH 5IR1A 4M7KL 2YPLA 3MGOA 2Z4QA 3QT2A 1KLGA 4PGEA 5KVDL 1CFTA 5CHNA 3OWEA 4H8WL 1YNTB 1YNKL 1AIFA 1FDLL 4XVSH 1EMTH 4ORGB 1G7LA 3IU4H 5ELIA 5CJOH 5EUOE 2BNQD 2YSSA 4FQIH 3VWKB 1CTOA 2H2PD 3R0NA 4JO4L 4NQCE 3S96A 1QQDB 5IBLC 3PGFL 2OK0H 1A9EB 1CR9H 1IBGL 5DRXB 3OXRB 3PL6C 2DKMA 2EZ0D 1QOKA 2G60H 1MHHA 4N68A 4N8CL 4O2FB 2VXTL 4NQVB 3B9KA 4U1SB 3SE8H 2NQCA 4IOIA 1ERNA 5E6IA 4S11A 1OCWH 1N3NA 3PGDA 4WJ5A 1BQLH 5IMOA 1H5BB 3V6FB 4DGVL 2VH5L 5E8EA 2XZQH 3VW3L 4LCUA 2I9LA 5FYJE 5INCB 3TJEH 5IEHA 5DMKA 5B8CA 5L2KA 3MO1B 3R4DA 5E99L 2OL3L 2G5RA 5CJXC 1JK8A 5EOQL 5A1AA 3K7UA 5EUKA 6FABL 2P5ED 5C0BE 1C16A 1J5OL 1PGRB 3MJ7A 4CNIA 1MIEL 2WINA 4AG4H 1R5WB 4L4TB 4XNZC 3E6HB 4RFEA 1FAIL 4U3CA 2Q8AH 4V1DE 4XB8A 3STZB 1A0QH 3QXDA 1MRCL 3OJMB 5K59F 2LTQB 3GSQB 4J3VA 1ND0A 5DI8B 5EORH 1GGIL 2OM5A 3AXLA 1MH5A 4NBZB 2VYRE 1T7XA 2AEWA 2FWOA 3LPWA 4LSSH 3H2WA 5AZEL 2G9HA 1B4RA 3F7VB 4LKCA 1AJ7H 4IRJD 5F6HJ 1TTFA 2E7CA 5ACLA 3MODL 1BQUA 2V2XA 5J56B 2IEPA 1T80A 1WF5A 2YOCA 2KZ1B 1UKTA 1FNHA 2YHGA 5I1GH 5B4MD 2DRUA 2GI7A 1TFHA 4JFYA 1MJUH 3CFCH 3ESVF 4HUMB 4OTXH 3DWTA 3MLZH 2YKLL 3LRSB 3HMWH 1FYTB 3RZWA 4NQSB 4F7PB 4X6EA 3NVQA 4Q9QH 1IJ9A 4QRPE 2FHCA 2JCCE 1N64L 4N5UA 4F15C 2XA3A 2WIIA 3CDCA 3O3DA 4X6BB 1LEKA 3HNSL 4QWWD 4LHJB 1IKNA 3DVNA 4XP9L 1WIOA 4PB0H 4HWBL 4R26H 4WHTA 1GIGH 1T1XA 1ZTXL 3F62A 3BH9A 3KLSA 3ARXA 4JQXC 1T0MB 1KB5A 2J4WL 2KL6A 5IFAH 1A5FL 1KIQB 4P3DB 5JA8B 2O5YH 3BUYB 3DTXB 3ILQC 5FHBH 4Z7UB 1OB1A 1J10A 3NGBC 3OJDB 1KYOJ 1OTUC 2QHRL 1FIEA 2YBRB 3KJ4B 4OCYL 2LABA 3TBWA 2YPLD 3TBSA 5CGYD 4DTGL 4JFHE 4G43B 4OLEA 3HE6B 3QZWG 4P2RE 4MAYC 5TE7H 4I4WB 3ZYJA 1JGEB 3QUZC 4OQ1A 1BECA 4PJ9C 4LLMB 5J12B 2VZVA 3HKFA 4PJIE 5DRZA 4Y2DC 4JFOA 3CFDA 3VXUB 2FEEL 3D0VA 4U49A 3WFHB 3R8QA 4DZBA 5DK2B 3B9KD 3BHBB 4LMQI 1FNEB 3GSRB 1AO7E 4RNRA 2Z35B 1WBYB 5GGRY 1RSFA 3AMLA 1OSPH 5E6ID 5D1ZB 4HG4K 3U0PB 4YGVB 4KJWD 1W8NA 1HI6B 4YBHA 1ADQL 4CN6A 1LO5B 4AK1A 3FB8B 2E27L 2QHLA 5L2KD 1JNNH 1FNSL 5F1OB 2ZSVB 4K8RC 2Y6SC 4M6OL 2H32A 1ZT7B 7CGTA 4NUGH 3F65A 3JTSB 2Q7NA 2FCBA 4B50A 3RHWF 3LKQB 1B9ZA 1EEZB 3TA3A 2OJZH 3THMH 4OT1H 3HR5A 5TDOB 2NMSA 4S0TD 4FTVE 3MMEB 5I1JL 3W0WB 4B7LA 3LKNA 3QUXB 2LVCA 1LO0L 3NZHL 1T03L 4KHTL 5I74B 1QSEE 4X4XA 3HC0B 4NWUL 5GIRB 2EICA 4M1CC 4EDXB 1OVZA 1U8KB 5HHNA 1Y18A 2ORBL 1ZLVK 2GJ6B 1IC5L 3UBXB 5JO5B 5I1LA 4JDTL 1RJLA 4UNUA 1M7XA 4MMXC 3LVEA 2BRRL 3MLRL 2MFNA 4WI2A 4GQ9L 1K6QL 3MJ9H 3CDGA 5DS8B 4WTWA 1JHKL 5K9QI 1TQBB 3O8XC 1RK1B 1K4DA 5IKCA 4XC3H 4GMTL 3MV8E 2BVOB 4U31A 3K2UL 3UEZA 3C9NB 4ZUTA 1AGBB 1E6JH 3CK0H 1RU9H 1HWGB 3NZ8B 5E6ZA 5ABDE 1AI1L 2BHUA 3O2WL 4U6VL 3JWDL 4UDUB 3OMZA 3X11B 4OM0H 3G9VA 1PG7H 2HJKB 2CIKA 1J0HA 1DL7H 2ZZUT 5E2WL 1HHGB 4K07A 4URTB 4IDJH 2DICA 4D8PB 2YEZA 5HHMD 4TN9A 4IBLT 4PRAA 4I3GA 1DDHB 1BX2B 4Q6IC 1OSZB 3SE4C 5F3HA 4EUPA 2IJ0C 3DO7A 1G9ML 4QHNB 1U3ZA 2FEEI 2AJZA 3GGWB 2WAHA 4ELKB 4NO5B 1QBML 3SJVB 3L3IB 4NYLB 1LQSR 3NA4A 2JB6A 1NC4B 4OLVH 2AQ1A 2MJWA 2DQEH 3QNZA 4R8WH 3GM8A 4AEIH 1HE7A 1A6UL 2X4UA 5F6IC 5F7MC 5FK9B 3D85A 2VWEC 3DMMA 4X7TB 5IHLB 3G6AA 5EA0L 4R96A 2CDEB 3DUUA 4Y5YA 3L5XH 4K3HA 3QIBB 3QUML 3NH7L 1UKSA 1EEYB 4E5XB 2V5SA 2FLRT 4WI4A 4PRIB 2YPKA 1OAZL 4JAMA 4NPYA 1CGXA 1UZ6F 3MPCA 4GKNB 5DJDA 4HJGB 4UT6L 3O11B 4WEBL 4I3SL 4PJ7F 3S88H 2VLKE 5HYQB 3FHAA 4ZXBC 1EO7A 3N9GL 3U30C 1Q0XL 3RY4A 3GHBH 3U46B 2DLFH 5L0QC 3C5ZC 4YNYA 3QUYA 1KN2H 1A8JH 4YXKL 3C6LB 4OJFH 5FO7A 5ALBL 3TA3D 1CLCA 1OT2A 2AABL 4W81A 5DFVD 3LD8B 5MEPB 4ODHL 5GJTL 4NRYB 3O0RH 1PY9A 4PLJC 3GBMH 5E2VH 1ZHBA 3NCMA 1DCLA 4XCYB 5KN5B 1U3HC 4FNLH 5KW9L 4I48B 4BZYA 1TITA 5GHWL 4WU7B 4FFYH 3D0LA 1XFPA 4Z8FL 1FAKT 4Y5VC 4NO3B 2IH1B 4OGZA 4U1GC 4GH7B 1ZLWK 1F2XK 1G1YA 5BZDA 1IAIM 4I3RL 4Z7WA 3EO1A 1R0AL 4PGBB 1A6VL 3GSNB 1HILA 1FGVH 4LLQA 1KB5L 1A6WL 3EKCA 1CS6A 1JFQH 3MLXL 5C0DA 4KZEL 2A6DA 3SDDB 4CW1A 1DQLL 3M8OL 4C56A 3AS3A 2IBZY 2NPLX 1CLZL 3EOTH 1C12B 2X6MA 4PJ5E 4Z95H 3T0EC 4AL8L 2VISA 4G9DB 4PG2C 4X5LA 2B4CC 1UWEL 1WWWX 1B2WH 3VFNA 1FSKB 1V3MA 4UIKL 2HFGH 5C6TL 4G9FE 4QRUA 4XNYL 1ZSDB 4KJPC 5MHSE 4YUEH 1GYAA 2YWZA 1KIRB 5F9JB 3P4NB 2RFXB 5F7LB 2UZYB 4Z76A 4U0RB 1I9JH 2EE3A 3SE9L 1FPTL 5JDJA 3MJ6A 2X41A 5IHUH 3S3PA 4R2GB 3L3OA 4TUJA 4JREB 1R3KB 5I9QC 4OZHF 3RL1B 1MJ7H 4LCCA 4PIRF 2Z31C 2GSGB 5IVZB 3BP7B 1XR9B 5ESVA 3GZKA 1TQCB 1ZE3C 4O4YH 2NLJB 3EGSB 2OLDA 2XWTA 3P4OB 4NKQB 2NY4C 4JY5H 2CMRH 4F58H 1JGDA 3QEQA 3DETC 3TV3L 2FLBT 3B3IA 5D1QA 1RULH 2K1MA 4X6DB 3OR7B 4LVHC 4WU5B 4PBVC 3WL9B 3DVGA 1A6AB 3D85D 3N1QC 3DMMD 3BPNB 3W81A 2NXYB 3IAQA 4KV5E 3EOBA 4MQSB 4OZIB 4JG0L 3G9AB 2OBGA 3OGOE 3HAEG 3IXTB 1B6UA 4U3HA 4GXVH 3VFPB 2GY7B 3K4AA 4PRDB 3O4LB 1MFAL 4NNPH 4XPFH 4EVNA 4PP2B 3CZJA 1CYGA 4XVJL 4G8GB 1U92B 4HHAA 2VIRA 1VADB 4FFWC 5TDNB 1SBSL 1UB5B 2VL4A 3VWJA 2D03H 3CDYA 3TT3H 5CCKH 3A6BL 3V8CA 3MNWA 3QSKB 1TJIL 4LK4A 3HA0A 3QUYD 1SYSA 3PWLA 4CGTA 1M7IB 2GCYB 5CEYB 1RZIA 3MACL 3VXME 5KJRH 2YD3A 4FQ1H 1FFPB 5F96L 1LMKA 4M1DL 4M4PA 3GO1H 4LFHD 4M93C 3WIFB 3DUSB 3C8KA 1EEUA 4R4NC 1C08A 1L6XA 2YUXA 3REWA 1I7TB 5FHAL 3IDGB 1YEJL 2H2SC 4HT1H 3ZE0E 3FOMA 3P0VL 4X6FB 4OLXL 3SDXF 1I9IH 1KCRH 5FGRA 1UC6A 1G7QB 5JW4M 1JMXA 4BJLA 2A0LD 5C0JB 4KVCL 3RVVD 3S36X 2YC1B 4G80B 5T3XL 3EYQC 4C83B 1X44A 2CDFB 3BGMA 2EIZA 1A14H 3VMOA 3RNQB 4H20L 4QRRE 4IOFD 4P2QB 4U6HB 2I24N 1N5YH 1RUPL 5CEZH 4RGNB 1UXWA 1MSPA 2C7UA 4WCYL 1D6VL 4C56D 4FABH 3T4YA 1JTPA 2AJXH 2IG2H 5BVJB 1KOAA 4DVRL 3K74B 3KPLA 1CBVL 2E7BA 2AJ3B 3I3DA 4HKXA 1OAUL 3AREB 4ENEC 2LE9A 5LBSL 1WBZB 4BZ1L 4EI5C 2EEDA 1S9XB 2AV7A 4KGJA 4WWID 1AD0B 5DD3H 3ARPA 4NC0B 3HUJA 1YPZB 4WV1B 4CN4A 4I8DA 3WEXA 2DIJA 4LLWB 1H3GA 4WUKL 3LV3B 5INDA 3LPGA 3DO3A 4OGAD 5KVFL 3WV0A 4OCSH 4M43H 3IU3B 5T1MB 3QFJB 5DJZA 5IWLC 4NRZA 1MCWW 3RZCC 2VZ3A 2NNAB 1LP9E 2HFFB 1JE6A 4PD4K 3DV4B 3P73B 3QEQD 4L3CA 5D1QD 4O00A 4NDMA 3K0WA 2EO1A 1QRNE 4I0CC 3CIQA 3D39E 2JKXA 4KC3B 4YDLB 4MD4B 4Z7QF 1I85A 3B8YA 4J7RA 4J3XA 1RZFH 2ITCB 4FQLL 1UENA 5AYUH 3EYSH 2D4DA 5B21A 3HZKB 1P2CB 4HS8L 3ZSSA 4PTUA 1OD7A 4JANB 5MI0B 1D9KA 4GW1A 2FGZA 1TVBA 2UVEA 1JYVA 2ARJA 2X4QB 5JIIA 3KPPA 1QA9B 3VXNA 3CX5J 5HDQL 2BNUB 4EN3A 5FGCE 3VWJD 4XXCA 5IMMA 2DM7A 3O6LL 1T83A 4JKKA 4HLZH 3MRPB 3DNKA 4XMKL 1X5YA 5JHDB 1OP3H 3MBXH 1T0NB 2IADB 4CN1A 4HGWB 3TBYA 5EU6D 2HTKD 1DEEA 3MOBL 3FT2A 3OB0H 1QBBA 3ROLA 2ADGA 3QRGH 2BFVL 5A2FA 4JHWL 1MIMH 4S1RH 5DVLA 1MAMH 2DQJL 2I60H 1PZUB 4QNPF 4PLKD 3CXHJ 3ZTNL 4RMQA 4P3CH 3D1MC 1FZMA 3ZKMC 4N0UB 5E7FA 4OUUB 4NNYB 2I5YL 4ZQKB 4S1DC 2J12B 5TPWH 1CDYA 2Q6WA 1EEQA 1A7PL 4JRXE 3HAEH 2Y23A 3OAUL 1BF8A 1X4YA 4L3EB 4OFPA 3P4LA 5IW6A 3KPRA 1PKQE 2PCPB 1C5DB 5DHVH 3RRQA 4ELMB 1OP5H 5B39A 1I3RA 3BZEA 3ZDYF 4WWKB 1KTKE 4P4KA 4QKXB 4H1LB 1ZGLB 1K8DA 3MRCA 4ZAKC 3O45B 3V9FA 1XF3B 1CU4L 4DOHE 3DX8A 4RX4A 4JFPA 4XBGB 5JHLH 1FJ1B 5J57B 1OGAE 5TQ0L 4AT6A 4WY7H 4I0PC 1DVFD 4YHOH 4NJ9H 5A16A 1IGMH 1U8PB 4GSDH 4R90H 5HHOE 1ED3A 4L8DB 3OKLB 5I76A 1IQWH 4MZ3A 4GG6F 2AEQH 4AEHH 1BREA 4UDTA 2R0ZL 5BW7C 1F6AA 2XNAA 2JE8A 4R9HA 1HINH 1GC1L 2DQIL 1Q9OA 3KXFB 4PJEE 4MNQA 5FDWB 1NKOA 3B5TA 4QTHB 4TPRL 1X6LA 2X7LB 1SMOA 4LPCA 1LK3H 2XYCA 3C2SA 4Z7UF 3FO0L 2JB5L 5TDPA 1RJYA 3LS4L 4HBCH 2XTJC 4APQA 5HHPA 4AIZA 1YYMH 5L6YH 4Q2ZA 3OPZL 3OKOB 1PQZA 4KKBC 4J3TA 4JO3L 3LQAC 3W39A 5TFSL 1WIPA 4I18C 2F5AL 1WFUA 1Y6NR 4O2CA 2XACC 2WQRA 3RUGE 2VOTA 4Q0XL 2VDRL 4H8WC 2ERJC 4R6UA 1A3QA 1QFHA 2QSCL 5EO1A 1M6OA 3WN5C 3UTPD 3W82A 2EDHA 4OCRL 4X8XA 4OD3L 2G5BB 1D9KD 2OS7A 3HI6H 1NAKL 4GQPH 3SDCB 3QCUL 1DBMH 3T2QA 3QNXB 1U8NB 2Y06H 1KFAL 1IM3B 3FQUB 3IDJB 2MSPA 3SGJC 3GUTB 4XTRC 1NGZB 3DX6A 1TZHA 4E41E 2IPTH 2VITA 4EN3D 5HTSA 3PJSA 3U7AA 4KK6D 1BZ7B 4DGIL 4LCWB 1NCDL 3QWOB 3Q5YA 1S7QB 3MV7E 4NZJA 4KROC 5KZCB 1LE9B 5ENWB 2OTWA 1BWMA 4DKFH 1J1PH 1P4LB 2P42B 4TQEH 4I13B 2PYEA 5GGVH 1YUHA 4D3CH 1L7IH 1MVFA 5F9WC 1NDMA 5C07A 4ZNCD 3QEUB 5E8PB 3HI5L 2YRZA 4P9HL 2X1QA 1NEZB 1VFMA 4ODTH 1FIGH 1AGCA 5MEOA 4FQHB 4R7DB 4JKWA 4PRPB 4BUGA 4NHUB 1A2YB 1MEXH 2B1AH 4MJ5A 3KLAA 1G6RL 4ZOAA 3T4AB 5KVMC 1HK6A 3SKUD 4P23A 5D2LB 2GJZB 3V6OE 5FFLA 4OLYL 4AENA 5H35B 1P6FA 1NKRA 3IFOA 1U0QA 4MXWL 1CL7H 1DANU 3Q48A 2NX5A 4RX4D 1MWAB 3ARSA 3TJHC 5HDBE 5HJ3A 3CLEH 1DUZB 2R1XB 2W65B 1CFVH 4JM2C 1M05B 1MVUB 3GSOA 4LRIA 2YD5A 1G84A 4QHUA 5ADPH 4HDIA 4KI1A 1ZLSL 4YHLL 1TDQA 4JKPL 3AM8A 3S9DB 3OKNA 3TCLB 5E4EB 3A6CL 1U8HB 3H9SE 2HJLA 2EXYD 1LNUA 2MKWA 2N7BA 4MNQD 3RX5A 2FO4A 5BV7H 3G6JB 3Q2CA 4QRPB 4XWGH 3RIAF 4XCCL 2Y5EA 4JR9L 3GIVA 2ZUTA 4X4YB 5DTFB 4HJJH 4HFUH 4OZHA 1FC2D 2B20A 4APQD 2E9IA 3N1GC 1YEGH 3EHBC 5DUBB 1W72H 3HCVA 5E94A 1FVEB 2D2OA 3D69B 5FYLH 3FQXB 3MA7B 2EZ0C 5ANME 2G2RB 1CFSA 3BPLB 2YD9A 4QRSB 3V2AR 1L9NA 5CINL 2FGWH 2OTUA 4XCNA 4U1JA 5SWZB 5DHXB 2XZAH 4ONFL 1ACZA 1RZGB 1BFTA 2JF1A 4HC1H 2DQUL 3UYOD 3ULUD 3C6SA 5J6GA 2J88L 3T3PE 1TTGA 3SBWC 3BISA 5IG7B 3TT1H 5F88A 3BT2H 4P2RB 1HXYA 2WBKA 1F11B 1U6AL 4PGCB 5IVNA 2PO6A 1KSRA 3SKMA 5KOMC 5F7HA 4IJ3C 1K2DB 3CU1A 1U8IA 4MNGE 3L3GB 1F4AA 2OI9B 1UADC 3BVNA 2EH8H 3B6SA 4WUUE 5ECJE 1T2QH 3QEGL 2VL5B 3ARGB 3SDAB 3MRLA 1MCJA 1P4BH 2Y36H 3ARQA 4BFIA 2E9JA 1QR1B 2EDJA 3DYPA 4UQ3A 2CKBA 3LOWA 1LO4L 3FCTB 4N8VA 4WFED 2PYED 4C57C 2WUBL 4HWZB 5E5UB 1KCLA 3HHRB 2HVJB 3HMXL 4Z77B 4DVBB 2VLLB 1A1NA 2GYSA 1XF2A 5C07D 3UROR 1HEZA 3PV6A 2Q8BL 2MKLC 2DLIA 3CDFA 2F5BH 1BLNA 5B38A 1X6NA 2C3VB 2WUCL 5FECB 4HCRH 3D87B 4Y19B 4YPGA 2FHBA 4NKDB 4UOW0 1E28A 3WNPA 2JJUA 2AEPL 2BC4A 4WHDA 1D5MB 4OZFG 4P23D 2LU3A 4NQXA 3TN0C 2DMBA 1CGTA 2ZOLA 4YHZH 5DWUL 3VI3F 1C5BL 2AXHA 2HJFB 1UGNA 3I3EA 4QWWC 4GS7B 4O5LH 2NX5D 2ZOKB 3OXSA 1A7RL 4X6CE 1IGJA 4G8FB 3BZ4A 1CGVA 1IQDA 5LWYH 3DECA 4Y4HA 1L9MA 3MREA 3V52L 1LO2H 5CJ8A 5GZND 2QQLL 3MRJA 3ROOA 4JVWA 2B5IC 3A0OA 5MP6L 1PD6A 2NXZB 3H3PL 1HQRA 1NMCB 1UZ8A 4ONGL 1MHEB 3U9UB 4L8CA 1HN1A 3GMRB 3JWDC 1EZVX 2AK4B 3U7YH 4KHXH 5EN2A 1XGYL 2C9AA 3BWAB 1NLBH 4MJIB 2ICCA 3NABH 5E9DB 1JZ4A 5IK3A 3RA7H 4LBEB 1JZ5A 4U1MA 4XNUL 1LILA 1A3LL 1B3JA 2VDPL 4MDJA 1G9MC 4OZGB 3WS3A 1T4KB 3LB6D 3RGVC 4R4BB 1OAXL 2XRAL 1DZBA 3PP4H 3QXTA 4X6DF 1EGJH 1UYWH 4ORGA 3I85A 1DQQB 1N6UA 3QJFA 1U58B 2KPNA 1QQDA 5DMJB 4KJWC 3GSWB 4OZIF 1BFVH 3S36H 3K8KA 1IAMA 3NCBB 3DVFA 4KTDH 3V79C 5ISZE 4KQ3H 4JFDE 2DI7A 4ZS6D 2PO6D 3KPNA 3P0YH 3L7FB 5F1NB 1FNFA 2GT9A 4LVNC 2UZXB 4L29B 3V6BR 3CFKB 5A3ID 5EU3B 3CSBA 1DSFH 5DMYA 1XIWC 3P77B 1PYWB 5F89B 1LD9B 1MJ8L 5FYLE 2VABA 1VCAA 4XP4L 3MA9H 3WS6A 1QHPA 4Z18A 3AU1B 5F9AC 1SM3L 2Z9TA 1UKQA 1R5WA 3GJFH 4L4TA 1DBJH 1JRHL 1S7VA 2VLRE 4JHAH 1ZHLB 4KWUA 5I1HL 2HKFL 4JFXB 3STZA 3IJYB 1ULVA 3D9AL 3BEVA 4YDIH 3FQTB 4WRLA 5D7IB 5IEKB 4TUKL 1IKFL 5IESL 4Z7NF 2QADB 5AG9A 1WTLA 4NN5C 4M6NL 2F58H 5IB2B 2IH3B 3EYFA 3TP4A 4CVWA 3LSOB 4LASH 3V7AG 1QFUL 3RPKA 4G8IB 2UZIH 1GZPB 5DVNA 2NY0D 3T0BA 4QXWA 2A77H 4NO0A 5F1IB 3VI4E 1Q0YH 2NTFB 3CNKA 2V5YA 4NQSA 3B9VA 4Y4HD 5EH1A 4JY6B 5DO2D 3TVMB 5GGRB 5KAQF 3AS2A 4GG6A 4BH7B 4HJ0D 5FF6B 3QG7L 4DZ8B 1AC6A 1YEIL 5TF1L 5CJQH 3KG5A 5D9SA 1B6DA 5T1DL 4L4VE 4DEPB 4MVBD 3HB3D 4G42B 2X70A 1YPZF 1T1YA 2QSVA 4U7MA 3D5OF 3BUYA 4OD2A 2R4RL 3VFTB 2IAMC 4Z7UA 4G9FB 3OJDA 2FDBP 4WEMB 2YBRA 4OZFH 1G7HA 2J3SA 3OKEB 2PETA 4CADB 3MLSH 3QXUA 5E08L 1Q9KB 5GS0H 1OAYH 3T04D 2ZUYA 1QO3A 1NCNA 4CMHC 4WI3A 2XG5A 1ZANL 4EBQH 1RFDH 5CD5C 1VFAA 4HIHA 3UAJC 4UOW1 5ITFB 4ZFZB 3BFOA 3GMNA 4OGXH 2WZPD 5CZVH 2HFEA 4F7TB 2AXGB 3IDIB 3O4OC 4UT9L 3EO0A 4D0DB 5KVGH 3MV9A 5E2JA 3ZKND 1ZVHA 2CKBL 2VQ1B 3VFMB 5DJ6B 3AMKA 3VD7A 5DK2A 3PDDA 3BHBA 1FNEA 1KN4H 1I1YB 3DV6A 1JRHI 3UJIH 1QSFB 3QDGA 3X12A 4H88H 5ETUB 3C09B 1JGVH 5D1ZA 5JW5B 3C5JA 4QTIH 4B41A 4YGVA 3TA3C 4JJ5B 2QTEA 3IGAB 4NSKA 4YHPB 3PP3H 5FM5O 5K33A 3OHXB 1JZ8A 5D7LE 3WHE0 4XNMA 3PNWB 1AFVL 5GRJH 4OLUH 3TPUA 2CQVA 2DKSA 5JR1H 5D2NC 1T1ZB 1NAMA 2FX9H 4IHOB 5BRZB 3NA9L 4LIQL 3QRFM 5ILTH 2J6EA 4HXAH 1KEML 4L4TD 4P57B 5TQ2L 1AHWA 5EO9A 1TPXC 2X40A 4TSBL 2Z8VC 4F80A 5JNYB 3SGKC 3V8OA 3QUXA 4H0IA 2D9CA 1A21A 1EXUA 4K2UH 5DZNA 4JQIH 1TJHL 1E4XI 2P24B 1U8KA 2BSTA 3IDMB 4I77H 3O3UN 4XP5H 1WAAF 3UYRH 4G6MH 4UILL 3U4AA 5EO0A 1BBDH 1R3IH 1HHIB 1N6VA 5DJAB 4DW2L 3KAAA 1A3RH 4ELMF 2NW3A 2MWCA 4GRWE 2AI0H 5DS8A 3FRUA 2R15A 1F5WA 1GAFH 1RUAL 5EOCL 2CXGA 4ZD3L 1RK1A 5HI3D 4O51A 4EZMA 3RY6A 3CU7A 3NACH 3CC5A 4OFIA 3C9NA 3TO4B 1AGBA 2IPUK 1IGIH 5I1EH 4BKLB 3V95A 3BGAA 4RMSA 2XA8L 3MYZA 2F53A 4UDUA 2ZUWA 1G0YR 1L4IA 1NGWB 5GRVL 2A9ML 4EQ2A 3X11A 5KG9B 1EJOH 1F8TH 3IVKB 1IL1B 4FZEH 1HHGA 1MI5E 4M03A 3QZWB 4YIQB 2B4CH 4HMEA 2X10A 2V5RA 2J8UA 1MREH 4OIBA 1DDHA 4EOWH 3VFVA 2W9EL 3NFSL 5C0IA 4QHNA 5CZXD 3GGWA 3DXAB 1NGQH 3O2DA 4TSAL 4ELKA 5BS0A 1H3WM 3DMMC 1KNOA 1MFEH 5BXFA 3SJVA 2A6KB 1F02I 2F54A 3L6FB 4N0YH 3VXQA 1AY1L 1T2XA 3KJ6H 4QCIB 2EDEA 2IPKB 2VN4A 4X7TA 1CVRA 3GNML 4F7EA 4GW5B 2CDEA 1YEDB 4NUJB 1R24A 2Z92B 4BSJA 4QYOB 1MY7A 3QIBA 4L8SB 3THML 3E8UH 4HEPG 1INDL 1EEYA 3BKCH 1JJUA 3L9RB 2G75B 4QHKJ 3RBSA 1MCKA 2GTWB 4NN6C 3QDGD 1VPOL 1G7MB 1VFBB 2V9RA 5D1ZD 1FLRL 4GKNA 1JN6B 3SEPA 5EIIB 4OQTA 2IMMA 3MUY1 3PWUB 3QIWA 1EH9A 3KPOB 3CFBA 3L3DA 3V5DA 5HYQA 1KC5L 5I30H 3VG9C 1H3PH 3NFPB 4AH2B 2YK1H 5IIEB 3VGEA 2EH7H 1BQHB 5C0CE 3VRJB 3HFMH 5EBMA 4JPIB 1BBJB 4ZOEA 4YX2L 1RUML 3LPFA 2P5WE 4IRSC 3QUXD 5C2UB 1EHNA 4HGMA 2VLJE 5DC0A 3VJ6A 4BZ2L 5KN5A 4PJFA 1RZ8A 2J5LC 4FQ2H 3CK0L 4MAUL 4WNQA 3MROB 5HXMA 4WU7A 1ACYL 3RVTC 4F57H 3DSFH 2VWEE 3BRDA 4IOFC 1MUJA 1MCHA 2IH1A 4YC2C 3OKDB 4PTTA 5DUPH 4CVXA 5H37G 4XP1H 4KY1L 3DHMA 5D2LF 2VXQL 2B0SH 5SX4I 3F7RA 4LPVA 4PGBA 2XFXA 3W11C 1MAKA 2HTLD 3OAZH 2DQCH 2DTMH 2Y9RT 2UWEB 2DYPA 4MB5A 2RR3A 1U8QA 4OF0A 1KPUA 4OIIL 5ICXB 1KCSH 3O6FA 1NEUA 3WIHA 4QOKB 1XGQB 4OCMC 2CGRH 3MCKA 3KYKH 3GBLA 4G9DA 5FKAB 2BRQA 2DD8H 2ZPKH 4WW1B 2D7MA 1UH4A 2E5EA 3QDJE 2F53D 3ZHKA 1NUDA 3BXNB 4G5ZH 1ZSDA 1YZZA 2KKQA 3WHE1 1HOCA 2RFXA 1OL0A 4TNVF 3ULSA 4X7SH 4XRCA 2AJYH 2J8OA 1ZLUK 5FOBB 4A6YH 1NQBA 3G6JF 1PX3A 5CLTA 4KZDH 1N59A 1WBXA 2UV3A 3VH8B 3D18B 4ZFGL 1GC1C 5DZLA 3WBDA 1D5XA 3RL1A 5BS0D 4PGDB 5EG6C 5JXEC 3BP7A 5GS1B 4XAWL 3SJVD 4KU1A 1PFCA 1U8JA 2NLJA 4PJEB 4Y8DC 1S5HA 4LHUB 4NM8H 3SCMB 5I18H 3IRZA 1X4XA 1RUKH 2F54D 5I71B 4HIJB 1NC4D 3S5LG 3I2CL 3OL2A 1N2RB 3ULVD 4X6DA 1JHLL 5C08B 4MLIA 5FGBA 2BJML 2NW2B 1INEL 1CD1B 5D70H 1MCDA 3SGEH 3CFJA 1EFXB 1AXSA 1AQKH 3IDUA 4ZTPL 4OJFL 3LDBB 5KS9E 1JUFB 3QIBD 3T0EE 35C8H 3Q6GL 1P9MA 4WTXA 3I02B 4PRID 3VFPA 4YHYC 3O0RL 4KMTH 3GBML 5E2VL 2Q76A 1T20B 4PRDA 3O4LA 4OAWB 2O5ZL 3MNZB 4FN0A 1CDHA 3SO5A 4K7FB 5IW1A 4X80H 1VADA 2HTKC 4LSPL 4O2EB 3V7AE 4OF7A 1GPOL 1RURH 3B2UC 4RWYL 3UPAA 1TTUA 5EZOL 1EAPB 1RK0A 3FO9B 3JV4B 1CDBA 1CICC 4MXVF 3GKWL 4NCDA 4P2OB 3LAFA 1M7IA 1KB9K 3DX7B 1E0OB 3C6LD 3LN5B 1A6ZB 3E3QC 1FFPA 3ARBC 3MRGB 3ZT6A 1BD2A 2QQQA 3WIFA 4WW2A 4Z0XA 1MCWM 5MENE 4MA3B 5ESQA 3TH4T 3O3AB 1ZKAA 5JW4N 2DL2A 1I7TA 3KYMA 1DE4B 3EOTL 3GSXB 4FQXB 3OF6A 1BVKA 2ZJSL 3RVWC 1UH3A 1IGYB 3EYOB 1KV3A 5GZOD 4Y88A 3WXVH 4HG4J 1CGUA 3TF7C 2IANE 1XGPB 1FL3B 4P9HC 4X9BA 1A4KB 2YC1A 4G80A 3QULA 4U05A 1JWSB 5C0GA 5FEBA 4HK3J 1DVFC 5C0RL 4XZUB 4LDLB 3RNQA 1QR4A 2VDNL 1CIUA 1N7MH 4U6HA 2GTZA 2DYPD 5I1AB 5EC1A 4MCZB 3O6FD 2NY3B 3RWJB 1N8ZA 2EC9T 5BVJA 5K9QG 3QWRA 1I1AB 2GEEA 5CS7A 2XN9B 3VU2A 4G6KH 3WFCL 4F33A 3RWIA 1DFBH 3O6ML 2ZUQB 1IILE 1MCPL 4HPOH 3AREA 5BQ7A 1RULL 4XMPL 4ZDHA 1WBZA 1PLGH 4G7VL 4Y4KA 1AC0A 5HYFA 2CR6A 4PJXA 3CPLB 1AD0A 1T66C 1YPZA 3H9HB 4WV1A 2ESVE 4HXBL 4I2XE 5F6HI 3CD4A 3HG1E 2VSCA 3IB4A 4R2GD 5C2BH 1T1WA 1VGEH 2XZCH 4NZDA 3GIZL 5BOPA 1F90H 1MFBH 3IU3A 4M5ZH 2IPUG 2NNAA 2HFFA 4UB0H 4PJ8C 2P48B 1GGCL 2W0KA 3WDIA 5F7FA 4FG6C 5DFWH 3TBTB 4IMKA 3CSGA 1NSNL 3OBAA 2BNQB 1FZOB 3JVGC 4YK4C 5BZWB 1EUTA 4MD4A 3MRDA 4M6AA 1AR1C 5DD5H 4KRLB 5EDXA 4Y4FB 3UBXI 1IAKA 2ITCA 2OTPA 1L7TL 1IGFL 2XV6B 3G5ZA 3EFFA 3LQAH 2QR0B 3LEVL 4M7KH 3SHSA 3PWNB 3CUPB 5ANMB 4EN3C 4KK6C 2OZ4L 5KVDH 5CP7B 4F3FA 1JYWA 3O4LD 4KRNA 3NFNA 1DTUA 2X4QA 1YNKH 3DGGB 4Y5XA 1QA9A 1JPGA 3RWDB 4G8GD 2DB8A 1A9BB 3MYJB 4GXUM 1WFNA 1KCRL 4JO4H 4NKOB 1E6OL 3PGFH 1MCLA 5EWIL 4NQDB 4KJYB 4OLWL 1AE6H 4N8CH 5CEXB 3U1SL 3PHQB 2VXTH 4D0CA 3HS0B 3HN3A 5JHDA 4OCWL 1T0NA 2XXCB 5HHXL 4ZUUB 1BD2D 1K4CA 4JY4A 4X4ME 1QACA 3GSNL 1IAOB 5CEZL 1H8OA 5E00A 5E70A 2R1YA 3GI8L 4DGVH 2YXMA 3HNVL 4I9WD 5E95B 3OF6D 4PRHE 3VW3H 4NNYA 1AP2B 3WJLA 3JV5A 1DQTA 1WAAA 3V6ZA 5E99H 5D7IF 2OL3H 3GJEB 4PJGA 5EOQH 4BQ9A 3HLAB 4IRJB 6FABH 4W6YB 1UM5L 3BP6A 1J5OH 3G6DL 1MIEH 5DJ2B 2PCPA 1C5DA 5D71L 5CD3B 2HMID 1FNGB 4ELMA 5DD3L 4WWKA 5KOVC 4J4PA 1FAIH 4H1LA 3BPOC 1J1OL 4LVOB 3WE6B 1MRCH 4XBGA 5T5FL 1FJ1A 1R3HB 1KCUL 3NIDF 4J3SA 5JOPE 1GGIH 2Y5TB 2XY2A 3QWRD 2RCSL 2Z93A 3UCRA 2BHZA 2IQ9L 4K3JL 2EDQA 3CH1A 5AZEH 2F15A 1FG2B 4HIIB 4RMUA 3ARED 2XWJB 4I1NB 3MODH 2W60A 1PVHA 1EHXA 4JJHA 3UPRA 4X6CB 3ARVA 4Y4KD 3KPTA 4J2XA 1TNNA 2CDGA 1ZA6A 3LQZA 4F7MA 3MC0A 4FQQB 2YKLH 3W9DA 4OFYA 5IR1B 2YPLB 3MGOB 2Z4QB 1KLGB 1CFTB 5K9JH 5CHNB 3FQNA 4JFFB 3HNSH 4XP9H 2HN7A 4PUBL 1AIFB 4HWBH 5GGTA 3T1WA 1ZTXH 3W2DL 3SOBL 2YSSB 4ZUSB 4J3UA 2J4WH 5J9PA 1HDMB 1A5FH 2EDNA 4ZSOE 1T5XB 2NYYD 3CFEB 4N9OB 1KGCD 3R0MA 4PY8J 3TBVB 4IOIB 1MIML 4PBXA 5E6IB 3CX2A 3PGDB 2V9TA 4N90D 4DTGH 4WJ5B 2DN7A 3QNXA 5DJ8A 5IMOB 5EUOA 2VZOA 4NQCA 2JJSA 5E8EB 1IM3A 1NPUA 4LCUB 5C0AE 5A2IH 3GUTA 4K3DL 5B8CB 2OSLB 1JK8B 1BZ7A 5EUKB 2A38A 1C16B 3LZFL 1DLHB 1PG7W 1S7QA 4CNIB 2WINB 3ZE2F 2XTJE 3LEXB 5JHDD 1WIUA 1TJGL 8CGTA 1I8LA 2V7HB 4RFEB 1P4LA 1RHHB 2IBBA 2B8OT 3BSZL 4HV8B 4LU5L 3QXDB 5C0FA 1WFOA 2DQTL 4Y16A 3T2NL 1B0RB 4QXTA 5C09E 1ND0B 3QEUA 2D7TL 3AXLB 1NEZA 4ODSL 1MH5B 4GBXA 2FWOB 4L4JA 2B7DT 5C0BA 2E27H 1J86A 4R7DA 2H3NA 2EDRA 1FNSH 4M6OH 4LKCB 4R97B 1NCTA 1T04B 2V2XB 5D2LA 2EKJA 4V1DA 5HHVL 4WWKD 1ZLVH 5I1JH 1UWXK 4J4PD 1JWMA 4LRIC 3SKJL 2BP3A 4BH8A 2ZP0T 4UINL 5GZNC 3NZHH 5E8OA 3N85L 4KHTH 4HUVA 1CXFA 4MA1B 5DQDH 4NWUH 4X6EB 5HVWA 1RVFL 1DUZA 1PSKL 2R1XA 2ORBH 4ZFOB 2WIIB 3O3DB 1LEKB 3M45A 1BGXL 1M05A 3DVNB 5HY9B 4JDTH 5JXAL 1T1XB 4YGAB 2BRRH 3BH9B 1V3LA 3MLRH 4U7SA 4GQ9H 1K6QH 5DFTA 3UZQA 2VUYA 5HYSG 4FQCL 4MXQC 4LRNH 3G6JA 4GMTH 4QRPA 5E2UL 2DJUA 3K2UH 1UVQA 4OFYD 2NY6C 3H8NA 4LMQE 3TBWB 5DTFA 5T5NG 2YUZA 3CVHA 4RAVA 1AI1H 3MLPA 1DQDH 3O2WH 3WKML 2HH0L 5DUBA 1DBML 2N4IA 4U6VH 1A1MA 4RDQG 1FVEA 3D69A 1ORSB 3FQXA 3MA7A 3IXAA 4TUOB 2G2RA 5E2WH 3V4UL 4QRSA 4HX1A 3QQ9D 4PJDE 2IPTL 5BJTB 4GT7A 4NKIL 4ZS6C 4HW6A 4XI5C 3CFDB 3PHSA 1CXIA 1B88A 2ATPA 1G9MH 3D0VB 1KTDA 1MCBA 3SN6N 1QBMH 1K3IA 4RNRB 4NC2B 2R0LL 4P2RA 3T8XB 1F11A 2N56A 4BSVA 1LO3L 3SY0A 2YS4A 2HT4D 5EU4A 1U3YA 4PJIA 4ETQA 1KF9B 4NQCD 4KKAD 1S9VB 4N1EA 1A6UH 3MLVL 3VFRA 2FH6A 4XNXL 2R69L 2BNRE 1J12A 1DBAL 1FLTX 5EA0H 5JZ7D 1JPFA 2H32B 4F15B 2R2HA 3AS1A 1A6PA 5HYEA 4K7PL 1AO7A 3QUMH 3NH7H 5KZCD 1EO8L 3HR5B 5I1KL 3FQRB 2PTVA 2ZG3A 1OAZH 4MHHI 1Q9WA 1XEDA 1P4IL 3UO1L 1Q72H 4Z77A 2HVJA 1JF6A 1MLCA 1UCBH 3ARRA 4DVBA 4Y16D 2APBA 4X4XB 5FYJD 4NWTL 1JTOA 4UT6H 5HHNB 2XPGA 1Y18B 4WEBH 4Q7DA 2EEBA 4I3SH 1E4KA 1GOHA 5C0BD 3D25A 3N9GH 1Q0XH 2AXFA 5I1LB 3QCVL 1RJLB 3AS0A 3O41B 4FTVA 2ZUXA 4YXKH 5ALBH 4KMQA 4B7IA 5J13C 3L5JA 1WZKA 4MAYB 3CDGB 3LEYH 4EQ3A 4V1DD 2UY6A 1YC7A 4PJ9B 1QSEA 5IKCB 1K4DB 4ODHH 4L9DA 4X4ZA 5GJTH 1HSBB 2P5EE 3X17A 2FEDC 4XWGL 2UWEF 4HJ0C 5KW9H 4ZUTB 3RIFF 2ZOKA 4HJJL 5GHWH 4G8FA 4HFUL 2YZ8A 4XPAL 3HB3C 1WICA 1J0ZA 1MOEA 4GRWB 5CP3A 3K8MA 4X9IA 4I3RH 4MNHB 4Z0BL 4G6FB 5GGTL 1KEGL 2A73A 2YEZB 1U2HA 3SKNA 4JGUA 1KB5H 1A6WH 1DR9A 3MLXH 1MHEA 3U9UA 4EUPB 4KZEH 2DMKA 3P40A 1DQLH 4HKJB 3ZO0A 1IRAY 4QRPD 3M8OH 2AJZB 4CDHA 4MJIA 4BK5A 1CLZH 4AL8H 4S0SD 4LBEA 4M48L 1UWEH 4Y2OA 2BOBA 3FFDB 2OMBA 2JB6B 3VWKC 5C6TH 4XNYH 1FYHB 2GITA 4PJEF 4QHMA 1W0VB 3WLBB 2X4UB 3GMLA 3ZKNC 1C7SA 4R4BA 3D85B 4WDIA 1ZA3A 3RFZC 4MA8L 3G6AB 1ZK9A 3PXHA 1ZOXA 4R96B 3DUUB 3SE9H 4Y5YB 1FPTH 2KQMA 4HMCA 2M8XA 3BN9C 2EDTA 3RDTB 1H5BC 1GZQA 3GSWA 2VAAB 4G6AD 4NPYB 4P2RD 5I75B 25C8L 1CL7I 3LMJL 2JIXB 3P9LA 4LGPB 3KYAA 4OFKA 3GRWA 3TV3H 3CFKA 1D5BA 5EU3A 5C9KA 4YHIB 1PYWA 4TTDD 2YN5A 3BMVA 1J8HE 4YNYB 4TTGA 5JPMB 2FIKA 4BQ8A 4JG0H 4KK9C 2PN5A 1AO7D 2ICEB 2DQHL 2LTQC 1YMHA 3RPIB 1IEHA 4JQVA 4H25A 5EBGA 1K85A 1ZHBB 3TWCH 1MFAH 2VLKA 4Q6IB 3F6LA 3D0LB 1MWAL 3MLTA 4RZCA 5CIPH 3IJYA 1SBSH 5DRNA 3A6BH 1TXKA 2W07A 5HI3C 4Z7WB 2A83B 1Q94A 1MCIA 3EO1B 5DR5L 3WKNA 4FTVD 3MACH 4AZ8A 4WI6A 5E03A 2P5WB 4GFTB 5F96H 5L2KE 4LLQB 2ID5A 3LSOA 4M1DH 5C0DB 1QSED 2A6DB 1HHJA 1CLYL 3BN3B 4RIRB 1EERB 5GQBA 4C56B 1EFQA 2A74B 4YEEA 5FHAH 1YEJH 1ZXQA 3AFLA 3ESUF 4LLYA 3P0VH 3QHFH 3UC0L 5IVXE 3PQYB 3VFNB 2NTFA 4OLXH 4NOBA 5L88L 2AQ2A 1X3DA 4KVCH 4YR6B 5T3XH 5DLML 2WBJB 3L7EA 3QIUA 5FF6A 4XHJC 3OAYK 1WV7T 1YEKL 3KJ4C 4H20H 2NXZD 4X0KB 2P8MB 2VC2L 4G42A 4JZNA 1JPTL 2W1NA 1RUPH 2EE9A 3MUZ1 4PJ5A 2E7LC 4WCYH 5L0QB 2KUTA 1D6VH 4EUPH 3HE6C 4F8QA 4MJID 4G9FA 3PABB 3S35H 4DVRH 5ESVB 4M7LL 3UDWA 3IETB 5HGAB 5JPNA 1IEBA 1CBVH 4KTDL 5J12C 2XWTB 3OKEA 3EOAA 1KUMA 2BMKA 3EOYG 4F9LA 1Q9KA 1JGDB 1OAUH 3I6KA 5D1QB 3B3IB 5LBSH 4BZ1H 4Q6YA 1P5VA 3U79A 3DVGB 3K3QA 2A1WL 2VRAA 5E8NA 3MJ9A 4GUPA 2MTPA 4ZFZA 4U1GB 3EOBB 5C9JA 4WUKH 2HLAA 5D93B 2W0LA 1S7TA 3P30L 3IDIA 3PIQA 5JIPA 3VD3A 4D0DA 5FIEA 1YY8A 2VQ1A 1UFUA 4WHYG 5DJ6A 1ZGLM 4EVNB 4KDTC 1YY9D 4JHAL 1GGYA 1H8SA 4UQ2A 2R39A 3NAAL 4HHAB 2VIRB 5JW5A 4PJAE 1HQ4B 3L5IA 4PRNA 5C70A 1NUGA 3Q5OA 3VWJB 4JJ5A 4YDIL 3T3PF 4P46A 3MNWB 3N1FC 3BD5A 1I8KA 3PWLB 1FCGA 1QLEL 1YECL 1RZIB 3QUXC 4FQLH 3M17A 3T77A 5DVOA 3F7QA 2F58L 4HS8H 4DCQA 2WIMA 3BAEL 3T08A 2MQ0A 3E1F1 2K3TA 1C08B 4FRWA 4JZJA 2WK2A 5JNYA 2VLKD 1EVUA 3FOMB 1BJ1J 2ZSWA 3NIFE 5HDQH 1EDQA 3VXMA 3O6LH 4AYFA 4YHKL 2Z31B 3RWHA 3BJ91 5DMGD 3U6RA 1HHIA 2QADD 4XMKH 3BGMB 5DJAA 5T1KB 4LARL 3F12B 4FZ8L 3VDAA 4GKOA 2BFVH 4JHWH 3EDKA 2DMCA 2C7UB 4LEOB 2DQJH 1EX0A 3T4YB 3AVEA 5TE4L 3G5XB 3VGDA 5ESAA 3UX9B 3KPLB 2I5YH 4OSUL 5DQ9B 3TO4A 1UJTA 3QQ4A 1A7PH 4HKXB 3OAUH 5D96B 5GS0L 3UPCA 5D2NE 4FA8A 1QEWB 2ICWI 5KG9A 1G1CA 1QG3A 3HUJB 4WO4B 1IL1A 4X6CF 1Z3GL 3WEXB 3QZWA 4YIQA 3OJ2C 4WI5A 1AKJB 3RKDC 4LDOB 1CU4H 3RVUD 3PWPE 2R56L 4G9FD 2D4FA 5MHSD 2QLVB 2MQCA 3VXSE 3VXPA 2R0ZH 4W4OA 4L3CB 4NDMB 3FB5A