4BFJA

Superoxide reductase (neelaredoxin) from archaeoglobus fulgidus e12v mutant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
ELFQTADWKKVKHVPVIEVLRAEGGVVEVKVSVGKEIPHPNTTEHHIAWIELVFQPEGSKFPYVVGRAEFAAHGASVDGPNTSGVYTDPVAVFAFKAEKSGKLTAFSYCNIHGLWMGEATLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding the Role of Key Residues in the Superoxide Reductase Molecular Mechanism, Exploring Archaeoglobus Fulgidus Sor Structure
rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE REDUCTASE
total genus 23
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4bfjA00
1DFXA 4BV1A 4BFJA 4BK8A 1VZGA 2HVBA 2JI3A 4BFKA 1VZIA 4D7PA 1DO6A 4BRJA 2JI1A 2JI2A 1VZHA 2AMUA 1DQKA 1Y07A 4BGLA 1DQIA 4BFFA 4C4BA 4BRVA 4C4UA 3QZBA
chains in the Genus database with same CATH superfamily
5HYIA 1KLFB 3T8MA 3BESR 1I7UA 1RSYA 4PJ8A 1A4BA 3LKPB 3QXWA 1TU2A 2RACA 3IJ9A 1ZIBA 2OMBA 3O2WL 1C8QA 1ZHKB 2WW8A 4CN6A 1PU0A 1AXIB 4PJHA 4J1UA 1T04B 2PXYD 4KK6C 4UILH 1MCFA 2OMVA 2WSKA 3C8DA 5JUEL 2E7DA 2LQRA 5C86A 4JANB 4Q8BA 3UEZA 3W9EA 2HJKA 1MWAL 3M1OA 4E0RA 3PJLA 2HLFC 4EJ1C 3QWRD 3WHE1 4PGEA 1HKFA 1NCOA 4Z0XB 1IAIM 2BNQE 4OZ4A 5L4FA 2YARA 4GRWF 5EU3A 2CHXA 1G9ML 2ZXEB 3ECBB 4M1DL 2WBJA 4AQAA 4PRIA 5G55A 5BUPA 4OZGF 3VJ6A 4OLWH 1OTUD 3TJPA 1L7TL 2VLJE 4DERA 1ZT1A 4E9QA 1UCBH 3PV6B 5DUMH 4F20A 3LZRA 3LKOB 4L8DA 3F58L 1H3UA 1CFNB 2D3NA 3GSVB 4CW1B 1D7BA 1D7CA 1I8KB 3KXFE 4M43H 4X6FA 1OWRM 3SODB 1XTMA 1SLUA 5HHOB 4LLDA 3DTUB 1MVYA 3EHBC 3RWIA 3RTLA 1I7ZB 2EO9A 1I9IH 1ZTXL 5GGRY 1C5CL 3T3PB 2QGBA 2RTTA 4WU5A 1TZ8A 4BZ1H 4PJ9B 2KZBA 2DY2A 2CCLA 1RJYB 5AW1B 3AWGA 2IV9A 3DXAA 2B59A 2C7UA 3R0NA 2CUAA 4G8EA 2WZ6A 1YEDA 3NZUA 1VGEH 3FU9A 5T33H 1ZE3H 3SE6A 4FNSA 3CLFH 5DUML 5T3XD 1LO3L 1S7XB 4CNIB 4H8WC 1U21A 3BQUA 4J4PD 4LNRA 5KVFE 3MV01 5D96B 2YQ3A 3CG8A 2UV3A 3HR6A 2W9EH 4QHPA 2Y1YA 3U1QA 1D5XA 5EF1A 3EOBB 2H3XC 4R4FL 3RUGB 1E27B 4ENZA 2OR7A 1P7BA 2F1EA 3AM8A 3P9WB 4X4ZA 2WZPD 4AJ0A 5I8CA 3MUGB 1IAKB 1XIWB 1H3PL 2OTWA 2XACC 5DUBB 4J27A 2VTFA 5HGAB 3FUMA 1BVNT 5BQDA 4XMLH 4TUUA 3ZRSA 5CUSH 5LCVL 3U1SL 2WY3B 3C60B 5KZCB 2G0LA 4NQXA 2Y2TA 3G08A 3SKJH 4NUPA 3F85A 3IJ8A 3HE7C 4K73A 3ZE0B 2JJSA 4PFEA 4NDMB 1JGDB 5BUAA 3QI9B 1GJUA 1CD1A 2AQ2A 1KN4H 1AQHA 3TGXA 4CVXA 1KTJA 4GSDL 1S7WA 1TQVA 4WK0B 2VRQA 5HGHB 1J1XL 3AT8A 3BGFB 4BWWA 3M88A 1TR7A 1DL7L 1JWUA 3ARXA 5LCVH 1BAGA 3RZCC 1ZLUH 3ZUNC 3L2NA 1MCOH 3TVMD 3SDCC 4EIZC 2PMZA 2L0DA 4OZGA 1ZE3C 2FUTA 2ZONA 4HWZB 4XOEA 3PCYA 1WHPA 5D7IE 3MPCA 5F1SA 2WXIA 3IETA 2QKIA 4TNVK 4YGAB 5D8JH 5EULV 1TZGH 4LHUG 2W9DH 1AZNA 3MOQA 4M7LT 3U6XS 5EC2B 5ITBH 3OKKB 4JK0D 3TJHD 2R8SL 2ZCKH 4TNVF 3B7YA 3EW3B 1P84J 5E23A 4ODUB 4XBEH 4Z7UF 4BSJA 2P49B 1FFRA 3ESOA 4JMXA 2NY5H 1GYCA 3WUWA 3OKLA 2CGYA 2PABA 4JO4H 3AGWA 1K4CB 3WXVH 1QRKA 2VZSA 1O9VA 2X0WA 2XBDA 4PJEB 1NBYB 4XTRD 4ZAKD 3NIGB 1P7KA 2WJ5A 5LBSH 4WUKL 2J4WL 1SPDA 3CFKA 2AK4E 4L1TA 4TVPD 5I30H 5FHAH 1QG3A 1XCQA 4G42A 3SE9H 4JJ5A 1HEZA 4ZMXA 5B38B 1F90L 4B50A 2XUWA 3P40A 3QISA 3CJJA 3GMLA 5TDOA 3SE4A 3BKML 1G5GA 4ZMAT 1J5IA 4DGUA 4NQUA 1QEXA 4TLTA 4LLUB 4MD5B 4QOKD 1FVEB 1YHPA 4WSGA 3X3GL 1SLVA 1J05B 2ZCKL 3G5ZB 4MJ4A 4S10A 4KVPA 3GZOA 1IM9B 3MLUH 1J1OH 5E2JA 2B4CC 3BVVA 2W9DL 3FAXA 2XZAL 1F45A 4BCYA 2EXSA 2E46A 2NTFB 4L48A 4G6AC 4R26H 4QRAA 3HEIB 3BOVA 3OMZA 3ZTNH 4PJ5A 4M61A 5TD4A 4UOW1 3KPSA 2Q7NA 3O3BA 4S0TD 5AAMA 1UKTA 5FHAL 5HDQH 5AG8A 1UA3A 4FNQA 4GRMB 5JQ6L 1M2VA 1TEYA 2HJFA 3FFCD 3D0LB 1SUHA 3B7RL 1EEZA 1XGRA 4P5SA 3VXNA 1PYWA 5D96C 3OLDA 1WS8A 2G2RB 1G1YA 5IHZA 1QD0A 2WV3A 1WLHA 4ZUTA 5D2LB 3APMA 4NP4L 1A6PA 1K2DA 3FO0L 4HEMA 3IS1X 5I24A 3MOBL 4AM0A 3ARRA 4N5ED 5MEPB 3KLQA 2F54B 1PCXA 3E80A 4LVNC 2J88H 5D7JC 1A47A 2XTJE 4OZFA 4NFBA 4KUCF 1IM9A 4S0HA 2WIIB 5D70H 3SQBA 2BNQA 3O41B 4WLCA 5FGCE 1S9KC 2VRKA 2FIKA 4BQ9A 1KV7A 5FM4A 4UAOC 1NLBL 4NAJA 5FO8B 4MNQE 1RZQA 4FOMA 4JY4A 4KKCC 4LVOB 3DV6A 1FUNA 3FU0A 4FI8A 4P0DA 1CGSL 3QUXB 4YBQD 5FF6B 3SKOB 1OIOA 1WSST 3Q2LA 3PJSB 1FZKA 4MVBD 5M95B 4UI2A 1AGFA 3RL2A 1FE8H 5I5IA 3JTTA 1QABA 2Q3AA 2XNAB 2OL3B 1DBAH 1H3XA 4XP1L 1CFVL 3BZFA 2D8KA 1B2WH 2IOOA 2R59A 2YXWA 1LWHA 1O6TA 1F02I 2TSBA 2Y9RT 4JPVH 2X1OA 5L2JA 4BFFA 1NKGA 3AADB 4HZLA 2EDOA 3LEXA 1KPVB 1B0GB 1GL4B 4PREB 1RUKH 1UKSA 5E03A 2ZJSH 3A3YB 5JYMA 1YYLH 3ARVA 5IBTH 3NAAL 2GK2A 1QW9A 2C1OB 4J3VA 4Y5YA 4A7GA 3T0EB 5DC0A 1B3JA 4GQRA 1VGKA 4HUXB 4N22A 4X99B 5FA4A 3IKCB 3QPQD 3C75A 3W37A 2P24A 3NQIA 4CADA 3BRDA 2BSTA 4JE4B 4N8VB 1AQKH 4APQB 1JI2A 1DVUA 2LABA 3GXUB 3W39B 2FX7H 4QHUA 4PB0H 2Z7WA 3HAEG 1OHZA 3FRUA 5C0JA 5MERA 1YPZE 4QUOA 1DQDL 5CIPH 1CMOA 4HGMA 4QKXB 1TFHA 2XT1B 1ADWA 4NSKA 3HC0B 4LDEB 3FQ1A 5J56B 2VWEC 3N0AA 5CF3A 3HZMB 3QXDB 1A6AB 4H20H 3TA4D 5J89A 3R19A 1ETA1 4U31A 5AW7B 4CRPA 4HIXL 1DJSA 4F7CA 2AXJA 4ODXB 3OXRB 1UWGH 2BXZA 3WFDH 2D3VA 2GFBA 5HHME 3LNHA 1T20A 2QKSA 3U6XA 1CK0H 3UXFA 2W60A 5KSBE 3FTGA 4P99A 1FNLA 4NKDA 4X6DE 2VZOA 1A21A 4O02A 4Z0BL 5HVHC 4KX8A 3IAQA 3W2DH 4YDIH 3LCYA 4LBAA 4KVNL 5CJXC 5CSGA 3FB7B 3F00A 2OQJB 5E1AB 3ZO9A 1E30A 3CVHA 2VW4A 4HD5A 3F3HA 1DE4A 5ERWB 3RUGE 4KH9A 3A47A 5LGJA 1JYNA 2XY2A 4QF1A 4Z7UB 3L7FB 3H8NA 3MRQB 5IB5A 4MA3B 2YPKB 1UCTA 1HHKA 4QLRA 4QRTB 5KJ7E 1OSEA 4G6KH 1N5YL 1UD8A 4Y9EA 3TH4T 4PRHE 3ES6B 4UQ3B 4HAKA 1UM5H 2YGQA 3BP7A 3QT2A 1QNZL 3KYAA 2R69A 1GY1A 1RZ7H 2VDKL 4WWID 2YR3A 5EZJB 1MFAH 1UACH 1P9MA 2GT9A 4KWUA 2MHAA 1OW0A 1FAIL 5L8LB 4X5XA 4XPHL 1IGFH 2Z91B 2EDWA 3DMMD 5C3IA 1MCPL 4Z8FH 2GUOB 2VIRA 1BJ1J 3T3PF 1FH5H 1ZS8A 1M05A 2GAZB 1X5MA 4BINA 4BYHA 3RYMA 2O1AA 4NCC1 3QARA 5DHXB 4JZJA 4BCXA 3HNVL 4Z78B 5JOEA 3MI6A 3TASA 4XVOA 1KBVA 1HL4A 5KYYB 5EEUA 1N64H 3DIFA 2FX9H 2WYTA 2Z93B 4LVOC 3VFVA 4CC4A 4D2NA 2I25N 4LIQE 4JRXE 5J0BA 1TEFA 1RJYA 4Z3GA 2ZUSA 2VRAA 4YSSA 3IJYB 5F9JB 2E8ZA 2WO4A 3DK2A 1RK7A 2OW6A 5HYSG 2NY7H 1E7VA 2RGSA 4QTFA 1S2EA 2NTSP 4L3EA 2IH8A 3CZLA 3E3QC 2C5DC 4H2AA 3DMMC 3ZPDA 3Q3GA 3VXPA 4I0PD 4L1SA 2AJXL 1L3WA 2VO5A 3QUKA 1ZK5A 4NZJA 2BCKB 3P2DA 4WEBL 3E8UH 1QLEB 4OT1L 2DTML 3MXWH 2FH6A 3AS2A 3AMLA 4FX5A 4R96B 3EG9A 1O7SA 4LQ1A 5CS7A 3RY6C 1NMCB 2NY3D 2ZUXA 3CHQA 5KWYC 3S37X 4EI5A 1BQKA 1UH4A 4JRFA 1R3HA 1INEH 2VXQL 4G9FE 5T3XE 1IGJB 1R19A 2BSBA 2JB6B 3H53A 2GYSA 3IBEA 4BK8A 2OV0A 2QVTA 5JIKA 2W07B 3C2SA 3WTWA 1H3TA 5DJZB 4TSCL 1WC7A 3LMJL 3ZQWA 2ZWYA 5E6YA 5BV7C 3QNZB 3P1VA 4Z77A 1E5ZA 1U8CB 1NCAL 3SJVD 3JTSA 4RMWA 3ORJA 3MLSH 3ULUL 3E8UL 3E2HC 3BD3A 1SDDB 4PGBB 5D2LF 4JRXD 3KBPA 1JG9A 2EAEA 3LNGA 1SXCA 2ZKHH 3FQNA 4KTDH 2CRZA 1J0YA 2WLZA 3FH5A 3MJ9A 2XZQL 1HKLL 4CADB 4BXSV 3IKKA 4BFGA 2WWKO 1UFUA 1NPUA 2VKWA 2EZ0C 2DH2A 3U7AA 2J6EA 3MRPA 1INEL 1GPOL 4IIQB 2AW2A 3FB6B 5E99L 4Z7VB 3HAEA 2DQGL 3EYFA 4BUHA 1NOLA 2VDMB 1CDBA 3CDCA 3WTVA 1GGTA 3L3HA 4M6MH 2P8MB 2Q9OA 5CCHE 1VPOL 5C09A 3U2SA 4PJEF 4GQPH 4GRWE 4CMHC 1EEYB 4DEPB 1KMGA 3AZUA 4TVUA 2YD6A 3QAQA 3D7PA 3FOLB 5FYLH 4M6OL 1C5DB 2CKBA 3O6KH 4XPGL 3S3DB 4RISL 4U1KA 2NY1C 3KM2A 3EXJA 1QSEE 1NFDB 3T0DA 5ISZA 2K70A 4OD1H 3P4MB 1A64A 1T20B 2YD3A 1YPZA 3S2CA 4N2GA 3WENA 4TSBL 4LCYB 2WLIB 2W94A 5CJ5A 3KWTA 3QXVA 1R17A 4Z3JA 1VFMA 1Z2KA 3QQNA 3FQNB 1E4WH 1PG7X 1RSFA 5IVXF 3EO0A 4JO1L 3FT1A 2BVYA 4KKAD 4OI8A 2G5BA 1J10A 4GG8A 1L7TH 2PWEA 2APVA 1CTMA 2VMEA 3O2DL 1F6FB 4K5OA 2AFNA 5MEQA 5C0FA 2VCOA 2J12B 3JZ7A 3S98A 3L3HB 2IPTH 1YNLL 1PQZA 5EPMB 5K39A 2TSAA 4X6DA 4PJXB 4OJEH 5CWSB 5A16B 4EPSA 2K78A 1AMYA 2WLLB 2O6PA 1NAML 3OGCA 2XQYG 4J8QA 3T1FA 3RX8A 1XL6A 3BZ4B 5ENWB 5D7LA 3BWAA 3O3DA 3VI4A 1SYSA 4PB9L 4FJZA 5GQBA 4AT6A 4E9SA 1W72H 4LPUA 2BRQA 3PAYA 3T0EE 2IH1B 3EGDB 3KYMA 3V6FA 1XGRB 3GJFK 5KVGE 3T0AA 1M7DB 1G1KA 1A6WL 1JS4A 1RHHA 3LNFA 1U8QA 5D1ZB 3MNDA 3OKNB 3KPSE 4TOYH 5JLZA 4JW3A 4QXGH 3DRQA 4XVJH 2HG5A 1MWAH 3SGKA 5DYOA 5JPMA 3LPWA 3UGUA 4M93C 1Z5YD 2YGNA 3OAYH 3ZR5A 1U6AL 4S0SD 4DN4H 1NCNA 2WTPA 3F62A 1P0SE 1SQMA 1KCRL 2FGZA 3N40F 5LBSA 5KW9L 1GSMA 1JXDA 1XB6A 3BSZA 1XZ0B 4NO5A 2Q6WB 4OUUB 3BKCL 4N8PA 2FIKB 2H47C 2BX5A 2VDQH 3UPRA 1QYGL 3PHQB 4ES9A 5MEOA 2EYRA 4G6JL 1NWOA 2GSIB 2JKSA 1D9KA 3CFDB 3N6YA 4YSPA 5E5UB 4WW1B 4MFHA 3VH8G 4HMCA 4NKIH 4OCMC 1EEQA 2LTQB 2HWZH 5LGKA 3QQ4B 2WNKA 1AZVA 4ATTA 1DJZA 1RIVH 4W9LC 1CICA 1P2CA 3DBXA 3O9WB 2ZXGA 2RALA 3BZ4A 5ENWA 4AZ8A 5DYFA 3C2AL 2NR6A 3O3UN 1J11A 4JQIA 1KJ3H 3UGXA 3GD1C 3WS3A 4I18A 1G6RH 4LCWA 1BEYH 4YC2C 4MNQA 1D5MA 2CLZB 4K4KA 1WK0A 5C07B 3VXRE 4TL4A 1ILSA 1LO5B 3HJEA 4DCQB 4ZXBD 3FTZA 4F2MA 2HG5B 4DZ8B 3MLWL 4FQXD 4G6AD 2ZX5A 3BPCA 3P11H 4RBPK 3VU2A 2J44A 3MCYA 1JSYA 1R24A 3QWOB 3IMSA 4ONHA 1QPXA 1JK9A 3S3CB 5I17A 4U1SA 4A7SA 4O51B 3IDNB 3ZDXB 3WTUA 1HS6A 3GHPA 3T0EC 3TONA 3NJJA 1HWHB 4FNRA 1NSNH 2WYHA 3NZSA 4O2CA 3W82A 4UB0L 5C1MB 1Y6KR 2G3XA 5IROD 2DM7A 4NOBA 1XF4A 3H7BA 5I6XB 5IMOB 4A2MA 2AEPH 2FYVA 2DWEA 3HE6A 2IWGA 2HJLB 1MUJA 4XTRC 4ZAKC 1ZXKA 5C09D 1YDPA 3GMMA 1BVZA 2IG2H 4QRTA 4LASH 2NY4B 2ARWA 2FRGP 4DO4A 2EINB 2KQMA 2APTA 5CD3A 2X70B 3V4VL 1KENH 3NEOA 2NY2C 5E2TL 2XTLA 5F96L 5C0GB 4UTAL 1NIFA 3DVNA 2X12A 5F93C 1HHIA 4ODXA 1SVZA 1F3DH 2HCZX 2WGNB 4FG2A 4ZJ9A 2HFFA 2AK4B 1MY5A 1NIBA 4HOZA 1UD3A 4WFFD 4FL4C 4NKDB 5DLLA 3RGVA 3TVMC 4A1RA 4BIKA 2OP4H 2DZEA 3H6JA 3KWXA 4PTTA 3S4SA 3BAKA 1DEDA 4P59L 2OQJA 3ARDC 2BDNL 1Q0XH 3AY4C 3LX9A 1RHFA 2Q3ZA 2FO1A 5D6CB 4PWHA 3S3BB 4DKFL 5DD0L 1BVOA 3B2VL 4Z7QF 3GJFH 1MF2H 2Y4SA 3P4MA 3OV6A 2P7TA 1ROWA 3UCQA 5JHDB 4AOFA 5BS0E 1JZ2A 5ACLA 1KTKE 4W9GC 5EUOE 1UM4H 1JPSH 2FT6A 3DO3A 3TBVB 3HE7D 5EOCH 2AI0L 3NFSH 4NQSA 4KKBC 1RZIA 4NPKA 3GB7A 2P5EE 2N7SA 43CAA 1W0VA 2ZX7A 3RB7A 3OZLA 1DJGA 3UTSD 2IPKB 2GIMA 1OP5H 3CVIH 4YVUA 4JB9L 5EH1A 3L7EB 2ICEC 2GTWB 2KPWA 2V17H 3WD5L 3MXVL 1I3GL 1AZZC 2ARJQ 4N2BA 5GSRB 3VU1A 1NC2A 3MRMB 3K2IA 4WDIB 5EU4A 4QHUB 5HYFA 3RGVB 4P2OD 1I8LC 3K6NA 2C9XA 3QEUA 3IVKB 2IH3B 4KGLA 4J3BA 1G87A 4GUPA 2BOCB 4IDLA 1EZLA 4E41A 2IALB 3FU7B 4IRZA 4PRHD 2WSDA 1ILUA 4P07A 3GM8A 4HAFA 2VLRE 3OB0H 5AW2B 3ULUC 1JNNH 3RIAK 1LNUA 2AZAA 1P7QA 1SXZA 1WBYA 1JGUL 3KLAB 3DIFB 5C08D 4D9QE 2DM3A 4P2QB 4WTZA 1S7XA 3D50A 3CVIL 4EQ3A 1UB5B 2ZX6A 4NKOA 4C56A 3FULA 3K4ZA 2JCWA 5BRZB 1TPXC 1XBDA 3A6OA 5CBEB 1KYOK 2VE6B 1MCKA 1EFXA 3DX1A 4YNYA 3TYGH 4UQEA 2EIDA 2G5RA 4X7DC 5D7LE 5D8JL 3Q6GH 1X7TA 3RA7H 3V5KA 1DHKA 4KXBA 3UDWC 1FPTH 1GYUA 2XYCA 5G4OA 1OTUC 3FCTA 3DURB 4QXVA 5IB3B 2R0WL 4QO1A 2DLEA 1RD6A 3B9VA 3GXNA 4HUUB 1LYQA 4X9HA 1LEGB 4JZNA 2XWJB 1IAMA 1WITA 4J6RH 2FBRA 1MSPA 2K7QA 3HG1E 3IU4H 3OPZL 2Z34A 2F8IA 3VD0A 2DBLH 4O9HH 5E5MA 4DF9A 1BM3H 4HPOH 4YC2B 2D9CA 3IB4A 1W91A 1S8DA 1CL7H 2HLFD 4JLRB 1AOHA 4EI5B 1XGPB 5KVEL 4N0RA 1U8NB 4WWKB 3Q8AA 3CDGB 4DHLA 4YXHH 1INDH 2Y36H 4PR5B 2ITDA 1EJFA 2FQEA 4A2GA 1A8ZA 3NESA 1EXGA 4FABH 2F19H 4MJID 4RGNE 4TL5A 2HX9A 2DMHA 1PLCA 3FW6A 3UJTL 4CC4C 3FT3B 4N0CD 25C8H 4JFDA 3WNIA 3SBQA 4H25A 2B4CH 4RFNC 1OGTB 3CSTA 1OF2B 5ANMB 5DCCA 3VO0A 1MAKA 1UZ8B 1QSEA 1LE9A 4Z7NF 2Q8AH 1I1AC 1JRHI 1AIZA 2AZUA 3RPKA 4ZFGL 1DTUA 2Y0SA 3MGTA 4R4ND 3KM1A 4KDTA 2PW2B 3TWCL 5F7EH 4JR9H 4PGEB 3KS0H 1T0OA 5IBTL 3LPFA 3V6OC 5J3HC 3MV8B 2ZJSL 5B8CC 2JKNA 2XWBA 5IZ7A 1BJ8A 2VH5H 4XPFL 4OFVA 3L16A 2XWXA 2EIZB 2E27H 3ZU8A 4OGAD 2FT7A 4PSRA 4OZHA 3M17B 1XH3B 3CFKB 4QWWD 4UBDC 2CKBL 3EH3B 3QQDA 3T65A 1ZT1B 1JGEA 2AS5M 4ELKB 1TNNA 2AJZA 4FHJA 2ESVD 3RVVC 3FTVA 4ZS6D 1SMAA 1ZGLB 3KL5A 3MV7D 5GZNC 1FZMA 3KDMA 3KGTA 5C09E 3FT3A 4FFTA 1NGPL 4JDVA 4NC2B 4JFZH 1OQOA 4FNUA 2Z35B 4ZUWA 1UACL 3AXLB 1JZ7A 4JVWA 5AB1A 2AQRA 3HNTL 5HHMB 2ED6A 2J2ZA 5I74C 3GMPA 4NDMA 4U4BA 4QJ4B 4M61B 3ISRA 1YYMH 1QSZA 4I2XA 4PRNB 4RAUA 3BEWA 3RFRA 1RP8A 3NVQA 1LO2L 3U0TA 5LHDA 1H5BC 3KGSA 1DLFH 2YD2A 5F89B 5MEQB 2ORBL 1TSRA 2NY5C 1YEJL 4OSUL 2Y06H 3V0IA 4MCNA 1QBLH 4XPFH 1ZHBB 4ORGB 4P2YA 3K5RA 2B9AA 1NAMA 5IVXE 4B3VA 5JA8B 4LOEA 5ESAB 1GW6A 2FYYA 4B5ZA 1RI8A 4MB4A 3PL6D 1DP0A 4OIBA 5AALA 3SCMD 1GGBH 2WWKT 2BVTA 1S9XA 4HUCA 4LXFA 3CHXA 4KQ3H 3HI5L 4J3OC 1KXHA 1W9XA 1YCSA 3AQZA 5DT1H 2RCSL 2X3BA 1AXTH 4JFXB 5EO1A 4PLJC 3NK4A 3US9A 4M5ZL 1EVTC 1BP3B 4NYLB 4EUPH 3V0JA 3KJ6L 5KANI 1XR9A 2AANA 1D7FA 1QRNA 2DIAA 3QDMD 1JPGB 1QBLL 4M1CD 2ISDA 3MRKA 4LCWE 3L3JA 2PYFB 1JDCA 2Y7MA 3N9GH 3TIDA 3RWFB 5KYXA 2DTSA 4FDWA 1XH0A 1UUNA 1MOEA 2FB4L 2Y06L 3H42L 3MBEC 3BPLC 3MAWA 3R18A 4P06A 1FZKB 2AJUL 3R7QA 5MENE 2APBA 5E9DB 4F7EA 2VDOH 2V3EA 3QIWA 5KSUB 3GFUA 1B88A 3SE3A 1I7RA 1MFUA 1QKZH 5I1LB 3MNVA 6CGTA 1ASPA 2BY1A 2K0RA 4M7LL 3RHWK 3BHBB 4GSXA 2XIDA 3B2PA 4OZHF 1B0RA 4H88H 4LLWA 4OD3H 3ZJAA 4FNPA 4MMZB 2FHFA 2H1LM 3CX5K 2AEWA 2UY6A 3WTTA 3CFIC 5DRNA 1E9QB 1JNLH 4YXLH 2X2YA 4AQAB 4F1ZA 3VDAA 3LKRA 1GGCH 2BP3A 4G8GD 4JHWH 3T2NL 4GKSB 5E51A 1TZIB 2XDHA 4N24A 1L9NA 5GGSY 4IBTA 4ZO7A 3PDGA 4EOWL 3T9WA 4HUVA 2HUEA 3U9PL 3US1A 3IE4A 2QPDB 2VQ1A 3RPBA 3SKNB 3QIUD 1A0QL 3QNYA 1A14H 4OB5H 3TTYA 1FYTB 5HHOA 3BRGC 3MZGB 2CO7B 1MRFL 4GW5B 2J8HA 1BJMA 3RNQA 5DA4A 3C6EA 3MACL 3O3DB 4FC3E 4X5PA 5E9DA 4F7EB 4DQOL 4XAKE 5D7JA 1SOSA 3L8QA 4IQHA 1LTXA 3NFNA 2X4NA 3GBML 1JNLL 4FQCL 4PD4K 5C71A 2J8OA 2DLHA 1NFIA 2DWTA 3HUJB 4G5ZL 5IB2A 4ICXA 1PD0A 1UC6A 1E5AA 2P45B 3O6FC 1V10A 4XX1E 3OHXA 5I71C 5JW5B 1LE5B 3TBSA 3PS6A 4ZTPL 3SQRA 1GOGA 4P57B 2ERJB 3E6FB 3U4EB 4MSWA 4M1CC 2Y7SA 1I1YA 5EBMA 3VXMB 1QBBA 2FATL 5K69A 1K8IA 3TF7C 4W70A 2IPKA 2NXZD 3ZTJH 1ZVYA 1IVTA 5FO9A 1QFUH 4QHKI 1TETH 5IFAH 4PTUA 3MLSL 3ULUH 3D0AA 4JUTA 5E1AA 3CX5J 3WIHL 4XPBH 3ASNB 4KRPB 3PL6C 2JELL 4YHKL 1XT5A 2DKSA 3OR6B 4K7PH 3FO1B 3BQVA 4KTEH 2RBLA 3P9MB 4XVTL 4YSRA 3VQ2C 2EVFA 5EOTB 1J5HA 5FW6A 2ZCHL 2CGRL 2Z8SA 2JLLA 1D7DA 4UQIM 3VWJA 2DQJL 2X7LA 3VWKA 2WTOA 3LZLA 3VWKC 1ZTXE 3C5ZA 1EHLH 4RX4A 3SE4C 1YJDH 1XR8A 4FS0A 4XRCB 3PWPE 1FIEA 2JQAA 1CZ8L 3ZVVA 2VDRH 1EHNA 1WH0A 3V95A 4DPAX 2BW5A 2FATH 3U83A 4Z7WF 4JO3H 2AJXH 3D85B 4EEEA 5CJBA 4OGXL 3DUUB 3FT2A 1DDTA 1HINL 3AREA 1TTAA 1Y1UA 2ADIA 3VGHA 2WAQA 4ES8A 3BSZH 1F11A 1IM3D 1J8KA 4TUJA 1AGCA 3RVVD 2YZ1A 1V55B 1WA1X 1X6LA 4X8JB 4JJOA 5GSRA 4Z9KB 5GRZA 3FTSA 3O3EA 4FN0A 3NEEA 2EIMB 1NCTA 3RDTB 2QKIC 3QJFB 1MCSA 4HJGB 4L3ED 2B14A 1RPUA 3O6FA 5ABAA 4DK3A 5J3HD 4GG6F 4FCHA 2W0FA 3QR1A 2O93L 3BE1H 4ZO6A 2XXFA 4HT1H 3RZCA 4XMTA 3C5SB 3FB5B 2V8MA 1XGPA 2AJVL 4Q6IA 1H9VA 5EIIA 4GAAA 2QADD 1KULA 3P73A 2R69H 3LKSA 5JHAA 4FYQA 3PWPD 3H56A 2A6JA 2HKAA 2P47B 1SFDA 3R0MA 2VN4A 3JBG7 4M48H 5CGBA 1BVKA 2B5IB 1M9WA 1KJMB 3CPUA 5CJOL 3G04A 3MC0A 3ABGA 5LXGL 2JJSC 2X4QA 4NQXB 4QRRE 1QACA 3CSYB 1MJ8H 2YWYA 3S5LB 4KROC 1DQKA 2VOTA 2FJHB 2BNRD 1NAKH 1T7VA 2BS8A 4PS3A 2GTZA 2XQ0A 3GM0A 5EU6B 2OJ1A 3SOBL 4PJFF 3JV6A 3N04A 4FEMA 5CJ8A 1MIEH 1QI4A 3BQUB 4LNRB 4ZMWA 3TN0C 5FR3A 5SWQB 4AIXA 5HHOD 1T5KA 2BNUB 2MNWA 3CZGA 1JV5A 5FKPB 2NUTB 3KYKL 3ZN6A 4BGDA 4TULH 1LMKA 4NQDE 1OAKL 2QTEA 2Z8VC 2R83A 1KCRH 3DHJA 5TQ0L 4OJDH 3S34H 4DN3H 5F7HA 1KENL 2GUOA 1CE1H 3SDDD 3MUGA 1OV8A 3HFML 5CEZD 1NGQL 4C4KO 6PCYA 2B39A 4GS7B 3QFJD 2JVUA 4FFVC 4K3DL 1DE4B 2Y72A 3LB6D 1A3LH 2OW7A 1BXVA 4HLEA 4U3SB 4WFEE 4ZOBA 4TTGA 1Y18B 2DYPD 1ZOXA 3G6AB 4I7ZC 5HI3D 1QLRB 3SJVA 5EUOF 4DETA 1C7SA 1QLEH 4KMTL 3G5YB 5DQJA 4FP8H 3KPRA 3RGHA 1IE5A 1T6VN 2OMWB 5F89A 2VGLM 3GMQB 3P11L 1NINA 4YE0A 3MLVL 4EDXA 1J5CA 5I30L 4ZFQA 4P2QA 1SBSL 4YS4A 2WQ8A 4IW4C 3CLEL 1G9MC 4XMWA 3ZTEA 4ZBJA 3PHSA 1WZ1L 1U8KB 2ZXQA 2I07B 3TT3H 3QS3A 5CR8A 4FQQA 1AVAA 3QEGH 4PV9A 2QGDA 4LCCC 3VE0A 35C8L 1KTDB 3Q3GB 4UT6H 1QUPA 3FQTB 4JPWH 1JOIA 4ZFFB 4Z7UE 2XZAH 3BPOC 1JK8A 3CCHA 4Y2DA 3TX4A 1C1EL 1C5CH 2PPEA 4LF3A 4PJ5B 3VFNA 4RLDA 1JHKL 5T1MB 3P30L 1EZVX 3S2AA 1JUFB 4HJEA 2CUMA 2V9TA 2YO3A 3DUSB 3D6GA 4KKBD 4ZTOH 3JWNC 4HUXA 5JHLH 4TNFA 4G7YH 4XN5A 5DJ0A 3JQOB 5D1QE 1A5FH 5AD0A 2JKIS 1GGUA 5GZNA 1OSPH 1TVHB 4IDJL 2DYRB 3WS6A 3EBIA 3K6OA 4XP4L 2EYSA 1IVLA 5LWYL 3IFNH 1PL3A 3PU7A 3MUUA 3K2UL 2R2CA 3NUKA 3VNZA 5C0BA 3ARDD 3F7LA 2RFXB 4YVNA 4PJDE 3EGDA 3KYMB 3ML8A 4ZUSB 4TN9A 3LV3B 4H44C 1NPNA 4LCIL 3ERXA 4QRBA 1TIUA 2NY4C 1WGVA 4ZS7H 3AMKA 4JFDB 5I5JA 4I2XE 4H25B 1YNKL 4AKPA 1N4XL 1N12A 3UBXG 4CVWA 3UBXB 4OGQC 3CDFA 1ZA6A 2XV0A 1BAWA 3FT9A 3NP4A 5ES4B 4HWBA 3MRCB 4LKCA 5I1EL 4UV4L 5C0IB 4TQPA 4TYUA 2XIBA 3QNXB 3PWPA 1A6UH 3FTGB 5A7EA 3PWNA 4RH4A 1DZBA 1UJTA 4GI8A 4F8LA 2PO6C 3LYRA 2C9PA 2XWTA 3WEOA 1RZKH 3LD8C 2G2NA 2BMKA 3ASOB 1MWOA 4PJHF 4FXGA 5AW0B 4CMHB 4HLZG 5A2CA 1JBJA 3L9BA 2HFTA 1F2XK 4FQXA 5E6ID 1WQVT 3HC3H 2Z31D 4L9LC 5F71A 4BA0A 5BV7L 2WQUA 1A65A 2Y7NA 2I60L 5LUMA 5F21B 3T3PE 2PP9A 1JHTA 5CZKA 1MCIA 1JL8A 1K2DB 2EEAA 2QVKA 3ULVL 1PJWA 4PJ7B 1NC4B 2GEEA 2HVKA 4PS8A 1U3ZA 3SZ6A 1TKWA 3T0ED 2KS0A 1LO0H 1OSZA 1DBBL 3NH7L 1MRCH 2OFQA 3NCJH 3A67H 4D9RE 3KWWA 2DQUH 2ZXCA 3QQ3A 2N7BA 4YDKL 3RTQB 4ZMVA 1BM7A 1IEHA 2VLKE 3U2JA 1T2JA 3EDKA 2NOYA 3IKCA 5MENA 2KHAA 2DQHH 3GMOA 4ZDHA 2X4PA 4FQXC 3RILA 4WFGD 1YC8A 5JIQA 5A6LA 5L9DL 1CVSC 3GMNA 5DZ9A 4MJJA 1FA4A 3V0AC 4K9EL 1N9PA 4XMKL 3IS0X 3Q1SL 2PO6A 5HP5A 4H40A 1SOXA 1YUHB 3IMWA 4MBRA 4UIMB 5JMOC 4UT7L 2A74A 2EH8L 3K81A 2I9TB 1XSIA 1K5NB 4LSTH 5E8NA 1GTNA 1KEMH 2AXFA 3NCJL 1DSFH 5JDSB 1YQ2A 4HG4K 5BZDA 1JHTB 1FLRH 4I9WE 5E2WL 2EVJA 4LLQB 4MQ7B 5AVTB 4Q9RL 2AEQH 3R8BB 4FTVA 2A73B 3WFBH 2W60B 3MCG1 1KXTA 3NJFA 3OVUB 3ZZQA 4EIUA 3D09A 4OUUA 4BFOA 2E7LA 4IOFC 5AB2A 4OKVB 3DTDA 4HHAB 4K9JA 5HI4C 3WLWC 1S3KH 3II2A 3NIFB 5TPWH 4F9PA 3NJGA 1ZLWH 4X6DB 3KPRB 4E5XA 4CSSA 4E68A 3KCWA 4KZDL 2NQ3A 2R29H 1UXLA 2ICEA 3QUKB 1KJ2A 1MCBA 4Y4KA 4MMYB 3HS0A 2XA8H 3BWAB 2VJXA 4W6YB 3D0VA 2OYKA 1XXFC 1KB9J 3H2PA 3HG4A 4R2GB 1SDYA 1RUQH 1PAZA 4GXUN 1MFDL 4QD2E 5J57B 1AI1L 5E24E 12E8H 3A4EA 3OWRA 3IMVA 3KL3A 1NWPA 4JKLA 1SF5A 3MLPA 4B7IA 1MJUL 1WO2A 2LFEA 4Y4HD 4NT6A 3U36A 3QIBC 1RLBA 4LSRH 1JERA 2CLVA 3TYGL 5DMJB 1UH3A 1PZCA 1CFMA 4XWOC 4K5LA 1N59A 5DT1L 3UG3A 3REVB 4FA7B 1HILA 5AVZB 4KKAC 4BH7A 3IMTA 3CK0H 1JZGA 3BP6A 3VDBA 3P4LA 4WUUA 3U4BH 4U6VH 4IGBD 2AQNA 2IDSA 3D18B 3Q6FA 1NUNB 1KLFA 4PV8A 5CJQL 1OARH 1GXEA 1GGYA 2BP0B 5BS0B 1PKQE 1QR4A 4NBYB 2R1WA 2DAVA 4PJAA 3IM1A 1QASA 3HE6B 3HC4H 4Z7UA 3L9EA 2H26B 4NJ9H 3IVKA 1MCEA 4UOQA 3WKYA 3X14A 1VZGA 2NCEA 3QGVA 4RMVA 4C57C 5LBGA 3GKWH 2YKLH 3MCLH 3NCFB 3D39B 3G5VA 2WXQA 3UTOA 1KBWA 1K6QH 2CRIA 1ACYH 1BXAA 2WWMD 1TO4A 4NWUL 3HMWL 1ANUA 4JDZA 4LGSB 1E8WA 3MYZA 4YSEA 4KH2A 1C5DA 1A6ZA 1KTLA 3L17A 4NZDA 3V0VB 4Y1SA 3UIZA 3L9RA 3F5WB 4HCRL 9CGTA 4XCCH 1XSJA 4MSWB 2PTTB 3ARWA 1D5BA 5SWSD 2EZ0D 2FQDA 3QNXA 1HILB 3SDXE 3D3VE 1HL9A 4D9LH 3CLWA 4RNRA 1V7NL 1HE8A 3T09A 4H8HA 1JZHA 3P69A 3INUH 5I1GL 4JR9L 2N56A 4B60A 2CIKB 2EE2A 2WMPA 3PWVB 3HAEH 2V7HB 2FTAA 4WO0A 3NG5A 1IEBA 4JRYD 4Z3TA 2GHWB 3K2MC 2I24N 5AW8B 3AQYA 3RKPA 3SJVB 3EUDA 5ITBL 3FQWA 4XCYA 5EU7E 1U58B 1OGSA 3AC0A 1KCWA 3QNZA 3SBRA 3LS4H 2E7BA 4I18C 1BVLA 4V2CB 1PW3A 2IPUK 2NR6C 4TS6A 3ALWA 3SYPA 2VR9A 1H8SA 1UA6H 2CCVA 5C0GA 4JKPH 4TPRL 2ITDB 4Q6IC 2WYIA 2PCPB 3R1GH 4NQTA 2VSDA 2A4EA 5E2UL 4DVBB 1V8HA 3PNWA 2EVHA 5DO2C 2R4RH 4FLQA 3DC0A 4P2QE 1K8DB 4ZT1A 4AG4H 4F58L 3HNTH 5DC9B 4N6QA 2FJFA 3QEUB 5KBPA 3ZY7A 5AWNH 1A6TA 1CDJA 2QSQA 3QXUA 3GXDA 1WAAE 2OL3H 3JV4A 4QRSA 3GSUB 3Q13A 4HIPA 2DF3A 3V10A 1EUUA 3FJTA 1IBGH 4PJAF 3GLAA 2ZUQB 1KFAL 4DKEL 2V7NB 3HB3D 4G83A 1OP4A 2DTMH 3MXWL 4XBPB 3CN3A 2J57A 4RFEB 2HP4A 5EWIH 4KFMA 3UC0H 3IK2A 3L6FA 3GB7B 4JFEE 4N85A 1WCBA 2E5EA 3L3OA 1YQVH 2XPGA 4MA1C 4PJCB 4YHML 3RFZA 1A6VL 1ZLSL 1WEJL 2JIXD 4WJ5A 2D7NA 3VFGH 4HGWA 3QC6X 4RIRB 5IFJB 1C12B 1HYSD 4OCXH 1O7DE 4ZW6A 3KWVA 4PJBB 4I0CC 1S7UB 4W9DC 1NCDL 5BNXD 2ZX9A 3SHSA 2DEYX 2Y5TB 3EYOB 3KBEA 5B3NA 1XQ4A 4AV0A 5JHDE 1R46A 2Q76A 2ZAHA 4L3FA 4WAFA 1A6TB 2B4CL 4LT7A 5AOZA 5ESQA 2AC0A 3DGDA 3QA3A 2X87A 2CR3A 2VERN 3TT1H 3FOLA 4PWGA 4J3OG 1T66C 4R0LC 4HSCX 4A7TA 5AUMB 1G7PA 3KPQB 1EGJL 3S97C 1QUNB 3VD1A 5DLML 1FQ9C 1KIPA 2A9BA 3LH8A 1M9SA 4X0KA 1HEZB 3ARUA 5FYKH 1VKXA 5T1KA 4Q14A 1KY7A 4WWKC 5B39A 1Q9WB 1WYJA 2UZIH 2GBUA 3DYPA 3MNWA 3NIGE 4EKXA 3H2WA 2G5BB 5BS0A 1E65A 1XBRA 4K7PY 1CQKA 1E7UA 1HQ4B 3AXHA 4LFHG 1ORQB 2CGRH 1DQTA 2KZWA 3IGAA 5I76A 5F7YC 5I18L 4NO0A 3U6RB 2YAMA 5CJOH 3MODL 3KWUA 4AQOA 3VA2C 1SFHA 3B2UD 4PGCA 2XLLA 3HG5A 1I3VA 3BMVA 2P5EA 3MV8A 5EPMA 5K39B 3HZVA 3WNMA 4Z18A 3AU1A 4WSKA 2XPZA 4FKKA 2H7WA 4MXVF 1JZ4A 4P4KA 1XH3A 4IU3B 5CEYB 5C92A 1MCNA 4HZ1A 3QORC 4LSVH 5DK2B 2BMKB 2MCG1 1THAA 1R0AH 3KVQA 2NY6D 3VGGA 3IDGB 1MCHA 1WAPA 2YMOA 1DO6A 4K94L 4XNUH 4HV8A 1K85A 1G7PB 4NWTH 3T4AB 1Z66A 5KJ4A 4ZX6A 3GBDA 5EG6C 1J88A 2AMUA 4RESB 5CMAB 1FL6A 2J5LC 4GKLA 4XMLL 3QPQC 2BVQB 1I8AA 1WF5A 4V1DA 4JO2L 2YPLD 4IBZA 1L9SA 3CXDL 1FAKT 4N8UA 4NCC2 1J9QA 3O11B 2YA2A 3SE3C 3QCUL 1KTBA 4HP5A 3CFNA 2LAAA 4X4XB 4F3FA 1NJ9B 1IC5H 1NL0L 2E7CA 3OX8B 2PW2A 4OLZL 4HUWA 5KS9B 2Q6WA 1DBKH 1UT1A 5JNYB 1G0DA 4KHXH 1BPLB 4B9ZA 3BFQG 2JCCB 1J86A 2X41A 4U1MB 2W0PA 5C09B 3U2SB 2MPVA 1BF5A 3IFLL 1HHGB 4ONFL 5C0AB 3PGDA 2BHFA 1MHHB 1AAJA 1X9RA 1YDPB 3PFQA 1MLCA 5INCA 2VLKA 4NHCL 3F7YA 4WRLA 3U46B 3GLZA 4NM4L 3BDBA 1D5MB 2CK2A 4YBQC 5C07A 5AYTA 2DICA 5B1BB 4W1TA 3VD7A 4XBGB 2YAHA 1TITA 3CBKB 2D4FA 3N1PC 1E4HA 4AQ8C 1FL3A 4JQXC 2JTYA 2ATPB 2R8SH 4QRSB 3GSUA 3MREB 4U1SB 3NJLA 2DQEL 3QHFL 2EDKA 5D7JD 3FNKA 3VX0A 4PRHA 3EOAA 3CD4A 4PJIE 4F15B 4FQIH 3RGBA 2GC4C 3LEVL 2WN2A 3GDCA 3LKNA 3SYAA 4OKVA 1GIGH 5JNYA 3KXFB 2WBXA 2WUBL 1OW0C 4W9ZA 4K5PA 3UTQB 3X1GA 1Q72L 1V27A 1KELL 4HKZB 4Q74A 3SDXB 1VADA 1MQKL 3LRKA 5DUPL 5IQ7L 3DX7A 4IJ3C 1B0RB 4UUJA 4YR6A 5FV2A 4WNSA 1ZWIA 2L7EA 5E6UB 2MQCA 1A1MB 5TDOB 4TNWF 1EH9A 3O45A 2IO5A 4BWTA 2NLJB 5SV3A 3BW9A 4LPCA 1A4KB 1QLFA 4PJAE 4IOIA 5IKCB 1T2XA 3BISA 3BUDA 1AO7A 1EJOH 3P3TA 3IDJA 3FUNA 3KWWB 1TDQA 4HFWA 2ZAGA 3PWUA 3BJLA 1Q38A 4OTXL 4PR5A 2IGTA 2O61B 2A9ML 3B3BA 5EZPA 1E3FA 3BDYH 1KFGA 4H1LB 2WNWA 4YHPA 2PYFA 5CCKH 3KPOB 4Z5RB 2XXGA 4GBXC 2WOBA 3V6OA 5BVJB 4DUWA 4JRXA 1DQMH 5C0ND 3REVA 3LN5A 2X9XA 4MB5A 4N0FB 4PRHB 5DVOA 4FG0A 1CLZL 2MOQA 2XOTA 2YD7A 5KYUB 1R3LA 1ZHLA 4HOXA 3NBNA 1U3HC 3LVEA 4RX4D 1EO8L 1QZNA 4F8PA 1ZGLP 2WGXA 4RFOL 2VC2H 5D6CA 1Y6MR 5EEZA 1BF8A 2XN0A 2OMVB 1HHHA 5L7XH 3IDIB 4FFYL 1E42A 2CJUH 3D3VA 5BO0D 5JHDA 3ZE1B 1XHHA 4HAGA 4X80L 1HXKA 4PCTA 5F0LB 5LAPA 3D06A 3QQXA 4S1SL 5DI8A 2MKLC 2NW3B 2Y1AA 4JVUA 5B39B 5GPRA 3SY0B 4QY8A 3QFDA 5TH2B 4NQSB 3U7WH 4ANUA 4PG2A 2VLRB 2FZ3A 2EIZA 2D3LA 4NQDD 2YXVA 1QSED 3M7OA 1DCLA 4LFHD 4HWBL 4Y4KD 3DHMA 3BGFC 2MRYA 3GJFA 4WV1C 3BDYL 3TJHC 5JW4N 3S3JA 1X5GA 3NJHA 7FABL 3Q2WA 1JNJA 1UJ3B 4H0LC 3VD5A 3WE6B 4C59B 1F90H 5ISZD 3OLGA 2FVNA 3BN3B 4IKLA 5IVXA 2PTTA 4M1GL 2EDQA 4ALAH 3MOAH 5DSCA 4NN6B 3GZQA 2ADFH 2F7OA 4NNPL 3FYIB 4JDVB 3HHSA 3RZCD 3NCCB 4IU3A 3VRJA 3GPEA 3S7GA 1ZVHA 2NXYC 3PP4L 4I4WB 2I9LA 4C83A 4NENB 1QA9A 2B3RA 3VX1A 2E76C 1FBIL 1YVLA 1I3RB 2XVGA 2ESVA 2DB8A 1U8OB 1PZ5A 5C0DB 1CDUA 3IPBA 2XN1A 1G9HA 5T3XH 1XIWC 5C08E 1J8SA 2AJ3B 4NT6B 2VN3A 5IV2B 3MVSA 2P8LA 2VN7A 1CFTB 5F3HA 4JY6A 3PP3H 4TSAL 1D5IH 4UF7C 4Y19A 3TWYA 3APNA 3U4EA 4GMSL 5DMKA 3T04D 4PN6A 4FMKA 3L13A 3DUUA 3FT2B 2J55A 3FT0A 1LP9E 1UYWH 3QI9D 1NUGA 3I6SA 3QORA 5AOKA 4BH7B 2JKTM 4UOJA 1AH1A 4RGND 1CXKA 4P4KC 2X44D 1IAKA 3RY5A 3V0WH 3WJJC 2X9ZA 1ETZA 1NFAA 1SY6L 3NRFA 5T5FL 4U1JB 2NW2B 3P30H 5GGVY 1ACXA 2ZWLT 1BCIA 4RRPG 2HRPL 2Y5TA 3EYOA 3JT0A 5FYKE 3SE8H 4S1QH 1F86A 1E5UI 3BDXA 4CGUB 1S7VB 1CLOH 5CLYA 2PPAA 3CWGA 1N0LA 4V1DE 5BRZD 4BDVA 5A3ID 1FBIH 1SEQL 2A1WL 2AGJH 4J4PC 2C4FT 2FEDC 3IDYB 4JG9A 4IHBA 5HYJD 3QA3B 3F7YB 1EEUA 4URTB 4MX7A 3QUZA 3SGDH 3UAJD 5HYJA 2YC1A 2P5WD 3SDYL 1FV1A 1GSKA 1U8NA 4WWKA 5F7AA 3VXME 4OJYA 4G7QB 3QEHA 4X5QA 4XO4A 4RFEA 3NSJA 1VEMA 5T1LB 3QZWA 1FYHB 1TJHL 2PR4H 4JRWA 3NCYS 4FHKA 5DO8A 4DGVH 2BY2A 3P4NB 3B5GA 4MXQC 2OJEB 4TTDC 4GRLB 4JM2B 5HHMD 3T77A 3GLEA 2F58H 4F9LA 3LQZA 3SIKA 4ERSH 1YEHH 1CYXA 1ERNA 4P3CH 4WJKB 2GCYB 4PUBL 1Q1JH 1AQDA 1BXUA 3M8OL 5GJTH 3QUMA 3CH1A 4K8RL 4PRIE 5GHWL 4JANA 1V3LA 2PLTA 3CFTA 3TU6A 4NC1C 3BVNB 3VXTA 2G60L 1QTPA 2WB1A 4QHLA 3H3BC 2VUYA 5J1SC 3H9SA 3PL6B 4F7PA 2J4WH 2IWFA 3S35L 1VZIA 1C8PA 3D25A 5G4NA 4JAMA 3VD3A 5LJYH 4H8WH 5FO7A 2R0LH 4ZMQA 4OF6A 3LXCA 3CMOH 4KK6D 1A02N 3RVUC 5F1IB 1O6SB 2GJ6A 3ARGA 1OCWL 4U6XA 2EEDA 2N7AA 4G8GA 4LBEB 3TBTA 1UZGA 4YHIA 3U0PA 1AZUA 2L7UA 1OQXA 2QSTA 3SB3A 5DJDA 3V0HA 5SWZB 4LCYA 5BVPH 5EF0A 2Y5QA 4ZAKA 4L37A 4LE8A 2WXRA 1JZ8A 1PD1A 1EWHA 4HS3A 2YD0A 3PPEA 1EZVY 5A2FA 3JV4B 4KK8C 2JJTC 4N87A 4LKCB 4XB7A 5B22A 4NZTH 4LSSL 1B2YA 1A4CA 4D9LL 1MFDH 2AQPA 4EXPX 1AHWB 3F7VA 3KD4A 4ODWB 5BXFB 4ABVA 3K5SA 4NO0B 1Z1WA 3AAZA 4PW3A 4OZ4B 2Q3XA 3LH2H 2ODHA 4KK5C 3L1EA 5CWSA 2WVTA 4M93B 3QDGE 3IFOA 4EUPA 4QCIB 5LQBH 4G5AA 3NGBC 4QXUH 5IQOA 2R1XB 5BO1L 1EXHA 1TF4A 2NY0D 3FUEA 3GO1L 3DX6A 5DK2A 4B5EA 4Y16C 4GMTL 1F3JB 6FABL 3WU1A 4M62H 5FGBC 5HGAA 1WBZB 1DLFL 3WEAA 1JRHL 2E75C 4PQXA 3O2WH 2CBOA 3WKMH 1ORSA 1KN2L 4DVRH 1XR8B 4XR8C 4GG6E 1QBAA 1UWFA 5E4EC 1G7HA 5E6IA 4OLXL 2FBJH 2Z8RA 4NFCA 2BH0A 1URZA 3CBRA 4JL1A 4JN1H 4JFOB 2IMNA 1QTYT 3DJZA 2H8PB 4FFZL 4HK0B 1OCCB 1U4FA 3P9LA 5D7KD 2B1HH 4ZD3H 1KCSH 4FNLH 2FHBA 1L3NA 2O4EA 1J1PH 3B56A 4LP4A 5DFAA 3V5DA 1P1ZB 4G72B 4WWOA 1TLKA 4OFPA 4L05A 1WFNA 1C16B 4X83A 1MNUH 2BJMH 3WSQL 2AVFA 1BD2A 4FZEL 3SPGA 4HUMB 1I8MB 3PHOA 1VADB 2R0ZL 5A2JH 2JQZA 4W9FC 3UC0L 5JPMC 4JKWA 3P0VH 4APQD 2JI3A 4AE1A 4LLWB 1RUKL 3V0DA 3O45B 4ZODA 3WE1A 2NLJA 4DKFH 2JV6A 1KN2H 4Y89A 4G7VH 1V3MA 1TG8A 5DU7A 2ZT9C 5IF0A 2K8MA 1UOWA 2A73A 4HJ0C 2VAAA 1AO7B 5ILTL 1RPKA 2WINA 1DQIA 1WFJA 1MHEA 4LPXA 3TXAA 1S7VA 4C56D 4KRPD 1AQMA 5ELIA 4AJYV 1IC7H 3S88L 3DOIA 3GRWL 1T22A 2ZPKH 4TMPA 1G94A 2D9QB 3KG5A 5I6LA 2F7QA 1AO7E 1HCZA 1LP9A 1CD1B 1M7IA 1Q1PA 3FRPB 5CILL 4HKBA 3DV6B 3IDNA 1DVFD 1YEGH 1CBVH 4B9GA 5I2IA 1KJ2B 1E4XL 1N8ZB 1ED3B 3KBFA 2J43A 4PM1A 4WKXA 3MJ7A 1GYWA 1BZ8A 1T5XB 4JKPL 1DBML 3JVFC 4J1UB 1Q9OB 3WN5A 1A1NB 1LXMA 5DUJA 2C3GA 4P23C 1SHXA 1WFTA 1PSKL 1X5YA 2N1KA 2MNJB 1DVFC 2YD8A 4LLVB 3G6DL 1NFIB 4XP9L 1LGVA 1YMHB 3BIKB 5LAXA 1KCUL 2NNCA 4EI6A 4IRJD 3WLWD 2HT2D 4P8QA 3LQAL 2OR9H 1FYTD 2VL5B 3KPRE 4G9FB 4V1DB 1EMTH 4X2UA 4AW7A 2X6CA 1IM3B 2HKHL 2WAHA 3CZUB 5AZ2L 5T3ZD 3TEWA 1XGTA 1G9NH 4KZ0A 4X4XA 4YPJA 4IBWA 1KT2A 1HOEA 1OSYA 2PXYA 2WUCH 4I9WD 1T03H 2V2TA 1BW8A 1EXUB 5F9JA 4IM8A 1RERA 2VZVA 2EDHA 4PEEA 2WWNA 2KLTA 2F5BH 3B2DC 1M7UA 4APQC 1CR9L 1S7QA 3OJVC 2KC0A 4WJG3 1ZSDB 3ZKSD 4WTWA 1F8TH 4P5RA 3CVBA 3Q5YA 1UH2A 3L7FA 3MRQA 4FNTA 3O6FB 3K8KA 4F7MB 1YC7A 2DDQH 5FWRA 5C0RL 3VTTA 3SDDA 1CGVA 2ZD0A 2D0HA 1QFWL 4DO6A 4K94H 4DEWA 3W9DA 5DHYA 2Z65C 3U82B 4X5WB 1PY0A 5D1QA 3VD2A 2NZ9C 1KTLB 1A6ZB 4Q97A 5IQLA 3WL9A 3MRNA 4CVUA 1Y6NR 3JUZA 4M4PA 4DPRA 5E2VL 1N26A 2ESVE 1T03L 1RZIB 1T83A 3GBNL 1X4YA 2MHAB 1D5BB 5E8OA 1JF1B 4CJ0A 2VDKB 2HSIA 4ZPTB 5L88H 2X1XR 1DO5A 5C0BE 3CXFA 1E9PA 3PWLB 2IANA 4GIPD 3DPBA 1NIEA 1IEAA 4H5SB 2LHAA 4Z7NB 3DI2B 1M42A 3IDXH 4GNKB 4CC1A 1A1OA 1QFPA 1WZKA 8CGTA 3CDYA 3BQUD 1PFOA 1M53A 4MQXC 2IJ0C 3G6JA 4MA3A 3QXTA 5H8DA 5FYKL 4XX1G 3HBGA 4PVBA 4I0PB 3JYBA 3EDDA 1CIUA 1QLFB 3SDDB 4PB9H 4WI3A 4Z7AA 5FCUL 1R5WB 2JLPA 5AOMA 4CVXB 5EU7C 4YHNA 3AU0A 3QFJB 4N2AA 4X5WA 4L2YA 4WV1A 5F9OH 5TJWK 1ND0A 2CK0H 1J5DA 5HYJE 3B3IA 3CUPA 3L5JA 4PG2C 1PNDA 4ZUSA 1Y0LA 3NTCL 4NXSA 1U3NA 3ABZA 3TFBA 5I1AA 5KBLA 2FGWH 5CFHA 2VKXA 4X42A 2XN9A 1TVDA 5EOQH 1CFQB 2B15A 1UT2A 4S1DC 3G6AA 4KX7A 1WIOA 4GAYA 5GIRB 1OB0A 2XQBL 4MJ2A 1R9FA 4NB7A 1EO5A 3HZMA 2YPVL 4PHXA 4HBCL 2BVEA 2EYTA 3MTXA 1F56A 4LASL 5GGVL 4M9PA 3DKHA 5DI8B 1P5UA 4MLIA 3RNKA 1CE6B 1N10A 1R3IH 4S11A 1P9MC 2EKSB 1YN6A 3MMEA 2YWZA 4MDIA 2PTUA 4FFZH 4P23B 1OM3H 2E7MA 4YE4H 4JLRA 2GHZA 2IMMA 4WJ5B 1ZVSA 3IFPB 4I3RH 4PJ5D 4KJQD 5C6WH 4HH9A 2FWOB 5EU6D 4EI0A 5I19H 3BRFA 1GCFA 2J71A 3V52L 3MRRA 1RPQA 2OK0H 1HN1A 4L9LB 2IGFH 1SXAA 4YDLC 4MA7H 3KJ4B 2BY0A 4XXWA 3L5IA 5IJBC 5DR5L 1G7IA 2PR9A 3TBYB 2RB8A 3TIEA 2A6DA 4HBCH 2Z31A 4KY1L 5E4EB 4G8GE 1I7ZA 1J9TA 2X2UA 3MLWH 2MTAA 4F58H 3QPXH 4NI3A 1BOGA 2K6ZA 1U4EA 3ARDB 5DJ6B 3T3MF 1I8UA 2AK1L 7PAZA 1BECA 5GS0H 1EO8H 4GRMA 1MWAA 3II1A 1IQDB 4MAYD 4UTCA 2YAPA 2ZKWA 2ENPA 4E9WA 4NQVA 3WOVA 2KI6A 3MTRA 4NWTL 3SGJC 3O81A 4HGKC 5A2IH 5FOBB 4PBVC 4LCCA 3SDCB 4AIZB 3ARZA 5A3IC 5ADPL 5J12C 1H6UA 2E4FA 2QQKH 2YMXL 1MG3C 2BP8A 1QVOB 2VDLH 3V8OA 3ZKNC 4JQXA 2H9GA 1ZTMA 4H0HB 2P5ED 3WIFB 2FO8A 5HHQA 2ZE0A 1BAFL 1OAYH 3KPSD 2CJSA 2H1PL 2ZAIA 1WJ3A 4KV5E 3BP4A 4YL4A 4RGNC 2J1YA 3MRRB 2EDYA 1JGIA 5AW5B 3ZHNA 3FS9A 4UAHA 4LSPL 5EC2A 1S7TB 3RIAF 4YHZL 1GYVA 1YO4A 1HESA 3RVWD 1I9EA 3QI9C 4WDIA 43C9B 4UV4H 2GJJA 3SOBH 2PCFB 3ARTA 4Z78A 3LKPA 3AG1B 2CIKA 2O5YL 3ZR6A 4Z7IA 5E6IB 5I76B 3P2TA 1ZLEA 4L18A 1H0DB 1VFBA 5I8EA 4AYFA 5GS2H 1ZHKA 4MJ5A 2F0CA 4N2EA 4XBMA 4ANKA 1Z9SA 1PQZB 4LLMB 3D2UD 4PPTA 3VMNA 1NC4D 3K6SA 4AEHH 3A6BH 3QJRB 2OJZH 2WTRB 4ZW8A 4G1MB 2QQKL 3ESMA 1UB5A 4D3CH 4NKOB 4R90L 3RTQD 1U8LA 2NXYD 3PNWB 4FG6D 2L7QA 4D0BB 2Q1EA 5H94B 5E8OB 3N85L 5BZXA 4JO1H 4HLZH 3UTPD 3VFUA 3FYEB 1TJIH 4IKIA 4FFYH 4RZCA 4D9RD 1YECL 4F57H 1W8EA 4Q9QL 3O4LE 5INDB 1KIQB 3LRGA 4Z7WA 3DTXA 3O9WD 1VFAA 4C54A 2FNBA 5MHSD 1Z5HA 3JWOC 1G9EA 2P26A 3O11A 4ZFOA 4OJAA 3TFKC 4J39A 3BUYB 3O0RH 2V17L 5J8OA 2VXTH 1KGYE 3QZOA 4QHLB 2HJFB 5C07D 4GT0A 3JUYA 5FYKD 4UT7H 2O5NA 5DTFB 4FQXB 3OLIA 5G4MA 5CO1A 2XN9D 3BH8B 3VMOA 3GMQA 1I85A 1I8IB 3MBWB 4HGWB 4YGVB 4EDXB 2NY2B 1ECYA 4OQ1A 4RIRA 5C6TL 4P49A 2C3VB 5DJYB 3MX0B 4M6OH 1T4KA 1ASOA 4YHIB 3U0PB 2J5WA 4PY8I 1JXJA 3QRGH 2X6UA 4MNQB 1JD7A 5C0NC 1Y7VA 4OD2A 1G0YR 4ESKA 1Q0XL 4IIQA 3RUGA 3SPHA 2CKNA 2BCKA 3RVTD 1FL3B 4IKNA 5F6IB 1J5OL 5BUGA 1WFMA 4R8WL 4LRIC 5ISZE 1BQLL 3FO2B 1EJ6A 3MGTB 4JY4B 3EFOB 1MCCA 1G7LA 5FYJL 5LNEA 3V0EA 2R29A 1M1SA 5ICYB 2O5XH 2CALA 3EYUH 1KYOJ 4ZFOB 2ICEB 3ZQXA 3S48A 1IBBA 3A6CL 4J28A 4M7KL 5E4OA 3VFRB 4GT7A 1T1WB 2O5ZH 4M5YL 3UMNA 5I5RA 1KN4L 2ZQKA 3UROR 1DLHA 1YEFH 1KOAA 1XCTB 1U8PB 5AOIA 1TXKA 5JO5B 2FGWL 2B5IC 4EUPB 1RK0B 1AKPA 3V0GA 4YR6B 4OR1A 4G7RB 4Q89A 5D1XB 3KGUA 2AK4D 2QV2A 5E08H 4G2AA 2OMYA 3SDAD 1WCQA 4AZ8B 2C4XA 5IHWA 4LLQA 2F74A 1KPVA 3QG7L 4MQ7A 3N50A 3C5ZC 1CXLA 1IT9H 1QHQA 3BW9B 1ES0A 3C6SA 3ARFB 3CDZA 4YHLH 3ZX1A 3EYVB 1TJGL 3F7QA 3VWJC 4Y2OA 4OZFB 2Q0ZX 5DHYB 1JFHA 4AYSA 5IB2B 2XHNA 5DHDA 3QZMA 2ZOKB 3RPIA 1SOKA 2PYED 3KLHC 4CN4A 4Q6KA 4ZMOA 1T1YA 3HE6D 5JHDD 4NO3A 4NNPH 3Q2VA 4AK2A 2GT9B 5A6IA 4ZOCA 3QUXA 4LESA 3SKOA 3GMRB 3EH1A 4F1SA 1CTOA 3D39D 1RZGB 5DZPA 4WFED 3FSOA 1H3WM 1AE6H 3P77A 5INCB 2IADB 1LWJA 3N1GC 2VISB 1FGVH 1KPUA 4Y5VB 3BZFB 2DYPA 4PJFB 4ZO9A 5T33L 2X3CA 2OCFD 2DN7A 2W9LA 2PP8A 3KVPA 5E5RB 3EBAA 4X9YA 4IIQC 1SYVB 4Z8FL 4IRZL 2E86A 5EO1B 4QXUL 1F4AA 3RGVD 1ZPUA 1VA9A 4PJ7A 3GC3A 3CFQA 1Q94A 4JN2A 5HDLA 2UXVA 2QJDA 3TO4B 1YY9C 1FH2A 2EXWD 1CTNA 2XKNA 3QJVB 5J13C 1HWWA 4X4YA 3GO1H 3GSWA 3TNNB 4F3FB 3G5ZA 4CSTA 1KF9B 4P48A 2D2OA 1I85C 5D7KE 1GS8A 4RDBA 1VLXA 3TO2B 5MEOB 2K8QA 4N1EA 4Q4EA 3LPPA 3VM5A 1NC2B 3MRMA 4AGNA 1U8IA 4YPGA 2COVD 3O3BB 3SZKC 2W8CA 4MNGA 3UBHA 4HIIB 5JIPA 3V8CA 2WIMA 2Z1PA 3VRJB 4ONOA 1IKFH 1FL5B 4NQDA 4ZRGA 1A22B 3FU8A 1QPPA 2JIXA 1B6DA 2AV1A 1KIUB 2GQHA 4HPYH 2ZSVB 2Y6SD 4ZNCD 5DFVC 4KKLC 5J5EA 3SD2A 3JWOL 3O8XB 4H8PA 3RBGA 3PQYD 3Q0HA 2V3FA 1HNYA 1MI5D 4I88A 1D9KD 3DYOA 3JZYA 4X7SH 3VXUB 1ZKAA 1FIGL 4RQQA 2X4SA 2I26N 1FSKC 1CJYA 4LK4A 3H9HB 4JN2B 4RRPM 5HVFB 2NY1B 5KJRL 3LZFH 4X5XB 4DSYA 2VABB 1DL7H 4WWPA 1KIPB 4KZDH 5HHNB 3LKSB 1R5IB 2O6FA 4RNRB 1KJ2H 4F8NA 4EI5D 1JYXA 1MW2A 2YRBA 2H6UA 4WWKD 5F7LB 1UB6B 3IJSB 3QW9A 4DFHA 3TNMB 3DIDA 1T3FA 5L4JA 5HPMA 5D1QD 3UTQA 5D7IB 3ZDXF 2HVBA 2VT0A 3FOMB 3PWJA 5E2TH 1AFVL 2J72A 1F58L 4O9HL 3MBWA 2V3DA 2XC8A 4N4YB 4YGVA 4GIAA 1E2ZA 2PN5A 2JIXB 3S8GB 4MJHA 2W65B 1EERB 5KAQF 4PRBB 2AV7A 4HBQA 4HZAA 2XNAA 3NQKA 2V5YA 1HSAA 4IOIB 4BGLA 2VDPH 4FQJL 2YS4A 5DC2A 4NUGH 3WMPA 3QDJD 3ZE1F 4A7QA 3E2HB 3PWUB 5IROA 5AVUB 2VAJA 4ADJA 3OHXB 3DVNB 4K7PX 4NBZB 1CXIA 4AMWA 1BWWA 4ICWA 5HDBE 1CF8H 1YEKH 4ZOAA 2AEOA 4YDVA 5ALBL 5DGQA 1BQSA 4JFUA 4XP5H 1T1ZA 4Y5XC 3AB0B 4IMLB 2OJEA 1L6PA 3I50L 2H9GB 3IDUA 4YNYB 3SDAA 2WQRA 4ZQKB 1EK3A 5AQ0A 3VFTA 3PUUA 5DMGC 2EIJB 2P5WA 3QO1B 5AZ2H 4KRNA 1K5WA 4H5SA 2Y23A 2WLYA 1HYSC 1DUYB 1S7SB 3VI4E 1S7TA 1XCTA 1I31A 5D5MB 2CRYA 3NJMA 4LARL 4CW1A 4FMFA 4PJDA 3FCGA 4OF0A 4QO1B 3HS0C 4L5FL 3B9KA 2QPFA 5IK3A 4QRUB 3C5JA 4BZ2L 5AWNL 4P9HH 4HEPG 3UOAB 3FTYA 1TMQA 5I0DA 1NBVL 2P46B 1MFVA 3WBDA 4F9PC 4L1BA 5F7UA 1FH5L 3H3PH 1OB1A 4X7FC 1EDHA 2DLIA 3BUBA 3LNIA 3L4UA 2KBGA 4OCWL 3TLRA 1FC1A 3JTSB 5JW4R 5AZUA 2HTKC 1D2PA 1QAWA 4KAQH 4IBYA 5ANHA 1YEGL 3OTTA 1KB5A 1TCMA 1Q9LB 3OMAB 4CAGA 1AZBA 3WGVB 4L29A 3BZEB 3FUKA 2Y1VA 3K0WA 2Y6TE 1DQJB 3QEQB 3Q9QA 3L3KA 5CP7A 1O9ZA 2B08A 3SGEI 1JDAA 4OM1L 4OFDA 4P2CG 4OH2A 4ZQKA 2ZYSA 3WIFA 3GTVA 4X6CB 2BSED 1A7OL 4N3UA 5JW3L 5LLIC 4C56E 3EKCA 1IFHH 1JGLH 2J2ZB 4OFIA 4PWFA 5DD6B 2HTKD 3ATDA 4P2RD 5D7LD 5GZOA 1QSVA 2NR6D 2NY6B 5CCJA 1U8OA 5ERWA 1NANI 3UPCA 2CBTA 1Q90A 3QJFA 4Q7DA 4W9IC 4X9GA 1ZIAA 3WEXA 4ANWA 4L4VA 1J87A 3R7RA 1NPJA 3PABA 3TEUA 4LCVA 5AZEL 4U1KB 5F7NC 1DQQB 1PZ3A 3T4AA 4BSWB 3BMWA 2IBZX 4KAQL 4Y1TA 4Q6IB 4G71B 1ZJBA 4M3KB 5IMKA 1BZDA 3B6SB 3Q1SH 1CG9A 4D8OA 2V8LA 1FL6B 3QORB 4P9HC 1OAXH 3N40P 3NFPB 3S36H 3DX6B 1OXYA 2R2BA 2CXGA 2FQFA 4H0GA 5EZIH 3CVHL 5EZJA 1BQRA 2NW2A 1H8OA 1U9KA 1DQJA 2DQIL 2FH8A 4RAHA 1LK3L 4P46A 3MRPB 3UBXI 4U1LA 3X3FL 1JFQH 4J12A 4V2BA 4JFHD 4U6YB 4YO0A 3RX9A 4GW4B 1XF3A 4B97A 3BSHA 3QWNA 1EFXD 4EUPG 4E41B 1OL0A 2V33A 1WBXA 4J3WA 3LRMA 4UNTA 4PJXA 1G7LB 2CO3A 4JFDE 5KN5A 2K4WA 2AHIA 1NMBL 1OCZB 2AKRA 2HX8A 4Q0XL 5BZWB 4DW2L 2CHWA 3UYPA 2R23A 4WUUD 4JG0H 3L81A 4TUKL 5F2FA 1N70A 2VM4A 4J23A 4ATWA 1I82A 4EN3B 4YHOL 5HVHB 3P0GB 4KUCD 2B0SL 1U36A 1YMME 4L4TE 3VXUE 1BEXA 2L4OA 4JBSA 2I27N 2YBRB 1KLUA 4MNGE 3UG5A 4ETQA 3UYRL 4A2EA 4N9GB 1UEMA 1D2OA 3B8YA 4HJJH 5D1QC 3TM6A 4ONGL 4BK5A 3O4OB 3HRZC 3QIUB 4J3OH 1A3QA 1JFQL 4K3DH 1A4JB 2VJ8A 3L4YA 1MIML 3IPEA 2Y7LA 5H35B 1NBCA 3T6ZA 1M1XA 2CDGA 2FX8H 3SOTA 4XPBL 3ZSTA 1AKJD 3GJFB 4HC1L 1U2YA 1HNFA 4XWOD 3VXPB 2YUZA 15C8H 2YPVA 3CHOA 4B3EA 4HG4J 4XVSH 3QRBA 3BAEH 5JYLA 3S96B 4XXCC 3MRIA 4N2FA 4GW4A 4JO8A 5EUOA 3B37A 4NO3B 2MH4A 2WB7A 2W0KA 3D4CA 4U0QB 1KG0B 1DSWA 3UTZB 4N2LA 2R2EB 1EGJH 1IC1A 1OP9A 4G6JH 4DOHB 5DFVD 3QQDB 3VXMD 4ZFZA 2JB6A 3GI8L 2Y6SC 2DPKA 2Z7YA 2NXZB 3I6LE 3FH7A 3CZFA 4WUUE 5CZVH 3ZDXE 4B9JA 3OZKA 3DDFA 2YQBA 1WAAF 5AVVB 2OSYA 1MDTA 2W38A 3MA9L 4R4BB 1RVFH 3LQAC 4OLVH 4W93A 5KUMA 1AYOA 1UZ8A 4O58L 4P9MH 4RMBA 3OF6D 3I3DA 1AY1H 1RUPL 5EBWA 1BAFH 1OAYL 1U95B 4UM9D 4O51A 2E56A 2BC4B 5L2KE 1FG2A 3L4XA 4OCRL 4WI0A 2OSLB 3RGVC 1WFOA 1NSNL 2EYRB 3TVMA 4LU5H 2FLBT 3EOYG 3EJSA 5I6MA 3GRBA 1DCEA 2C9AA 3VD4A 1GHFH 2KZ1B 3HN5A 1N0LB 4NQDB 2XTJB 3RIKA 3UBGA 2DM4A 4B0MB 4XCEB 5EOCJ 4LVNB 5HJBA 4KMTH 2YEVB 3HZYB 1X9UA 1ZK9A 2ADGB 4M29A 2JMRA 4R90H 2VZ3A 1PZDA 2V5RA 5GGQL 1L0YA 1XR9B 5DR5H 2NQCA 1OP3H 1FN4A 3LIUA 5DD5H 3H9SE 4P5MA 5FHBL 1W6WA 1GZHC 1R3KB 3DV4A 3HE6C 1BFVL 1V05A 5EU6E 3WV0A 1KC5L 1TTCA 2XBZA 2XG5B 1XEUA 1V7MH 4HK3J 3LTVA 5BOZG 1RIVL 4G43A 2VE6A 2Z1KA 4LU5L 5CAYB 1HOCB 1L9OA 2OTPA 1EMTL 1QNZH 1Y1DA 3HFFA 5HDRA 3OX8A 1BZ9B 4UOZA 4A6YL 2I9LB 3LRHA 4C83B 3OKYA 2PWHA 4TULL 5AYUH 5KSUA 4ORGA 2WM0A 4JHVA 2W5PA 4KKRA 5LN8A 3WN5B 1A1NA 5SX5K 4XVTH 1FO0A 4WIQA 3WNNA 5HPMB 5CKGA 2QLYA 5GGVH 3GXTA 3QG6A 3GEWB 5KEZA 1XV8A 4G11A 4JG1L 1FO0L 5DURB 1P4UA 1WUNT 2OMTA 2G3NA 1L6XA 5E6IC 4RMSA 1FL5A 3B7UX 3NEXA 4K71B 1U33A 1MHPL 2P8LB 1BQHB 2YUWA 4NJAH 3ZDZF 1SYSB 5K9QG 4NN6C 3HC0A 2HVKB 2OXGA 3GHBL 2UY6B 3G5VB 4Z3IA 5B3JF 5KSVA 3DSNB 3WTXA 4BSVA 1WAAA 1R5WA 3MGAA 1F4WH 5FK9B 2ZYIA 4XMVA 1WIPA 3OWEA 1JPEA 1FWXA 1E4XI 4XP4H 5E9DE 2O5YH 3B5TA 4MXVE 5J6GB 3EZJB 2HMIC 1ND0B 4UANA 4YBHA 5L0QC 1W16A 2VL4A 3IJHB 3KE0A 4JM0A 5F6HI 4MHHG 1GIGL 5TE7H 3RVTC 3KPLB 2ZOUA 3HTLX 4DP2X 2VABA 1Q72H 5SWZA 3TBBA 1H8LA 3KHQA 4G5ZH 4JFEA 4YDZA 3RWHA 4BEIA 4ZMYA 1IGYB 1KGWA 4OZHE 4PTTB 3K3QA 2VLRD 5I0ZA 2P5WB 3FQRB 5F0MB 2EDLA 2CBMA 5IVZB 3BFOA 1SHWA 2Q2EB 2XIIA 4NQCD 4M6NL 3QUMH 4BUQA 1ZDQA 4HX1B 3T8XA 2VLME 2HJKB 3CSFA 4M7JH 3Q5OA 1EAOA 2XRAL 2P5WE 2K3HA 1R34A 3SGKC 1IJNA 1X7QB 3NT0A 4HKXA 2OZNA 1MPAL 2A9CA 1LDSA 3HN8A 4JY6B 4BRVA 1PLBA 3CFMA 5AVXB 4PJXE 4B9IA 4GBXB 5EORL 1FF5A 1DYZA 2A4ZA 2XKNB 1FRGL 2GEQA 5KSVB 5LGHH 5IMMB 1AXSB 2FECL 3ZE2F 4U7MA 2VITB 3HLKA 5D72L 1E6OH 5I8KH 3LZQA 5I0WA 4G80A 3ROOA 1M3JA 3GSOB 1YMMA 4L4TA 4WGVB 1PBYA 5F7EL 3S96A 3WO4C 1EAQA 2DQUL 4JS7A 4OM0H 1WBZA 1YG9A 3QWOA 2UYLA 3L5HA 2H3KA 4Z1PA 4WNQB 5DDHA 3FSZA 3GJEA 4OGYH 4MNGB 4OLZH 3DETC 4FD0A 3ARPA 1FFNA 5KSAA 3TBYA 4K3HA 5F7FA 1RU9L 5IB4A 1QLEL 4FG6C 3TIEB 3ZL4L 1KEGH 4ZNEA 2ICES 2AV1B 1DBAL 4F7MA 1UTDA 5EDXA 3PL6A 4Q58C 2XZQH 3MUJA 5I1CL 4MJ6B 1FE8L 1ROCA 2CZNA 1QR1A 2XYBA 2PCYA 3SE8L 3LIZH 1HL5A 3DECA 4Y4FB 1QTSA 1N67A 2OMWA 4F15C 4WW2B 1SY6H 5T5FH 3PIQA 2DH3A 3MLRH 1A7QL 1SEQH 2A1WH 2AGJL 2BVUA 3S34L 5JPNC 3VH8A 5T5NG 4YDJB 1FNSL 4FABL 3QBTB 2J1XA 1E2WA 3GSQB 3SO5A 7TAAA 1FNHA 5I1EH 5EBWB 3MV8E 3IEAA 3IJYA 2UXFA 3CSBA 1KTDA 1XMWA 3DVFA 2MKWA 4OLYH 4F7KA 1RAMA 2DWYA 3QH3A 4N68A 1A8JH 2DM2A 4PJBA 5CP3A 3OAUL 3MOBH 4ODVL 3RLSA 3WJLC 3BZEA 4TNEA 2OR8A 1A7PH 3K1KC 3TPUA 3EGSB 1DJHA 2IAMB 1I8KA 4X6FB 5HJGA 3OBAA 4E9TA 3K71B 3ZKND 5GGTH 1F6AA 1URLA 1JPGA 1NLDL 2QV4A 3TP4A 3WIIH 1SJEA 1UWYA 3HBPA 4C4KT 4ZK8A 5E08L 3RA7L 1T22B 3I9GH 3BX7C 1DANU 4XCEA 1G0XA 5ESQB 1HWGB 1OAZH 3ARED 2W81C 1CYGA 3V4VA 2NY0B 4LLMA 4PMEA 3FDWA 1YNTB 1IL1A 1XGUA 3RAJH 4HF5H 4OLYL 5DS8B 3WYRA 4Y1AE 3HNSH 3WCYA 4XCNA 5E0QA 4LNVA 3EJPA 2G60H 1FNSH 1ET7A 2D0GA 2QQQA 4G1EA 4XC3L 1R3KA 3DV4B 3POCA 3I6KA 2CD0A 4XMKH 3CFEB 2Z4QA 4U3XA 4XGZA 1AQ8A 2HRHA 4EZKA 2VR8A 5BQ7A 1RJLB 3UC2A 3Q8FA 4D8PA 4O5LL 2Z31B 3WKQA 3U7YL 4EIGB 1CXHA 5E7FA 4HFUH 5C0CD 4M4RA 5T3ZL 4JFFD 1AE6L 3IXAB 3JWDH 2GTZB 1WS7A 1S78C 2LU7A 1Z3GL 5IEHB 2QADC 3QIWD 1E9QA 3NRQA 2YMTA 3BPOB 4XNQA 3U4BL 2H1XA 4XMPH 4FZ8L 3FTUA 1GGIH 1ET5A 1EHXA 5ADOH 5KUKA 4N20A 1OD7A 5DZOA 1MVFA 1DVTA 5SWZD 2V37A 4PB0L 3D05A 1PDKB 1SDAB 5KN5B 2DJMA 1PG7W 2VDKH 1JV2B 2BNRA 4OFQA 5GGSB 5IW6B 4G42B 3T65B 4JJ5B 1BBDL 1KXVC 3ZDZB 1JWSA 3QAZC 4PWKA 5IB1B 3WHE0 3MLVH 4EF3A 4RWYL 5DD3H 2XWCA 2OMNA 3KNBA 5BV7B 3G7TA 4YMPA 4MD5A 5GISH 1II4E 2DKMA 1DZ0A 1RZJH 3T5WA 5IW3A 3F7KA 2OZ4A 3OKOA 3ISYA 3O4OC 1J9CT 1JYVA 1U3YA 1DVFB 1G9NC 1UGNA 1AI1H 4KPHH 1EJ8A 1TJIL 3N41F 4NRZB 3AQDA 4YZFF 1GAFH 3P4OA 1K9TA 3MR9B 5IMLB 1OAQH 2F5AL 2H8PA 3OKKA 4GG8B 3WFHB 3BEWB 3U0TB 4LOVA 4QRPB 4K5NA 3UO8B 3W2DL 1ZT4B 2OAAA 1IAOB 5KVEH 2Z6FA 2OKMA 1O7DC 4L4VB 5D2NA 4P04A 3FHQA 3R06B 2UUDK 3HPLA 3FQ4A 1NGYA 2GBTA 4GBXA 2R0LL 1K4CA 1X3DA 1U8KA 3LHAA 4OIIH 1NAMB 3ZQ9A 4QJ5B 3CNKA 5E8NB 2OCCB 2XN9E 3B2XA 4AW4A 4BE5A 3FQ2A 2ZUTA 5HYSB 2DD8H 2C3WA 3V6OE 2WLMA 2CDEA 3ZT6A 4GAJL 4GEIA 6PAZA 4HWEH 2YN5A 1JNHB 1Z9NA 1O6SA 2D7OA 3ARGB 4U6XB 3ZMNA 4Z7VE 5DS1A 2C9SA 4GMSH 4HOMA 1SLXA 1G6RA 1S7UA 5K9KB 1VCAA 4NZRH 2PWGA 3NSDA 5D9SA 3NABL 2A9AA 2B8OT 3LS4L 4M8QA 4P46B 2V2TB 4QRFA 1AACA 4KROB 4Y19D 1KZYA 1BJ1H 3T0WA 2DWDB 3QHTC 3HI5H 3FCBA 1R6VA 4UT9A 5DD1H 4EDWL 1QFOA 2NZ9D 3MFGB 5B8CA 3O6FD 4G43B 2K6YA 1ACCA 1YEIH 5IJKC 4XX5A 5ALBH 5CJXA 3EJUA 4GW5A 4LIQL 5F1OB 1S7WB 3N1MC 1P1VA 2H41A 3BPNB 3TA3B 2WSPA 1YUHA 2E27L 5C0BB 3D0LA 1E8XA 1QATA 1T80A 1HZKA 1FVCA 2AMGA 1OWWA 5I6NA 1C08B 2R4SH 3BCFA 1FO0B 2GW5A 1O9WA 3SDYH 1F1DA 1KJVB 3B7TA 5E1IA 4JQVA 1LD9A 4R7LA 3QIUC 32C2A 2SEBB 1J8HA 3UG4A 3BLKA 2FX9L 1OPGH 3HG1B 2EIKB 3AGVA 3C5SA 3FB5A 1DUZB 4DKAA 2AJUH 2CLZA 1X44A 4I1NB 3BIAX 1QSFB 3ENEA 1E9OA 3VFWB 4AQEB 1UATA 1ZHNA 4ZTEA 1WHOA 2WP3T 2AJSL 1UADC 2IDCA 1HDMB 3BT2H 3FUFA 2AI0H 3NFSL 2FR4A 1WFIA 2R4SL 4QDGA 1HK6A 4IRJC 4LPVA 3GSVA 3OMIB 2P80A 3HC4L 5CINH 5TFSL 4LKXB 3VXRA 4GI9A 5CN3A 1CGSH 4XZUB 1J0HA 3ETBF 4O00A 4G9FD 2YEQA 3CSYA 1F4YH 2XVLA 3OL2A 1BIIA 1E40A 2ZCZA 3EYQD 4CSPA 2J73A 3QS2A 4YXKL 2H32B 3C09C 3GK8H 4HPOL 4HUKB 4QIRA 1HCVA 5EU6A 1WZAA 2CHDA 3J27A 4P3DA 4KQ3L 3FKUS 1KXQE 4QGYA 4GQQA 2QPEB 3UDWA 3H9SD 4D8PB 2ZCHH 4FQ2L 1NM4A 3GUFA 4DK5A 2VXQA 1MDAA 2E9GA 1O75A 2UXTA 4QTHA 3ULSB 2X4PB 3LN9A 2F6AA 2GTQA 3VYPA 3M46A 4Y1AA 1FNGB 4HXBH 1OTSD 1AXSA 3FO9B 3C09B 2F19L 4NI6A 4DK6A 2MNUA 1KYDA 4O02B 1C5BH 2UZIL 4UINH 2ZUYA 1F11B 1YMMB 4L4TB 3DXAD 2WCGA 2Y7OA 4GAYB 2FSEB 2MTPA 2A74B 2ZKXA 3GBNH 2P24B 4K07A 3TIDB 4J3OD 5E2VH 3ZDZE 2IPTL 1A1OB 4NPYA 5E7BA 4UDUA 5TQ2L 3SCMC 4XVSL 4KXAA 5K59E 5B3JE 2G9HA 3FONB 4I13B 4BFKA 2BXYA 1S3KL 3L48A 4JGJA 1HHGA 5TPWL 1VRSA 3POHA 3PGDB 2KLRA 1I8LA 4P3CL 4N2OA 1ED3A 5DHMC 1ACYL 3FQRA 2A7BA 2HRGA 2DEXX 2ZTBA 3GMLB 4Z3FA 4IU2B 2XG4B 5MEPA 2O72A 1YNTF 1NCCH 3FN0H 3ZHDA 4NC1E 4ZNEE 2X09A 4C8XA 5H4YA 4BKLB 2F53D 5MP6H 4NLAA 3NGBB 1JZ6A 3LEYH 5J11C 2GVYA 2CKBH 1A2YA 3T3ME 5IJVA 3IRCA 3ESUF 1ZEAH 4WSJA 1J48A 2PETA 3VXSA 1IBYA 3EOBA 4JO2H 5AW3B 5IJCC 1EDQA 1WWBX 3S3SA 4POUB 2EC8A 2O30A 5C9KA 3ZTJG 3HS0B 1A0QH 3NAAH 1KIQA 3AJ7A 4OQTA 4MAYB 1YN7A 4PCYA 4UBDD 5CLZA 4WHDA 4QWWC 4AITA 3QG6B 5EA0H 1FFNB 1JVLA 5KSAB 1JPST 3O2DA 3FHEA 3SGEH 5IQ9A 2PPDA 2K9UA 1HAWA 4BQCA 1HXMB 3F7PC 3K6DA 3L1FA 4H2CA 3NCMA 2DI7A 4JFED 5EN3A 5AD0B 3U0WH 3QDGD 4MKTA 2HKFL 3LDBB 5AKTA 1OAXL 3KYKH 1URIA