4BFJA

Superoxide reductase (neelaredoxin) from archaeoglobus fulgidus e12v mutant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
b'ELFQTADWKKVKHVPVIEVLRAEGGVVEVKVSVGKEIPHPNTTEHHIAWIELVFQPEGSKFPYVVGRAEFAAHGASVDGPNTSGVYTDPVAVFAFKAEKSGKLTAFSYCNIHGLWMGEATLSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE REDUCTASE
publication title Understanding the Role of Key Residues in the Superoxide Reductase Molecular Mechanism, Exploring Archaeoglobus Fulgidus Sor Structure
rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
total genus 23
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4bfjA00
1VZGA 3QZBA 2JI3A 1DQIA 4BFJA 4BK8A 4BV1A 2JI2A 4BRVA 1VZIA 4C4UA 4BRJA 1DQKA 1VZHA 1DO6A 4D7PA 4C4BA 2HVBA 1DFXA 4BFFA 2AMUA 4BFKA 4BGLA 2JI1A 1Y07A
chains in the Genus database with same CATH superfamily
1MLBB 2ZWZA 1QUNB 3MJWA 2TSBA 2D03L 4EZMA 3ENEA 1OCCB 3V0WL 2XXFA 3Q2NA 5FECA 4FTVE 2C4FT 1E65A 2OMYB 4XPGL 3GRGA 3M07A 1TFHA 4P04A 2CKBH 1KCUH 4IRJC 4A6YB 5B8CC 3HVNA 4B6ZA 2A99A 1UURA 4OD1L 4PJ8A 2PP9A 3WD5H 2ICCA 4ZPTB 3RTQC 3EBGA 4P2OD 4XBEL 4MYPA 3D3VD 4GP5B 1ONQB 3K1KC 2EZ0C 2A1WH 1XGYH 2CSPA 2NY4C 5D71L 3PJLA 4FG2A 2F9BT 1WG3A 3VX1A 1YRKA 3H2QA 3RURA 4CKVX 1KY7A 3QUMH 4L1HA 5J9PA 1T4KA 3PPSA 5I16A 1XIWD 2VL5A 3IXTB 2E7CA 4ONGL 3K2UL 4P23C 5GJTH 4H1LA 3ARRA 3BKCH 5HDRA 3V4PA 2G75B 4W68A 3KPNB 1MAMH 4Y89A 4M8UA 3TT3H 2XBTA 3WELA 3NFSH 3DC0A 4PJDA 3C5ZC 1NMAH 4WFFE 1HX0A 5HGDB 4ZQKA 5I0VA 3DX1A 5TQ0H 3MV9E 1HK6A 3PWPD 1L7IL 4MYWB 5AL0A 4NFCA 1ZT4B 5DD6B 1XT5A 3HMXA 3KPPB 3SDAC 2FATH 3OG6B 5CZVL 4IRJB 5B8CB 3MJ7A 3FF8A 1KCSL 2NCEA 5HI5C 1HH6B 5HHMB 3UYPB 3C6LC 2V5YA 4HJTA 1N0LB 2XZAL 2AK1H 4MQTB 1CQKA 2D7NA 3BUBA 3CFDB 2CO6A 4HUWA 4ELMF 4DW2L 3U46B 1CLZL 3DARA 1WDAA 2DF3A 3ISWA 4Z3IA 1PLGH 1P1VA 4P23B 5FKPB 1HI6A 4X80L 1NQBA 4LAJH 5EFIA 3IJ8A 4MNHA 2UXGA 4X7EC 2HVKB 5MENE 4FFVC 4H20H 1NAMB 4KO9A 2B77A 4NRXA 1FH5L 4PJHB 1IM3A 3TYGH 2F1EA 3TIEB 3C5ZB 2V0AA 3O0LA 5HHMD 2CGZA 2D0FA 2XQYK 3B2MA 5J6HA 1MFUA 2EDFA 2X7LB 4R5TA 4RBPH 5DTFA 4AG4L 2XQBL 3NQKA 5IB1B 3MRHB 2MPAH 3S4SB 4TUJA 2WXNA 3ASWA 3FH5A 3L5WA 3P4MA 1DN2A 3BO8B 3HUJA 3EBIA 1EAJA 2GJ6A 2QT6A 4GKNA 4A7TA 4NIKB 3MJGX 3RX7A 3S36H 3NDZE 3C6LB 4IEFB 5HHNA 2AK4B 3F6JA 4UAHA 3WIAA 5DRNB 1OSZB 2GHWB 4UM8B 2XX1A 3WNJA 2VR9A 3C5ZD 4DK3A 1QSEE 3CFKA 4MB5A 5I6XC 1Q9OB 4QCIA 4ZUTA 4XC1H 2VDMH 3ML9A 3LZNA 4LLDB 1L9OA 4XH2B 3LYRA 2AJUL 2FVNA 4WK0B 1Y18A 1AKJB 2CHZA 2VO5A 1IKFH 3PGDA 3DO7A 4YHZL 3DIDA 5JORB 5HDQH 3QRFM 4FMKA 2JELL 5C0GA 3TEUA 2CLZA 5BO0D 3C6LD 5K9JH 3O4LE 3O9WC 3FONB 3MV8A 5FA3A 2AK4D 2J6EA 4NXSA 2CH8A 4J3WA 3ZL2A 4BH7A 2EKJA 4JKLA 1UH2A 4GSDL 2JCCA 1YQVL 4IBQA 3KYMA 3TP4A 3DTUB 4Y5XC 2FJGB 4GMTH 1A9BA 3UP6A 3VXRE 4PJIA 3E2HC 1MPAH 3WNPA 2ZXGA 1FGVL 4E68A 2O72A 4L0YA 5F97E 4ZFZB 3UDWA 4L8CB 3GKWH 3WXWL 3O11B 3LKRB 3QULA 4QTIH 2VKWA 3A0OA 3D0VB 1X3DA 1BMWA 3MNWA 1AKJD 1F18A 3VXSD 5EBWA 2IALA 3CDZA 3EGDA 3CVCA 1DDTA 4CC4C 3Q6FA 4YSAA 3KS0H 4LHUB 1HEHC 2X2IA 4HA1A 5I6XB 3T0ED 2A9CA 1OGSA 3AREC 5DD3H 3AC0A 3ULUF 3FB6A 1XB6A 3FO2B 3GC3A 4OLWH 5I1CL 1R24B 3DURB 4NUGH 4NO3B 5DMKB 2Y0SA 2R39A 4PGZA 1JF1B 2FBJL 2N4IA 3FSVA 1YO4A 4WU5A 1H3UA 1Q9KB 3HNSH 3IGAB 3OQ3B 4HJJH 3S37L 4PLNC 4ZG1A 2UXVA 2XWXA 3RX9A 5HYSB 4TTGA 5E1GA 1DQLH 1QI3A 2YD4A 2E9WA 3O9WB 3QDJB 4WEBH 5C07A 4AENA 5BZDB 1BZDA 3KH3A 1LEGB 4M1GL 4BHUA 5LGYA 3BUYA 4QHKJ 3EYVA 2D3LA 2E59A 4H8UA 4LHUD 4Y5XB 2EEDA 4YPGB 3B37A 3HLAB 3E2HB 2WWKT 3BEVA 1KT2A 4I1NB 4EDXB 5BS0A 1CYXA 3MRRA 5M95B 3MZGB 1MRDH 3MO1B 3OF6A 5E2TH 2WZPD 4F3FA 5H8DA 3TIDA 1ZXKA 3KPSE 4Q0XL 1WCBB 2VDNH 3IGLA 2EIBA 2X3AA 4HUKB 3FUIA 3M17B 5K1NA 4WHYH 1WA1X 1A1MB 4PB0H 1XEDA 4I3RL 3O9WD 3QCTL 3QDJD 5B1CA 1T03H 1FCGA 2XTJE 3AREB 2WXFA 3KDMB 1K4CA 2WBWB 4PSPA 5DJ0A 3S3SA 2DM4A 2IAMD 4OZIF 4R8WL 5AOJA 2ARWA 1SXZA 3HC2A 4N2EA 4OIBA 5DQ9A 2VLJA 1NGXB 4LVEA 4XXCA 5TE6H 2YUZA 4MXVF 4JZJC 5MHSD 3DX7B 3MRNB 4Z7WB 2B1OA 3KPTA 1FIGH 5L7XH 3B8SA 1DP0A 1OGAD 3GZOA 1CTOA 3UAFA 2WQUA 4EIUA 3WTSA 5BOZG 3GM0A 3IETA 2X4NB 4L4TE 4AUJA 5KAQF 5A2KH 3L3IA 4RISL 2Y6TE 1CQYA 1WAEA 2YK1H 3ATFA 2J56A 3U1PA 3ZHLA 1CBVL 2UZIH 1NC2A 1OL0A 2CIIA 1RV6X 2EIDA 5I6MA 5J6GB 3VXNB 3O6ML 3LPGA 1WC7B 4HHAA 3BUPA 4MCMA 3PWVA 1S9KC 1OQOA 2X89A 3FL7A 4C4KO 1IAII 4XX5A 3BE1H 4L0ZA 4H8HA 4M5YH 4MA3A 1JXGA 3L17A 2VXUH 4P57A 3DVFA 4EKJA 2NYKA 5F7EH 1LO3H 1BD2B 1MHHB 3G6AB 4HEMA 2X5PA 5GZOD 3P0GB 4G43B 4F91B 4ZMAT 4ELKA 3QG6B 2EKSA 3VFUB 2Q8BH 4U1HB 2G5BA 3OKOB 4R3SA 1GKEA 2VXQL 2YEQA 3G6JB 4Q9QH 3ZR6A 2DQUL 5LJYH 4G7QB 4CW1A 1FO0H 1HAWA 1A25A 3MRCA 4GG6E 4Q52A 5EH1A 1CL7I 3SJVB 4X7TB 5ETUB 5EIIG 2XI9A 2XV6B 2QMKA 4YHKH 2DKSA 4JVPA 3VD1A 4H25A 3SPHA 5IBUG 4XBGA 4LP8A 2X1PA 2B14A 2JQZA 4LLQB 3NCWA 4B9ZA 3P4OB 5IM7B 1B4TA 1BD2D 1SJMA 1UXMA 1BAFL 1GMIA 1F58H 1CFQA 5HYJA 5AOZA 1WGOA 4H0LC 1MFEH 5FYJL 3QQDA 1G7QB 1PPIA 2R0LL 2CUAA 2ZX8A 3VI3B 1QNZL 3QHZH 1QQDB 2OJZH 3BHBA 2N1TE 5FCUL 4OZIB 1T7YA 1EAQA 2N3JA 1EGJL 2JJTA 4O5LL 1JL8A 2VDRL 1A7OL 3SJVD 1MVUA 3K6IA 2JKRM 2NCMA 2NNCA 1E9PB 3CC5B 1FP5A 1AE6L 3I2CH 4KDWA 4QRFA 2DQMA 3NABH 1D5XA 5ABAA 2M1KA 3W37A 1D5RA 4P3WA 1KTJA 2W60B 5MP6L 1TVHA 4AMWA 1AIFA 3W5NA 2GFBB 3FK3A 3CXDH 2W65B 1A7NH 4JFDA 3CVIL 2G9HB 2B8OT 1V05A 5IQ7L 5IMMA 2DQFB 1NDMA 1CLYH 3EFFB 3GINA 4WI7A 1HZKA 3X1FA 2RIKA 3GIVA 3D0LB 1OARL 5IJKC 4NPYA 5JW4Q 1R46A 1IILE 3KEDA 1LO5B 2FCBA 2R7EA 3R0NA 1ZSHA 1EFXB 1KYUA 2DDQL 2NY5L 4LLVB 1DJYA 4P46A 4LNRB 2V3FA 1WEJL 1LO4H 2YGOA 3C9NB 2B5IC 4HCFA 4B95C 2WXGA 1JD7A 2BNQA 1U3HC 2YHGA 3QSKB 4XNXL 3TCTA 1SLUA 2J5LC 3J27A 4NWUH 4F2FA 4F37F 1U8PA 3VH8B 3QJQB 2VLME 3NJLA 5DS8A 3NG5A 3FT4A 3QDHA 4LLWB 5ILTL 3HI1A 1OTSD 4JO1H 2PTTA 4PR5A 4QRTA 5DHYB 3RWFA 3MU3A 4XNUL 4DVBB 4HBCH 4PJ7E 3GBNL 1J10A 1EFXD 2E5EA 4MAZA 4XP9H 4E9TA 4OI8A 3QUZD 2QSQA 4J3OF 2V7NA 2G9KA 5KOVC 4PQXA 3DPBB 2MWCA 1LWRA 2BVUA 2FX8H 3BYYA 4ZMNA 3C6SB 3R7QA 3FB8B 2GIXA 1CBJA 3VQ2C 1I9JH 1L3WA 1R3IL 4PI2A 2P5ED 2WN2A 1RERA 5DA4A 4UQ2A 4MB4A 2HX7A 1U41A 1YMHB 3JQOB 1YUHB 2APTA 3N85L 4BZYA 2DBLH 3BW9A 3K8LA 3N0AA 2DLEA 2B5IB 4WJ5B 4AQ1A 1QWUA 4AMKL 1M3JA 3BGMB 2QSTA 3JV5A 3CCHB 3P9MB 4MXQC 3CZJA 2ED9A 2J5LB 3SE9L 4YNYB 4A37A 4WU7B 2X09A 4P5TA 5CJBA 4F2MB 2BIQA 3IU3A 2Z92A 3HZYA 2EH7L 2VDOB 2IANA 1TQVA 4QF1A 4QHMB 5JIKA 1X5IA 3AG3B 3FMGH 3CVBA 3KM2A 4UCFA 4A39A 4HYTB 3VGDA 1OGTA 5HPOA 2VWEC 1AGCB 3GXDA 4N5EC 4NNPH 4QY8A 5MERB 1EBPA 1P7HL 2FJSA 5CEXB 5T5NF 2WBKA 3QIWC 3RVVC 1S7UA 3DK0A 5DCCA 1ZSDB 1QFUH 4BUGA 4HCIA 1FPTL 2CK0H 4XCNA 3WUWB 5C6TL 3M6DA 1HESA 3N04A 5FK9B 5B22A 2RACA 5TK2A 3PAZA 4HK0A 3KPQB 5C70A 2BK8A 4OQ1A 2VC2L 5I8EA 3PXJA 1SEQH 4UNUA 3GBEA 4BSJA 5CEZD 2I69A 3SDXB 3TBVA 1G7MB 3ARWA 3QPQC 1NGPL 4L3FA 3DSNA 4FHBD 2GEQA 3HAEG 2CJSA 1NWOA 3K1DA 1Q9WB 4GUOA 1G6RA 5ITBL 1S7VA 3U9UA 1JCVA 4HOXA 3K2KA 2IPTL 4H5SB 1ICTA 5BUPA 2FX9H 1XZ0B 1AH1A 3LKPA 4NYLB 2DQDL 1DUYA 4AJVA 1RUPL 1VFMA 1FVCA 5BMFH 1MWAH 2ZXBA 3UIYA 1P84J 2OTPA 4L3CB 2VM3A 2A74C 3DHMA 4U1LB 2Q7AA 3V6OE 3WSQL 2IDFA 3SKMB 4AKQA 1CG9B 5EEZA 1J87A 2VZ1A 3C8HA 4O02H 1QTSA 4FGMA 3D33A 4LKCA 1MHCB 3SYOA 1B2WL 3QIWB 4Z3EA 1H15A 1FVEA 2ZKMX 1FAIH 1Z0MA 2QVTA 4HIJB 5KTEH 1DVQA 1PEWA 1UB6A 2GT9B 4HHGA 1JZDC 1YHPA 4AYGA 4MXQD 3UP1A 2NLJB 4N2HA 1CGTA 4HISA 4KJYB 4BDVA 1KFAH 3M1BA 3TH3T 1R3HA 1GIGH 3VDBA 1CE6A 1J11A 1CVSC 3MI6A 3ALXA 4HIEB 5EBGA 5D2LA 1UWGL 2EO9A 1MCIA 4NNXA 3C6EA 3SD5A 2A83B 4CADA 1IJ9A 4KHXL 1ZDSA 4G8EB 3BSZA 5C2BH 4NUJA 3RVVD 1YC7A 3QUYA 5GGSA 2DQIH 3SEPA 1MHPH 1Z3GH 5EORL 1ZK9A 2H32B 2OR9L 5CJQL 3QEUB 5LBSH 4F57L 3RY4A 5E8EB 2A74B 3FKUS 2EILB 4X7SL 1SQMA 4WCYL 4YDJB 4MMZA 4ENED 4JCWA 1GC1C 3VGAC 1QSZA 5EOQH 5CJOL 1MW0A 5D7IB 5EC2A 1NC4D 4NHUB 3CTTA 3P77B 2VXVH 3CZFB 4OTXH 4WNSA 1F42A 5I76A 1UVQA 2ZYIA 3RPBA 1R9FA 4D3CL 5FIEA 2B1HL 3NN8B 1KIUA 2E6JA 4OQTL 3N3EA 1FYHB 4R90L 4P59H 3BWSA 4PG9B 3HG1E 1LEKB 3NRPA 3RVTC 4N85A 1BG9A 2J7LA 3HCVA 3OHXC 4G7YH 4HETA 1DANT 4OZ4B 1NGQH 1C5CL 2VRAA 1PZ2A 1Q1JL 4PJCE 4OF0A 5K9OA 1G7PB 4LDEB 4YBLC 2AABL 4K3DL 3F12B 1HSAA 3FRUB 5CJ5A 1MREH 2EXWD 3MODL 1WD8A 3OL2A 4XOEA 3ZVVA 3BP4B 1MCJA 4W70A 3UZQA 3VFGL 5C09B 5C0FB 1NGYA 3H9HB 3BVNB 5IW1B 4NO2A 1R3LB 5BW7A 5K39A 5IZ7A 4WQOA 1N26A 3QO1B 2V4LA 5DJ2B 5HGGS 2Y23A 2NNAB 5FFGA 3BAIA 5GJSH 3VO0A 1JHLL 3P9LA 4FXKA 2P8LA 3RL2B 1PU0A 4L4VB 5D1QA 1AXIB 2D9QB 1E9QA 4DTGH 4YR6A 2HFTA 3L4CA 5E8PA 3SPCA 1IL1A 3B7TA 3DUHA 1T2JA 3VGAB 4K71C 1ZGLP 2HFFA 5ACZB 4ACTA 1XX9C 4DQOH 3X1BA 3MRFB 1T3FA 1ZMYA 1OVZA 1GY1A 3TWCH 1FBIH 1PFCA 5BV7L 5C09D 1F0LA 3CN1A 3EYFA 3IFOB 3HJ0A 5T1DH 4XVSH 4UNIA 2XN0A 3RWIB 5JOPE 5EU6A 4HS3A 3HA0A 5I8KH 4L4VD 3OHXB 4D9RE 3G08B 1OHQA 2BIMA 3JWNH 3BP5B 4PRPE 1QHPA 4LSRL 4YBLB 4YSRA 2PKDA 4EJ1C 5FO9B 2AKRB 1Q4NX 4LU5L 5GSVB 3SZ6A 5AQ0A 4GB9A 2AV1A 1P4UA 1ZCRA 2VH5H 1JGEA 1V8HA 3L4YA 1VSCA 2WIMA 3TCLA 1SMOA 3ZZQA 2B15A 4AIOA 4B0MB 3VFWB 3TPUA 3E6HB 4MKMA 3PWUB 1KBVA 1UCBL 2XIBA 3BN3B 1R33A 5DUBA 3FB7A 1L7TL 5F3HA 4WWID 4ETQB 3X14B 5GZND 3RVTD 1H3VA 3L4TA 3QFJA 3IF1B 4QXGH 3UTTB 4B3VA 2C8NA 4MX7B 4ZUWB 5HHOE 3EJUA 3H1ZA 1M9WA 5AZEH 1JZIA 1L5GB 3IK2A 1S7TA 3L95A 4XAKD 15C8H 1FN4B 1RUMH 1WZ1L 2IH8A 3L6FA 2XFXA 1BHGA 3A23A 1J9SA 4TULH 2Q87A 5JPMA 2O30A 1WT5C 1PKOA 3HHSB 5J5EA 5DZPA 1KGJA 2MCPH 4UB0L 3MBEC 2Z0BA 4AQAA 3HN3A 4JRXD 1OAYH 3BUIA 3C5JA 4KI5E 5KSVA 1XH2A 2EUWA 3LIZA 1ADQH 2DL9A 1B6DA 3RVXC 4YX2L 1KPUA 1MI5E 2Y2WA 1ZA6B 1JS4A 1KGWA 2E3VA 2QEJA 4X0KA 3UJJH 3Q2LA 5E95B 3CG8A 5IVXA 5DF0A 3P40A 3F85A 2JIXB 1TMCB 2KL6A 1S5IL 4C56D 5JQ6L 1LM8V 1G7IB 1IAIH 1TF4A 4IKJA 3VFTA 1FF5A 2K70A 2VE6B 5I0XA 1CS6A 1T1YB 5ANMB 1WO2A 3FT1A 5AW7B 3VG0H 4FX5A 4PGCA 5I0WA 4Y9CA 1F5WA 3GTNA 2FR4A 1XD1A 2GITA 3AAZB 1KTLB 2Q8AH 4WHDA 4GUPB 4PJ8C 3TTSA 4Z76B 1X5GA 3PGCA 2YAPA 4GAJL 4CJ1A 4FNSA 2K3HA 4D9QE 1A3RH 3DX0A 2M2DA 1PD1A 1YC8A 3W9DB 3W56A 3ZKXC 3KD4A 1DQDH 1Z3RA 3MBEB 4FQHB 4AMXA 1HC1A 1YYMH 4PY7B 1MCWW 1SQ2N 1E5UI 1CL7H 4HKXB 1W0WB 5B38G 3LS5H 1ZTXL 3GLDA 3DECA 2D7TL 3JWNE 4RFOL 3Q44A 4WWNA 3VWKA 2WYTA 1IEAA 3AQZA 5EN2A 5CZXD 5J3HC 3REVB 4D8PB 1MF2L 4LPTA 3ZE1E 4E2OA 2Y5TA 1HL4A 1YEGL 1O7DC 4GIOA 5T1LB 3QRGL 3DI2B 3GI8H 1KXHA 5C92A 4OFKA 5DLML 1QHOA 2BFVL 2FH6A 3HFML 4Y4HD 2HJFB 5SWSE 3KL0A 1TTCA 5KZCD 4TL5A 1I9IL 4R84A 4N3TA 1EAOA 3QG7L 4C57C 2WXOA 1ZHBB 4UNTA 3U9PL 2DQEH 1XDTT 3TZVB 3V5HB 2YEZB 3ROLB 1QRKA 2VERA 1I9RL 1UHVA 3MSPA 4TQIA 2O5ZL 4AI7A 4FNPA 3K46A 4PJ8B 1F41A 1MXDA 4G6JH 5E8NA 1JCKA 3JUZA 5A43C 1TU2A 1FSKC 5H4YA 3ZKXB 2NZ1A 1FDLH 2MJWA 4MD5B 2XWEA 4W9CC 3HUJF 5DVNA 1P4BL 2FHFA 2EUVA 2FQEA 1N68A 4KGJA 1JZGA 1T4KB 4NUPA 4DAGH 1G4RA 3D69A 3FQUA 3FCTA 4K2UL 1B4LA 3SO5A 5DR5H 3L4ZA 5CCHE 5HHVH 1AO7A 3RRQA 2DLFL 4MAYA 3TZVD 1P5UA 5E08L 3RIFK 4L8SA 2AJ3A 4PJDB 3PUUA 3LMJL 1AQ8A 2CO1A 5DJ8A 4TSCH 4HXAH 3IPEA 5G55A 1YG9A 3CJJA 3QH3A 4XMPL 3QFDB 4L1BA 1A6PA 1ND0A 4RNRB 1I8KA 4NP4L 1UD3A 5FEBA 4U7SA 5E6SB 1IQDA 1U21A 2P5WA 3GJFB 4BD4A 3CZUB 1QBLL 2EIJB 4KMTL 3RBGA 5SX5K 3QVAA 5JW5B 3GF8A 2CA4A 1F3JB 3BKML 3ZTEA 1KEGL 5EU7C 5J3HD 2Y25A 3EYSH 3L2MA 4LCYA 3WFBH 7FABH 1A4AA 1QACA 4PJIF 1FSKB 1SF5A 2EE3A 3QGVA 3TLRA 2CO6B 4HUWB 2EXTA 3P4LA 1KTDA 5F1KC 4BFOA 4ZOAA 3QIUC 3K2IA 1ZT1A 1KCLA 1JD9A 1XF3B 4CBPA 3KPRD 3SCMC 4MMXA 4MJ4A 3OGCA 5EFIB 4MNHB 5HHQB 1KJ2L 3JUYA 5FXCH 3S98A 1R19A 4XP5L 3NDYE 2YS4A 3HNVL 4JY5L 3H9SD 4PJBA 3PQYE 4NN5C 1R0AL 2XKSA 2A2QT 1MEXL 4RMQA 3TJPA 4B9PA 5J6HB 1WUNT 2AEQH 1DVUA 2XXMB 4FLHA 5DTFB 2XG4A 1RK1A 3VWJD 1GR7A 3AW5A 4TUJB 1PKQE 5ALBH 4Z23A 2MQ0A 3P4MB 4ZTEA 3UDWC 4GKNB 4M02A 2C9RA 2VISB 3ZHFA 2WKOA 3TF7C 1MAKA 2VDLH 1IBBA 1PNCA 25C8L 4JFPA 5HHNB 3U36A 4A38A 5EV7A 2X44D 4NZDA 1N8ZA 3BT2L 4AEIL 3BEWB 3QIUB 4EIGB 2NXYB 5IQNA 1NFKA 2I9TB 4QCIB 2F18A 3SCMB 2Q3ZA 2IXQA 4HS6B 4V2CB 3QIBA 2CKBL 2X0WA 4PBVC 1DCLA 2IGFL 3QO0B 3T8VA 4C4KT 1FHGA 3CDFA 3UTOA 3WMSA 2FT6A 4KX7A 1Y18B 2MKLC 3FFOA 3IJSA 2GSMB 3KL3A 3P2BA 4F7CB 2A1WL 3DO7B 4NN5B 4HIPA 1NUFA 4G6KH 4TF4A 5C0GB 1LP9B 1F90H 2K7PA 1YYLL 3FQNA 3QUML 4NKIH 4URKA 5FA3B 2VZOA 4OZGF 4YDNA 1JVOA 3AZUA 4ODTH 5DUPL 1UD6A 4KWUA 4BH7B 2JCCB 4JFFD 4OCXH 4X6DE 1NJ9B 5E56A 4E9XA 4JQXA 3QIUD 2BW4A 2NXYD 1WBYA 4WHYG 3EIFA 4GBXA 5GGTL 3TT3L 1PG7H 2BHFA 3SCMD 5CBEA 5F7UA 1MJ7H 2FB4H 2HX9A 1U3JA 5IIEA 4F20A 1NMAL 3MV7E 2G2NA 3BIBX 4R7DA 3I6KA 2D2OA 5EBWB 5EZJA 5I26A 2IALB 5TQ0L 4YXHH 3GSWA 4JFEB 3Q6FB 4WDIA 2ED6A 4UOQA 3G5WA 1CZ8H 4UQEA 1XCQA 1THCA 2IQAA 4OCSL 2OBGA 2WXIA 3FB6B 2AFNA 1FA4A 2VN3A 5T1MA 3VXUB 1A6TA 5IJDC 4OBSA 3S7GA 1FFTB 1THAA 1JI1A 3LSOB 4WU5B 5C97A 4HIXH 3V2AR 4J1UB 5IGXL 1HZLA 4QHPA 5C07B 4I2XE 1EK3A 2D7PA 2HJLA 2P3YA 3CFCH 4LDCA 3UERA 2CHWA 4P9HH 4PJFB 4JFED 3BUYB 3EYVB 3BWZA 5AFAA 2MIZA 1IX2A 3S36X 2CPCA 4QMEA 1P1ZA 4FF9A 3BEVB 3WUZA 1Z9SB 5BS0B 4LLUB 4QXTA 1JXDA 1U8MB 4WUUD 1J88A 3GXPA 3BQUD 4PLJD 3TIDB 4GI9A 2IOIA 5KYYA 3VXUD 3OAZH 3VD0A 2BP8A 2CRZA 4ZSOE 4RFEA 4XN2A 2DI9A 2H2PC 4UBDD 5D96C 3DROA 1G7HB 1HHHA 2Q3AA 5CSGA 5D7JA 2ICWJ 2DI8A 5DHVH 4NBZB 2MPAL 4FJ6A 3HFFA 1S9VB 4KZEH 4QRSA 5FYLL 4M3HA 3RIFF 2GC7C 1K4CB 2FSEA 3QUKA 2ZXQA 2XDHA 5DJ0B 4IKIA 4KXDA 2YKLH 1CK0H 3B5TA 3ERXA 3S36L 3OQRA 2QTVA 5DQ9B 1CGUA 5BS0D 1OSPH 5AD0A 1ORSA 2VM9A 5HVHC 4AEHL 1EJOH 5ICZA 2YPVA 1E8WA 4XC1L 3RFRA 2VYRE 4K94L 1OE2A 4OFYD 4YGAB 1F1DA 2EXYD 1G6VK 2WPGA 5CFHA 1OP3K 3L3IB 4DKFH 2IH9A 3U0PA 1N12A 1A14H 4P07A 1NC2B 2CIIB 3OPZH 4ES8A 1IKFL 3PL6A 1AD9A 4NAJA 3ILQD 1XGZA 4NKMA 3FUEA 3LD8C 1WITA 4HHAB 4HP5A 3PWVB 1A6UL 4HXBL 4FQLL 3R19A 2OL3H 1RKRA 4ODSL 4XN9A 4E9LA 5K9JL 4H8WC 4LFHG 5T3ZH 3O3DA 5C9JA 3VNZA 5D96B 1NA8A 1TR7A 3ARFA 3N0PB 2JJTC 2BZDA 4MA3B 4P57B 4ZNCD 1BM7A 3NT0A 4GMTL 1H0DA 3NSJA 1F97A 3ESNA 2OYPA 1MPAL 3B9KA 4UT6H 1DBBH 1U3ZA 4OF5A 5CEYA 1WBZA 4AYFA 2G2RB 4IRSA 2EDWA 2E56A 5JNYA 3GKWL 4HV8A 1UH3A 2A9BA 5C0CD 4I1RA 2G5BB 4R3SB 5IFHL 4QRRD 2TSAA 2Y72A 1X5YA 2BOBB 3ZTDC 5HVHB 4HK3J 2QLYA 1NFDA 4F24A 1JIBA 3WJMA 3MRCB 3I3DA 5G5DA 5F8QC 4PJ9A 4PRHB 2B59A 1A66A 1U8KB 4FZ8H 1XR8A 5H35A 2RA1A 3LY6A 2UV3A 4EIBA 4GH7B 5HHPB 1LEIA 3AT8A 4NUGL 4DK6A 1LE5A 3BMVA 3DX9A 1A7QH 3BZDA 3K6NA 1DUZA 3HNSL 4HJJL 1CGVA 5C0DA 3LD8B 1CFQB 5HYJB 4AM0B 4JFTA 4HFWA 4XCCH 1YEWA 1F1GA 3QQDB 1DQLL 3FRPA 2WB1A 3JTTA 4PCYA 1FZKB 4P46C 2F2HA 4M62L 3MRJA 2IPKA 3B1UA 4P49A 3ATDA 4JQVC 3U48A 2QQNH 1FZMA 2A0LC 1HINH 1YPZA 2K8QA 5FUZH 4XI5C 4PRHD 3RILA 2GTZA 4ZX3A 1QSFA 4NO0A 3CDYA 1V3KA 1DO6A 1R34A 2LE9A 4EF3A 1D5XB 2ZUUA 2ORBH 3D39E 4LMQI 3FDWA 4MNQE 2X4SA 5CLZA 3KS0J 3ZLQC 2BIHA 2XCMC 3FU0A 1X4ZA 1AZUA 2Y7QA 5J7CC 3LZLA 1TVHB 3MLUH 1K5WA 5T33H 2PYFB 2GC4C 3L7FA 3MFFA 3VYNA 1U4FA 1I53A 4RETB 2ZCHH 4R5VA 1YY9D 1NDMB 2HWZL 4J4PD 5FHBL 3WCYA 3GIVB 4NHCH 2VN7A 2X4PB 2BVYA 4NPYB 3DGDA 2DW5A 5TE6L 2R2EA 3KBEA 1RULH 1XB8A 1I8AA 2IDQA 5K9KA 2R7EB 5JW4R 1CXHA 4R6UA 2QKSA 2WQWA 3DIFA 5H37A 4MCYA 5L7XL 2ZKYA 1SMAA 3B9EA 4JPKH 3K81A 4WW2A 2J8UE 4P46B 3H56A 4HCRL 1TKWB 3LN4A 4AQ1C 4Z7QF 4DFIA 1I85A 2HT3D 4NQEE 5T3ZE 5DQDL 2Z8WC 3CXHK 4OLEA 5J11C 5FW6A 3NSYA 2NX5E 3V0JA 3CZGA 1JFQH 4LRIA 1A6VL 3FT4B 2VW4A 5EIIB 3HI1B 4A2GA 4KKLD 4DKEH 2K4WA 5AZ2H 3NJKA 5B1KA 1NEUA 2FLBT 2PTTB 4PR5B 3TO4D 4QRTB 1UM5L 1TTAA 2BJML 1A21A 3BE1L 3OZKA 5DI8A 1E7UA 4KK6D 2BSBA 4MHHI 4RMSA 3SPGA 4CMHC 5EUOA 2VXUL 4N8VA 4Y19B 2V7NB 4ELDA 2FZ3A 4JZOA 3LN9A 1LO3L 4DP2X 5BQ7A 2XT1B 1ZRUA 4Y2OA 1VEMA 4LASL 3US9A 2H6OA 1V7MH 2C9PA 1P7QD 2NW2A 4A68A 4MDJA 5GGUB 4XI5D 5I5JA 2RGSA 2YN3A 3HIZA 1M7IA 3HG2A 3GS4A 4Q9QL 5D7LD 4OGYH 3B3BA 4N0YL 4WK4B 4RRPM 5CFAA 3CVHB 1FO0L 5K59F 1FZJA 4Z7UA 3S9DB 3BW9B 2DQGH 1IAIM 3M8OL 3BD5A 4AQ1B 4OJAA 1E5CA 1R3JA 3BESR 1CDUA 5G4MA 5J11B 4Y19D 3B1TA 2FECI 2ILLA 2DEWX 5D2LF 5BRZA 4OKDA 3BKJH 2XKUA 3E3QE 3IU3B 2Z92B 4FQIH 1DVFC 5J1AA 3HZYB 1IO4C 4FNQA 4YFEA 1FV1A 2IANB 4JRLA 4QF1B 2OW7A 1OGTB 2L0DA 2ADIA 2W94A 5F44A 2CCLA 1QRNE 1AZCA 4MQ7A 5CS7A 2H47C 1T04B 1ZHLA 3ZL4H 1S7UB 2YFOA 1TCMA 2KH2B 4XCNB 1EDQA 1JXFA 2ICEA 4KK9C 4H4NA 4L23A 2XHNA 4JGMA 4JY6A 4UOJA 2BSEA 5I8EB 4FQQA 1YA5A 4UMSA 5GISH 3NABL 2VQ1A 3BSHA 3B2DC 1IGJA 3TBVB 1E27A 5KVFL 4Z7QB 3DSNB 1U9KA 1U93B 1MCSA 3H0TA 4WFGE 2X6VA 2MQ3A 4HU2A 4OD3H 1PLAA 4LCCA 4MA1C 2ZUSA 2IAND 3P0VH 4OM0H 5FS5A 1QKZH 1G6RB 3B34A 3CXDL 1AFVH 4ZNEE 1S7VB 3U9UB 5DVKA 1REIA 4JAMA 2WUCL 4X6CE 1NMBH 2XV3A 4E5XG 5C8JA 4EZLA 5KSBA 1TSHA 3CN0A 1CLYL 1DUYB 3QA3A 1ITBB 4PJXB 1H3WM 2CDFB 1DVFB 2P1YA 2WINA 3QPXL 4WV1A 4E9VA 4JKNA 4UM9A 2AJSH 4LGPB 5I5MA 4NO5A 3II3A 3QQXA 4ZMZA 4PRIA 5E2UH 1NCNA 3DXAD 1SOQA 2VIRA 3ZDXE 4MMZC 3OB0K 5E4OA 3UZEC 4F8NA 2XVKA 5GS0H 3LNHA 3CFTA 1WLHA 4LKCB 1J5HA 1OWWA 2VAJA 4JN2A 2OK0L 2WLHA 4R4NC 1SJEA 2O5XH 4FNUA 1GYWA 3NEEA 1KZQA 1J05A 2APVA 2HA1A 5EOCH 4U6XB 3CZKA 2M83A 3IDMA 2YAQA 1MCRA 2FJUB 1JGDB 4JO1L 4X5QA 1JZ2A 3NH7H 3HN8A 3PV7A 4LSTH 4BDVB 4DO5A 3M1BB 1DVFD 2VSKB 3LZPA 3MJ9H 5KS9B 2ZUWA 3G9AB 4HBCL 3VDAA 5CIPA 1W2KT 5I8OH 1N70A 4MA1B 4UTBL 2YD1A 1KN2H 3FOMA 4XP9L 3KJ6H 5BO1H 2BVPA 4XCFL 2X10A 1XGQB 4M93B 2BW5A 1OP5K 3X17A 4AQ8C 4PWFA 2PABA 4LESA 2CRIA 2FX8L 4OIFA 3O6KH 3U4AA 4Q7DA 2IOMA 3SN6N 4R4BA 3RAJH 5DC0A 5LXGL 1KLFA 2H45A 4FXKC 1VJSA 2BDNH 1E42A 5D1QC 1YEHL 2Y3NA 2DQCH 3K6SA 5CSZB 2NSMA 1HYRC 2PPEA 2A6KA 3V0HA 1NIEA 4HLZH 3FQXB 4MMZB 1TCRA 4APQB 4K7FB 2P8MA 4L1TA 5DEFA 1B4JH 1P6WA 5EC2B 2Y7MA 1CXKA 1OM3L 4L9LA 1OQXA 3S3PA 1O7SA 1RK7A 2R0WH 3JWNG 4OCMC 2BX5A 2DMBA 4Y8DC 5J6SA 1UVQB 1OF0A 2ADGA 1XTMA 1FNGA 1TJGH 4X99A 3CFEA 3CQPA 3ECVA 5LDUA 4UQDA 3FUKA 1KGUA 3ZYOA 3AU1A 1SJVA 1JMXA 1B3JA 5KANI 5IOKA 3DETC 3VI4B 1OAUL 4X4ZA 3HCVB 4NNPL 1N5YH 4OV5A 1GZQA 4JR9L 2I7OA 5FO2A 3VXPB 2H1PH 5K9OB 3K3QA 2OZNA 1EHAA 1IC5H 3OBAA 4Q9CA 3NACL 4F80A 3W81A 2UXFA 1J9RA 3MFGB 1HSAB 4YDKL 4Q56A 3FU9A 4APQD 5EZLA 1GGUA 1FFPA 1VA9A 4FABH 2VN5A 2DWEA 4LIQH 1SEQL 2G3ZA 4JVWA 4X9IA 3LQAL 2X4TB 2LLNA 4NO2B 5K39B 3RUGA 4IMLA 4BCXA 2TAAA 4EQ3A 3QJZA 2WSPA 4FXKB 5E00A 2P8LB 3ZRSA 5D1QB 2NUPA 5FF6A 5CINH 2VLRE 2CNYA 4G5AA 1E9QB 3MCLH 4ALAC 5KWYC 4M29A 4CU8A 3PP3K 1MCNA 3K91A 4M7LL 1IL1B 1AP2A 2A9ML 2FO8A 4QIRA 1RZFH 4QHLB 2HFFB 2G3MA 9CGTA 5F9WC 4AW7A 5B39G 1EGJA 5DT1L 1G9NH 1HQRA 5FDWA 4JKPH 5BMFL 1YY8A 1DSWA 1I1RA 4YXKL 1AR1D 2X6BA 3FH7A 1XCWA 1HKLH 4KO7A 5TGBB 3K74B 3MRQB 3JTBA 3EYFB 1D6VH 5JPMC 1G0YR 1T1WB 2LQRA 3NCYS 5EU6B 1IGIH 5AW0B 1CDHA 3SPVA 5DGQA 5JMOC 1MJ8H 4L0PB 3RL1A 3DJZA 3QNZB 3X12A 5GS3A 1VPOH 4O02L 4ZOEA 4JLRA 1PBYA 5IFJA 1K3ZA 4RRPG 5CCKH 1RUQL 3PGFH 1N6QL 4ADIA 2EVIA 1FAIL 3DIVA 4XNYL 8FABA 5KTEL 4X4KA 4D7PA 4Z7OF 4J3BA 4MJ5A 3B6SB 5FC9A 3U1QA 4AK2A 3TCLB 2DZEA 4WI2A 1MFBL 5C0BE 3UBXI 4RMBA 2DQHH 4M56A 3TPUB 5KYNA 1SVZA 1KFAL 1JWSA 1NCWH 1GIGL 4U1KA 3IMTA 4LPUA 3L4WA 2ZWSA 1HXYA 3EG9A 2KZ1B 4G6MH 4IBYA 2DEXX 3OKYA 1IKNA 3KLQA 3DETD 1RZKC 2MTPA 3KWVA 4DGIL 3V9FA 1CXLA 3QFJB 3HBGA 5C0AE 3OTTA 3QZPA 5DLLA 5F9WB 2VERN 4K3JH 5C2BL 2Q3XA 3THMH 3WU1A 2DQIL 3V4VH 1MHPL 1UWYA 1S7TB 3L95B 3UAJA 4KRPC 4I3SL 1NFIA 1MCFA 3L6FB 5EC1A 2XFXB 4S1SH 2RJMA 4J5VA 4EN3C 3EBAA 1PD0A 1RZIB 5JPMB 5F0MB 3NYKA 3FT9A 4EI0A 4NOFA 4RDQG 4FTVB 4CA4A 3CFIC 3V0AC 1NUDA 1NCBL 3MR9B 3HE6D 4L3EA 4F92B 2A6DB 2DYSB 1W72A 5KSVB 4OTXL 4M8RA 2IMMA 2EXSA 4XVOA 2IFFH 3CBRA 3VWKC 2QGEA 4FQ2H 1SXSA 3L3HB 4ZMLA 1KPUB 3V8CA 5F7WC 4AE1A 4ZZKA 3ZE2B 4M6NH 1NAMH 1WWCA 2UVEA 3V7AE 1ECYA 4LIQE 5IHWA 1L9PA 4OF3A 5IVXB 1XCTB 1KYDA 3OKNA 1ZVHA 4G7YL 4KRLB 3B7YA 4XXDA 1FLRL 4U1JB 5HY9A 5F1SA 3BGAA 3C75A 3A24A 1KULA 5DEZA 4FTVD 2XACC 3VFTB 5DEGA 1ADQA 2DJUA 4A7VA 3FSAA 3BWAA 4ODHH 2GJZA 2YZ8A 4NQCA 4OJYA 4U6YA 4PGCB 1S7XA 1E2VA 2FH8A 2V17H 1YMMA 4KRPB 3FHEA 1KLGA 2FK9A 2GITB 4LPCA 2IPUK 2OLDA 4DZBB 4EN3B 2UWEA 1KTKE 2PCFA 5CLTA 2HKAA 4F9LA 1X4XA 2UY6B 1TQUA 2DWTA 2HZHA 3NZHL 1JYNA 2VAAB 1MSPA 4B41A 1IGYB 1JOIA 1GS6X 4POZC 2YGPA 4XVTH 2WQAA 3QCVH 4ZO8A 1T22B 1NL0H 1SEBB 4MJIA 4UQBA 1IFRA 2PR4H 1ZAGA 2DQJH 3IJ9A 4PJAF 4DQOL 1HKFA 1M05A 4RMWA 4OCRL 5HPMA 3VWKB 1L9MA 3H7LA 1IEAB 3TWCL 1U8QB 1VKXA 4HG4K 3F7QA 4MAYC 4XVSL 2OMVA 3WNIA 2BMKA 1OTTC 1P5UC 4WFFD 3EGXA 4ZO6A 1RK0A 4KRPD 1BOGA 2JV6A 2ZG3A 4HJGA 4KHTH 4EN3D 2DB8A 4BYHA 5C0JB 3NIFB 2YGNA 1O9VA 4K3HA 1DZ0A 4PJGA 4PJBF 4BFNA 3AG2B 1UA6H 1OZUA 2WOYA 1WGVA 4ENZA 2ZOLA 4UTAL 1MIEH 1RUAH 4CSTA 4IOFC 1BIIB 1SN2A 4TKWA 1N64H 2DTSA 5EBLA 3FO9B 3MUGA 5ICXA 2ATKA 4NBYB 5EU3A 5HGBA 5I71C 2WV3A 4QXUH 1TU2B 3OXSA 3U7YH 2EIEA 1BZOA 3L5XL 3WN5B 2LHAA 4FL4C 1K2DA 2XPGA 4ZPVA 4WTZA 2O6CA 2HLEB 5HHME 2V7HA 1F6FB 4QXGL 3D69B 3FQUB 3FCTB 5MEND 1IM9D 2FEEI 2K6ZA 4MMXC 5A3IC 5JIIA 3HI5L 1RD6A 4PTUA 15C8L 4G8GB 4YLQT 4JGJA 1PYWA 2HX8A 4TULL 4UV7H 5E7FA 5F1NA 4MAYB 1KF9B 1P5UB 1QSEB 2VRKA 3KWUA 3WJJA 2AAAA 3C60D 2EYRA 2ZD0A 5DJ8B 2YZ1A 3KXFE 4PJHE 1TUPA 1NEZB 1X7SA 1HJBC 3AXLA 1OAYL 3FTUA 4CGTA 1ND0B 1UA7A 3FT0A 1EJ8A 1I8KB 3LKQA 4M7ZC 5GGQL 4QJ4B 2W9LA 5E6YA 3VD7A 5L8KB 4MNGE 1IQDB 2FGZA 4KJPC 2B7DT 2P5WB 1QG3A 4G9DB 4HKJA 4QI3A 4C8XA 2APFA 4FAAB 4XP6L 2JQMA 1RHHA 4KH2A 5ISZA 4JS7A 1CB4A 1DVZA 3APFA 4WI6A 3UJJL 1A4KB 5FAAA 4OFVA 4ZMXA 1JK9B 3PFQA 4G8GD 1Q1PA 3QDME 4K7PH 4OT1H 5E9DA 5I71B 5IBLC 4KY2A 4WFHE 4BKTC 1QSED 4FL4B 3I9AA 4FFYA 1I3UA 4MRBA 3Q5OA 1KTDB 1MZYA 4JK0D 1ZT1B 3RWCA 1ASQA 3UO1H 3VAEA 3RVUC 3BDYH 5I1DA 1E40A 4N2IA 5LCVA 3TGXA 3VG0L 2AEPH 5F96H 2VN4A 1J5DA 3QIBC 4MMXB 1PZDA 4X4ME 3QDAA 2P5WD 2FQDA 3PWJB 4JDVA 3WFHA 3V6FA 4OQTA 2RHEA 2NY3C 3O4LD 4LCVA 4KZEL 3T6XA 2BXZA 4Z5RA 1BMZA 1HCFX 3F7LA 2IWGA 4CSSA 1DQDL 1LO0L 1YYML 3TO2A 1JPTL 2Y36H 2AXJA 2D31B 4KKBC 4S2SA 2ZCLH 3LS5L 4M7ZB 3VXRD 1TXKA 1O0VA 2X88A 3OR7A 4JQXC 1UEYA 4S1DD 4GBXC 2DLGA 1UJTA 5BZWA 2P8PA 4WI5A 2FNWA 1IC0A 4QJ5B 3CSTA 4OCWH 2ZYHA 3VYPA 3R0MA 5FUOH 3U2JA 3U36B 4DN3H 4JFPB 2BM3A 3TYFA 4YUEL 4AGPA 1N8ZB 1OT4A 4NT6A 1QA9A 3FSZA 3T2QA 5EU5A 4Z7VA 4H88H 4LPWA 4ZAKD 3TA3A 5KBMA 5J89A 2V3EA 3N91A 3F83A 3KPSB 4DEWA 3QIBB 2Y1VA 2EACA 2ZAHA 2X2JA 4KJPD 1XSIA 5DJZA 1G9EA 1RL1A 1YEIH 4UUJB 1W0VA 3D7PA 4G6JL 5DHXB 3VU1A 1KB5A 4OCLC 3IJSB 2F53A 2V9QA 2NY3B 2B1AL 4NUQA 5TDOA 3AT0A 1FDLL 1BWMA 1G1OA 2E6PA 2B4CH 1I4FA 2VSCA 5IBLD 3LXAA 4NGHH 3VFPB 4K8RC 3GMRA 2CJUH 4DAGL 5I17A 2PCXA 2VDMB 4JFVA 2WTRA 3ORJA 3GJFK 2J4WH 2VLKA 4AL8C 5BXFA 3HPJB 3H6JA 1WBYB 3ESPA 3IFPA 1MCDA 4GBXB 5HHVL 1EH9A 1UOKA 2KMWA 3KPSD 4X42A 5CBEB 3VRLE 1T6WA 1WRFA 4RZCA 5EBMA 1ET8A 2YSSA 3U2SA 2AJXH 5HBBA 5TE7L 5C3LD 3NJGA 4R7DB 2ITEA 4QTFA 3I6KB 1I3GL 5EZJB 2O6PA 4PLKC 4KROC 4G6AC 4F7EA 2YD2A 4KQ3H 4OBRA 2XTJD 2D3NA 3ILPA 5D7JC 5D1XA 2QZQA 2CUIA 1XCQB 1IEHA 4YBHA 2IQAB 2PXYD 4XPAH 1IBZA 4KKBD 4UQ3A 5CHNA 4D94A 1FGNL 1YQ2A 2ZX5A 1MFCH 1CTMA 3GLAA 3GFUA 2ZUQC 1LL1A 5T1MB 1E8ZA 2KLSA 4NX0A 2KUTA 1A6TB 3HAEA 4QHNA 3UGEA 4KZDH 2W9DL 5B3JE 5LWYH 4ZX5A 5IB4A 4POYA 1HWWA 3HI6H 4P9MH 5F3BA 1BVKA 5IVOA 4MLSA 2HJLB 3V0EA 4BIKA 2OSXA 4W6XB 4LXFA 1NFDF 1U8JA 1LO2H 4X9GA 4NQSA 4NZFA 1JHKH 1P1ZB 5KBPA 3GDBA 1C16B 3BP6A 1RHFA 1S9WB 3PL6C 4QXTB 1KZYA 2VABA 4BKSC 2X40A 3JTSB 1UH4A 4LEXL 5J57B 3LX9A 3T2OA 5F0PB 5F1OB 5BOJA 3IVKA 3TEYA 1OCOB 4HFUH 2PUQT 4KROB 1D6EB 3G5XA 4GLRI 1HHHB 3MMEA 3AT9A 3ARFC 3NJNA 3QJHB 5D7JB 1EEUA 6FABH 2CPUA 1TTUA 2P48B 4YSOA 4E41A 4JO2H 4A2LA 4QRSB 4APXA 5ALBL 1KCWA 3FJTA 2XV0A 3B9KC 4OLYH 3IDJA 4AJYV 2FSEB 2HVBA 3MTRA 3QUKB 4Z0BL 3ULAB 4IRSC 1NTDA 1G5AA 3BRDA 2YQBA 2ZUQB 1Z9MA 2VDNB 3PNRB 2VDLL 3AVEA 5HJBA 4MZ2A 4PIBA 2NY2D 3RHWK 2G2PA 3UTPE 5AD0B 3QR2A 1ORSB 1XWVA 2I07A 1X9QA 5CO1A 5ICZB 4JG0H 4GXVL 3G6JE 4PJ9C 1PG7X 4JPWL 3VW3H 3ZOAA 4CU6A 1OPOA 4KK5C 5D7JD 3GKZA 1FL6A 4LPXA 1ASOA 3ARPA 1NUGA 4PBXA 3U0PB 2WVTA 4PU2A 5D55A 4M6OH 2CU9A 2UYLA 4YH6A 3PL6B 1AANA 3MRBA 4NKMB 1DQQA 1F90L 1UACH 4RLDA 3MBXH 2GHZA 3UYRL 5C9JB 4N1HB 3X3GH 1RU9L 3DX3A 4BFJA 3ARFB 1OAQH 3TBBA 1MQ8A 3BH8A 3VI3E 4H0HB 2WLZA 3O2VH 3QJXA 2ZP9A 1NFAA 4Q4EA 4PY8J 4P99A 3B9KB 4QOKA 3NK3A 1PG7L 4WW2F 4OZIE 4KKRA 1WBZB 4AYFB 4IRSB 1EEYA 1MJ7L 4HV8B 1DJXA 2H2SC 5CGBA 4E36A 4G5ZL 5HDOA 4N0FB 3ZKNC 4RMRA 4QGYA 4YL9A 3VFSB 3TC9A 2X6MA 3H2PA 4NB7A 4QRQB 4G71B 4YXHL 2LU3A 3D52A 3WJMB 4CC1A 3BXNB 1EPFA 1QYGL 2J55A 5G5DB 4B3EA 3LNIA 2DJ4A 2PLTA 4LCWA 4PJ9B 2MNJB 1XR8B 5H35B 4TSAH 4R97C 3OR6A 1F2QA 1V7NH 4YHYC 4IM8A 4U6VL 5L2KE 2G30A 4YEEA 1G1YA 1LE5B 3ZU8A 5EUOF 3KZ8A 3B9KD 2Z8RA 4E42A 2FEDC 4A7GF 1DUZB 1ILSA 2KBGA 3U30C 5LGHH 4DERA 3CNKA 1T83A 1HCZA 2N7SA 5GGRA 4OUOA 3TEXA 4DCQA 3FRPB 3JTTB 1O6TA 3LS4H 1NMCC 3MRJB 3P1VA 2X2HA 5HGAA 1VLXA 2ID5A 4P9HL 1GH7A 1I85C 4R5XA 1FZMB 4HOZA 4MAUH 3MLTA 2OZ4L 1YPZB 4IBVA 4J23A 1JV5A 1IIIA 1QFOA 3MJ6A 2OJ1A 1QSFB 1BAGA 2WMPB 4GO9A 4KUZL 4NO0B 4XP1L 3T09A 4BFGA 5MEOA 2GY7B 1NBZA 3NEXA 4LRIC 1B3IA 2NR6A 4CILA 1U91A 2DD8H 1SFHA 2DYPA 2X4SB 3T65B 2WB7A 1YN6A 3LRGA 4U1GC 4GSUA 3BT0A 2B3RA 3HBZA 5CP3H 1EJFA 1GAFH 4J8QA 1LWJA 1NAKL 1MCCA 4I48B 2IEPA 3FB5A 1PEZA 4KV5E 4L1DA 3WGVB 2X1WL 1S6NA 3CZLA 5GS1A 5IEKB 1JZ6A 4OGQC 2OI9C 3L7FB 3MFFB 1K8DB 4F58H 2YMOA 2DN7A 4R97B 5I1IL 4XB8A 4AZUA 4YHYB 4G42A 3SKNA 1NSNL 2YKLL 1OO2A 3D4YA 3O3BB 4DWHA 3NJIA 3WO3B 3L4UA 4U0QB 4S1RL 4UTCA 1MH5A 5JMRA 1KJ2A 1XF4A 4FG6D 3PV6A 1VGKA 1OSPL 1SM3H 2R2EB 3U30B 1GJIA 3D85B 1J0ZA 4IQHA 5BVPH 5M94B 1IMHC 3K8MA 3WKMH 1NUNB 1EJOL 1OAJA 4MCYB 5D1ZA 2E7DA 2W88A 1JGLL 1NMCB 1W8NA 2VR4A 2CALA 3LVTA 1T20A 3CMOH 4GAGH 4BHUI 3KLHC 4LSUH 2FUQA 1ZVSA 1G0XA 4RA0C 3KR3L 1N2RA 1QFWH 2O6DA 5JHBA 1A14L 1MG3C 3PABA 1ODAA 5F71A 2Q10A 1EFQA 2H32H 1AR2A 3LV3A 4LLAA 1I3VA 3ES6A 2FEDD 3JWOC 4YXLL 5IMKB 4U1GB 4HQQL 1JZ7A 3GTTA 1OT1A 3H7BA 3D85D 5DI8B 3D6GA 3PDOA 2NY6D 2OI9B 3MYJB 1XV8A 1RAMA 2FZ3B 2ESVA 32C2A 4JZOB 4AXWA 1F56A 1B9KA 2ICEC 2QDWA 4Y2OB 3E1ZA 1HHKA 4MDJB 3RQ3A 4IJTA 4D7BA 1RY7B 2C1PA 3ZUNC 1M7IB 1MIML 3MOAH 1TQSA 1UM6H 5D7SL 1YNKL 1J5IA 4LCCC 3SDXE 3KLAB 4I89A 1Z1WA 4Z7UB 4ZMTA 2ZSVA 5LNDA 5DO2C 3MRKA 3RZCC 3WLBB 1KCKA 1KELL 3DV6A 1ES0A 2HTLC 4RAHA 3FQRA 4U33A 1A7QL 3D2UB 5GSRA 5KJ4A 1YEJL 3UJTL 5J1AB 3MOBL 5FKAA 2CO3A 3QZWG 2R9HC 1FV1B 2HYMA 1P84K 4XCCL 2Q7YA 1BF2A 2OULB 4FNTA 4G8FA 2VM4A 5IESH 2IJ0C 2KS0A 2ADIB 1YN7A 2ENPA 2OAAA 2VDKH 4XO9A 4EI5A 5IR1A 2QQNL 4MQ7B 5DRXB 1HINL 3E6FA 3WFDL 4XWGH 2OS7A 1F00I 4H40A 2VWEE 4AKPA 2ICEB 3KLHD 1U8LA 1T89A 4GRWF 5GRUL 2ICWA 1FAKT 1Q0XH 3K72A 4FQQB 2GJJA 3ZUCA 1CJYA 3O3AA 4M03A 2ORBL 2VQ1B 5IBTL 5EN3A 1IGJB 2ZCZA 1E27B 2DMCA 3RWHB 3D2UD 4EAEA 2J5WA 4BK8A 5FGSA 2WXRA 4ZTOH 1AC6A 1FYTA 4HGMA 3H0TB 5ESQB 3GS7A 4LCCB 4PWGA 4ZI8A 3ARTA 4RH4A 4LAQH 4JHVA 2BY3A 1BM3H 4YWGH 5IVNA 3TBSA 3WTUA 2ZAIA 4AE0A 3GHBH 4JAMB 3RZCB 1AXTH 1KLUA 2YGVA 4HLZG 4KQ4H 3HG1B 5KSBB 3QWRD 4PGEB 1MCPH 3LRSA 3QA3B 4NHCL 3TJHD 2EDKA 1N7MH 4NCC2 3BMWA 3O0RH 1JSYA 5EO1B 2APWA 4W4OC 1ROCA 4PRIB 1K72A 5LGJB 2VIRB 4BELD 3RUGF 4M61A 1KXQA 2H0FA 2V5SA 4JN2B 3LXUX 4L9LC 1SJEB 2J8HA 2JQAA 4BGLA 2CO7B 4ERSL 5DVPA 1MWAB 3GSNL 3RZCD 1J05B 1JFQL 4E0RA 1ZVNA 4AYBA 2HTLD 2KC0A 2YBRA 3LRLA 1JHTB 5E1AB 3HG1D 3IDMB 3V7AG 4DKEL 5E6UB 3VD9A 4OFQA 4XVUD 2DLIA 4LQFH 2C3HA 2J2ZA 5CIPB 2HFGH 2A6IB 1H8SA 1HHIB 3R18A 5C0IA 3A6BH 4HLJA 2DI7A 4JM2D 5BPPA 3ZTCC 2FIKA 5E7BA 3N43F 3FT2A 3T3PF 1NPNA 3KYKH 4TQHA 4ILDA 3KYNB 4J8RA 2NTFA 1JZ5A 3KVDD 4R4BB 2Y6SD 1DR9A 3NIDF 1CDIA 1D9KA 1KLFB 4AVJA 3ZHDA 4M3KB 1NZRA 3K6SB 4JHUA 5BRPA 4NM4L 2HJKA 1F8TH 2PPDA 4NNYB 1WF5A 3UMNA 3FO1A 3ZYIA 1UZ8B 1IFHL 1TO5A 1A2YA 2P8MB 3JVFC 4L4TA 1GGCH 2C1OA 2GI0A 2IDCA 2ITCA 1FNHA 3O2DH 4R7NA 2L7UA 2EINB 5T5FL 4Y1AA 1OCWL 3ULVL 4L9LB 2H0JA 1M56B 3KPOB 3ZGHA 5DURD 4NXKA 4ONOA 5E4EC 5JOPD 2R8SH 2IFGA 2ADGB 2F7QA 4HU8A 4Y5VA 4BZ1A 5ID1A 5B1AB 4WY7H 2YQGA 5CCGE 4D9RD 2ZX7A 3TN0C 1OB1A 3BPCA 3D2TA 5C7ZA 4PRPD 2OMZA 3KPLA 3NTCH 4XMXA 4OV5B 3G5YA 5T1KA 1GOHA 3GGWA 5T1JA 5K9QI 2WAHA 2HKFL 1TZGH 2IADA 4R2GC 3L1OL 2QDVA 1YEFL 3NSFA 3QDGA 5EZLB 1FFPB 3HC4H 3LPPA 5JHLH 5GISL 3RU8H 4AYDC 2QHRL 1IEBB 2BOCA 5E00B 1T21A 2I9LA 1T1XA 3PYCA 2NUPB 2WXLA 4OD3L 4OM0L 3P0VL 3VXOA 2J57A 4Y9EA 4ZMVA 1QKZL 1Z66A 2E76C 1MI5B 1N3NB 1SJHA 3TVMA 5L6YL 4HUXA 3MX0B 5HHOD 5I73C 3VE0A 2K78A 4N68A 4WHTB 5HYEA 1JXJA 4ZFGH 2Q86A 2APXA 1HQRB 5BVJA 1YY8B 3REWB 3RNQA 1SXAA 3GSVA 1B0RA 5E4EB 3UAJC 4YVUA 4LEOA 2NSQA 4XAWL 2VSDA 4GI8A 3UTTE 4EVNB 4IDJH 3EH5B 1XAUA 2DM2A 2OCFD 5BJTA 3SPVB 2XBZA 1V10A 4DZ8A 3TN0B 3QI9D 3RL1B 4ZS7H 3X12B 5DD5H 3UPCA 4JFUA 5BNXD 2HLFC 2NZ9C 5D5MA 4R2GB 2O5XL 4DP4X 1MI5D 4C58B 1WICA 2EDJA 4H1LH 3V4PH 1IE5A 5JHMA 2R4RL 2ZPKH 2MCMA 3U4EA 4M5TA 4BWUA 4E9QA 5KVDL 4NQTA 3MJ9L 4U1KB 3MA9L 1BYPA 3H4FA 4O2FA 3S4SG 3ZMEA 5I8OL 4HWUA 2E4FA 3PU7A 4DHLA 5J1TC 2XYCA 3KJ6L 4WWKA 5BO1L 3TN0D 5JZ7D 4JDZB 4GW1A 3ZE1B 4OIIL 4GLRH 2GSGB 4ZO7A 2NW3A 5I73B 2EDBA 2D0HA 4HCRA 5D4QA 1PX4A 3HMXH 4U31A 5AWNH 1AHWA 5KSAB 5LG6A 1W9XA 1ITCA 1F2XK 3SDDA 3RAJL 1NFIB 4PJGF 5EC1B 5SWSB 4D9QD 2JLPA 4GRLA 2X05A 2DQCL 5ANME 4BINA 4CVXA 5I24A 1U92A 3DUUA 3I02B 1K4DA 4F9LC 3GNMH 1BG1A 4JO4H 3O8XC 3QJFB 1I1FB 2QQKL 1W72B 3RJDA 2ZXEB 3V4VA 2FYVA 2R1YB 1Q0YL 3CBKB 4MA8H 2WHVA 1EMTH 5F7AA 2OYLA 3DPDA 3U0TA 1MN4A 2E8ZA 4WO4A 4YSDA 5KSAD 3F7KA 4X9BA 2KDGA 3P69A 3PF2A 4Z9KB 1CXIA 3QJTB 1UJ3A 1MNNA 1DBAH 5SWSD 1C5DA 4Y7OC 1SGKA 1N5YL 5CMAB 3ABGA 4L2YA 4XXDB 3TBYB 5IHBA 5HY9B 5F7HA 3JZYA 2CK2A 3GMLA 3IDYC 4DUVA 3KMDA 4AC4A 4N9GA 3QUXC 3CQQA 5DK0B 4FABL 2GJZB 4NQCB 4PRBA 3LPWA 5FA4A 2NZ9D 4WI0A 3V79C 4XOBA 2JFCA 2XA8H 4YMPA 3TJEL 1S7XB 5BV7B 5EA0L 1YMMB 1KJMA 1KJ3H 1KLGB 2RAMA 4ZDHB 4HJUA 2QQLL 1F6LL 2UWEB 4KAQH 4Z77A 4G1MA 4AX3A 4EUPH 1MQKL 4P2RA 4N2GA 2XXGA 1T5XA 4EO5A 2KDYA 4LSSH 2E27H 3O8XB 2O4EA 2P80A 1TQBC 4PMEA 2N1KA 3MGTA 5E8OA 2R83A 4MJIB 1YEDB 1MDTA 5HYSG 2Y1YA 2WN3A 4JKPL 2WYHA 1M05B 4I87A 1Z9LA 5HPMB 1UOVA 2GTQA 2WVVA 4HAGA 4A6YL 2OXHA 4RWYL 2O93L 1VKXB 4UAOC 1OKEA 2J71A 3W38A 1D6VL 1J8RA 4UWQB 4I0CC 1IGIL 1AVAA 2D0GA 1S78C 1YMMD 2WSDA 3EGXB 1S4IA 3WJJC 1BOGB 4LL4A 1P4IH 4HJGB 2WLIA 5EDSA 1VPOL 1O7DE 3UTQA 4PJDE 3NJFA 2J6EH 4TPRL 1Y1DA 3IDYB 3O8XD 5CU9A 1EXGA 3QUXB 1E4WH 3K71B 2ZOLB 4H2AA 1TTFA 3PQYB 1IBHA 2CLRB 3RY5A 3ZKSD 5I66A 1XF2A 3WN6A 2O61B 4MHHG 1IC7H 2Y06L 4V2BA 3UL4A 3ZIMA 4F1SA 3C08H 3MUGB 4HKZA 5ICXB 3UTSA 4LARH 2ATKB 4O58H 4TOYH 4QGTA 2ZKXA 5AVRB 4G6ML 3A22A 3OXSB 1X44A 4NQDA 2YRBA 4LSPH 1X5XA 4KJQD 2XPGB 4ZPVB 2BS9A 4G9FA 4GQZA 3MRGA 1TQBB 2V7HB 1VFBA 1INDH 2F58L 4YHNA 4WZ9A 5L8JB 2PO6C 4IU3A 5LUMA 5KUMA 3UH8A 5LN8A 1QMUA 3QUXD 2MFNA 4XNBA 4ELMA 4YDZA 4GP4B 4IOIA 4Y5YA 3PQYD 3G7TA 1A7PL 4CMMA 3QORA 1W91A 5LG1A 3LOWA 1BZ8A 1UENA 2F7OA 4ZX4A 1YEKH 5D72L 1AHKA 3O3EA 4Q4IA 1KENH 1BGXH 3ZBMA 5AKSA 1A64A 3LKQB 4UTBA 5A6LA 4KX8A 3TXAA 4KK8C 3VCLB 2IFFL 1CICA 3FZUD 3NCJL 3Q1SH 1CDJA 4HKJB 5JO5A 4FQ2L 5AYTA 4LSDA 4PFEA 5ISZB 1Y1UA 4M6NL 1NAML 2L8AA 2FLMA 3OWEA 4I0KA 3VFVA 5JR1H 1MCKA 1Q8MA 1U0QA 4PV9A 5E9DB 4KFZC 1MCHA 4OCNC 2FSDA 3CMGA 3M86A 4IW4C 3UX9B 3HUJE 4G8AC 5GRYA 2GJ6E 5EU7E 4OJCA 2VMEA 1MFVA 2LW3A 4BZ2H 3RWCB 3S35L 4DN4H 2R4SH 2PO6B 3K4AA 3TA3C 1CT8A 4FQXC 1E3ZA 2V17L 3MV7B 4HIIA 4AYMC 1ECZA 3RZWA 3CHOA 2YN5A 3QCUL 4G72B 4PRDA 3UOAB 5ISZD 3V6FB 3T3MB 4OAWA 5L4JA 2NT0A 4HUUA 4B9GA 4Z7NF 5JHDA 2IDSA 4OV6F 4Z76A 4PJ5A 1RVFH 4U4IA 2H5UA 1OAKL 1U8IA 3M1CA 1PS3A 3QCVL 4XVTL 4DUXA 4Y4FC 1NL0L 3BZ4A 3NJHA 4MS8D 2KZBA 4PIRF 2WQVA 2COQA 3DMMA 4S2SB 4ZS6C 2VXSL 4IMKA 4AJ0A 2PR4L 3Q3GB 5L2JA 1QFWM 3O45B 3I50L 3MV8E 3UPRA 3C12A 1TTBA 5G2NA 1TJXA 1BFOA 2D4FA 5KOMC 2PO6D 3OAWA 3WKPA 1YYCA 1IQWL 2JCCE 2P8PB 3UABA 4CN1A 3MV7D 1YZZA 4FQCL 1LE9B 4PJIE 1AGEA 1FNFA 1R75A 3FU7A 5K33A 5IB2B 5GHWH 4GIPD 4NZTL 4FRWA 3TYFB 3ULSB 1FNEB 1RIHH 3D12B 2Z7ZA 3QHFH 5L8LB 1UOWA 5F9AC 1UA6L 5EU5B 4Z7VB 4BSVB 4WSGA 3RBSA 5D1XC 4OJFH 1MIEL 1RUAL 3RP1A 3TA3B 1MW1A 4OI9A 5E1HB 5K69A 2HAZA 2LT9A 4FQXB 2F8VA 3LHPH 1N64L 3G6DH 2MOVA 4CDHA 4W6YB 1WFMA 5AALA 3MLSH 5EIVA 3HR5A 3QEHA 1KB5B 2YRZA 2JE8A 3U7YL 1JNJA 4U0RC 1D7CA 2JJWA 5TDOB 3VFMB 4Y1SA 4ZX6A 1I4FB 1RZ7H 2FRGP 2PWFA 3WKYA 4CRPA 3SDCA 4Y4FB 4AY0A 5I17B 3M7FB 1VF5C 3DUSB 4TTDD 4KMLB 4BK5A 1KGIA 4K7PX 5FGRA 4D9LH 2XZCH 2VLKB 3V5KA 4FLRA 4Y4KA 5C07E 5BXFB 4QYOA 3S48A 3H3PH 4CDGC 3HBQA 2ITDA 3T9WA 3I6SA 1E67A 4FQXD 4RZCB 5EBMB 2YSSB 1Z7JA 3U2SB 4XPTL 1VZGA 2VO8A 4LCUA 4EXPX 3VH8G 4F7PA 4IRZA 4FJZA 5ITFB 5BS0E 4Q8BA 5KYWA 4S0TD 2NT1A 1BQLL 2BP0A 2YAFA 4H8WH 2AQQA 3GM8A 5GRVL 1CR9L 4F7EB 4NKDA 1ED3A 3ILPB 1ZHKA 2KQNA 4F15C 3S88H 5ICYA 1LLAA 1QASA 5D1XB 4Y4FD 43CAA 4XCEA 5CHNB 1LNUB 1ACZA 4LGRB 5LN4A 1P5VB 4U1IA 2C9QA 4OT1L 2AERT 2VGLM 3AB0C 1L9RA 4HD5A 5INCA 3ZE0F 4U0RB 5IB4B 1O5DT 4OB5L 4LOUC 5IY5B 1H6EA 2ED7A 2Z7WA 4E5XA 4I0PD 2VLJE 1BVKB 3T08A 3UO1L 1HU8A 3F5WA 1SYSA 2B20A 2XTSA 5CJ8A 5EF1A 1FQ9C 2AHIA 2AEPL 3Q8EA 5I1KH 1F1AA 4GW4B 4GQPH 3GXFA 1U8JB 1XBRA 4E9SA 4NQSB 4XWOD 2AMUA 1L9SA 5FO8A 3BP6B 1BZ7B 2H7WA 4B0MM 1DLFH 2VABB 2UUDH 2Z9TA 5KYUA 3EH1A 2OW6A 3DX6A 1ZOXA 3P73B 1F13A 1I8UA 3IVKB 4XPFH 3RDTA 1XH0A 1AS6A 1C12A 2ZCLL 2QVIA 3MXVH 4RBPK 2E9IA 4F15B 3ZZLA 2FD6L 1DBKH 1BEYH 4M7KH 3WMPA 4IGBC 1S9YB 1DVSA 5D2NA 5AG9A 4HS8L 4APXB 4TNVK 4K4KA 1RMFH 5J06A 2QZ5A 2FQFA 3K7UA 4GW5A 4ZXBA 3WOVA 1GPOH 2BY0A 1UATA 3BVWA 5ADOH 3FYIB 3WUWG 5FUOL 3DRQA 4HEME 4DN3L 3AB0B 3C8KA 4K55A 3IJ7A 4X98B 2XPYA 2I07B 4L3AA 4UIMA 1IFGA 3IFLH 4X4YB 1ETZA 1OTUC 3NZUA 1QP1A 3CSGA 3ZTJG 3INUL 1RPUA 4H88L 2XQYA 2PCPA 4O51A 4XXWA 4XHJD 4ATWA 3H9ZA 3ZSTA 2WTPA 3D39B 1HHGA 4P3CL 1UKTA 1ZHNA 4MNQB 3QXAA 3ESUF 1VADA 1YEIL 2BC4B 2AAVA 2X4OA 1SOKA 1MCOH 2UYLB 2YPLA 3QJSB 4UU9B 3MRBB 3Q43A 3MXWH 3SE6A 5JXAH 4NI6A 1DQQB 1T83C 1KCVH 2O1AA 5KW9H 2CBQA 1DJGA 2ZXCA 5GRWA 3K4ZA 1TNNA 4NENA 3LTVA 5HYJE 1ZV2A 3RNKB 2L4OA 5IHUH 1X9UA 4KTGA 2ZCKH 2HKHL 4JRYA 5E6ID 3VNYA 4B50A 2RQEA 4IGBB 4U1MA 3FQWA 4QOKB 4Z3TA 4OGAD 3IU4L 4QKTA 4UTAA 1HYSC 3D39D 4MZRA 3GK8H 2Z4QB 3E9TA 4HJ0C 4MNQD 1GGYA 1A3ZA 1L3NA 1O9WA 3COOA 1I31A 3R4RA 4NJAH 4OCYL 2NR6C 5DFVC 1JYWA 2OL3B 3DOIA 2J1XA 4B9YA 3P3TA 3LNFA 4NQEB 3U4BH 3TEZA 1KMGA 2XTLA 5E03A 1ZLEA 3UC0H 3MN8A 3CXHJ 3D25A 1HNGA 1J86A 4LCWB 4LSVL 2PYEA 5GS1C 1I7UA 4D0CA 3FQ1A 4P2CG 2XNAA 4FMFA 5DJDA 4EI6A 1IBFA 4Y16A 1BLIA 5LBVA 3CHRA 2JKIS 3FQTA 4U6HA 4XCYA 4Y2NA 2GW5A 4JO3H 1P9MA 1GYCA 3UBFA 3WGUB 4IGBD 3RJOA 3R4DA 3HOGA 4B53A 2EDQA 2YMXL 4JFDE 1AHMA 1WISA 3GI9H 1DQJB 5LWYL 2NNFA 4Y9GA 1D5ZA 3FBQA 1ZLVH 3BDBA 5GGRB 1FC2D 2FWSA 5D1ZC 4EEEA 3HI6L 4DCQB 4UV4L 2R2HB 4YDVA 2FBOJ 1MCEA 3RKDC 4MBRA 4WEUD 4NQED 5T3ZD 2ADFH 5HGAB 1G6RH 4HMEA 4QT5A 3IDNA 4WI3A 2E7BA 3MLTB 4UIKL 1LO2L 1IVLA 4L1SA 1JHKL 1RZ8A 2ZE0A 2AP2A 3LJ3A 2BNQE 4YHLH 4OJDH 2E4TA 3MLZH 1NBZB 1MRCH 3UBXA 2XIIA 3EO1B 4HF5H 2DYPB 4WEMB 1YN6B 3RVWC 3ECBA 4HFUL 1RSFA 1FL3B 2VZTA 2JKTM 4G80A 2FX7H 3WIHL 3IAPA 3QEQA 5GS1B 4OD2A 4QLRA 3NEOA 3AABA 3NFPA 4ABQA 3STZB 1OP4A 3N44F 4OLYL 4O9HH 2C3XA 5I5RA 4KVNL 2X6CA 4G42B 3I3EA 1HWGB 4HH9A 1CE1L 4I77H 5F9JB 2QHLA 1DVXA 2QFPA 3TASA 1NCIA 1H8LA 1MH5B 1KJ2B 1N0XH 3JT0A 1E43A 3PV6B 3MBWA 3Q6GH 4FFTA 4YLCA 3OVUB 4M48H 1P69B 3VUAA 3RWEA 1WWWX 2ZWLT 4MA7L 4P2QA 3HE7A 2K45A 1ZVSB 4BSWA 3IEAA 3BSZH 5DJCA 4L37A 2EC9U 1EHLH 2BS71 2KYIA 5AKTA 5DJXB 2VITA 4NZJA 4EOWL 1JPSL 1CURA 3LV3B 2I7SA 3C2AH 5E23A 1UACL 5JIHA 1JRHH 2P28B 2OYKA 3ES6B 3MBXL 4EDWL 2VT0A 1N6VA 1OAQL 2IANE 4PCSA 3GXMA 5CLWA 3KL5A 3O2VL 3RKDD 4X9FA 3U4KA 1PKQA 2R56H 4JL2A 3TPKA 2ESVB 4OIAA 2JLLA 3B2UC 3QNYA 5E0FA 5CEZL 1I1AC 3DV4A 5IVZB 1T89C 3MCG1 5DMIH 1DN0A 1HHKB 5BUAA 4W81A 3ZDXB 4B9JA 3IS0X 5GRJL 2C1PB 2VDOL 4WFGD 1AGDA 4DVRH 4EBQH 3F7YA 3FQ4A 1GZHC 4RQQA 2R69L 4Y2DB 2A4EA 4N0CC 1INEH 1MLCA 3L3JA 3GZQA 4Z7QE 1LILA 1FWXA 1M71B 1TJIH 2EDLA 2D7QA 3JV6A 2XVBA 1MCQA 3MRKB 2CCWA 3QUHA 1KTCA 4ZFOL 3MNDA 1ES0B 5CGYC 1V7NL 2X41A 1L9NA 3GMOA 5DZLA 3TM6A 1U42A 3ECQA 2YQ3A 1E3XA 1YJDC 5CD5C 2MEJB 1WH0A 5JLZA 2VQTA 3DYPA 3IYLW 4JFQA 3QQ9D 1KSRA 1P2CA 2AQ2A 3SYCA 4DPAX 4BXSV 1E9OA 2DIJA 4ONHA 2JI2A 5ANHA 1RZQA 1QAWA 3X13A 1KTRL 4G8FB 5F89B 2NY0C 5C0RH 4UINL 1JXKA 1YN7B 1JGIA 1H3GA 5H94A 4B5ZA 7CGTA 1U8NA 5IR1B 4Y2DD 3H85A 1BQHA 1CDBA 3E6FB 4XOCA 4UQAA 3X11A 1NLBH 3OSVA 4IK6A 3DOSB 1EVTC 2Y24A 1I1AB 2IQ9L 5EZOH 1U2YA 3CE1A 5IROD 2ICWB 5FOBA 3ZDYB 3K72B 3LKOB 2I85A 3O3AB 5F9OH 4ANXA 2JJVA 5B1BB 4ODWA 5IEHA 4L05A 3D8MA 2OP4H 5GS0C 4U1SB 4FI7A 3MUJA 3RY6A 1DE4A 2BCKA 3V0IA 3TBSB 1FNLA 4YIQA 5F7MC 4V1DA 2CHDA 2XVGA 2YAEA 5D2LE 4K94C 4EZKA 2YA0A 4OZHA 1T2QL 4ZMWA 1NKOA 4HPOL 3GHPA 2QPUA 2Z31D 3PCYA 4MJHA 3OLDA 3BRFA 1I1AD 1D9KC 1UGKA 4MFHA 5J4MA 4GOSA 4X5WA 5BVPL 3WKML 5ERWB 3BPLC 4GXFA 2F61A 3UZVA 2NY0B 2CGRH 4FNRA 4ALAH 1P4LA 3FAWA 1IE4A 2QV2A 5I9QC 3HNTL 2K9FB 4M61B 2HTKD 1T0NB 3JXAA 3DHUA 1B6UA 4LSUL 3KJ4C 4UNVA 2XC8A 4GG6F 1QFWL 2AV7A 3CZEA 4GQ9L 4TLUA 5CF3A 5M7QA 1QLFA 4KVCH 3KPMA 1FORH 1WTGT 1ID2A 1KCRH 4KXCA 4PGBB 4P48A 1EZLA 3GSRA 4Y5VC 3MRLA 1YCSA 4KXZI 1A6WL 1F02I 1RURH 4P5MA 3RWDB 3MGAA 3M7OA 2J2ZB 6TAAA 1DQTA 1A6AA 4Y7MA 5D6DA 1AOZA 2NY0D 5C0IB 1E4XL 2FIKB 4Q58C 1CXEA 4TRPL 3ZMRA 1BIHA 3FT2B 3FF7A 2V9RA 4PWEA 3OKLA 3WI9A 1UKSA 3LIZH 3KBFA 1PCSA 1W8EA 3ECWA 2GYSA 3CZNA 3DYMA 3DDFA 1S8DA 3IJHA 1AS8A 1SFDA 2VLRD 3FFCA 3PWNB 1D9KB 1I7ZA 4TSBL 1LDSA 1T5KA 1QLRB 2MQCA 2X4RA 3LN5A 4LB8A 3P11H 3BPLB 1NBYA 2BNUA 3BZFA 3TFKD 3NIGF 4GRMA 4ESKA 4AIZB 4IS6A 5I9QB 3RIAF 3AUVA 3QEGH 5D1QE 3UFIA 1A2YB 1UD5A 2C1OB 1RZKH 1VCBC 2ITCB 5GS0D 4R7NB 3KJ4B 5C0BB 4ADGA 4G3YL 3T4YA 1OB0A 1EDYA 3GMQA 2PN5A 4YDMA 3FO0H 1X7TA 2RMNA 4LSQH 3ROOA 1IT9H 1E90A 1X9LA 3A67H 4KKAC 5F93C 2XXCB 2YXFA 5CWSB 3CFNA 5F72S 1D2OA 1KPVA 2P43B 4Y5VB 3QPKA 3NFNA 5IESL 1UT1A 4OFPA 4KKCD 1D9KD 2PW1A 4FLOA 4P2AA 3PUCA 3BOVA 5I30H 3KPLB 1T7VA 1PZUB 1GC1L 3GGWB 2EDYA 5EU6E 2ZJSL 5B7EA 2ZYSA 5I19H 5ESVA 3KLDA 4ZUUB 1QABA 2IADB 1QR4A 4WW1B 5FYKH 1PAMA 3EHBC 3ML8A 4TLTA 4ZUVB 1TFPA 3QDGB 2IF7A 5C0BD 1K3IA 5E94A 1Q0XL 2ZOOA 3ABMB 3Q2CA 2JKWA 1SF3A 2N01B 3C87A 1GS8A 2BOCB 4HD9A 3SKOB 1T21B 2I9LB 2CBMA 1ZK5A 2AXFA 3VXOB 5C0ND 3EF7A 1BM3L 4WWKC 4YWGL 5C0AD 1V3LA 1T4WA 1INQA 1ZE3H 1SJHB 3BAXA 4LZKA 1X5MA 2JB5H 1ROWA 1PFOA 2EVHA 1ZY9A 3ZHNA 1JNHB 4PJ7F 4KQ4L 4CSZA 5A7BA 4GMSL 4KI1A 1AHWC 1UG9A 3CHSA 3D87B 2GG1A 2Q86B 5BVJB 1N6UA 2OZ4A 1KG0B 1A4CA 3RNQB 3QFJE 1UYWL 1B0RB 2GAZA 3GSVB 3TV3H 5KVMC 4LEOB 4QHKI 1S7RA 4A55A 1CD8A 5DFAA 3O0RL 4GRLC 2VUYA 2Z64C 4I7ZC 5BJTB 3J8F7 2P7TA 3EOBA 4HWNA 4GKZA 4QTHA 2YKKA 3EF4A 4CVZB 5EO9B 1G43A 1EO5A 3N1MC 3SKJL 3LHAA 2EIMB 2OKMA 1BQ5A 4G8IA 3RGVA 5D5MB 1C5BH 5TF1H 1QFHA 3EHBB 3GIZH 1S7QA 4JPIA 4A63A 1WIOA 4O2CA 3OG4B 4ZUSA 4UF7C 2QVKA 3APCA 4KKAD 4LOVA 3I75A 4KRMB 2QPSA 1UJ3C 3EJTA 4N6RA 1Z2KA 3N41F 4O2FB 4ZYKA 3MUHL 1AZZC 5D70H 3NQIA 3ZE2E 4X7CC 5JW3L 4KUCF 2A9DA 4WWKB 1A9EA 2IC2A 3AXHA 4YO0B 5IVXE 3ETTA 4TUKH 1WBXA 2QGBA 3LEVH 2WBJA 2C4FU 3KYKL 1AHWB 3LQZA 1Z9PA 2AQ1A 2OTWA 3GSXA 2FQGA 3H2WA 1ACYH 4HG4J 3EHBD 1G9MC 3EJYD 4PMFA 3N42B 4BUQA 4GRLB 1U92B 3DUUB 2JB6A 1PY0A 1K4DB 4JKMA 3PAUA 1F8TL 4JY4A 1KB3A 4PRAA 4FYSA 3ARYA 3KBPA 5EO0A 1UXWA 2A9NL 4M1CC 2CJTA 1GGCL 1VFAA 2N0KA 1H6UA 1J0KA 5FO7A 3B5HA 4Z7OE 2JVUA 3V4VB 2NX5A 4L1LA 2GQHA 3B9AA 2R8SL 4K3EH 3EO9H 4IOSD 4HPYH 5FYKE 4KY1L 1GL4B 2HRPH 4G1EA 3MJ8A 4YZFE 2XRAH 3RTQB 1UJ3B 1CIUA 2JNZA 1KPRB 2NY4B 1C5DB 4N2KA 4HX1B 2R1XA 1J1OH 4HGKC 1RIVH 4FZEH 5LHDA 1BBJA 3GBDA 3CXFA 1LDPH 2GSIA 4JM4H 5F8RC 5JXEA 3BZEA 1F3DH 4JVUA 3NIFE 2M26A 3ARBA 4PRBB 35C8L 2CG9X 2OMXA 4W9GC 3RU8L 2WUBH 4FJYA 1DQMH 1IGTA 3FAXA 3KXFB 4AGMA 1NH6A 5CP7A 1SYVA 1R47A 2XWBA 4WWOA 4IRJD 3OJDB 2WTOA 1DLHA 3MYZA 4UT9A 1ZLSH 1S7SB 3WLWC 4Z77B 2EE2A 4G1MB 4MNGB 3MUUA 3L2NA 1T5XB 3RTQD 4XNDA 2HH0H 2YD6A 5L9DL 2LVCA 1WFIA 2RBLA 3ME0A 3MGOA 4KC3B 1NICA 2EZ0D 4PCKA 4BFBD 2NY4D 5IKCA 2XZQH 4ZJ9A 1HS6A 1L6XA 5E8OB 4TN9A 3R8QA 3QDMB 1E5BA 2EDDA 3LDBC 3QFGA 3SDAB 1P7KA 4P23D 4BWTA 4NBXB 4X7FC 2WVVB 1GSMA 2OXHB 4FP8H 4IDJL 1HEJC 1J9CT 2DRUA 3BPNC 3QORC 4YE4L 4EUPA 3KXFD 2N7BA 2C7UA 1KWKA 4G8GE 1MDAA 1JAEA 4CN4A 4ZS7L 1AO7E 2WLIB 1XR9A 3I9GH 5DD5L 4CU7A 1AG6A 2YOAA 5DMJB 3UTQB 5TQ2H 4LLMA 3NA9H 2FT8A 4M1CD 4PJEA 1BFTA 1CICC 2IIJA 4JQIL 3H3KA 5I66B 1SY6A 3QDMD 1FE8H 2NNXA 4XP4H 2EDXA 4J7RA 2H1XA 1MAJA 3SDAD 2P5WE 3MNZA 4HKZB 3UTSB 2I5YL 1NBVH 4WFHD 1U4EA 5HI5D 2Z93A 3OLEA 4J2XA 4UOW0 3BUDA 4UI2A 4NQDB 1JPGA 1Z5LA 4G9FB 3MRGB 3DVGA 4NZUH 2NOYA 1ZEAL 4YHNB 1YNLH 3HMXL 2BWIA 5AWNL 1QPKA 4PJCF 2OMNA 3LDBB 2GCYA 2RFXB 4FFZA 3T71A 1J8HA 3SY6A 1O5PA 5E6RB 3UEQA 1RJYA 2ZKHH 4ELMB 4IOIB 2Y7NA 4HLEA 3GSNA 1JVKA 3QJRB 4CMMB 3BPNB 3QORB 4FFVD 4P4KA 4KGLA 3QZMA 4JO4L 4H0GA 2FO4A 3IPFA 2WLNA 2F5AL 2F54A 4KDTA 3WLWD 4QRUA 1UFUA 1J0HA 4PJBE 5I15H 3ABLB 3KYAA 3DMMC 5HDBF 4K8RH 4IMKC 5TF0A 5HVGB 4N2LA 4MA8L 5HJ3B 2GVYA 1D5BA 1CICB 1EMTL 5JO5B 4NKOB 4RMUA 4XPHH 2K6YA 1P0SE 5EZIH 3CD4A 4AL8H 2Y5QA 1DDHA 3PP4H 2NYZA 3P54A 1AMYA 4O00A 4L29A 1BAWA 3T6VA 3QXTA 3LQAC 2ZF8A 3STLA 1DBAL 2J20A 4N2AA 4M7JH 3WDHA 4JPVH 4D0DB 1M7UA 2RQ8A 3DX8A 1T0OA 2A6JA 2YRPA 1U36A 2IG2H 1HFUA 1JF6A 1AZVA 2Z7UA 4KPHH 2AGJH 4RGOL 3ARDA 2XA8L 1OSYA 3OX8A 4FYRA 1AI1H 3BPOC 1NGWA 4HIIB 5I1GH 4K9EH 3WHE0 3Q9PA 3JVGA 3CH8A 2F0CA 4PRDB 4KAQL 4AQZA 2BO0A 4DGYH 4I18C 1PNDA 3BWUF 1XSKA 5JHDB 4HUUB 5F0LB 1KC5H 4X6FA 4XZUA 3ULUC 4DPBX 1Z9NA 3CH1B 1LGVA 1F4HA 4PJ5B 4XVJH 3V52H 4LRNL 4BZ2A 5ACLA 2WSKA 3SDCC 2C9XA 2W0PA 3DMMB 4D0BA 2ITFA