4BFJA

Superoxide reductase (neelaredoxin) from archaeoglobus fulgidus e12v mutant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
ELFQTADWKKVKHVPVIEVLRAEGGVVEVKVSVGKEIPHPNTTEHHIAWIELVFQPEGSKFPYVVGRAEFAAHGASVDGPNTSGVYTDPVAVFAFKAEKSGKLTAFSYCNIHGLWMGEATLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE REDUCTASE
publication title Understanding the Role of Key Residues in the Superoxide Reductase Molecular Mechanism, Exploring Archaeoglobus Fulgidus Sor Structure
rcsb
source organism Archaeoglobus fulgidus
total genus 23
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4bfjA00
2HVBA 4C4UA 4BV1A 1DQKA 4BRVA 1VZHA 4BK8A 4D7PA 1Y07A 1DO6A 2AMUA 1VZGA 1DQIA 4BFFA 1VZIA 1DFXA 4BFKA 4BGLA 2JI3A 2JI2A 4BFJA 2JI1A 4BRJA 4C4BA 3QZBA
chains in the Genus database with same CATH superfamily
3OTTA 4PG2A 4IOFD 4N8VA 1FSKC 4FXGB 1R47A 2ESVB 4XC3L 1NBVL 5E9DB 4IU2A 2EYRA 1RUQH 5F2FA 3L4UA 2VDNH 5K9QI 1L3NA 1LD9A 2EH8L 2XLLA 3BSGA 1YNKH 4FULA 4PR5B 4R0LB 3QC5X 2NY4C 1WD8A 4L4TA 1NLDH 3APNA 5H94B 1F0LA 2MOGA 3U0PB 1BFTA 1T6WA 4QXWA 5B21A 3KS0J 2JKXA 4WI6A 3G6DL 3NIDF 3DX3A 4P05A 5JQHC 3CN4A 4M62H 1WTLA 3QGVA 3QDHA 2Q3XA 4XOAA 3U46B 5F88A 4G80B 1P1ZA 1OCZB 5CZKA 5DJCA 3KJ4B 1NZRA 3K4AA 4HMEA 4XPAH 4LLUA 2E46A 4XMZA 1AKPA 3NRQA 4FG2A 3FF8A 2W81C 1L7TH 4HIIB 1WISA 1IILE 1E5YA 5DA0B 3BAXA 5DJDA 4XP5L 4PJAB 1N0XL 3ARYA 4U1GB 3VNYA 1IC5L 3WNOA 5HTSA 3IGAB 5DZLA 3BGMA 3DRTA 2W65B 3C2AH 5C8JB 1FJ1B 1AJ7L 4WGWB 3BH9A 4X4KA 1NLDL 4MAUH 4D3CH 1J5OH 4Q97A 3SPIA 4LCWE 5EC1A 2HJFA 1XIWC 3ES6B 3DO7B 1H6EA 2XG4B 3QRGH 2V4LA 1MDTA 2XN9E 4QRFA 3UBHA 1C16B 2ALWA 2JB5H 4M7KL 1YEIL 4YC2C 3WFCH 3U2SB 1QD0A 2XKUA 5C97A 1R75A 5DUBA 3QUZD 3PF2A 4XH2B 4AYEC 5IHWA 3UC0L 1ZT4A 3DOHA 1GPOL 4ANKA 4PUBH 2WTPA 1LP9F 2XIIA 2NY0C 3P0VL 5ISZD 1OTUD 3UAJC 4X7EC 4K71B 4HIXH 2YAHA 2VLKD 3E2HB 3PFQA 5F7BA 5C3LD 1E5BA 1V54B 2E8YA 2WTRB 2EXWD 5TDOB 4PRDA 4ZO8A 3EYOB 3ZKXC 3N85L 4QHNB 1BG9A 1G9EA 2R2BB 2ZUTA 1UD6A 4PCTA 1WWCA 3CX5J 3LRHA 1DLFL 1YEKH 2BINA 4HWNA 1W0VB 4RA0C 3W2DL 3IGFA 3GHPA 1UADC 5BQDA 4XBEH 1K8DA 3IWUA 3DVGA 1FCCA 4MAYD 5T1KB 1KGYE 4WI8A 2YR3A 5DZOA 5I75B 3BPLC 4GSDL 4WW2C 4FKHA 4Y2LA 4LK4A 2Q2EB 2YEZA 3QJUB 2EACA 3VFPA 4PWHA 4Z7VA 1IVTA 3U4EA 1AR1D 1A6ZB 3VFRA 5I1CL 1P4IH 1QUPA 3PHAA 4MJJA 4N2CA 2AJSL 2ZXWB 1H3UA 2WZ0A 3MN8A 3QZPA 4K7FB 4TVPH 4R5XA 1I31A 1OPGL 5JHDE 1MW2A 1IBFA 3BSZL 1IM3B 3CDGA 1ZHKB 3MBWB 3NCJH 5FA4B 2BY3A 1D9KC 1EEUA 1GC1L 3MYJB 1NCUA 2PMZA 3MLXL 3VCLB 3M07A 4YN3A 3IKKA 2Q8BH 1NFDF 3CBKB 3RWHA 4ZXBC 3AU1A 3DC0A 4Y2DB 4C4KT 3W37A 4RBPH 4W68A 4RGMC 2W0LA 1IEHA 3OKLB 2FATH 4F2MA 2Y2TA 5IVXF 3B5GA 2V17H 4PRIB 3GINA 1AY1L 1NDMA 1ZCRA 4QPEA 1O5DT 5AW7B 2NYKA 1P84J 4R96A 3LOWA 4AGNA 3CVHB 4PRPA 2OV0A 2K3HA 2CDGA 4CC4A 1PZ3A 4XO3A 3V6OA 3VWKB 3AS1A 4JR9H 1E9OB 1QPPA 2OM5A 4U0RB 5BZDA 3QDGE 3HPLB 1SLWA 3ROOB 4Z95H 1ZIBA 3VI3B 2HP4A 3PPEA 3WENA 2CRZA 3CZGA 5D71H 4EJ1C 4BA0A 1WC7A 2LOEA 2ZOUA 1I7RA 4FFZL 2RGSA 1YSOA 3BUIA 3COOA 1OAUH 4IEFA 2DMCA 3L6FB 3EJTA 1AI1L 1K6QH 4FG0A 1T4KA 4P2AA 4RMWA 3QFDA 1XD1A 4MMXC 3P9MB 4BZ1H 3QZNA 4GW5B 3O4LB 3RWIA 3M8OL 2WXRA 5K9QG 3NPZB 4KRLB 2ADYA 1NSNH 3FB5A 3ILQD 3UMNA 3S8WA 5IJKA 4GINA 1PFOA 4M7LH 3L5XL 4FKEA 3D18B 4Z78B 5EOCH 1KCUH 1A4KA 1SXZA 2OI9C 4UQ2A 4Y19B 5KG9A 4DP5X 3IAPA 1DDHA 1RUAH 5IHBA 1UZGA 1BZ8A 2I60L 3U9WA 1KF9B 3B2DC 1OAKH 1DVZA 4X42A 2J12B 1YLBB 2OX5B 4GKZA 4OZFG 4UBDC 4AMKH 4GEJA 3ARFD 3MLYL 4IDJL 5DMGC 4C55A 1JSYA 3TZVD 1D5ZA 1AHWA 1YNLH 2D7PA 1J9QA 4WUUB 1NAKL 3TV8A 3P73A 1KCBA 4XR8C 4WFHD 1R3KB 1IB5A 1O75A 1YN6A 1F3JA 1F41A 5FKPA 3BE1L 3MBEC 5FW8A 1OP3H 3VVWA 2VWEC 5D5MA 1BQ5A 4JFFE 4DGIH 1YYMH 5IESL 1J0KA 5SV4A 1G7PB 4U49A 2X89D 4XCYB 3PHOA 4FZ8H 1IGIL 4JL2A 2NQDA 4PJIF 3OG6B 5C1MB 1ZDQA 4N0UB 5FFOA 4A04A 3CFQA 3EOBA 4L3CB 1D3CA 2ARJQ 4U7MA 1LEIA 2ZNWA 4TQEL 5JXED 2JI2A 5E4EB 1WBZB 1HNFA 3DOSB 4U3SA 2Y06L 3KM2A 1RUAL 4L9LA 3UJTH 3D07A 4N8VG 3WE6A 4YSEA 1IE5A 3ECVA 1MCRA 3QQ4A 5FB8A 1SUHA 3QULA 4XNMB 1TJGH 2P45B 4XNZB 1MCOH 3DBSA 3OKEB 4PJ9B 4TRPL 3CGTA 4F91B 3GXTA 2WCPA 5I71C 1JPSH 3D30A 3RUGF 4JO4H 1AOHA 1UA7A 5G4MA 4O2EB 1W91A 3U7AA 4L48A 35C8L 4POUB 3ZHFA 4FNUA 4MNGB 3X14B 4D7BA 4C58B 2B1AH 1A1MA 4QWWC 1AQKH 4WW1B 1QYGH 4LSUH 2EC8A 1FYTE 5EF0A 4L4VD 4HPOH 1DSFL 5FHAL 4I3SL 5GS0L 4GAGL 4HEPA 4UT6H 1XGZA 4LCUB 3N91A 3Q2CA 4UOW0 3TN0B 3NABL 4S1DD 1ZSHA 5DK0A 4YS4A 3FJTA 2R1XA 2R4SL 1I1YA 2XWRA 4RFNC 3TIEB 3WIHH 1ZHLA 4H8WL 1SLVA 4MSWB 2X4SB 2YUVA 2WIMA 2O6DA 3GI8L 2PCFA 5F6HJ 3T4AC 5KBNC 1TJGL 3HRZB 5FYJE 2HLAB 3OBAA 3II1A 5C09E 1KLGA 3UIYA 4M5YL 1SUJA 3BO8A 4LCWD 3QYCA 3TASA 3RIAF 5KS9E 2WVVA 3VDBA 2YUZA 2Z7WA 3ZGIA 3OM3B 4JQIL 1T03H 3E6FA 1JV2B 4X8JB 1BZEA 5DMJB 4FQLH 4QF1B 4NI6A 4JFQB 2VLJB 4WDIA 3BHBB 2D4FA 5IBTL 4OGXL 2IWGA 2O5XL 2GFBB 4PJFE 4PV8B 3EH4B 1SHXA 2DYRB 4ZDHA 1TZOA 1UURA 4JHZA 1QRKA 1DBMH 3KPQA 5BRZD 3BRFA 2Q7AA 4EI5D 1DQMH 1IGCL 2JLPA 2ZSWB 3IF1A 3IS1X 3HJEA 3N41F 3N6YA 4J3OF 5INCA 4CU7A 4GG6E 1MCWW 3B4NA 3HHRB 3QR1A 1SN2A 4P9ML 4RGNB 2OR9L 3MRCB 1V5JA 3F62A 5HYJE 4AGQA 1CLOL 1KJ2B 4AQ1B 1XSKA 4MJIB 4PG9B 5TGBA 4Z77A 2RB8A 1PD6A 2J44A 1GXEA 3MRDB 5I76A 1UWFA 2DQFA 4ONFL 4JG9A 3QUMH 2OS7A 3P4NA 5D93B 4HOMA 5D8JH 2XBDA 5EIQA 1JWSA 1VGKA 2JK5A 2G75B 4G6FB 1WAAF 3QFJE 1MCLA 2ZP0T 1XR9B 3S2CA 2HG0A 5E4AA 2ESVD 1WBYA 3FU8A 4P2QA 4YNYA 5E9DD 2IBZY 1WZ1L 4AUJA 2VCOA 2WSDA 1XMEB 4HISA 5EMYA 1JZ7A 1GSMA 2VAJA 1ES0B 3QXDA 4KJQD 4NEHB 4WGKA 5E5MA 2P46B 4BZ1A 3QXWA 5JMOC 2A0LD 3BUYB 3VFSB 1CPUA 1YMMA 1DQLL 4LMQE 2X05A 3QR0A 4JX0A 3BWSA 3IU3B 2P8MB 5JHLL 4LF3A 1CF8L 2XPGA 3IDNB 4FD0A 1QA9A 5EU7E 1EX0A 2BXZA 4YSPA 2R27A 5IY5B 1LO4L 2XJLA 3EGSA 4J3SA 4LSDA 4WY7L 4FKKA 3KLAA 2ZXEB 1S7VA 1UATA 4MA7L 4OCYL 5TQ0L 4HJ1A 4ELMB 1BBJB 1INQB 3QDGD 4K8RC 3IT8D 1V7MH 4NJ9L 2VXVH 1EVUA 1ETJA 3UTSE 2UZYB 1X4XA 5KYNA 3B3IA 1BYNA 5DR5L 5BZWA 4C83A 5I1EH 4I89A 1GAFL 3MRGA 4AXWB 5KZCB 4J6RL 4CU6A 5I8EB 4ONHA 3VXMA 3SYAA 1QRNA 4PWIA 4KXDA 4OD2A 1UT2A 1D5IL 2ZCLL 5JHAA 3WIFB 1FHNA 3MLSL 3IJ9A 4HW6A 1TFPA 3PWLA 2C9RA 4XNDA 4HOWA 1KMGA 2EH7L 4G6JH 4P46C 1KCVH 2WXJA 3QJFA 4P4KD 1KYFA 1IAKB 4DP0X 4JN2A 4U1IB 1T80A 3QT2A 4X6FA 2RCSL 1ZLVK 1EFXA 2FWOB 1OD7A 3SZ6A 4RFEA 4WI5A 1ETA1 1GYVA 3OR6A 2WQWA 3O3EA 4HSCX 1EXUA 3TX4A 1IC7L 4ES8A 4IHOA 1BQLL 2EE9A 5GS0C 1T22B 2DICA 3POCA 3WAJA 1OVZA 1KDIA 4ANVA 4AVHA 3HCVA 2Q86B 1KIRA 1NCWL 3II3A 2Q7YB 3V6FB 4DFIA 4L18A 3W0WB 2WLNA 4Y8AA 4CC0A 2J8UB 2K6WA 3JWNH 1N0LB 4ILDA 4OD3H 5I74B 1LQBC 5T1KD 1EHNA 2X3BA 5F93C 4Q9RH 4IRZH 4GRMA 5CM1A 1LDPL 1O6SA 4ZO9A 4EDWL 5HHMB 4UUJA 4U1JA 5I1AB 5JW4Q 2DQEL 3WIHA 3LKNB 5T8IA 2H1XA 3QG6B 3KGTA 2C4FU 4KUZL 3U0WH 1MEXH 3H9SE 4PJDB 4YHIB 5FGSA 4ZMTA 5FO7A 5IR1B 1IM3D 5HVWA 3WEOA 3QUYC 1T1XB 4DK5A 5E4IA 4L29B 3BVUA 3UROR 2NR6C 1CTMA 3HZYB 4Z0XA 1IBYA 1QLRA 2QQNH 2G0KA 3NOIA 4GFTB 4LRNL 4Y2DD 1RH8A 2Y69B 4P5MB 5LVEA 3MNWA 4OLWL 5JLZB 4NIYE 4KK5C 4D0CA 1I1CA 4PRID 1CFNA 3L3DB 5GZNA 3NYKA 4ZW6A 1CD9B 2LTQC 1HCVA 1LO3H 1I1AC 1SZNA 4X0KB 4WEUD 2R69H 1AD0A 2CRMA 3QRLA 1KBPA 3AREB 3FCBA 3FFDB 4AJWA 3QCUL 3APMA 3L95B 3TH2T 5AFAA 2X0UA 3F12A 3UAEA 4F7MB 3R8QA 5F7EH 3NZ8A 2N0MA 3KYNA 3VWKD 3WFEH 5AENA 2Y7NA 3QG7L 3T2LA 1CQYA 1K8IB 4LCWA 3RY6C 1DQTA 4WTZG 4E9XA 3BD3A 1V3MA 4HEPG 3GXFA 4MKTA 4PB0H 2J20A 3NCCB 1GZPA 4NFBA 2XN9A 4GRWF 4BCYA 5IIEA 5FYJD 4ZMVA 4P59L 5AWNL 2P48B 1X7TA 2ZPKL 3FONA 3QUMA 2DY2A 5C09D 3V6ZB 2X12A 5EBMA 2W38A 1KCSH 5AAMA 1LE5B 1Q8MA 5C0EB 2YC1B 5IM7B 2V7HA 2VJ8A 4Y16A 5GJSH 2ADGA 2DMGA 2CLVA 2H0PA 1E0OB 2F54A 4E36A 2FSEA 3OLIA 3H9YA 1DBJL 2E7BA 4WUKH 3O4LD 5H37A 1YEDB 3GSUA 4MDIA 3SYQA 2AJXL 3WDIA 3CVHH 4XRCB 2UVFA 2P80D 2IGTA 5LGKA 3CFJA 3EH1A 1LEKB 1K4DA 3MNDA 3P3TA 3QNZB 1X5XA 4NNPH 1KLUA 2WLZA 4UIMB 4LZKA 3INUL 4J3XA 4Y19D 3N9GH 5AYUL 3UTTB 4YR6B 2EXSA 2VW7A 1A7NH 4OZFB 4DOHB 3CZNA 4H25B 3GKWH 2XTJC 1ZPUA 2APSA 3GMMA 4H88L 4R7DB 5C0DB 4QRPE 5FYJH 4Z3TA 3BDBA 5F0JB 4JHWL 1N4XH 4EZJA 3FT0A 4K55A 5F7KC 3OGCA 1BQSA 3ARDA 3LD8B 2DQGL 1SDDA 1UXWA 3IJEB 1MY7A 1QTPA 3T09A 5D1XE 1U8NA 1OAQH 1I8MA 5C0BE 5H8DA 4BK4A 4JHVA 2E5EA 3RL1B 4M93B 1MI5B 4WUKL 5A43C 1NMCC 3EYQD 3DPDA 3EYVB 2DLGA 3N5AA 4RCAA 2NY1D 5JHDA 1SY6H 2AP2A 3HE6D 1SXCA 3L9BA 1AZRA 1U3HA 2NY4B 4CSZA 1RUPH 1MPAL 2CJUH 1SYSB 2VL4A 4UU9B 3FNKA 1TU2B 1XWVA 4X2UA 1JFQL 4NNXA 3F58L 3HI6H 3QFJD 4K3DL 3QIWA 5ALBL 1VFAA 2ZUXA 4ZODA 4CILA 2I26N 2W91A 3BWZA 3NTCL 1IKNA 4Z7OF 2OBGA 4MTMA 4PGDA 5EH1A 5CEYB 1URZA 3ZDYB 3AY2A 1DUYA 1LD9B 1NWOA 3GQFA 3TA4D 4DKEL 5T3ZD 4NO0D 2VR9A 4PJ9D 3S98A 1TMCB 1F18A 4OF5A 4WEMB 1KOAA 2IH3B 2YQ3A 4JO8A 2H2PD 1SXSA 3NN8B 4Q4EA 2VR5A 2UXTA 1CYXA 5DDHA 4OCNC 1COBA 3GHBL 1EZVY 4WI7A 4FC3E 5BUAA 3LTVA 2IWEA 2UUDH 3Q8FA 4JO2L 3X11B 4ERSH 3HLAB 4JQXA 2A83A 3ETBJ 1JGEB 3BVNA 1H3WM 3G5YB 4LLDB 5CWSA 2A6IA 3VH8A 3DIVA 1P7QB 1I82A 1MJ7L 2Z91B 3DMMA 4NPYA 1HH6A 3SYOA 3TO2B 4PGCA 1XIWB 4NAJA 4X7FC 4IJ3B 5AOMA 1ZV9A 5E94A 3TBWB 3TN0D 2HH0H 3HB3B 5IVZA 1KULA 3K46A 5AVVB 4LAQL 2CUMA 1EMTH 3WN5B 4TV3A 4YC2B 4C56E 4U6YA 3EJZD 4GSQA 4YDLC 1U30A 3BJLA 5BRPA 1WG3A 2VC2L 2B9BA 4JMXA 4NRYB 4FLOA 4Q4IA 4G5ZH 4H20H 1ZLSH 4YLBA 3ML9A 1EGJH 2BSDA 4IRZA 4Z18A 5JW4R 2NY0B 1TTFA 1FZKB 1OK8A 1AKJD 5EC1B 2HJFB 2ZP8A 3BAYA 3MV9B 4W4OA 5AL8A 3RWJB 1KSRA 4PY7B 2VDLH 4ODBD 3EJCA 2VISA 5IOPB 2ZX6A 1RZJL 1BXUA 2XXMB 2YPKA 1MFMA 4FA8A 5F0MB 1XV8A 3CJJA 1NANI 5KVGL 3BLBA 1A7PL 2YMXL 3A4EA 1HL4A 4A7VA 1P6FA 3A5VA 1D5RA 2DI8A 5JXAH 3VSVA 2A9ML 2AQTA 2I5YH 3EYSH 1G7IB 4HUXA 4FADA 3Q2LA 5I82A 5HDBF 4XPGL 5B3SB 5IQMA 4KI1A 2GJ6E 1PG7X 2VXSH 1VEMA 3BPLB 3FFCE 4WW2B 5G2NA 5I0XA 3ULVE 4JFFA 3H9ZA 4X9BA 3HFMH 5D7KD 4RGND 3S96B 2JCCF 2YRBA 2R69A 4CNIB 1XZ0A 4YGVA 4W6XB 1CI3M 4MJID 1G0YR 4PJEF 1F1GA 2WWKT 3L2NA 2WNXA 6PAZA 3FB6A 5L7XH 2WW8A 2EE3A 2X6MA 3ZT5A 4ABUA 2D2OA 3C8KA 2K6YA 2P5WE 5ID1B 5E08L 2DLFL 2QMJA 4KMTL 1J0IA 3VFPB 5J0BA 1QW8A 2D7TH 4G6FD 2E56A 4P5TC 2YA2A 3VFRB 1SN0A 4F37K 2BSSB 3BZ4A 3F7KA 3LB6D 4JFTA 4N24A 2E59A 4JPWH 1JG9A 4FNLL 4MA8H 3V7AE 4ZW5A 3IMUA 2C1PB 2VLRE 2IANB 2WUCH 4YFLI 1VACA 3QIUA 4OY9A 2NXZB 1GW6A 1PL3A 3L3JB 3RWHB 4GXUN 4EZLA 1LGVA 4AEIL 3BLPX 2EVFA 2Y9RT 2CIKA 4MZRA 3FT2B 3U7WL 2BDNH 2DM7A 4BXSV 3CXHJ 3RLSA 4XO5A 2C9PA 1FYTA 4JG1H 5CBEA 1L6ZA 4PJCE 5DJZA 3WLWD 1YUHA 2QVMA 2VT0A 3VXUE 5IEKA 5DYOB 3ARGD 1GY1A 1VCBC 2A74C 2JQZA 1WBXB 3IFPA 1R19A 3K71A 5HGAA 1OB1B 4O51A 2AHIA 4PRPB 1HVXA 4DZ8A 5TF0A 3TJHC 4KAQL 5SX4H 1UTDA 2B15A 4PP1C 2FUQA 5DT1L 1Y1DA 4BWTA 3UDWC 4HUUA 4KK8D 4WSGA 4HV8A 1HILB 2AEPH 2VTFA 5FYKE 1JHLH 4E5XB 4MA8L 1BD2E 2OQJA 3KPSA 4R8WH 5GGUA 5CKAA 2Z64C 3Q2NA 1VFOA 3SGJA 2WN2A 3QW9A 4YX2H 1U8PB 2VABA 1CBVL 3MLUH 4MVBC 1WC7B 4JHUA 1PLAA 5F9OL 1KBGL 1I7RB 2GG1A 4S1QH 1DBBL 1O9WA 4IOIA 4IEFB 5KZCD 4YSDA 4PJFA 2X9XA 3QI9C 3ALWA 1T4KB 4KHTH 3QFDB 2JKLA 1CFBA 2PWFA 2A9BA 3J2PA 3DX1A 3WLBA 3ARSA 1ET8A 3OKKB 1KEGL 1J8KA 1K4CA 4POZC 4HMCA 2ROYA 3F83A 3EBAA 1DFBH 3UZQB 3K7UA 5H37G 3CZJA 4RWHA 4X7SL 3HE7D 5EN2B 4GG6A 2QVIA 2YKLL 3RQ3A 1G94A 3O45A 4LEBA 5SWSE 4J2XA 4AZ8A 3TS8A 3L3KA 3MRLA 5HYJA 1RHFA 3MBEB 1DDHB 2F2HA 1JPTL 4CKVX 3IMWA 1KYOJ 4G3YL 4MYWB 3TTYA 4UV4H 2B2XH 4QRPD 5J5EA 2EINB 3NJHA 5ICUA 3FUKA 1JZJA 5IW1B 4HKBA 3VQLA 4PJGF 2Y22A 4OU3A 1AQMA 1Q72H 3CVIH 3DDFA 4URKA 5D1XD 4F2EA 2AJZA 5SWQA 3W0WD 1FIGL 2MRYA 5FIEA 2ZP9A 1HL9A 5AOJA 5AOKA 1U8LA 2BSEA 1J18A 2BM3A 3JV4A 1IV8A 2PW1A 4N2KA 1AD9A 2VH5L 1UGNA 3F7QA 4PGBA 4PW3A 4W9LC 4CJ1A 2DRUA 4CMMB 3NPSB 2F5BL 4UQ3B 1MIMH 4H5SA 4HKXB 5ICZB 3ZE1E 2FVNA 1GHFL 4L1BA 1JZ4A 1UJ3A 2FLMA 4BCXA 4B3EA 4NPJA 3T2NH 3CZSA 4L9LB 2A38A 1V05A 2B2XL 2YXWA 4Z6AT 4NO3B 2ZAIA 3QULB 3MUHL 1KELH 2Y1ZA 4YZFF 1FC2D 2HMID 2BFGA 4BKLB 2WSKA 2CGYA 3UPRA 1U33A 2R39A 4MS8C 4IDLA 4DK3A 3Q9PA 4YXHH 3H6JA 4RFNB 1OO2A 1AZBA 1V8HA 4M1GH 4MA1B 3S3JA 4H44C 4AH2A 3UTSA 4A55A 3ARED 1PKOA 3GEWB 3WV0A 3KWTA 1A1MB 2R0LH 1NINA 1RFDL 2G30A 4HJ0D 3O6KH 3SPVA 1VDGA 5C0RH 3PWJB 2V2TA 4OLVL 2V3FA 4ZMWA 4R7VA 3H1ZA 4DGWC 1AG0A 3NACL 5C0GB 5B4MD 1A6TA 4C56D 4TTDD 1F13A 4GKSA 1WWWX 4TLUA 2VUYA 3U6RB 2E4FA 4NPKA 5ID0A 1PLCA 4NQEE 4DKAA 2NY5H 4UTAL 4AYMC 4LEOB 3BO8B 2J57A 4QOKB 3T8XB 5IWLA 3D85D 4PP2A 3FZUD 3V52H 4FYTA 1A9BB 1AHKA 1ID2A 3LS4H 3FO2B 4M6ML 4X0NA 5KJ7E 5J3HC 3UADA 5BCAA 2R0LL 4ONOA 3L08A 1CICA 4LMQI 4OFVA 2MNJB 5GRYA 3RX5A 4YHNB 1D5XA 3P02A 3IMTA 5GQBA 1GS8A 5CJQL 3UTTD 1TF4A 2DQTH 4OT1H 4FFYL 3DPBA 5DF0A 2VWEE 3N1QC 4OCXL 5ANME 3QHZH 4HFUL 2JH2A 5J89A 5DC9B 1DQQA 4YHOL 4G59C 3B2MA 1I7UA 1O7VA 4OZIE 3WXVH 3UPCA 5A2CA 2FECL 4TS6A 3V0WH 1RJZB 1JJUA 2Z7ZA 5DZAA 4ADJA 5HI4C 4Z77B 3VRIA 5DC0A 3SBWC 1CLZH 2H5UA 1KPUA 3S3DB 3FQ1A 2ARJB 5I76B 3V5DB 3H9SA 1ITBB 4Y4FC 4A1RA 3IKCB 2IFFH 3PY9A 3RDTA 3G7TA 1T2QL 2L4OA 4TNFA 3CMOH 3RPIB 1F6LL 2P5WD 2NY4D 4M56A 5TF1L 3Q05A 1UB6A 4DN3H 1JWSB 4MD5B 2JK5B 4PV9B 2CXKA 4RVBA 5FO9A 1JRHH 3C5ZC 2J2ZB 3PIQA 4JDTL 2CK2A 3B2XA 4N2LA 4GJTB 3PP4L 4B27A 1U8IA 1WE5A 3ULVH 5LHDA 3TVMB 2R0ZL 2Y0SA 3ARGA 5F0PB 5CP7B 3DVIA 1HOCA 4G8FB 1PQZA 5GRJH 1GJUA 1SBBA 3IFLL 3WXVL 2HG5A 4NUJA 4HU2A 4NZTH 4B53A 3TM6A 1J12A 5J6GA 3MV11 2Y07H 1E6JH 4ZUWB 2NY7L 5IMOA 3GXMA 3CN2A 5E2VH 5AVWB 2W60A 1PLGH 3VXUD 4DK6A 3N50A 2NYZA 4ADIA 4G7YH 4EQ3A 3S8FB 3UG3A 4OCSL 3CLWA 1THAA 2OZ4L 5KANI 1IM9A 1FGVL 3IJSA 1X5AA 2A9NL 1AMXA 4YJZL 3FRUA 4P9HL 3FUDA 2AK4E 4I77H 3BKMH 3L2MA 1UC6A 2CM5A 3ERXA 3KCPA 1S7VB 3KBPA 1XIWD 2H6PB 3ABZA 2CMRL 4G8GE 4LKCA 2IOOA 5FYKD 3H53A 3WS6A 3GPSA 3HB3D 3GIZL 1SRDA 4XPHL 5FS5A 3V4UL 5FC9A 3JV5A 1XVSA 3ESMA 4P46B 2OMNA 4Y9EA 3U4AA 5DLLA 3QIBA 3F6LA 2XA8H 5C0CA 1UFGA 3O41A 4ONHB 3VXMB 1QRNB 2MNWA 2NY0D 3UYPB 5ADPL 3UAJD 3L16A 5IB2B 1XGYH 4NKMA 1FO0H 3MV9D 1ZVSA 3LXBA 3D9AH 4YDVA 4IIQC 4P57B 3STLA 4ZUUA 5B3NA 3ZY7A 4HPYL 4QRPA 3L7FB 4AVJA 4O2CB 4N2BA 4ZFOA 5HJGA 4M3KB 5FYKH 2XTSA 1XCXA 2G2RA 5SWSD 4JN2B 3WUWA 1SEBB 4MXVF 1B3JA 5FV2A 4V1DA 4PJXE 1EFXB 4RFEB 1HWGB 5E8DL 4JY5L 1MHPH 5DEZA 5C0BA 2A9CA 3S5ZA 2ICEA 2MTAA 3SKUD 3ZXAC 4JFWA 1SYVA 2FT7A 4HHWA 4FQHB 2YS4A 1Q0XL 2BVUA 3TL5A 4E41E 3KPRE 2PR4H 3S0PA 5B8CB 4P48A 4ORGB 4WFFE 3P77A 1ZV2A 1HJCA 3K6IA 1UA6H 4Q6KA 4F2FA 4WO0A 3CN1A 4QRAA 2APWA 4JBSA 4G8EA 3LHPL 2YD2A 3SKNA 4Z3FA 1XAKA 3MV7B 3M17B 1H6FA 2DD8L 3JZYA 1UWXK 3DK2A 3NFNB 4XPBH 5D1ZA 4P2RB 3ZDZE 1OWRM 4ZMLA 5IFAH 2WWKO 5IMMA 4ZYKA 4KZEH 1C7SA 1IGJB 5D6DA 1U8MB 3A67L 3VRLE 2ZONA 1ZT1B 2ZZUT 4IGBB 3ZSTA 4WHDA 4QRRE 1AGEA 3AACA 5GHWH 3NQIA 5BW7C 3FPYA 2X4OA 3PXLA 2IAND 4NWUL 1F58L 4B9ZA 1IL1A 3FRPB 2X4RB 3LH9A 4LKXA 3RVXD 3W9DB 3D4ZA 3Q1SL 4Z0XB 5I8KH 1QLRB 1B4LA 3FF7A 1DBKH 2Q3ZA 4QLRA 2FWUA 1ZANH 3K8LA 3ZL4L 1IFGA 1CGYA 5JIPA 2BC4A 4ZTPL 3DYPA 3BDXA 4TNVF 3OG4B 1NDTA 4KFMA 5I6KA 3B9KB 1AD0B 1H3XA 4RX4A 2NW3A 4B9YA 3VMNA 4HUCA 4M61B 4I0CC 3E80A 5KN5A 1P53A 4Z8FL 4BIKA 5CD5C 2WP3O 3C6LB 5DQDL 5LQBL 2EIKB 3FCSB 2X28A 3U48A 1YY9C 4WI9A 3NGBC 3W57A 5BS0E 4N2AA 4XWOC 1RULH 4XMXA 3ZK0A 1TJHL 4NN5C 4HC1H 2F8XC 4IK7A 1UCBH 1OCOB 2CGRL 4GW4A 1H3VA 2NMSA 2OTWB 3DRQA 3GUFA 1GZPB 2ALAA 2FB4L 3T6WA 1N64H 1UWEH 1N8ZA 3WY3A 3VJ6A 1UQSA 3VD1A 5EBMB 1UCTA 1ZANL 2L7QA 4FP8L 2B77A 2V7HB 4WVRA 2N56A 1AQDA 5D1ZI 3TEWA 4MNQE 2FSEB 4PSRA 2YQGA 4X5XB 3OSVA 4HU8A 5KSAC 2JKSA 3BRGC 1WT5A 1DJZA 3FHAA 1EEZB 2GJ6A 1IU1A 3RWEA 5DMGD 3CFJB 2E74C 3FFCA 4JHAH 3WNNA 2FECI 1L0YA 1HAUA 1ZWIA 3AITA 2YWYA 3NJJA 3PPSA 1E3XA 1G7HB 2NSXA 1NLBL 1MCFA 2HVJA 2LLGA 2O4EA 3HG1E 1PMYA 3BQVA 5EN3A 2VR8A 4L8SB 1NMCB 3MBED 2WWNA 5HHNB 3VA6A 2MOQA 1IAIL 3IDJA 5DS2A 1Z3GH 3FQYA 3ARUA 4K9JA 4YHYB 3F65A 5KANG 1A2YB 1BREA 2JI1A 3JWOC 3OGCB 1T3FA 4OZ4B 3GEFA 4F5CA 2P5WA 3LXAA 5AB1A 4EEEA 2JIXB 3OQ3B 1PZSA 2BNRE 3OLGA 4LLVB 4XB3A 3QCTH 3TCXA 2NZIA 3R06A 4NQCB 4Z7NE 5FECB 1L9SA 3NJIA 1I75A 4BQBA 2JJSC 5D7IF 3ZIYA 1K9TA 1N5AB 4PRHB 2VLRA 1U8OA 2Y23A 3K0WA 4OZHF 2EILB 4PYGA 1HE7A 3NK3A 4GO9A 1JZHA 4LSRL 1BBDL 1FORL 5D72L 3IDYB 1I3RA 2X9WA 4ZZFA 4U1LB 2KLRA 4R7NB 2CO3A 5HY9B 3RTQC 1I3GH 2IAMA 1QQDB 1E3ZA 3R19A 4E9YA 4M29A 4K2UL 4NM4H 2OTUA 1MFCH 4PS4L 3P4OA 4PGDB 5CUSL 3ZHDA 4QWWD 2AXHA 1P7KB 1FO0A 1EO8L 1MFUA 3V4VL 1XB8A 4D7PA 1HK6A 3MLWL 3H7BB 5FHBL 3H6AA 2HUEA 2VDOL 4X4YA 5BMFL 3K2MC 3P0YL 2HFEA 5AVXB 4AC4A 1BVLA 4DVRL 3LZNA 2A5UA 4ZFGH 1BD2A 4LDOB 3ISRA 3GFUA 4YDLB 4JZNA 2NXYB 2V8LA 3CZFA 1JN6B 2Y5QA 4FHBD 5IHUL 3NCXA 1GJWA 3KYKH 4TLKA 5CWSB 3LPPA 5A40E 2A6IB 3FAWA 3L54A 4QRUA 2GTWA 4GAAA 4IMKC 1NPNA 4PGCB 2F19H 4KNQA 2YGOA 2FRGP 4WEEA 5LAPA 5LNDA 2EKSB 2QSCH 1E8WA 2GVYA 3VYNA 2APVA 2HAZA 4PD4K 4BUHA 1MFCL 2YA0A 1OW0C 1HKLL 5J12C 3ZKMC 4U6YB 2IEPA 1MDAA 3X13B 5E99L 2G4EA 2BRQA 3GI9L 1CVSC 3F7PC 2ZXCA 3PWNB 3DBXB 3IK2A 3HS0A 3RIAK 3DXAB 5DZ9A 2MNUA 4HCRH 5SWSA 3NT0A 4QOKD 1J48A 4C59B 4KK6D 4D0BA 1BZOA 2XTJE 3W9EB 32C2B 4UQEA 1F6AA 4F9PA 5L4JA 2ED6A 1ROCA 1NAMB 1BOYA 3OHXC 3MX0A 5HGHB 1AGDB 2YPKB 5HXMA 1QLFA 5I15L 1UVQB 1JNHA 3UCQA 3CQQA 4AV5A 3LNHA 1CVRA 5DUPL 5TD4A 4MMYA 2R2HB 4HUXB 3WUWG 5ADOH 5IKCA 3MRKB 3ASWA 1D9KA 4YSQA 5IHZB 3CPLA 2Y72A 4WFGE 4ZXBA 2WJ7A 3D4GA 3KPRD 2H9GA 5D2LE 3LNEA 1AXTH 2EO7A 2GCYB 4WFFD 1WD9A 3EJYC 4OJFL 2NW2A 3VSTA 3OSKA 1E40A 4XMTA 1YQ2A 2DJ4A 4QUOA 1QBLH 1T1YA 5PAZA 3T1FA 4HQQH 4N5ED 4D9RE 2J55A 1E4WL 2VDPL 3GUTB 3WHE1 5E6IB 1XF1A 4HC1A 4NBYB 1KGJA 1NEZA 4GP8B 4NQUA 4DIXA 2VXUH 2HT4C 4ZI8A 2FJSA 2QDWA 2LLLA 4GB9A 4O2FA 2DLTA 4GI6A 2JELL 3CFUA 3MRHB 3HC3H 4ZMQA 1KWKA 1DE4A 2F58H 2IVFC 4KI5F 5LNEA 1ZTMA 4OIAA 5K9OA 2HKHH 1IBGH 1VACB 1FZMA 2QFRA 4HIEA 2NLJA 2PP9A 5ESQB 3TVMD 2X6UA 1TENA 3QXTA 1L6XA 2R4RL 1FFPA 3RZCA 4P49A 2FJHA 4YDIH 4UANA 2QDVA 1VPOH 4FL4B 3RWFA 5LGJB 3FTGA 4M03A 2CIKB 5J13B 4L5FL 4S1RL 3PAUA 4Q9QH 1HWHB 2E7LC 5EIIA 4BCZA 4YSCA 3WSQL 4K8RD 4QHMA 2JJVA 4XCNB 1OM9A 4MMXA 4XVOA 3IAGC 1OE2A 1TLKA 2AITA 2AVFA 1T7VA 2FJGB 5BVPL 2ARWA 1J1PH 3JV6B 1B2WH 3AY4A 5A6IA 3KL5A 2IOIA 3D2UA 1NMBH 1KIPB 1MJ8L 5GISH 1U8JA 3WS3A 1FG2B 3C5JA 3PL6C 4HUUB 1S6NA 3OXSA 4NQEA 1HL5A 5GGUB 1MG3C 3GGWA 3SDCC 5FCUL 4LEEA 3ULSA 1LO0L 3P3UA 2F74B 3K5SA 5IJCC 5KOVC 3RBGA 4P46D 2BP8B 5CGBA 5LDUA 3M46A 4IOIB 5DHYA 2O5ZH 1SN5A 5CXPA 4F33B 4K8RH 4CA4A 4G7QB 1NC4D 1YEJH 3F01A 2AXWA 3L4YA 4ONGL 3BW9A 4XNAA 5EU5A 1PG7L 1IAII 4MNQD 1U4FA 1AGBA 1S7TA 4AGPA 3MAWA 1U91A 5GS0D 1J1PL 5KVFE 5DD5L 1SDYA 4EUPA 2PPDA 2CNZA 2N4IA 3FO1B 4OCMC 1R5VA 1WIOA 2UZIL 2EUWA 1KLFA 4UQ9A 1AZNA 4OZIA 2Y7QA 4ZMOA 3FU6A 4FFTA 4OZGF 3NG5A 2YRPA 4DAGH 2VC2B 3MRLB 4LASH 3X3FH 4ETQB 3B7RL 4X4XB 4Z3HA 1H3PL 5T5FL 1IAIM 3BSHA 2PN5A 2QKSA 3GXPA 5IB1B 1N7MH 2X4PA 3VXRA 4LEXL 5DJYB 5IEHA 2V2XB 2W9LA 1JVLA 5DVKA 2WC7A 1S46A 3G5ZA 1EZUA 1YEJL 2AJZB 3FBKA 2IGFL 4WHTB 4PJHE 2XWBB 4ZG1A 4AWJC 5CO1A 5F7FA 2XQBL 3QRBA 3D1MC 4FYRA 1XH3B 1Q9WB 1FFNA 2NR6D 4NOFA 3MV7D 1CD8A 3A6BL 3V7AG 1OLZA 1GYWA 4HEME 3VDAA 4H5SB 2CA3A 1M1XA 3DGGB 4NQXB 4KK5D 4Y4HC 2NPLX 1A7QL 3I50L 4IGBD 1J88A 1LO2L 3BPCA 2CPCA 4OVVA 3N44F 4JFZL 4V2BA 1J8SA 5AB0A 1I3UA 3VTTA 2QPFA 2B59A 1TZGH 3KGSA 3MUZ1 1JF1A 3VSQA 4O00A 3LRGA 3T4AA 1RJYB 3NIFE 2EDKA 4P3CL 1JPEA 2QVFB 1TQUA 4JDVB 2AK4A 3PDGA 4MD0B 1P6AB 2DJMA 4Y5YC 4G8GA 3ATDA 4KGLA 2CUIA 3A4AA 4L2YA 5EG6C 3CWGA 1XF3B 5KSVB 5CEZE 4KV5F 4HUWB 3VXNB 5CFHA 1FCGA 4XAWH 2I32A 1GL4B 2FR4A 5EUOE 1A14H 3SPVB 1KN4H 2QHRL 1J10A 1F8TH 4AQ8C 3KAAA 3S3SA 4LPXA 4NNYA 3QJVB 1MSPA 1U3ZA 5EPMA 3TA3B 4DNLA 4PY8J 4QTIH 1TTAA 4ODSL 4D0DA 3TFKC 1B3IA 5DD3H 4JO3L 4UILH 1Y18A 2WKOA 2VN6A 1NFDA 3D0VA 3TCTA 3HC2A 5FW7A 3HUJF 4F57L 7FABH 2HYMA 1H8OA 2QL1A 4KJWD 2NY3B 2ICWB 5TDPB 4PJXA 1ED3A 2XTJD 2OMXA 2WO3B 2NCEA 4DP2X 4HFWB 1KV3A 5ESAA 3VFNA 4LSSL 4CDGC 3GJFH 3DX6B 1Y6NR 1PKQB 1OF2A 3AXIA 3AG2B 3PQYE 5F6IB 3DROA 2G3MA 5DUMH 2P3YA 4E41A 4BFGA 3QS3A 4FJ6A 2VXQL 4A63A 1AS8A 5CP3H 3DX8A 2DDQL 2FX9H 2RQEA 3GMNA 4K9EC 4KHXH 4GMSL 4X83A 4Y4FB 1P4BL 4A6YH 2YFNA 2XWDA 5FR3A 1A3RL 2EUXA 1FDLH 1RIHL 2HRGA 4H26A 4QI3A 3H3PH 3HNVH 1NMAH 4KH9A 2YA1A 2XNAA 3MGOA 3GNML 4WKXA 1RAMA 1BQUA 5FOBB 2JIXD 2PWGA 3Q6GL 5FA3B 3WFBH 4YL9A 4NQCD 2X70B 4XPTH 3O9WA 1LK2A 1TYRA 2XC8A 1N12A 2CE6A 5KBMA 3T3ME 3TLRA 2R1WA 4QRRA 3GZPA 4D9RD 1L9PA 4PRHD 1I4FA 1FLRL 1P5VA 3DJRA 5F89B 1VB9A 2J88H 4QT5B 4JKLA 4U4IA 1UB6B 3CN3A 5I1KL 3DHJA 3K72B 4QKXB 3WJMA 5T5FA 1BHGA 4CMHB 1DLHA 1TKWB 4X8GA 4YO0A 2G5RA 5HBBA 4AW4A 4FNSA 3LKRB 1QLEH 4QY8A 2FX7H 1CU4L 1F2QA 4IS6A 3VFWA 4DQAA 4CADA 3RVUC 3S36X 4L0YA 5EA0H 1PQZB 1PW3A 4MJ6B 4AIZA 3CHXA 2JCWA 4NM8H 7PCYA 4M4RA 1TQSA 1ROWA 3C9NB 1YAZA 4UTBH 1J1XH 1MCHA 5EZIL 4AEHH 4DW2L 1V3KA 2ZSVA 4LBEA 3M88A 2GITA 1JDDA 2CR6A 4X5RA 5BS0A 1T0NA 1H5BA 3G6JE 1OZTG 2W60B 2OTPA 1IFHH 4PJ8B 3TIDA 1MH5B 4XGZB 2DBLH 5EIIG 5F9AC 1X7QB 4M8QA 3V5KA 2XZZA 3ZHKA 3CLFH 3ZL1A 2EYTB 5EO9A 1OCRB 5HHVL 4ENEC 1TEYA 4FLQA 5JIQA 5T3XL 1S9WA 3MQIA 4JRXA 2WMPA 3ZU8A 5J8OA 4LCIL 5FGRA 4EI6B 3KMDA 3BCFA 3EW3B 3PWUA 3E6HB 2ROXA 1H8SA 2A6DB 4JRYA 1UM6L 5IG7B 2J4WL 3VRJA 4IIQB 3EADA 5GS3A 4MNQA 2DQJH 3ZE2F 3ZYOA 3GTVA 2CXGA 3CFNA 2HFTA 3N2JA 3S4SG 5L8KB 4F7PB 1FNFA 3CLEH 4K7PL 2J72A 1LHZA 4MDJB 1U3YA 3KBEA 1CFVH 3QIBB 2WWMC 4UOQA 4X80L 5C0CB 2L7JA 4KX8A 2B1HL 3OJVC 3W82A 2OMWB 3CC5B 3DXAD 4AK2A 2IPUK 4G7VL 2G5UA 3HG1A 1CK0L 2X4QB 6FABL 1QWHA 2LGNA 2EKJA 3LN9A 4LHUA 1ZS8A 1OHZA 4ABVA 4WNJA 5IFHL 4M7ZC 3GIVA 2E4TA 4ZUUB 1CFSB 3FPXA 3L1GA 3K2KA 2CSPA 3BGFC 2QQKL 1IKFH 2XZCH 4EUPG 1MJUL 1ND0A 2WHVA 3BIBX 5E51A 4U1HB 4V1DB 5L6YL 1BOGA 3LSOA 3OLDA 3PG2A 3FQXA 2BNRA 4WU7B 2L04A 2XPYA 1E28A 4RISH 2DKUA 1OQOA 1NCDH 2QHLA 5GSRA 3K6DA 4FTVE 1BLIA 3QUYA 4XCFL 2QGCA 5BV7L 7TAAA 1B4RA 1KIQA 3P69A 2NR6A 1MUJB 3NUKA 2OJEB 4P5TD 3KNBB 1UZ6E 3QCVL 1WFMA 5E1GA 4G2AA 1XH0A 1EV2E 2G5BB 3P77B 4N22A 5E24E 3L1OH 4E9RA 4M00A 1KXVC 4LLWB 1NAMH 1A6UL 4XNUH 4G8EB 3PWPE 3SKNB 1I1AA 1OSYA 3BD4A 3KL0A 5E6ID 2VQ1B 2YZ1A 1GYCA 3FH8A 5D1ZB 5H35B 4LSPH 2EC9U 1LMIA 3QQ3B 3ARBB 1Q1JL 3CXDH 1AO7E 1P9MC 3CCHA 1ERNA 1FH2A 4G1EB 1FVCB 1JWMA 3TCLA 2ZQKA 4OTXL 1DJHA 2X4OB 4JM2C 5C0AB 4AEEA 1EA9C 1HT6A 2BNQB 3MNVA 4DGVL 2D73A 3ET9F 2PF6A 1YRKA 1Z9PA 2DTSA 1PF3A 3GSRA 3TJHD 1RZFH 1L5GA 4PP1D 4OKDA 5E2UH 4OI7A 4ZS7H 1W9XA 4WU5A 2OMZB 3MJ6A 4EVNA 4NN5B 1KT2A 2X40A 3L2LA 1Z0NA 4DPAX 3Q8AA 4FQQA 5J6HB 3TWYA 5KVFL 1MJJB 5ITBL 4MVBD 1HOEA 1VEPA 4U1MA 4W9FC 2NW3B 4X5QA 5CP3A 5DRXB 5CEZD 3PJLA 4X7CC 3IPEA 4YUEH 3UTZA 1KBKA 4LLYB 4A6YA 3GSQB 4F7EB 1E5ZA 1IGTA 3RX9A 3BP7A 3QI9D 3B83A 2AK1L 2LT9A 4TQ8A 3I9GH 5DJAB 3AM8C 4N26A 3CSBA 4FF9A 2CBOA 4ZBJA 2ADJA 1WAAA 3HC4L 3II2A 4NKOB 4KPHL 3BX7C 3QDMA 1HCZA 1KGUA 1AE6L 4WWID 1G6VK 4NAQA 4ANXA 1EDQA 3R1GL 3DRQB 4FOMA 3LEYH 5EU3B 5D7SH 3EOTL 3B6SA 2R0WH 5I16B 3MRFB 1OXYA 4FQ1H 3UEZA 2MWCA 2KDGA 3UAFA 4UM9A 3WMPA 1JGDB 4JM0A 4F8PA 4OSUH 5I73C 1AQDB 4AE0A 1ONQA 3BP5B 2DM4A 2YBGA 1W80A 5CEZH 1OAYL 4F8LA 3LMJL 1I9RL 2WAHA 5DTFA 3N40F 1RUMH 3UG5A 5E1AB 3D7PA 1KGXA 4DO4A 3PQYD 4WRLA 1ZWIB 4NO5A 1HDMB 5C7ZA 4H0HB 4AE1A 3DK0A 3BVVA 2HVJB 5D2LA 4Z7VF 3CC1A 1KFAH 2Z31A 3LVEA 2H3KA 5DJXA 1E90A 3GHEL 3QUXB 2PXYA 2XZAL 1A47A 1LEGA 4LOFA 1QABA 4U7KA 3SDDA 2EDEA 4CVXA 2CAKA 5CHNB 2UXGA 2XT1B 2Y7LA 1GGBH 2G0LA 4L3EB 4YHZL 2BZCA 2CKBB 4D2NA 4Y5VB 1BV8A 4JZJC 5AW3B 3AQXA 3UYRH 1E5CA 4I18C 3EBIA 5TTRA 2F08A 1G7MB 4NGHL 1S7WB 4JDZB 3U25A 2CNYA 4NQTA 4NP9A 1WHOA 3GRWL 3UO8B 2FX8H 2WINB 1ZLUK 3MZGB 1I3RB 1E43A 4N9OB 4RGOL 2YZ8A 4UAHA 4W81A 1KB5H 2NZ9C 4MS8D 2YPVH 3BKCL 4K94C 4O58H 3ZE0E 4AEFA 1NH6A 3HG0A 5DEGA 2NUPA 2YPLE 2PW2A 2VNCA 4JKPL 3ZTNH 1V7NL 3CFKA 4X5LA 5MI0B 3KPMB 3RNQA 3IMBA 5EO0A 5KBLA 1VGEH 1GSKA 1N70A 4DQOL 4WF7A 3QJHA 1KTCA 1XMWA 3SOBH 1J9SA 5CJOH 3ALPA 1RZKL 4X4YB 3BUQA 4HGWA 3FYIB 3LIZH 5BV7C 2YUWA 5KSBE 3WL9B 1MVUA 1BVLB 2BSCA 1URIA 3HZVB 3P9LA 4FNRA 4P8QA 4X5WA 3F64A 4K5NA 1MCKA 5J12B 3O6LL 4H0GA 5FUZL 2Y2YA 1NOAA 4XN9A 1IEAA 4P2CG 4PJ7E 1I9IH 2VRKA 1B0RB 3JTSA 4RETB 3DX9A 4A7GA 2CCVA 3DUHA 3OZ9H 2C3XA 1SQMA 3DV6A 1CD0A 1MY5A 2GT9B 4Z7QE 4WI2A 1T83A 4N0FA 4GRLC 3SE9H 4PQXA 2HKFL 3TA3D 4OF3A 1G6RB 4I0PA 4D8PB 1MOEA 1DEEB 1DJSA 5E2TH 4AV4A 1NKRA 3BI9X 4UWQB 1X5FA 2O1AA 4OJYA 5KVEL 5J3HD 4A39A 1UH3A 1OSZA 4QTHA 1ACZA 3NCYS 3PGDB 4DERA 3LV3A 1RZ7H 2FO4A 4XOEA 4UV7H 4S2SA 4APQA 3OXRB 3T6QC 2ICES 1IGYA 3VG9C 3CX2A 2DIEA 4GP5B 4JZOB 2GEQA 2RFXA 3ZDXB 1C08A 5ABDE 1CE6A 1XF2A 1F6AB 1AMYA 3MCKB 4OLYL 3WKNA 1HL8A 4YIQA 5D5MF 4HLEA 3LQZA 4AL8H 2DEXX 5AD0A 3UTQB 1CI5A 1JXKA 1RURH 4LHUG 1T7YA 4XMVA 1R4XA 4M7LT 3U1SL 4A2LA 2FJFA 5MEQA 8PAZA 5HI4D 2V6HA 2K7PA 5DFWH 5JOEA 3RI5F 1DZBA 1P4LA 4GXFA 4WK0B 1JGUH 1S2EA 3A6CH 4GUPB 4Y1AB 5IKCB 4Y4FD 2XX1A 1VFMA 3Q5OA 5TK2A 4EZMA 5I2IB 3B37A 2FQEA 2E9GA 5D7EA 2XRAH 3M45A 4HWEL 1X9RA 3P11L 4UV7L 1MWAL 4P2OB 4DP8X 4M7JH 1AGFA 4N9GA 3MBXL 4CDHA 5E2WH 3MPCA 1Z5HA 2X3AA 2A4ZA 4HLZG 3KXFE 1H0DA 1D2PA 2A74A 3WIAA 3UP1A 3RWDA 1JUFA 4YMPA 3KPPB 4OCRL 2AVGA 4AQAA 4N0YL 1XCQB 3A21A 5FGCB 3AGVA 1AZVA 1LWHA 3IGUA 4RNRA 3MLZH 1DANT 4DGYH 3QZWA 1AO7D 4BZ2H 4HT1L 4PWJA 4QJ5B 1N6QH 2D31A 1WLHA 5EEYA 4JAMA 4IBQA 2PTTA 5F3BA 1NCGA 2GB2A 4GAJL 2ID5A 3C75A 2E3VA 1JBJA 2DAVA 5C7XL 5FO8B 2AXFA 1I9EA 2YSSA 4R90L 4P2YA 4ZMAT 5EOTA 3GMPB 2AAVA 1PX8A 1DL7H 4Y2OA 4AITA 2EE0A 5AOLA 5EUOA 5HHPA 4F15C 1HS6A 5EIIB 4J3OG 1CG9B 3TOPA 4LGPB 4MFHA 3FSZA 4JW3A 3GYRA 4XNXH 4BWWA 3PYCA 1S5HB 3BT0A 3OMIB 1GY2A 5DD0L 2H3NA 4XMKH 1EWHA 1H9VA 2AQNA 1IBHA 1OGAB 1ZHNA 2I07A 2EAEA 3HZMB 2GBTA 4KTEH 1ZRUA 2PO6C 4ES9A 3WS3B 1MRDH 1SFDA 4HCIA 5EOQL 2KL6A 3WIIH 3V4VB 1N6QL 3S4SB 2G9HA 5JA9A 3MJ8A 2VDOB 3CFCL 1GZHC 3ILDA 4K5LA 4O9HL 5DHVB 5T1DL 3DYOA 3WFDH 4BV1A 5CSBA 2WZPA 2WZ5A 2B0SL 4L1LA 2OULB 1BQHA 3AAZB 1FNGB 2XN0A 3EFFB 1CE1H 1JD7A 2GC7C 2YD7A 2J5LB 5IW6A 4LQFL 2VZOA 1BZ7A 2AQRA 1M1SA 5F1IA 2F7OA 3MUGB 4Y5XB 5ETUA 5HYSB 5HDQH 1MCEA 3GMRB 3DVFA 3DETC 1KB5A 2XWZA 3NIDB 4FMVA 5FGBC 1MWOA 3H55A 3L4ZA 3OX8A 5EBWB 4C4BA 4EUPB 2IALA 2OW7A 1JFHA 2AEQH 4U1SA 3GO1L 3NIGE 4M1DL 5B38A 1R5VB 3SGEI 2R23A 4BUQA 1BEYL 4OGYL 3VXSE 4Z7WE 5ICXA 3GB7A 2IDSA 2HLEB 3PGFH 4F3FA 3LQAL 1NWPA 3LEVH 4QEGA 3LIZA 2PYEB 2Y5TA 5E5RB 1J7VR 4FQCL 5DVNA 3T71A 1G7JB 1WWBX 4Z0BH 3O3AA 5HYFA 2X4PB 1DQVA 3VXRB 3V0VA 5G4OA 3KR3H 4EDXB 5IEHB 5LKNA 3I6SA 4JDEA 4EN3A 5BNXD 5F3HA 4EOWL 4A7QA 1TYEB 1I7TA 3SY0B 3I75B 5DK2A 4QXUL 2J1WA 5IBUG 1OCWL 1AC6A 1XL4A 1W0YT 2FZ3A 1Q9OA 1BX2B 1NCTA 2F1EA 2HFFA 3FQWB 5F1OB 4MKMA 4JFPB 2CO7A 3KH4A 4G7RB 1MLBB 4LVOB 2EZ0D 1CZ8H 3OAUH 2RQ8A 1UXSB 1ZD6A 3MOBH 5ACZA 1OSPH 1CFQA 3GWJA 3H2WA 1NCAL 2JJTC 3ARBD 1OPOA 3BP6B 1NGQL 5FCSH 1CT8B 5CN3A 2VMJA 1PFCA 4Y5YB 1FVDA 1R5WA 5C0AD 1LP9B 3QZMA 2BNQD 2CK0L 2YPLD 4Z9KB 2RHEA 3G6JA 2EUVA 4I9WD 5C9JB 4J3WA 5H4ZA 5C0FA 3IE9A 4JFEB 2VSKB 3NA4A 4Z0BL 3Q3GA 1YY9D 2Q20A 5C08E 3EJPA 2VDPB 2BHYA 4L8BA 3C09C 2VLMD 4TNVK 5AW9B 3O81A 1UOVA 2CBQA 3FQTA 5M95B 1OAXL 4PEEA 12E8H 1UM5L 1FLTX 2AJUH 3MOAH 3D50A 3VQMA 3VVVA 1AOZA 4M6OH 4UDUB 3UERA 2FD6L 2B20A 4TSBL 2Z3FA 5GGRY 2APBA 5BVJA 4N1HB 3MMEA 3SE6A 5C70A 2A6JA 1J05A 1UACL 3IFNL 4NSKA 5DWPA 4CW1A 3SY6A 1VKXA 3HNTH 4U6XA 1YPZE 1FE8H 3S34H 1WTGT 2NYYC 5L4IA 4TNEA 5ESVA 4P06A 1QTYT 4YHPA 2DWTA 3D48R 5KSAD 4ZD3L 3OL2A 1YC8A 1U8CB 3I3BA 2C7UB 4BFBD 2BCKB 3FTZA 3U36B 5F7NC 5DMKA 2WXFA 1TVBA 2J6WA 4YXKL 4JVWA 5T1MA 1EHLL 1NFDB 4UT7L 1EFQA 5EZLA 1AS6A 3WKMH 1NCIA 4HCFA 4Q8BA 3QXAA 1E67A 4JUSA 4MBOA 4QGTA 1R24A 3LEXA 3MOAL 4NN6C 1ASPA 3KYMA 5I24A 1IQDA 5IVXB 2N01B 1NTDA 5I8CB 1XH1A 4X9FA 4BZ2A 2V8MA 3QEGL 4ENZA 1BXAA 4L2LA 4FTVA 5I1HH 4RAUB 3DX0A 2HT2D 2OMVA 4B9KC 1C1EH 5TQ2L 5E6ZA 3EF7A 1S9XB 4HUVA 1EVTC 2R8SH 3C5ZA 1WFJA 3BWUF 3QJSB 3EGXA 3QUXD 3AABA 2FIKA 2PP8A 1A3ZA 3MRQA 4NC1C 1F6FB 3DIFB 4HJEA 1KPVB 4JJHA 2ZOWA 3PWPA 1A1OB 2XCMC 1I1FA 4ZOEA 4F27A 2XNAB 1KPRB 3DURA 1PYWA 3EG9B 3MGOB 4L3ED 4LLMB 4UQAA 4CN1A 4NHCH 3N42F 3RTQD 1N68A 4Y88A 4F8QA 4PCYA 1A8JH 2YMOA 4QHLB 1K2DA 5EWIH 3JWOH 2EEXA 2XXFA 3WO4C 2J1KA 1U95A 4HLJA 3B7UX 3F2LA 3IDGA 4UNVA 2DWEA 2P7TA 4ESKA 5AZEL 3VI4E 1KGWA 3FU7A 5CBAA 4ZQKA 2Y6TE 2AEWA 3H9HA 3VFTA 5FYJU 1P84K 5C2BH 1BM3L 4YO0B 3BRDA 2BY1A 2NY6B 4YPJA 3V0IA 1ZKAA 1FAIL 3FU5A 4GG8B 2Q10A 4BRVA 1FWXA 4N8UA 4ODWA 1INEH 1JYWA 3TYFA 3KH3A 5C07E 4CADB 2IG2L 4KQ0A 1MLCA 4HUKB 4R26L 2QKIC 5I18L 1G9ML 4MAYC 4PJGA 3QEQE 4ICWA 2ZSVB 2B3RA 3KG5A 3KJ6H 1D6EA 1EO7A 2GITB 2K3TA 3JTTB 4WO4A 3WCYA 4N8CH 4BRJA 5JPNB 3TIDB 4I5BB 5E0FA 3HZ3A 1BGXH 4P4RA 3C8DA 3UL4A 3ML8A 3OHMB 4LLAA 1GW0A 2VR7A 3QO0B 5KYYA 5EO9B 2ZAHA 3D2TA 2H41A 2Z93A 3GK8H 1I8AA 1T20A 2KLTA 4XN2A 3WAKA 2X3CA 1CTOA 3FQNA 4MX7B 4PJIB 2AV7A 4JRXB 1W0WB 1LILA 3SJVE 5JOPD 2BSRB 4XAKE 1TETH 1KNOB 4GXUM 4BFOA 3GJEA 1FZJA 4A2MA 2BS8A 1BZQK 4YHKL 4JRYB 4TLTA 2ZX8A 2AZAA 1WAPA 1KTDA 3QWRA 4JPVH 5G55A 1G9NC 5TFSH 4LLQA 3BGFB 4Q9CA 3VD9A 1KC5L 3CDZB 4TUUA 1QNZH 1PIGA 4FTDA 5EDSA 1WUZA 4MA3B 2UVEA 1QR1A 5DVPA 2XG5A 3MXVL 1X5MA 3PV6A 2QPEB 4H40A 4LHUB 3QEHA 2KI6A 2ERJC 1FVEA 2V5SA 3RUGB 4BWUA 1N26A 3FT4B 4U33A 1S7UB 1Q9LA 3JVGC 1BM7A 3K0YA 4MJHA 4YE0A 2IV8A 1GZQA 1SHWA 5DSCA 3QQDA 4XCEB 3QJZA 4UCFA 3REVA 5IB5B 3EJYD 3VFGH 2FBJL 1G6RH 2IQ9H 1BOGB 3GBMH 5MENE 3F3HA 4OIBA 1FL5B 1G4RA 2Q3AA 3UFIA 4Y1AD 5KW9L 4MCMA 1TZHA 3U4BH 1KEML 1E4HA 3I6LE 3APCA 1N9PA 1SM3L 3C8HA 3I2CL 4DVBB 3KS0H 1KIQB 4HAFA 5AQ0A 2P5EE 2CHNA 3AZUA 5IQ9B 3T5WA 3IGKA 3MNZA 2F5AL 4NWTH 2XETA 3IRCA 1BECA 4R4FH 2EDOA 2ZJSL 5DRWB 3U9UA 4P2OD 2IPTH 2FYYA 3RKDC 2V9QA 2Q8AL 5A3IC 1B6UA 1RIUH 2HRLA 3S36L 5IBLC 2DQCH 1XGUA 4CC1A 2JB6A 2B4CL 3L9EA 4G6KH 1QUNA 5D7LE 3VXTB 3BZEA 4B5ZA 3CN0A 4MMZA 3TBTB 3HS8A 2FWLB 3UJIH 1TO4A 2W0FA 1PZ5B 2O6FA 2IPUG 1E3FA 3BQUB 4YXLL 4PJBE 3HR5A 5D2NC 1N8OE 4NUPA 3BD5A 3EYUH 1F4XH 1HINH 1WA2X 4NENB 3U7YH 1GGUA 5KSBA 5L9DH 5FYLL 4ZFFA 2BHFA 4BH8B 4HULB 3QJOA 5I1JH 2GAZB 2X09A 3D25B 3BJ91 4XOCA 4HOZA 4PJ7A 3E7JA 3N41B 3Q48A 4I3RH 4Y4KC 3TPKA 1L5GB 2ILLA 5C08D 1O7DC 2Z1PA 3PL6D 5TJWK 3RWCA 3TT3H 3TJPA 3CPUA 1KT2B 5L2KE 1S9YB 4JANA 3P2DA 4ZUSB 2G4GA 4N2HA 4NUGH 3V8OA 5FUCC 5LGHL 3HMWH 2C9XA 3FN0L 4L3FA 5CCKH 5JXEC 1OGAD 3U1QA 2IBZX 4B0MM 2W9EH 2FNWA 4R4NC 1D6VH 4KK9D 2O61A 1TQCC 5GRXG 1CO1A 2ZXQA 3FSAA 3SCMB 3D06A 4JG0L 5IF0B 2FEDD 1NJ9B 5K1NA 3BP7B 2X4UA 1YEFH 1G7QA 3MR9A 5I73B 1W2KT 3V9EA 3RVWC 2V2WA 2RAMA 4AM0A 4A38A 1S7XB 1UEYA 2WLLA 3WFHA 1TVHA 4J4PA 1AIFA 2VDKL 5CLZA 3HI5L 1TTUA 4WQOA 1E8YA 3T0DA 1FBIL 4DO6A 4BELD 5DD6A 3WEMA 1QKZH 4UM9B 4GAYB 2EDDA 2BJML 3EDDA 2EDYA 4UNIA 1U0QA 2QV2A 2Y3AA 1A7BA 3EZJB 1MCPH 2JJSA 2VDRL 2CLRB 5I1LA 3DSFH 3BDYL 4HIHB 2YLHA 1WFIA 1QMUA 4FQIH 2XU9A 3TEXA 5JORB 2DQHH 4JFVA 2Y5EA 3LNDA 1MFDL 1M6OA 3VFUB 5MEPA 1HZKA 5DD1L 4X5PA 4NO5B 3RU8H 2CHDA 2OXGA 1E50A 4N2MA 4JZJB 2Z31B 4YPGB 4MCYB 1AVAA 4KDTC 3IAQA 3HAEH 3RTQA 3MA9H 1A4AA 4QRSB 5I17B 3MLPA 3FCTA 4RMRA 4WJG3 4APXB 3ILEA 3HW7A 1Q90A 4RMTA 3J27A 4ZUVA 2PYED 3MGAA 4JO1H 3T04D 4CVXB 3KXFA 4JPIB 1XT5A 2B5IB 2E47A 2MEJB 1JI1A 1N10A 3SO3C 3LZLA 2Z35A 5IBUB 4Y4HD 4CSTA 1EAQA 2CM6A 1S7RB 4R4BB 2XVGA 4NI3A 4H7VA 4RQQA 1NOLA 3NJNA 5D70H 5HHOE 5SWZA 3SQOL 4L8CB 1MAJA 3I6KA 1OALA 2MCPL 3S35H 2MHAA 2HVKB 2MQCA 3VXOA 1U93B 5LXGH 4FQXA 3C08H 43C9A 1BCIA 1YEWA 2NRDA 3EOYG 2Y36L 4R2GB 5DZNA 2VQUA 5JIMA 5ITFA 2XV6B 3EDKA 3MV8A 3ARWA 3TEZA 2OMTA 1HXKA 3LKPA 5BV7B 4GQQA 2XFXA 2ZG1A 4AT6A 3QE5A 4XMLL 3JYCA 4ODUA 3UTPD 1KG0B 3EGDA 1FNAA 1KN2L 3AXLB 3EFDH 4OV5A 5KS9F 4LCYA 2DS4A 1OW0A 5JIIA 2O5YL 4PGEA 4I2XA 4LCCC 3EHBC 4NYLA 3SYCA 3FBQA 4LNRA 1PEZA 1Z0MA 3H3KA 2QTEA 2XZQL 3UAAA 5ILTL 4LOUC 4JL1A 3QEQD 5JPMC 1W72L 3TH3T 4PJFF 4DO5A 3ELAT 4HGMA 4BXVA 1FL6A 4KKRA 5C71A 5E6UB 1WEJH 1LLAA 4BFIA 1DQJB 2PKDA 5GIRB 3TFKD 3JTSB 3MA7A 4Q6IB 2EDHA 4AQEB 4WEBL 5DURB 3V0HA 1KENH 1EAJA 1OT4A 3VFVB 3LN5B 4GG6F 2OMYA 1FN4B 3VG9B 3DV4A 4PB9L 4AUUA 1RZQA 3SZKC 4R0LC 2ZOLB 4JVUA 5CJXC 4XXWC 3S3PA 3BPNC 1L9MA 2A7BA 3QORA 1A7RH 3RWGA 3BPOC 4H2CA 2HN7B 3EBGA 1VF5C 3ECWA 3T1WA 4ACTA 4QTHB 2JNZA 2QGBA 1X5JA 5GGVH 2BFVL 2H26B 1MHEB 1MVYA 3BIKA 1N5YH 2XWJB 1PZCA 1RVFH 1DN0A 5KYWA 4Q14A 3NCBB 2VDQL 5IT2H 1YMHB 2YJLA 4ZSOB 2G60L 2YGNA 4WTXA 5JUEL 1MFVA 1A25A 1RHHB 2X0WA 4Z7WA 3VXSA 5DWUL 4AYSA 4P23A 4GOSA 4JY4B 2PPFA 3D4YA 3F04A 3KLKA 1CE6B 2DWXA 3BAIA 2QQLL 4HXBL 3LQZB 3TWCL 3UEQA 2Y7SA 2OFQA 1XTLA 3WTWA 3T2QA 4BFNA 4TOYH 3FMGH 4K3JH 2JLLA 1M42A 4UIKL 1MW1A 5KAQG 3WJLC 1CGXA 4HS3A 3VXPA 1E30A 1F4AA 1Z9SA 3K1KC 4XVJL 4PMEA 4HF5H 4BZ1L 4MNHA 4F8OA 2Q7NA 2V5MA 4RH4A 1XBRA 1Q0YL 4TPRH 5B39B 3MTXA 4KQ3L 4XVTH 1VAHA 2WKLA 3IN2A 3L9RB 4GRWB 2ZAGA 4K9EH 4NP4H 2XYBA 5E03A 5CZVH 3EJJX 3KLDA 4PW4A 1HU8A 5F9DC 3STZB 3RWDB 4FXKC 4I8DA 5CU5A 4LAJH 1T5KA 3BYYA 2WNWA 4HWZB 5GRVK 1QFWL 3AUVA 1AS7A 2YK1H 2NTFB 4YDKH 5L0QB 3MJ7A 5GGSB 3SQRA 2NY6D 1OT2A 2NNRA 3ESPA 2YEVB 3WNMA 3SDCA 4XMPH 2OYMA 4ENED 4KTYA 2KQMA 1NGPL 2LAGB 3JWDC 4X99A 4WK2B 1I8LC 4PRNB 5MERA 3OD3A 3REWA 3MLTB 5HHPB 3B34A 3CHQA 3EUUA 1GGYA 2BSTB 3TT1H 4XO4A 4J3BA 1TZIA 4YDZA 2E86A 5CZVL 2M83A 1YPZA 4QD2E 1T0MA 1BA9A 4Q2ZB 2Z8VC 5F0LB 3TO4A 5JA8B 3HAEA 2ITDA 3L5WA 4JEGB 3AJ7A 3ZUCA 4BKTC 4GUQA 3LDBB 1BYOA 1OGTB 1GMEA 1Z5LA 4Q6YA 3WTVA 3OZKA 5CLWA 1MQKL 2WLIA 4PWEA 2F8VA 4TKWA 4EBQL 1HZHL 1IC4L 1MREL 1YECH 3GMOB 1BIIA 5CSZA 4Y2DC 4H8HA 2P52A 3DJTA 4H1LG 4TUJA 3O6FC 4Z7UE 4HJTA 3CVDA 2WLMA 1YYCA 1BFVH 1EZVX 1CBJA 2EDJA 3NZHL 4R7LA 5DI8A 4BK5C 4Z7OB 5C0JB 1HHGB 1TTGA 1PZ2A 1GGIL 3NJMA 2COQA 1P7BA 1QI3A 4PTUB 3BH8A 4JM4H 5ETUB 2ZG3A 3MI6A 5HI3C 2FO1A 5D4IA 4M6NL 1J9CT 1HSBB 5EU6B 3QWOA 4OLZH 3HNSL 1ICTA 2IALB 1XGQA 3LS5H 4U0RC 2MH4A 4JFOA 3RVVC 4HZAA 5CMAB 3CHRA 2NX5E 2ODHA 3RZWA 3KEHA 5AW8B 5GRZA 1GIGH 3U9PH 1I85C 3W81A 1W15A 5KBPA 5E1IA 1T21B 1ACYL 1NCBH 2CG9X 4YH6A 4EF3A 3J8F7 4P3DA 2TSBA 2NTSP 1DSYA 2ADFL 2XPZA 1BFSA 2ITFA 3BKYH 1EAPA 3N04A 3CSFA 4ZUTB 1JHKL 5DHMC 1ETZA 3BUBA 4PTTA 3A4DA 3WKYA 1IX2A 5HHOD 1O7SA 3K2UL 4LPWA 3VI4A 4ALAC 5I26A 4DEUA 1NGXB 1JWUB 4JM2D 4L8DA 4X6CE 2J6EL 4HJUA 3UABA 2AJYH 4X8CA 4J3VA 1NFIB 2HFFB 1U41A 2VDMH 4ODXA 5FYKU 1M7DB 2QBWA 3NH7L 4M5ZL 5GJTL 4RRPM 5CILH 3W5MA 3I6GA 5C07A 5ACZB 2EXYC 2BP0B 3GMQB 1J9TA 3BQUD 2NUTB 1J8HE 5IB3A 1BMZA 3NSFA 4DSYA 2QVKA 3OAYK 4KY1L 2R15A 4ODVH 3U9PL 3QEQA 1XB6A 1HHHA 5J9PA 4X6DE 3V4PB 4XN8A 1MWAB 1A3LH 2F15A 4KJPC 2VMFA 1HQRA 5KYUA 5HDBB 3X1NA 1D5MB 4U3XA 5CZRA 3U0TA 1DJXA 1ZEAL 2VW4A 3OJMB 4N28A 5LBSH 3FU0A 1IQWH 4QHKJ 1RSFA 2VYRE 3RAJL 1R0AL 2MPVA 3FQTB 2JCCB 3SJVA 1RPUA 1LVEA 4HD9A 4XNYH 4JVPA 3B9EA 4MCZA 4OKVA 5DEFB 4O02H 1DJYA 3PDOB 5C0IB 1JCVA 3F84A 1JNNL 4MXQD 3E8UL 1ILUA 4FLHA 4PJEB 2PETA 4AVKA 4I4WB 5E4EC 3T77B 4ODHH 3GLAA 2ICWJ 2X2JA 2JVUA 3SCMD 5F96L 1NKGA 5MP6L 4GUCA 2ZF9A 2VR6A 2MCG1 3EOAA 2GYSA 4UT9H 3ME0A 4EKJA 1CJYA 1F3DH 3ATEA 3RKPA 2WQSA 3MRJA 1J0JA 4PJ9C 1NKOA 1RK0A 2HB0A 1EHXA 1IJNA 5F7DB 1PDKA 4D9QE 1QHPA 2VERN 5GGQH 1EPFA 1M2OA 2PPEA 4O5LH 5LBSL 4UINH 1ECZA 2P28B 3V95A 3OF6D 2WCGA 4NQDE 4OCLC 2COVD 5EZLB 5TPWL 4IBVA 4BINA 2ZKHH 3BLKA 4OGZA 3HA0A 3QZLA 1S8DA 3QDJE 2WKGA 4R5VA 3LEXB 5E8OA 5MENA 5T3XD 3KYMB 1IQDB 3SKJL 1M71B 1MZYA 4FQJL 3DTXA 4KI5C 4JRFA 1GGCH 3BAEH 3TN0C 3OKDB 5EU4B 2GUOB 2BMKA 4UM8A 2UY7B 3ZW3A 1HQ4A 1R3JA 2V5YA 2P5EA 5A2BA 1AFVL 2X1OA 1AP2A 2V37A 1ZSDA 2GI0A 3GSWA 4EIBA 3QO1B 1XCWA 4QRTA 1TEFA 1RLBA 3PV7A 1GOGA 3CK0L 3WO4B 1LK3H 3MRQB 4JFDB 1F3RB 1CDGA 2CLZA 1VFUA 3O3DB 4TULH 2NNCA 3VFOB 4BFEA 1B4JL 4KKCC 2MFNA 3T3PE 5D7LA 3S88H 1QFWI 2H1PL 2P8LA 3TFBA 2VSCA 2R1YA 3KWWA 1QEXA 2NZ9D 3PGCB 2C7FA 2WB7A 1NICA 3IXAB 3LKOB 3IXTB 3MOQA 1T2JA 4M48L 4GIAA 4PJBA 4Q56A 1J86A 2VJ0A 3MRBA 3NA9L 1OM3H 4GLRH 4HJJH 5J11B 1QBMH 4KROB 4AENB 4R3SA 3ZQ9A 4AIEA 2Z92B 4QXTA 3RDJA 4UOJA 5LDSA 1CXLA 4G6AD 1LWRA 1SJEA 2IXQA 3D69A 1UFUA 1E9PA 1U2YA 5LO7A 4LARL 4DP9X 1NGWA 3NAAH 2X7LB 4YQXH 5AZUA 2MKWA 2I9LB 1TITA 3AG3B 4NUQA 4ZQKB 2XXCB 2BVEA 2IDQA 3NK4A 4OF6A 3CZKA 4OFYD 4RESB 5L2KA 4XPFH 3UC2A 1RK7A 2AI0L 1UWYA 3RFZA 2P43B 5DMIH 1Q94A 1G1KA 3DX7B 1OK0A 3D0LA 3QC6X 4KNUA 4TVSa 4WWKC 3WJJC 3B7SA 4F37F 3IU4L 1IGMH 3KYOB 2TSAA 1UG9A 5E00A 4KDWA 1J5CA 1T1ZA 4K94H 5GRVL 4KVNL 1TIUA 1IZKA 4PJGB 4LSVH 1PPIA 5TDNA 2J8OA 5F6HI 1J1OL 2YD0A 4TUOA 1UB5B 1YNTA 2WZAA 4GPVA 1O5PA 2BWIA 3MRNA 4KQ4H 4NDMA 1MFBL 5F9JA 2J7LA 3VE0A 3FTVA 2VMEA 4ZOCA 1FFTB 4NKDA 3QA3B 4NJAL 4XP9H 5DURD 1QPKA 2YBRA 1A21A 1S3RA 4GEIA 3ULVF 4YHML 4QIRA 4YWGL 4IHBA 4W9KC 1FZJB 3QEUB 2IADA 5DMIL 2IH1A 2ZCKL 3VYPA 4S1SH 4LLQB 2XQYK 1GA2A 1M05A 1IGML 2WXIA 4F58H 5A6MA 4WHYH 1S5IH 2L8AA 4ZW3A 4JB9H 3FT1A 2DTML 2A73A 2CDFA 4FI6A 1F97A 4JFXA 4UB0H 3FFOA 1CL7H 2BIHA 2YSTA 3O3BB 5EZOL 1H9DA 4NC1E 1RXLA 1NC2B 1MF2H 1HNGA 1F00I 1KTLB 1B9ZA 1FVEB 4NCDA 5DYFA 3WU1A 1XH2A 1Q9LB 3MRPA 4EXPX 2GSGA 3VD0A 1FPTH 1T5WB 3RI5K 2Q5BA 1BXVA 4QJ3B 4W9ZA 3O8XB 4U6VH 3NSCA 4ZOBA 2VXTH 1JHTB 5JR1L 2OA9A 3O6ML 5HHQB 2WM0A 5LBSA 3FB7A 5KEZA 2E27L 4HS8H 2HZHA 1HHIA 1BP3B 3TNNB 4JM2A 1BG1A 1CDIA 1TZHB 2JTYA 5E4OA 4PJCF 3UYOD 4DN4L 4JGUA 1R6VA 4WJ5A 3UO1H 5ISZE 1H15A 2CRYA 1NM4A 4FX5A 1HIMH 3A3YB 2VLKE 3HI1A 2A3TA 2QGDA 3MNZB 3D3VA 2GK0B 5CCJA 1MFAH 3SDXE 3IDXL 1A1NA 4IM8A 3U9UB 4EXKA 3PAZA 4WKZB 3SO5A 2IMNA 5GGVY 1G7LB 3QJQB 4GQ9H 3HMXH 3D5OF 3QYNA 3MTRA 4XMUA 3MLVL 1J11A 4UT9A 2EDRA 4L9DA 4RAVA 25C8H 3CDYA 4QXGL 4CVZA 4QMEA 3T4YA 2W0FB 2B16A 4N6RA 2H32A 3TBCA 2ED8A 3HR5B 4F20A 2R2EA 1KJVB 1TJIH 4GUOA 1OARL 1EDHA 4HS8L 2LU4A 2XOTA 1QO3A 4KGJA 4ZFFB 3WTXA 3ABKB 3ABGA 4BDVA 4KUCF 1XGTA 4G6ML 3MZTA 4PVMA 4IU3A 3GSNH 3NFSH 2QPUA 3QPXH 3BFOA 4OCWH 3IDMA 1JZFA 5I74C 4XBGA 1QX1A 1W16A 3FTWA 3QFGA 1CGSH 2YXFA 4JJ5B 2WXPA 2F7RA 2XKNA 2V7NB 3L5JA 3VU1A 4JANB 5I1IL 4E9SA 4GQ9L 5C6WH 1QSFB 3Q2WA 2YKKA 4O4YH 1QZNA 2XWTB 3H7LA 5EBGA 1U6AH 5CGMA 3IJYB 1NBZA 1XD0A 3FQRA 5TE6H 5GZOC 3GSXB 3LZFL 1UWGL 5ENWA 2QSQA 2XV0A 2YRZA 5EEUA 3NEEA 2WO2B 1QSEE 4WW2F 4P5KA 3SPJA 2GBVA 4FFVD 1BJ1J 4H1LB 3C60C 3RA7H 4LNVA 3S6CA 4RBPK 1F4YL 4J6IA 3F7YB 4BBWA 1N6UA 1YJDL 2H7WA 5KVDE 3DETD 1TVHB 2HMIC 1CTNA 4XC1H 4XP1L 3SPGA 4LU5L 3FT3A 1BAFL 1TCRB 4JO5A 4FZEH 2XWXA 5DD6B 4NQDD 2DL2A 4QCIA 2HJLB 2F53B 1MXDA 4G43B 3AREC 1FL3B 3QDJD 3ZE1F 4PVBA 4IMLB 3UCRA 4HJ0C 3MFFB 1BLNB 5EU6D 4AGLA 1CR9H 5MEPB 3FQ4A 1ILSA 1DO5A 1D7BA 1F2XK 2DLEA 2WQRA 2OXGB 1PSKH 4U1KB 2X6AA 4PMFA 3JQOB 3BXNA 5I0VA 4XCCH 1EZSA 1UKTA 1VFBA 3ULUC 3F7VA 3L4WA 1EAOA 2EDWA 3Q43A 1N2RB 3LPGA 1ZLWH 4BFKA 2JXMA 4LOVA 1JERA 3ZZQA 4ZUVB 5LGYA 4XVSL 3RGVA 5JQIB 2ZD0A 1XZWA 4HZLA 4X7DC 5D2NE 2D03H 3MFGB 4G1MB 5DQJB 5SWZB 2FEJA 4WV1B 4NT6A 2Z9TA 1XR8A 4N2DA 5ICYA 4JFHD 5EUKA 5G5DA 4WI4A 2GTZA 3FCUB 1OP5H 4CJ0A 4IOSA 1CD1A 5FF6B 3S5LA 4GXVH 3QAQA 4K3EH 1HXYB 4OIIH 3NSYA 3PABB 1AIZA 1ZXQA 3EHBB 5K9KA 2ZCHL 3I02B 4N5UA 1UD2A 5ITFB 3MV8B 2OMTB 1LTXA 1O7DE 4NUMA 3VWJB 3LH2H 1TQTA 2WQXA 3LKPB 5JPMB 4YDMA 3NESA 3GM0A 4F8NA 4XE0A 3D39B 4ZAKA 5BPPA 2VMCA 4GRLA 1RJLB 3UGXA 4G9DA 4N0CC 1E27B 2EO9A 3EGDB 5MEOA 3Q06A 1LE9A 2ZXDA 3SQBB 2WBJA 2QTVA 2P49B 2V9TA 1QEWB 4PW9A 3RL2A 3CNKA 4HAKA 1Q38A 5GSVA 1RIVH 1OP3K 2AABH 4M93C 3L3OA 3FB8A 4OJAA 4NZ8A 2SEBA 1T1WA 2NYYD 2OL3L 4UDTA 3BPNB 4QDGA 1JTTA 4JMNA 4NRXB 1A7OH 2OSWA 3BPOB 1OAJA 1MRFH 5HGGS 2Z4QA 3FOLA 4Q9BA 3E8VA 4PG2C 4Z7UA 3WXWH 2ITEA 3TBSA 2HRHA 3S37H 4U1NB 5CR8A 4BKSC 5IMKB 2OPCA 2XHNA 3UZVA 3FL7A 4XP6H 2OMYB 4GMTL 5FUOH 4OZIF 3MXWH 3V4PH 4H13C 3RVTC 1WCBB 2E6JA 2YAQA 1PY4A 4L4VE 4QYOA 1EJOH 3QORB 5D6CB 4W9JC 5TE7H 1CCZA 3ZTJH 3MO1A 1NIBA 1P6WA 3HMXA 3OJDB 4HJGA 2YGVA 4KVPA 4BGDA 4XTRC 3CFDA 4PREB 1K5WA 3FO0H 2W9DH 1RUQL 3HC0A 1DN0B 3G5VA 1HHJA 1KB9J 1YVLA 2VDNL 1REIA 2NX5A 1YNKL 2QR0A 3QJRB 4M02A 1BZ9B 4KJYA 3C5SB 2OR8A 4IQHA 1OL0A 5AVSB 5BJTB 4PJ5B 5EC2B 3EYFB 1YN7B 2P8PA 3LZQA 1RZGA 3GSOA 1NCHA 4PRBA 4IJ3C 4IYKA 4YVUA 3HB3C 4M62L 1XF5B 1Q1PA 4TNWK 1H19A 2KPNA 4A7TA 2VDKB 5A2LH 4FG6D 1NIEA 4RSVA 3WN5C 3HZKA 3WKPA 4GO6B 2DYPA 2K9UA 3GSNA 4XPAL 4JN1H 4AMWA 2GSMB 3IETB 5AOIA 1QASA 1U2HA 2X1QA 4JFDD 4MNHB 3K4DA 5TH2B 4FXKB 1HXMB 5D7JB 1L7TL 4UMSA 4XXDA 5BRZE 1LL1A 2VDRB 1BWWA 3EO1A 4OV6F 4XNQA 2BW5A 2YOAA 1XF4B 3OQRA 1Q9KA 3C2AL 4XX1E 1CS6A 1YEHH 3EH5B 3H0TB 3K8KA 3MCLH 5LN4A 1J8HA 3GXNA 4A2EA 1F90H 4J1UA 5AUMA 3V0FA 3VFMA 4MAUL 4XBPA 3SGDI 2UWEE 4D3CL 1J5OL 4X6DA 3LRKA 3MJWA 3ZTCC 1F11B 1QATA 2HWZH 5E9NA 1U8QB 3QRGL 4X8XA 2MQGA 2VRAA 2WXHA 1ASQA 2PO6A 2JB5L 1KJ3H 3WFCL 3ZQWA 4K73A 4BEIA 5IQ7H 3MJ7B 4TSAH 1AR2A 3O0LA 1ZGLB 2Q2LA 5DQ9B 3AU0A 4PUBL 3MNMA 4UNTA 1XCTB 1XGPA 3MKGA 3SE8H 1M56B 2ESVE 4PH8A 2WPGA 4WNQA 4HIXL 5E9DE 3SDAA 4DKFH 5FDWA 4L1TA 2X4TA 2Q1EA 3CFIC 5DHXB 1N59B 2WKOF 1T7ZA 5E1QA 4HS6B 3KLLA 3KHOA 2A6KA 1MAMH 3O6FB 3UBXB 1QWNA 4AJYV 3GS7A 2J25A 1YEKL 2I85A 4PJXF 5D7IB 5CEXB 3DJ9A 5HHXH 1NL0H 4XBEL 3AG4B 4P07A 4OZHB 5E8PA 1KIUA 3MGTB 4G9FB 1QSED 3ECBA 1VEOA 1EJFA 4P5SA 3T0EB 1UYWH 5AVUB 3RVXC 2NXZC 5DJ6A 3MRIB 3K6SA 2Z7YA 3WEAA 4MQTB 1P4IL 2WN3A 4DP7X 1W72B 3M7FB 3PLYA 4KKLD 2OL3A 1JK9B 4TVPL 1XFPA 1SVZA 2HRPH 1ANUA 1EZLA 3NCJL 3QHFH 4PJAE 1M7IA 4KXAA 2Q8BL 3ZDZF 3HKFA 1FYHB 1G9NH 1NCCH 1ZTXE 4D94A 4GW1A 4IJTA 1I1RA 3VRLF 1N3NA 2FATL 3VGFA 4CC4C 4DCQB 4IBWA 1DVFB 4R84A 3NJGA 1KFGA 1PNDA 2V17L 4PBWD 3V6OC 4OQTH 1U9KA 3M7OA 4FJYA 5DJ8B 4GY4A 1OT1A 4L37A 2PWEA 4QTFA 4E2OA 4JFOB 2MJWA 4OM1H 3AC0A 3GZKA 1RCYA 4OD1H 1JNLH 8CGTA 3JWNE 3BH4A 3UH8A