4BFJA

Superoxide reductase (neelaredoxin) from archaeoglobus fulgidus e12v mutant
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
ELFQTADWKKVKHVPVIEVLRAEGGVVEVKVSVGKEIPHPNTTEHHIAWIELVFQPEGSKFPYVVGRAEFAAHGASVDGPNTSGVYTDPVAVFAFKAEKSGKLTAFSYCNIHGLWMGEATLSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE REDUCTASE
publication title Understanding the Role of Key Residues in the Superoxide Reductase Molecular Mechanism, Exploring Archaeoglobus Fulgidus Sor Structure
rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
total genus 23
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature ec 1.15.1.2: Superoxide reductase.
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01880 Desulfoferrodox Desulfoferrodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.730 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4bfjA00
4C4UA 3QZBA 1DFXA 4BGLA 2JI3A 1DQKA 4BRVA 4BFJA 4D7PA 1DO6A 2AMUA 4BFKA 4BFFA 2HVBA 1VZHA 2JI1A 2JI2A 1VZIA 4BV1A 1DQIA 4BRJA 4BK8A 1VZGA 1Y07A 4C4BA
chains in the Genus database with same CATH superfamily
1SUJA 1YY8B 4A63A 5ICZA 4PJXA 2X4SA 3ATFA 1BWWA 1NAKH 1SHWA 2DQCH 5AVVB 1KFAL 2V2WA 3KDMB 4X6CE 4PJ8D 3ZK0A 2P43B 3MKGA 4I89A 1UD8A 1EO7A 5CN1A 4Z0BL 2CNZA 5IB3A 1TJIL 4H1LG 3WNKA 1KCRH 2GJZA 3FRPG 4HIJB 3A67H 1DL7L 4PJAA 1MOEA 1VGKA 4XP1L 1PYWB 4B0MB 3ARWA 1G94A 2IOOA 4FNPA 3VXQB 1J9RA 2VH5H 1B0IA 2CBQA 3WBDA 1ZVSA 2ZYHA 1LO5B 3RILA 1RZPA 1PX3A 4JQXA 4G1MA 3BPCA 1LEGA 3B2PA 1CDYA 4K9EC 1UATA 4NRYA 1XD1A 2OMNA 1J12A 1VPOH 5BOPA 1HEZB 1MIEH 2KMWA 4LEXH 1RZ7L 3L5HA 4WKZA 3QCVL 4AVKA 4PJHB 1TKWA 4HCRA 3BP4A 3IJHB 4LASL 5E94A 4AH2B 2VXTL 4TRPH 2F2HA 4Z95L 4LARL 2NCEA 1QEWB 4L3EE 5GJSL 1F5WA 2XA8L 3MLWH 4FTVB 3GSRB 4FFZL 4PP1C 1KN2L 3MFFA 3KXFA 4BFEA 3EJSA 3VNYA 2ZTBA 4A39A 2G3NA 2AJUL 4L1BA 2GITB 2YD1A 4I48A 2ZKWA 5GIRB 3X14B 2VLJB 1DJYA 4MXWH 1NAMB 1KACB 3ARBB 5CP3A 2BINA 3OQ3B 1UZ8A 4LCWE 3ZRCC 4OM1H 1GYVA 1HJBC 1LWHA 4LOEA 4UTAA 3U1SH 1RZKC 1YQVL 3IS1X 2OZ4A 5J11C 2XIIA 5A40E 2COVD 1K6QH 1Y6NR 2EKSB 4IRZL 1Z0NA 1BD2E 4CN1A 4YHLH 4PJFF 2FECI 3U7WH 3EF7A 5DCCA 1TTUA 2PO6C 4XCNB 4ABWA 3TS8A 5AENA 4DW2H 2HLFD 5MENA 4M6AA 1WAAE 1CTNA 2CJTA 3EHBD 1T03L 3BXNA 2ZPKL 4Y4KC 5TPWH 5GS0L 4I2XA 5C07B 3F7YB 1NINA 5C71A 5LG1A 5I18L 2X2HA 4O2FB 2YD3A 3KXFD 3U6XS 3SY6A 3L7EB 1I1AC 5DC9B 5LQBH 4XNXL 4X80L 4R4FH 3LV3B 3PWJA 3U2SB 1OAYL 2L7JA 1NBZA 2QQKL 2X3AA 2Y7QB 4FLSA 3IDJA 4XCCH 3GSVA 4BFIB 1UG9A 5E95B 4M1GL 3U36A 3ZKMC 4NZJA 1ACXA 5DJXA 4TULL 2GCYA 1XGYL 4CVUA 3I6SA 4JM2B 5T3XL 3ROOA 3V4LA 1XF5B 1WAEA 2DQHH 3I50L 1JZ2A 3REVA 3FMGH 5C2BH 3HZYA 3BDYH 5FAAA 2OSWA 1ZLUH 5A1AA 1WZMA 4KTDL 3TP4A 4KJWC 5IBLD 1MSPA 3ILPB 4TSAL 2FX7H 1BYPA 3ISWA 1DVFB 1I85C 2CUAA 2AZUA 3CVBA 1TPXC 3E80A 3JWNE 3PDOB 1ZK9A 1TOXA 4OCRL 3TN0A 4A38A 1HESA 3MOAH 1MJJB 5MEND 3CH8A 5SWSE 2L4OA 2XKUA 2HVJB 1WZ1L 4FADA 4JK0D 1KTDB 3STZB 1L3WA 4JPWL 4HOZA 1NIBA 4FZ8L 4E9WA 2QDWA 3TYFB 3ZKSD 4LB8A 2PWHA 1DVYA 3B7TA 1SJHB 3ZZQA 5D7IB 4QRPE 4PLJC 4AYSA 1QHQA 1IGFL 5IQOA 4ODHH 1WIUA 4RQQB 4FQLH 1BBDL 4IBLT 4P2CG 4DUVA 1HCVA 3HZKA 1OLLA 3FB6B 4LAJH 1AR1C 5DD0L 4ONOA 1JPEA 4PJGB 1V3KA 3VMNA 2YPLE 5A2IH 1K5NA 1ZA3A 2QKIC 3KPNB 4AEFA 1OCWH 1H0DA 2K4AA 1D5XB 4XHQA 3ZX1A 2FJFB 1VACA 3K72A 4BWTA 3RZCB 1C9SA 4Y5VC 3TBBA 5IHUL 1P7HL 4MX7A 2R56L 1UGNA 4GAGH 3TN0D 1JV5B 1X5KA 2HX8A 2MQ0A 2VITA 1PD6A 4PY7A 5DMIH 5T3XE 3ERXA 4AWJC 4N2KA 2B5IC 4G6KL 4KK6C 2NY6B 3VDAA 3GXNA 3RVTD 4PREB 2AJ3B 4X4XB 1R9FA 1XCTA 4JZJC 1V3MA 4EN3B 1HL9A 1YEKH 4AGNA 4M03A 3QQDB 1G1OA 3THMH 3BUQA 3LKRB 4FRWA 3TCXA 1LK3H 4HJGB 5C0AA 4K3EH 1OGTA 1SOSA 4DTGH 3KGRA 1MW1A 2HH0L 1TETH 4FFYH 2H2PD 1A1OB 4HWZA 4OCWL 3WSQL 1D5ZB 4ZNCD 1I3VA 1T1YA 2WWNA 3GMMB 1PNDA 1OPGL 2ZSVB 2JF1A 4GKNA 2ZOKA 4XC1L 4CU8A 3VRJB 3GK8H 2KUTA 2AEOA 2R15A 4LOUD 5D2NC 4JFFA 5G5DA 4NN7C 3MNMA 5JW5A 2ATKA 4OZIF 1DSFH 5J6HB 3VMPA 4O02A 4F8LA 1BOYA 2V7NB 3L4YA 4NPJA 3PGCB 1BP3B 4G9FE 1KFGA 3QH3B 4FQPA 1Q9WA 4KMTL 5CLXA 4XO8A 3BAXA 2IWEA 2KKQA 3SKOB 1P4IH 4ZMAT 35C8H 3GSXB 4DP5X 3KWXA 3PWPA 1A7BA 4W4OC 4JY4A 2BY3A 4DK3A 4EXPX 3AXLB 1RZIA 3LQAL 5IEKB 4Y0GA 4PVBA 1OAZH 2R2BB 3DO3A 3CH1B 3JV0A 3KYKH 3O4OB 4Q7DA 1UXSB 2AQQA 3KDMA 4IYKA 2EIBA 2WZ0A 3WCYA 5C0AD 4IW4C 4JE4B 2Y1YA 5BPPA 4YIQB 1QSEB 3E8UL 5CCKL 2HRLA 1P2CB 4Z7WA 3TFBA 4OD1H 4EDXB 1N9PA 4K5OA 2WBXA 3VXTB 4HIJA 3K6DA 5IVXA 1JHLL 5HHNA 4IM8A 4TNWK 2WBWB 4KI1A 1BXUA 1DQKA 4HHWA 3CFJB 1YEHH 2BY0A 3QZPA 5AB2A 2BVQB 4RESB 5FGCE 2VJ0A 4UM9A 4WKXA 4JFFD 3QT2A 4MA7H 2CR3A 4XCEB 3WY2A 2F53E 4F2FA 3L4VA 1ZVNA 5KVFH 3V0VB 2I9TB 1OAKH 1QSFA 5AZEH 1KF9B 3AG4B 4OGAD 1MQKH 2AVGA 2ZUYA 1CXIA 1NOLA 2UVEA 3BH9A 1JWSA 1FP5A 1HEZA 4HF5H 4MNQA 5CD5D 4FZEH 3RAJH 3IAPA 2ZUSA 2WYZA 3DXAB 5I9QB 3BI9X 3VI4B 5IEHB 4JFQA 3JUYA 2FBJH 4WHTB 3N44F 3PL6B 1I3GH 1UFGA 4BA8A 1CN4A 1ZRUA 5F0MB 3VNZA 2RCSL 5I30L 5E5RB 5G2NA 1DBKH 3CDYA 3MSPA 3QJFB 3U30B 4S10A 2XTJE 3B2UC 5GGQL 4DVBA 4DZ8B 3AT0A 4K2UH 4KKZA 1EBPA 4TKWA 4R7NB 4Z7VE 4CW1B 4YLCA 1WT5C 3L1OH 4UM9D 3BAEL 3R19A 2VLKE 2V7HB 3I9GL 1DEEB 2CU9A 4KXZH 3RBSA 5B38G 4LCYA 1QSFD 3F01A 3HN3A 1IC5L 4CKVX 4Z7NE 2A99A 3A4FA 4LAQH 1BQHA 1QRNE 3ZKXC 2AP2A 4Z7QF 3BZ4B 1G7LB 4MNQD 4MYPA 4I77H 3T09A 2EDHA 2J7LA 4R3SB 1D9KA 5BZZA 3GD1C 3K2UH 1PY4A 2FB4H 1IFHH 1FF5A 5C0GA 2HFGL 4YSUA 5G4MA 3A6OA 5EOCH 2FSEB 1BJ1H 1SEQH 5CKAA 1ETJA 2EXWD 5JA9A 1DLHB 4OZIE 1JGIA 3SDAB 5DMYA 5ALBH 2BP0B 4OR1A 5C07A 3AQZA 3N06B 2ENPA 5HHOB 3G9VA 1J5OH 2K8QA 4YPJA 2LU5A 3N1FC 3QARA 4AXWB 2Y7SA 3DX2A 4RFOL 5HVHB 1BWMA 3IFPA 3LV3A 2XTSA 3W39A 1NC4A 2A5UA 3OXSB 1IKFH 1CICB 2Y7QA 4YDZA 4ZMXA 1KB5A 2I07B 4NFCA 4HLEA 2KLRA 3OKDB 4PJ9C 4M1CC 5DVOA 3UBXI 1IJ9A 4FMVA 2GC4C 4XGZB 3T77B 1KXVA 4DP9X 5CP7B 4KZCA 1MFCH 4JO1L 4ZODA 4JRXE 1NCCH 5DJZA 4LKXB 5KVMC 1D9KD 5EZLB 4YX2L 1FI8C 1DVFA 1LP9A 3CD4A 1KT2A 3RWIA 5AWNH 1MJJA 3GMOB 4NKMA 3GMPB 3ULAB 5JPNB 2CDFB 4LCVA 5C07D 3VX0A 3GSOA 4HK0A 5AZUA 3SKNB 1OSPH 4JY6B 4OCSH 2ZWLT 4MJ6A 5B21A 4XBGB 1ZLUK 2JKJA 4WAFA 5D7IA 1NC4D 5TQ0H 3E1F1 3HBQA 2W60B 1YZZA 2I69A 3FUEA 2I60L 1VFBB 3FB8B 4L4VA 4RMBA 3Q7JA 2ADGA 2Z92A 3BKMH 4MNHB 1J87A 1A9VA 1MFBH 5IREA 4QHKJ 2C5DC 1CPUA 3GSWA 4ZOAA 1E42A 2VXVL 1FDLH 3MRQB 1EFQA 1M6OA 5HI4C 4KJYB 1YUHB 2QADC 3WKYA 4LNRA 2DM3A 1DVFD 3A5VA 3HTLX 6PCYA 4NN6C 1IKNC 3QEGH 1F4YL 4DGVH 1JYWA 3RL2A 4UQBA 4PRAB 2CE6A 2YKLL 2XLLA 4PM1A 3MV7E 5AVZB 3X13B 5I28A 1KSRA 1QLEH 3NQKA 4KJQD 5GGTA 4X4XA 4HSQA 5HVWA 4EN3A 3PUUA 1T66C 2Y25A 4XZUB 5I1GL 1N64H 2ICWJ 3BAWA 1ZS2A 5IWLC 4Z8FH 2DLHA 3ZDXE 2F54A 1UFUA 4L4VD 4MJIE 3AU1B 4EE2A 5EU3B 2IG2H 1FIGH 1KIUB 4EI5A 3KPSE 3MLYL 1N4XL 2H41A 5IM7A 1BAGA 1FO0H 2E5EA 3IU4L 1QBML 5FUCC 4R7XA 2X9WA 2L04A 3W37A 1I9JL 1BVNP 3F6JA 2D73A 4PJ5B 1A22B 1NCAL 2ZXBA 1A6AB 1E65A 4QY8B 3IYLW 4N4YB 2ZCKL 1PG7H 2H7WA 2WNWA 1N68A 4H40A 4AYMC 5D7LE 1UM4L 2DLIA 2FZ3B 3OM3B 1JDAA 3LH8A 3NCJL 4TOYL 5E51A 3L3OB 1IQWH 2BOCB 4NCC2 4YL4A 1ZDSA 4HOXA 1V54B 3REWA 1SRDA 1AIFB 3QWOB 5EBMA 3ULVC 3SKOA 3SSGA 4IU3B 4OFVA 4KZDH 5J9PA 2J88L 3G5VA 2VR3A 4L9LB 4YHMH 5IEKA 2AABL 1LHZA 2O30A 3AREC 4L9DA 4EN3D 1AQHA 2GQHA 3ZJAA 2CUIA 4OLYH 1U9KA 1GOGA 2F54D 3JWOH 3P3TA 3FCGA 5C6WH 1CG9B 3GMLB 2PR9A 4EI5D 5E2TL 4BFBD 2Y06H 5DQJA 4R26L 4PV8A 4Y16B 2BNUA 4JHUA 4DT2A 4BFNA 1QFWI 2BH0A 4FNLH 3G5YB 3NCYS 4RFNC 1KBGL 4EDWL 4XNQB 1KPVB 3UTPE 1Z66A 2H3NB 2QV2A 4JCLA 1AFVL 1XSKA 3U4EB 3RDTC 3Q05A 4HAGA 3V0VA 2R29A 1JMXA 5J57B 5HHMD 4E9XA 3F58L 4XMKH 1MUJA 3MLXL 3BVXA 2R4RH 1KY6A 4PRNB 1J05A 4D8OA 3S5LA 5EF1A 4HJEA 1JVKA 3S2AA 2ATAA 4YVUA 2NLJA 4OGYH 5FYLL 3PHSA 4G7YH 3VI4A 2CSPA 3C2AH 5D2LA 4A6YA 4N9GA 2J5LB 2VE6B 2A74A 2APSA 3AAZB 1FL5A 3MV8E 1B4RA 4X98A 3BQUB 4GAFB 2JI2A 1OB0A 3GSNH 5DC0A 1FJ1B 1CL7H 1IGYB 2ZX7A 1TT6A 4ADIA 1LO0H 3DURB 4BIKA 2R1XB 1OSYA 1EGJA 3HMXA 2J20A 1MCKA 4LXFA 3S36L 3C5ZB 4GAYB 2QPUA 3FT3A 4LSRH 5DD3H 2NY0B 1FFTB 5E6IA 4Y1SA 1PSKL 3UG5A 3I3BA 4QHMA 4V2BA 3C60C 1AI1L 1NBQA 3NESA 5ID0A 1BQLL 4HKZB 4GSRA 2VRKA 5IV2B 3V5DB 1SY6A 3IPBA 5C6TL 3W9DA 3RKPA 3I3EA 5A2CA 1BX2B 1JERA 1SXSA 4BFOA 3BO8A 1KZQA 3AROA 3NCMA 4GXUM 2G2RB 3TBTB 5MERA 2OTPA 3VXNB 1OV8A 1DP0A 4MB5A 3O2DA 1YG9A 1QA9A 4GO8A 1H19A 4HJIA 1SFHA 1GJIA 2C9VA 2YQ3A 3WTVA 4JPSA 3GIVB 2CIKB 2Q76A 1MFAL 3RJOA 4B9JA 5IFJA 4BQCA 3SE6A 4PD4J 4K7PH 1GJUA 2XG4B 5FYLE 2GK0B 2I07A 1JWMA 4XMLH 1PZUB 5B39A 1AYOA 5E70A 4UOW0 3V4VA 2BIMA 5GHWL 1IC1A 3OLDA 1M7DA 2CLZA 5E6ID 4A7GF 4YC2C 4XGZA 5JHBA 2YD7A 3E8VA 1S7TA 3T77A 3NCWA 3TH4T 4AZ8B 3ZSTA 4PBVC 1YCSA 4O00A 4LKXA 4RMTA 1KTRL 2YA0A 2W80C 3DHPA 1QPKA 5CBAA 1SQMA 1ZVYA 2WUCH 3S97C 1ZT1A 2VW4A 3H0TB 2WXQA 2XXGA 4M5ZL 3R7QA 3HJ0A 3W9EB 4Q14A 4U4IA 2OL3H 5KOMC 2VDNB 4K9JA 3ZDYB 3FT9A 1RLBA 1HEHC 2W60A 2WXKA 2XFGB 4QXWA 4PRPE 3NFSH 2X10A 1I8LC 2EEAA 2IANB 5CF3A 1OKEA 4LCUA 2BNRA 1F90H 1XEUA 1HKLH 3NUKA 2ZX9A 3VE0B 5I0DA 4GMSH 4QO1B 3F6LA 4KJYA 8CGTA 4UI2A 1YUHA 4IBVA 4IIQA 1INQA 2X2IA 4OIAA 4Y4FC 5L2KA 4OZGA 1N59A 4O4YH 2IADB 2K8MA 2BS71 3JV4B 3D1MC 1U4FA 1RPKA 2DMCA 5AKSA 1E2ZA 4U1MA 2E75C 2OMWB 4LVNC 2DD8H 1Q9OB 1KXHA 4QF1A 4Y2LA 4CMHC 3FNKA 4NUJB 4AIEA 3CZFB 1OGAB 4WFGD 1S9VB 3MQIA 4XCYB 4NUGH 1CGVA 1PZBA 5H2BB 1I7RA 4JG1L 4HSAC 5EZOH 2Y6SD 4ZUSA 2WLIA 4XP6H 4CC0A 1ZT7A 3ZRFC 1SJEB 1E2WA 1BECA 4UBDC 1KIUA 3R1GH 1AH1A 3VXSE 1YN6A 1AD0A 4WO0A 5E8EA 2BNRD 5F7LB 1S7WB 3NSYA 4UQAA 3KPQB 2V0AA 4OSUL 1X5MA 1JZ7A 5B1CA 5IQLA 1DQMH 1XGTA 1X7QB 3FOLA 1UWXK 4WUUE 3T2PA 3WDHA 3OR6B 1H5BC 5J11B 3FUFA 3WEXB 2E7HA 4R7VA 5L2KD 3KYMA 4L8CA 2PO6B 4DVRH 4MD4A 3V8OA 5A43C 1J8KA 4PR5A 1IILE 3MYJA 3PHQA 2EZ0C 1AIFA 5I6XB 4KJPD 1YECH 3LHPH 5EN2B 4FQ1L 4Y4KB 3U25A 2JV6A 5KYYB 2NZIA 4NP4L 2R1YB 1XGUA 2EC9T 2P5EA 5IB1A 5AD0A 1I1AB 1B9ZA 5ERWB 2QSQA 1HCYA 4XBEH 3KHQA 5LGJB 1OGPA 1XBDA 4XWOD 1CG9A 2HLAA 3KLLA 5MP6L 3T4AC 1NGPL 2AK4E 1OCOB 3TWYA 5AOMA 3CDCA 4AQ1B 2DWXA 4Y16A 5T5FA 3BKJH 1CC3A 4YGVA 5FDWB 2QZQA 3L4UA 3QEQE 4XNBA 3L3IA 1BA9A 1IBDA 3NSDA 4WK2B 1KB9K 2JMRA 3MLSH 1KPVA 3WKQA 4N0CD 4J3OC 2H3NA 1KJMA 2J4WL 2VLME 3TIEA 3HB3C 5BV7H 2HWZH 1TPXB 3EGXB 2MCPL 2VXSL 1HL8A 1IGIH 2EDMA 2OMXA 2ZQKA 4JDZB 1OWRM 5J06A 1J18A 3DJTA 5I26A 3D6GA 4QXUH 3FDWA 3T2NL 2EH8L 5IMLB 3MOBH 3QQNA 4XPHH 3N1PC 3DRTA 3SY0A 3WG7B 2P5ED 1OAUL 4YFLF 2DOCA 2G4GA 3CBKB 3UO1L 5IJKA 1U58A 5DYOB 3AAZA 1Y0LB 5DC2A 4AVHA 4QHPA 3S8GB 4Y16D 4R7LA 3GEFA 3FULA 4HK3N 1RLWA 1R0AL 4KHTH 5JORB 3CXDH 1OSEA 2QKIB 3FT2B 3FH8A 4N5ED 3WJJC 2CO7B 4EKXA 3O3EA 3HZ3A 4LSUL 3D33A 3HW7A 2D03L 4Y5VB 3L9RB 5KOVC 1MNNA 1T0NB 3X3GH 1QVOB 4J39A 2VR4A 4QTHB 3V7AE 5CJQL 5K5YA 3WO4C 1HQ4A 3QUZA 3CFQA 4NHUB 1RD6A 2B5IB 2Q5BA 5E6UB 1MRFL 4JFEA 5E6YA 1UKTA 4LF3A 2G2RA 2ZX8A 3SDCC 3TBTA 1GCFA 4HGWB 2MOVA 4FXKA 2VN5A 4JZJB 1N5YL 1HJCA 5DUBB 2V2XB 3NVQA 1MDAA 4HV8A 3KW7A 1SBBA 1DBML 1OHQA 4EI6B 3VFVB 4F7PB 4K55A 3CN3A 3B2XA 3ZTCC 2XNAA 4KK8C 3UJTL 2VDRL 4XMWA 5AB1A 3ARFA 3LSOA 2GAZB 1MHEA 1OEZW 1A1MB 3DPDA 3U9UB 7PAZA 1QX1A 4E2OA 5F7HA 2HRPL 3F7VA 1NDGB 4TQIA 5D2NB 4NN7B 3VSQA 1NGZA 4F8TA 1CLYH 1EDQA 3VGBA 3KLDA 2ZIDA 3DX0A 3RFZC 4MS8D 1AR2A 5DFVD 4D7PA 5KTEL 3T0XA 3QUZD 4Z7OB 3OKMB 4HKXA 1KC5L 1RCYA 3HI5L 3TONA 3JZYA 2ITEA 3B4NA 4ZW5A 4JFED 4V1DB 3II3A 4M48H 1LEIB 5FHAL 3PWVB 3QZWA 25C8L 1HIML 3CHOA 2I7SA 4QCIA 1IAII 2F19L 3ESOA 5GRUL 2KZBA 3T0EC 1SUHA 4NQEB 5ILTL 2MCG1 4FCAA 2LVCA 2LU3A 3QYCA 1GGIH 1WA1X 2N56A 1BPVA 3V4PA 1MJ7H 5J12C 2K9UA 1JF1B 3ARFD 4HD9A 3CPLB 3VFMB 4APQC 2A0LD 3BEWB 1DO6A 4NQVA 1DTUA 4IU2B 2ERJC 3QWNA 2WLZA 4ETQB 3O0LA 1JNLH 1O5PA 4NKDA 4U3CA 5EU6A 2HPTA 4N0RA 1AHMA 4YSRA 3TJEH 1LE9A 4XPFL 2GSIA 4XVJL 32C2B 1E3ZA 1FNGB 5IR1B 5HDWA 1YY9D 4OF6A 3N9GH 4XT1C 2BVPB 2DWDB 1A3RH 2Y7OA 2VXUH 3C8KB 4P3DB 2P24B 4QT5A 4K8RH 3K6SB 2CIIB 2AMUA 1MCEA 3ARDC 3DHJA 1U3HC 2VC2H 2ARJB 2VDML 2JKRM 4HDIA 5KSUB 4MQSB 4NUJA 2QHLA 4Y9EA 2DTSA 5D96C 3CZFA 1T89A 3D87B 3W0WE 4FABL 4ZX4A 4HEPA 3RIAK 4L2LA 3FU0A 4DK6A 2VMJA 1AY1H 4QIRA 2PN5A 4MA3B 3RUGA 5FYJU 1E2VA 5HYSG 3QA3A 2WTRB 1W6WA 1HSAB 4GSUA 3S96B 1ACCA 3ARGC 1U8CA 3D9AH 5EU6D 1DJWA 1R47A 3K8KA 1S7WA 4NSKB 3BSZA 3FQXB 3WHXB 4TNVF 2FIKA 1Z32X 3WE6B 3UAJC 4OFYA 3QXUA 1JGUL 4MMYA 4WUKH 3MXWL 3BWAA 4ELMB 2IH3B 3ZKXB 3WIHA 4N8PA 2VZTA 4WI5A 3WEXA 2CJUL 3IF1A 4W9ZA 4Z7IA 3H6AA 3MA9H 4NZ8A 3S3BB 4XN9A 4ZTPL 2EUWA 1TCRB 5F9OH 2BWDA 3L3HA 1M71A 3QQ3B 5AVWB 3GS7A 1FN4B 1RULH 5DGQA 3TBSB 4MD5A 3RX7A 2Q0ZX 5DRWA 3KHOA 1NMCC 3L81A 4MCZB 1Q1PA 5IQ7H 3ZTDC 4ZUTA 5JHLL 2ZSWB 3QP3A 4WI0B 3Q44A 1FE8H 1OGAD 1T2QH 2WC7A 2RIKA 1G7QA 3FH5A 1AGEB 5CEZH 1V27A 1T5WB 1D5RA 3F7QA 1GYWA 1Y6KR 2AJSL 4M7JL 3D08A 4PJ9B 1L7TH 3DK0A 3P4OB 4NZRL 3UBFA 1G4RA 4TTGA 4KO6A 2J8UB 4JRLA 4F2EA 4OFYD 4GAJH 4BSVB 4C4BA 5AVXB 3O2WH 2IOMA 1NMBH 3EYQC 2G5BB 2CMRH 2YZ1A 4QGTA 5C0ND 4EXKA 5BUPA 3VXOA 3UH8A 1AKPA 4KQ3H 2Z8WC 1FYTB 5CCJA 1I85A 4ZO6A 1R3HB 1ORSB 2E4FA 1DBAH 4LHQB 3EG9B 4PWIA 4IOSA 2VO5A 2YD5A 4CVZA 5IVZA 4ACTA 4R0LC 2HTKC 1EBAA 3B8YA 2XZQL 5F9JB 4TN9A 5FLVA 1PIGA 4FQXA 4JS7A 4YK4C 4NZDA 3ZHFA 2UY6B 4MGXA 4JDTH 1I1CA 5TE4H 1A0QL 2G60L 4LL9A 1Z9MA 2QQNH 2X6BA 3MUHL 3FU3A 4HCRL 4F7CA 5FK9B 3KH3A 4FG2A 3ZKMD 1ZHKB 4OD2A 4PS8A 2D7TH 4X99B 3SKJL 4GW4B 1KYOJ 4UOQA 1HHIB 2HRGA 3BWZA 5K9JH 3ZYZA 4EIZC 4WW2C 1N2RB 4ZW8A 3MBXH 3SGKC 4KJWD 5AG9A 1RFDH 5BJTA 4JO2L 2QADB 4Y5VA 3T3ME 3S37H 1Q0YH 2V5YA 3RG1C 3U48A 1HWHB 4IGBA 3ILQD 4BFRA 4QTHA 5DT1L 3N85H 4IOSD 4G8IA 1ZV2A 5E5UB 3RWDB 3C6LA 2NDFA 4NHUA 2W9DH 2FT6A 1HZHH 3F6IA 1E5AA 1U21A 4HU8A 1OE3A 4FQXD 1JTTA 2XACC 4J2QA 4NKIL 4HSCX 1FV1A 3ZMRA 4JKPL 2OZ4L 3BOVA 4NRXB 2ZYSA 1MAMH 4W9LC 4YDIH 4OZFH 4KTEL 4PWEA 4E9SA 1EEZA 3JTSB 4PLJD 3PHOB 1XIWC 2WBJA 3DX7A 5EN3A 2L7EA 3TIDA 3IVKB 1ET8A 4GIPD 3V6FA 5CIPA 3VFVA 5I2IA 5DQ9B 2XN9A 1WA2X 4AL8H 2YAQA 1IKOP 1KXTA 1GZHC 2G9HB 1AR1D 2ITCB 4PJIB 3OPUA 5DRNB 4Z7UB 2BVYA 1UWYA 4L4TB 4CSSA 3UTTA 1B2WL 3DYMA 3B2VL 1T22A 3QRLA 4L37A 5J5EA 4B9CA 3QRBA 4HEME 5D2NA 3HZMB 3ESMA 3LMJH 4XNMA 3PIQB 4IGBD 1KG0B 2DYPA 4S1RL 4QRFA 3VQLA 1XF4A 2EDDA 3AY4C 1LNUB 3C6LD 4W1TA 3GBLA 2A4ZA 3P2DA 3PP4H 5IB5B 1MVFA 1IEAB 1R3LA 3KXFE 4W4OA 4GP5B 5FM4A 6TAAA 1NGWA 3KG5A 4JQVA 4UQ3A 3WOVA 1JTOA 3AREB 3LZPA 5GS0C 5EUKB 4WSGA 1XFPA 2WBJD 1ZGLB 4O58L 1TJGH 3FCTA 2W59A 2XN9D 3P02A 3I6LE 5CINH 1FGVL 1RL1A 3T3PF 5A6IA 2X4OB 3DSFL 3BEWA 4X0KA 4ABVA 1QFPA 4PRHB 1LJMA 3UTTD 1EH9A 1JK9B 5LLIC 2GEEA 4XO5A 3P73A 2H0JA 3GYRA 3VXUB 2MH4A 4MXQC 1AGBB 3QUMB 5KYUA 3B6SB 3SGDH 3EZJB 2DMKA 2DYPD 3OMZA 2XYBA 3FTZA 4KVNH 1OAQH 3RDTB 4BUHA 2EYSB 4WV1C 5MENE 2BHZA 5IOKA 4AITA 3GLDA 4JR9H 3KR3L 3ARTA 1FQ9C 2Y7MA 5IR1A 2ADJA 2I25N 2CR0A 3I6GB 4X4ZA 3MV9E 4I2XE 2A73A 2CM5A 4KHXL 2NQDA 1MVYA 3C8KA 3MPCA 1XB8A 1BF2A 1WRFA 1YRKA 4NWUL 2VDOH 1O7DC 4ZFZA 4GQZA 2B4CH 2VMDA 1ZIAA 1OM9A 3SD2A 4YS4A 2VDLH 3SE3C 2WM0A 4I7ZC 1M05B 2HG5B 2XG5A 5KSUA 4TQPA 1X9LA 4XVSH 2LLNA 7PCYA 4JN2B 3W5NA 3D69B 3WIFA 1KFAH 3L3JA 3ULSA 2NNRA 1WBXA 1P69B 2XA3A 2MNWA 4OCXH 2CO2A 2HT2D 1VFUA 2EACA 1F3JA 2FYYB 3E6HB 3AVEA 2H2SC 1KTJA 3N1MC 4MSWB 1AZBA 2WN2A 2HJKA 2VISB 3NIDF 1E9PB 2Y1AA 4PG2A 1JZHA 1DL7H 5DD1L 3LEXA 4JPIB 2ZG2A 3ARYA 1KNOB 3KNBB 3ARVA 4XP1H 3C60B 4OJAA 3I75B 4I0KA 4ELMA 2CBPA 2VJ8A 2CHXA 1KOAA 2BSSA 3EO1B 4GH7B 1UXLA 2FVNA 5SWZB 4ZMPA 4LIQL 5INCA 5I17B 4CILA 2BXYA 4B3VA 2EP6A 1FO0B 3SBQA 3SODB 3EJZD 2NX5B 3MRNA 4MQTB 3LKQB 3F8UB 5EZPA 3PGFL 4L1HA 1IAKA 1FN4A 4R4BA 5ESAA 3TBSA 5KSVB 1JHKL 2IAMA 2BSEA 4MCZA 2XZAH 1CE1H 4ANWA 5JR1L 3MBEB 4FQIL 4PJBA 5EO9B 4O02L 5E9NA 1FC2D 3G3LA 4DGUA 1WAPA 1TFPA 4LARH 4WU5A 5DJCB 3ZL1A 5M94B 2E7CA 4PJDB 5GJSH 2XA8H 1T5WA 2QV4A 3B2UD 1PX8A 5CHNA 4FFZH 5ITFA 1KN2H 2D0HA 3SDYL 1OK8A 3IB4A 3S98A 4OI8A 1KV7A 5I15L 2VLRB 3LCYA 4WSKA 3P4OA 3QEUA 5FW6A 3X1BA 1EEUA 2XICA 5DJ8B 4YC2B 3OJMB 4BSVA 2BIQA 3ABLB 2P8PB 3OC5A 2HKFL 4CN4A 2JKXA 4PWGA 3SEPA 3I02A 2C4FT 4OUOA 1FUNA 4X5RA 4MWFB 3AMKA 4KXCA 5K39A 4IRZH 4LQFH 5D4QA 2IAMD 2BSED 1FWXA 2FEDC 3O0RL 4K5MA 5D7SL 4NJAL 3QDJE 1QLFB 2J8HA 4KNUA 3PGDA 3GJFK 1IGMH 4LOVA 4YR6A 1TZ8A 3FU5A 1OW0A 3MNZB 2MPAL 4LIQE 3OLGA 4NQCA 4WI8A 1T03H 2ZPKH 5GS0H 3DI3B 4IOFC 1KLUB 2BJMH 4ENZA 5E1HB 1F58L 3PREA 3R8BB 1I4FA 3CBJB 4NP9A 2EDJA 2D3VA 1E3XA 1XHHA 2QPEB 4U4BA 2QQKH 4GT0A 3X1EA 2FJGB 5CAYB 3DUHA 3I3DA 4LLYB 1ZEAL 1TENA 5LUMA 4TULH 4KH2A 1XGYH 4JRWA 1PZCA 1JI1A 3GSNB 3PWPE 1II4E 4Y4FB 1OCRB 3J2PA 3NIDE 5JIDA 1NLBL 4KPHL 2V2TA 2ZWSA 1KJ2H 1HHJB 3DGGA 3LQZB 4LBEB 4D9LL 2HG0A 4LVNB 4Z1PA 3UADA 2F74A 3KM1A 5EU7E 3V6BR 3ZR6A 1E6JL 1U8OA 5DVPA 4FFWD 4CMHB 1I8KA 1INDL 4G7VH 3AXHA 4NQCD 3RWFB 4AQEA 3ZMEA 3SGEH 3BP6A 3JTSA 4HFUL 1M9WA 3IAQA 4PIBA 4NYLB 5IWLA 2JFCA 3NACH 5HD8D 1WD8A 2WYHA 3EJCA 5FUZL 1TQBB 2W1NA 2B1HH 2GG1A 4X42A 5DRNA 2JELL 3T71A 1U8IA 5IBUG 1QSFE 3O6KL 2VERN 1WFTA 4OIIL 3CQPA 1OTTC 1FC1A 3VB8A 4MNQE 2YN5A 4N22A 2DQFB 2Z8RA 1CT8B 2QADD 4QRUB 1H5BB 4PJ7B 4GSDL 1KG0A 3DROB 1AE6L 1JPST 5DRZA 2Z31A 1KB5L 4H8WL 4ONFH 3FL7A 1UWGL 5DRXB 2WMPA 5KBLA 4FGMA 4MYWB 2QMKA 4F7EB 5FUOL 5IB5A 3OSKA 1ORQB 1Z9SA 1QBBA 3G08B 4G6AC 3QNZB 4JQIL 3RP1A 3JWNC 5AZ2L 1P9MA 3BUIA 2YD9A 5GGSA 5AW6B 4AQAB 1BQ5A 2XZCL 1XCXA 4YUEH 5EBLB 3IJYA 5FXCH 2HVBA 5BO0D 2IXQB 2ZP0T 1F6FB 4XXCA 3T4AB 1XH0A 3NIFF 4AGMA 1QMUA 1KYAA 1B3IA 3BUPA 4R6UA 4PRHA 5IMKA 1FZKB 1RIUH 2QT6A 3L95A 1WGOA 4F33A 1H3UA 1TJHH 1AP2B 1ND0B 3GUTA 3WSQH 1ERNA 3OKOB 3H7LA 2OL3B 1EZLA 4U3SA 4MTMA 2WINB 4NNXB 3PNRB 1KLGB 4KKRA 4UOJA 2OPCA 3HB3B 5DURB 4F24A 2P52A 2Z31D 2FHFA 4IBQA 1MFMA 2I26N 2EYSA 4XC1H 4YO0A 3WNIA 4LCIL 4P23C 1NC2B 5LO7A 2AQ3A 2EEFA 1I7ZB 2FTAA 3GHBL 3I6GA 3ULVD 2WO2B 2CDEB 5FA4B 2P5WB 3LKNB 2X4UB 3QFJB 2XKSA 3T8MA 2ZUXA 1JHTB 3K4AA 2ZKHL 4FG0A 4WGKA 4EI0A 4KMTH 2OQJA 3O2VH 5BW7C 4APXB 1KCBA 4OLZL 2FECL 4LLDB 5TJWK 4JPVH 2DIBA 2GBVA 1CGSH 2VDQB 4NO2A 4UAHA 4S1QL 1HILB 1U8MA 3MNWA 3LQAH 3NH7L 4P2RB 4NCDA 4W93A 4B5EA 1RZGB 2W9EH 4PRHD 5E0FA 3AS0A 4H0GA 5JW4N 4X6DF 2OW7A 2JJSA 5GGTL 1ED3A 2HT4C 5KBKA 1JS4A 4AI7A 1K4CB 1OVZA 1CDUA 3EGSA 3MX0A 4Z78A 3WTSA 1KEGL 2VL5B 4Y19B 1N7ML 4RRPG 2NY4C 1LP9E 1MWAH 1YMHA 3RTLA 2EXSA 1S7XA 4RDBA 1KNOA 2VQ1A 2A2QT 3PXLA 2OYLA 1JD9A 1NUGA 4EUPB 4JFZL 3IETB 4PD4K 2Y5TA 5IT2L 5K9KB 4ZFOB 4W9DC 4UNUA 4X7SL 2OP4H 4I18C 3VD4A 3AACA 3B9VA 2BWQA 1F6AB 2KDGA 4XRCA 1BZ9A 1DEDA 3OJVC 3SDCB 1CK0H 1P4BL 1TYRA 3FCSB 4XO4A 4RGNE 3G6JF 5KSVA 1J1PL 4AC2A 2LW3A 2R0KL 3Q1SH 1XR9B 4L4VE 2YD0A 5EORL 4AEIL 5ISZB 1GJWA 4NPYA 2W38A 2Q3AA 4G71B 1LGVA 2X88A 2VM4A 5E5MB 2ZJSL 5EUOB 3VFNA 1RZ8B 1I53A 4XODA 2CHZA 1BYOA 1E28A 2RCSH 4HKJB 2DM4A 2WZPA 1WUZA 2MFNA 2VLRA 1M2VA 4TM9A 2Q20A 5CJBA 4PH8A 1T21B 3CVHL 4DQOL 2K7QA 4NUMA 4LZKA 5ID1B 3P30H 3NIFE 5JMOC 3RFZB 2YQBA 2A6DA 4DUXA 5IB2B 3A4AA 3RWEA 1A6TA 3D3VB 4ZFGL 3RGBA 2Z7UA 4FE9A 1JZ8A 3QDGB 5TDPB 3F12B 2X0UA 4EVNB 5AB0A 3SE8L 1IU1A 5I0XA 3G04B 1V7NL 2ZUQC 4PSRA 4GRLC 3T0EB 2WQXA 4OBSA 2VRQA 1RIHL 2ZX6A 5DLMH 5ICUA 3HR5B 3DX6B 3ZDZF 4ZO9A 4ZX6A 2R29L 4Q4EA 4GUOA 4WTZA 1W0YT 3RNQB 5J12B 5DZAA 3CDFA 4APQB 4M5YH 4NKOA 1UM6H 3EH5B 2ERJB 2D7NA 4Y5YC 3ETTA 1Q0XL 2WZPD 1I8LA 4A6YL 2VLRD 4PCSA 1A66A 2J6EH 5EFIB 2IALB 3GS4A 4HPOL 3QIBB 2IDTA 3GMQB 5DJ2A 2XTJC 4KWUA 1RUMH 2FQGA 5KAQF 2C9UA 3ZQ9A 1W72A 4GQQA 2PP8A 3LQAC 3NFNA 1YHPA 5ADOH 1DQDL 4HH9B 4Y4FA 2JTDA 4XPGL 1ZE3C 1S7VA 1G6VK 3HMXL 4KQ4L 3X11B 4G6JL 2J43A 3KVQA 2Y3AA 3ARDB 3A4EA 2O4EA 2I27N 4WNQB 1R5IB 3Q8FA 5D96B 1T1WB 1T0OA 2NY2C 2NY3C 2A9DA 5HDBE 4ZOBA 3V10A 4WJG3 1PDKB 1F3RB 3GI8H 2BC4A 1BGXL 2ZYRA 1EXUA 3G6JE 5M95B 1S9YA 4ZDHA 3ARGB 3O2DL 5EA0H 3ARSA 3MZTA 2V3DA 3TEYA 3K8MA 4OF0A 1D5IH 3EZ8A 1PJWA 4OCNC 2OR8A 3QG6B 3R8QA 3AQDA 4PVLA 3M17B 3QZOA 3P4NB 3T08A 4BSJA 3QUHA 2FCBA 5BQ7A 2BP8A 5IMMA 4Y4FD 4ZNEA 3QQ4A 5D2LE 1EQWA 3WFHA 5FM5O 2F8IA 1KXQA 1YSOA 4FQCH 3V4VL 2ARJQ 5HVFB 2ZUWA 3MRJA 4BXVA 3ESVF 4YDJB 3UTSB 1QI5A 1YEFH 2V9QA 5FECB 1GYCA 1MI5A 2YSSB 1BFSA 3QNZA 4AM0A 2NNCA 2XQYA 2CKBA 1I3RB 2YKLH 1ES0B 3KLQA 4KKNA 4OLXL 5F6IC 3BZEB 1CE6A 3CQQA 4HETA 4Y4HC 4NAQA 5IBUB 5EBLA 1DQTA 4G72B 2IXQA 5EF0A 2D7OA 12E8H 4D0DB 4HS6B 1KGXA 3NZSA 4J4PA 5CO1A 4HIEB 4YH6A 5DD6B 5L7XL 3ZDZE 1A21A 5E8NB 4LU5L 4FQ2H 2JIXA 4DN3L 4JO8A 3RB5A 3QIUA 5A2AA 1AQKH 5C0CB 1ND0A 3MLYH 1JZ3A 3CLEH 5IJVA 1PBYA 2EIZA 1QBMH 4ZUWA 5FO7B 2AJZB 5D1XE 1MRDL 1T5XB 1NUFA 1NCAH 3UJIL 1UEMA 2HFEA 2ZCKH 5GGRA 3FO2B 3TPUB 2OA9A 5JW3H 4X6BB 4CC4A 2E6JA 4E41E 1UOVA 2X4UA 1MI5D 3M86A 5K9OA 2VSCA 4GI6A 4RSYA 4FFVC 1JFHA 4YK4B 3VH8B 4APXA 2EINB 1BREA 2NOYA 5GGVH 3C8DA 3SDXB 5C0EA 1AOZA 2WGXA 4DGIL 3H7BA 4I9XA 1PF3A 2B14A 5IGXH 1HILA 1MIML 3O6ML 4J4PD 2YK1H 4YAQB 1CXLA 1KTLB 3OGOE 1EEYA 1OK0A 4P2RA 3CX2A 5CGYC 5ABDE 2JIXD 1BYNA 3IT8D 1YPZA 4J7RA 3QIUD 4JO3L 3LRLA 5KS9A 3KDPB 2VC2B 2VLLB 2PPEA 1DZ0A 4KI5F 4WW2B 4R26H 4AYDC 3PAYA 4Y19A 4UINL 3INUL 4J3OD 1RJZB 4IDJH 2HJLB 2CWRA 1QYGL 2BIIA 3MUY1 5DURD 5CR1A 3KW8A 4XXWC 4D94A 1FH5L 2Q6WA 2VXQL 4EDWH 3VI3B 4EUPA 4FTDA 3N43F 4LDLB 3MRKB 3VWKC 2X1OA 5IY5B 4F3FB 5IK3B 4ZUVB 3DV4B 2AANA 5I8OH 2O5XL 2A9NL 4WFGE 3F04A 5E2VH 5GRXG 2Z3FA 4CBZA 2CO6B 3FCSA 4ORGA 3LD8C 2H6PB 2Q3ZA 1G0YR 5HHVL 3TT1L 1JRHL 1XIWB 2P5PA 3BUTA 2QQLL 3BISA 5ISZA 2I32A 3FBKA 3RWJB 4P2RD 2BNRE 15C8L 5H4YA 1CFQA 3OTTA 5KWYC 1DFBH 3GXPA 4U1LA 1DDHB 5EUOA 1VEMA 3UX9B 2QDVA 4B9YA 2UZXA 3N1GC 5HHQA 3U46A 4BZYA 4Y19D 2Y36H 4OH2A 4HC1H 5HYEA 1T21A 3AQXA 4LPWA 4OZGE 1U8PA 3FCUB 2VMFA 4CU7A 4H13C 4A2MA 2YAHA 2X89A 3F3HA 5GQBA 5L0QC 3AADB 4Q56A 1EMTL 1CVRA 3JT0A 1BBJB 5DHYB 3HI6L 2GEQA 1PSKH 5LCVA 5B8CC 5TDPA 3F12A 2AXWA 2R7EB 3GJFB 1AGCB 1U6AH 4U6XA 5C6TH 3MAWA 4FYQA 1OARH 4P4RB 4HPHA 2HMIC 1F41A 3HR5A 3L7FB 5DTFB 4GG6F 3PE9A 1XEDA 1ZCRA 5ISZD 3DYOA 2D9CA 1GC1H 4G6FD 5E7FA 3G6DL 1QABA 2DBLL 4R83A 1YAIA 3EH3B 1GSKA 1U8QA 5KEZA 1A4KB 4AQZA 1XZWA 2Y5QA 2YPVL 1QP1A 2J2ZB 4R97C 3QI9C 3KVDD 1UXWB 4NQXB 5LNEA 3WMSA 2IALA 1N67A 3TL5A 2ADYA 4RDQF 4QHUB 3GMQA 4H1LA 2X89D 3FRPA 2DB8A 4WV1B 5IKCB 3D12B 5KSBA 3MMEA 2JNZA 4UT6A 1AO7E 2NZ9C 4M7KH 1ZT4B 2Q86A 4KI5E 1E4XI 5DR5L 4L3FA 3KGTA 2F9BT 4NDMA 1JGVL 1ML0A 2WXJA 4GIAA 3T0ED 4XWGL 1JFQL 4KMLB 3SDDC 1U3HA 1MVUA 1SMDA 1H6TA 3VXPB 5AW7B 4N6QA 1NM9A 3EJPA 1X5XA 2IDUA 4GXVL 4M6OL 4G8FA 1MLBB 5D7JC 5IB4B 4BH7B 4ZSOB 1EJFA 1RV6X 5F1OB 3WLWD 4F93B 3DOIA 1OF0A 1NPJA 4NQDB 3ZE0B 1RERA 3OAYH 1CI3M 5C9JA 1R3KB 2VABB 3ARGA 3I9PA 3MVSA 3IDIA 3EGDA 4I8DA 5EC1B 5MEOA 1PG7W 5FDYA 1OAXH 3H8NA 3FTWA 4K7FA 4IEFB 4YL9A 3VXRB 1YMME 3SPIA 4OZFB 4XNDA 1DVXA 4K3JL 5D8JL 5TH2B 2K6ZA 2E27H 5L4IA 1WS7A 3GQFA 1QFWL 1MCQA 2YJLA 3L2LA 3S8FB 2NCMA 2YA1A 1IC4L 4F8NA 2Q8BH 1PLCA 3VG9C 3QNFA 1YEJL 1NH6A 1MJ8H 1SVBA 4WHYG 5CGBA 3MJGX 1LD9A 3D09A 1U3HD 5DZLA 5BVPH 5FECA 4YDJA 1EEQA 1NKRA 4AKQA 3TNNB 3NABH 1CZ8L 2YGNA 1QWNA 4NM4H 3RHWF 2LLGA 4PCYA 4QRTA 1FFRA 3VD5A 1T6BX 3DVFA 5D1ZA 1UM5H 1DBJL 4PV9A 4UIKH 4D0DA 4HS6A 3P69A 4LLQB 3UGXA 2DMHA 1H9VA 4X6CB 3ARGD 2NY5L 4TQEL 3VTMA 2BVOA 1R6VA 3RWGA 4JG0H 3OKYA 3PP3K 2E9GA 2X41A 5I66B 3FFDB 3V4PL 5E03A 4X9HA 4K94L 2WQWA 3N41F 4AK1A 3BGMA 4BDVB 1S7QA 4MA8H 3U4BL 2C7UB 1KTCA 4JFEE 1O9WA 2ZG3A 4OSUH 1BFVL 2NSXA 3SKMA 1RUPH 5CM1A 3T1FB 1WFNA 4A7TA 1MFEL 3JTTB 4P59H 2H4EA 1KYOK 1ID2A 3TPUA 4UOZA 4R0LA 5AW5B 5IOPA 4MKTA 5TE7L 1S5HA 3BSGA 4PG9B 2Z91A 3BE1L 1R33A 4XTRD 3LRSA 4PBDA 2FJHA 2BHYA 3R4DA 4CUCA 2Y6TE 3SDXA 4H25A 2FL5B 5B4MC 5TF1L 5EPMA 4IRSA 4BKLB 5D1ZD 4O51A 4NP4H 5FW7A 4XOBA 1TQCC 1KCUL 2HTLC 3MRIB 4L29A 4L3EB 3PJSB 1VB9A 2DQTH 3FONA 1FORL 5AW8B 2A4EA 1F2QA 4YSSA 1FVCA 5FO9B 5HJ3B 5MP6H 1IM3B 2VLLA 5AAMC 2N0KA 2HKAA 1C12B 1G1YA 4IRJA 2HJLA 5LB1A 4K3GA 3SYCA 1P7QB 1XSJA 3HBPA 1Q90A 4JANB 1JXJA 4LCWB 1G9NL 1NFDA 2CXGA 3QUXA 4B9GA 5IW1A 4GG8B 1AGFB 3BSZL 2Y7NA 3HR6A 4M7LH 3IDXH 3GMRB 2VXSH 5DJ6A 1J8RA 3DOHA 1MG3C 5GISH 1AKJA 3LAFA 1MCHA 5IROC 2CO6A 5KYXB 2PUQT 3WIHL 1J1XH 2H6PA 1HSBA 2LVEA 1KGCE 4IRSD 5GS1C 3T2NH 4TSBL 1XIWA 3B9AA 1C5CH 2VN4A 3ZHNA 1G4MA 1Z9NA 5EU6E 3BEVB 3RWJA 5I6MA 1F1GA 3B83A 4QTIL 1NKOA 4JVWA 1H6FA 3A22A 2AQRA 4FJZA 1BZ7B 4X7EC 4DP2X 4L1SA 5ACLA 3VD7A 3UMTA 3UEQA 2PCXA 3HZVB 1OZUA 2VDPL 2ZOLB 4IRJD 2P8MB 4AYFA 1EIBA 2X4PB 1A4JB 3JV5A 1U41A 2XN1A 1DN0B 3OGCA 1R0AH 5FW8A 5AQ0A 3KPPA 3ALPA 4B9IA 4A67A 3QUXD 2A9ML 3QS2A 3NP4A 3ULUH 3TV8A 1XH1A 3BUBA 3QUYC 2XVBA 4MDJA 4H26A 5KAQG 1RKRA 1PTZA 2R69A 4X9FA 1AKJD 3QISA 4QOKA 2H32A 3HVNA 3Q8AA 4PUBL 1AGCA 1DUZA 1A7NL 3CZGA 4UNTA 3RUGE 3IDMA 3ZUNC 4JEGB 3BH8B 3PS6A 5C09A 5SWSB 3DYPA 1XIWD 5CNHA 5DTFA 3WLBB 4M93C 1JIBA 3S34L 2J25A 1AZUA 3VFGH 2BOBA 2AERT 4AENB 2J5WA 3EYFA 3IFOB 1HQRA 2Y23A 2OMVA 4P57A 3ULUF 2DM7A 4UWQB 1L0PA 4L8DB 5FYJH 4JCMA 3O6FC 4PJEA 4DIXA 5LBGA 1NCJA 1A4KA 1EAJA 2ITDA 4M6NH 1O7VA 2XYCA 4QRPB 3WDIA 5FR3A 1FZJA 1S7SA 2ZZUT 4BA0A 5JPMC 1ONQA 4HXAH 4NQSB 3SIKA 1XGRA 5EMYA 5DS2A 5H94B 4Y9GA 4DHLA 3SBWA 2AF2A 1FLTX 4CAGA 3TEWA 4F9LA 1ZKAA 4P23B 2XXCB 4H20L 1GYUA 3CC5A 1ZT4A 1NUDA 3VVVA 5F7KC 1FBIH 1HFUA 2ZF9A 1WEJH 3QZBA 2H6UA 4QOKD 1JE6A 1BIIB 1P4LB 2PYEA 5ENWA 3TLRA 1KC5H 4JY5L 2JCCF 5DD5H 5C09D 4TPRL 2YD4A 1SXBA 5AB9A 1C5BL 4LT7A 4F15C 1VFMA 1NEZG 1RH8A 5GRUH 1FLRL 4ADGA 5F3BB 2EO7A 4HLZH 5GGSY 4NQDA 4KRNA 4CVXA 4BWUA 3Q3GB 4K5NA 1OL0A 2JH2A 1XCQA 2VABA 3MGOA 2Z1KA 2AV7A 5DEFB 3WN5C 3CXHJ 3F00A 1IBYA 2K6WA 1PS3A 3L4ZA 2NY4B 3DDFA 3V5KB 3ZT6A 5C8JB 1MWOA 3A23A 1I1YB 1SJXA 4V2CB 4D0BA 1MCFA 2P1YA 1GTFA 1FNEA 1T3FB 3LKOB 4WLCA 4PGDB 2AITA 5TH2A 5JA8B 4MRCA 2EUXA 3VFUB 4DPAX 3BCFA 1FL6A 2A83A 1EAPA 3RBGA 5BRPA 4YJZL 4ZX3A 4YBHA 4I18B 3O6LH 5DS1A 1RJLB 3OAYK 3UYOD 2PYED 2C26A 5KUMA 3JBG7 5B38A 3KPTA 4G11A 2HRHA 4R2GD 4XI5C 4G9FB 3T2LA 2VUOA 3UBXG 2UZYB 3IJEA 5DJ0A 4XNUL 4LSVL 5FF6A 1GW0A 4K0OA 3H9HB 3MUGB 3GI9H 5CJ8A 3SOBL 4NQDD 1F4XH 1MHCB 1N8OE 4HIIB 4ZI8A 4OQTA 1S4IA 1X4XA 4ZFQA 4U6YB 1MHHA 3BP5B 4H8VA 1A9BA 4UCFA 4X7TB 1MPAH 4K7PX 1RUKH 4XP5H 1BOGA 3RWHA 3VQ2C 1FCCA 1QFUL 1ANUA 1EPFA 1WWWX 3GSQB 4V11A 4HG4J 2WYTA 4DCQB 4N8UA 5TFSL 1A6VL 1DQIA 2GFBB 5FGSA 4NJ9L 2NW3A 1E4WH 3HG4A 4YHOL 3QQ9C 4OFQA 3HI1B 3LPPA 5F0LB 5FGCB 2LU4A 4YHNA 4PLNC 3PU7A 3T1FA 5CR8A 3JTTA 2F53B 1F4WH 3CSTA 2ZUQB 4GRLB 1GGCH 2DMGA 1W0WB 4ODWA 5G55A 5C0DB 4L0YA 3BCDA 4ZTPH 3ZUCA 4ETYA 3UABA 2XN9E 2UX6A 2X4TA 4PGBB 3FFCE 1IGCH 2FL5A 3UTTE 1DJZA 3PLYA 3FC8A 4YNYB 5EU5A 1NIEA 2FUQA 4UB0H 3BN9D 3VFSB 3WHE0 5B7EA 4O9HL 4Y5YB 2C8NA 4ZJ9A 2VR6A 4BK5C 1W8OA 4IK7A 4CRPA 4HIXL 4M3JA 5D5MF 1NANH 1CF1A 1G7PA 5FO9A 5HJ3A 3WEBA 1IM3A 2X4RB 2C3VB 2WVVB 2XTJB 3MRPB 3O3AB 4JVUA 4DOHB 1ZDQA 4OAWB 3NFPA 1L5GB 3CLFH 5IZ7A 2AJVH 2APBA 3BT2H 3L4TA 4UV4H 4Z7VB 1P7KB 2VLKB 2HB0A 2F1EA 3JVGA 3LPFA 2XJKA 1M3JA 4G6ML 3WNPA 1KZYA 2HJFA 4Z7NB 3S35L 1QRNB 3KBFA 3N42F 4CC1A 2DQ6A 4S0HA 1NOFA 1BD2A 2QPSA 4QHNA 5KYXA 2NY2B 4YSAA 2NY3B 4UIMB 2XZQH 4OF3A 5T8IA 1OF2A 2E7BA 1JCVA 1IAIL 4H8HA 3K1DA 1KCKA 2F5BH 3MRBA 4JRYB 1V5JA 1HHGA 1DN2A 1YDPA 2PCFB 3QJZA 1M4KA 4IIZA 4LSPL 3P77A 2FJSA 1U8NB 5FHBL 5AYUH 2O72A 3QXDA 1KIQA 4HCRH 3RGVA 3UBHA 3TESA 3AU0A 1IM3D 2O6DA 4HCGA 3TVMC 2ZE0A 5AOKA 4ZS7L 3L13A 3HZVA 4D9RD 4BHUA 4AKPA 3RKDC 1F8TL 3PPSA 4OZHF 4HULB 3SKJH 2X4PA 1A4JA 1CGUA 4DN4L 1DN0A 4M61B 4A2EA 1IAIM 4OU3A 4NOBA 3L3DA 3IJ8A 4KXZI 4IQHA 2GI7A 4AG4L 3RU8L 2NT1A 4RDQG 4A7VA 3T4YA 1XH3B 3EJYC 1J0JA 2Z8VC 4JO2H 1A8JH 3C5SB 1NGQH 2VWEE 2ZXAA 4PRDA 2QLVB 4PS4H 1NJ9A 5ELIA 4H44C 5F1NB 4JRXB 3WD5H 3EDFA 5ITBL 4HJUA 1BD2D 1T7ZA 1ZS8A 1NSNL 2XC8A 3O45B 5CP3H 2C1PB 2CLVA 5F6IB 3PABB 1T80A 1EK3A 4JN1H 1B0GA 2MTPA 4Y4HB 2UXVA 5SWSA 3BDBA 4UTAH 5I1LA 4PJ8C 1MNUL 2BERA 5CILH 3MFGB 1MHPH 4I0CC 2WLKA 2IH1B 1KYDA 4KTEH 1YYMH 2CZNA 3WFBL 2ZWZA 1UCBL 4L8DA 3RGVD 3OHXC 1ET5A 1CD1A 3VD3A 2DQUL 1A1NA 1C8QA 1S7UB 3WFZA 1EX0A 3CG8A 5A6MA 1NDMB 2BSTA 3QR2A 4X4KA 4E68A 2G0LA 5H94A 3APNA 1B2WH 4Q74A 4Y89A 1Y07A 5KJ4A 1QW9A 1U93A 1VADA 4TUKH 1KJ3L 1ZA6B 1IIKA 2YPLA 4G9DB 4G59C 4W9JC 1A7OL 1A7PL 1TYJA 5ADPH 1B0RA 3PCYA 2CALA 1REIA 2QBWA 4PJBE 3ZE1E 4DQAA 4S1RH 3HUJE 3UYRL 5EDXA 4AQOA 3FUDA 1PAZA 1P4LA 3GT6A 4MCYA 4N2HA 1U2YA 1S3KH 2CAKA 2MQGA 4DAGL 5BW7A 1NLDL 4GXFA 4NGHL 5SWSD 1ETZA 1I8IA 5AW9B 1JPTH 2PP9A 3GBNL 3D50A 1INEL 1OSZB 2GTWB 2MNUA 2NR6A 3DOSB 3GLZA 3MV7B 5ICYA 1V10A 5I5JA 1CBVL 1LILA 4H2CA 1E8XA 2W9LA 2YMXL 1PLBA 3JQOB 5DHVB 1X9RA 4PJFA 5EU4B 1EZVX 2IQAA 3PWLA 3S3CB 2KZKA 2J73A 1V3JA 2OMZA 4G8EB 4LEOA 4MZ3A 3D4YA 3ZDXB 4MJIB 4HX1A 2VQ4A 3V5KA 5DLLA 2QGEA 4I4WA 2PTUA 5CU9A 3HBGA 5C8JA 5T1DL 2QVTA 4JQXC 1HU8A 1JSYA 1QWHA 1YNTF 2XPZA 1JZFA 1EO8L 2B16A 2YPLD 3IXTA 4PVMA 4L8SA 3VFUA 5GS2D 3VWKB 4JFXA 3FO0H 3LIUA 4KV5E 2ENJA 5DMKB 3NMEA 1NEZB 3VM7A 4OZHE 4BYHA 1JZJA 1HL4A 1JPSL 4NQCE 4PRBA 5KVDL 3NTCH 3VD0A 1J5CA 1MFVA 2ESVB 5D7LB 2HLFC 3LD8B 2CLRB 5GGRY 3WFEL 3NAAL 4MD0B 4MJ5B 4E36A 1I82A 2EE0A 3EHBC 1RK0B 3ETBF 1LDSA 2NR6D 3LN4B 1UYWL 4G42A 1HHHB 1DJIA 3PV6A 1BM3H 5B1AB 1GY1A 1WA0X 3IMVA 1BJMA 3US9A 1HNGA 3EBIA 3SQOL 3ULVL 2DQDL 5IHZB 3AG1B 4U6YA 2IOIA 3QDAA 4AC4A 1IE4A 3QO0B 4NO3A 2IQ9L 2QTEA 3BPNC 4JDVB 2DH2A 1CD9B 4O5LH 1F56A 2UWEE 4DCQA 3CVDA 5L0QB 3GSUB 1JWUA 4L0ZA 1A9EA 4TLTA 5IBLC 5DD1H 1P6FA 3ZQWA 5ESQA 1CFTB 4A1RA 3VD1A 2F58L 5B8CB 3LRKA 3GZOA 4NO5B 3AG3B 3M6DA 1L7IL 4C58B 3DI2B 2F53A 1XD0A 1YEEH 4GRLA 3FO1B 1W0WA 4K71C 2AJXH 4PB9L 5HJDA 1KBKA 1PZ2A 1MCBA 3DJ9A 3VA2C 4MMZA 4K3HA 1GZQA 2OX5A 1ADQH 1HH9B 5EF3A 3MGAA 4N25A 4YXKH 2G3ZA 3NZ8B 3QFDB 3QPQD 4GW5B 2WXMA 4NC0B 4PJCF 1QQDB 1Q1JL 4O02H 5KVDE 3IMRA 3V5HA 3KJ6L 4UQEA 4R97B 3QI9B 3MV8B 3MJ9L 4B60A 3E38A 1F1DA 4W9EC 1UUSA 1XGPB 4DP8X 2F8OA 3B5GA 4FDWA 1SOKA 2EH7L 3O3AA 5I15H 4Z7AA 1IFRA 3K2MC 3WDJA 5G4OA 3GTTA 2YRZA 3DVGA 3E7JA 4DP6X 4Z7VA 4OLWH 1ACYL 4N2LA 2F53D 4FXTA 1KLFA 4B9KC 1AMYA 4GRLD 5DI8A 3WXVH 5F72S 5JIMA 2N59A 3BP7B 3T0BA 2R0ZL 4OB5L 3W2DL 2BIPA 5F7NC 3RVTC 5C3IA 5D7JB 5D7SH 4W9HC 3D85B 2ZOTA 1CQYA 4JJ5B 3LIZA 1KTBA 1SYSB 4OZIA 3B9KC 3UCRA 5E08H 4LP4A 5KBDA 1GHFL 1GW6A 1CB4A 4XMPL 1I7TA 1ITBB 2H2PC 4KX8A 2IJ0C 1N18A 3DK2A 5IQ9A 1CL7I 2VZ1A 1B3JA 5B3JE 2QFPA 3LPWA 3S4SG 4LLMB 3STBA 4FQJL 2JK5A 3AS3A 4LLUB 3MRMB 3OC8A 2BSRA 1T7XA 3ZL4L 3QXTA 3LNIA 4JM4H 4HJJL 5HHPB 4CNIA 4M29A 2YEQA 1CTMA 4S1SH 2IVFC 3X1NA 5DWUH 4PJHF 1O5DT 1NLBH 5DEGB 5A16A 3O3BB 1NAMH 2NY2D 3O45A 4Y4HA 1MXGA 4H5SA 2WNKA 2NTFA 5BUAA 2APWA 4YHIB 3ETSA 5EC2A 3KM2A 6CGTA 3D7PA 5KG9A 3GGWA 4FYRA 1AACA 3CHRA 1HKFA 3Q2NA 5FUZH 3WXWL 1RZJH 1U91B 3TZVA 1GPOH 3EOAB 3AG2B 4B9PA 4X6FA 3V9EA 3US1A 2R23B 1KMGA 4HQQL 4PRPB 4WY7L 1BVOA 3EJRA 3O6KH 1SYVB 4EBQH 1AYRA 4C8XA 4YHPB 5F3HB 4TVPE 5T1KA 3K6FA 1ZA6A 3IU3A 3QDME 2Y72A 4TUOA 4OGAC 1JGDA 2H3KA 1TO5A 1FPTL 4HLZG 4H8WH 3HFFA 1UZ6F 2NUPB 4B97A 1UWGH 1W16A 4NOFA 1W72L 3KJ4C 2JQMA 4Y4HD 5I1CL 4BRJA 2BRQA 1AMXA 4XOEA 4XNYL 2CHDA 4ODVH 4JX0A 1TQCB 4F1SA 2VAAA 2MOQA 5EU7C 4RGMC 3FTUA 4KAQH 3QNXA 1K8IB 3FW6A 3MREB 3L45A 4IMLB 2CO3A 4N68A 2GI0A 4RA0C 1XSOA 5E1AB 1X6LA 2EDQA 4XAKE 1IC0A 3TZVD 1MCJA 4FP8L 4JFPA 3X12B 5J6SA 4N2NA 4RAVB 1D5BA 4ZFFA 1JNHB 3QJQB 1FFPA 2BFVL 4JM2F 4MJIA 3IGAA 5DVLA 5T33L 3KPSA 3VXSB 1PZ3A 5T1KD 4FNSA 1GOHA 2RB8A 4PCKA 5FWQA 3VGAC 3O4LA 2WSDA 2HFFB 5AL8A 4P8QA 5E6SB 2K4WA 3GHEH 1UQSB 3TO4A 3I9AA 1JXKA 4LHUG 1ZGLP 2AQSA 3WJMA 4WUUB 5GRYA 4RWHA 1D6VL 1U3NA 2ZCHL 4RZCA 1B4JL 1GTNA 3DTXA 3I6KB 3ZE2E 4FFVD 5BRZE 2B3IA 2IFFH 3ORJA 3DVNB 1EO5A 2ZKYA 5D7LA 4N8CL 2KHAA 2EXWC 5GS1B 3BFQG 4FQQB 3ZPDA 3NIGF 4AV5A 1KIPA 1HHHA 4P5TA 3CFKB 5CEYA 2KZ1B 4W81A 2FEEI 5D7IF 3BGAA 1R5WB 4EZMA 2WV3A 3SYAA 4ZUUB 4GUPB 2QHRL 4IS6B 4HHAA 3NH7H 1YNLL 1HHKB 2CKBL 1EFXA 2YEZA 1LK2B 4MJID 1MW3A 4PJGF 3OB8A 3KPSD 5L4MA 2AK4B 2FX9H 3ECQA 3APFA 5GGTH 4HUWB 4EZJA 3U0WL 4HBCL 4EJ1C 1SJVA 1KEGH 3O4LD 5K69A 1N7MH 1OGSA 3IRCA 4BZ1H 3QEQB 4QRQA 1OPOA 3MRHB 3BPOB 4X7DC 2QSVA 3D4GA 3TO4D 4Y2OB 1YNKL 3PAVA 5F89A 5L88L 3I2CH 4XN1A 5DO2D 1XX9C 1L9TA 2P4AB 1J86A 5IT2H 3NCCB 3MR9B 1VZGA 5D7LD 1TSHA 1JVOA 3OZ9L 2X28A 5I1AB 5KBPA 1D6EA 4NNPH 4OF8A 4AJYV 1TUPA 3G5XA 1GZPA 4M93B 1HH9A 3TBWB 4P5TD 2X6AA 1FIEA 2RR3A 3CSYA 3QFDA 1EDYA 2FX8H 1AXSB 3DGCR 1UZ6E 3HPJB 4I85A 4Y5XA 3O6FB 4RH4A 4GW5A 4HUXA 4TTDC 4QXVA 4WI3A 2AGJL 4AEIH 4H88L 4H8WC 1EFXD 3K2KA 5HDLA 1SJMA 2XIDA 3QI9A 3VYNA 4UU9B 1BF5A 5E2WL 2NPLX 1P0SE 4GYBA 4ZNEE 1XGPA 3L9YA 2WP3T 1KXQE 3OAWA 1KXVC 4J1UB 2Y07H 2WCSA 2MHAA 4YFLI 1MI5E 4RGOH 4DQOH 2WCPA 5I0VA 4TSCH 5JMRA 4RNRA 3H54A 1Z6JT 2AXFA 1MCCA 4PTTA 2P45B 5C97A 5C0JB 3CSPA 1WGVA 1LMIA 3SDDA 2HMID 1PEZA 1MJUL 1DJXA 1P53A 4F15B 5IHWA 1RJYA 2OTWA 3R4RA 3RNKB 3V2AR 1V7NH 4LLWA 3OMAB 1U8KA 5HY9B 4WWKA 4LBAA 5ANMA 4MAUL 3JVFC 5DZPA 4UV7L 5IUCA 5E8DL 3T1WA 1MEXH 3D85A 3KAAA 3D51A 4RGNC 2R29H 4HT1H 4JKLA 1SYSA 2R2HA 2A77L 3W56A 4OJEH 3QXWA 1M9SA 3QI9D 3TM6A 3WN5B 3D39A 3NIGE 4IBSA 4PGEA 3LNDA 5EWIL 1QUNB 3B8SA 3HAEB 4U1IB 4YEEA 1FGNL 2YBGA 2R0WH 5HYSA 5F7DA 4UYQA 4BE5A 2AAVA 1G7MA 2FBOJ 3V95A 4HIHB 2FO4A 1LE5B 1PZ5A 4KNTA 4A7UA 4NZFA 4B50A 1SXAA 4Q2ZB 3SDDD 3SE4A 5KVGL 1BW8A 2XWEA 3Q1EA 1EGJH 3C08L 1A6ZA 2VSMB 3ZZLA 1CYGA 4X9IA 3VI4F 3CFCL 3MKKA 5A2KH 4G6JH 5IBTL 4WWKD 5I76B 2QKSA 2ZCZA 3OKNA 4V33A 3B5TA 1YPZE 3GLEA 4KK5C 1WWCA 5LCVL 3D85D 3TPKA 5KS9E 4AE0A 2KQMA 3MOQA 4JFYA 1SY6H 3FQ1A 3WFDL 3D39D 2R4SL 1ASQA 3O3DB 2DIAA 2VZSA 3QPXL 2DLFL 4OKVB 4D9QD 3OLEA 2EADA 2PWGA 4PWHA 4KKBD 1Y6MR 4Z76A 2R23A 3BJLA 5AOJA 2YUXA 3NPSC 3O2DH 1QBLH 3VFTA 4PRIE 1KJVA 5EIIG 3AGWA 1WFMA 1PKQE 5J13B 2PMZA 1PU0A 4X9BA 5BZWB 5JQ6L 3QJSB 1JDCA 3OKLB 5GJTH 2VDRB 4BV1A 1QR1A 3B9DA 3CV5A 2HVKB 4YQXL 4XC3H 2NUPA 4LK4A 4P2QA 1KULA 4JUSA 2ZF8A 3V4VH 3GXFA 2MMXA 1JNJA 3LKSB 3D0LB 4UT6L 2FQFA 4JHAH 3P1VA 2PWFA 4M4PA 2ADIB 2J55A 5GRZA 2OMBA 5AOLA 1VFAA 2GYSA 1C16B 1LLAA 1DJHA 3ZT7A 5DK0A 3FOMB 4AYID 4BFFA 2VO8A 3MREA 4IMLA 2P80A 5KVGE 3ZZ1A 5I5MA 1YEWA 3F7PC 4I5BB 3F84A 3W0WB 2CBTA 4L8BB 1S78D 2FD6L 4ACPA 5L7XH 4OGXL 3EFDL 1JP5A 4PYGA 3VJ6A 1U8HA 2H1PL 3BZDA 5I82A 1RIVL 4ALAL 4E0RA 5JOPD 1U8LB 1A25A 1PY9A 4WDIA 1KTKE 4J6RH 2AKRA 5D70H 1H15A 3HMWH 5I8EA 1UQSA 3QEHB 2Z7WA 4RMSA 3RVUD 4P2QD 1OT1A 2OXGA 4Q9RL 1IMHC 2XTLA 3I6KA 3UERA 1U92B 3IK2A 4N2MA 3DO7B 3ET9F 3LS4H 4A7GA 4FQQA 1YJDL 3DJRA 2BHUA 4UT9A 2IPKA 2XWTB 5GSRB 3MGTB 5T3ZH 4I3RL 2Q8AL 5ABZA 4S0TD 3CTTA 2P80D 1BXVA 3UZVB 4Q0XH 1P4UA 3DXAE 4C56E 1R5WA 3FU7B 2W07B 4PU2A 3CUPB 4ODXB 4S11A 5CJXA 5JOFA 4XX5A 1MIMH 1A3LH 4ERSL 1KCVL 3TVMB 5KSBE 5A3IC 2A38A 3NJXA 1WITA 3BVNA 1NL0H 3VSVA 1LK2A 4E9QA 2APFA 1YEIL 2COQA 3ECWA 2DM2A 3IN0A 2WOBA 5HSFA 1I9RL 4JO3H 4HS3B 4IOIA 5E6IC 4IKIA 1HAWA 2VDMB 1JN6B 4DGYH 2QPDB 2Z0UA 4E5XG 1MH5A 3RL1B 1E5ZA 1A2YB 1I7UA 1PZSA 3QUYA 5CLWA 2X70B 3FB7A 1SDDB 1YLBB 2JXMA 3DJZA 3DUUA 1FH5H 2V4LA 2X7LA 4QXGH 4WK4B 2DH3A 3LKPA 4N26A 4XN7A 3LHAA 2DEYX 2WLLB 4N0FA 3OKEB 5D1XC 5C0BA 3BZFB 2WBKA 4OBRA 4P9HL 2W0FB 3TTYA 2O5XH 2RALA 3GBMH 2R2EB 4LSQL 4PJ8B 1S9XA 3F05A 4GB9A 5F9WC 4AZUA 1JRHH 1KGUA 5IMOB 1RURL 3OHXB 4PLOB 4KNSA 3A4DA 4L5FL 2QQLH 4GO9A 4TNEA 5K59E 1ILSA 1G87A 2WXNA 5H37G 1KPUA 5JPMA 2OJ1A 4UU9A 3G5ZA 1IT9H 4QHKI 4GRWH 3EJTA 3MXVL 1DQLL 4XXDA 4HGMA 2V5RA 2YSTA 1F2XK 2CM6A 2QR0B 4UQCA 1AS6A 3LZRA 1MDTA 1NEPA 4EIGB 1Z5YD 3KPOA 2O6CA 4JG9A 2XWJA 3NZUA 1J1OH 1Q9KA 1EAQA 2G3XA 3FQRA 3QUYD 4ZK8A 1K8DA 3IJSA 1L4IA 3CXHK 5H35A 2FATH 1CUOA 4W4NA 3STLA 5IFHL 3T3MB 4A55A 5C0BD 5ICZB 4PJXB 2X4SB 5T5FH 5C0JA 2WQ8A 4QYAA 4BCXA 3S0PA 2V2WB 3HFML 4JMNA 3V0HA 1GAFL 3WY3A 4F7TB 3O9WA 4C83B 2ICWI 1SOXA 3FRUA 3QUKA 5IB3B 2GJZB 4LPUA 4PJAB 3CK0H 4NZTH 1VGKB 3FUJA 2UZIL 4ODUA 3Q06A 2J57A 4G80A 4PGJA 1RVFL 1NCDH 4QEGA 3PDDA 3AB0C 2IV9A 1ZVSB 1E4KA 3PPEA 1JOIA 1BZDA 3DBSA 1OM3H 4NRYB 5TGBA 2G4EA 1LEGB 3HAEA 2JKIS 5IHBA 1E67A 1DANT 4N8VA 5GRJH 5IW3A 4B9FA 1FSKC 4A2LA 3DHUA 4L5FE 5A2BA 4IIQC 2ZWNA 2SEBB 1AQ8A 4RISH 1TKWB 5FFGA 1L9OA 1PL3A 3HC4L 4HG4K 2FWOA 2VSDA 5DHMC 5E94B 3HJEA 1CVSC 4ZD3L 3VG0H 5DQDH 1A5FL 4N3UA 1R3IL 3TURA 4KJPC 3ILEA 4UILH 3O9WD 3EHBB 1I8AA 3L6FA 1DUYA 1JGVH 3OR7A 1UASA 1S9WB 4AMWA 3MFFB 3KXFB 4YDKL 4NO0B 5CZVH 3CVIH 1GS7A 3MCLH 2W65A 2QSCL 1KY7A 2R69L 4GXVH 4I48B 4QLWA 4BSWA 1G9EA 5D7KD 4N2FA 5CSGA 4JB9H 3BPNB 4XPBL 3FB5A 1EHLH 4DP7X 2WVSA 2VIRA 3H3PL 2C3HA 5L4FA 2XU9A 1UGKA 1FRGH 3HNSH 1FNSL 1UZ8B 3MROA 4OJFH 3RPIA 4JZOA 4LOFA 1NFDE 2NRDA 4NHCH 4A2FA 2V9RA 3AFLA 1JTPA 4OCMC 4W68A 1BPLB 4N0CC 1P5VA 3IFLH 1WBZA 3AC0A 2R8SH 3H2WA 3GJEA 2J1ZA 3AWGA 3KBHE 4TLKA 5T5NF 1ZSDB 4HUVA 5MENB 1HZLA 4K71B 1IC4H 4LKCA 4I2XB 3JWDH 5I75C 5IHLB 4KI5C 2DV6A 3QULA 3WENA 2CA3A 4N2OA 5I1DA 3IFNL 3EW3B 3PWJB 5KVEH 2JB5H 3MCKA 3OAUH 1NBZB 4X8JA 3IDJB 8PAZA 3GSVB 3U36B 2ZUTA 1SNRA 5DJXB 2GCYB 4GFXA 2H9GA 3ROOB 4K23L 1H3TA 1OTSD 4TQEH 4Q89A 3REVB 4N5EC 3HZYB 3RJDA 3R0NA 5EZIH 1E4XH 2KBGA 4QOKE 1A8ZA 1X5LA 1RUQL 2VDNH 4NIYE 1VCBC 2HCZX 1V55B 4OJYA 2EDRA 4PEEA 3SGDI 3QC5X 4JRFA 3TN0B 4B53A 5C6PB 3U4BH 3VM5A 2D2CC 1B0WA 1BFVH 2OR9L 5K33A 3OB0H 1HE8A 1MFEH 4PFEA 1U92A 1BVZA 3BUYA 4PJEE 2E76C 4GFTB 3X1FA 5TE7H 5IJKC 4RAHA 1NCOA 5CEXA 3N0PB 2B1OA 4K9EH 4WRLA 1VIWA 5E0QA 5F88A 3ZDYF 5KW9L 2CGRL 3US0A 2YHGA 3UZVA 3L17A 1MFDL 3HZKB 5TF1H 1RZQA 2I5YH 4IHBA 1FG2A 5HGAA 3P4MB 1K5NB 1ZA3B 2BIOA 1QZNA 4HP5A 1CMOA 1H0DB 4LSTL 3TJPA 4QI3A 2DIJA 5DUJA 2WXGA 1VACB 3K72B 5I6LA 5EB9A 4BZ2H 3MRGA 4UUJA 1N5AA 2PYEE 4MX7B 2WKOF 2X9YA 4OM0L 4ZYKA 4MS8C 5DFVC 1SM3H 1Z0MA 2VITB 2VMCA 4M6MH 4MHHG 3QUZC 4PY7B 1HL5A 1W91A 2X70A 1SDDA 3IMTA 4FQHA 3V0GA 1U42A 5FGBA 3TEZA 3F5WA 1XCTB 3SPVA 3WS3A 3OPZL 2B7DT 3IDNA 4OFIA 1N6QL 1RZKH 2Z4QB 3EFFA 1OGTB 1MXDA 4FLQA 2R83A 2QTVA 4FEMA 4AGPA 4CGTA 3VU2A 1MCNA 2A0LC 3TVMD 3VDCA 4Y9CA 2OJEA 4GKNB 4QTIH 2YUVA 4AVIA 3RKDD 4YSTA 3AS2A 1BSIA 4OZ4A 4U1HA 4P06A 3MRCA 4JFFB 5G5DB 4GEJA 1FYHB 1AS7A 4OF7A 1B9KA 2ATKB 2IWFA 1I9IH 2VDPH 1OD9A 2BDNH 1LL1A 5JUEL 5I6KA 4O02B 3EJYD 4KUZL 2ADFL 4KKCD 1JVLA 1T0PB 1Y18A 4KXDA 1YY9C 1Q9WB 4M7ZC 1D5MA 3UDWA 5HI5D 4MAYA 5EOQL 4P07A 2WIMA 3PWPB 2AEQH 3L1EA 4JY4B 3BMWA 2NY5C 1BLNB 3KJ4B 1RZIB 1TLMA 2XRAL 3HHRB 2PPDA 3EBGA 3TA3A 4F7TA 1CR9H 1PNCA 1V7ML 5GGUA 2G5RA 5A6LA 4C83A 1FFQA 3MRRA 4RMUA 2DRUA 4PUBH 3S5LG 4K94C 5DFAA 4G8AC 5KYNA 3EO0A 4LP8A 4Z7WB 4QJ3B 3A6CL 1UB5A 3BUDA 4M9OA 3FKUS 4TNWF 1NCWL 5IVXB 5HHNB 4CL7A 3CFUA 2NQCA 2V33A 4GBXC 2IC2A 3DX3A 1MCOL 1XTMA 2C9QA 4N86A 4UM9B 1VGEH 2DI8A 1DZBA 5F7MC 4H8QA 4OI9A 5GZNA 3VGAB 1QSFB 4B7IA 3RA7H 5CGMA 5BUGA 1AXTH 4XPTH 5I1HH 4RIRA 3BH9B 1WPCA 1JWSB 1R24B 4MNQB 2AEPL 2SEBA 4MAYD 4HEMA 4RRPA 2WWKO 3FXIC 4K8RD 4F37F 5BMFL 1XDTT 4JFQB 1Z9LA 2LFEA 3AJ7A 3BD4A 4LEEA 4WCYL 1NBVH 5EZJA 3TA3D 1X4ZA 2ZG1A 4MA1C 4D0CA 4GLRH 3H42L 3WL9B 3SCMA 1S9WA 2XPYA 1T89C 2DTML 2O61A 4NO0A 3ABMB 5D72L 1QFHA 3SGEI 3BAKA 4DVBB 3GMNA 4D9RE 5I1EH 1D2OA 3F7KA 1G9NC 1NAKL 1QRKA 5EBWA 2HUHA 4GQ9H 1VRSA 2M26A 3MO1A 4LCYB 1XF2A 3WKMH 1BQHB 5C0NC 1KCRL 5IG7A 3A67L 4WWOA 1NFKA 4YSPA 1RI8A 3S36X 3MLUL 5CIPH 1D9KB 1BZEA 3Q5OA 5B3NA 1JUFA 5DUMH 1X5AA 3L3GB 3AXIA 1KIRA 5C0GB 2VH5L 1ZSDA 2IF7A 2P49B 3MRDA 3QHZH 3SHSA 3MV9A 3RI5F 2QVFB 3SCMD 1WTLA 2ICWA 1CDHA 3SPCA 1EJOH 2DEXX 2VAJA 4NO0D 1CFVH 1VPOL 3QJHA 3BKYL 5CEZD 1MIEL 4FXGC 3D4CA 1HOCA 2V6HA 2YPKA 2ZNXA 1QPXA 3IFPB 4LEXL 4RSVA 1NC4B 4XNUH 3W39B 4QDGA 4LSVH 2D7PA 3OLIA 5LXGH 4XX1G 4DK5A 1KB5B 3NSCA 2YQGA 3VXMA 4TRPL 4NM8H 3I6LD 1Q72H 3BIKA 4G3YL 3MLWL 2MKWA 3S48A 1QHOA 3ARXA 3TX4A 1AVAA 1QFUH 5ES4B 4JHVA 5DJZB 5IFAL 3HRZA 1OD7A 1CLZH 1P6AB 1LP9B 1OB1A 4JFVA 1KT2B 3RWIB 5KSAA 1NEUA 1M7IA 3ILQC 4ISVA 4Z7OF 2XV6B 5IQMA 4Z6AT 4NKMB 4YHOH 1Z3GL 5E8PA 3EXJA 3MV9D 4OM1L 3N3EA 3GSOB 4HK0B 3DKHA 3RY5A 1NZRA 3O8XA 1E3FA 4FQXC 3U1SL 4WENB 4MJ6B 1MN4A 3CCHB 2BZ7A 5D71H 1RK1A 4YHLL 3PQYE 1TVHB 3U7WL 4RGNB 4GQRA 5I6OA 3B9KA 1BZ8A 1C7SA 5D4IA 2DAVA 4L4VB 5ALCL 3VXMD 1FAIL 4DW2L 2ADGB 2Z92B 4C57C 3P9LA 3LS5H 1ZTMA 2OJZL 2EDEA 2WLNA 4RWYH 3OB0K 3P4MA 1G9HA 3GSWB 3TWCH 2E9WA 2HN7A 3D4ZA 5KYWA 2PWDA 1TVBA 1N12A 4RMRA 5LQBL 1M6OB 5TQ2L 1WV7T 3MN8A 2V17H 4LNRB 4XMZA 3QXAB 4IGBC 5KSAD 1HTYA 2D9QB 2Z7YA 1KENL 1C5DA 3UACA 1T83C 5J4MA 3GNML 3RL2B 4GUQA 2IMMA 1R1CA 3C6LC 2D3LA 3Q6FA 4DO5A 2DQHL 4WJKB 2OSXA 4XBPB 3OQRA 4HXBH 3O8XD 3FMGL 1I8MA 4G6MH 2QFRA 5C2BL 3TBYA 3BDYL 3S35H 4PJFE 2FX7L 1E4HA 1WZAA 1YYLH 2WBJC 4GI8A 4JO4L 1QEXA 1H3WM 5ICXB 2Z4QA 3B9KD 1FA4A 2F08A 2F54B 3AGVA 3QDJA 2OM5A 3Q5TA 3FTGB 3ENEA 1M1XA 2DJ4A 4EI5B 4P04A 5IM7B 5JIPA 1QLRB 4N6RA 5AL0A 4ZPVA 5C7ZA 5F7YC 1WFIA 1BG9A 3TBVA 3NPSB 4GKSA 2K6YA 3WUWB 1KN4H 4JCWA 5HGHA 1F3DJ 4G5AA 3FUIA 4DKFH 5KN5A 4G43A 4FQLL 4ELMF 2Z6FA 3LZLA 4KUCF 2QGCA 3QCTH 4KVCL 5HHMB 3RIFK 4I1RA 4W70A 3REWB 4AGQA 5I1KH 5EBMB 5IW6A 3WS6C 2AI0H 2ZXGA 3IKCA 3OKKA 5J9PB 4GPVA 1OCWL 3G5VB 5BXFA 3WYRA 5HP5A 1LEKA 1BLNA 1TTAA 4XH2A 2DI7A 2GJ6A 4JQVC 3D0VA 5BS0E 2YD2A 3FFOA 3CVHB 4LLAA 2XN2A 2NNAB 1XZ0B 3QDJD 5LKNA 3G6AA 2GSGA 5LGHH 1HWWA 1GL4B 3U9PL 1BVKA 5DQJB 4PV8B 3BLKA 1JZEA 4XAWH 2BNUB 4ZQKA 2HT2C 3EDJA 5HDBB 1MNUH 1PJ9A 4C54A 3SOTA 2NZ1A 4B41A 1MCIA 2FO1A 5DU7A 3WFBH 1YEKL 3JTBA 3G6JB 1TZHA 2J8UF 3THML 2DEWX 4LLVA 3HPLA 3LIZL 4P48A 1LK3L 4K3EL 1Q9LA 4DTGL 1KEML 3AWEA 1NWPA 1R24A 2FEJA 1MUJB 1HEJC 3A24A 3HLAA 1HH6B 1J05B 4FX5A 3S5LB 3SKUD 1QAWA 3UYPB 43CAB 3PWPD 3EJZC 4OCLC 2NLJB 3GK8L 4AIOA 1A7PH 1MW2A 4W6XB 2GJ6D 4GSXA 5D2LB 5F3FA 4A6YB 1IB5A 4F37K 3UPRA 4N9GB 5T5NG 4NS0A 2A74B 2VWEC 3U0TB 1FL5B 3WL9A 3ALWA 3BVDB 4X98B 5ESVA 4R5TA 2XWDA 4OIBA 3V0WH 1KPRA 2ED7A 3GBNH 1P4IL 2GBTA 4P4KA 5BVJA 4HJTA 3VFPA 1F4HA 5BZDA 2BY1A 5AKTA 1CBVH 2ISDA 1OAZL 3KYKL 4PG2C 1G7JB <