3PNRB

Structure of pbicp-c in complex with falcipain-2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
160
structure length
129
Chain Sequence
b'GKSLKLGNISNQTNQETITQSLSVGEILCIDLEGNAGTGYLWVLLGIHKDEPIINPENFPTKLTKKSFFSEEISVTQPKKYMQLLGGPDRMRSVIKGHKPGKYYIVYSYYRPFSPTSGANTKIIYVTVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Falcipain 2
molecule tags Hydrolase/hydrolase inhibitor
source organism Plasmodium falciparum
publication title Structural basis for the regulation of cysteine-protease activity by a new class of protease inhibitors in Plasmodium.
pubmed doi rcsb
total genus 30
structure length 129
sequence length 160
ec nomenclature
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3pnrB00
2C34A 2WGNB 3PNRB 2FO8A 2H7WA 3CBKB 2OULB 2NQDA 2NNRA 3E1ZA 3M88A 3CBJB 3M86A
chains in the Genus database with same CATH superfamily
5I28A 2AQ2A 1FJ1A 1OP5H 2FWSA 1G4MA 3VSTA 3QUHA 1T0PB 1A9EB 1D7CA 3ZKXC 2JB6B 4HCFA 4NNPL 5SWSD 5DMIL 2P7TA 2BJML 5KOMC 5F9OH 4JBSA 3L6FA 1EEZA 1D2OA 1A7QH 5F7LB 5JR1H 1TMQA 2EE6A 3VW3L 1KYDA 1MZYA 2WSKA 4AGLA 15C8H 1JMXA 2VJ8A 4Z95H 5FO7A 5TDPA 2AI0H 3HMWH 3PU7A 2AJXL 1S5IH 5E8NA 1IMHC 5K9OB 5LHDA 2VDQL 5C0BD 5D7SH 4Y5XB 4QHNB 1IBBA 5CN3A 2E9BA 3GF8A 3ML8A 5CP7B 3UTTB 1WA0X 3D30A 2MNJB 3B1UA 3EXLA 1BF2A 3W0WD 3ZL1A 1N4XL 4LPUA 2FYYB 3AMLA 5IBUG 4XX1G 5JW4M 1GGTA 2YSSA 2A9BA 4Z76B 1LE9A 5DEGA 5I0DA 2CKNA 1A9BB 2KYIA 3CUPA 3CZFA 4FAAB 1R24B 1T1YA 4KROB 4ZMOA 4DZ8A 2C9AA 5DURD 3RVXD 25C8L 1ZS2A 3KLAA 4JGUA 3S34H 2YMTA 2JE8A 3QDHA 4HG4J 1RK0A 3V7AG 1NAMB 2NY7H 1O9ZA 4GSRA 3LPOA 4HA1A 1BP3B 1WZKA 5AW5B 4HCGA 4N0YH 4ZPVB 1AZZC 3KWTA 2E7DA 1AC6A 1BVKA 3RKDC 3GMNA 3MRCB 3E8UL 1HQRA 2E4TA 2VSDA 5IW3A 2F54E 2D4DA 5FIEA 1Z9PA 1OSPH 1LP9F 1PZ2A 1BEXA 4AGOA 2EO9A 3JV4A 4GJTB 2K4WA 2LHAA 2NNCA 2F7PA 4N1HB 1PLCA 3LN4B 3S3JA 2FEJA 3VXRE 4BELD 2JB5H 1JD9A 2LQRA 4HC1A 3DC0A 1EUUA 1MF2L 1CF8L 1CR9L 4CL7A 1LHZA 2AERT 5HD8D 4KRPB 4MS8D 1QEXA 5CINH 3QUKB 4EDXB 3LHAA 4WHTB 3WS3B 1VSCA 2YKKA 5ADPL 5C6PB 1E4WL 3S34L 2FEEL 3C87A 3SKJH 2YBRB 2BW5A 2JIXB 1MHEB 5KSBF 3CSBA 1A0QH 5F6IC 3VG9B 2HX8A 5IEKB 2V7HB 5I82A 4AIZA 1FAIL 2VXSH 2X4OA 4JFUA 2UXTA 3HR5B 3CDGB 3MLPA 3CQQA 4E42B 5LUMA 1B4JH 1BFVH 5F7HA 2QVIA 3FU7B 3TC9A 3B7TA 5E8OB 3OKYA 1UT1A 1O5PA 1IVLA 4OD2A 3OKNA 5KVEL 1EXGA 2DKSA 4BGDA 1BEYL 2WBJC 3C6LC 1UA7A 4ZW6A 2QADB 1J5HA 1Z9SA 2Y1VA 2QPDB 4M6OH 1RVFL 2AJXH 4J3WA 4I0PB 2GQHA 1G4RA 3KEHA 4PJHB 1B0RA 2WBJB 3C6LB 4O2CA 1AO7E 3I2CH 3WFDH 1JFHA 4LQ1A 4XO5A 4D0DB 4F7CA 5GRYA 2CO4A 4EVNA 3QDGD 3WJLC 2UZYA 3V0IA 1BGXH 1PIFA 3FT4B 5JIKA 3FQUB 3ZJAA 5L4IA 4XN4A 4OCXH 4BFEA 5ICZB 1NAMA 4L8BA 2NLJA 1DR9A 4HJJH 5GZOA 3QA3B 1SEBA 4ESKA 3N1MC 5DEFB 1IAMA 2Q6WB 4F93B 1C8PA 1M05B 2VMJA 4N0CD 4X6DB 1AQ8A 1DFBL 1KB5A 5E7BA 5AVSB 4MNQD 4J1UB 2MSPA 4WHDA 2D7TH 3VD7A 4YLQT 4B9YA 2VN6A 1N3NA 4M3JA 4M8RA 2CJUL 2ZAHA 3HG0A 3P3UA 3BSZL 4CC1A 3V4VL 4F7MA 1DUZB 5CXPA 2X0WA 4Q74A 4TM9A 3DBXA 1D5ZA 5CHNB 4HJIA 3UOAB 4JG0H 4KRPD 1LWRA 3F12A 1U8CB 3QPQD 1MFAL 3IDXH 4XX1E 1SVBA 4IHOA 4GAGH 5E6RB 2KL6A 2XVLA 5B1JC 3GFUA 1P5UC 1VFBA 1GPOL 2N7BA 4HKBA 3QZBA 4TSCH 4ANKA 1OAJA 3LZFH 1JPGA 4FFYA 4HIEB 5F3BB 1LJMA 1NCBL 2BC4A 5FHBH 1R19A 1TT6A 2QKIA 3DECA 4CKQA 4U1JB 3SDXE 2ZX7A 5CCKL 1AJ7L 2QFPA 2VZUA 2A74C 3ZSTA 5HI4D 4XVSL 7PAZA 4WU5A 3MV8B 4XN5A 1K9TA 4YXLL 3AT8A 5ICZA 5IFAH 3H42H 3O3DA 3KJ6H 1U92A 4BIKA 4YDIH 3CVIH 4X4KA 4M62L 3W2DL 1D5IL 3UYRL 3FCUB 1RZKH 3KPLB 1KN2L 4UU9A 2B39A 4RDBA 3AS2A 3AT0A 5FB8B 4JFZL 1UWYA 5A2KH 1HINH 2H9GB 2AXGA 3GJFK 3LXCA 4MXVE 1XR9A 2WY3B 4PY7B 1IRAY 2AJYH 3APFA 4GMTH 1HCVA 1NJ9A 2YXMA 1CE6B 4JZOA 1GGYA 1Q9LB 4OQTL 3GMQB 1HOCB 2ERJC 3VXSA 4F2MA 4BYHA 2EC9T 1VKXB 2FR4B 5C0RL 2C9XA 3FRPB 4JFFA 5IGXL 3OX8B 4UQ9A 3PNWB 1SZNA 3BAJA 43C9B 4FGMA 4IMLB 3I6LD 1EGJA 2WTPA 1CLYL 1HL5A 3SB3A 4EVNB 5JOEA 3VRJB 4HULB 2MPAH 1NFDB 2A74A 4PWEA 2M2DA 2R69A 4ZSOE 5CGBA 2X9WA 2I9LA 3BGFC 1CXEA 4UINL 3S4SG 3QUMH 1FLTX 1XF1A 3IDUA 4PJFE 4K8RH 1A9BA 1XQ4A 4JX0A 3QWOB 3W37A 3CSYA 2JKNA 4JFWA 5E5RB 4MXQD 3DHUA 2MCPL 3PL6D 1MFUA 1XH3A 3KLHC 1O6SA 1GL4B 4JDVA 4PCKA 1NANI 4MAUH 5HVHC 2ADFH 1WC7A 1XB3A 2NZIA 2DWEA 1MRFL 4Y16B 1KBGH 5IB1B 3ZZLA 5DRNB 2O6PA 3ATBA 4U6TA 1K4DB 4TOYH 4Y1TA 2DOCA 3PXLA 1KLGA 4AV5A 2LABA 3RGVC 3FSOA 2P24A 1UZ8B 2X10A 3QUMA 1NFDA 3F04A 2R4RL 3OJDB 1T7VA 1W8EA 1FE8H 4YHLH 2CKBL 1ADQL 5HDWA 3ZT7A 1KT2A 4K23H 2CHNA 4GUQA 3P73B 3GK8H 4Y1AD 1KY7A 2Y9RT 1QRNE 4FFVD 5AOKA 1P1ZB 4HK0B 4NUJA 5DHVA 1MFVA 1JFQH 4BM7A 1XCTA 1WZ1L 1VERA 2ZXAA 5LGJB 4FG6D 1CFSA 3CVCA 8FABB 3T0EB 3D3VB 1N18A 1MH5A 1Z3GL 4H8WL 4YDLC 1E4KA 1L6ZA 2ZAIA 3WBDA 4YAQB 4KKPA 3RL1B 2KQNA 5DZLA 3MC0A 3SODB 2CJSA 3QCTL 4PWHA 2UY6A 2IPKA 4TUUA 2WXHA 3NJGA 2SODB 1T3FA 5DHVH 2VLRA 5EU3B 2P5ED 4KK8D 4WU7B 3ZTNH 2MTAA 5F1OB 4WEBH 1U8QB 5LNGA 5CLXA 2J1ZA 5C2UB 1QWHA 3BH8B 3Q5OA 4I5BB 1KACB 5C0CE 4NYLB 3PWPB 4P2OC 3QH3B 1LO0H 1OALA 1JAEA 2X4RA 3C09C 1QSFD 3MRQA 3O8XD 3QB7C 4GEIA 4BFBD 4Z3IA 3Q06A 2YXFA 4PIRF 2MOGA 3A21A 3WGVB 3GJFB 4PJGB 5JW5A 4L4TB 2JV6A 2V17L 3O0RH 5GZND 4Y1AE 5D7EA 4IS6A 1G1KA 4TLTA 2AKRA 2YK1H 3U83A 9CGTA 2YXVA 2Y2WA 1QYGH 3QCUL 3VXUD 2RQEA 4QRBA 3QWOA 1UM4H 1QTSA 3D0LA 4LKXA 4P46B 3V7MA 3ARTA 3JTSA 2BY0A 5D2NE 1NBQA 4LVOB 2OK0H 1UM4L 1AG6A 5IROA 1XF2B 2WM0A 4M1DL 4OAWB 5GISL 1SEBB 4GRLC 3QJQB 3QCUH 1Q94B 5I6MA 3OKOB 3QDJB 4Q9QH 3TA3D 3G5ZA 2CIKA 3LXAA 4M4RB 5JOPD 2EE9A 2EXWD 2XX1A 3BZFB 4HD5A 4QRUA 5C0AA 3VWJD 3ALPA 1F02I 1ZWIA 2A2QT 2H0FA 4BUQA 2XQYK 1Q9OA 1A7OH 1Y6NR 3N2JA 4LOFA 3RFZB 1WZAA 2YPLD 1EJOH 5GZNC 5H2BA 4EN3D 3MRBB 2BNRB 4HEME 1GGBL 5MEPB 3DOSB 4NUPA 3CN0A 1E9QA 4L2LA 5F96L 1CDYA 5AUMB 1FGNH 2YS4A 4KNSA 3T6QC 2MOVA 1SJHA 3NCMA 1JHTB 1LO2H 1YUHA 3C5ZB 4X6BA 3WG7B 5JO5A 1G9NC 3ELQA 4Z9KB 4E9SA 5D2LA 3MUGB 3WHXA 4Z7VA 1FZJB 5IOKA 3QCTH 5JXED 2QTEA 4QHKJ 4UOZA 1JUFB 4JPSA 3BUPA 3Q9PA 2PWHA 1A6TB 1QSZA 4JFDA 1WFIA 4NGHL 3DMMA 3MJ7A 4IDLA 4UDUA 1IM3D 2XJKA 1PGRB 3EYQD 5IBUB 3V4VA 5BMFH 1AIFA 5KSAC 1A7PH 2FLBT 5DZOA 2AMGA 1R33A 4KK9D 5ALCH 3GMLB 2W38A 4WTZG 5HPOA 3FCSA 1J5OH 4PGDA 1A4KA 4RISH 4AQZA 3BUYB 4EN3C 4R90H 3QRFM 4L4JA 1BAFH 5DC0A 4CGTA 4WV1B 2JB6A 4PCTA 2ZXDA 5G4MA 1EGJH 1LO3L 3FSZA 1OIOA 2YK1L 2OW7A 1HH6B 2ZOKA 4AX3A 4J2XA 2P8PB 1NCCL 5CJQH 4AEIL 5GRVL 5B22A 3TF4A 1DDTA 4LNVA 4OM1L 5DJDB 5BZZA 2TRYA 2XQBL 3MJ9L 2XPYA 2YR3A 5FOBA 4ZI8A 5B1KA 4YHIA 1VEPA 2WUBH 4DAGL 5D7KD 4X6FA 1I7RA 3WY1A 3D4YA 2A0LC 5GGSY 1MFMA 2CH8A 4YNYB 3EJPA 4MD5A 2EDDA 2EE3A 2MNWA 3T65A 2A9AA 1R3HB 2MJWA 4XI5C 4YSAA 2ZNWA 5TDNB 3TTYA 2FX9H 1XGTB 5DDHB 5E9DE 4U1LB 3MXVL 4ZOEA 5JHDD 1GYAA 3TP4A 1PNCA 1FG9C 3NVQA 3E6HA 1B4RA 1ZHLA 4YZFF 3WTWA 4MNQE 3B8YA 4UINH 4X4YA 3UPAA 3GMMA 2EADA 2FIKB 1B90A 1B0GB 2K6ZA 3GBEA 4N2MA 2YJLA 1JZGA 5BUPA 5E1AA 5I1DA 1FORH 4M8QB 2PP8A 4FFWD 2NXZD 2VKWA 4PS4L 1TTRA 1A6VL 5J11C 1LK3L 4UV7H 4AVHA 4MNQA 2O5XL 2CU9A 3HPLA 5ACZA 3SE3C 4P04A 1ZOXA 1W8OA 4PRAB 1WZ1H 1IBGL 2R23A 4GW4A 4QY8B 3GSNB 1QFWM 5DO8A 1H5BC 4AH2A 3D6GA 3TBBA 4L29B 4YGVA 5EU5B 3KCPB 2DL9A 2X3AA 1DE4B 3HJ0A 3NG5A 3SQOL 2CKBH 2NY1D 4LGRB 2ORBL 3EIFA 3RWJA 5JIQA 1F4YH 4OZGE 4GQZA 4ADIA 1T4KA 4Z3GA 1WF5A 1YEIL 1VACA 2ARJA 2P8MA 4U1GB 3K6DA 1X5IA 4GT7A 3FO2B 2BS8A 4N5UA 4P5TB 3FCBA 4WFEE 5KS9F 2PW1B 1WFTA 4LHUA 4YPGA 1TQVA 1XBDA 3K5RA 3H3PL 1MRFH 3CGTA 3OJVC 2KERA 3ARZA 2HVBA 3HAEH 4HJ0D 3UDWA 2WTRA 3MBWA 5C0IA 4F7TB 1FVEB 3Q8FA 5FGBC 3V0AC 2QMJA 2XWEA 4K15A 5LGHH 4HWBH 5SWZD 3QIUB 4F33A 4K8RL 2AQTA 1H15A 3OXSB 3JWDL 4XB3A 5A2FA 1UCTA 1IV8A 3ETTA 3WEXA 4LSVH 3ILPB 1U2CA 2BDNL 2ZP9A 3PHSA 1OLLA 2O61B 5I74B 1CO1A 2BY2A 1ODUA 1X5GA 1TEYA 4ZPVA 1LO5B 2CRIA 1CB4A 3B43A 5DWPA 4NLAA 3DXAD 1HHJA 2ED9A 3LQZB 1UD4A 4AUJA 2OMZA 3IJEA 1BZ8A 1QPKA 4XNMB 3MBEB 3ILQC 4IJ3B 1Z3RA 1QO3A 1BECA 1PQZB 2QGBA 3I6KB 4GMTL 5D5MA 4LT7A 1C5CH 3D2UA 4KUZL 1U36A 2VDLH 3ZKND 4R0LB 4I3SH 5E2VL 2P43B 3ZOAA 3KPSA 1OLZA 3OV6A 4LXFA 3E2HC 5HHNA 3FQRA 2FUTA 4ORGA 3OLGA 2HPOA 4KJWD 4QLRA 3REWB 2N7SA 3DYOA 1RUPL 4L9LC 1MCRA 3IU4L 4LCWA 5B4MD 4BRJA 5C7ZA 4GG6F 4JKKA 3VU1A 1LEKB 4NC0B 4TQEL 1CFNB 2GY7B 2AANA 3K8KA 4I48A 4F7PA 3WTXA 1AS8A 4OFYA 4C83A 1BQHB 4PJAE 3QZMA 5I1IH 3BWZA 3T3PE 4AJ0A 1AXIB 2F2HA 2PKDA 3DUUA 1JZJA 1YY9C 4U0RC 1PG7L 2WSDA 2XPGA 1SDDA 2DTML 3QYNA 1S7VA 2XZQL 2Z8SA 1UGKA 3UTTE 3B2UD 1SY6H 4CVZA 3EOAB 3F7KA 1QI3A 1A4KB 1EH9A 4XOBA 4RH4A 4OLZL 2YGNA 4PJFA 4PB9H 1TTBA 3BWSA 4D8PA 2CJUH 1Z9OA 4ZFGH 1GR7A 5E03A 3RKPA 2AK1L 3T8MA 1KLGB 1UOLA 4IU3B 1GXEA 4HSCX 4JFDB 1OARH 1WFJA 1WVZA 3PWVA 4G8EB 4K5MA 5CZVH 2B4CH 1UZ6E 1RIHH 4EZKA 4Z77A 1EK3A 1IKFH 4IIQA 4PV8B 5D1QA 1JGUL 5L88H 4E0RB 5LCVA 4HGMA 1UD8A 2BVPB 4U6VL 4ATWA 4KK5C 3BD5A 3UP1A 5J9PA 3T1WA 3VTTA 3GSRA 3U0TA 1Q0XH 1P6AB 2ZUXA 2OTWB 3GLEA 5FM5M 5IBLC 1OV8A 3EOBB 1HVXA 1KFAH 4HAFA 4K71B 2G5BA 4M93C 3WFDL 2WVSA 3PWPA 4X9YA 1FPTL 4AW7A 5BUGA 3MNVB 3MLVH 2YGPA 4KRPC 4MNHA 3MRGB 4OCRH 3ZDWA 4M7KL 3DA0A 1BYNA 5HJDA 5AFAA 2GBAA 1LD9B 1L9SA 4B9KC 5BVPL 4V33A 3RB7A 2LOEA 4F8LA 5DJ2A 4ZUTA 1HIML 2BERA 4JRXB 2E6QA 1S3KL 4L9LB 4EIGB 3HPLB 2EAEA 2R2HB 2Z31D 2BWDA 4C4KO 1VLXA 1F41A 2CHZA 2CBOA 5E51A 1GYVA 3G5XB 1SF3A 4X4ME 4AENB 3R7RA 5AAWA 2HT2C 3BN3B 3GI8H 1OAYL 1OGTA 2I26N 4LNRB 4R0LC 1INQA 1ZA3A 5EPMB 2IWGA 3FMGH 4J3OG 3EJTA 1IAIM 3GMOB 1OP3K 5LBVA 1WA1X 2ZP0T 3MBEC 4PN6A 3UPRB 4ELKA 5MERA 4IKIA 3DOHA 2YA2A 3A6BH 4P23A 3RVXC 5A7EA 4ZMPA 1MF2H 4P5TA 4MWFB 2NNAA 1I1RA 1GGIH 4ZX3A 5L9DL 4JY4B 4NUGL 2VDQB 1U8LB 4LEEA 5TQ2H 4AG4H 4LF3A 2H1PH 1LQSR 4N68A 3U7WH 3O6KH 1WZLA 2OMTB 3BO8B 3MRRB 4CKVX 2X41A 1RUQL 4IBSA 3W0WA 2CLZB 2ZZUT 1QABA 5I9QB 2R39A 5E9DD 4KJQD 1T1XA 2NQCA 5EU5A 2BJMH 1K6QH 3VXNB 2J8OA 4MJ6A 1SEQL 3HNTH 3NTCL 3CFEB 4IOFD 4Y2DD 3N9GH 4I9WE 5EF2A 4M00A 3QUXD 3EGDA 3UP6A 4HSAC 1FCGA 1QHPA 3GZPA 4G8EA 4X7FC 1UJ3B 2EVHA 2XIBA 1AIZA 2AABL 1A7RL 3FTZA 1RKRA 3KVQA 2XWXA 1INDH 3PGCB 3ARBC 3RHWF 4OCWL 4W9HC 2OP4L 4HISA 3WHE1 5CJBA 3MGAA 1KGWA 4YSTA 1CFQB 3WD5H 2VXQA 4P57B 1SUHA 3EDJA 3ZHKA 2H6OA 3P77B 2A6IB 1FZJA 1RFDL 3PAYA 1VENA 4AITA 4LCWD 1CFTA 2CO7B 4ZUVB 2O61A 1U91A 3VVWA 4TVUA 3MGTA 4HQQL 2Y2TA 4GT0A 2EKSA 3UBXA 2W1NA 3APMA 1PD6A 1YMHB 4M29A 4YHIB 1HJBC 1AD0B 1F4WL 4PREA 5GRVK 4Z95L 1TG8A 1D5MA 3I3EA 2Y7LA 1Z9SB 2WBJD 3B37A 3C6LD 1B2WL 4W4NA 2J88L 4P59H 5EOTA 4EAEA 3SDXF 1GHFH 5C8JB 4PWKA 5DHVB 3MKGA 5JR1L 4PJIB 5F89B 3BKMH 3RWCA 4DW2H 1V7ML 1FNLA 4X9BA 5D71H 2GKIA 4J3UA 2RA1A 1SHMA 4NNPH 4AYID 4HIJB 2WVUA 3L7EB 1MPAL 3CMGA 5KYWB 5L7XH 2E5EA 3MLZL 4P9HL 5JIHA 2B9AA 4WO4D 4POYA 3HE6D 2PXYC 2X4SA 1C7TA 3SHSA 4DP5X 1OCWL 3IFNH 2FLMA 4NKIL 3CDCA 4LSDA 3VB9A 3DXAE 5FX3A 5EU3A 3RUGB 2H45A 3L54A 1QKZL 4WU7A 3GKWL 3MACL 2B1HL 1IGML 3HRPA 1ASPA 5C0BA 1XSOA 3RNKA 2ZG1A 3CH8A 3NP4A 3VFPA 5TD4A 1JPTL 4Y5YC 3R4RA 4HU2A 1ZTMA 3M1BA 3B2UC 3MMEA 2XTJC 5BQ7A 5MEPA 1QW9A 5F7YC 1E9QB 5HYEA 2Y6SD 3ZTJH 4MDIA 3FT2A 3QIWC 4I2XB 4MMYB 3US9A 3KBFA 4JG1H 2PPCA 1H3TA 3FB7A 3HTLX 3KPTA 4JRWA 1BVLA 2V5YA 3V6FB 4PJDA 3WXVL 5GSRB 1A1MB 1MCKA 2YGOA 3MRKA 5DTFA 5JXEA 5GS0C 2R1YA 5IM7A 3FH7A 4L3AA 1BOYA 1IGJB 1KT2B 3VD4A 1UZ8A 2DWDB 3QUMB 4NNYB 4PJHF 2YWYA 1E42A 5F7EH 3U4EA 1XF2A 1DQVA 4XXDA 3V4VB 1ZK5A 2GFBB 1VZGA 1IFHH 1M2VA 2ZYSA 5EOQL 4IIZA 3NRPA 5E2UL 5C9KA 1CFMA 4KK6D 3UERA 3P3RA 4KXCA 4P4KD 1QNIA 3NESA 4OU3A 1IEAB 2FVNA 2OMVA 4WI9A 3A24A 5E1IA 5DZNA 1B2YA 4WHCA 2N1KA 3UTSB 5KW9H 4HC1L 4IMKA 4W9LC 4M3KB 1CS6A 1RJYA 1BG9A 3BIAX 4JPQA 2IQAA 2Z93A 3E38A 3GHPA 2NCMA 4QTHB 1I7UB 3SGJA 3WE6A 4BQCA 2MOQA 4WWNA 1BZEA 4UIMB 4PJ5A 3BP4A 1H19A 4HMEA 4HIHA 1MI5A 3DETC 3GO1H 3EOYG 5I6NA 1IC7H 2Z35A 2EIZB 3FUEA 1EX0A 3VRJA 1WA2X 5JIIA 2IQ9H 4WI0B 2HFFB 1DSFL 1V3KA 2DQUH 3H54A 3ISWA 3L3HB 3WJJA 2DH3A 1T2JA 1LO5A 1MREL 2WNWA 1BFOB 3V0DA 1GS6X 1I4FA 3GRGA 3JV0A 5J11B 3CSYB 3N42B 3VDCA 5T1JA 4D9QD 5J7CC 1PIGA 1NFDF 2GUYA 2C9UA 1JPST 4HSQA 3MOBL 3F5WB 2YMXL 3H9HA 2VL5A 4KROD 4P2AA 2IPUK 3Q05A 2XZAH 4JHWH 3MV7A 4PJEF 3VRLE 4FN0A 2KH2B 2BHZA 1WEJL 3T8XB 5JHDA 2UVEA 5CZKA 3HG1E 2G5UA 4ERSH 1F3DJ 5EOQH 4F9PC 1E3ZA 2WXMA 4A7VA 5EZOL 2EO1A 4I89A 5DHDA 4HHAA 1Y07A 3D85D 3G6AB 1FC1A 1DEEB 2HTKD 3EH5B 4NN6B 4PQXA 3RDTA 1M6OB 4MSWA 4OJFH 4QHMB 3TT3L 1JGVH 4DGYH 4AV4A 4XX5A 4DTGL 1ASQA 3SGJC 3IAPA 3WXVH 3O11B 5IEHA 3WLWC 1JWMB 5C97A 2O6DA 4UQ3A 2E7CA 4OI7A 1QFWL 1BMGA 3DJTA 2ICEA 5C0AE 2H1LM 3QFGA 4U2ZA 1G1YA 3F6JA 4E41D 1G7MA 1IT9L 1ZHKA 4GMSL 4P3CL 5KEZA 2Z8WC 2I9TB 4N8VB 3BPCA 3AITA 4WAFA 4XN8A 4N2FA 1UOWA 2NOYA 3CQPA 3AC0A 4BH8B 3QZPA 3HE7D 1PG7W 2V9RA 1WIPA 1Q9KB 2ADGB 2D2OA 4TQHA 1KPUB 3HI5H 3LKQB 4KXZH 1X5YA 2ATPA 3ZW3A 3PG2A 5EEVA 5CEZD 3SE9L 1WIOA 4JDTL 4NQVA 3V95A 2VLRE 5D96B 5C09E 3PFUA 4DZBB 4YDJA 3D3VD 1IGTB 1MCLA 4XOCA 4H20H 3BVNB 3QJUB 1NBVL 4U31A 1ZLUK 4DZ8B 2XSKA 2OMYB 2Y22A 4RETB 5KS9E 3UZEC 3V4PB 3QDME 3BVTA 3LNIA 2IPUG 4WY7H 2P3YA 5F7EL 5ITFB 3ZTCC 4LKXB 4P46A 2FJHA 2K9UA 4BCYA 4DW2L 4HFWB 4XNYL 4XNUH 5TFSL 3U2SA 3IJHA 3HLKA 1S7SB 2J88H 3FOMA 2DQHL 4GUPB 1E0OB 3O3DB 2AQSA 3LKQA 3L9YA 3NJXA 4Z7OB 4NHCL 4ZMZA 1LWHA 5DC4B 1QVOA 4PRPA 4JFDD 2EDQA 4BJLA 1EAPA 4Z8FL 1OGAB 1DSYA 4OZHB 4J28A 3BIBX 4QJ5B 4WK0B 2WQSA 1BG1A 4WSJA 3VI4A 4PJHA 4Y4FC 3CV5A 4XCCL 3LEXB 1KJ2H 3DO7B 1T22B 3IPEA 5GGSB 4X6CB 3VXUA 4AM0Q 3DV6B 4YE0A 2C7UB 5JYMA 3KVDD 1PCSA 2R0LL 4JHBA 4M6NL 4EOWH 3H6JA 4YSOA 2WOYA 4PJDF 2HMIC 2YD7A 1OM9A 4KRLB 5AOZA 3LKRA 4G6FB 1X9RA 3LN4A 1WFNA 3QP3A 4UQ3B 5C1MB 2HN7B 3Q5YA 1CT8A 1H8SA 3HC0A 1J0JA 4G5ZL 4Y0GA 2FJHB 4F8NA 1OCWH 2W9EL 2OTUA 1U93A 3TBYB 5DVOA 5E4OA 1DN0A 1QSEE 3N40P 2IDQA 2A74B 1I75A 1KB5B 2C5DC 4P9HH 4UOJA 4B5EA 5DJAB 5H94A 1MCDA 4UM8B 2B1AL 3B5HA 1OCCB 1XF5A 1NMAL 3STZA 1FYTE 5KBMA 1JCVA 1WAAE 1RHHA 5T1KD 4G8IA 4Y8AA 1GW6A 3LAFA 1XR8A 1TLKA 4A7GF 4G11A 5TF1H 3TASA 1GHFL 2D0HA 4P4KC 3U7WL 3LN5A 2JKWA 1HWWA 1CQYA 4B0MB 3IGFA 2AJUL 2X09A 1KCRL 4P5TD 4WFFE 4YEEA 1FNSH 3WDJA 3IXTB 1QLFA 1JPGB 4F92B 2VWEC 4L2YA 4O02H 1HSAA 3RZWA 3OJMB 4N8CL 4A6YH 2BW4A 2X1OA 3SE4C 4QRQA 3EYVA 2J21A 1MCNA 3GS7A 4NCC2 2G75A 2HKFL 3FOLA 1XXDC 4JFSA 4LMQI 4M48L 5GIRB 2VMDA 3NIFB 3WD5L 5DCCA 4RGNE 4UZSA 1QFUL 4B9ZA 3L2MA 4LIQL 3TIDA 2PW2A 3S37H 5EWIH 1FFNA 5FO7B 2E59A 1DVFA 3BH8A 5HI5C 1M05A 2GG1A 2BLFA 2XICA 2V9UA 3LY6A 5HI3D 1YJDC 3MNMA 1AXTL 4XHJC 1FP5A 1TDQA 2C4XA 2CCVA 3FQ2A 3GTNA 2ID5A 4WO4A 1O7VA 5TE7H 4LCUB 2GJPA 1WRFA 1VF5C 2RMNA 1D5ZB 4HIQA 5D8JH 1SEQH 1FBIL 3T8XA 5DI8A 3FBQA 4KTGA 3X14B 2GTZA 1HSAB 4IRSC 2JCCF 2ITFA 3MV9B 1DVSA 4IJTA 1W91A 4QRSB 1OT2A 4P2RB 1BDYA 1E9PA 2Z7UA 4I18B 4KFZC 5IK3B 1JGUH 3O6FC 2XN2A 2KDYA 2QZQA 3D1MC 3LYRA 3GTVA 5E08L 4TLUA 3QYCA 5F9DC 3TIEA 4K7PL 5C0NC 2Q2EB 4PJDB 4FQJH 3NCYP 3CBJB 1CLZH 1KXTB 1KPUA 1EFXD 1XF5B 3CQFA 4N0UE 3H6AA 3STZB 1V05A 3S8WA 2F74A 3QEUB 1FJ1B 2ZJSH 4DKEH 1BF5A 5CWSB 2EUZA 1AR1C 2WKOA 1ZANH 2WBJA 3C6LA 5HDLA 1XGRA 3HB3B 2P52A 4IGBD 2FB4H 3K1DA 5D7IA 1G87A 1MHPL 4XTRD 3O41B 3FU6A 5F97E 5TPWL 4TVPL 2FGZA 2NY4C 5DJ8B 1OAXL 1OWWA 4Z7NF 2WK2A 2Z92A 1K5NA 4XZUA 2YHGA 4GQRA 3TWYA 1O7SA 3RIKA 4LASH 1DBML 3RL2A 1INEH 3IVKA 3HZVA 4AUUA 1U21A 5D7IE 3PHOA 5MEOB 1JCKA 4QRRD 3VJ6B 2VISA 3E0GA 1E43A 4G3YH 4F58H 2CPUA 1UM6H 2BIPA 2YPVL 4HXAL 1IAOA 3FSAA 4IBTA 1QRKA 3S35H 3T6ZA 3U4EB 1IKOP 5IFJA 1QVOB 1Q9WA 3P54A 2IJ0C 5HTSA 3EYUH 4H1LA 1T7WA 1BQKA 4U6VH 4YDZA 1QATA 4J2QA 2P5WA 4PJ9A 1ZVSA 4R4FH 2OSLB 2BFVH 2UY6B 5FYJH 1IEAA 2OMVB 5KJ7E 1RZFH 1UZ6F 4QRAA 5DD3H 3A4EA 2WKGA 4FFYH 1P4IH 4MXWH 4MDRA 3HKFA 3IFPB 4AT6B 1CK0H 3AZUA 4OZGA 3K2MC 4P99A 4R96A 3GBNL 4AQ1A 4CADA 4NRZA 5JOFA 5LWYL 3C8DA 2NY5H 2UX6A 4QYAA 1QWUA 1KN4L 1RP8A 3IB4A 1FV1B 5TGBA 5K59F 1QMUA 2CHDA 3HMXA 4LLQB 4K3DL 3OKEA 4E41E 1HILA 4YJZL 4KNQA 1N7MH 2ZCLL 4L9LA 3WIAA 3L7FA 4Y19D 2NYZA 1JZFA 5EIIA 1TEFA 2YKLH 4UNUA 5L4MA 1A64A 1TENA 2BNQB 2DTMH 3POHA 4Z18A 4H8VA 1T22A 4F91B 3JWDH 4PSPA 3ZKMD 4V11A 5JHMA 1ZHNA 3MYJB 4NLHA 2AHIA 1BF8A 1K8IA 2M26A 1MFEL 5LG1A 4GG6B 2HUEA 3BAWA 3H3BC 1I9IH 2D2CC 5INCB 4P06A 1G9MC 1ET5A 2CK2A 4IBQA 4JDEB 3H2WA 1U95A 4PRIA 1L9QA 3HMXH 3JZ7A 4KI5C 4P23B 4C55A 1Q72H 5F1IA 3A47A 4N90D 3D50A 3LRKA 3DLQR 1NICA 5D7JD 4DHLA 1JZIA 3V5DB 5HHQB 4NQTA 1S7RB 1CFBA 1OK8A 2XTLA 1AGEA 2JJWA 3K8LA 5LO7A 3VXPA 4AC4A 4N2EA 4XMWA 5FYKH 3ZXAC 1RCYA 1PPIA 3RPIA 4I3SL 2FUQA 2HJLA 5CD5D 4GSUA 3EO1B 2XWRA 2QGDA 4OLUL 2XRAH 3VG0H 5FDWA 4UTBL 4UILL 3KGSA 4JE4B 1G1OA 4N5EC 4G8GE 1M1XB 3VMNA 4ETQA 4G7VH 2RJMA 4Z7VE 1V7NL 5D2LE 2IANB 1E4JA 2HH0H 4H88L 3M88A 2ZONA 3DIFB 3N1PC 5IKCB 3H7BA 3AREC 4FQIH 2VTFA 1YEDA 1JGLH 2NW2A 3FT2B 1CYWA 2H9GA 3O2WL 2OFQA 1QSFB 3O8XB 1E8WA 2FK9A 4XPBL 3BPCB 3PWPD 3IJYA 4OGAC 2HJFB 1T2QH 1ND0A 1K8DA 3CHRA 2ICCA 2JK5B 3AM8C 3LVTA 5HPMA 1S78C 1IIIA 3HN3A 2X0UA 4RRPA 1BFOA 1UATA 1BOGA 2AEPL 2DD8H 3GSQB 3HG2A 4HZ1A 3TVMA 3Q5TA 2HCZX 2JKLA 1JYVA 2UZIH 2UX7A 3EDFA 3MR9B 3HPJB 1HHIA 1LP9E 1RK1A 1SBSL 1ZA6A 4UQBA 3NCYS 4JL1A 4NM4H 3MJ9H 1U3HA 4ALAC 3IXAB 4JKPL 1HOEA 3IS0X 4ZXBC 3RVVD 3MZGB 5J6SA 5F7BA 2IFFL 1A6PA 3EJYD 2ITCB 3QFJB 2E7LC 3BP5B 1MIML 2BWQA 2Z3FA 5DRZA 4WKXA 3CDZB 4XP1H 3ZDYB 1JS4A 3VXQA 4AMKH 1LE9B 1W2KT 3M1OA 5CCGE 1U8CA 3MFFA 4D7BA 1M7IB 1U8HB 5IMMA 3BP6B 4N25A 5I5IA 2FHFA 1E6OL 3V55A 3ZE1B 5KS9A 3QDGE 5TDNA 2X70A 1TR7A 1VGKB 3UJIL 5IVZA 1P9MA 4DGWC 3H1ZA 2EQDA 1FZOA 2AJZA 1JZ4A 4WUUA 1EBAA 3KW7A 1FORL 1BWWA 1URZA 3JQOB 1R47A 4O9HL 1OEZW 4HCRH 3OLDA 5DRXB 2XZCL 4OLYH 1F0LA 1J9SA 3QUXC 5AWNH 3ZO9A 5CNHA 1FG2A 5IQLA 2WGNB 3V4PL 3MRCA 3IDMB 3RVVC 2XQYG 5DLMH 1CLOL 2BP5M 2MQ3A 1GOGA 1RULH 3NJHA 1MCEA 1LO2L 1NFDE 3T2OA 3RY5A 5BZDA 1S7VB 3D25B 1OOWA 2X2HA 4CMMB 2FHBA 3QR2A 2G9HB 4EN3A 2NYKA 3UMTA 3QQDA 4UT9L 2KZ1B 4PJ5E 4XVJH 1QRNA 2VL5B 4BKLB 4HCRA 1N0XL 5JW4R 1ZHBA 1BQ5A 3NZ8A 1ZLSH 1H3WM 3NCJL 5D93C 5FYKE 3NJMA 4YFDB 5DSCA 3U2IA 2YD1A 4B6ZA 1BAWA 5B8CC 3RP1A 3ARGB 3WUWG 3C60B 3MRPB 5FA4B 2EXYC 2XWDA 1E67A 1M9SA 3SYOA 1YN6B 2NR6A 4G8FA 2DYPB 1YQVL 4ZMLA 5AB9A 1CYXA 1ZS8B 4Z77B 1KTRL 1CXKA 2F5AH 2BVQB 3PREA 3PPEA 4D9RD 4WW1B 2VR5A 3TZVD 1S7TA 2E86A 4WCYH 4YK4B 5G55A 5IMKB 5ALCL 3GIZH 3IMUA 4PRHA 2PTUA 3HFMH 2GJ6D 5T1LB 2XYBA 3DOSA 1G6RL 2VQTA 3P40A 3M46A 3HHSB 5AVQB 2G5BB 2CDGB 5HD8C 2FIKA 5E5LA 1QRNB 2NY2B 4HIJA 1PJWA 2ZSWB 1DCEA 5JA9A 2YAEA 3L6FB 4R7DA 4U3SA 5F9AC 1DQDH 3BYYA 1AG0A 3OSKA 5A7BA 3G08B 3MCKA 3PIQA 3VCLA 2XY1A 3W1ZA 4AJWA 1S7SA 1ZXKA 2HT3D 1U8MA 3VXMA 4UAOC 4QXGL 4L9DA 3VFMA 4NSKB 3T3MF 5JW3L 4GW5B 2W5PA 2J25A 1Z5LA 4FFZL 2W60A 4PI0A 1ZEAH 1LILA 5I2IA 1FGNL 3QDMD 2SEBB 2WXRA 3T4YB 4A2MA 2WXQA 1I8MB 2RQ8A 5I15H 3KXFE 1Z0NA 2X4UB 4WUUB 3TA3C 1BX2A 3APNA 1DTUA 4IEFA 1AGDB 5ILTL 3O2VL 3THMH 3ULVD 3S3PA 4NCC1 3AQDA 4JJOA 4FERA 4A38A 1WG3A 4O51B 4OUUB 3PJSB 3SKNB 3CFBA 4JREB 2VE6A 4Q9QL 3QQ9C 3WNJA 1FFTB 4ONFL 1U3JA 2ZSWA 4UOW0 1EHXA 2EH8L 4OZFG 4XH2B 5GISH 1G7IB 1AKJD 4ZS7L 3W39A 1OTTC 3OMZA 4KQ0A 5A2LH 1FL6B 4RMUA 5DK0B 1FAKT 1CFNA 2QQKL 1XIWD 1PJ9A 2CCWA 2EECA 4FYTA 2HLFC 3NZSA 5IQ7L 1EZSA 1TJIL 1LYQA 1VCBC 2Y23A 3AQYA 3QBTB 3V5HB 4U1LA 1CD1A 1JF5A 1L7TH 1MRCH 4JAMA 5F1NB 3PP3H 1WBZB 3ROOB 2I60H 4MQXD 2HRPH 2VKXA 4NFDA 3RBGA 1VEOA 4QHNA 1NCUA 1TEGA 1L6XA 3DGCR 5FA4A 4KZDL 4JKLA 3H9ZA 2OMWA 3WIHH 2KHAA 2X4UA 1GSKA 1UVQB 3P2BA 3OKMA 2I27N 1YUKB 2UZXA 4KK9C 1G9HA 5DJXA 3ZY7A 4PTUB 4C4BA 3T71A 5J6GB 2YSTA 4AQOA 1YEHH 4UNVA 4D8PB 3I3BA 5CBEA 4JY4A 4PRDB 1XFPA 3DUSB 2CIIB 3NJNA 2OYMA 4PHXA 3TV8A 1FO0A 1T7YA 2VE6B 5GRUH 3KEDA 5BOPA 3ZTNL 1IM9D 3BD3A 1JVOA 3CFJB 3QEHA 4ODSL 4MZIA 1RQ5A 2YAOA 3EO9H 1H3GA 4ADJA 1JRHH 5C3TA 3TV3L 2WB7A 1M7XA 3FPXA 4FQXB 4ODHH 2B59B 2F1BA 4WW2C 3DSFH 4IBYA 3TYFB 5EU7E 4EKXA 4C83B 1PAMA 5JNYB 3F6LA 3IMBA 4UQDA 2DQCL 2AGJH 4DQAA 4Q97A 1X44A 1FO0H 4PJCF 3EJYC 4QF1B 5I6KA 5A3IC 3Q2NA 2ZCHL 4YIQA 2F8IA 3UJIH 1LM8V 6TAAA 4ZTOL 2J8HA 4NQUA 4L1LA 3BPOC 4Q6IA 3OSVA 5ICUA 4RBPK 5IQ9A 3RWDA 3DVGA 1OSYA 2V5RA 3BAYA 2YEQA 3PFQA 1QFPA 4FTVB 1I8KB 2BVEA 4OGQC 2WXFA 3B7RL 2NX5D 4GKLA 4OSUH 1DUYB 3D33A 3WNMA 4V1DB 4RQQA 3BPNC 3T4AA 4NKDA 3F58H 3CVIL 4QOKA 3VA6A 2X05A 3V7AE 1TXKA 5JIPA 4NQCB 4KUCF 2ZYIA 2FSEB 2WQ8A 4AI7A 3DYMA 4YXKL 2ZPKL 4KFMA 3GNMH 3LRLA 4JO1H 4PV8A 2PCYA 5D1QB 3K0YA 2YRBA 4LP8A 4KKBC 4KITB 5GPRA 1H6TA 3L7FB 4QGTA 5KYNA 1NBZA 4B96A 4X7DC 4CN6A 2ZF8A 1W6WA 3X1GA 2XWZA 3W11C 1D6EB 2H6UA 3RWFB 3QUML 1EEYB 3BWAA 3U9PL 4AGMA 5KSBB 1HEZB 5JHLA 1VPOH 1SJMA 2PF6A 1L3WA 2FIRT 3BXNA 2NSMA 4C56A 2RB8A 4D9LL 3PV7A 5KSUB 5DLLA 3M6DA 4TRPH 2BP0B 2UWEF 3FUIA 1HEJC 3U1SL 4YSQA 5LGJA 4X6CE 3COOA 4PS8A 4IRJC 1CLYH 4WENB 4RAUB 3MRHA 1L9TA 3KDMB 1TZ8A 2EEFA 2OMXA 2ZPKH 4M5TA 3O3AB 5J13B 4U3SB 2BS9A 3Q1SH 2AV1B 1CLVA 4YNYA 4XMLH 4PJ6A 3O6FD 4OLUH 3TZVA 2AJYL 3GHBL 4DETA 1BJ8A 5DK3A 1XCQB 5C3LD 1QA9B 5HHOA 1NAKL 3WEMA 4L8CA 3CN1A 1MLBA 5HBBA 1C9SA 1IJNA 4RAHA 3QZNA 3NJVA 2WXLA 5BOJA 3P0YL 4Z7QB 4Z0BL 1J5DA 4JCLA 3B2MA 2XA3A 4JQIL 3UC2A 3NN8B 1NLDH 3PCYA 1E9OB 4HUMB 2ADYA 4ZTOH 1M53A 3DX9B 3E3QC 4RMSA 5SWSB 1LNUA 5BZWB 1NEPA 4FADA 3SYPA 4A7QA 1NKGA 2X1XR 4X5WA 1IFGA 1KENL 3K6OA 2NXZC 3O41A 3QS2A 5H37A 4YXHL 5I8CB 5E5UB 4KXAA 4NT6B 5GSVA 1U8KB 4Y4HB 3ULVH 4E9LA 4P2CG 4YHZH 4GW5A 3LZFL 3WU1A 2DLIA 1FZKA 3EYFB 1ZLDA 4KJWC 4OLVL 4NN6C 3ZZSA 2J72A 3F85A 4OR1A 2NMSA 2BVPA 1OB1B 5CP3A 2DQGL 3TBSA 2ZCLH 4CA4A 3GSQA 1R5WA 4MMXB 5GGVY 5GRUL 1WBYB 3S5LB 1REIA 3DVNA 3H85A 1KN4H 2YQBA 1MVUA 3FHEA 1F1AA 2YO3A 4U1IA 4DKAA 1KGCE 2R2BA 3D07A 4F7PB 2IH3B 2LVCA 2WHVA 4HS6B 1BYPA 5DO2D 3U6XA 5BV7B 2DWEB 4Y16A 5D1ZI 3TN0A 3RFZA 4JO5A 1AZUA 4BKTC 1SLUA 2Z7YA 3SCMB 2HRPL 4OCXL 3GSUA 2H7WA 5D70L 5EOCJ 2HLFD 4CVZB 4CRPA 2WWMD 1I7ZA 3EUUA 1NCWH 2FJGA 2X2JA 3VTMA 4ZW5A 1ZVNA 1UWEL 1D9KD 4PJ7B 3T8VA 2XTJE 3Q0HA 3RWEA 2PCFB 2ZXWB 4OFVA 4ABUA 4N2CA 5MHSE 4GYBA 4LCVA 5FDWB 1G7LA 2FQGA 4NQEB 5E8EB 1N59B 4PGBB 1EEUA 3E8UH 5IB2B 4MCNA 4GKZA 4LAQH 3HAEG 3RWIA 4GAJH 2XKNB 3TVMD 3L3JA 4N0YL 5F71A 4EIBA 3JWOH 5MEQB 4MQTB 5KVDH 2UWEB 4PJ8C 1BD2D 3HZMB 4F5CE 1TQBB 4YHOH 1OOAA 4HKZB 4KKLC 3D09A 4IIQB 4KK5D 1TU2A 4XNAA 3DRQA 3F12B 2H26A 3PABB 2OI9B 2ZKMX 3X11B 3O2VH 1ONQA 3THML 1HYSC 1R3IL 3FFCB 4MAYB 4TVPH 1R4XA 4OGYL 2PNDA 5AUMA 4F7EA 3D2UB 4OJYA 1XAKA 1WHPA 4L4VE 1KGCD 4FCHA 4UV4H 1BM3H 1H8LA 5E0FA 4Z3FA 5BNXD 3PHQA 1ZEAL 1EDYA 2I69A 2J43A 5D7JC 2GSIA 3TJPA 4F80A 1AE6L 3A4FA 4X0NA 5K33A 2V9TA 2HVKB 1G7PB 5IJKC 4ODUB 1WS7A 3NSYA 3QNYB 3R18A 3CFCH 4IRZH 5EA0H 3PIQB 4M7ZC 9PCYA 2AC0A 5D7JB 4BSWB 4DP4X 5I76A 4Y9CA 1HL9A 1D7BA 2Z4TA 3B1TA 3CCHB 3Q48A 1OANA 3P73A 2VOTA 5I1CL 4O2FB 3Q6FA 1GGCH 1F90H 1YPZF 3BP5A 5LGYA 2WPGA 3VXSE 2MQCA 3P3TA 1NGYB 1XGPB 1PF3A 2DQTL 3QFJA 1B0RB 2NUPA 3HA0A 5C07A 2CRYA 5T1LA 5K69A 1XZWA 3QIWB 4HOZA 1HH9A 1JYXA 5JQ6H 4MS6A 1ERNA 4W4OC 1MCFA 3G7TA 4KNUA 3TH2T 4F9LC 5HSFA 3TBVA 2BIQA 2OBGA 5AB2A 4G6KL 3MFFB 3FTUA 4FJ6A 3UO1L 4ZBJA 5IMMB 3G08A 3MCKB 3VCLB 1QX1A 1LK2B 3FT3B 3SGDH 2H3XC 4JDZA 5JQHC 5KUMA 1MFDH 3T2QA 2VR3A 1S7XA 3GGWB 5CIPA 4AQ1C 5KYUA 4HWZA 2PYFA 3SOTA 3V6OE 3C5JB 2Y36H 2Z65C 1A4JB 4GEJA 3SBWA 5E6ZA 3SDDD 2E27L 3RRQA 4A63A 5T5FH 2VDRL 2NZ1A 1E3FA 1WPCA 2C9SA 4L29A 4RMWA 3L3IA 3SCMC 4AMXA 4JFYA 2D0FA 4X4ZA 3RWGA 2XJLA 3MRMB 4XCYB 5EEWA 5FGRA 2R0WH 3KYMA 3O9WB 4OUOA 2NYYC 3AAZA 2H2SD 2VN5A 1CLOH 4G8GD 4QYOB 4UF7C 3IJ8A 4K9JA 3DXAA 2AJVL 2PABA 3U9UB 2G5RA 3UO8B 3D8MA 3FHQA 2O5NA 3QWRD 1BQLH 2BO0A 2Y1YA 1CDGA 4JGNA 4N26A 4XAWL 1J8HD 3HOGA 2DWTA 4PRNA 1ET8A 3QIBD 3QUZB 4EBQH 4EI0A 4MVBD 2BSDA 4F7TA 5I74C 1M2OA 4K4KA 1A7QL 3F7PC 4ZSOA 3V6ZB 2B0SL 1OTUC 2Q7NA 3JWNE 3K6FA 3AG1B 4MNGE 3C08H 4E5XA 1T1WA 3KWWA 1OO2A 2AF2A 4G7RB 3DV6A 3LIUA 4QCIB 1XL6A 4BK5A 2GJRA 5KBDA 2HT2D 5DJYB 5JDJA 3MU3A 3X1FA 5KBPA 3S96B 2OJZL 2W07B 3LIZL 5C2BH 4XP1L 1KF9B 1NMCB 3CSFA 3B2PA 4AGNA 3QZWG 4JGJA 2W9EH 3QCVL 4HH9A 1IE5A 1MAJA 1YNKL 4ZNEA 5KBKA 2IPTH 3R1GH 3PQYB 4U0QB 5AW2B 4W6YB 4HBQA 3GSNL 5T33L 5F1KC 4D3CL 4EDXA 3IN0A 1HH6A 2WXGA 3L4ZA 5I5RA 1UYWH 4FS0A 3IDIB 3WUWA 43CAB 4YVNA 5KTEL 1U6AH 5SV4A 2R0KL 3DJSA 4RRPM 2IANE 3IDYB 4ZAKC 2J8UE 1H8NA 3ARFC 1JHTA 1YUHB 2IOMA 3SJVD 3SZ6A 1K8DB 4MCYB 2I7OA 4JFQA 3U7AA 3WLBB 3D4ZA 4YHMH 3IJYB 2X4OB 1N67A 3NZ8B 4K0OA 5DWUL 2TRHA 3VTAA 3E80A 3VYOA 4WFHE 1H5BB 1KYOK 4LEXH 3N91A 4NYLA 3BVNA 1PX4A 3UTPD 2Q5BA 5D1XD 2DLFL 3SYCA 1GH7A 2WTOA 2A7BA 4HJEA 3ASNB 3FB8A 1ZT1B 2CO6A 4A6YA 4TKWA 5DJYA 2F08A 3L3KA 2HB0A 3SN6N 3BAXA 4TVPE 3EGXB 3CC1A 1DHKA 1JPEA 4QRQB 3ZKNC 2I5YL 2XXCB 1QBLH 4CVXB 2OULB 4WY7L 3KXFD 2A77H 1WAAA 5ESQA 3V6OC 4M7JL 4O2EB 1II4E 5AW8B 2X2IA 3F01A 2J56A 1KCSL 1JTOA 5GS1B 1PKQB 2Y0SA 3FT1A 5AW9B 2MCG1 3X17A 3DWTA 3ZDYE 4C4UA 3SKMA 5IJVA 1I9RL 2COQA 2NLJB 3GDCA 4HZAA 4MA3A 4P5KB 5TK4A 1T0MB 1AP2B 2YOCA 2QSTA 3GXTA 1B6UA 3NIDB 4JCWA 1ED3A 4LIQE 4PJ8D 3WY2A 4G70B 3ARYA 3ATFA 3WFBH 2UWEA 1JXFA 1T4KB 2I07A 2TAAA 3V52H 2KZKA 2LLGA 1K2DA 4JRYB 2IADB 1KB9K 5HVWA 1H3XA 3VFNB 3FFDB 4WV1C 3K1KC 3EBAA 3WDHA 1AR2A 2OTUB 1XWVA 2BP3A 4GFTB 4I87A 1KXVC 2W07A 4K7PY 1QBAA 3HR6A 1FLRL 2WZPA 3TYGL 1NL0H 4PW9A 3GXNA 3QPXL 1DANT 4NO2A 4IHOB 1MJUH 1D5XB 4JPWL 3CK0L 4JDVB 4GUPA 4UT9A 4WLCA 3T9WA 1S9KC 2V4LA 1KCUH 1C12A 2GT9B 3IJHB 5HP5A 3FT9A 1NSNL 4Y5XA 1TETL 2VDPH 5HGDB 1HHGA 1GJWA 4FNLH 3OQRA 3TLRA 2D4FA 4CVWA 4HT1L 5DVLA 3NDZE 3SPIA 1ZPUA 3TEWA 5DHYA 2K9FB 4O2FA 5BO0D 1F42A 1R5VB 3LKOB 4HK0A 4NUJB 2QHRL 4JPIB 5EZOH 3JWNG 2ZCKL 5EBWB 1FC2D 5PAZA 4CMHB 4O5LH 1I85C 1T04A 3EYUL 1Z9MA 4NZUH 4OY9A 3FZUD 1RJCA 3C8KA 3QIWD 4OZ4A 3RL1A 4LP5A 1LEIA 5BRZA 5CMAA 3LZRA 1DN0B 2JTDA 2ZXQA 2LU5A 5E7FA 3S37X 4CN4A 1IAOB 4X9IA 4JPKL 5DFAA 5DZVA 1OGAD 2R0ZH 2RBLA 5HHXH 2J2ZA 4Q9RL 4JR9L 3RFRA 5HHOD 1TFPA 4M5YH 3VWJB 4QJ3B 5E2TL 5CD3A 1BZ7B 2JQAA 3QRLA 2ZUTA 3M45A 3OKLB 2OZ4H 3U7YL 4R3SB 4XXCA 1DQQA 1YYLL 3U30C 3ZE1F 3CDGA 1MHHB 2NDGA 2ZT9C 4X80H 4X5RA 4XNXH 1KGUA 5FO9B 1IZKA 5TPWH 2EIBA 2IIJA 1MHPH 4DQOH 1VB9A 3QT2A 4I5BA 4RNRA 2QZ5A 5AVUB 3ULUF 4U1MB 3TJEL 4RDQG 3FTWA 2A4ZA 2JKTM 4UT7H 2CBTA 3D69B 4JFOB 3I50H 3I75B 3Q7JA 4KZCA 4HOMA 3I6LE 1TJHL 43C9A 3MTXA 5IHBA 2OMXB 4G7YH 3FOLB 3OLIA 5IQMA 4UBDD 2L7EA 3S36L 2ZKWA 1N6QL 3B3IA 3RX9A 2Z9TA 1SYSB 4L8SC 4N2NA 1ZGLP 1OP5K 1SN0A 2FQFA 4XN2A 2DQEH 4D8OA 2NXYD 2XWCA 4LCYB 1AXSB 1ZV9A 1MVYA 3BH9A 1AO7D 3HCVA 4KJQC 4NI3A 3TCLA 1M3IA 2GBVA 4JQVC 5I71B 1Y0LB 3D39B 3HE7C 5HJ3A 3V5KB 1RU9H 4Q2ZA 5LDSA 1DLFL 1HSBA 2K3HA 5EBLB 4BE5A 3O0LA 2Q6WA 1RAMA 4QT5B 2MHAA 1IEBA 3B2VH 3OQ3B 2XV0A 5EZPA 3BVUA 2BCKA 4UT6L 4J3VA 1SYVB 1U8NA 3EDDA 5BV7L 4TSAH 3BT2L 3MVSA 3WNNA 1A1NA 3D08A 5FHAL 5ENWB 5TJWK 4N85A 3EYOA 3LKOA 4QRTB 3UH8A 2D0GA 2YFOA 3VD9A 4F7CB 4FMKA 2RIKA 1K3ZA 1M7DB 4RLDA 2ENYA 2P45B 3F5WA 2VDOL 1BW8A 5MI0C 1XH2A 4HEPG 1CG9B 3IF1B 2RR3A 4LL1A 1MWAL 4JFQB 2Y5QA 3L81A 3F3HA 4XP4L 3WLBA 1G9ML 3LEYL 4H0LC 1WSST 2CLRA 4KKCD 5F3FA 3ZRSA 2AV7A 4X6EA 3HC3L 2VL4A 2EIJB 3RGVB 1MAKA 2APVA 1CICA 4GW1A 2OR8A 3OMAB 1FFPB 3V0GA 3SKMB 2FBRA 2WUCL 3RDTD 1AAJA 4QEGA 1E90A 4MQ7B 4O02L 1QLFB 1QR4A 4NAMA 4RGMB 2HFGH 1DFXA 2K4AA 4QRPD 5KYUB 1TCRB 2VDRB 5CWSA 1KCRH 1ITCA 2OXHB 4Z7IA 4KTDH 4MS8C 1D3CA 5FO9A 3WS3A 1AH1A 3PUUA 2AZUA 5ADOH 1VFBB 2Q8BL 4DUVA 4UB0H 4LCWE 4MWFA 2MCAA 1W0VB 5TF1L 2VLRB 2QTVA 4GP8B 2XQYA 4CU7A 1T6VN 2FJGB 3T77A 5FKPB 3VFTA 4D2NA 5HYJB 4GRMA 4OZIA 4X8XA 3DOIA 2ZKYA 4OFKA 5HJBA 4A39A 1RK0B 1GY1A 3HBGA 4I2XA 4FQCH 2V9QA 4MMYA 2HLEB 5CMAB 1F4WH 2EYRA 2NR6C 4KBPA 1UB6A 4ZFFA 1PZAA 2FX7H 3P4MB 3GSXB 4WWKA 4DERA 4LCYA 5BJTA 2G2PA 2KPWA 3MI6A 5H4YA 3PABA 5GQBA 2YAMA 1WGVA 5FEBA 3DIDA 2A3TA 2ZWKA 2QADD 4FQ1H 3WGUB 3ZHLA 4YWGL 2EEDA 1QTYT 5CF3A 1U8JA 1GY2A 3WSQH 2PP9A 4AKPA 4MASA 3B3BA 2OXHA 2WXOA 4O58L 5DO2C 4G6MH 5BRZD 1DQML 3PHQB 4ZXBB 3VRLF 1CU4L 3DX8B 1XEUA 3P4OB 5CILL 5AVRB 4EZJA 2IXQA 3ATDA 1BQHG 1MLCB 5I1GH 1DSWA 1EFQA 4N9GA 1A7RH 5D7KE 1AANA 3QQ3A 3FPYA 5FW7A 2NR6D 2O5YL 3KDMA 1PL3A 4G9DB 4JPVL 2CRZA 4RMTA 4H1LH 4LLVA 4F37K 2Y4SA 1CJYA 4NQDE 5EFIA 3B2VL 2VLLB 2VXUH 2VO5A 4XC1H 5FGCE 4Z7WE 1YRKA 1UM5L 3D9AL 4FZEL 4ECNA 3PJNA 4QRPE 2A73B 3VSVA 1RPQA 1LTXA 4WNQA 1RURH 1DLFH 3C5ZC 1PNDA 2MMXA 3INUL 3K72B 1HAUA 1NGZB 2OR9L 4NHUA 4HJGB 3VD5A 3TBTB 2XNAA 3K6SA 3UBXI 4MCMA 4ONGL 3A6BL 4DEUA 3VQ2C 3GBML 4WW2F 3WAJA 4MZRA 3WKPA 1I9EA 2WQWA 4P2QA 5IW1B 2HVJB 1D7DA 1IGFH 4YN3A 2VRQA 4K8RC 2E9JA 1MFCL 1G1CA 5JPNC 5AENA 1X5HA 1SDAB 2WXIA 5F7KC 1FIEA 2VQ1B 3K4DA 1E5ZA 4PMFA 1VGEH 1NGPH 4PRHB 1NC2D 4GQ9L 1N64H 1KNOA 3MGTB 4G72B 4AW4A 3LRSA 3VXSD 5HY9A 5B3JE 5K9QG 3VFPB 1S3KH 3QORC 2H3NA 2UYLA 5KANI 4UOW1 1RUKL 1E6JH 1V27A 4AM0B 5JLZA 2V33A 1TUPA 2NNXA 3B9AA 1V5JA 3QVAA 1NOFA 2OJEA 3PL6A 1CBVH 4LU5H 4GS7B 2R69L 3K4AA 4M8QA 3AY4A 1M57B 4QHLB 2VR4A 2KLSA 4H5SA 2WN3A 2Y06H 4HWEL 3GS4A 4AK2A 1U8LA 1BVZA 2NXYC 3IJSB 2J6EH 2AV1A 4J7RA 5C0CA 4FC3E 2P5WE 4QCIA 1SQMA 3BDYH 5D7HA 1RZPA 2QHRH 4MA3B 1NC2B 1AMXA 2B4CL 2JJSA 2WBKA 3NIFF 1MCPH 3IGKA 1F00I 1RUML 1FN4B 1GZPB 1XIWB 5I1AA 3D7PA 4PJ7E 1M2VB 1HN1A 2VR8A 4UQ2A 4HH9B 2GBUA 4FQXD 4UT7L 4FABH 4GKNA 2OW6A 3DX7A 2QJDA 3MLWL 1KZQA 3QEGL 4DPCX 5IOPA 1JYNA 1ORQB 4PB9L 1RZ7H 4NWUH 2EDOA 5K39A 5INDA 1L9NA 4QDGA 5C0IB 3KYMB 3O9WA 3BYTA 3B4NA 4YSPA 4HFUL 2XY2A 2UZYB 5C08B 1DSFH 2DQUL 3RGVD 2LU7A 2G9KA 5C0CB 3GINA 5JMOC 3EYFA 4NN5C 5ID0A 3MRDB 3MJ9A 2R4SL 3P69A 1E50A 1L6PA 4ES8A 5IHZA 1BVOA 4LK4A 3T2NL 4NERA 3SY0A 3TPKA 3NFSH 1WISA 2EP6A 1PSKL 5GGVH 4L4TE 3QJSB 5F88B 4NZJA 2UY7A 1FA4A 3OKMB 1Y6MR 3KPQA 4Y9GA 4HUUA 5DHEA 3R06A 1ID5I 3QE5A 1DBAL 3VE0B 1ZVYA 4OIBA 4H26A 5ANME 5C0DA 1JXGA 3N50A 4UOQA 4PWIA 3L5HA 2A4CA 3G6JA 1JE6A 4ODVL 3T6XA 3ZKMC 2HJKB 3OZKA 3IKCA 2WNGA 3VGFA 2VUOA 5D2NB 4JB9L 1QRND 1UG9A 1WITA 1JWSB 1KG0A 2P1YA 3WEXB 3MNVA 4MNHB 3A4DA 5TDOA 1A5FH 2B8OT 1A4BA 5DJCA 4LLMB 4ADGA 5I2IB 4ONOA 4X9FA 3TYFA 3HLAB 1MCCA 4L4VD 4XPGL 1ZLVK 4WFHD 3SQRA 1ED3B 5MP6L 4ZMNA 1BVNT 2E0PA 4FNUA 4TYUA 1T0MA 1CL7I 3O3EB 3O3UN 2FBOJ 4A68A 5KJRH 1VFMA 1FHNA 2NY6C 3WL9A 4C58B 3UGXA 5D1XC 5AOMA 4WSKA 3DVFA 3LNGA 4X7CC 1UB5B 2AEQL 3UBHA 2AW2A 2DAVA 4NUQA 3VM7A 3KL5A 3IPFA 2WKOF 1NC4D 5LGHL 3WEOA 4PRID 4S0TD 5T5NG 1BXAA 2V7NA 1TKWB 2B08A 2MIZA 4HV8A 1QLRB 1OGSA 2FX8L 5MENA 4N8UA 5DUBB 3H0TA 3N44F 1TZHA 1U8MB 2EVFA 2AZAA 4FKEA 5GGQH 1QKZH 4X4XB 4FQ2L 4X7TB 4HMDA 2QVFB 5EU4B 1YJDH 2HVKA 2DLTA 1OWRM 4KOBA 2ATKA 5T1LD 1EAJA 3DTDA 4CDGC 2AAVA 3FQTA 4NFBA 3VFUA 5G4NA 1HCYA 4DVBA 4Y7OC 4BUGA 1MWAB 5AKRA 1XD1A 2J71A 2ZKHL 4MKMA 3TZVB 4ENZA 3MLZH 3LIZH 2APSA 1AD9A 4FL4C 3ARDB 4ORZC 3O6FA 1IC0A 1U8QA 1E27A 4M7JH 1I1AB 5J9PB 5C0FA 2D3VA 5IWLC 4L8SA 2HX7A 2YQGA 3ETBF 1BIHA 4PBVC 4U1HA 3VFRA 2O5XH 3S35X 1JWMA 4BXVA 1QSED 1GC1H 3SDYL 4U6HB 3U0WH 4GI9A 3KR3L 3BW9A 5L2JB 5KN5B 1C5DA 4KI5D 2J7LA 1BQLL 3LNFA 3AS1A 3MLTB 2IH1A 4HQQH 2C34A 2AJ3B 2XN9A 4W1TA 4ZDHA 3B2DC 3O6LH 3QHZH 5EO0B 3A23A 3TXAA 2VJ0A 1RFDH 4MZ3A 3BP6A 4DSYA 1CDUA 2GY5A 3BUBA 2H2PC 3CNKA 3DI2B 2VERA 5EU6D 5CGYD 3QORD 4XWGH 2YPKB 1U6AL 4CBZA 3FRUB 4BH7A 1EJ6A 4RX4A 4V2BA 2IGFL 2CDGA 1J1PL 4MA7L 5JHLH 1NUFA 1DL7L 2NTFA 3I9PA 4XR8C 1A6UL 2ZCZA 1HEHC 2IBZY 3LQAL 5IVXE 3ME0B 1MFDL 2CHXA 2VDOB 4U6HA 1ZGLM 5EEXA 1Q8MA 3EO0A 1IARB 4HUKB 1BSIA 2OSWA 3QXVA 4OW6A 1EGJL 1LO3H 4JRXA 2F15A 1ZIAA 4EN2A 5BVJB 3KLHD 5F7FA 4G9FA 4EI6A 4K94H 3FQNB 1XH3B 5HHOE 1W15A 5J8OA 3QIBC 1JN6A 5BOZG 5ELIA 5JPMA 2ALWA 1GZQB 4LPTA 4HK3N 4G1EB 4X8CA 1ZHBB 2QSCH 3ETBJ 5K93A 1A3RL 2WLMA 2BNUB 4XPFH 3CFQA 2NY6B 1P84J 4NM8L 4L05A 4ZW8A 3VGHA 1OHQA 4NDMA 3LKPB 4OZIE 3ZE1E 3F6IA 5IQOA 1GMIA 4X42A 1IBFA 1WUZA 4L5FL 5DS2A 3BSZA 2J6WA 2IAMD 3NIDE 4KRNA 2X12A 4N1CA 1JNHA 3CZLA 3LOWA 3QNZB 4ZODA 1G7HB 3KYNA 3RAJH 1HQ4A 4XPHL 1A3LL 2X6AA 3AQZA 1T2XA 3BO8A 2VM9A 3MRRA 1E5YA 5FW6A 4FQQB 2DV6A 4YE4H 5D2NC 3IU3B 4FLHA 4OLWH 1MH5B 2ZP8A 1EJOL 3QISA 2L4OA 3T3PF 3D0LB 1UFUA 4JHAL 5FR3A 2BNQD 3X12B 4AK1A 2KS0A 3KL3A 2VZTA 4QPEA 3BEWB 3MRKB 2APWA 4ENED 4AGPA 3G5YB 3L8QA 4KY1L 4YHOL 3K46A 4MTMA 2Q3XA 4MZ2A 2CM6A 2P8MB 4U3CA 3B8SA 3GXDA 4ZX4A 5I1KH 4GAJL 3MBXL 3S8FB 3SDAB 5C9JA 4J12A 3ES6B 4G6AD 4M3HA 3VFVA 1HL4A 3ZTJG 4QMEA 2HKHL 4LLDB 5I19L 1CFVH 5CLTA 4OI8A 1P53A 3RWFA 1Q0YH 3L9EA 1XGQB 5A1AA 4ZFZB 3SD2A 2W0FB 1JNHB 4K9EC 5C92A 1WS8A 4HZLB 5C07D 2EACA 5DZ9A 4AYSA 2VXQH 4YSSA 2ADJB 3MUGA 4XP5L 4PB0L 1FVCB 1O6SB 5EG6C 2P8LA 4HV8B 4PGJA 3HZYA 4FQLH 3US1A 5AAMC 5JO5B 1IE4A 4WWID 5EA0L 4JRYD 1J9RA 3EG9A 4ENEC 1RIUH 2CNZA 4DVRL 5AKTA 4KKCC 2XXGA 5LBSH 3K80A 4TUJA 5SWZE 1JPFB 1W72L 3ESNA 3IJEB 4RGOH 4QRRB 4G80A 2WAQA 4OJCA 4Q0XL 3B7UX 4DIXA 5LKNA 5E00A 2ZUSA 1YNTB 4D0BB 3SCMA 3OKOA 3QDJA 2UYLB 2E9WA 1MJ8L 5GJTL 1KTBA 3DX4A 3AVEA 3OKKA 4ZUUB 3KXFB 1S9VA 2W0PA 1JRHI 2ZWZA 2IDSA 1FYTA 4UIKL 4NPYA 2VSCA 4YC2B 1EAOA 4ZMQA 1AHWA 1D9KC 1HL8A 5FOBB 2P48B 3MRBA 4TQEH 3IMWA 3QNZA 1YVLA 4GRWE 2GTZB 5I0YA 1OE2A 5DUMH 1CXLA 2HT4C 2N59A 3LS4L 1JPSL 1S7RA 3G6DL 5DD1H 5E9NA 4DOHE 2WLHA 3VXPB 4DCQB 3NACL 3VXMB 1RSYA 2FNBA 2XWBA 2EABA 5EUOA 5DFVC 3VXRB 1DVXA 4Y19E 1JPFA 2BZCA 2DKMA 5E2VH 4JFHE 3CFMA 1J8HB 5IHUH 2VWEE 4WJ5A 1D6VL 3F7RA 2H8PB 5A3ID 4N1EA 2P9RA 4UDTB 2DMGA 1VHPA 4PJFF 6CGTA 2ITEA 4YSRA 4QRTA 5J06A 1AGBA 2F7RA 1JZ7A 1CZ8H 2DM7A 4JKMA 3SQBA 4O51A 2V3FA 1G7JB 3DX1A 4B53A 4M1CC 3PQYD 2CK0H 4AL8L 2WBXA 3BAEL 1L9RA 2X87A 4ELME 1NWOA 4HK3J 3KPNB 2Z92B 5I26A 2I25N 1A6WH 4WI4A 4D9LH 2HJFA 4FG0A 5IROC 3X13A 1VPOL 1QLEH 3PGFH 4DJMA 1F1GA 3CFTA 4HHGA 4Z1PA 2AQRA 2NUTA 2ODHA 4CJ0A 2R56H 3F7VB 4G7SB 1NDMB 1HI6B 3QR0A 3I6GA 1W0WA 2D9QB 3QQNA 4UTAH 3VFOB 3MXWL 3ZUNC 3SGKA 1PMYA 3DJRA 3L1OL 4FNPA 1OKEA 1CC3A 4ETYA 4Q14A 3RILA 3CLEL 4OQTH 2ARJB 2D03H 4KHTL 4LHUD 3DJ9A 4K3JH 3TBCA 1MAMH 1NEUA 4OIFA 1URIA 3QEQA 1IB5A 4FNTA 1HEZA 1XSIA 4O2CB 1KXQA 3MLSL 2BOBB 3O4LE 3FCGA 3OM3B 4HIIA 4PY7A 2Q1EA 4XVTL 1PG7X 5D4HA 4JFZH 1O7DE 4QWWD 2F53D 2E7HA 1DDHB 3N85L 4NQED 3SQOH 3MLSH 4XVTH 4CILA 3TPUB 1AXSA 3BH9B 3HCVB 4BFNA 2JKRM 2Z91A 1IC4L 1KELH 2B15A 4GUOA 5IVZB 2LV4A 1WC7B 1CGVA 2LFEA 2VSKB 3BC9A 3FN0L 5T1MB 3G6DH 5DD1L 4FTVE 3V9EA 3LXUX 3WTVA 4Z7VB 5D2LB 5DUML 1NBYB 5EORL 5A2AA 3UC0L 1PYWA 3H42L 1JHLL 4JFTA 1RZJC 2F19L 3ULUC 2PXYB 5HGBA 4NDMB 1DJGA 1AYOA 2ZOTA 5AOIA 5DSCB 3BISA 2G2RA 1AJ7H 2NQDA 4JZNB 1O5DT 2IC2A 4J1UA 1IGCH 1FRGL 2GTWB 3DBSA 1XGRB 3KPRD 1XL4A 3ARXA 5DD6B 2R9HD 2OMZB 1W9XA 2HX9A 3GSRB 4P48A 7TAAA 3KNBA 5IKCA 4W4OA 4GAGL 5L8LB 3SDXB 4B27A 1MFAH 1VDGA 1U8JB 4XVUD 5KAQG 2W0LA 2XN1A 4Q0XH 4QWWC 5MENB 2ETWA 3IVKB 1TZGH 4YHPA 4DEWA 3JBG7 3MV8E 4FYSA 4NBYB 4P5KA 1FH2A 2ESVB 1KV3A 3P4NB 3Q44A 3JT0A 4I4WB 4AYBA 5I6XC 3DARA 5AAPA 4OTXH 2UY7B 4H2CA 1HZHL 3MOAH 5H37G 5B1BB 1WJ3A 4MJIE 3TO4D 3E9UA 1MY7A 2DDQH 1D9KB 4HUWB 1D6VH 3VAEA 4RESB 1KTLB 5H35B 5EB9A 2EDMA 3W9DA 4FFVC 3KPLA 4TUKH 1XF4B 1KDJA 3WKMH 4QNPF 3VQ1C 3QS3A 3X3GH 4YHYB 1AZVA 2HWZH 1S4IA 3EFFA 3SDXA 3TH4T 1M1XA 4HJGA 4EMZA 2X4QA 3FQ4A 5BO1H 5AQ0A 2W80C 1S7WA 2GIMA 2KPNA 2PYED 3FTYA 3FFCD 3OAYK 4LMQE 4MAYD 3SE6A 3ZE2B 1HZKA 2ZCHH 2Y6TE 4YEFA 4PG9A 2W81C 2EH8H 3UIYA 1GYWA 3M17A 3ZVVA 3RVUD 4M6OL 4Y2DA 1I1CA 1BBJB 1M7UA 4TPRH 3UTOA 5T5NF 4PJ8A 3FQWA 4NIKB 5B3SB 1MQKL 1BEYH 4XNBA 5IZ7A 3EF7A 3WFEH 5CR1A 3CTTA 1KIRA 1VFOA 4K7PX 2NSXA 3NABH 4BINA 1YMMA 5BS0A 1O6TA 4X8JB 3ZDZE 4IOIB 4R2GC 1DJZA 3ARDD 3OD3A 5HHNB 4CUCA 4L8DB 1MNUL 3QORA 2VZ3A 4DO5A 5BJTB 1G6RB 1LO4H 2RCSL 4IKJA 4AXWA 5I15L 2WP3T 2I9LB 5F9WC 3QRGL 4RGNB 2X4RB 1W72H 3Q2CA 1ZK9A 1DVFB 4KVPA 5INCA 1DQTA 5I6OA 3FAWA 3SKJL 3GMMB 1E28B 1RHFA 1S7WB 2EEBA 3HEIB 4Z7QF 2EUXA 3IXAA 6PAZA 2E4FA 3J2PA 4J3TA 1F97A 4QXGH 2ZUQB 4OUUA 1JNJA 4NBXB 2K7QA 4OZFA 4FTDA 4FQLL 4YLCA 2R1XA 2Z4QB 1NC4B 2A6DA 4XOEA 2IV9A 1T0NB 3HE6C 3VWJA 5DHMC 4ZTPL 4OF8A 1F11A 3TA3A 4A66A 3ISYA 3NSCA 3IPBA 3OJDA 2QPUA 1YQ2A 4FDWA 5EC1B 1E9PB 4I18A 3IFOA 4DWHA 1TJIH 1T83A 2HJLB 3MRJA 4EEEA 3UJTH 3GIZL 1OSPL 4J4PC 3JV6B 4U6XA 4WCYL 2NX5B 5E94B 5I24A 2F7QA 4X6DA 1KCKA 3X13B 2FDBP 2WNKA 2XFGB 2VMFA 5T5FA 3M1BB 5FLVA 4FTVD 1XCTB 2ZSVA 2EXWC 3HE6A 4J6RH 3VWJC 2VDNL 4IBUA 4XWOC 4Q9BA 2LT9A 2XTJD 3WELA 1JOIA 2QGEA 3T09A 1ZVSB 2B2XL 4PRIE 3LMJL 1F8TH 1PBYA 3NIGF 3MUJA 4GAYB 5EC2B 4AYMC 3LQAH 1IC1A 5AYTA 3NCJH 2DTSA 3MREA 5FUOL 3AUWB 3P9MA 4NCDA 4RFEB 2G30A 3LNHA 3T3PB 2YBRA 3RVTD 3MLUH 3QZWB 3SDDA 2GIYA 4ABQA 4ZW3A 1YEWA 3RZCA 1FIGH 3HNSH 1T1WB 4JFED 1I7ZB 3RL2B 2YUXA 2R7EB 3RY6A 5B38G 5JW3H 2R59A 5CEZE 1GYCA 3LN9A 3LRSB 4MBRA 1EZLA 5I8OH 5AKSA 1UZGA 4OGZA 5KSAD 4FNRA 4MB3A 4M8UA 2IBBA 4U1SB 5EO9A 5E1HB 1PZ5A 1W72B 5F7DB 5ERWA 4F1ZA 3QJTB 4KX9A 4XHJD 4OZ4B 3GMPB 3T1FB 2OL3A 2PWEA 1KJ2A 2A4EA 1RIVL 1IGTA 1G6RH 5EC2A 4PJXE 4QAWA 4U3XA 4KVCH 4HS3A 2IO5A 4LEBA 5J57B 2LTQC 1Z66A 4PR5B 1JNLH 5T3XH 3VXSB 5CEZH 2Z7WA 3GK8L 1JBJA 1JL8A 3QDJE 3U2SB 2J1XA 1YQVH 1VFUA 4JZOB 2CLVA 4LEOA 2GIXA 1HKFA 3UAJD 2OQJB 4R26H 3QG7H 3WHE0 5HHVL 5D4IA 4NRZB 3BIKB 3E1ZA 5CKGA 5HGDA 3GSVA 4H44C 1DL7H 4TOYL 4KQ3L 2KBGA 3FUFA 3FB5B 3C2AH 5JHLL 1N26A 1MW1A 2WV3A 1NCGA 4P0DA 4A7UA 2W9DL 3CN3A 3P02A 4L18A 3EGSB 2Y25A 3L13A 3KS0J 2QQLL 4R83A 2IVFC 3KCWA 1UTDA 3BVWA 4A55A 3U46A 4PUBL 1UKSA 3MLYL 3SD5A 5I75B 1HH9B 2GJJA 3QFDA 5D1XA 5D72H 5KVDE 4FLOA 5L0QB 1BJ1J 2NUPB 5C07B 1QEWA 1BD2A 2NY3C 1JGLL 3HI1A 3SE8L 1SMOA 4OI9A 5IUCA 3MREB 3POCA 5LCVL 3G6AA 3HBPA 3L7EA 4JN1H 2YD9A 3P3YA 3IE4A 5CJOL 5LDUA 1I8LA 1W16A 3MRNB 4LCIL 2H41A 4OGXL 4C8XA 2CO1A 3JUYA 3RY6C 1CXFA 2BRQA 2J20A 4IK7A 4LRIA 4Y4KC 4S1RL 1HXYB 5BS0D 1E6OH 3KHQA 2VCOA 2BSSA 5DUJA 2DH2A 4XVOA 2JI3A 3CHQA 3FB5A 3WTSA 4J6IA 3BRDA 2BSTB 3NA4A 3O45A 3CU1A 4ZFOB 1E5BA 1KEGH 4AENA 2EDHA 4KTEH 4M8VA 4E68A 2B5IB 2YD3A 1M56B 3S5LA 1HE8A 4HUCA 1N6VA 4P3DA 3U82B 4XCYA 3A4AA 1I3GH 4MAZA 4AQAA 4N90E 3SQBB 4OFDA 4JFVA 6FABL 1SLWA 3NQIA 4OGXH 4OIIL 1CGTA 1VKXA 1LD9A 2WZ6A 2ADGA 2XOTA 3OZ9L 5C6WH 1FHGA 3FN9A 1HNGA 1PSKH 4PCSA 5GGVL 4AMWA 5E9DB 1NGQL 3SE8H 2WINA 2Y7OA 4I0CC 3LSOA 2ZOLB 1NCBH 3MLRL 5FHBL 1YMMD 2WO2B 3TIDB 4AXWB 2HFEA 4UTCA 5I9QC 1HE7A 3OZLA 4ZRGA 2J8UB 3BZ4A 1M42A 3DKHA 4HFUH 3GSWB 4ZO9A 4W9GC 3EYSH 3IDXL 3ZE0F 5T1MA 3GI9L 3HS0C 5CZXC 5I8KL 5GRWA 3EAKA 2W9DH 3CFEA 1KYOJ 2MEJB 3GJFA 3HE6B 2JKSA 3IMTA 4PJGA 4XPTL 5E8PB 5HDRA 4WO4B 3MLWH 1KFGA 1X5XA 2IH8A 3DSNB 4NQSB 4TN9A 3H9SB 2W59A 1HAWA 1HWGB 3RDJA 1FYTB 5AEAA 2IEPA 35C8H 3Q3GA 1P4IL 3IGAB 3CIAA 1M7DA 1QLEB 4M03A 5IMLB 3CFKB 4PGCB 1BLNA 2B16A 3EBIA 1W0YT 1ZCRA 4KI5E 3V0WL 1ROWA 2UXGA 1I7UA 4E36A 1X7SA 3P3SA 4HGWA 4ZAKD 3N6YA 2A9DA 5I5JA 2BFVL 1HDMA 2IG2H 2ZUYA 4HIXH 2KT6A 1UQSB 4P5SA 1CFQA 3EW3B 4KVCL 1F3RB 2A1WL 1BVLB 3X2QB 1MJJA 3HS9A 4G83A 5E24E 1PD0A 1GAFL 2ZSVB 2YLHA 2GSIB 5FFOA 3VWKB 3ECBA 4FXKB 5DVNA 3TT1H 2X44D 3LH9A 4J27A 4N0CC 1JERA 4KKLD 3UG5A 2E7LA 4C54A 2R69H 2VZVA 3EJUA 4PTUA 1K5WA 3HUJE 4M56A 5A2BA 4ZOBA 3K6IA 1SF5A 3M07A 1I9IL 4CBPA 3D2UD 1U3YA 3NIFE 3NFNA 1MZZA 3GTTA 3CZUB 2IDCA 4B3VA 2WQRA 1OF0A 2RAMA 2OCFD 1G7JA 3L5WB 32C2A 4KKAD 3FT4A 3WKYA 5IB5B 1UEMA 1B4JL 1BFVL 4KPHH 5FA3B 2HLAB 1BLNB 1WZMA 4XE0A 2QR0B 1P6WA 1JZEA 2PO6B 3AU1B 3MLXL 3L4WA 2P28B 1KLUA 3WEAA 1ET7A 2VZOA 4ES9A 2R8SH 1MFCH 4FNQA 2E6JA 3RDTB 4DKEL 4PJ5B 2NXYB 4FABL 4HHAB 4X8GA 5KANG 1CLZL 1WFOA 2IALB 1R6VA 2V8LA 1F8TL 3ARGD 2VUYA 1G7QB 4BFOA 4E0RA 3UGUA 4IOIA 4K3EH 4BV1A 5E2WH 2IWFA 1DJWA 3GQFA 2YN3A 3TGXA 2WVVA 4LHJB 5ANHA 5FCSH 3O11A 2VB5A 5IEHB 4H25B 4XZ4A 5DR5H 3I9GH 2QV4A 3B56A 4UDTA 3JV5A 4MJJA 3AJ7A 1RURL 2FO1A 3O3BB 4UQIM 2BOBA 4GBXA 2R29H 5KYWA 3FB6B 4LSRL 5BXFA 5I1JL 3S35L 1JF1B 2K6WA 2PR4L 4AQ8A 1BQSA 5J12B 2N0KA 3VFMB 4ZPTB 1CBVL 2B77A 4G3YL 3QUYB 4NQXB 1KOAA 4AV0A 1TTUA 5LLIC 4NQCA 1FZKB 1SMAA 3LKPA 3LQAC 4QRRA 4G80B 1DBMH 2NY0C 2PPFA 2D7OA 3BKYL 3BSHA 1J9CT 3OPZL 4NC1C 5DUPH 5KSBA 1MQ8A 4L4VB 3MMEB 3MX0B 3JXAA 4FHBD 4NO0B 1FF5A 4YWGH 1ONQB 2ENSA 3AAZB 1RLWA 4YHPB 4N2GA 4HPOH 2FJFA 1Q90A 2CSPA 1UWGH 2VR6A 3BHBB 3OG6B 5CEYA 2XV2A 4F57H 2CJ3A 1WBXB 3C09B 1S6NA 4W93A 2FX7L 2ZUVA 1BMWA 1I1FB 3IWUA 3MYZA 2BIMA 2V7HA 3TONA 4PG2C 1OSZA 3CC5B 3GIVA 3QJHB 4QTFA 4RGNC 1MHEA 4FQCL 1JG9A 4NN7C 1LVEA 4UIMA 3NK4A 4ANWA 4MA8H 5IJKA 1G5GA 2ZIDA 2PCFA 4FQXC 4PGZA 1UJTA 4E41A 4MCYA 2WMPB 3FUJA 1L9PA 1U4EA 1NBYA 2YEVB 4XP9L 5JHDE 5K1JA 5JIMA 1VESA 3D9AH 3FUHA 3EJQA 3UAAA 2A6KB 1A02N 1RP9A 1NMAH 2N0MA 4QHUA 4TUKL 1AY1H 2A5UA 1EWHA 4TLKA 2N1TE 2IGTA 3MAWA 3NCFB 2RFXB 4KJYA 5DQDL 2OPCA 1BZQK 1AD0A 4FZ8H 2OZNA 4MXVF 5FK9A 5FYKD 2C1OB 2VM4A 2FT8A 3VX1A 3S4SB 5K9KA 4ANXA 4G43A 2DBLH 4UBDC 4WKZA 1UWGL 3IDNB 3VXTB 1Y18A 3Q2LA 4WWKD 4APXA 4ZZFA 1YY8A 4G42A 1IIKA 3U6RA 3NAAH 2HT3C 4HW6A 5IT2L 3VB8A 2VRAA 3EFDH 1NC2A 2XBDA 1JVKA 3RI5F 3L4YA 4EDWH 4GG6E 1G9MH 1DO6A 1RD6A 1U3ZA 2O6EA 1G7PA 3OPZH 3VGAB 2HKFH 4ZD3L 1UUNA 2V5MA 4BWWA 1PLGL 4M9PA 2DWSA 3QIUD 2LAAA 5E5MB 4QNPE 4Y16C 3MBEA 4LSPL 2WLNA 5FKAB 4DUWA 5F21B 2EUVA 2A6JB 3CPLA 5T3ZE 3FULA 1AY1L 2ZX8A 1JHLH 2CA3A 3RNKB 5GS0H 5DZPA 2MH4A 1PLBA 3GPSA 5I1JH 2O5ZL 2C7UA 1E2WA 1YEFH 1NCDH 3TN0B 3H0TB 5C09B 1BFTA 1R46A 5D1ZD 3K5SA 5IVXF 2CLZA 3D85A 4BZ2H 1E4XH 3HG3A 4LF3B 3BMVA 4KTDL 3LNDA 4NQEA 2XXFA 4MB1A 4H20L 3EZ8A 4GQPH 2C1PB 4AE1A 4K3EL 3CMOL 3SJVB 1IC5H 3BAIA 2DKUA 3FO0H 3TU6A 3S36H 3CLEH 3FO9B 2Q9OA 2ERJB 3M8OH 3UAFA 3DV4B 2J5WA 4CAGA 2ZWLT 1FL5A 3HI5L 3SO3C 5DUBA 3BPNB 4L1BA 3MXWH 3QO1B 1L0XA 4AQ8C 2MQ0A 2VDKL 5FWQA 4KKAC 1TQWA 4GO6B 2FE0A 1MWAH 1T7XA 1N8OE 5ISZB 1UACL 4UANA 4PJ9C 3CFDA 4TNEA 3FQ1A 3QIUA 3FTGA 4NKOA 4WUKL 1R5IB 2B7DT 4KKRA 5KUKA 4F24A 1FZOB 2WIIB 1CFTB 1IT9H