3PNRB

Structure of pbicp-c in complex with falcipain-2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
160
structure length
129
Chain Sequence
GKSLKLGNISNQTNQETITQSLSVGEILCIDLEGNAGTGYLWVLLGIHKDEPIINPENFPTKLTKKSFFSEEISVTQPKKYMQLLGGPDRMRSVIKGHKPGKYYIVYSYYRPFSPTSGANTKIIYVTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the regulation of cysteine-protease activity by a new class of protease inhibitors in Plasmodium.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Falcipain 2
total genus 30
structure length 129
sequence length 160
ec nomenclature
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3pnrB00
2H7WA 2OULB 2FO8A 2C34A 2NQDA 2NNRA 3CBJB 3CBKB 3E1ZA 3M88A 3PNRB 2WGNB 3M86A
chains in the Genus database with same CATH superfamily
1HH6A 4E41A 5CR8A 5H37A 3F04A 5HGHA 4RX4A 4TQHA 2IALA 2NUPA 4JDEA 3HE6A 5DD0L 5JHMA 1ADQH 3NSYA 4V1DE 4BRJA 5CCGE 2FHFA 3IJ8A 3H4HA 1EXUA 3ML8A 3R4DA 4WI3A 4N0YL 5F1OB 4ANKA 4IOIA 3HNVH 1QG3A 2DQEL 3M45A 3MTXA 1PG7L 3G9VA 4ZOCA 1QW8A 3BH9B 4OCMC 1I3GL 1K4CA 1WEJL 5KEZA 4LCCB 2YUWA 4MVBD 2M1KA 3H3PH 4U1JA 1DLFH 5E2VL 1CB4A 3QH3B 2J4WH 3BH8A 2R0KL 1QUNB 1A7QL 1HOEA 2EDEA 5BW7C 2CA3A 5C0BB 3Q8CA 4K9EC 1IGCL 2YIHA 3VD1A 3S5LB 5I1KL 1XAKA 1CQYA 3HE7B 4KMTH 2NXZD 4KQ3H 4FXTA 5BRZB 2EXWD 2WUBH 4GO8A 4UWQB 5IB5A 5L4JA 3ECWA 1CXIA 1TR7A 1DVFB 1U8CB 2MNUA 5GGSY 3FO1B 1ZLVH 4Z77B 1P7HL 1BEYH 1A3LH 3WJMA 4F5CA 5F89B 2ZOTA 4L0YA 2I7OA 3CCHA 4R3SA 1U91A 2DEWX 2F7PA 2CWRA 1X6LA 2ZD0A 4U1GC 4J8RB 1G4RA 3MJWA 5I1CL 1UGNA 1AQMA 5AZUA 1MXDA 3EFFA 1A1NB 4LCCC 3VRJA 4XNBA 5KSBF 2GKIA 4X8JB 1A7RL 4R4BB 1DEEA 1PZ5B 1T1YB 1YHPA 3U9PL 4Y5YC 4NO5B 4HWEH 1FFPA 1MW3A 4TNVF 4OD3H 1V7MH 1JPGB 2GAZB 5IK3B 3ECBA 1RU9H 3TEUA 5BZDB 1T6VN 4H8HA 1ZT4B 3ULVE 3MNZA 5E8EA 2F9BT 3OC8A 5D1ZD 5G5DB 1JZ3A 1BWWA 4OGZA 3F01A 2CHNA 3TFBA 4UDUB 2AJXL 3UERA 3Q2WA 1K2DB 3UJTL 1AO7A 1W16A 1H15A 2PWEA 2K7QA 4KC3B 3IAGC 2J2ZA 3NTCH 3OB8A 4HHGA 4PR5B 4YAQA 2HKHL 5B7MA 4LHUA 3CUPA 2WZ5A 4GB9A 4POUB 5GJSH 1GGCL 3BJ91 1M57B 1MFBH 4GKSA 4Y2LA 5DRNB 4QTIL 5FW6A 2G3NA 2AJVH 2OMVB 3PWPD 3QI9D 3B3BA 2NQDA 3IJYA 3GC3A 2GUOB 4HFWA 3NA9L 4N2BA 2CPUA 3O6MH 4LIQE 4K71B 2WVSA 1ZV2A 2DQMA 2W0FA 4OZGE 5A2BA 1IQDA 3ARGD 1CI5A 3BVDB 2Z35B 1JGLH 5HVWA 2WXPA 3SE8L 3ZO9A 1NUGA 3QISA 1KGYE 3DV4B 4HSCX 4JMXA 5C0AD 5D7LE 4LLVA 2ADIB 3P9MB 3NCJH 2FO1A 5EFIA 5I24A 1QP1A 5T3XH 3SGEI 4MNGB 4JHWL 3TN0A 4ERSL 4K9EH 2UWEE 3LZLA 4DAGH 2OMVA 5DF0A 2BVOA 4DAGL 3VO0A 1PZSA 4NOBA 3RVXC 1CVSC 1PEWA 2ZNXA 5FYKE 1JGVH 1PPIA 3UMNA 4POYA 4L0ZA 1L6ZA 4NO3A 1MI5A 5HGDA 3TWCH 5BRPA 2PPAA 5KG9B 1DBBH 1HC1A 1WWCA 4FOMA 4F80A 2AJYH 4YOKA 3F12A 2Q86A 1YPZF 3TPKA 1T2QL 3GXMA 4YEFA 4YXKL 1CGSH 4KTEL 3IWVA 1H8OA 2Q8BL 4OM0H 5FUZH 4G6KH 5CEZL 1RL1A 1BECA 2I85A 1QUPA 4TLSA 1J1XL 1XZ0B 1RP9A 4BDVA 3QC5X 5C0FA 2XY1A 2G0LA 2W59A 2VMCA 1E4JA 3P9LB 5FO2A 3ENEA 4KKAD 4IS6A 5B39A 2APTA 5K9JL 2HTLC 1FFPB 4JRFA 4UCFA 3M6DA 1KB3A 4PVNA 4RGMC 2NTFA 4A7GF 3VD9A 1J8HE 3I3BA 3CXHJ 2V2TA 3BAKA 1QPXA 1HL4A 1ZAGA 1HJCA 4TVPL 4MA8H 2X4OA 1CDIA 2ZJSL 1FZMB 2KMWA 3OJVC 3OKNB 4XXDB 1DJSA 1EWHA 3L4UA 4PUBL 2X6CA 1SUHA 2QHLA 5A1AA 1I7TA 5F7WC 1YEKH 1KTDA 3DO4A 3G5WA 4DK6A 5J3HC 4NNPH 3EDFA 2WMPA 1JGUL 2Q9OA 2JK5B 4LP8A 2BY2A 3S35H 4JM2B 3UP1A 1PZAA 5IUCA 4FQCL 1LTXA 2E4FA 4M5ZH 4XMPL 3QDGE 3QFJD 5I6LA 1N6QL 2MQ3A 2N01B 2ZCLH 3O9WA 3TO4A 3TASA 4WDIB 3D0AA 1J18A 4WO0A 3ZZ1A 4NEHB 9CGTA 4WNQB 2W0LA 3I50L 1JI2A 4HK0A 5I0VA 1BMZA 1UVQA 3P3RA 4L3FA 3TA3C 2A77H 3DKHA 3T0VA 2D9QB 5KZCD 4KX9A 5HJ3A 1LO4L 2AQ1A 3QXAA 2ZP0T 3KLHC 3SYCA 1NBCA 2EVIA 3PUCA 3LEYH 3SDCC 1NSNL 4F9PC 2OM5A 2WLKA 4XC3H 4AKQA 4DEWA 3UJJL 2GSMB 3VMOA 3MGTA 5LB1A 1FFQA 2X7LB 2NYKA 2A73A 2VE6B 1LLAA 1OTSD 4GMSL 4A6YA 5J1SC 2GYSA 4A66A 3QWQB 4MNQD 1LE5B 1X5KA 2Q7NA 5ITBL 5BUGA 4KUCF 4O4YL 3QORD 4TQEH 4PJIF 4ZS6C 2GTZA 5H8DA 4QWWD 5EHFA 3U30B 3ZE2E 1UM4H 4YHIB 1PTZA 2Q2EB 2WC7A 1XD1A 3HG1D 5KYWB 2K8QA 1BQHG 3RVWD 4U2YA 5IHWA 3HTLX 4UT6H 1QWHA 3V4VH 2JCCF 2DM4A 4G8IB 2WNXA 3Q8FA 3QDMA 4OSUH 4ZTOL 4PWJA 4GAFB 2VABA 5HSFA 3BISA 3VXQA 3BFOA 4J28A 4ZS7H 1J0IA 3QO1A 3NSJA 3L7EA 4ZTPL 4PGEB 5FCSH 1EEUA 1EO7A 2ED6A 3B1TA 3NZ8B 4AEIH 4BH8A 1E5CA 4Z3IA 2KDYA 4AVIA 4TPRL 3DX3A 1C1EH 3LH8A 5EN3A 1JUFB 2PWFA 4X7CC 1UD6A 4PW9A 1QBML 4GXVL 1ZS8B 3WU1A 3U4KA 5HYIA 3Q5YA 2OMXB 3SBQA 4R5VA 2NY6C 4GW4A 1QWUA 5DHYA 2EE0A 3CLWA 1MELA 4YE4H 3BZFB 3SGKC 3KDMA 2XJLA 1EHXA 2VLJE 1CD1A 1KIRA 1P53A 1YYLH 2CJUH 1XF4A 2V3DA 2OQJB 2V9TA 2VDPL 1RIHH 3TO4C 2EDKA 4AQEB 4XPHH 2IDCA 3U46A 3PHSA 3PWVA 2GBTA 5F7MC 2NDGA 3FT3A 5HDBF 2PCXA 2EADA 5F0LB 3VSVA 2APXA 5KSUB 2X3AA 1I8LA 4LLWB 3T6XA 4ALAL 1BJMA 5I15L 2X6UA 1DBAH 2Y07L 1YPZB 1N3NB 1JPTH 3H0TA 3AS0A 3CDZB 4FA8A 1AO7E 1AOZA 5AYUL 5CJ8A 4GG6A 2Z4QB 1KIUB 4KZ0A 2X0WA 5TQ0H 2QKSA 3HZVA 1L9SA 2AEIT 3TXAA 2CALA 4X0NA 5SV4A 3ULSA 1IGFH 4P2RD 1J10A 2FATL 5HHVL 4DGVH 1AKJD 4Y2DB 2AS5M 1ZA6A 4QRSA 3U2SA 4NO0B 1F6LL 1DBBL 3RIAK 3H9YA 3UTTD 3HFMH 1A6UH 3VCLA 3B2MA 1J05B 3D0VB 5FCUH 3SQRA 1GZQA 1S9XA 4U4BA 4UAOB 3CXDH 1URLA 5DC9B 1BAFL 3RGVD 3P2DA 3MJ7A 3Q8EA 3V4PH 1PFOA 5E56A 2ED9A 3MYJA 3C5SB 4KUZL 4LGRB 4B27A 1NC2B 4ZSOB 1TJGH 1N4XL 3QIBB 3LMJL 2J6WA 2O5ZL 5KVEE 3VYNA 3FRUB 1H8SA 3VJ6A 4ZPTB 3GM0A 3ZIYA 4K7FB 5JLZA 1F4WL 4H1LA 5BPPA 3MFFB 1BQLH 1JGDA 4PS7A 3AW5A 3OBAA 2GIYA 4XWGL 2KZ1B 5DUML 4MCYB 5DWPA 3FOLA 1Z9OA 1J88A 5ICZA 5KYXB 2WB7A 1AR1B 4KPHH 1F0LA 2QDVA 1R34A 3DX9B 5LHDA 2AEPL 1K3ZA 3AREB 3NIFB 4EN3A 5LVEA 5FB8A 3ABGA 3GBLA 1X9RA 1JN6B 3ZDWA 5T1DL 5ITFB 3C5SA 1FIGL 3UJJH 4JRYE 2FDBP 2ADJB 4IU2A 5FW7A 4MCZB 5D71L 8FABA 1AXSB 1SN0A 1MCOL 3AVEA 2RA1A 4NO5A 3AUWB 5I1IL 2C3XA 1YRKA 2EC9U 2VB5A 5FCUL 3UEQA 5I71B 4D0BA 5J89A 5B38A 4L9LB 2DQFA 4TL5A 4YSQA 2Q3AA 5HYQA 5B4MC 1WGOA 5AVZB 2WYZA 2B15A 1F3RB 4J27A 3UPCA 3EF4A 5ADOL 3CC5A 4FN0A 1U8OA 5I6PA 4P07A 5IUSA 1GGIL 3SDXA 4WJG3 4ADIA 2CLVA 4OIIH 1P6WA 1THCA 1C16B 3P30L 4PLOB 5HJDA 5KYNA 1RUPH 1UM5H 2WNWA 4ICWA 4XZUB 2EC8A 2K9UA 3C5ZD 4HUVB 4H8WL 1ITBB 2VMFA 1JTPA 5HHPB 5GGRA 3C09B 1RZFH 4OFPA 2B59B 3V9CA 2CCVA 1EFXB 4K94C 1NDTA 5FYKL 2YJQA 3HR5B 3V5DA 2CIIA 4OLWH 4QRTB 4M8UA 4YFDB 5LDUA 5LDSA 2AJYL 4LLDB 5LUMA 2WNGA 4L48A 4TVSa 4FADA 4Y9FA 2XTSA 4MMXA 4YR6B 1NGZB 1YJDL 3CFJB 1H5BB 4XXWC 3WFHA 4ELME 2JV6A 1P5UC 5DCCA 3ZE1F 5IROD 1MFEH 1KPRA 1E9OA 1MIML 5E5MA 5DXWA 4ACTA 2GJZB 4GBXC 5HVHB 4N68A 1CPUA 3E80A 3QG6A 3FNKA 5G2NA 1TITA 4JFPA 3NOIA 3H9ZA 4I2XA 1CURA 3LQAC 3DGGB 4NPJA 2R1XB 2YAOA 4ZQKB 2BC4B 3IDGB 3KXFD 3G6JF 3UZEA 1A6AB 4YK4C 3WD5L 3O4LE 1W72H 3X1EA 4AL8C 2YR3A 5CIPB 1I3VA 4I9WE 3LPOA 5JO5B 1X6NA 3U0TB 4QHLB 5MEPA 1RERA 2YQGA 3CXFA 1NGQL 4PRDB 3EBGA 5CILH 4XNAA 3D52A 4O9HH 4YDIH 5ESVB 5DS8B 5LLIC 1BFVH 3KPSB 1C7SA 4NZTL 1KCBA 1NDGA 4M7KH 3RIFF 3LS5L 1HHHA 4OY9A 2FGWH 4JFPB 1E4XL 3EOAB 4BD4A 5ETUA 1Y1DA 5FLVA 4LP5A 3VFOA 3W0WB 4X50A 5KSAC 4N9GA 4X8XA 5KW9L 4PJ5A 2XN9E 3DSFL 1SXSA 1LO3L 3KGRA 2EDHA 1S9WA 4M7JL 5FGBC 2E86A 5FYLD 1I1RA 2E7MA 2HTKD 3ELQA 5EU5A 4ALAH 3QFDB 3QXVA 1AXIB 3IWUA 4EIZC 4WFGD 2A9ML 3X3FL 1EHKB 1GAFH 1R5WA 5E4AA 1KCSH 1A4JB 4P9ML 1CD9B 4H0GA 3SDDD 3WY3A 4KFMA 1TG8A 4OGYL 3D48R 1HSAB 1SLVA 4HS3A 1I1YB 1D5BB 2CDFA 1BZ9B 2BS9A 1KT2A 2RR3A 4NPKA 4UINH 1PAMA 1EJOH 1XF5A 4R7DB 4W9CC 5IBUB 2W9EH 1MCLA 1WZMA 1TJIL 2WY3B 5HI4C 1I9IH 4PJ6A 4ZFFA 3GB7B 3MV8D 5J13B 3WJLA 1GVIA 5AOKA 3EKCA 5IIEA 1RZGA 2R59A 3VA6A 2ZWLT 3FCUB 3VQ2C 2C4XA 1FFNA 4X9HA 2UXFA 3BZ4A 2A6IA 3FFDA 5HHNA 4PP1D 2AV7B 4JO1H 2O26U 1T83A 5I16A 3QSKB 4H1LH 5D4HA 5ID0B 2CE6A 3L7FB 2QBWA 3QDME 4AM0B 4D7BA 3U6RA 3UCRA 5AENA 1DFBH 1PDKA 3ABKB 4XMVA 1E7VA 1LD9A 3VWJA 3CZFB 4X6DB 3MLYH 4BELD 1G0YR 4HZAA 3AM8A 4Z7UB 4FQLH 4H8WC 3MX0A 5FKPB 4Y9EA 5GQBA 5HHMD 1MFCL 4MJIA 2GVYA 1UWEH 2UWEB 5JNYA 4JGNA 4HK3J 4UQ2A 4ZFOB 2GBUA 1GOHA 5A3IC 4HS3B 3ARWA 4JGJA 4NP4L 4UT6A 3NEXA 4HC1A 5T1MB 5ANMA 1BLIA 2JH2A 1FLRH 4NKDA 2J5LB 4DCQB 4HWZA 1UH2A 3ZUCA 4G9DA 5CN1A 3WFCL 2JIXA 1ESOA 5EU5B 1QRNA 3WXVH 4KZCA 1IAOA 3EOYG 3HLKA 3PRZA 1MCHA 2QR0A 4NQTA 1BQKA 1KYOJ 4P4RB 5F7KC 3FN9A 3C5XA 4N1HB 4LPWA 5I1LB 4PGBB 5FECB 2UZYA 3TT1H 3FCTA 5F7DA 3ZDXB 2AXFB 1T22A 5DS8A 1CWVA 2QFPA 4LVOB 2CR3A 5JXEA 3L81A 3ZPDA 2QEJA 1ACCA 1JVOA 1Q0YH 3ZIMA 3V4UL 2VDQB 2O1AA 4R7NA 2WQ8A 1EJ8A 1MZZA 3CU7A 2QQKH 4M1CD 3LKSB 2K4AA 1DSFL 5D2LF 2GJPA 3SPHA 4U1HA 3WLWD 4PJ9A 4ZQKA 2XQ0A 1RQ5A 1UXWA 5DS1A 4KO6A 4M1GH 4K3EH 5IROA 5SWSE 2R0ZL 1BVLB 3IMSA 4X7EC 3VMPA 2AK1H 3FBQA 5E8EB 3LPWA 1T2QH 2F53B 4KRMB 1QLRA 5ICZB 1HN1A 5GGSA 3SE4C 1LNUA 2XKUA 3FUNA 3P0YH 4PS8A 5IW6B 1E5UI 2WVVA 3F7LA 4XNXH 4U3XA 3WKPA 2D2CC 3PNRB 2X4NB 3L3DA 1JZEA 1ETB1 4K94L 4PY7B 2W88A 3VRJB 2WO3B 1AZVA 5FDWA 2QADC 4BZ2H 4K9EL 2YQBA 2QSTA 2YD0A 4Y0GA 4BH8B 2P80D 3P11L 4NJ9H 4GINA 3AWGA 4BUQA 3KH4A 1YQVL 3FUKA 4X4XB 1BFOA 1K8IA 3O8XA 5JORB 5AW4B 1OAYH 4XVTH 1GPOH 2Z31B 3RWIB 3IJSB 1QTSA 3DUSA 4I18A 4AVJA 1DVYA 3GXTA 3SPCA 2ODIA 3BPCA 4M8QB 5HD8D 5J6SA 3PWNA 2P7TB 4K7PY 1VGKA 1GKEA 1X5FA 3A4EA 2WLIB 4ZW7A 3VMNA 1KTCA 1KYAA 3BEWB 2AJVL 2YEVB 3JT2A 2X88A 3Q8BA 5K39B 2NNCA 4LSUL 1L0PA 2RIKA 3RDTB 2DD8H 1IX2A 1E3ZA 1G9NL 2G5RA 3PGDB 3BIKA 3EYQD 5CJQH 5IHUL 3B8YA 1OARL 3BXNB 1MSPA 3SDXE 5CHNA 2Z1KA 1ET8A 4V11A 1BVLA 1BMWA 2NTSP 2XXCB 2AJXH 2NYZA 1HNGA 4NJAH 4OLVH 1UXWB 1EJ6A 4O58H 3WY4A 1ET5A 3NP4A 2IAND 5AKRA 4HCRH 3P4NB 5C9KA 4YXLL 2DQJL 1ZT7A 1T5XA 2Z9TA 4JHWH 1INQB 5AW9B 4ERSH 1TIUA 4HIJA 3RY6C 3F62A 4OF5A 3HVDA 2AW2A 3QXDA 5E2WH 1KCRH 3GD1C 5E2UH 4DF9A 4HUXB 4UUJA 5D71H 3NDYE 4NO2A 1OGTA 3QEHB 2ZXWB 4H4NA 5DHVA 5E00A 2XG4A 4LBAA 4NQCE 4RBPK 1VACB 3HVNA 4HAFA 4MD4B 2FD6H 4DFHA 1HL8A 1BEYL 4TOYL 4BH7B 2L04A 3HE7C 4ETQB 4L4TA 5D7JC 3ZYOA 1DJYA 3WYRA 3SQOH 1IAOB 4XWGH 2GJ6B 1UD4A 4N9OB 4YBQD 1HHJB 4ZAKC 2NNFA 4U1MB 1H3GA 1MEXL 2J43A 4G6FD 4YC2B 4HFUH 4QOKA 3TEXA 4GQPH 4NNYB 3SZ6A 1MWAL 1WIUA 3IJ7A 5DJ2B 1KBGH 4O2CB 1TDQA 2Y2TA 1FLTX 3HNTH 3G3LA 2YRPA 4UZSA 3UABA 2FJSA 4BXVA 2AP2A 4LSSL 3K71B 1ZWIB 2VDQL 1A7QH 1I1AD 4Y5XA 3MJGX 2RB8A 1VFUA 2AF2A 2JJUA 5CZRA 4HPOL 4CL7A 3FF8A 5D4JA 2EDNA 5EN2B 4P5RA 4Q9CA 4IMLB 1QBMH 5AAMA 3VNYA 1U8MA 2GY7B 3FRUA 2VDRL 3D4YA 5FO9B 4HGWA 5AAWA 3II2A 1F1DA 5BV7C 1KTJA 2Z34A 2CKBB 1HILB 1JZ5A 5K9KA 2KLTA 3HUJF 1ONQB 3AT0A 1RUAH 2HVJA 5EO1A 4LSQH 3AUVA 4M43H 4X7SH 3SDCD 5CUSL 3VWKC 3C9NA 2FSEA 1NCBL 3L7FA 5AKTA 4JPSA 4EEEA 2H1XA 2Q76A 4MB3A 1V8HA 2N0MA 4MNHA 1MRCL 1OF2A 3UZQA 4DQOH 5CD5C 3TIDB 4MJIE 3MN8A 3LRKA 1LQBC 4LP4A 3QORC 2VDNH 4D9QE 1N5YL 3OKYA 1WZ1H 3ZE1E 1C12A 3NEEA 3QUMA 4JFEA 3DO7B 3PIQB 1H3WM 4UQEA 4JO4L 4ZTEA 4KNTA 4LLQB 1LDPH 2E6QA 1NOFA 1IAIL 1OZUA 3BOVA 4ODVL 2E6JA 1SXAA 4W93A 5H4YA 1RHHB 1S8DA 3JV4B 3KPMB 4BRVA 4FI6A 1J0KA 1MWAB 1V3KA 4XMLH 1HAUA 4TUOB 5AOLA 4PGEA 3QZWA 3DECA 4RDBA 4CVXB 1MCSA 2XTJD 4BFGA 2YJLA 1F3JA 3QWRA 4B9FA 4EF3A 2V5TA 3GPEA 4MQ7B 1E28B 3VXTA 4HDIA 4N87A 4W6WB 1YAZA 1YNTA 4G7YL 3ARFC 3RTQB 2Q8AH 1LO4H 3D09A 1M1XB 1KDIA 3BUTA 4ZMWA 2IGTA 2W8CA 4NFCA 1YEIL 3MJ6A 3SO3C 2IPKB 5D7KD 5KYWA 4DN3L 1E42A 4FZ8H 1BX2A 4GRWE 5EOTA 2C4FT 1MQKH 3NQIA 2PTTA 3KL3A 3HRZB 3T4YB 1BZDA 4I0PD 1YQVH 3GHBH 1HAWA 3C5JB 4YZWA 2O5XL 4HSQA 2R1WA 3C9NB 1A0QL 3GO1L 1J5IA 3LX9A 2XSKA 4NUGH 4R2GC 5EULV 3CVHH 2W60A 4NUMA 1DR9A 1ETA1 3ARGB 4YHMH 4PCTA 4MQXC 3VX0A 3EFFB 5I8EA 4HLEA 1JZDC 4PY8J 2OK0L 4OI8A 5DFVC 2X10A 4BEIA 5GJTL 1MLCB 1QFWM 4QXWA 2QSCL 3K6FA 4TUKL 3AQDA 3FO1A 4N2NA 5TE7H 5D4QA 3CTTA 1SEQL 2NDFA 4X7FC 4P4KC 3RQ3A 1W9XA 5GS2H 4POZC 1DN0B 4NAJA 2YXFA 4U1NA 3ULUH 1U8QA 3VB8A 3ULAB 2F61A 3NJJA 1ZEAL 2NY0D 1S7WA 4NKOB 4AQZA 4G7QB 5I9QB 1ORSA 4AYFA 3R7QA 5KTEL 4GEJA 4OZFB 5EOCJ 4D9LH 2E7DA 4AQ1A 4YN3A 5E99L 2OI9B 3FSWA 3GSRA 2GY5A 2NY5L 4PHXA 3HBQA 2WKLA 4PJXB 1U8PA 4J3WA 4ODSH 3GYRA 2NUTA 2CK2A 4YDLC 1SLWA 3GZPA 4ECNA 1KCLA 4FERA 3L6FB 3KEDA 2QZ5A 3MRQB 3IDUA 4KRNA 3RI5F 4QHMA 2QLYA 5AB9A 2B8OT 2FX7H 4GI8A 1XD0A 5IVXA 1JPST 2ZZUT 5TH2A 2AEQH 2X6AA 5E8PA 2Z8RA 3CG8A 1HXKA 3VXUD 1UM6H 3CLFL 2OTUB 3KPOA 3RZWA 4N2GA 2YD1A 4NN5C 2V5SA 4J2QA 1FCCA 2TSAA 4G59C 2KI6A 3EHBD 5SWSA 2Y07H 1JNHA 4HKZB 2ZSWA 1MCPL 5LCVH 1FNEA 3J07A 1SXBA 3OAZH 4EI0A 1VERA 3W2DH 2W60B 4UOW0 4XVJL 1D9KC 2X40A 3PHOA 4PRPA 3DRTB 4F20A 4ETYA 3S98A 3FN3A 5D2LB 3RVVC 1HEHC 4OZHE 3ABLB 3DK2A 3BN9D 1DFXA 3OKNA 4ZBJA 4GUQA 2M2DA 3MCKA 2G3ZA 2GT9B 3B56A 2VR8A 3GXIA 4PWGA 4A6YH 1IBYA 1L9OA 2XTLA 3GBNL 3NK4A 1G7PA 1AMXA 4FFVD 4PYHA 3ECVA 1YEJH 4LOEA 1G9ML 3BAEL 5GS1B 5MEND 4NAQA 3QJQB 3EYOA 1ANUA 4YEEA 4J3OC 1MY7A 2VDOL 4TSCL 4JFVA 4XGZA 2OA9A 1NLBL 3L5HA 2Y1VA 1TJGL 1NL0H 4P2QA 2WAQA 5A2CA 4KY2A 2BIPA 1MHCA 3RWEB 2PYFB 3QAZB 3CFCL 3B5GA 3QIBD 1IM3D 1EUTA 1HT6A 5C0IA 3U36A 1ZMYA 3STBA 1XSIA 5C0JB 4APQC 3VD0A 3FCSA 3HNSL 4O00A 3MGAA 2W1NA 1NPNA 2KT6A 4PS4H 4AYBA 4RX4D 5IQNA 5BNXD 5J8OA 3FYIB 4LCWA 3TBSB 4JRWA 1VKXA 3EJYD 4CGUB 1ZKAA 5MEQA 1KFAH 2FX9L 4NT6A 4U7MA 5IJBC 1NCJA 1T04A 1GIGH 4NN7B 4AEEA 1FPTL 4KKZA 1S7QA 1FYTE 3EJCA 2C3VB 1KG0A 1P7KA 1B9KA 2KL6A 2J1KA 2CCLA 4FFVC 4KVNL 2ETWA 1MY5A 1JPTL 5K1NA 1EXHA 4O2EA 5FM5M 4P99A 4PJAE 4G3YH 3HC2A 1NDMA 1ZGLP 1EEYA 3H9HA 1T22B 2M83A 3FSAA 3UX9B 4F37F 3RVVD 1DBML 4XWOD 3W11D 1I9EA 4UV4H 1GGCH 3O3AB 4UM9D 4MBRA 4I1NB 1LO2L 2LU3A 2AC0A 3GHEH 3O4OC 4QD2E 4BKTC 1RIHL 3RFRA 1P1ZB 1QRND 3MRLA 4JRXA 2ZKHL 4JKWA 1NFAA 5L88L 2XWBB 4ZMLA 4PJ9C 4QCIB 2HVJB 1RZ7H 1HWGB 1KXTA 2FNBA 2XY2A 3HZKB 1FHGA 1UENA 4YUEH 2GIMA 3NCMA 2WBJB 1KSRA 1D6EA 5KSAD 4F3FA 5MERB 3U0PB 4FCHA 2ZOLA 4J23A 3CUPB 1MWOA 12E8L 5IB4B 4AUYA 1QFUH 2GC7C 3LNDA 1BZ7A 4GEIA 5JQHC 1R0AL 1QSEE 3Q2LA 2N3JA 3GJFH 4F57H 4HWBH 2J8UB 4ONOA 5TDNB 4WF7A 1ZHLA 2YPLE 3PDDA 5C0JA 1K8DA 4JZOA 1PSKL 3ZRFC 1DBKL 4XAKD 4C4BA 4UM9B 1AGCA 4HLZG 2RCSH 1TZIB 2DY2A 3EO0A 3BP6B 3HUJA 1ZT4A 3MOBL 3OKEB 3HC0A 4MLIA 5J57B 5DHYB 3WFBH 2AEOA 4KTDL 4L8CA 2OMBA 2RQ8A 4NC2B 1G84A 1XH3B 5L2KA 2ZWZA 4FQLL 4OFYD 5C0ND 3LRSA 4CJ0A 4HS8L 4EUPA 1NGXB 4XP4L 4XO5A 2VO8A 4U6HB 4MTMA 2WBJD 4EPSA 3ZE1B 3LKQB 3MRDB 4QWWC 4ZNEA 5IJDC 1ORQB 3QUYB 2WTRA 4XAKE 3BUPA 4RGOH 2R2HB 3WFDL 4UTBL 2EXSA 2TRYA 1MI5D 4UYQA 5A16A 1MF2L 3EJSA 3FUIA 4QT5B 5FWQA 2J1WA 2IWGA 5IY5B 4JKPL 2HH0H 1IBHA 2YRBA 1KGJA 4AI7A 1FVCA 1G6RL 4IBTA 4NCDA 1F56A 2F8IA 3S5LA 1TTBA 3HBGA 4LEBA 4NKMB 4CC0A 1ODUA 1HTYA 5D2NB 1VESA 2YN3A 3MACH 3WS3B 1T3FB 2BOBB 3MXVL 5EZLB 3QWOB 5GRUH 4M7KL 5IB4A 4FNRA 1Y18B 1A4JA 3EFOB 3W9EB 1I4FA 3MRGB 5D5ME 3V4VA 4X42A 4FF9A 4G72B 4OU3A 3BPOC 4R8WL 4X98B 1N8OE 1O7VA 1PZBA 4AGMA 4EMZA 3LKPB 1K5WA 3QWNA 1Q0XH 4LCUB 2XN2A 3CZUB 5FDYA 3WUWA 5CSBA 2GABA 3GSWA 3VXUE 3Q01A 3U6XA 2XWDA 4H2AA 2D73A 2BOLA 3DIDA 5FO8B 1B4JH 1EUUA 1WGVA 4PJDB 5L4IA 1OGAA 5IW1A 2VDKL 1A9BA 3ARXA 1JGIA 1YUKB 3WE6A 5JR1H 4RRPM 3F8UB 3QQDB 3SJVB 2XHNA 2X2IA 3CVHB 3G5YB 3WE1A 2F5AL 4FHJA 1NCWH 4NKOA 4E9SA 4NM8H 2R0ZH 3F6LA 3OAYK 4S0TD 1CFQA 3W38A 1ZA3A 2FJGB 5IMMB 4NRYB 1MCJA 1YEEL 5E6ID 2LAAA 2X4TB 4IBWA 2W38A 3ZQWA 3J2PA 4HFUL 3N55A 4HF5H 3EDKA 4JCWA 5IQ7H 4TLKA 5I1JL 5IVXE 2VC2H 1AC0A 2P9RA 2WXRA 2APFA 5DK0B 3P1VA 4IJ3C 4RGNB 1JXGA 2I69A 5C0CB 4BFRA 4YC2C 2XACC 5FYLE 3L8QA 1QHQA 2FT6A 4JVPA 4EN3D 1ZVSB 3HMXA 4JKNA 1M6UA 5F70A 4FTVE 4DKEL 4QEGA 4F9LC 4OBRA 3UTOA 4XXDA 1C5CH 4OCRH 4A68A 3SE6A 2AZUA 1XR9B 2E76C 3BWAA 1NAMB 4FRWA 1J1PL 3DVIA 4XNUL 1ZOXA 1GXEA 2XWJA 1ND0B 4M03A 1LMIA 3O6LL 2X1OA 1A9EB 3S0PA 4S1DC 1EFXD 3NSFA 3DUUA 1FZOB 2EXTA 2MCG1 3VFGL 3HHMA 5I76A 4KO9A 4UTAL 3T0EA 5JDJA 2F68X 1FV1A 4KKLD 2N4IA 2DJSA 3CAFA 1ZVNA 2H9GB 4JUSA 1TU2B 4M5SA 4N2FA 1MFCH 3CVHA 3G5YA 3B7YA 5HYSG 1V3MA 5J11B 2VKWA 3LV3B 3PV6A 3QR1A 5F0JB 4XC1L 4DGIH 2ZOWA 4W1TA 1USQA 5LGJB 3FU6A 1YC8A 1FFOB 2V5MA 4PP2B 5TF1H 1MWAA 3VXUB 3EF7A 1IQWH 3NIFF 5EO0A 3F58H 5IKCB 3IU3B 4HLZH 1N59A 1T7YA 1M71A 4NLHA 3S36L 3WNOA 4APXA 1JZJA 4C57C 1HS6A 3GSVA 1KJVB 3H8NA 4MNGA 2ERJC 5EBWB 5B7EA 1JYXA 2X4NA 4U3HA 3K2MC 3KNBB 4OAWA 1MHEA 1MJ8H 3S8WA 5GGUB 4HWZB 3APMA 4F7EB 2B5IC 4DP4X 4AJYV 1BJ1J 2GHWB 3FSOA 4HUCA 5CJOL 3CHOA 2W65B 3UMTA 3T1FA 5B38B 3SDDB 1WK0A 2EVFA 3DX0A 1NCGA 4LOFA 3VVVA 3NIGB 4XVJH 5AVWB 3GI8L 2Z31C 3ZE0F 1KEGH 1T5WB 4XAWL 4JVUA 5KYYB 4CGTA 4XNMB 2PYEA 3AT8A 2X6BA 3DURA 4XPBH 1S7WB 1TEYA 2FLRT 2XFGB 5ES4B 2BVQA 1SOSA 5HI5C 4GXVH 3TVMB 3O41A 5EEZA 1G7MB 2DS4A 2NY5H 3BKJL 3DX9A 1CK0L 3MUHL 4L3ED 4Y5VC 1LD9B 2K3HA 3VWJB 1I1AB 3O2VL 5IB3B 5CZXD 1HOCB 1R3IL 4PRHB 1D7FA 1CXKA 3QA3B 4WJKB 5DQDH 2YAQA 4O02B 5DMKA 4A39A 5DO2D 3LZRA 3NQKA 4IRJD 2FQEA 3LDBB 1JRHL 3TYFB 3K6SB 2Z7UA 1VJSA 1AZRA 2H0FA 1D5MA 1X7SA 2OTPA 5D7LB 3GRBA 4BBWA 5ENWB 2BCMA 2YUXA 1IRAY 3EIFA 2DMGA 3KE0A 4DZBB 4U0RB 4Z3HA 4NNYA 4Y16D 2WZPA 3ZKXB 5M94B 1YPZE 4FI8A 5IQ9A 2LTQB 2O5ZH 1HEZA 2X70A 2VJ0A 2CO7A 2X4SA 3P3UA 4KPHL 4Z7OF 4JG9A 1FE8L 1U4EA 4JO5A 1KGIA 1AGCB 2P3YA 4A67A 2FEEL 4CNIB 1QBLL 3QC6X 3S34L 1BD2E 3PQYD 2VWEE 3U82B 4X7DC 2YD9A 3EH3B 5JHDD 1FYTA 2WKOA 3H3PL 1PLGH 1ZLVK 3GK8L 3X3GL 3QUKB 2G60L 4FZEL 2CRMA 5I0ZA 4L37A 3E8UL 2NY0B 3H0TB 3D69B 4X9GA 2VDNL 2B14A 5DSCB 5FYJH 2F54B 3SKNB 2E7CA 4TPRH 5EO0B 5HVGB 4I8DA 4Z7NB 3C87A 4K3GA 1GSKA 3N44F 2EDJA 2PABA 3VG9C 4A7QA 2YMXL 4W6YB 4Z7QB 1ZT7B 1Q1JL 4JRXD 2EIBA 5GRXG 3PXLA 1CGVA 4OUOA 5SX5K 5HYJE 2Y6SD 2C7UA 3MXWL 4X7SL 5JW4N 4XB8A 1J05A 1I3RA 3L16A 2ZF9A 1YMHB 1GGBH 2LHAA 4FKKA 4LCCA 1FHNA 4P5TB 1S7VB 4ZTOH 3I2CH 1A7PL 2QVIA 1UWFA 3MOAH 4PD4J 1HZLA 1DVXA 1C12B 2HLEB 3DVGA 4M4RA 5F7LB 4G82A 2V17L 4ZUTA 3PDOB 4LZKA 3TZVA 3MRMA 4KZDL 3OMIB 5GXBB 4XRCB 1OTTC 5J4MA 3ESOA 4S2SB 2M26A 2IAMA 4RISH 1WZLA 3FMGH 4OLWL 2WXGA 2DJMA 3BPNC 4NQEB 4YWGL 4BK5C 1SUJA 5CIPA 4U3CA 1XEDA 4GAYB 4LF3A 5INCB 1PEZA 1RZJC 3T2LA 1FVEB 3ZHKA 1IGIL 4XMLL 1BZ9A 4LARH 1JNNL 3QDMD 2CJUL 1B6DA 3EO1A 5H94B 1B0WA 1THAA 2DYPD 3QDJD 3O3BB 2WLLB 3DARA 2JJSC 3WIHL 4YS4A 5L6YH 3DPDA 1JYVA 2P28B 4MRCA 2EYTB 1DHKA 1RPQA 3SGDH 5CGYD 1U3HD 1NOLA 2A1WL 2OMXA 5DC0A 2AITA 4LLYA 4C4KO 3UG3A 2IG2H 4HC1L 2D7QA 3UBXG 4JFDE 5CZVH 3JYCA 2YSSA 3PWJA 3MV11 1W72L 1RH8A 3WEXB 1XAUA 4LHUG 4JQXC 1QATA 1F86A 2ZOUA 5FYKD 5EU4B 5L4FA 3F7YA 4G3YL 1Q72H 3PGFL 3ROLB 5EZPA 5EBLA 4FULA 4KDTC 4NJ9L 1WPCA 1OARH 2CBPA 4A2DA 3D4CA 4IIQA 3ISWA 1FPTH 2R4RL 3GSRB 5DMIH 5F93C 1NC2D 4FTVA 3B83A 4JZNB 3FL7A 1GC1H 1JK8B 1LK3H 4WHYH 2DLGA 2G0KA 2XTJC 1YYCA 3ZE0B 4EUPH 1KELH 2XN1A 1HCZA 4XZUA 3TZVD 3R0NA 1WAPA 4KK5C 1WBZB 4PJEF 1CGXA 4PRIB 2VLKB 1VEMA 2JB6A 2DQDL 1XSJA 3O6FA 1QYGL 3RVTD 4OF6A 5E00B 1MJUH 2C7FA 3BI9X 3STZA 4G1MA 4AM0Q 3CFDA 3BAJA 1F45A 3ASOB 3LCYA 3WOVA 1N6VA 5ADPL 1XCXA 1B2WL 4XNYH 3L3KB 1YG9A 1BOGB 3L2LA 2X1QA 5CMAA 3V5KA 1E9OB 3M17B 1L3NA 1L7TL 3AABA 3IU4L 3QCVH 3WFHB 5FM8A 4OZFA 2XQYK 1NGPL 3CQQA 3K0YA 1BM3H 2CIKB 3F83A 1T1WA 3VQMA 1TO5A 3HN5A 3SE9H 2CKNA 5DQJB 1W8OA 1AQDA 2DEYX 3CFDB 3VUAA 1OIOA 2NY5C 3OJ2C 3Q44A 1YEHH 2J6EH 3V0AC 5IBLD 1UB5A 5BVPH 1QSFE 5I18H 2J6EL 5LWYH 2I25N 2QV4A 4QRRE 1XH3A 1BF2A 2CLZB 2Y7QB 4WHTB 3E6HB 4KKNA 3U83A 1UZ6F 3A0OA 2N59A 1XZ0A 4UT7H 1AY1H 1S7SA 3QDGD 3QFJE 1SOQA 1QBBA 3FULA 1BG1A 4L29A 3S35L 2YAEA 3E38A 5AUMA 4DUVA 1E28A 3VXTB 3F7QA 5KVMC 3GUTA 1F6AB 3VRLF 2XETA 2ZYHA 2P24A 2PKDA 3D0LB 5FO7B 1KGXA 2E8ZA 4TNEA 4IRJA 5IT2H 3P40A 4JN1H 4JZJA 2GK0A 1V5JA 1XQ4A 2B9BA 2JELH 2P1YA 2ZUUA 2DDQH 3GMOB 4UU9A 1G4MA 1TF4A 1MI5B 1X5ZA 4C56B 5AVYB 3EH4B 1BZ8A 2NYYC 5SX5H 4EI6A 2ZYIA 4ZX5A 3NRQA 4FXLA 1BIIB 4X4ZA 4KK9D 5AD0B 1VA9A 3L3IB 4IBVA 1JHTA 1OGPA 3QRLA 2GHZA 2RTTA 5KTEH 4ISVB 4KZDH 1OP5H 4K8RH 4GAGH 1N5YH 3SJVD 4OUUA 1M7DA 3UTTE 5AW1B 3BT2L 2WQRA 2CJ3A 4M9OA 1YMHA 2PMZA 2QKIB 3HAEH 1FI8C 2EQDA 2IPUG 3PG2A 5DJCB 3CZJA 3NSCA 4JQXA 4R7DA 5A2KH 3BP4A 3BUYA 4V2BA 5I75B 4MQ7A 3CH1A 1B4JL 3DWTA 3PWLB 4RCAA 2KERA 3EUDA 3MRHA 4PJFA 2W0FB 4WW2B 3LKSA 3MGOA 1FRGL 1FC1A 3OMZA 4LSQL 4M43L 5FGSA 3FUEA 4MNGE 3APDA 5DI8B 4OSUL 1PZ3A 4HGWB 5FYLH 1A5FL 2BIMA 3QUZD 3FQUB 1CD1B 4NT6B 4HT1L 5IJKA 3G04B 3QZBA 2VR6A 1IO4C 2BY3A 4X83A 3H2PA 4EQ2A 1U58B 4M5TA 3RKDC 2J2ZB 4FFWC 4ZNCD 1TNMA 2P5EA 2E27L 2EAEA 4AGOA 1HCVA 1YMMD 5F71A 4MNHB 2WO4A 4EO5A 2PYFA 3SGEH 5EV7A 3VGAC 1IGIH 1TVHA 4FQIH 4IRJB 4PRAA 2DWEA 2DLFL 3UADA 3DDGA 2UYLA 4EKJA 2APSA 3MLSH 3S4SG 1TTRA 2GAZA 4CU7A 4P3CL 3ARUA 1KJ2B 5ENWA 1GMIA 5LN4A 1BWMA 1WF5A 3ULUC 3UZEC 4HJSA 2Y1YA 1UYWH 4M1DH 2ITFA 2ZKYA 3ZTNL 2X5PA 1QD0A 4HHAA 5JNYB 1A2YA 1GS7A 2MNJB 4HP5A 1MI5E 4PG9B 4DTGH 1ZWIA 1LVEA 2HPOA 4DUWA 4BXSV 1A8ZA 3MV8A 4UAOC 3CZGA 1F4YH 2P52A 4ONHA 2DWXA 4OF3A 4KROB 1F6AA 4F8QA 1FCGA 2OMYB 4F24A 1NCCL 1T20A 2J1ZA 1S3RA 3QIUA 3WN5A 2BSRB 2YK1L 3I9GH 2JFCA 4LLUB 3CV5A 4Q58C 4ELMA 5BUAA 1DVZA 5LO7A 1OF0A 1C1EL 2VRQA 1ERNA 2VN3A 4ZMZA 2BLFA 5EF2A 1F8TL 1HE7A 9PCYA 2D3JA 4DH2A 4RWHA 1W15A 5C07B 2NZ9D 2J12B 2PXYD 2QHRL 4JJOA 3L3KA 4G6AC 4QHMB 5E1AA 3W39A 1D5IL 1SXNA 4FQIL 5D1QD 1KWGA 2FSDA 1IM9D 3DTUB 5BOPA 3EO9H 2HFEB 3TJEH 2YMXH 4WWKC 3HBZA 2XWXA 2V3FA 2JJWA 4PJXA 3HG0A 2VUYA 5FA3B 5CKAA 5EEWA 1DE4A 2E9BA 5GGTH 1OP3K 1KJVA 5EBWA 3JVGC 2ZXGA 2ADFL 3HE6B 4E42A 4H88H 2DQHL 2UX7A 2P8MA 5LGKA 5HJBA 1QFHA 4MKMA 3IJHA 5CM1A 3RE0A 2G4GA 1FDLH 2F19L 5KYYA 4TKWA 2ESVA 3MBEA 1CICA 4CADB 3PDGA 4ELMF 3N91A 4OFIA 1XCQB 1XH1A 2ZT9C 2WAHA 4LLMB 2BH0A 1DVFD 2DDQL 1KB5H 2W91A 4PG9A 2ORBL 4Z0XB 3ATFA 2NY6D 1IGYA 2VLKA 4IOSA 2YA1A 5DWUH 1U2CA 2EIZA 4GFXA 1F8TH 4X99B 2I60L 1M2VB 1TTCA 5GIRB 2OCFD 4BSWA 1MCEA 2FNWA 4QHUA 3WIFB 4J3TA 1KGCD 8FABB 2AKRA 2CNZA 4JDEB 3ES6A 2P5ED 4ZO8A 2F53A 1E3XA 4PRAB 3CE1A 3SHSA 4L3EB 4AH2B 4Q0XL 4AJ0A 2L3BA 3LSOA 3BPCB 4M8QA 5GGQH 5T3ZD 3WEXA 1ZJAA 2EDTA 1K5NA 2XV3A 5LBSL 1N6QH 4OB5H 4GAYA 1PZDA 3FOLB 2Y06H 3FPYA 1ZDQA 5DK3A 5DURD 1RLBA 1TQSA 4HS6A 4OFYA 4JDTH 1I8AA 2R8SH 1EHAA 1MDTA 4WNJA 5E8OA 1DANU 2ITCA 3WCYA 4HDIB 4GIPD 2BSTA 3KPPB 3A6CL 2FK9A 3HS9A 4HSAC 4KMLB 4PS3A 3ZZSA 5I1DA 5LN8A 4ONGL 3SDCB 2ICWA 2IFFL 4L4VA 1CGUA 1O7DC 4ELKB 4DEPC 1MFUA 4X9YA 1I8IA 3QHZH 3TCLB 2ATKA 3MUZ1 3L08A 3B9VA 3PF2A 5AOZA 5GRYA 3UTZB 4WFFD 3CIQA 1X9QA 3CFJA 4NZUH 5DT1H 5JHLA 2NX5D 1BHGA 3MV9A 1BIHA 1RIVH 3VFNA 3M7FB 1X5HA 1T6BX 2A9AA 2IWFA 4KRPB 1INDL 3G5XB 3RHWF 3RU8H 1DQJA 2CHWA 2CU9A 4G9FD 3PABB 4X9BA 1S7VA 1QPPA 2GCYB 4WY7H 2VLJA 1JNJA 1WHOA 3CN0A 1TTAA 4PIRF 1EDYA 2FE0A 3SEPA 4L1TA 5KS9E 3EGSB 3DYMA 1AIFB 3FS9A 4IYKA 1G7HB 4BZ2L 3WE6B 1TYEB 3MLWH 7TAAA 1KLUB 3OAUH 1KXVC 3UO1H 2CDGB 2MFNA 4QDGA 5AVQB 1EZSA 5CP3A 3FT1A 4OLXL 1RIUH 1LE9A 2RJMA 2NSXA 2JIXD 2VH5L 4ALAC 5BUPA 2Z8VC 3CSTA 3IFOB 2V3EA 1A6PA 1OSYA 1NCAH 1G7JA 5IEHB 1DEEB 1PZ5A 3JWNG 5HD8C 2P5WD 5I66B 4CVWA 1ODAA 3APFA 4Y88A 1Z7JA 3GBDA 3CWGA 3CVIH 1CGWA 3Q6FA 3GKWL 4L05A 1YY9C 3RP1A 5DZ9A 1JZFA 3N5AA 5DQJA 3GBEA 5K1JA 4XPTL 4KKAC 4EUPB 4AKPA 3ARVA 1IQDB 3MNVB 4E5XG 4YHOL 4H88L 4JM4L 4BFIB 4ZFZA 1HEJC 1MQKL 1X5JA 5JIHA 4LVNC 3DYOA 3P02A 5DMGD 4HUUA 5H2BB 3M17A 5C0CE 3FQ2A 4EKXA 3GHBL 4ZW5A 4OZGA 4P2RA 4ODBD 2A74B 3QEGL 1CYGA 2OZ4A 3TS8A 3S6CA 1HU8A 3FZUD 3HZYB 4Y4FC 4Y8DC 4Z76A 3NDZE 1ECYA 4O02A 1MFNA 3H6AA 4BWUA 3SPIA 1HSAA 2ICEC 5LAXB 1D5ZA 2EECA 5I1HL 3VJ6B 1HINH 3MV7D 2LABA 5FFLA 2E7LC 5I1IH 5JW3H 1QI3A 1S7TA 3M1BA 3NCEB 4NKIH 4Y4KA 4R2GD 5C09B 1RZGB 1AZZC 1RUQH 2WTPA 4KJWC 2WWMD 2RD0A 3OAWA 3ARSA 2C9PA 2X9YA 4XCFL 4XNMA 3MLXL 3OXSB 2P47B 1LO3H 4G8AC 2DQTH 1A22B 2CDGA 3ALPA 2OSLB 3U0WH 1JFHA 1A1OA 4D0DA 1QEXA 2YA2A 4I89A 5KYUA 3OZ9L 4KJYA 4JY5H 4RFNB 1UUNA 4GW1A 3VI3A 1I1YA 4JL1A 4ZUVB 3V6FA 5GGUA 1SN5A 1AG0A 1R3KB 1SEBB 3FQ4A 2X2HA 1KBGL 5AAPA 4OCNC 1UWXK 3ZE2F 4KZEL 4FCAA 1I3GH 3Q43A 3ZZQA 1ZV5A 4EI5B 1N8ZB 2K6WA 3OGOE 5E9DD 2WGNB 3SDAC 4GKOA 3HAEA 4EJ1C 3UL4A 1MRCH 3PWNB 4UQBA 2JTDA 5I73B 4WIQA 5L2JA 4URKA 1P84K 3T0BA 4D8PA 1ADWA 4RMSA 1K5NB 3OHMB 2IGFL 1U30A 2AXGA 3I6SA 4BQ6A 3MRRB 4MA1B 1V27A 4K5LA 2JKIS 3Q6GH 1U8JB 4HJ0D 3ME0B 4NQSA 5DUPH 2YHGA 2YLKA 1YNKL 2N1TE 4TQEL 3VI4F 2BRRL 3WIAA 3NZHH 2X4UB 1TZ8A 1JL8A 4LAQL 2RQEA 3RX5A 1OPOA 2ZPKH 3L5XH 5E94A 4TNVK 3NIDB 1KN4L 1WD9A 3MV8E 4FMVA 5AAMC 4GKNA 2XRAL 4M6NH 1SFHA 4FJ6A 3BEVA 3MFGB 1VCAA 4FEIA 4YGVA 4OIFA 1FE8H 3KM2A 4NRYA 3S37L 1U8JA 5HYJD 1UQSA 3S37H 5IHZB 2FHBA 3ESNA 5JXEC 2F53E 3HS0C 2VLRD 2EE3A 1BMGA 1M7IB 3FQYA 1N10A 4JG5A 2B0SL 4JFHE 3LS5H 3ES6B 4G83A 5IWLC 2GJZA 1SJEA 2DM3A 4ATTA 2NY4B 4LESA 2C8NA 1CQKA 3GWJA 3ZLQC 1C5DB 1G7IA 1F4HA 1U95A 1WS8A 4B9JA 1SY6L 4HWBA 4Q14A 4ZUTB 4M93C 2DQCL 1G7PB 3KPSD 4NPYB 3GLAA 2A83A 1CBJA 4CJ1A 3ROOA 3UYRH 3LAFA 5JUEL 1YNKH 2Y7NA 3KPRB 5BXFB 2CBOA 4V1DD 2WBWB 2EJ1A 3I6LE 2C26A 2PCPA 5BVJB 2X6MA 2ZTBA 2OX5A 1DO6A 1DN2A 3H42L 4OJFH 4ZS7L 1FAIH 4N4YB 4ZUSA 4KVNH 4PV8A 4PJ8B 2CO7B 5EZLA 4DP9X 4DP5X 4HG4K 3B9AA 1BYNA 1TUPA 1QWNA 3DO3A 3EBIA 3HC3L 2XQBH 3GJEB 3IDNB 4I9XA 1T20B 3QCVL 1KEGL 5ICYA 4PRPD 4N8CL 4AQ8C 2YXMA 3CHXA 1FVCB 3QRBA 1U8NA 3SZKC 3BVVA 3VGBA 1QBAA 1OALA 3LRHA 3D69A 2VQUA 3F58L 1H3TA 5TH2B 6CGTA 4GW5B 1WC7A 1N26A 1SBSH 4PB0L 4BFNA 5C97A 4XC1H 1SBSL 4Y8AA 4K7FA 1Z5YD 1VFAA 1S9VA 2YEQA 2ZCHL 3BO8A 3CFBA 5CSZB 5I74B 4K9JA 2EYRA 3L5IA 4QXUH 4QHPA 4WWNA 5E6IB 2NY2B 3DXAE 3NA9H 3DUHA 4LOVA 1S7XA 5AW0B 3PL6D 2WYTA 3WO3B 3ASWA 1A66A 2H47C 4X5XA 3EXJA 2X4RB 3VTAA 5DD6B 5ESQB 4RA3A 4JG1L 1DVSA 1FQ9C 1X5MA 3EJPA 1A4CA 3OKMA 1OCCB 4P48A 4L8DA 3QYNA 4OD2B 2WVTA 3F84A 3N42F 2NY4D 1W8EA 1ZHKA 5EG6C 2WLHA 1M6OB 2BMKB 2VXQA 4LIQH 1DSWA 1U9KA 2OMWB 5KYXA 2L7UA 5JDSA 1CZ8H 1S9VB 3BO8B 3L54A 1IGFL 4RRPA 1E8ZA 4R3SB 5BRZD 1SDDB 3VM7A 5BW7A 3BAIA 3BZ5A 2DB8A 3I3DA 1XV8A 4AEHH 1XF2B 4B5EA 3CFUA 3UTSB 4A63A 4Z77A 2DEXX 2WKGA 3L3OC 2DKSA 4KKBC 3D9AL 1SJVA 4NZUL 3G5VA 1E30A 4OVUA 5DT1L 3RWHB 5KVFL 2AEQL 4GKZB 2XPGB 4UV7L 1K8DB 3ZU8A 3OF6A 1U8HA 3BLBA 4HMEA 3T0ED 5SWQB 3MNMA 4OCXH 2JWYA 1CYXA 4AIXA 3MREA 2HFFB 1TU2A 5F3HB 2ZAGA 3NCBB 4F5CE 2CSPA 2QQQA 4Y2OA 5EO9B 2Q6WA 3P2TA 1MAKA 3QCUH 3KDMB 2JJVA 3SPGA 4G5AA 1RZJH 3NJMA 4LVEA 2QSCH 1EJFA 3VE0B 2YEZB 2HX9A 4S0HA 5TGBB 4B95C 2ZNWA 5EOQH 4P3DA 3K46A 4LU5L 5AD0A 3JZ7A 2CUIA 3ILQC 2P48B 4X5QA 1RJCA 2DBLL 4MAYA 3ZDXF 2KLRA 3WNKA 3TT1L 4WWKB 1R1CA 1ND0A 2G5BB 3C6SB 2Z91A 4NBXB 5C0RL 3NZ8A 1UEYA 3CX2A 4NHUB 4MLSA 5E5LA 3KYKH 3RVUD 4ABVA 3WLBB 3MRCB 2GSIB 1AJ7H 2WQAA 2H9GA 3GPSA 3INOA 5FUCC 1Q1JH 4OIAA 5A2AA 3LQMA 1UWEL 5I5IA 5HVFB 3BZFA 3ETSA 5D96B 4A2MA 4JFFB 3CFNA 4CC4C 1BVKA 3BESR 2HN7B 5GRVK 4K3EL 3I9AA 2RACA 4XBPB 2XKNA 4JPQA 4MB1A 4JKKA 3F6JA 4P05A 3A22A 4AIOA 1I8KA 2ADGB 3VG0L 1DFBL 3EH5B 1NAML 1MHPH 1SM3L 4Z95H 3GSUB 3ZL2A 3OR6A 4JMNA 5D1ZI 2VSDA 2B1AH 1VFOA 2FWOB 1H3XA 4R0LC 2WXKA 5IW1B 5I8OL 5CBEA 5GPRA 1OANA 3MLRH 4KXZH 3OX8A 4P2RE 1SJHA 5I1DB 4KQ0A 2PP7A 5LNGA 4NYLB 4L1DA 2AXGB 4J3BA 4MDIB 5E8NB 4Y7OC 3Q7JA 2K9FB 3FMGL 3WL9B 3OLGA 3QBTB 3P73A 4PRDA 1GC1L 1VFAB 5G55A 5C07D 2XZCL 3KHQA 2DLEA 1TSHA 4ZW6A 3NTCL 5KW9H 1DVFA 1U8CA 3CFEA 3QCTL 1H8LA 1TJXA 1HZHL 4ZO6A 5E2TL 5DA0B 1LWHA 3S4SA 2ENQA 3OL2A 4X80H 1GHFH 2GTZB 5F88A 3BKCH 3O9WB 1CICD 4N2EA 4R4FH 4B9IA 1HDMB 2IG2L 4WW1A 3WO4B 2XNAB 1NKOA 2IANE 1MAJA 1WRFA 1V7NL 3ATAA 2YOAA 3CDCA 4M48H 3UAJA 1WA2X 3IRPX 1KCSL 3DA0A 4LK4A 4GSUA 4DQOL 3BH4A 2Q8AL 1KTBA 3L95A 3GGWA 3GTNA 2F5BL 3FFCB 4K8RC 5DGQA 4I2XE 2R9HC 1TETL 1MJJB 2CHDA 3G6DL 3MLPA 2AQNA 1U8QB 3QUXC 2X9ZA 5AZEL 3QW9A 5E9DA 4P57A 4HUNB 1Y0LA 5BZZA 3MCLH 3RIAF 2IGFH 3K5SA 1CCZA 3RZCC 1CVRA 2OKMA 4X4KA 1D2OA 1AXSA 4TNWK 5TF0A 3X13A 1RK0B 3A4DA 3O3BA 5KVDE 2ZICA 3ML9A 5CZXC 2IH1A 5BO0D 4BGDA 1E43A 4Z7OB 4PWIA 4P04A 3TX4A 3EDEA 3GS7A 2BSRA 4P5SA 4E9YA 2BP8A 3F7VA 2EDOA 4N6RB 1ZLEA 1U33A 2WLJA 4P49A 2Q8BH 3IJSA 2CUAA 2LAGB 3HI1B 4I13B 2JB5H 3BVXA 2VW6A 2A77L 3FTZA 2BCKB 4M61B 4M7LL 3V7AG 2DIBA 3IDYB 3RDTA 2HX8A 4LRNL 4FYSA 1UCBH 4MYPA 1AACA 4PY7A 4AQ1C 1A6VH 2O5YH 3PGCA 3G6JB 4OR1A 5EFIB 3WD5H 4IBLT 5JA9A 2Y3AA 2BVEA 3DXAA 4MBOA 2WP3T 2Y2YA 4LLUA 4A38A 1BZQK 2IEPA 4YXLH 2F74A 3MLUL 4DPAX 4XBEL 1T66C 5D1QC 2YPLA 2NQCA 4FQHB 1HL9A 1NA8A 3ORJA 3D2UB 4QRSB 1JK9A 3U2SB 3FQNA 1MVFA 3GMNB 3LZQA 3HI5L 5D7IA 2IGLA 4MJ4A 5DEFA 3K91A 5DD3L 5E2UL 5KUMA 1RXLA 1WWAX 1M53A 3TH2T 4IKKA 4NM4L 4JN1L 4TN9A 4LBEB 4XTRC 5F7FA 1JHLH 4KK6D 2OYPA 4GQ9H 1N64L 3UBXA 3BGAA 4GKSB 4OW6A 3HS8A 1DUYB 3Q9QA 2OTWB 4UQAA 3QT2A 5CIPH 3F7KA 4Y16C 2AXWA 2D3LA 1W72B 3VU1A 2VXSL 1Q90A 5HHOA 3RGHA 3SQOL 2YWZA 4MJ5A 3V6FB 1B4LA 2GBAA 1PGRB 1CE1H 1VPOL 2MOGA 5BMFH 3OSKA 1R17A 3WAJA 1I75A 2HTKC 3WNLA 3ZRCC 3AROA 1OD9A 3MRLB 3CPUA 3GIVA 4NQXB 1GH7A 4KK6C 2RHEA 4XVSH 1TQWA 1WYJA 3RWJB 1AHKA 5KVGH 5HHQB 3FQWA 1Z3GL 1R3IH 2K45A 3TA3B 4KVPA 2ATKB 5EUKA 2FUQA 2VDLL 2NCMA 1SHMA 4KK5D 4GAJH 3QULA 1E3FA 1ZE3H 2QQLL 5EC1A 1F3DH 2XIBA 3RFZA 1WISA 4R7NB 3WTXA 2OTWA 3DX7B 1V10A 4X8JA 5D6DA 3LHPL 1RSYA 4HU2A 5EDXA 2NZ9C 2PXYC 4C55A 3LHPH 3FTSA 3LQAH 1IEAA 1JNLL 4PJAB 1F6FB 4L37B 3EDJA 3QS2A 2C9SA 4Q2ZB 4ZMQA 3H56A 2B39A 4PREB 3E2HB 3TBSA 2NY7L 3EH2A 5F1IB 4UM8A 1MRFL 4TSAH 2CR6A 4NCC1 5E7BA 2YPLB 3QRGH 2ZX9A 4YSCA 2XI9A 4XPFH 2ZONA 2AK1L 2BP8B 4G7VH 2VO5A 4WFHE 4FQHA 1X5IA 2BY1A 5GRVL 5HDBE 3UTSA 2UXTA 1RZFL 3V55A 1AANA 4L4VD 3VXRA 2B1HL 1U3JA 4BQ8A 5T1LA 3B9KB 1T7ZA 3BAEH 3V2AR 5ID0A 3E6HA 5IFJB 1RURH 3PU7A 4NRZB 2XA3A 5C2BH 4WUUB 4X99A 3ZQXA 4F7EA 5JPNB 3OJDB 4LASL 1T1WB 1MOEA 4LVHB 4CA4A 5DMKB 2E47A 3NRPA 2WXJA 2QHRH 5T5FA 2IPUK 1KJMA 1SHWA 2BK8A 5J56B 1FVDA 5KJ7E 2QMJA 3GGWB 3PNWA 1WQVT 2EDLA 5BO1L 4K55A 1MW0A 2NXYB 3NCWA 4F1ZA 2O4EA 2C9VA 1LL1A 3EYQC 5GGVL 3IMWA 5IB5B 5JW5A 1QX1A 4CMHC 3VD2A 1KYUA 3K6OA 4KKQA 2B4CH 4HPHA 1RULL 4K3JH 3ULUE 2ZUQC 2XG5B 4FFZL 4M9PA 3U9PH 4P9HL 3P77B 2Y5TB 4QXGL 4RA0C 4N1CA 2UXGA 1XL6A 5E9NA 3X13B 3CFEB 3CXHK 1N70A 1M05B 3K0WA 3O4LD 4I77H 2IV8A 4JFXB 4MRBA 4TF4A 4F7PB 5I73C 1HHKB 3RUGE 3UXFA 3ULVF 3C08H 3LNFA 3ZDZE 4KKCD 4PRBB 5LCVA 2XV6B 4BJLA 3C5ZA 3C2AL 3FW6A 4YSDA 4ZZKA 3OKLA 4X6CA 4FTVD 5C70A 3MGTB 3RURA 3L95B 2P7TA 1H19A 3FQTB 4IIQB 4LCWD 5BVJA 5DD1L 4WFEE 4PP2A 4F27A 1C9SA 3FT2A 4OQ1A 3GRWA 4PTUB 3VX1A 4E41D 3EG9A 4Y4FA 1YYLL 2CNYA 3DX8B 3VXME 4RETB 2CRZA 3L13A 1R75A 1KLGB 3O4LB 4OI7A 3FFCE 3MXWH 2WYHA 3LS4H 4DKTA 5D70H 1F41A 5CWSA 2NY2D 1RZKL 2DI9A 1BP3B 3UG4A 2G75A 2WK2A 2WSDA 3RX8A 3GSNL 4EI5A 3VXNB 1IGJA 2DI7A 4JFFA 4NBYB 5IQMA 5M7QA 1A6AA 1NBVH 1FNSH 1LILA 3P73B 2YN5A 3T5WA 3V5HA 1TJHL 4G6JL 1DLFL 1A0QH 1V3LA 1YECL 3GO1H 4XH2A 5LQBL 1OCWH 3VSQA 2XQYG 2OR7A 1QLRB 1ED3A 3WNNA 3KYMA 3QHFL 3ROLA 1OCWL 2H3XC 1WVZA 3ZOAA 2FATH 4U6YB 5HHVH 1L9MA 2Y36H 2Y3NA 3R18A 2HB0A 2PYEE 3F65A 4P5KA 3KWTA 4PJ5D 4WWKA 1JF1B 2E9GA 4M7ZC 3RWCA 1MIEL 5SWSD 3MRFA 3PWUA 1ILSA 3KGSA 5DJ0A 3HNSH 3MLXH 1I7ZB 2VW7A 1Z2KA 3APNA 2KS0A 2RFXA 2XN9D 1OP5K 5I1AB 2UVEA 1HYSD 4K23L 5HXMA 4KOCA 1T3FA 1S3KH 1EH9A 2R39A 1BD2B 1NCDL 1URIA 4GLRH 3FUDA 3HE7D 1IV8A 2LLGA 3GSQB 1UWGH 3OWRA 4LCWE 4MB4A 4OCWL 3C6SA 1RMFH 1YEFH 3MRCA 2VZOA 5C3TA 5C0NC 3LVTA 3FRPA 1YN6B 5C07E 1DE4B 3LPFA 4S1RH 4Z5RB 5JHLH 1WZ1L 1UA3A 2R1YA 5F3BB 3GJFA 4IMLA 1QQDB 4L5FL 4ELDA 2ZKMX 4EDWH 3FU8A 1PLBA 3V5DB 4F7CA 3VD5A 4UDUA 2DQIL 5H37H 3MA7A 2O6DA 2XCMC 2YD6A 4ODTH 4GXUN 2X4SB 4KI5E 3VYOA 5EEYA 4YSEA 5AKVA 3T8VA 4X9IA 1RK1B 3BX7C 2DV6A 4DW2H 4N2MA 5DZJA 1S7RB 2LVCA 5J12B 3B9KA 3GXPA 2XN9A 4CAGA 4UF7C 4Z7UE 5C0EB 3T3PE 1INDH 1A5FH 2HLAB 3WNJA 4ZMTA 4L3CB 2GUOA 4BIKA 4JDVB 2QGEA 3CZFA 1EVUA 3SKNA 3B1UA 2B1HH 3MLRL 4L1BA 1FH2A 2FJHB 4JO3L 3K2UH 1TCRA 1ZHNA 2B2XL 3G9AB 5LAXA 5GRJH 1CLYH 5KVGE 2I5YL 2B1AL 3LEYL 2H3NA 2P8PA 3SKJL 2CLZA 2Y7QA 1HIML 5E6RB 4AUUA 5IESL 3CX5K 3LKRA 2YGVA 2XVLA 3RB5A 4F3FB 3WSQL 4ZUWB 1R46A 4ZFOL 4YFEA 1JWMB 1G0DA 3MRBB 3DTDA 2A4ZA 2BNQB 4XHJD 4YGAB 3TVMA 3K72B 4AT6B 5K69A 2YAHA 4HHWA 4X6DE 2DW5A 5H37G 2BSEA 2JJTA 3BE1H 3CVHL 2NY3B 3NRFA 5D7IE 5GJSL 1T5KA 2QV2A 2AJSH 3WTWA 3T1FB 3T0AA 1EEZA 1IT9H 2FLMA 2X2UA 3UIYA 1EAPB 3FFOA 4WEBH 5ANHA 2ZUTA 2F1AA 1RCYA 4YLBA 3SE8H 5BCAA 1BDYA 2HX7A 4KDWA 4GSXA 1DQVA 3BUBA 3GBML 2ICWI 3W9DA 1SYVB 3KS0H 4WTZA 3O0LA 3SE9L 1SYSA 1GKOA 3VXOB 1R5WB 3RL2B 5C7XL 1D6EB 1MXGA 3MMEB 3ZQ9A 2O5XH 1AOHA 2VR3A 3WHE0 4OCSH 1N59B 4PJXF 4GAJL 4L1HA 4ZAKD 2R0LL 4JFDA 2XN9B 3K6DA 5E99H 5CO1A 2VQTA 1CJYA 3S3PA 4PUBH 5BQ7A 3IMVA 4NP4H 1G1OA 5C0AE 4QRRD 5FUOH 2Z31A 4ODSL 1INEL 3EOAA 2Z8WC 1ROCA 2JLLA 1IL1B 4XMKH 1MCOH 2HT3C 3IXAB 4AGPA 4XO8A 4X4ME 3OKKA 1K4CB 2R15A 4AKOA 5BXFA 3PAZA 1F4WH 2JKLA 1AKJA 2MCPL 1BLNA 1DQIA 4GOSA 4MQXD 5H35A 2WIIB 1FL5A 4I1RA 1YEDB 2XIDA 3RVWC 2CBTA 1NTDA 1P2CA 3B3IB 4YZFE 5MP6L 3VQ1C 4TUJA 3VFOB 1KPVA 3FT3B 1L5GA 2Y7LA 4R96A 3RDJA 4X6CE 1TQCC 5IHZA 2AABL 4RZCB 4XCNB 3TO2A 3D0LA 3MUGB 1MQ8A 3V6OC 2XXGA 2FQDA 4E0RA 4HJGA 3VXRE 1MG3C 1TLMA 4QRRB 3WGVB 2ESVB 2I9LA 3DIFA 3MBEB 2QPDB 4JZJC 2VZVA 1G0XA 4LDLB 4NN6C 1L7IL 2F0CA 4DGVL 4QOKD 4H8UA 4WO4D 2BP3A 3C60A 3VXMA 5CLWA 4XGZB 1G94A 1PX3A 2WIIA 5FYJL 3RNQB 1N18A 3ZO0A 1H6TA 1Z1WA 5IB2A 2BS71 2CD0A 3ARBA 3EYUL 4Y89A 1NIEA 1T66D 1UGKA 1WS7A 2OZNA 4PLKC 4LSDA 3CSGA 2PETA 3WMQA 1RHFA 4H0HB 2F08A 1ED3B 1RK7A 3BLPX 3T4AB 3KM1A 1A9BB 2JI1A 2OBGA 4ODXA 2VR5A 4DO6A 3GSWB 1Z9PA 2ZSVB 4PJ9B 3A6CH 5HHPA 3UEZA 5HGAA 4YMPA 3KWUA 2X4QA 5GZNC 4G8IA 2DWTA 4OF0A 4IHOB 3DHPA 3TV8A 2MNWA 1Y7VA 2LU7A 4GUPA 4WEMB 2XRAH 5JPMB 5AWNH 3VGAB 4TNGA 4U1NB 1S7TB 4Y4KB 5C09A 4D9QD 3ET9F 3TEZA 5E5RB 2CIIB 3T1WA 1Z9NA 3RLSA 3NIDF 4PBXA 2E56A 3IKKA 3ARRA 4TQ8A 1NLDL 5ESAA 5FYKU 2FJFA 5GZND 2V8MA 1CG9B 4XN1A 3TNMB 3EG9B 5DFTA 4JREB 1R3KA 1SEBA 2P8LB 4W9GC 1A1OB 4D0DB 1KULA 1TT6A 4HUVA 3UH8A 4XP6L 1EO8H 5I17A 4GH7B 1EEZB 3VACA 2LE9A 2H1PH 2H41A 4AOFA 4JJHA 3V0EA 2P8MB 3TP4A 1RJZB 4N0UB 3N43F 3FBKA 3K5RA 1PKQB 4QKXB 3EOTL 5CBEB 2JIXB 5E1GA 5FXCH 3S96A 3AGVA 3WXWH 2XWCA 1I7TB 5DHVH 4IOFD 2PPEA 2WQUA 4M6AA 3MNVA 4CRPA 4R5TA 1RAMA 5EU4A 3DX2A 1KJMB 3MRJA 1R3HA 4UT6L 5DVMA 1N0LB 2D4FA 2UZIH 3QEQB 5F3FA 5TQ2H 4EZJA 1S5HA 4IBUA 3HRZA 2QKIC 1RULH 4K3JL 4PRNB 3QIWB 1Q9WB 2UVFA 1I4FB 3FFDB 4KDTA 1H6UA 4NI6A 1SF5A 1NKRA 4XODA 1I8KB 5HHNB 5L8JB 4MMXC 2AFNA 4HCGA 4JFFE 3IPBA 5BRQA 2C9QA 1ZV9A 2XZAL 4UV4L 4NZRL 5D1XC 3ZHDA 5GS1C 1A14H 1VRSA 4ATWA 2JCCE 1BV8A 3FHQA 4UANA 4X5PA 5IGXL 2D3NA 3QIUB 4P4KA 5J6GA 4JRYB 4WSJA 2OJZL 5CBAA 3JUYA 5HHXH 4Z9KB 3E3QC 3GKWH 1XCWA 1QA9B 1JE6A 1GTNA 1E90A 4LASH 1XB6A 3QQ4B 3IFPB 3T65A 4NWUH 4RWYH 4OLZL 4KTEH 4OM0L 3EOBB 1A6TB 2MQCA 1NCAL 3HI6L 3LN9A 3IFLH 3TV3L 3S88L 2AI0L 3TBYA 3DNKA 3D0VA 1AQHA 4Q89A 1XVSA 3S3BB 2J20A 1OHZA 3BZ4B 4F8LA 4WQOA 4ZW3A 1M7DB 1KIPB 1DQJB 2LW3A 3WIIH 5F9JB 1ZTXH 4D7PA 2EP6A 4MAYB 3L5JA 4LGSB 2J88H 4FQQB 1S78D 4N2IA 4OV5B 1MHEB 3CFKB 2WZ0A 3LZOA 3ZTCC 5L4MA 5MP6H 4WLCA 3ILPB 4K8RD 4N0UA 5I6XB 3TBCA 1YPZA 2ALWA 2E7HA 3I9PA 3MOBH 4XMZA 5DDHB 1EPFA 4EXKA 3QNYB 2A38A 1QEWA 4FZEH 5C71A 3CSPA 2BNQE 3UAEA 4XP9H 4IW4C 4F33B 3DTXA 4AGLA 4O58L 5KAQG 2WZPD 5D1ZB 3BAXA 3ZTDC 4GG6F 3QZWB 2CKBA 2H2SD 1CG9A 4LQ1A 1K85A 5IHLB 2GSGB 4PJEA 2QELA 2ZIDA 2D31A 2X4PA 3CZKA 4P5MB 4LHQB 3U4EA 3WGUB 4GUOA 5DVOA 5T3XE 1P7KB 3F3HA 2WB1A 3D85D 5E7FA 1LP9B 1N64H 3DYPA 3KYNA 4LLWA 5EU6B 4WUKH 5I76B 4IDJL 3ILDA 3PWUB 1YEWA 2R83A 4DGUA 5T3ZE 2IXQA 3PWLA 1ZSDB 3TIDA 3U36B 3IT8D 4LCWB 4TOYH 1U6AL 2VW4A 1JF1A 1FNHA 3TEYA 4BFBD 2OW6A 1X7QB 2NX5B 3FONA 5I1JH 1J12A 3BKJH 5C7ZA 1AQ8A 2XTJB 2RMNA 2DI8A 4HW6A 4S1SH 4LOUC 2WUCH 4P2OB 5DJAA 2XBDA 1JHTB 1E8WA 3P3YA 1OM3L 1UXSB 3FJTA 4ANUA 1CGYA 3L48A 4JFEE 4CUCA 3KWVA 2W0PA 4PRHD 3GEFA 3X1GA 5E8OB 4QY8A 3M88A 3MLUH 3HRZC 3KLAB 4XMXA 5BOZG 4LPXA 3J8F7 2BP0B 3WN6A 1WC7B 2QTEA 4MXQD 4NNXB 4NQUA 4XCEA 2B59A 1OB1B 2WJ5A 1XSOA 4W9KC 1KENL 2A9NH 4OCRL 1KBVA 1R24B 4PAZA 3VXSD 3IMBA 1AXTH 1A3RL 4UILL 1E0OB 2W5PA 3DOSA 2A4EA 1I1FB 2CRIA 4ZRGA 2QL1A 3N3EA 4FQPA 1P4BL 1VSCA 2WBKA 1V55B 5FHAH 4MMXB 1JHKL 4HOMA 2VXSH 5TK4A 1OL0A 1PF3A 2FBRA 1HZKA 1CU4L 1KB9K 3DXAD 5AG8A 5KAQF 3I02A 2VLKD 4R4ND 3NCCB 4NFBA 2XBZA 1XGYH 3MRNB 2IC2A 5K93A 2NUTB 2HLFC 4OAWB 4JQVA 1C08B 2E6PA 3BAWA 4Z3EA 2HJKB 4R84A 1CICB 2KBGA 4I0CC 4ODTL 1TSRA 1A14L 3TBBA 4QTIH 2BDNH 1VADB 3WMSA 4FABH 2P4AB 1UA7A 2JSFA 3POHA 1HKFA 1EHLH 1AE6H 2O5NA 4JJ5B 4JS7A 3VXSA 1VF5C 3UP6A 1KV3A 2CM6A 5IBUG 4D9RD 1EZUA 3ULUF 3MMEA 3SDXB 4AJWA 2Z0BA 1BW8A 1JVLA 4G43A 4JFZH 4XN5A 3FB8B 5CCHE 3HB3B 4IGBB 5DVLA 4NZFA 5JZ7D 4K7PH 5C92A 2CDEB 3D1MC 4XVSL 3GSNA 4A55A 3KW8A 4EIUA 5JPNA 4PRIA 2V2TB 3KPLA 3PAUA 1QMUA 2IADA 4IMKA 2XYBA 2AQQA 2UWEF 1NCCH 5DHDA 4MDIA 4HJJH 5E8NA 3DV6A 3TA3D 5EU6E 1IAIH 5AB0A 2PLTA 5JIMA 4HH8A 3T0WA 4ELMB 5IW6A 1O6VA 4HCIA 3F85A 3E6FA 1BJ1H 2OJZH 3RVXD 3I74A 4Z7UF 3MJ7B 4Q9QL 4RGNE 1DBJL 1WFMA 3LN4B 4IRSB 5KS9A 3IN2A 3AS1A 3MRBA 1DBJH 1FFTB 2ARWA 1UZGA 4IRSC 4YDJA 5AW6B 4OFVA 3RKPA 2X44D 1WFOA 5HGBB 5B8CC 4M3JA 4DNLA 4DKFL 2WXFA 1E5AA 1QSFA 3PHAA 4B7LA 5ID1B 5T33L 3MFFA 4U6VH 4Q2ZA 2ZCKH 2IBZY 5DYOA 5JOFA 1DCLA 2YD5A 2YPVA 5ABAA 3CQFA 4GQQA 2FJHA 4MJHA 1J7VR 3RGVB 4DEUA 5FYJD 3MBEC 1M1XA 3NZHL 2PO6B 1Q9LA 3O8XC 2WBJA 3MZTA 2A9BA 1IBGH 3KPRD 4I48A 3FU7B 5B3NA 2ATPB 1PQZB 1AD9A 2E0PA 2IAAC 2ILLA 4CW1A 4FQ2H 2ROXA 4FFZH 4RBPH 2RALA 2KC0A 4WI2A 1PCXA 1GZQB 3KDPB 2G60H 1MLBA 1EJOL 1IFHH 3N04A 2LFEA 4N3TA 3US9A 2QQNH 4FG0A 2EDQA 4N1EA 5J0BA 3L9BA 4YNYB 5F8QC 5C09E 3GIVB 2IF7A 3NCFB 4P46D 5E2WL 1MCWM 4CVUA 4PMFA 1MH5A 4ZDHB 4NDMB 5A40E 3DO7A 3TF4A 4LSTH 1IBFA 4WEEA 3KR3L 3S35X 3L2MA 4NNPL 3DRQB 2GI0A 3RGVC 4RRPG 4C56A 1NPUA 4ZW8A 3WDIA 1PJ9A 2UWEA 3ASNB 3H3KA 2C7UB 4TUUA 1YY9D 4YDVA 2DTML 2BNRD 4XX1G 3O3UN 3EGDB 4A7SA 5L2KD 1A6ZA 4B9KC 1HESA 2AVFA 3JQOB 2OYLA 4APQA 3CU1A 4CVXA 2FT8A 5TQ2L 4HXAL 2DYPB 4HJ1A 5LGYA 2LVEA 6FABH 3IJYB 4M8RA 4E5XB 1SQ2N 4RISL 2VR7A 5E51A 4KNQA 3FB7B 1BYOA 1P4BH 1I7ZA 4XO9A 5ID1A 4G9DB 4RFOL 3IDMA 3QUMB 4ES8A 1BIIA 3AG3B 3EHBB 4Y9CA 1EVTC 2Y6TE 4CSSA 2W65A 3D85B 4B96A 1EV2E 2CO3A 2D03H 1T1ZB 2BIIA 3ZN6A 3LRSB 3NFNB 4R97B 4P2CG 4ZD3L 3U7AA 3E6FB 3NBNA 4QMEA 3JVGA 2FO8A 3ZTNH 4WI0A 1E9QB 2XPGA 2F54D 2VQ1A 2J8HA 4Q6YA 4APXB 4BHUI 4FABL 5I6MA 3D3VD 3RWHA 4PJHB 3SYPA 1YLBB 1NBZB 3R06B 2KHAA 4NUJA 2Y1AA 4UB0H 3NZSA 5IQOA 3JTSA 2PPCA 1JNHB 4HZLA 5FHAL 3DDFA 2DIEA 5IREA 5HJ3B 3IDJB 4S10A 1R5VA 1Z9LA 3BGFC 3ETTA 3BZEA 4PJAF 4PWEA 1KFGA 4FGMA 2VMJA 4Z7VE 3UO1L 5K9OA 2OCCB 5A6MA 5DYFA 1YO4A 4MJ2A 1F2QA 2V7NB 3IJEB 3F05A 4RGNC 3QPXH 3V4LA 1WFNA 4JFQA 2IFFH 5DR5H 2N56A 2COVD 2ARJB 5BRZA 2F1EA 2MKWA 3QFDA 4HX1A 1PBYA 2OXGB 3LN4A 4YHYC 1R3HB 3UZVA 2QQKL 1XMEB 5I82A 5J12C 5T5FH 3VFNB 2MMXA 1LMKA 2CLRB 3LKNB 2WINA 4V2CB 1Y6MR 3B2DC 4A37A 1MVUA 3U79A 4PJ5B 1LK3L 2XDHA 1HKLH 4BFOA 5CMAB 4FG6C 5AL8A 3V5KB 4G8EA 3PXHA 3TTSA 4BINA 5KANI 5ACZB 1WSST 4XNZB 2JCWA 1QKZH 2BIHA 2X89A 2ZKXA 1NM4A 2FYVA 2YO3A 4HPYH 1KPUB 2W80C 3PPSA 4KJQD 1MFAL 5EF3A 3VFGH 3DPBB 3NH7H 4ILDA 2X87A 4N2AA 3U6XS 4GRMA 5D2LE 3IGAA 4AXWA 3QQ3B 4ESKA 5BV7H 4OZIE 2UX6A 4FL4C 4H40A 2L7JA 1CDCA 5EIIG 3F5WB 3ATDA 3M7OA 3WNPA 4XHJC 1M3JA 5ISZB 3V95A 5FOJA 4PJ8A 5FAAA 3SY0A 4PJHA 1FGNH 4ZXBD 2AANA 2TAAA 4N9GB 4U05A 4P9HC 1HHIA 5HP5A 2WXMA 2X4OB 4MAYD 5KG9A 2X9WA 4K7PX 3WSQH 4QR7A 1RVFL 3BSZH 4ODVH 3HMWH 1UZ8A 4EIBA 1F1GA 4HIXH 4RZKA 1I7UA 1JWSA 25C8L 4BWWA 2PTTB 5FWRA 5MEOA 2OK0H 4QTHB 2WVVB 4L5FE 4QIRA 5T1LB 4XBPA 4BCXA 3HMXH 4IQHA 5FF6B 3LB6D 1IGYB 5C0FB 3CSBA 1OZTG 4OVVA 4RAUA 3CLFH 1TQUA 4MXQC 5GS3A 2CM5A 1BG9A 4TTDD 4PVMA 1QI4A 5DVPA 5AEAA 3CH8A 3MI6A 1J86A 2XWRA 2F5BH 1G7LA 3BQVA 3FTXA 4J3SA 5IJKC 2YD3A 5E2VH 1BAWA 3KJ4C 5DRZA 1ITCA 4HEPA 1HFUA 3MUGA 4UM8B 2XLLA 4H8PA 4M7LH 1MCBA 3V10A 1NFDA 2VUKA 4AG4L 4PH8A 3TF7C 2APWA 1X4YA 5L2JB 1Q9KB 5HDOA 3HLAB 4N6QA 2AJZA 3D39D 2H8PB 2R29L 2WHVA 2ZQKA 4KQ3L 3DPBA 2D31B 4J3XA 1T03H 2O93L 2Y2WA 2NNAA 4JREC 3Q6GL 4YHKH 4FLOA 5DGRA 3OR7A 1JZ8A 3DBSA 3QZOA 4GP5B 4MYWB 2HFEA 1CIDA 3MKKA 4Q56A 4WU7A 4EVNA 5B1JC 3VI3B 1J48A 5F7AA 4L4VE 3RL1A 3UZQB 1PZUB 1I3RB 5A6LA 1SLXA 5JQ6H 3W0WD 1P4LA 1JIBA 3APCA 3VXSE 1BZOA 3H7LA 5HDBB 3MU3A 4HMDA 5GGRB 3GRWL 5J6HA 3QFJA 1U8HB 4JFDD 1TFPA 3CPLB 4F58H 1ZSDA 2IOMA 5BZDA 2IBBA 1W2KT 3KBEA 4XT1C 1PW3A 3ZJAA 2DRUA 1ETZA 3HNVL 4KX8A 1GY2A 5AKSA 1J0HA 4NUQA 3O6FC 3S34H 3OMAB 4KITB 3QIUC 3WENA 3MV9D 4IGBC 3HB3C 1URZA 1PG7W 2OPCA 1I8UA 2V17H 3T3MF 1QTPA 2JJSA 3GINA 3JSSA 2GSGA 4PJEB 2FO4A 1BPVA 1DJIA 1HOCA 4TULL 1KC5L 1GYUA 2ZXCA 1JWUA 1O9WA 1OM9A 5B3JF 5EEVA 2X6VA 2H6PA 4HGMA 4AITA 3K4AA 2VDMH 4MSWA 4XOCA 5J6GB 2NXYC 5E8DL 4KROD 4LNRB 4L8DB 3U7YL 1GZHC 4FQCH 4M5ZL 5IHHA 3P9WB 3KGUA 1SDYA 1DJWA 1BBDL 4M3HA 4BFIA 3HN8A 1R9FA 3B9KD 1WBXB 4GAAA 2X38A 2W92A 3V6OA 4MKTA 3M1CA 3D3VB 1QLEH 2TSBA 3GS4A 3HZMA 4OLUL 5GHWL 5DO8A 2JCCB 4F1SA 4HVBA 5GSRB 2QJDA 1IKFL 3SGJA 2EYRB 3B7UX 4GBXB 3HS0A 1JZGA 1W6WA 1AR1D 3HHSA 3IDXL 2BHYA 3CCHB 2A6JB 3AGWA 5B1KA 3SDAD 5F9AC 1W91A 2B9AA 1G7MA 4P46A 4I3RH 4PJIB 4NHCH 2V9QA 3K8MA 3RG1C 3V0WL 1K4DB 4UOJA 1ZPLA 2AMUA 1YNTB 5JYMA 3QUXD 3V7MA 3C8KA 3QPQC 1NGQH 1XF5B 2Z8SA 5I8OH 3N42B 4QF1B 3IDIB 4DP7X 1NFDB 3TA4D 2Z1PA 2D7OA 4LHJB 4IBQA 5E6ZA 2OULB 2EICA 1AIFA 3CHSA 1MNUH 5FKAB 5FYJU 2PYEB 3C09C 4HWNA 2F7IA 4YDVB 3C6EA 1UACH 5FK9A 4Y1AA 2JQAA 4ZFGL 2BSSA 2IH8A 4O9HL 5JHAA 1RPUA 2PCPB 1YNLH 4UOQA 4PEEA 1G7JB 3QUZC 5D55A 5BJTA 3NPSC 5KBLA 1R5IA 2NT0A 3BIKB 3CFCH 5AFAA 2XVKA 4AQAB 3NH7L 5IZ7A 1T21B 3QXUA 1ZLWK 3D2TA 3QFGA 4M5YL 1OF2B 2R7EA 2GEQA 5FYLL 3KVPA 4HKBB 4Z5RA 2E59A 4JHVA 3ZDZF 1XGZA 3CDZA 3ZKSD 1A8JH 1SJEB 3L4VA 2EEDA 2MCPH 4AK2A 4Z7QF 2WPGA 3QQNA 4IHBA 3UPRB 5FA4B 1K9TA 2YD7A 2XPZA 2NLJA 3X1FA 1AHWA 3SKMB 3KD4A 3AQYA