3PNRB

Structure of pbicp-c in complex with falcipain-2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
160
structure length
129
Chain Sequence
GKSLKLGNISNQTNQETITQSLSVGEILCIDLEGNAGTGYLWVLLGIHKDEPIINPENFPTKLTKKSFFSEEISVTQPKKYMQLLGGPDRMRSVIKGHKPGKYYIVYSYYRPFSPTSGANTKIIYVTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the regulation of cysteine-protease activity by a new class of protease inhibitors in Plasmodium.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Falcipain 2
total genus 30
structure length 129
sequence length 160
ec nomenclature
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3pnrB00
3M86A 2NQDA 2NNRA 3CBJB 3CBKB 2FO8A 2OULB 3M88A 3PNRB 2H7WA 2WGNB 3E1ZA 2C34A
chains in the Genus database with same CATH superfamily
2QQNH 4HS6A 3WLWD 3WO3B 5B38G 4OFIA 1OGPA 1XB3A 2WXMA 2OR8A 5EC2A 2NX5D 4IRSB 1P4LB 2VIRA 4O5LH 4XXWC 2WTRA 4AQ8A 1HK6A 4BH7A 3UTTD 1PZCA 2R7EB 5EBMB 5EF3A 4NQEB 3FS9A 1GZHC 4XCFH 3TIDB 1PYWA 4OCWH 5KSAA 2J8UE 5DJ2A 2EILB 4OAWA 4D9LL 1OTSC 5BV7B 3PGDA 1A3LH 2R1XA 4O4YL 4CBPA 1NWOA 1NSNL 2NY6D 2BOBB 4UNIA 4EO5A 1RJYB 1A21A 3TVMD 2VR8A 5GGUA 3B7YA 5DURB 4BFFA 3LDBC 4U7SA 4OF3A 4OJAA 2FB4H 1I1YA 5D5ME 4QRPE 5T1DL 1I9JH 3RA7L 4PRPB 5JHBA 1NIDA 3LRSB 4HZAA 4DP7X 2QKSA 3TCLA 5CBEA 3FU9A 1EUUA 3FTGA 4F7PB 3SE4A 5D2LF 3LRSA 2I07A 1KULA 3GEWB 3DETC 3D85B 3G6DL 3GNML 4I77H 4XB8A 2FHFA 5C07A 3VFOB 4S0SD 1C5CH 4HUWB 5DRWA 4B0MM 2G2NA 4X6BB 1O75A 3B56A 3NJIA 2IXQA 3HJEA 1MJUH 2A9DA 3APNA 1J05B 4FTVA 4Y19E 3PUUA 3QDMB 1L7IL 3ISWA 3FN0H 3N43B 3QJFA 4PJAF 5CSZA 5E94A 5F1KC 1A6WL 4HXBH 2C4FT 2NYYC 3P2BA 4TF4A 4UB0L 5EORH 2K9FB 2Q6WA 1GKEA 1FAIL 1RK7A 4HK0B 2YQGA 1C5BL 5HPMB 2Z35B 3RBSA 2E4TA 4MWFB 5D70H 3CFEB 4M7KL 4P3CL 3SEPA 5D8JL 5DRZA 1WBXA 1EAPB 1I8UA 4QNPF 5EDSA 3M88A 3FYEB 1U42A 1YEFL 3OHXC 5LJYH 2VXQH 4M5TA 2UZYB 1M2VB 4RGNB 4KROC 3EZJB 1ZS2A 1GSMA 1NFDB 4GY4A 2CJUH 3GSRA 5INCB 2CU9A 2WZPA 2IQAA 1MFCH 1TZ8A 2VH5L 3IRZA 1X5FA 4JFDE 3T0AA 5AVVB 2IG2L 1PVHA 3FCSA 2ADFH 2PWGA 3FU0A 2FATL 3AREC 1WBYA 1GAFL 2O6PA 1MG3C 1IFHH 3F7QA 4U1MA 5I15H 5J57B 3LS4H 4DVRH 4RFEB 2Z91B 3FU5A 1V7NH 3L54A 1EHLL 1IC7H 1IQDA 4YO0A 1Y07A 3NGBC 3BPLC 3B2PA 1BECA 2LU7A 3LVEA 1MFEH 4PJGA 3TOPA 3ZE2E 4G7RB 4ZW8A 4WKXA 5FB8A 2ZONA 5E23A 3S7GA 4MVBC 5J4MA 1DQML 3OR7A 2IGFH 3NIGF 1OB1B 5H37G 4JRYB 4JGMA 3L4YA 2AQTA 1V3KA 3GO1L 1IUZA 1MAML 1FE8H 2GCYA 4LAQH 1AJ7L 3EADA 4NWUL 2D0HA 2W0KA 3G6JE 5ANMB 4AITA 3HVNA 5I1LA 2GEQA 3N6YA 1VEOA 4G6JL 1BM3H 3U46B 1FJ1B 4N90E 2DOCA 4KXAA 4Y2DC 2WXPA 5GRJH 5T1KA 4XNYL 4M5ZH 2HKAA 2LOEA 1A3RH 3U0TB 2F5AH 4L1BA 1KJ3L 3CCHA 1HX0A 3T0EE 3ZDYE 4J3TA 4H88H 3MTRA 4G5AA 5KVFE 3TBVA 1RIVL 4FYQA 3L5XL 4DJMA 1VDGA 4HA1A 2BSSB 1QACA 4LEBA 4M29A 2ZYIA 4KZCA 3VNZA 2FX7L 5IFAH 5JA8B 4GUPB 5EEUA 5F6HI 1IFGA 1Y6MR 3S35H 3P0VL 3QJRB 4BCYA 4WVRA 1MHHA 3V5KB 4CUCA 2Z0BA 3LNGA 1U8MA 1YSOA 3MAWA 1KGYE 4HJGA 4KAQL 1WZKA 1IFHL 2VDPB 3K8KA 4L3FA 3UACA 2HWZL 3RU8H 1F42A 5FYKL 3LB6C 3VH8G 2E8ZA 4I8DA 3AU1B 1KLGA 2CD0A 2P5ED 4PJHA 4WEUD 2WWOA 5EZOL 4ZW6A 4A7GF 2Y5QA 2EVHA 3ISRA 1P7HL 1SN5A 3ZJAA 3H7BB 1UGKA 4X7TB 3L4CA 3DTDA 3LN5B 4OD2B 3UTTA 3U1SL 1MRFL 2SEBA 2ZAGA 3BAXA 2R9HC 1TENA 2DJ4A 2QADC 3LMJL 4M4RB 4V1DB 3O45B 5I1CL 4P9MH 4X0KB 4XX1E 1MVUA 3AXIA 5AYUH 2WLLA 4NN6C 3QR2A 3GRWA 5GGUB 1ZVSB 3CDYA 5K93A 3CDCA 4NPYB 4OTXL 2Z31B 4APQD 1Q9KB 2J6EH 3BKYH 5HHXH 4CBZA 5KOVC 2XTJC 1N70A 4Q0XH 1MFMA 4XNZC 3GBNL 3E2HB 3IU3B 4S1DD 4TULH 2H7WA 5CJXA 1BMZA 3BAJA 4JO8A 4XVTH 2OULB 5C07D 3IJSA 4Z9KB 3ZKQD 5MERB 1F45A 4JHWH 1GMIA 3F6LA 2IPUG 3JBG7 3M6DA 2XWTA 1CLZL 3SDXB 4RBPK 1NKGA 4HKJA 2MOGA 1HYSC 2CHZA 1CGWA 1DQIA 4P5RA 3MQIA 5T5FH 3RA7H 3ZGHA 2WXIA 4V1DD 3MC0A 5SWSD 1XB8A 2BNUA 1IKNA 1MQ8A 5H37H 4U6XA 4WWPA 2OJEB 4GRMA 3CN4A 4LSSH 1M4KA 4JN1L 3VXRD 4QRSA 4WUUA 3RRQA 2V2TA 2AI0L 2V7NB 4PBDA 1EJ8A 2EDHA 4R97C 1RL1A 2AKRA 5FV1L 1DSFL 4I5BA 3AQZA 4OCWL 4KFMA 4LDLB 1NBQA 3FZUC 4FGMA 5CIPH 3L3OC 2B2XH 5KBPA 3NEEA 2VN5A 2OS7A 3RKPA 2IPTL 2NY5H 3R8QA 4S1RL 4ANUA 5BV7C 1D5MA 2AXHA 1NUFA 5DD5H 2I60L 4LEOA 3QPQD 1MLBB 3E80A 4PJBA 4U1LB 3AXLA 4NO0B 3SBWA 1G7IB 5ABZA 3QPKA 4HBCL 4OZHF 2VT0A 1JWSB 3AG2B 5IROC 4OI8A 5K9OB 1LEGB 1URIA 2JVUA 2Z31C 4RSVA 3SDCC 2DQJL 2RTTA 3MLSH 1AXTL 3O3UN 4AK2A 4BKLB 4Z3GA 2ILLA 1RUKH 1SQMA 1JG9A 5LBVA 3VA2C 4F7MB 2Q7NA 1A4JA 4NUGH 1IJ9A 4O2FA 3G5YB 3U2IA 2JFCA 3IS0X 5FGBA 5JLZB 1Q9LA 2KERA 5FFOA 1JRHL 4ENZA 1LP9A 3DOSB 2ARJB 4CC4C 4CU6A 3VH8A 1DEEA 5LBSA 2QLYA 1T2JA 5B7MA 1XGUB 1NLBL 2ZXDA 1HAUA 2BDNH 3ULVF 4KQ4L 4K94C 4HEPG 2NLJB 3EJYC 1BGXH 2LU4A 1B0RA 1HILA 1AACA 2F7QA 4GAGL 4OUOA 3PP3K 4FTVE 1LLAA 1D9KB 3SZKC 3QJZA 4F37F 2ADJA 2AC0A 4IGBB 4UV7H 5JUEL 3NESA 3W0WE 4H0IA 1ZWIA 1P4UA 3SHSA 4TRPH 5CKGA 4I0CC 2BHZA 1XFPA 3KHOA 3CE1A 1QKZH 1TJIL 2R2HB 2O5ZH 4Z5RA 1N67A 3FRPG 1UA7A 1BJ8A 3QISA 5FYLD 2R2EA 4N9GA 3V0AC 3ES6B 2YPKB 3MCYA 2F58H 4A7SA 3OMNB 4QT5B 1LO4H 4M62H 3DUSA 5LUMA 1N0LB 1R1CA 2EAEA 1MNNA 3L4TA 3SDCB 1NCOA 4RQQB 4HHAA 4ZOEA 2BZDA 4OCNC 1SMDA 2P8PB 3SYAA 1INEL 4I0PA 1FORH 5MI0B 3E1ZA 3P54A 5BW7A 1YJDC 4XO8A 4BA8A 3NDYE 1OGSA 2IJ0C 2VQ1A 1HH9A 3GC3A 4RRPA 2EDQA 2RB8A 4PV9B 4YVNA 2APSA 4PEEA 3QQXA 5L6YH 1E9QA 3JVGA 1TJHL 2VLMD 1QUNA 4KX9A 3KBHE 3RJOA 1NMAH 1NLDH 3VVWA 1JHKL 2EKSB 1CLYL 4OZ4B 5E2WL 2OJZL 3L5HA 4LMQE 4CSSA 2DQDH 3LYRA 4FKHA 3FT3A 5ES4B 1FFTB 3LQZB 1G7JB 3EGSB 2VLJD 3CVHH 1DVYA 2C3XA 2MOQA 3K91A 3FFCE 5IB2A 1OHZA 4WJ5A 2VLLA 3WFHA 4QY8B 1E4WH 4R5VA 4R5XA 1ZE3C 3S2CA 2JKWA 1H0DA 1X6LA 5DJ6B 3C09B 3JV4B 1ZA3B 1J86A 4GRLB 4B97A 2VMEA 1JCKA 5F9WC 1XBRA 3O4LB 1UQSA 1P9MA 5CILL 3N1GC 3GSQB 4HK3J 5ANHA 1PIGA 2HSIA 5D7IA 5EOQL 1UWEH 4KK9D 3OMIB 4RZKA 3RUGA 4HS6B 3ARDC 3CU1A 2NQCA 2V5YA 5ALCH 2H9GB 2GBUA 3HZKB 5E8DL 3QEHB 4RFNB 4I1PA 1CTNA 1BBDL 5IW6B 3ATDA 3P0YL 1WGOA 3UTZA 4AEHH 2GBVA 2IOMA 2KL6A 3WNPA 4F33B 2F58L 1WZ1H 3DYMA 3N50A 4PVNA 1U95A 3NCCB 1P6WA 4JO2L 3R8BB 4Q9CA 2IGTA 2A9ML 1W91A 2ZPKH 4IKKA 3NAAL 1ZE3H 3EYUL 4X98A 3H9SE 3MV9A 4UOQA 3VRIB 4KX8A 1HIML 1M3JA 3ARBA 3HB3C 5LCVL 4OFYD 4PGCA 3HFML 3KW7A 3T2OA 1BMWA 4HVBA 5IEHA 3EHBC 1PF3A 3QQ3B 4JFDB 3INOA 4YHKH 5LO7A 5D7JC 4PS7A 3FRUB 3DC0A 4G7VL 1BX2B 4ERSH 3SDXE 4AQ1B 2XWDA 5ILTH 1VGEL 2DW5A 2NY5L 1XF4A 1MJ8H 4OM1L 1U8JB 43C9A 3IJHB 5E2WH 5GRWA 5IB2B 5HHNA 1XF5B 4MBRA 1M7IB 2OTUB 4KY1L 4KNUA 2Z93A 1F8TL 3JVFC 4ZFOB 2GITA 4OJFH 3IU4L 4N0RA 1SJEB 5DD3L 5B1AB 1FZKB 1ZSDA 3UZQB 3IJ8A 3ZE2B 2OL3B 3GZQA 1MLCB 1L6PA 2VUOA 1QPKA 2O6CA 4Y4KD 4ICWA 1RUKL 2NOYA 1RUPH 5CBEB 4XP1H 3BSZH 2A6KA 3J27A 3KYMB 2XKNB 2QV4A 1KBBA 2DWDB 3SE9H 3HA0A 2BIQA 4MTMA 3QCVL 3V52L 3QWOA 1DJIA 3TYFA 2I27N 2UY6A 3EW3B 1T2QH 3X12A 4J3BA 2E6PA 3BVNB 2Y2WA 3DV6B 4GKLA 4GEJA 4X6DF 3L9RA 5IROD 1MG2C 2B4CL 4HIHB 1YNKL 2JKIS 4NM8L 3F83A 3MNZB 4LKXA 4OZIE 4FNPA 5IFHH 2J88L 4X6CA 2DH2A 3Q7JA 5AKTA 1J9TA 1AI1L 2WXGA 5I8EA 4F2MA 1RJZA 1EQWA 1T7VA 4B9FA 2DWEA 1MCJA 4XP9H 3VFGL 2LQRA 4XMTA 2QT6A 2XHNA 3FZUD 5DEFB 1S7QB 1CL7H 1T22A 5JPNC 5EC2B 4JPKH 4OFYA 1IT9H 3WUWG 1PEWA 3LCYA 1KOAA 1OPGH 5HGAB 2N7AA 4R4FL 1FZOA 1RJLB 1AE6L 3HE7B 3KZ8A 4LRNH 5C8JA 1AGBB 4AIZA 2VDPH 5IFAL 3KLAB 3P4NB 2ZCHH 4R7XA 2H4EA 3PHOB 4Z95L 1GCFA 4G3YL 2BRRH 2B1HH 1K3ZA 3HS9A 3QH3B 4OZFG 5ICUA 2AV1A 5B39A 2ICEB 3VYOA 1L9MA 1CGSL 1LEKA 4XPHH 4BINA 3T6VA 4FI7A 1NAMH 4ES8A 1YN6A 4PJ8A 4HUNB 4EUPA 2NNAA 3OXRB 4GQ9L 4N28A 5MHSE 2DBLH 3JXAA 4MA8L 2IBBA 3DROA 3MOBH 4ZMOA 3CFDA 4LDOB 3NFPB 1IL1A 2YD3A 2IAMB 2XKNA 4KJQC 4Y9BA 2IFFL 3U1SH 4AM0Q 3W5MA 4MCZB 2V3EA 1XR8A 4JLRA 2NX5B 3DPBA 3P4OA 3FNKA 3PWUB 2VR3A 5DHVB 1WV7T 3QQ9D 3ECWA 4YLQT 1C7SA 4PRIE 5B21A 1RZGB 1S2EA 3V95A 1WISA 3KPLA 1UH4A 3KDMB 2MKLC 4KDVA 4LPCA 3PAUA 1DL7L 5I1DA 3VCLB 5CD3A 4Z7OB 1W0WB 2WINA 2EDJA 3HUJF 1FZJB 3V0IA 4PLOB 4EI5B 2HJKA 4YZWA 3SYPA 4M43L 5IW1A 3F85A 5SWSE 3MOQA 1Z9LA 5GGTH 4D7PA 2ODHA 2HG5A 3D1MC 3RWGA 5GJSL 2V2WA 2Y06H 1OY3B 3G5VA 3SDAB 2RR3A 4X83A 5JPNA 1A0QL 4PJCA 1OKEA 4U4IA 2GQHA 4PY7A 4Q7DA 1EVTC 2EVIA 5F3HB 2FLMA 4Y16A 4MAUL 2CGYA 4C83A 3D3VA 3RX7A 3TASA 3R18A 3CFIC 5IVXB 3WIHA 1I7UA 4BHUA 5DUPL 2OP4H 1KACB 2JLLA 1QFWI 4WHTB 4IBQA 2OMUB 4H26B 5JXAL 1Q94B 1B0WA 4U0RB 4PJ6A 3UO8B 4JCMA 5L9DL 4E9TA 1AJ7H 3TN0A 5FYKD 1DSFH 1MUJA 2D3JA 1XGUA 4XH2A 1VGKA 4FQJH 4LLUB 2HUEA 3ROLA 5BMFL 5IT2L 5MP6L 4HIJA 4XNYH 4M48H 1SRDA 1NCNA 2BNRE 1GSKA 4G8FB 3BAIA 2NZIA 4DGYH 1MXGA 1MJUL 2DKUA 5AB2A 2E56A 1BVZA 4G8FA 1TT6A 2EZ0D 2LTQC 4AC2A 1EEZA 3F04A 2JJSC 5KW9H 2BM3A 1M7IA 3LEXB 4KI5C 4W9KC 4ZFOA 3L3HB 3IM1A 1HL4A 1LILA 2FGWH 3IDJA 7CGTA 3VGAB 3QUYA 4FABL 2VXUL 5T5FA 3QIBC 3S34H 5B7FA 3LRGA 2HRPL 2BCKA 4I2XA 4R7NB 5A16A 4MJID 43CAA 5D8JH 3WIIH 1UURA 5I30L 2FB4L 3AG4B 5CCJA 4XNQA 2H32A 5HYSA 4YFLI 1RZ7L 1GZQB 4OJEH 3ARSA 2OMTA 2VXTL 3FXIC 3APCA 3JWDC 4L8DB 3X1NA 4P46A 5DK3A 1TLMA 3GIZL 3L4VA 2PYEA 4H8QA 3HR5A 2P5EB 3GSXA 1AQDA 4GQPH 2X4NA 4OV6F 4DGYL 5ID0A 5C08E 3RWGB 4JFED 4K3HA 4Z0BL 5IW6A 4HZLA 3NPZB 4AMKH 2C9VA 3IETA 4PAZA 2BNQE 4ZAKA 1KTLA 2AQQA 4QJ5B 2OCFD 1MNUH 1XCTA 1ZHLA 3ARYA 4KDTC 4B9KC 1G4RA 1L7IH 1NBCA 1YNTF 3FO9B 3MLXH 3QO1B 2Z65C 4ZOCA 2VDML 2DL2A 3PL6B 1H3PL 4LLQB 4DGVH 4X8JB 2H0FA 4M7KH 2C4FU 32C2A 2CE6A 4OGAC 1V3MA 4QHLA 3MV9E 1YQVH 3BPOB 3UTOA 2LU5A 2EDNA 1N5YH 3PGFH 4APXB 3QZOA 4PRDA 3AC0A 2CKBA 2NMSA 3CLFH 1IL1B 2EADA 2IGFL 4PJ7F 2YWZA 4ZO9A 3CHOA 1UM6H 4K5MA 1UCTA 1GYVA 4JZJB 1KJMA 2CR6A 5IHWA 1IVTA 3OGOE 1BZ7A 2R1YB 3MV7E 3QQ9C 3KJ4C 1KXQE 3QG6A 1FVCA 2CBMA 5C0EB 1R3LB 2WXFA 5FYJU 5T5NG 1NSNH 4G8GA 4FG4A 2BWIA 1A25A 4L4JA 4DVBA 3RI5K 2DQCL 4ZZKA 3FRPB 2BRRL 4B41A 2V7NA 3DUHA 1A6PA 4TTDC 3SDAA 4KXDA 5DUML 5F8RC 2XWRA 1NZRA 4YBLB 3U9WA 1A14H 1PX8A 1UACL 3GRWL 3MRNB 4XCYB 2OJEA 3IDGA 4N0FA 3S3JA 1CGSH 4MYPA 4JQXC 4CADA 3FTSA 4PRHE 2YD4A 2X89D 1PLBA 5DYOA 1N9PA 5C0AA 5DA0B 2X9ZA 3HPLB 5AW7B 5ESVA 1JS4A 3BVUA 7PAZA 1HHHB 2MPAL 4OCRL 4RGNC 5LN4A 3D0LA 3TVMA 1SHSA 3FBQA 4Q4IA 1OGTA 3U4EB 3WN5C 2HKHL 4M8UA 1WDAA 3HN5A 1QEXA 5HJ3A 5EZJB 1BF8A 1EAPA 4QCIB 5IB5A 1OM3L 4MNHA 5E2JA 3QEQD 3VJ6B 3D12B 3NFPA 1YY9C 1SHXA 2K4WA 3MUJA 3MYZA 3FSAA 4BUGA 2YEQA 4KJYA 4PCKA 5E8NB 4YVUA 2ZOKA 3RPBA 3UTPE 5E1AB 4PR5A 1KF9B 1JI1A 3QNXA 3ZZSA 1AIZA 1RZJL 2G30A 5CWSB 1ZK9A 1CFQB 3EGDB 4KRPB 5B39G 1FZKA 1ZSDB 4PJGF 5FYJD 2C1OA 1EZVX 2G4EA 2SEBB 4PP1D 3TPUA 3LS5L 1NGXA 1TZOA 2N59A 3HNTH 2X4QA 3HC3L 3BPCB 4K7PX 4N85A 1JPST 4L4TE 3TLRA 5LGJA 1VF5C 3U7YL 4BQBA 5BZXA 3S5LA 3NN8B 3DIDA 4MCZA 3QIWD 3S98A 3TIEB 2ODIA 2GI0A 2C1PB 1UC6A 3W39B 2P26A 1DCLA 3EH5B 5EORL 2Z31A 3TZVA 3V5HB 2LFGA 1JXKA 3HG1A 3DDFA 5BZDB 2W94A 1YAZA 1CG9A 3BVVA 4K0OA 2ROXA 4NO2A 4X7DC 3TONA 1SGKA 2CDEB 2BRQA 1NLDL 4F8OA 4G82A 1N6UA 2NXZB 4MA1C 1OK8A 3RKDC 3X3FH 1UWGL 3GJEA 3VGBA 1SEBB 4PJIE 1SM3L 5EU5B 4L8CA 4FERA 1UCBH 4ZS7H 3G6DH 2WQVA 2ICWJ 2XTLA 2NW2A 3SGDH 3S6CA 4FQHB 3NZ8A 1U6AH 3G5VB 2JIXD 1E4XH 3CQFA 4M7LT 1J1XL 4S1QH 1AS6A 1Q9WB 2G5RA 3F7PC 1TJGH 3SPCA 3A0OA 1A7PH 5E5RB 2H9GA 1Q1JH 1O6SA 4G8AC 3KL3A 1I31A 1IKFH 1B4RA 3K71A 4D0DB 2QPSA 5TDOA 4E9YA 1TVHA 1FNHA 4PD4J 5CZVL 2DM4A 3GIVB 4ONFL 4F7KA 4YJZL 4HU2A 3LNIA 1TQTA 1EEYB 2QSVA 4X80L 4PJAE 4Y16D 4ZODA 4OI9A 3LPOA 4Y4KA 3E7JA 1U8CA 3D3VD 4E9LA 2X28A 3PWUA 1F4WH 3NVQA 3RTQA 4O02L 4E9SA 4F15B 3WEOA 3CSFA 3DX6B 5DZOA 3CQPA 4BXSV 2WKOA 1J18A 2DQTH 1TMQA 4JRYE 2AEWA 2V2XB 3CPLB 3H3PH 3TV8A 1P6FA 1KTBA 1UWXH 1JYWA 4ZUSA 1CU4H 2NNFA 3R1GH 5E8DH 3KYMA 4DKEL 4JY4A 2QTVA 3H4FA 4RNRB 1AZVA 3G6JA 3CU7A 3HG1D 1BOGA 3CV5A 3LD8C 4HQQL 5H4YA 4J23A 4WFED 3V0VA 2VWEC 2VZ1A 3GS0A 1KMGA 2ZSVA 5HDLA 3ABKB 4JDVB 3BFQG 2GITB 1ITCA 2N3JA 5IMLA 5MEOA 1PX4A 1CDUA 1QLEH 2PCPA 4XNMA 3WUWB 3D3VB 4XMPH 3CHPA 1IFRA 4AM0A 1BF5A 2FEDD 2ENQA 3MLUL 5DWPA 3BDYH 1UHVA 3LNDA 1QYGL 3LRLA 1F6FB 2YQ3A 3VFRB 5DFTA 3PDOB 3JUYA 2P5WB 4OCSH 4M6AA 4H8HA 5D7IB 4MWFA 3CSBA 3RUGF 2KBGA 3ESVF 4Z7OF 4Z5RB 5A2KH 4MD4A 1NC4D 3R1GL 1J1XH 4S1QL 4U2YA 5LBSL 1NMBH 5FDWA 1TSHA 1GR7A 2Z8WC 3D25B 2BW5A 2K45A 5J1TC 1QHOA 3I6KB 1FZJA 3IN2A 5JIMA 1DBML 4DP5X 1A65A 1VPOL 1U3ZA 1FRGL 1S7VA 1F4HA 1I8LC 1CL7I 1SLXA 3MV11 3QUZD 2IPKA 4FF9A 1UH2A 2PTUA 5EU3B 3PWPE 3SKUD 5FO9A 4LSUH 1OCWH 3UPRB 1Z3RA 4OU3A 1HE7A 2BW4A 4IMKA 4WUKH 1CBVH 4JUSA 4R2GD 2IWKA 3CFBA 2FH6A 3O6LL 1SJVA 3O41A 5B22A 1ZVNA 4XPAH 1W9XA 4XWOC 2DY2A 3OJ2C 5B1BB 1JRHH 2EIZB 4NQTA 2FJHA 1J10A 2A77L 2P5PA 2Z92B 3CDGA 3UEQA 3VG0L 2CHWA 2E9WA 2NR6D 4WNJA 3AS3A 4WWKC 4YBQC 1MCFA 3A6BL 1GC1C 3DO7B 2BSTA 2Y6SD 5EZLB 1S9XA 5FYJE 1ROCA 5ITBL 3OZLA 3RLSA 4MAYC 4PGBB 4Q0XL 1DQDH 3FT0A 2E7DA 4OQ1A 1WEJH 4PWJA 4YH6A 4RESB 4LP5A 2VC2B 3ORJA 3IAPA 1D5XB 4HT1H 2HVKA 4L29A 2CDGB 5I1IH 2Z3FA 2J73A 3GXTA 3BP5B 1BZ9B 2VO8A 3IJYA 5SWSA 2BVEA 2H5UA 2VDNB 3QXAA 4L37A 4UT6A 3GBML 5IMOA 1DR9A 2BHYA 4XMPL 4TVUA 2Z92A 3CDGB 2QR0B 1FYHB 1QBLH 2YN5A 3DBXB 5F96H 5BQ7B 4R9HA 4N6QA 1A47A 4NM4L 4MBOA 3WXVH 5E6ID 3WNLA 1HXMB 4BZ2H 2Q76A 4PCSA 2DD8L 2BJML 3HE7D 4M61A 4NUGL 2NXYB 4XMWA 3TPKA 1FNEA 3AY2A 4U1GC 4W93A 4OFKA 4LU5H 3P40A 5I9QC 5GHWL 3BRDA 2B2XL 5DI8B 5F1OB 5FM5M 1GA2A 1X3DA 2I9LA 2IQ9H 1HEJC 1M1XA 1IQWL 1PW3A 4BK8A 5GRZA 4F57L 4DERA 1N59B 3GPEA 2Y1VA 1E5UI 2J8HA 1PZBA 3K6FA 3MLTB 2DWYA 4HAFA 2BC4A 2AJXH 4LOUC 2WOYA 2YRZA 3QCUL 5D1XC 3SDYH 2AP2A 2CKNA 2KPWA 4AKOA 4QJ4B 4HCRA 1T20B 3GJFA 4GP5B 1MF2H 1JGEA 3CMOH 2E75C 4PW9A 3PJSB 1I8KA 2WVVB 5JHDE 4PGDA 3WLWC 1S7WA 1PFCA 4YE4H 4F9PC 2X2YA 5JQ6L 1HQRA 4LSSL 5CGMA 1IILE 2HT2D 2XRAL 1BAFL 5EU6D 1NBVL 1G7JA 1IGCH 3GSNH 4LCWB 1XF5A 4X8CA 2NLJA 3TESA 4Q9RH 3NCJH 1WO2A 3B2UC 3CMGA 3OPZH 3PGCB 4PRBA 4YXLL 2W07B 4URKA 5A6IA 1PEZA 3C6SB 1ETJA 1GGBL 4JG0L 4L8SC 2ID5A 2EDRA 3NFNA 1TSRA 1QBAA 2VDQH 5D7LA 4CGTA 2NNRA 2VC2L 1SOSA 4FEIA 2XCMC 2W9EH 1RSYA 2COQA 2FEEL 4WI7A 3W9EB 4PUBL 1FHNA 4WI3A 3LMJH 1HNYA 2XETA 2KZ1B 3IDXL 4QXGH 3RZCD 4YHZL 4BSVB 4PJIA 4DKEH 1U3HC 1SVBA 4QHKI 4Y1AD 5HGHA 3O6FC 3S3DB 2R59A 4IRJB 3DBSA 5EWIH 5AOZA 4DAGL 3QB7C 2E9JA 2V7HA 1AZNA 1DVQA 3CX2A 4MRCA 1MHHB 3HCVB 3U9UB 3TBCA 4B60A 4JKPH 4M7LH 2AZUA 4FMFA 3F7VB 3PQYE 1UWYA 2HLFD 3GMNA 3MJ6A 4XNZB 3P30L 2QTEA 4YNYB 1WFOA 2HX9A 3ZQWA 2XFGB 2X7LB 3C9NB 4ZFFB 4HIIA 3TNMA 1H8SA 4LOVA 4XMVA 1BQ5A 1AVAA 2ERJC 1R3HB 2AMGA 2GT9B 4B9GA 2R4RH 1T0NB 2A9NL 3IDNB 1ZXQA 5T1KB 1I4FB 1JGLH 3NJVA 5C0IB 1BZDA 1XEDA 3L3DA 3NSCA 5D2NA 1NICA 4UANA 4BZYA 2HKFH 3NCXA 1T04A 3B8YA 3FT4B 1OCZB 2QGBA 4AZ8A 1HINL 3QWQB 3MA9H 3VFTA 4C4KO 5CD5C 4KUZL 2IWEA 2B14A 5BZDA 4QRAA 2JKNA 2HPOA 4L9LC 1X9LA 3CZUB 3N0AA 4AMKL 2Z64C 3H55A 4Z77A 1JPSH 2HH0H 1CD8A 2B1AL 1BIHA 2OCJA 4Z7VF 5BOZG 3N0PB 1C9SA 1T0MA 5D7JB 3RWCA 4AKQA 1XXDC 2OMXB 1TQWA 4S1SL 2X6CA 2IAND 1MFEL 4P46D 3WGUB 2D8KA 3BKML 2XFXA 4HOWA 1GGCL 1TQCB 1QASA 1PY0A 4PGBA 3WUZA 4BUHA 2V0AA 2AAAA 4PJDA 3O4LE 1NGXB 2YC1B 1N64L 1KIPB 3Q48A 4Q89A 4DO4A 3LDBB 3UYRL 2XQBL 4AW7A 4AZ8B 5GRJL 2IALA 3DJSA 4DPBX 2VN6A 3S37L 1F3DH 2B5IB 2MHAA 4UM9B 4ZMAT 1ZHNB 2EINB 3TT1L 4MMYA 3TBYB 1G5AA 1ICTA 3B2MA 4TLKA 3UL4A 5E6YA 4HZLB 2IWGA 2CKBH 4L4VB 3MRCA 1QSFB 4LAJH 2GB2A 3G6AA 2IH8A 2XIDA 3TEXA 4Q52A 3MJ9L 1GOHA 2CO4A 1V7ML 2V2TB 3O6ML 4FFWC 5F1NB 1COBA 3WFDH 3MRKB 4LVOB 5EZJA 4K15A 2IF7A 5IVZB 3FQWB 3VXUE 5HDOA 1E5AA 2UZYA 2X4OB 1Q4NX 3ZKXC 2EVJA 5SV4A 4NQSA 3V4VA 4JRXD 1AOZA 3L5XH 4AOFA 2FD6L 1A4KB 1U8PA 2PW1B 4M6OL 3ILQD 4S11A 1A5FL 3FB8B 2BSCA 3QZWG 1J5HA 4PJ5E 3TA3A 5JYLA 1BEYH 4JHAH 2A6IB 1J0KA 4LHUG 3F00A 3HE7C 5IOKA 3OF6D 3H0TB 5I76A 5E6IC 3UBXG 2WBXA 3MRJB 3Q6FB 1D9KC 3SSGA 4E5XG 5KVEH 2YD0A 5DVMA 5B38B 3MJ8B 1W0YT 5L4IA 5TDPA 5DMKA 5J8OA 3RG1C 4WCYL 4UB0H 3EG9A 4PJEA 1N7ML 4JKNA 4R4BA 1K6QH 2A4EA 4H8UA 4MXQC 3TFKD 1NCCH 1RU9H 3NA9H 1A6AB 4FQ2L 2ZNXA 2D73A 4XNXL 1JOIA 1SVZA 4K3EH 4DNLA 3QC6X 5AW8B 4GKNB 3RPKA 1MCLA 4W4OC 4BK5C 4IEFB 4MAYB 4O02A 2XRAH 5GGQH 4QEGA 1MCBA 3N3EA 3F05A 4M8RA 3V79C 1AC0A 2CRZA 2Y5EA 3PLYA 3G04A 4WWKD 4EI6B 4F7TB 1FGVL 2VXTH 2KLTA 4OD3L 2ZX6A 3STBA 1GAFH 1RZ7H 5H4ZA 5ADPH 3WG7B 2YARA 1IC0A 4LP8A 4EE2A 2JCCE 4OLUL 2FWOB 1JNNL 1BIIA 2VDMB 3PS6A 5ECGA 1TDQA 1CFSB 3HE6C 4O58L 3UPAA 3DO4A 1PX3A 1ILSA 3CFEA 3DRTB 4BWWA 4UU9B 1MFDL 5KJ7E 2EO7A 2EDWA 2L7QA 3F62A 3KL0A 2V2WB 2XPGB 4GRWB 3ECBB 2UVFA 3GMPB 1P69B 5IQMA 1CXIA 4BGLA 3V7AG 2VXQL 1KNOB 3GZOA 1AH1A 4LCWE 2FE0A 5BZWB 1IX2A 1ZTMA 5DC4B 4IS6A 2O61A 1HI6A 3KBFA 4M5YH 3FAXA 1N8ZA 1SUJA 5B1CA 3VACA 3T77A 1U4EA 3EHBB 3LQAH 3I2CH 5I6OA 1RLBA 2GAZA 3NZ8B 3C08L 2R56H 3ZKSD 1B4TA 2MNWA 1FFOA 2D7QA 2IBGA 2XA3A 1U33A 2Z7UA 3DRQA 3FPYA 4OLXH 4R5TA 4IOFC 1KBVA 1Z9PA 3FFDB 2EECA 2Y3AA 3D4ZA 5D4JA 5AW5B 3LXAA 4YHPA 3KYNA 3HAEH 4P57B 3SPVA 1PLAA 4EN3A 2R69A 2DJSA 1ACCA 4PRPA 3G9AB 3FUEA 1T1YB 3DJ9A 2BP0A 4LQFL 3EDFA 2VLKA 3AY4A 1LQSR 4R4NC 4KKZA 3CBRA 1QFWL 1TQSA 1CL7L 1HWHB 1TQVA 2VN4A 1U36A 1T1ZB 2VDQB 4IIQB 4OLWH 2OFQA 5D2NC 4CGUB 3EYSH 1HOCA 3CBJB 3FQUA 5FFGA 3TBSA 1JUFB 3H9HA 3VUAA 1S7TA 2BS8A 3UC0H 3WLBA 3NJHA 2DDQL 4O51B 1BXXA 1ZRUA 3GHPA 4NHCL 1GTFA 1RURL 2FO4B 4G9DB 4Y4HC 4YDJA 4MNQD 3LKPB 2HT2C 3SO3B 2WXOA 5F88A 1M05A 3PREA 4IK6A 5BJTA 4ZTEA 1F41A 4LOEA 4FQ1L 3NRQA 1U3HB 1J5IA 5BVPH 2N7SA 6CGTA 2DZEA 4LL1A 5K1JA 3BGMB 2YPLB 3DV4B 4ZXBD 3WJMA 4F3FB 1MWAA 5BV7L 5KAQF 2YA2A 3MACH 3V5KA 1HHGB 2L4OA 5INCA 2WYZA 1L6ZA 5JW4Q 2ZG3A 1S7VB 2MCPH 1KT2A 4LPTA 4C4KT 4D0BB 2IFFH 2QGDA 4RGMC 2OMNA 5AW0B 4EI5C 3MJWA 2O6DA 1A4BA 1AI1H 4Y16B 3OX8B 3F7VA 3H9YA 5C0GA 1G43A 2AABH 2HFGH 1HQ4B 3FQWA 3ZTCC 1IB5A 4L1HA 5E2TH 3DO3A 1BFVL 2DH3A 2NR6A 4MB5A 1QRNE 2APTA 2ZWLT 1IEBA 2WLYA 2BJMH 2DLEA 1ZA6B 3QA3A 2FJUB 1BAFH 2FBRA 1P9MC 4G9FB 3QAQA 5IJDC 2CIIB 2L7JA 5C2UB 4I0PC 5AWNH 2AXGB 4YLBA 3VM7A 5F7WC 4JKMA 2VLKD 1CYWA 1KN4H 2JWYA 4MA1B 4H0GA 3ATFA 1KPUB 2BOLA 5D93C 3S96B 4LCUB 1UXSB 3WTSA 3WENA 1AZCA 5EZLA 1J0ZA 1F1GA 2Z93B 1U58B 3X1GA 5A43C 1KB5A 1DTUA 3QCUH 4LCCC 4MMXC 3MRDB 1HE8A 1SNRA 1EMTH 5E56A 3IU4H 5DD3H 5DVNA 1E8XA 3T4YA 5DS2A 4NZTL 3KLHD 1JERA 4PS8A 4WEEA 1QI4A 5HSFA 4JY4B 1UUSA 1YYCA 1RCYA 2HFTA 3Q9QA 2A6DB 3FB5B 2E9BA 1TJXA 1GL4B 3Q3GB 5DQDH 2GVYA 5DHYA 4Z7WB 5I71B 5JOPD 1T21A 3ZUNC 3VMPA 1TITA 1P7QB 5FO8A 1H3VA 3QUKB 4KRPC 4U31A 1PKQB 2CLZA 3DGGA 1T2QL 3FUKA 4FJZA 1LE5A 2FHBA 4R7LA 5F3HA 1GGBH 3WS6C 2OI9C 1CF1A 4MA8H 1F3JB 4U4BA 4GO6B 4PJIF 3UG5A 1OAXL 1BD2D 1VIWA 4OGXH 4PWFA 1H9DA 1QO3A 3K6SA 4NQDE 5C08B 4AGOA 1CYGA 2W9DH 3FTWA 1KYAA 3PNWA 4DP2X 4ANWA 4BGDA 5D6DC 1DDTA 1DQDL 1I3VA 1N59A 5DVPA 2CO6B 5HGDB 3UP1A 1A1MA 3V0HA 1I9IL 1WLHA 2GEEA 2WUCL 3MOAH 4HJJL 1A7PL 3J7HA 5HGAA 2YSTA 4GI8A 3U9PL 2B0SH 2QQLL 4P59L 1B0GB 1QSFE 1QZNA 3N43F 1TPXB 2B1HL 5EFIB 5HHPB 5H94B 3LXBA 4X7FC 1U8NB 4HWNA 4URTB 2V7HB 2ICES 2RALA 1BWWA 4KKLD 1EVUA 1GVIA 3QJUB 1C8PA 3A6BH 4P99A 5B8CC 4JPQA 2AK4A 5FLVA 1E27A 1GC1H 1KEML 1YMMA 3NDZE 3NJKA 3V6ZA 2EEFA 3FF8A 4RGMB 4W9JC 4KFZC 5L4JA 1PDKA 2FEDC 4YHKL 3QRBA 4X8XA 4P2OB 5HVFB 1EZSA 5D2LB 4CU7A 1SVCP 4W9ZA 1EV2E 1S78D 4KTDH 2YAEA 4HWBA 3TA3D 3WFEL 4Z77B 2OMWB 4HJEA 1JMXA 5DRWB 4MMXA 5LNEA 2ZUTA 1OARH 4CN1A 3QYMA 2YMOA 5E8OB 3TT3H 3RVVC 5ALBL 5GZOD 3OZ9L 3WKYA 1AS8A 1QOKA 5KYUB 4GH7B 2YEVB 3GMRB 2WIMA 4TSBL 1RZQA 2EE6A 4OZ4A 5EEWA 3TCLB 1RULL 4F7PA 4EN3D 3NIDB 3LZLA 3MV7B 4KC3B 4XP4L 3SDAD 4CMMA 3UYPA 2Y7MA 2J1YA 2JNZA 1ZT1B 3QUYB 4Z7NB 2C7FA 4ZSOA 4GUQA 1LO5B 3KXFD 1SJEA 1JMZA 4NUQA 1ZS8B 3KPSE 3QWNA 3P3UA 4N8UA 1RUPL 3ZZLA 4YDLC 1H19A 1ZMYA 1AR1B 2G9KA 1MH5B 1AGBA 1YEKL 1K8DA 2LHAA 3T2LA 3MLUH 3ZDYF 4A6YH 3BZ4B 3H9SA 1ZT7A 4XGZA 5A2FA 4UT9H 1ZLVH 4HWUA 4P2OD 4YSTA 5KYUA 5DC9B 4BM7A 5LDUA 4NN7B 1L3WA 3LPFA 2AXFB 3KLSA 1CTOA 2C4XA 5JR1L 1HQ4A 2EEXA 1RK1B 5IBLC 1M6OB 3FBKA 3FHEA 2HKHH 2X53A 4P2RA 1TIUA 2OMZA 1MDAA 3O2VL 3GSUB 3NCMA 5LWYH 3UBHA 3K81A 1VZIA 3D25A 4S0HA 2PCYA 3NUKA 1HSAB 1NBYB 4Y5YB 5GRYA 3IWVA 4ODWB 5LXVA 2M8XA 3UTZB 4UQ2A 3ETTA 3MRHA 3O6LH 3CSTA 5T3XD 2WSDA 4LARH 2UXGA 1XGRA 4LSUL 4P5MB 1AGCB 4MJ5B 2MQGA 3V7MA 1DSWA 3X3FL 4XXCC 1KEMH 4JFYB 5DUBA 3E6FA 1J8HE 2B20A 1CDYA 3ERXA 4L3CB 2HLEB 1BZOA 5L7XH 2EACA 3QDGB 2N4IA 3WKML 5I0WA 5LGJB 4YHNB 3IRCA 3U4AA 4ELMA 3IWUA 2XV0A 5E6UB 1KPRA 2XV2A 3OKLA 3QI9B 4K3JH 4JAMA 5CEZE 3O4LA 2NY4C 5L2KE 3DX8B 4FKKA 4NQUA 2PR4L 4HS8H 4G6FD 5L8JB 3U7YH 1NKRA 3QIBB 1ADQH 3DGGB 4IIQA 3U6XS 1QAWA 3CK0L 4FA8A 1YCSA 5C2BH 3EYFB 1KN2L 2QKIB 3A6OA 1IVLA 3MUUA 3CBKB 5C0FB 3X14A 4MKTA 4X6CE 4R6UA 3V4LA 3RFZB 5ESAA 2QDVA 2EXTA 1KTKE 1CE1L 1SYVB 2H47C 4N0CC 2L7EA 1UZ6F 3IT8D 2PXYA 4K5OA 4HZ1A 3T0EC 1IV8A 3PXHA 3HG1E 1UCBL 5DJYA 4Y5XC 3OX8A 2VRKA 1T4WA 2ITEA 5ID1A 4OKVB 2OTWA 5F7DB 3D0LB 5IM7A 5DMYA 3O2DH 3D0VB 4U6VH 1JTOA 2YPLA 2C7UA 1TYEB 5L4FA 2BWDA 1Z5LA 1AAJA 1WT5C 2GIMA 3CZNA 3PHOA 4QF1B 5B4MC 4IDJH 5GRVL 5KUMA 3RVXD 1MWAH 2G60H 4ZDHA 1O6SB 12E8L 2F7RA 1AYRA 3N1QC 1BZ8A 5HI4C 3PCYA 4FS0A 3KJ6H 1AGDB 2R0LL 3AABA 2XWJB 4LL4A 5EU4B 4F24A 3FU7B 3T0ED 3L4XA 2WQAA 3QJXA 5DHEA 1FPTL 4WTZA 2V9RA 3RDTB 3ZE0F 4NRXB 1AZUA 2B77A 4XX1G 5I66B 3QWRD 1MI5B 5DMIL 1ZTXE 5E1GA 6FABL 4QXVA 5BRQA 5C09B 4NGHH 3IGAA 2TAAA 4U3CA 3Q1EA 3MA7B 5CJ5A 4LHUA 3VFSB 1X5MA 3EOTH 4LNRA 1TUPA 4OQTA 1H9VA 1H3GA 3RZCB 1CCZA 4QHUA 1E3ZA 4BBWA 3LQZA 1JPGB 3P0GB 2J8UF 3I2CL 2J20A 1NCIA 3BEWA 4DO5A 1EJOH 3IKCB 2BFVL 2UV3A 1MW1A 4A68A 4PJ8C 2H1LM 1C1EH 4J6RH 2J56A 4LGSB 5D7SH 4DKAA 2GJ6E 3BKJL 5JZ7C 3NCBB 4NQVA 1MFAH 1EFXA 1UASA 3WS3B 4D8PA 1MFBL 3MBEB 5D7KD 4BH8A 2IO5A 4GSUA 5F7EH 4N1EA 1JPFA 3L3OB 4R3SA 1SY6A 1UACH 3GRWH 3TBSB 4AKPA 4EAEA 5HY9B 1UFGA 4Z3FA 4K2UL 2ALWA 4PHXA 4YR6B 1N0LA 4NB7A 1RURH 4K9EC 2OXGB 5F93C 1YEHL 2VLJB 4ZMZA 3PWPD 4U1JB 3MRLA 3SO5A 3WELA 3MJ7B 3QFGA 5D7IE 1J1OH 2X6VA 1T83A 3DXAB 4KQ0A 5B7EA 1UOVA 4JREB 2ZOLB 1G7QA 3NJGA 1K4CA 4CW1B 3QBTB 5HI4D 3EJZD 3H2WA 4N90D 3TWYA 1OVZA 4WW2F 3Q6GL 4L5FH 4P2QD 1K4CB 5IMKA 4UM8B 3IGFA 1SFDA 2ZG2A 4MDJB 4B3EA 5DA4A 3KWVA 5F1NA 2APXA 4MJ2A 3NA9L 4X5PA 1AQ8A 3IDYC 4OF8A 4G6KH 3PABB 4YC2B 3SPIA 2WLZA 4GG8A 1YMME 2BK8A 1KGJA 4K55A 1W72A 2RQEA 5CHNB 3T1WA 1GJUA 1NMCB 4LSQL 4KJWC 5I23A 3RY5A 1OTTC 3JWNC 4UQ9A 2KLSA 3UG3A 3EJQA 3QDAA 4W9CC 3UDWA 5KSAC 1CMOA 4KMLB 3X1FA 2RAMA 4K7PH 4DGVL 3HG5A 2EDEA 4ZMQA 1U4FA 4OBSA 2XWTB 3CSPA 3OKEB 3OVUB 4CJ1A 2D0GA 1BM3L 4FL4C 2VDLL 1T4KB 3W38A 2V2XA 4ODHL 4R8WL 4ZNEA 4NWUH 3ATBA 5HDBB 3SPHA 2JELL 4O51A 3CHSA 1NDMA 1ZIBA 5M95B 4HIJB 1JXJA 3QRGL 1GY2A 2DEWX 4Y2LA 4YDVA 1NH6A 1ZJBA 2C34A 2YK1H 3HMXA 4A2FA 1A8JH 3O9WD 4JM2B 4MQSB 3T8XA 1Q9KA 4HPYL 4OZHE 3VXSD 3SGEI 4KOCA 1W0VB 2GBTA 3WO4B 2J2ZA 3MI6A 2H0PA 2XN9A 2EZ0C 3MLZH 5HGBA 1B4JH 1VAHA 2GI7A 4AUJA 3QIBA 3FHAA 2CKBL 2X10A 3LRKA 5F7YC 1JHTB 2A5UA 1OGAB 3IEAA 3U83A 4FLHA 2GTWB 3UBXB 3FU6A 5KBMA 1RZJC 4CILA 1J8HB 3BWUF 4KJYB 5E8NA 1HCFX 4FQXD 1T0PB 2QMKA 1E4XI 4PRID 5I1EH 3MRCB 4CVZA 5EO0B 3QAZC 5IMKB 4PJHE 5HJ3B 4JQIH 3FO9A 2F5BH 1S8DB 1O0VA 1UZ6E 2NZ1A 2X4PB 4K5NA 5D4QA 4ZX5A 4L1SA 3HC2A 2DJUA 1QBBA 3CFNA 4HGMA 1JV2B 3OAZH 4S1SH 3MODH 5AB0A 3VB8A 1U2YA 3ZHNA 1T22B 2ZKHH 3ESUF 3IMSA 4MYWB 2EP6A 3RHWF 4AXWA 4XWGL 4Z23A 3GJFK 3ASNB 4TPRL 5KW9L 1NBYA 4Y5YA 3B2VL 3MBXH 4ETQB 2P24B 2E46A 4NM8H 4A39A 3JTTB 2DI7A 2X0VA 3TBWB 3EYOB 1JV5A 1YNKH 3VI4B 4NCC1 3SY6A 1PNCA 2LABA 1UM4H 5JO5A 1P2CB 4G1EB 4ES9A 1BSIA 2VJ0A 5EO0A 1NGWB 2OP4L 1AFVL 3B5GA 4NUPA 5I75C 5JHDB 4QUOA 3FQYA 2NYYD 4QTIL 2CGRL 1QWNA 4DQAA 3KLHC 2WTPA 1D9KA 3KNBA 4HCFA 3UIZA 5JXAH 1KXTA 5L2KA 3NFNB 4F80A 2CCWA 3ZU8A 1HTYA 3FTGB 4ELKA 2ED7A 5I6NA 3V6OE 1D7FA 2BY2A 2DS4A 5C0NC 4GI6A 3O0RH 3KAAA 2NTFA 3AB0B 4GG6B 2X1QA 1CICD 4XC3L 1I3RA 1ZS8A 3N41F 5ANMA 3RZCA 2E27H 3GMLB 3PPEA 1CDIA 1BQLL 3AREA 4GQRA 2W1NA 5HHNB 2DPKA 3RVVD 4WHYG 3VRJB 4W4OA 3GBDA 3ARFD 3I9IA 1S3KH 1TQBB 2ARJQ 3ARDA 3BE1H 5IHUL 4J2QA 3UROR 2BXYA 2YAFA 3VFNA 3FB7B 1D6EA 5BNXD 1G6RL 2EIMB 2UXFA 4OLVL 4JFPB 1ZLUH 4FC3E 4N2OA 2YKLH 4TNEA 4QRUB 4QXGL 4R7DB 4IBTA 1DFBH 5JPMB 2JIXB 4JFDD 5FUCE 5BS0B 2EIDA 1C1EL 1TCRB 3BH8B 1TZHB 2GJZB 1N18A 2XIIA 4J6RL 4NQQA 4WU7B 4U6YB 4JFFA 2F1BA 2QVIA 3NAAH 4UILH 3MODL 1G94A 5DEZA 4QDGA 4RFNC 5F21B 4TM9A 1ZLVK 1EHXA 4FQPA 4U1NB 1G9HA 1S8DA 3IDNA 3VW3H 1UEMA 1CICB 5IGXL 3D18B 1HN1A 2KS0A 4TN9A 3LH2L 2J25A 3ARGA 4DEPB 5F9OL 3I9AA 4Y4FA 1VFBB 2R2BA 4QR7A 4YBHA 5IESH 1AKJD 2R0ZL 2XC8A 3NG5A 2GJ6B 4QRBA 2ATPA 2XKSA 3UAJD 5AB1A 1R5WA 4V2BA 5DMIH 1P4IL 5GGVY 2IANE 4M1GH 1NCUA 4LSRL 4EUPG 4N0UB 1BP3B 1P1ZB 2X4TB 3QORB 1LDSA 1XWVA 2R1YA 2PCFA 1W6LA 3WSQH 4ODVH 3LNFA 2FEJA 2NY7L 4OGZA 2UYLA 3QS2A 5I71C 4WKZA 3RWFB 4PTUB 4X0NA 3QWRA 1NCBH 4PN6A 3IMRA 1UOKA 2JTDA 2APWA 1Z0NA 3WFHB 5DEGB 3S3SA 1GPOL 5ECJE 5D7JA 4FTDA 1KB5L 2WQ8A 3RVUC 4FFYH 4M43H 5TE6H 1YG9A 1DP0A 2ZUYA 3B9KC 4RX4A 4N9OB 1QNZL 3CDZA 3CN2A 4FHJA 2L04A 3OBAA 1QNIA 1TVBB 2OYLA 2VZUA 2ZSWA 1XO8A 3FL7A 4ZPTA 1UENA 2Q2EB 4KNSA 3KS0J 2QGEA 4WDIB 1PG7H 2CO7B 3O9WA 1KIRA 2AJSL 4BKSC 4PBXA 5DUJA 5KS9B 3WDHA 4MXWL 1QA9A 1RPKA 1NC4B 2HJFA 1RD6A 3OWEA 3B1TA 1H6FA 4FHBD 2IQAB 3GI8H 2DRUA 2ZCLH 4YDKH 2WO4A 5FKPB 3QSKB 4U1NA 3VD2A 1I7UB 4X4ZA 5IQLA 5JXEC 3US0A 4GBXC 5DO2C 2EE2A 3L3KA 4H5SB 1BVOA 2VE6B 1OLZA 3LEYH 1RJLA 2DLFH 3Q6GH 4JFFB 5GGRY 4Y5XA 1E6OL 2A9AA 5EOCL 3KWTA 5TF0A 1IKNC 4I85A 2R7EA 1FN4B 2CWRA 4N3UA 3K0YA 3VFMA 2ZWKA 4C56E 1NEPA 4ZQKB 2XZQL 3DUUA 3MFFB 4TSAH 3VMOA 1UD2A 2BMKB 4O2CB 4MS6A 5KTEL 15C8H 4Q58C 5C6TH 5SX4H 2NY0C 4UT6H 4UOZA 3Q01A 4DH2A 4MA7H 4XR8C 1MEXL 3VXTB 1YYLH 1CXHA 3UAFA 2G0LA 3L3HA 4Q97A 1L0PA 1K85A 3FFCA 4BFKA 3TYFB 3KH4A 3LKOA 1G6RA 3KVPA 2A73A 4UQIM 2R0WL 3QEQE 3ZOAA 1AQHA 1OD9A 1H8OA 2EIZA 3P3TA 4JLRB 1UVQB 1I1AB 3UTPD 1PZ5B 1X5XA 3GMRA 2LTQB 5JR1H 4JJOA 3U46A 2IWFA 3KNBB 1ODAA 1S9KC 2KDGA 3GLAA 3NJJA 4PRHB 5HHOB 4QHUB 2VM3A 1U8IA 4GXUM 5B1JA 5AD0B 4EOWH 2DQEL 1O6VA 5HD8C 3W0WD 4DP6X 3V8CA 4G5ZH 1TTBA 3MNVA 1E9OB 3VGEA 4XC1L 3GXPA 2HRHA 3O3DB 3JWNE 5DGRA 1F90L 1YYML 2KYIA 3TIDA 3ZDXB 3ULUD 1YHPA 3I50H 5IK3B 4J3XA 3ARED 3NZSA 5HVWA 3K1KC 5EIIG 3ML9A 1MLBA 4PJ9A 1TVHB 5EH1A 3IJEB 3CZGA 4R97B 1FN4A 4JJ5A 3T0BA 1KCBA 5LQBL 5D1QD 3MUZ1 4GXVH 4UINH 3PXLA 5HGDA 3EO9L 3L3KB 2GYSA 3IBEA 1S4IA 1KC5L 3FQRB 5AFAA 3QXDB 5L8KB 3U0PA 1YPZA 5TDNA 3T77B 4K8RL 4HXAL 2JSFA 1T6WA 4NQCA 2OMVA 4P06A 5CSGA 1GC1L 3U2SA 3ULSA 3KR3L 3PP4L 1ONQB 4FG6D 4RNRA 4MA7L 1BFOA 1PS3A 2K3TA 5AZEL 5I75B 4HV8B 1MFVA 3MV9D 1RUAL 3UH8A 4NN5B 5I1GH 1DJYA 3DROB 4XBEH 3POCA 3US9A 3C60D 1DBMH 1UQSB 4YDVB 4F7EB 2CGZA 4BYHA 2VLKE 3IFNH 4HISA 4EUPB 4OCYH 4HEMA 4ADGA 1H0DB 3QDMA 4IJ3C 4NFDA 5CSZB 3BSZA 3MYJA 1TCMA 2B0SL 1QEWB 2QQLH 3OZKA 2KI6A 4LCIH 4LSRH 1EXGA 3VFUA 3WHXA 5MENB 1ZGLB 3OKEA 1S78C 2AQRA 2BSTB 2W5PA 3GSOB 3H54A 3NIFF 1A9EA 4LSVL 3NQIA 2AJVH 4LCUA 4Z7WE 1RZKL 4EQ2A 3FTUA 3BAYA 4XHJC 3V0VB 5F6HJ 1JF1A 3BI9X 1T5WA 2F15A 5KAQG 4GAYA 4Z7QF 2W65B 4B27A 1LTXA 4IBYA 3VU1A 4F2ME 3GUTB 5C7XH 4HHWA 4ZFZA 4I5BB 4KJPD 1TNNA 2NY5C 1ASQA 4PJ9D 5BV7H 5KSVB 1WZAA 5IJBC 1RSFA 1U8KB 3DIFA 1DQTA 3MKGA 1S7QA 2MTAA 2OR9L 2Z34A 3HPJB 2QSCL 4QRSB 4WUUB 4U1GB 3V6FA 5MHSD 4P4RB 3MLWL 5I5RA 5J13C 4NWTH 2G75A 2OZ4L 1QI5A 3CHRA 5EU5A 4ODXA 4L8CB 5JNYB 4X98B 5C86A 4ODUA 5BUPA 2R1XB 3O2VH 1KNOA 3P4LA 2IEPA 4KMTL 4NUJB 4FXKC 5I6LA 2EXYC 3Q8CA 1TF4A 5IROA 1U3HD 1DJWA 3PWVB 2WNXA 4JN1H 3FSVA 4OKDA 1Q1PA 2KDYA 1EIBA 4NQDD 5IQ9B 2MKWA 2YWYA 3GIVA 3T8VA 4AG4H 4LCCB 4PM1A 3BP6B 4BE6A 3KCWA 3QIUD 5B8CA 8PAZA 4L0PB 4JZNA 4Y5XB 1VACB 3AXHA 3L6FB 1FVDA 3NEXA 3ZDZB 4F8TA 2GC7C 4IJ3B 4ISVA 4A6YA 4AUYA 3QXVA 3MNMA 2ZUQC 1URLA 3ABGA 3KPMB 5CP7B 3DHJA 3JTSB 4UI2A 3GMQB 5DD5L 4Y4FD 4D2NA 5KN5A 4HW6A 1OSEA 1NC2D 3U0TA 1WF5A 4KGLA 4D7BA 4PSPA 2DQGH 4ZSOB 3TBBA 5CP3A 1DVFA 4I3GA 3QG6B 4AYSA 2YSSB 1T1ZA 3MV7A 1FI8C 5CZXC 1KDIA 3UZEC 2ZXQA 1RPQA 5F9WB 1ZV5A 4KPHL 3BGFB 5F6IC 3SBRA 3BYTA 3OF6A 4KKCD 1L6XA 1MAMH 4OM0L 4XBPB 4ZS7L 5FGSA 4UCFA 4A2DA 4P9HL 5IHBA 3HHMA 4JR9H 3QNZB 4QXUH 4RAHA 3OQ3B 3CTTA 1N2RA 2EO9A 2BZCA 1S9YA 3MHZA 2IV9A 3VQ2C 2X4RA 3P2DA 4LASL 3Q9PA 1BD2A 4WSKA 1T5XA 4PTTA 3H85A 1A4AA 1MVFA 5JDSA 4ENED 1Y1DA 8FABB 5IMMB 4TKWA 3K46A 4GO9A 3WDJA 1CFMA 1KV3A 4NRZB 1HVXA 3UG4A 4EBQH 1DBBH 3LEVL 3QZWA 1AO7B 4UZSA 3OSKA 4AQ8C 2EIEA 3JV6A 4WV1C 1JD7A 1Q72L 2XTJB 2X4TA 4NQSB 1VEPA 1Z5LB 4QF1A 2GBAA 2XKUA 1E3FA 1I9IH 2WUCH 3DUSB 4NT6B 4B53A 3AS0A 2ZJSL 1BBJA 3MJGX 4XI5D 4YHYB 5DR5L 1RFDH 3WTWA 4JM4L 5E03A 3X1EA 4N8PA 4K9EL 2AGJL 4JQVA 3IRPX 1GPOH 4LCVA 3AWEA 3KPRB 5LNDA 2P4AB 4UILL 2CBPA 1DBJH 3OAWA 3FOLA 1YEFH 3OLDA 5DZVA 1HL5A 3D52A 4RA3A 2IDQA 3BZFB 4Q4EA 5FYLH 4QY8A 5C0RL 1PQZA 1DQJA 1SXBA 2PO6C 1BDYA 3QRGH 4BDVB 2X87A 3BAWA 5CEZH 5D7HA 1B9KA 3BQUB 4HHGA 3H53A 1ES0A 4P2CG 3ARFC 4B9IA 3QDJD 1T6BX 2RBLA 1VENA 2AQ1A 3NACL 4ZXBB 1GY1A 5GS3A 1TU2B 2MPAH 5C0BE 1JZ6A 3L13A 2NQDA 5EG6C 3GZKA 2WYTA 5FM5O 5FECB 1QABA 2BSEA 1ZLWH 4DKFL 2IMNA 1QFOA 4R4BB 4HC1A 2F5BL 3NCYS 3GEFA 2UZIH 1IC5L 3DX3A 1Y0LB 2RIKA 4YHNA 4F7MA 2ZUVA 4HWZB 4LIQL 1E2WA 5LAXB 5LGHH 2GK0A 3ARWA 4TQIA 5IWLA 4OGYH 5IJVB 4YZFF 2KZBA 4NZ8A 3DGCR 3C6LB 2G5BA 3OKKB 1LNUB 3V4VL 5JXEA 1E8YA 1AOHA 1GCYA 1OTUC 3QUYD 4A7QA 1SXAA 5GGQL 5FX3A 5ID0B 2A38A 3HRZB 4Y2NA 5IVXA 1JF5A 3QJVB 1A3LL 4O4YH 5TQ0L 5FDYA 3J8F7 5DF0A 4PJXA 5KSAB 1KFGA 1B2WH 3BUIA 4JRFA 4XCFL 5L0QB 3BH4A 1OF2B 4XCNB 3KPRA 3K6OA 3RDTA 5KSBF 4EDXB 1HHHA 4ANVA 5DS1A 4W9EC 3ZDZF 3LZNA 4C59B 1MFBH 3ETSA 3MLTA 1BBJB 4FOMA 5JHDD 1NBZB 4FFZH 1HSBB 2XJKA 2NXYC 4JQIL 1KJVB 1UD5A 2NW3B 3CX5K 3VI3E 2WLNA 2HH0L 2BIIA 2CLVB 5DVLA 4BV1A 4JFEA 4EDWH 2Y5TB 3BZEB 4ICXA 1KZYA 2ARJA 4J3OH 1KJ2A 2OXHB 2YIHA 4F93B 4X6BA 4A63A 3FW6A 5JLZA 3SE4C 3RL1B 2PYFA 2LV4A 4Q14A 1JGVH 2AHIA 4XCNA 1AG0A 5DXWA 1CO1A 3V9EA 1BJ1H 3QXTA 3O8XC 4U0QB 4J6IA 1BD2B 3EJUA 4Z3TA 3H9HB 3QW9A 2V17L 2W07A 5LLIC 4P5TD 4KKAD 3QFDB 3QDGD 1LDPL 4N0YL 1K4DA 3ARGC 3CFCL 4NJAL 3IJYB 3UTSD 3GS7A 3IXTB 5EN2B 1DVXA 1INQB 1U91A 2UUDK 3AQYA 3R06A 1IC5H 5KYWA 3FH8A 4DEPC 3VD0A 1KPVA 1W72H 3N06B 1R5VB 3HRZC 5EUOE 5I74B 4E9QA 4P07A 2NDFA 3DKHA 2FJSA 5F7NC 3NCWA 5SWQB 5E8PB 5IJVA 5T1LA 2BIPA 3ALWA 4DUVA 2JCCF 1S9WA 2R69H 2P8MA 5HHOE 4NI6A 1NM9A 5CEYB 3A4EA 3VX1A 1UZ8B 1BEYL 1NJ9B 4X7TA 4BFEA 4YXHH 1S6NA 4LP4A 1J0JA 1E4KC 3HMWH 5L2JA 1N64H 3RIKA 1VACA 4IW4C 2CO6A 1IGMH 3QQ4A 4GSRA 4I3RL 3HFFA 4L1DA 1UA3A 4HJGB 4LB8A 1SDYA 1J8KA 3DX0A 2ZKHL 1YUHA 3D34A 1SJHB 2NSXA 3QUYC 2VW4A 4YHML 1JZGA 2NT0A 3EJCA 4UQEA 2NY0B 5DFAA 2F18A 2GSGA 1DQJB 1Q0YH 2D7PA 3Q8FA 1OT1A 3GSUA 2BFGA 1II4E 1X9QA 2RD0A 3WKQA 2E59A 3DX7A 4HUUA 4IU2B 3MXWL 1AKPA 1XCXA 4HG4J 1P4BL 1G7QB 3S9DB 4IMLB 3QEGH 3X3GL 3GXDA 1I85A 1E2ZA 1Z32X 4GIAA 2Q6WB 4Z6AT 4P46C 3VD3A 4HJ0D 6PAZA 4KZDH 3HNSL 3RPIA 1RUML 4ALAC 1XV8A 2N0MA 2CJTA 1A1OB 4EMZA 3LD8B 1W0WA 3BKJH 5D71L 5GGSB 1F6LL 2OL3A 4X99B 3TU6A 2AK4D 1JDCA 4JAMB 3DO7A 4NHUA 4FI8A 4BKTC 2VM4A 1LO5A 2HTLD 3L1OL 4M8VA 4QHMA 4L4VE 4IRSC 4PVBA 3I3BA 1E28A 4YBLC 3WAJA 1OD7A 3R7RA 5T1JA 4PJDF 5AAWC 1I1AA 3L1FA 1GIGH 3IDMA 2KH2B 5IB1B 3NACH 3A22A 1WVZA 5EO9B 2NY4B 4KTEL 3UPRA 3NTCL 4XMXA 3VGDA 1JSYA 4K07A 2Z91A 5C0GB 1NFIB 3FONB 4NNYB 4UTBL 5A7BA 1CGVA 3P77A 4LSTL 4NNPL 5D1ZA 3CLWA 3BSZL 5C09A 3BCDA 3I6KA 1BFTA 1G7HA 4XO4A 1MSPA 1YAIA 4NNYA 4P2RB 3ULUL 5C0JB 3U36B 3L9RB 5I8OH 4R26L 1IBDA 2OMVB 1AHMA 4Y9FA 1MWAB 2NCMA 1E7VA 1YY8B 5D7SL 1J0HA 5C0BB 1DN0B 3QCTL 4XMUA 5E9NA 3MRQB 4F58L 4Z76B 4HT1L 1PFOA 3V0GA 1YUKB 2F8OA 3C60A 4K3JL 4OV5A 1Z9NA 3K6DA 4P5KB 4P3DA 1KIQB 1NUNB 2R1WA 4MMZC 4OCLC 2BERA 3FT2A 4KPHH 2Y6TE 3GTVA 3QNFA 3K4ZA 2ED8A 4P5KA 5BO0D 4JHBA 5CLXA 3S37H 4UTAL 3SCMC 4P2QB 1S7RB 3GXFA 3SD5A 2XBZA 3QXAB 1MCSA 3S48A 4KROB 5F7BA 1A3ZA 1Y18B 3MO1B 3A4DA 4MD0B 4PB0H 4L9DA 4JR9L 3E9TA 6FABH 2F19L 1KUMA 3UCQA 5F8QC 4R4FH 5CZXD 2G3XA 3WIFA 4QRPB 4Y2DB 4KWUA 3AMKA 4RISH 2IH1B 4JPKL 4XE5B 2OMXA 4G2AA 2NX5A 4LPYA 4AQ1A 4F9LA 1J8RA 3QQNA 3BUBA 3C2AH 4Y1AB 4H44C 2IXQB 5H8DA 1UADC 2IQ9L 3EGSA 3WNIA 3OKYA 1G7PB 3WYRA 4EZJA 5KS9F 1N2RB 2YS4A 1FWXA 2E74C 3I3DA 1XH2A 3B7SA 4PH8A 4ZD3H 4AQZA 5D7LE 3TV3H 4AMXA 1EJOL 1MAJA 1A7RH 1MVYA 3RX5A 3N42B 3O3AA 3LKNB 4HKXA 4UINL 3MKKA 1D5ZB 3PWJB 1MW2A 3TIEA 2BH0A 5KSVA 1FSKB 3Q2VA 2ZKYA 4X7CC 3WFCH 1J9QA 2YSSA 3FUNA 3R19A 1WFNA 2FJFB 3U9PH 1OGAE 3OKOA 3GK8H 3I9GL 3HS0A 3CMOL 3H8NA 5D1QB 3LNEA 4PV9A 3TZVC 4DUXA 1BZQK 5FK9B 2E5EA 4XOEA 1G9NH 4W9IC 5IVXE 5CLZA 5AVYB 9PCYA 3HAEG 3ZO9A 5EFIA 4DKTA 5AG9A 5FA3B 3D7PA 3GRGA 3QHFH 4MZ2A 5DZNA 2Q7YA 2CLVA 3C8HA 2MNUA 4HHAB 5DJ2B 1WCQA 4PG2C 2EXWC 1AHKA 3PP4H 1TZGH 1E5ZA 1XGPB 3NYKA 2CIIA 3VB9A 4NQEA 4OZGB 3E6HB 4JG1L 3BD5A 2DWSA 1AGCA 4PJCE 3J2PA 3BP6A 5LAPA 4IMKC 3RWHB 2K9UA 5IBLD 1KENL 2H2SC 1DBBL 1YY8A 3ZGIA 4OZFB 5ALBH 1K5NA 4PYHA 4CKVX 2PR4H 3LX9A 5CS7A 4ZTPH 3BLBA 2EYSA 2I25N 2APBA 3EYQD 2IANB 4IGBD 5E9DA 1YPZF 1I9RL 1WUZA 3U6XA 5LBGA 2ICWB 1NPUA 2AJUL 4Z78B 2N1TE 4QGTA 3ETBJ 1INQA 1U91B 3AM8C 2WZ5A 3IFLH 1IGIL 4TTGA 1WGVA 3ZTNL 4ZMNA 4KUCF 3O3BB 1AZBA 3Q2WA 1OSPL 4TNVK 4WHDA 3UAEA 5C07B 2ITDA 3TF7C 2COVD 3QHFL 4DK5A 5LHDA 1OHQA 4I4WA 1DHKA 4Z18A 5ISZD 4PRPE 2JE8A 2WWKT 1WEJL 2F1EA 4F91B 4ZUSB 4U6TA 1MPAH 1J1PL 5HYIA 2DQEH 4Z0XB 5I6XB 1RUQH 5SWSB 5CP3H 4JZJC 3T3MF 1IGJA 3GSNA 5ANME 1MIMH 2Y1YA 4AT6B 5JW3H 1UJTA 3P9MA 4AEFA 2PNDA 1DUYA 4BZ1H 3VWJA 4MXQD 4HD9A 1FO0A 5GS1B 2YAPA 1MHEB 1KTCA 3CZFA 1OAKH 3UTSA 4AVHA 4KOBA 1Q0XH 3BVTA 2PUQT 2VIRB 3UZVB 3H7LA 4D9QE 4IOIB 1BG9A 1MFNA 1Z3GH 2P3YA 4LEOB 3O3EA 4MNHB 4HOXA 3W37A 2XXMB 1A7OH 3SE3C 2H6UA 1LGVA 3ZTJH 1Z9OA 1XAKA 4IU2A 4YS4A 3FT2B 3MV9B 3FF7A 1V05A 3S2AA 4AGNA 3PQYB 3MRMB 1WFUA 2WN3A 4FQIL 4JFFE 3C60B 1E27B 2WB7A 1X4ZA 5CXPA 5HXMA 1QSVA 2VQ1B 2CA4A 4N8VB 2W59A 3M1CA 4G72B 1U8NA 3O6FD 1ZHBB 4XP5H 4NSKB 4JY6B 3BZEA 4DSYA 2YRBA 3U82B 2XOTA 5AUMB 3RWJA 2XV3A 3GZPA 4NOFA 3VWKC 4Q6IC 3LHPH 1YEDA 2CRIA 1WAPA 4P23B 3MCLL 3IFLL 3OG6B 4GMSL 4LO9A 1LE9B 3EBHA 1QFUL 3P9LB 5HVHB 1BQUA 3I75A 4R26H 4HS3B 2AJUH 2GUOA 1MY7A 4YDKL 4DK3A 3WNKA 2VW7A 4BFNA 1ZXKA 4RX4D 2ZQKA 1IAII 4WEMB 1FUNA 2F61A 4GRLA 4N8CL 4YSUA 2CUIA 2HFGL 2ADJB 4AI7A 1N6QH 1F58H 1GGYA 1MCHA 4WJ5B 5CBAA 1MPAL 1S9XB 4Z7UF 2XX1A 2AF2A 1LO2H 2J2ZB 15C8L 5IQ7L 4HAGA 1Q0EA 1W0VA 3Q3GA 1E4XL 4K73A 4EF3A 3G5XA 4JPWL 3WJJA 2P52A 5B1JC 3UJIL 5FA4A 3VFWB 3CFJB 3NOIA 4QNPE 1KWKA 4RLDA 2MEJB 1KTDB 4IIQC 1H5BC 4FXGC 2APVA 4DGIH 4HALA 2ENYA 1J0YA 2DQHH 1DQQB 2CHXA 5CIPA 3I6GB 3F65A 4GQZA 1FZMA 3LKRB 1WA2X 4P2QE 1UYWH 4P05A 1I7ZA 4NT6A 2IMMA 4JO4H 3DYOA 4PGJA 3O6KL 4WNQA 1ZHLB 2GKIA 1OGTB 3BJLA 2R69L 2BVQB 4Y4KB 1E6OH 1P7BA 1XCWA 3GWJA 4UOW0 4QTHB 5TE4L 4P2AA 1HSBA 4WU7A 3BQUA 3DSFL 3JTBA 4PSRA 2OMBA 2X4NB 5KTEH 4ZQKA 5I8KL 4AJVA 4UYQA 4UBDD 2PW1A 3RDTC 2M26A 1ILUA 4ZXBC 1EMTL 2R15A 1F2QA 4XPTL 1GTNA 2E7CA 2ESVA 3JSSA 4FJ6A 1T1XA 1OAXH 5I5MA 5CUSH 1CQKA 1CLVA 2ADGB 1YO4A 4NPYA 1DZ0A 4WW2B 2A4CA 3T2NH 1FHGA 3OLEA 4BWUA 1FP5A 2BPBA 4GMTH 5E51A 2WWNA 5DCCA 3ZTJG 1ZDSA 1CFNA 2HT3D 3C6LA 4RMQA 1QHPA 5BS0D 4ZJ9A 5HDWA 4E42A 3F6IA 1OAUL 5IWLC 4X4KA 2E7BA 1NCGA 3MBEA 2CXKA 1GOGA 5KYWB 4AL8H 1KIPA 1P84K 2I69A 2IAMC 3DPDA 3V5HA 1M9SA 4G9DA 4BQ9A 4OH2A 4Y88A 3QDHA 5K9KB 1R0AL 1CFBA 3H3PL 1BXUA 3DMMD 2E27L 3U48A 5KBKA 2C1PA 3GXMA 4JGJA 2OSXA 1SY6L 1YEEH 5IOPB 1E42A 5AZ2L 5TE6L 4FDWA 2I32A 3FB7A 4WHCA 3PAYA 5INDB 3SGKC 4HSQA 3D4CA 1CLZH 4CVUA 1GS7A 1SXCA 5B3JE 5IEKB 3SKNB 4DZ8B 2VAJA 1GZPA 4XVJL 4B5EA 4ETQA 1HXYA 4Y9EA 1WIPA 1EAQA 1A6UH 3VXOA 1FC2D 1LK3H 1IAKA 3VRLE 1ED3A 1N3NB 1IZKA 1FGVH 3VVVA 5KZCD 4ZI8A 3ZR6A 4YHIB 2V5SA 4TSCL 5A2CA 2JKXA 2W95A 4UIMA 2VXVH 2K70A 2YA0A 4ZMVA 2CSPA 3UABA 3BQUD 1SF3A 3W0WB 2BSSA 1ZHBA 2IBZY 5I66A 3WIIL 5I30H 3LXCA 5AVZB 3S3PA 4KTYA 1FC1A 2D2OA 1EAOA 1JPTH 4QRRE 3QXDA 2VL5B 3GGWB 2WZ6A 3PY9A 3QHZL 4JFXA 3HOGA 3NSJA 1X4YA 2VUYA 4KV5E 3DMMB 3CXDL 1MIEL 2O61B 4UTBH 1CQYA 1TLKA 3ZX1A 4RMUA 5JTWA 2XG4B 3MRRB 2ATKB 5MEOB 4HCGA 3SDDD 3W11C 3AACA 3VSTA 1GHFL 4YHIA 3QHTC 1ESOA 2ALAA 2H45A 3ZYIA 1G9EA 4RIRA 3BAKA 3BVXA 4YSQA 5BVPL 43CAB 3AGWA 3SGKA 1YEJH 2YD1A 3C6LD 4QYOA 1E30A 1RIUL 2XXFA 4OFVA 4X6CB 3TM6A 5GPRA 1CDBA 2WIIA 1DUYB 5E9DD 4Z3IA 1HINH 1BG1A 1W72L 3ARGD 4FFYL 4J8RB 2F0CA 3BH9A 1UM4L 1X9UA 2DV6A 3LIUA 2IAMA 5FS5A 4G6KL 4HGKC 3WCYA 3ARPA 1T4KA 4TUUA 3ZL2A 1JZIA 5FYLE 3G04B 4DETA 4LSPH 4CJ0A 5KBDA 1ZVSA 3FB6B 3DVGB 1PZAA 1FNAA 4L48A 4N2HA 4P8QA 5CN1A 4MX7A 3ZR5A 4GG6A 3OM3B 3MRPA 2H26B 4ZUTA 2EDMA 3FOMB 4AK1A 3O0RL 4F2EA 1IIIA 2DTMH 3Q8EA 4AQ1C 1S7SA 4FD0A 2JJWA 3RAJL 1QFPA 5C0AE 2H2SD 1A3RL 4JN2A 1K9TA 2FQGA 5IESL 1DEDA 3UYRH 2YAQA 1FFNB 3PHAA 4YNYA 2X70B 3GSRB 4ZO7A 5EV7A 4BFIB 5KVMC 2RGSA 5JHAA 4OAWB 5C8JB 4C83B 1JVKA 2VDOL 3HB3B 1L3NA 2AJ3B 5FF6B 2E7LC 1ASPA 2FYYA 1KEGH 3LQAL 2I9TB 3OWRA 4MJ5A 4PI0A 3TBWA 4JO1H 4ODTL 4PJ9B 3FH5A 3CN3A 3O2DA 2J44A 5BCAA 1RY7B 4LSDA 3HI5H 1OK0A 1UXMA 1QD0A 4PJBF 3ZE1B 1QR1B 1NWPA 1KZQA 5ICXA 5HYJA 1FBIH 3GSWB 4MNGE 4L3EB 3CVIH 5CJOH 5I2IA 2FH8A 4LF3B 4M48L 3JV6B 5HHVH 4TLSA 3ZHKA 5IB3B 4JG9A 2X9XA 3M17B 2VXQA 4UMSA 4Y8AA 1FA4A 1CE6B 5I0ZA 3ZLQC 3KPPB 1NAML 4R83A 3O9WC 1YEJL 3BKCL 2ESVD 1JN6B 3RWIB 1WK0A 2YFNA 1JP5A 2Z8RA 2QVKA 3C6SA 5FW8A 4N22A 1ZTXH 5A2LH 1NANI 5CINL 1IAIM 3F3HA 4HC1H 5EEYA 2DB8A 2Z8VC 4WTXA 1LDPH 1IIKA 4N0YH 1V8HA 4GIPD 5FYJH 5DQJA 1ZGLA 3OLIA 1HDMA 4LASH 3QEUA 5FOBA 3SKNA 1FO0B 4EZLA 3IGLA 5DEGA 2K7QA 1IT9L 5TTRA 3GLDA 4NKMB 1E9OA 2YK1L 4HP5A 3T3MB 3V0DA 1OAUH 2PPCA 3QEUB 4ZFOL 4LLYA 2XVGA 2WTRB 3L95A 4Z0XA 5IV2B 2ISDA 2QVTA 4X6CF 4MA3A 3GS4A 2DYPA 1OP4A 1AO7E 1Q72H 5I8CB 1WCBB 5IG7B 5FUOH 1ZVYA 3T3PB 2EIBA 2VE6A 1MNUL 2VABB 1SBSH 1YMMB 5C0IA 5FM4A 4DN4L 5DI8A 4FQHA 3IETB 3MOBL 1G6RB 2H6PB 3UBGA 2MTPA 1SOKA 3CC5B 3VDCA 1YPZB 5TDNB 3PWVA 3TNMB 1L9SA 1A0QH 1RZKH 2H6PA 3IKKA 4I0PB 1OCOB 3D0VA 5A2IH 4GLRI 4D0CA 1O7DC 4UM8A 1MHPL 2W60B 4M7LL 5JIQA 4KKRA 2R8SH 4NAQA 3OJVC 3TGXA 3WL9B 5DVKA 3QUHA 2NY3D 1Y6KR 3C09C 3DXAD 4XZ4A 4JPWH 1JXDA 3RWHA 5CEZL 2IH3B 5KVDE 1DJZA 1NTDA 3QFJA 1KSRA 4QOKA 4LGRB 4MXVE 5IJKC 3RKDD 2DI9A 4UDTA 1SFHA 4YWGL 1NOLA 3S5LB 2YAHA 3BUYB 3WHE1 1SN0A 4RZCB 3KPOB 4PVMA 4HLZG 1MLCA 3RY4A 4X4MA 2OKMA 3D50A 4JHZA 2NUTA 3LEXA 4XP9L 3HNVH 4UQBA 4WKZB 5F1IB 1T6VN 2HFFB 4ZAKC 4Q9BA 4N26A 2XQYG 4ABVA 1R0AH 1H3TA 2JB6B 5A3IC 1CT8B 3NIFE 1GZHA 3QR0A 4W6YB 2NTFB 4MJ6A 4RWYL 5J56B 3D48R 3PV6A 1JPSL 2CLRA 2DQGL 1EFQA 3VH8B 3PFUA 3FTVA 4P5SA 5CJ8A 5BQDA 4NC2B 4M1DL 4PRBB 2NY3B 4A55A 3QIUB 4I1NB 4OGAD 5DS8A 1AQMA 1SMOA 3AS2A 2XWCA 5DFWH 5IFJA 3O8XA 6TAAA 3P73B 1NGQH 4RDQF 4U3SB 1R3JB 4ORGA 3RDTD 2VMDA 4UTAA 5ICYB 4YDIH 5TE7H 1YEKH 5DJCA 4ZS6C 1WC7B 3W56A 3WEXA 1J5OL 1QW9A 4ABWA 1ZK5A 1YYMH 1CD1B 2E6JA 4MAUH 1XGQA 4POZC 3WTYA 5CJQL 4GP8B 3MLYL 3FHQA 4GP4B 1NA8A 5JOFA 1EPFA 4L8BA 1FPTH 3QA3B 4BRJA 2XWJA 1CE1H 3BMWA 1YMHB 2R0LH 3BGAA 4FEMA 1BPLB 2UXTA 1E4WL 3OPZL 3VFPA 1IMHC 3QEQA 1YEDB 1TQCC 1XGPA 5ISZA 3ARBC 3RZWA 5FF6A 5IUSA 3LSOB 2DMKA 4HKBA 1PD0A 4Z7AA 5LWYL 4JO3L 1NCAL 5L2JB 4BFRA 1P0SE 1C7TA 4DAGH 3OAUL 3UJJL 2FBJH 2XACC 4XB3A 5FR3A 1NCWL 3KMDA 5JIIA 4G11A 4JFEE 3V6BR 5KVDL 4FMVA 4PYGA 2MQ3A 4DVBB 3CLEL 4J2XA 3MPCA 2QHRH 5K9QI 4KK5D 1EDQA 1XGQB 2IADB 1NMAL 5F9DC 1R3LA 1MF2L 1N5AB 4H25B 1OAKL 1TJHH 3G6JB 1FG2B 3PDGA 5FO7A 1KPVB 1M05B 1AO7D 5I1GL 2CR3A 2ZSWB 4ZPTB 5AD0A 5AZEH 2C3VA 1V10A 5I1IL 4MCYB 3G5YA 4A7VA 1DVSA 1WZ1L 5ESAB 1BAGA 1KBGL 4QLRA 1SJXA 5DHXB 3EFOB 2DBLL 2I7SA 1ULVA 5IB1A 3B9KA 4G8EB 2NY1C 5IBTL 1PZ5A 4ZOBA 1KYFA 3ML8A 4R96B 2JB5L 1HKLH 3BPNB 5IOPA 5G4NA 2GABA 1BVKB 4L2YA 4BD4A 2QZ5A 2IADA 4R0LB 3VG0H 1KC5H 4RGNE 3EHBD 3LQAC 5ICZB 5GISL 5FHBH 4AC4A 3QO1A 4LEXH 5EF1A 1SF5A 4MS8D 3P11H 3MV01 3EO0B 4L9LA 5C7XL 4DTGH 4XBGA 4PVLA 4CMHC 5JW5A 1M1SA 3CZEA 3IB4A 4CRPA 3EYUH 3QNXB 3FFDA 1TQBC 4FQXC 4M93B 1G1CA 4FLQA 2IVFC 4OV5B 3UTTB 1ANUA 4QO1A 1CE6A 3GHBH 1YEIL 3FQ2A 1TNMA 1CC3A 1J8HA 4XX5A 5JOFB 1KENH 2DKMA 2QDWA 3K6NA 4JKWA 4YAQB 1CZ8H 2I85A 1A7NL 5LCVA 4NZTH 3NZUA 3OL2A 4W9LC 4RAVA 4NQXA 1FFPA 3ZDWA 2A3TA 1H5BA 3MR9B 4KK9C 5EEZA 4ZNCD 1WIOA 3IF1A 3EBIA 2ICCA 1ET5A 4JM2D 4MJ4A 3E38A 3UPCA 4B9ZA 1NC2B 1ZT4B 4HU8A 2XN2A 5EOCH 4R7NA 5A16B 2YGNA 1AP2A 3UX9B 1RKRA 4TQEL 5DC0A 1MJJB 3ZTNH 5B3SB 3BSGA 2XDHA 2HCZX 1ECZA 2PYED 3BWZA 5J1SC 4NZFA 1RH8A 2I26N 3R4RA 2BY3A 3CVHB 1GH7A 4NAMA 3RFZC 4MJ6B 3C60C 3HZVA 2WXRA 2ZCZA 5KSAD 2WZ0A 5FCUH 4WQOA 5H35B 3CDZB 4KVCL 1M7DB 1S9WB 3PQYD 1G6VK 2GJPA 1R9FA 1OARL 2P1YA 1E65A 4H0HB 1BMGA 5IBTH 2G3MA 5JUEH 4KI5D 4A37A 4I88A 1CLYH 4CSPA 5FOBB 2E4FA 1W15A 4Z7UE 1RUAH 1JZFA 3EAKA 4N1CA 2EC9U 4WGVB 3R06B 2XN9B 1YDPB 3BT2L 3HBZA 3QYCA 4ZW7A 5SWZA 1RZ8B 1MCNA 1KYDA 1MFUA 3FO2B 1PSKH 2EDBA 3NSDA 4PJXE 3QJTB 4XPAL 3DXAE 4HIEB 2ZP8A 5CGYD 2H8PB 5E08H 4FCAA 3OB0K 1ERNA 5I6XC 5I8OL 4QXTA 5C9JA 5EUOF 2AKRB 5E6SB 3NK4A 3PFQA 5IJCC 4JHWL 4XBMA 3S36X 2FIRT 1U95B 4HX1B 1AGDA 1MELA 2R29L 2EXWD 4Y5YC 1CBJA 3PWNA 1M7UA 1DBAL 4N2CA 1GGUA 3SBWC 4A2LA 4DOHE 1GXEA 1SLVA 3SQBA 3MRIB 3HZYB 1Z0MA 4LF3A 4OF6A 3VSUA 1MHPH 2BVQA 2X4UB 2CUMA 4A2MA 5DRXB 3VD1A 3Q2CA 4AUUA 3MRIA 4FN0A 4JY6A 4JDTH 2NSQA 1M71A 4E0RA 2IAMD 2JKRM 3PABA 5KSBB 3GYRA 2AXWA 4OW6A 1WBZA 5JIDA 2VL5A 1M53A 2VQ4A 1F4WL 5J7CC 1HESA 3TO4A 3TBTB 3STZB 3MRFB 2X9WA 3Q8AA 1Q38A 3JV4A 5BZZA 3P3SA 2ZCLL 5C0EA 4UQ3A 4X4ME 1S9YB 2KHAA 5HYFA 1AXIB 3ZTDC 1NCWH 1WHPA 2FK9A 4RSYA 1KCLA 3MJ9A 1B6UA 3E8VA 4N2GA 3QFJD 4WV1B 7FABH 4Z8FL 4W70A 2WCSA 3K2MC 3ABLB 4M5YL 3S8FB 2MIZA 4MJIB 5DHYB 1I8LA 4OCRH 4F27A 5GZNA