3PNRB

Structure of pbicp-c in complex with falcipain-2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
160
structure length
129
Chain Sequence
GKSLKLGNISNQTNQETITQSLSVGEILCIDLEGNAGTGYLWVLLGIHKDEPIINPENFPTKLTKKSFFSEEISVTQPKKYMQLLGGPDRMRSVIKGHKPGKYYIVYSYYRPFSPTSGANTKIIYVTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Falcipain 2
publication title Structural basis for the regulation of cysteine-protease activity by a new class of protease inhibitors in Plasmodium.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
total genus 30
structure length 129
sequence length 160
ec nomenclature
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3pnrB00
2OULB 3PNRB 2WGNB 3CBKB 2H7WA 2NNRA 3M88A 2C34A 3CBJB 3E1ZA 2NQDA 3M86A 2FO8A
chains in the Genus database with same CATH superfamily
4R2GD 1QP1A 5KS9E 2DJUA 2NY2B 2QGCA 5F9WC 3OKLB 4QKXB 2X6MA 2XZQH 4S1RL 3MV01 4LLYB 5DTFA 1YQVL 2VWEC 1RV6X 3RB5A 4GW4B 2DLFL 5SV4A 3DX8B 1EIBA 2APSA 3LN4B 4NO3B 2NNAB 2X4NA 4NNXA 5E6YA 3X11A 2FSDA 1PY0A 3W11D 4LQFH 1U95B 3MLXL 4FQXC 3HFML 3B2VL 3NIGF 4KJWC 5B1JA 1PG7X 4OCNC 5CS7A 5D1ZB 4B50A 2YPKB 3ATEA 1QHOA 2LLNA 4J6RL 4U1SB 4GQZA 1OE2A 4HWEH 3VFTB 1YC8A 4P9HH 4FA6A 1A1MB 2VM4A 3BGFB 2D7TH 5IVZB 4OQ1A 4GAFB 3BZFA 5AZEH 1T04B 4Z0BH 4IJ3C 1ACZA 3QWOA 4YXLL 4DGIH 1GKEA 3KYOA 3WXWL 2E8YA 2OMZB 4Y7MA 4ZK8A 2DQTH 3AABA 4O58H 2H1PL 1IAII 3EJYD 1H3VA 2W9EH 4O5LL 3VU1A 3NH7L 4B9FA 5DFTA 5JXAH 2Q3XA 5C97A 4BKTC 2QQLL 4L9DA 1M4KA 4XC1H 1JGUH 5H4ZA 5I19L 2HFFB 2H8PB 5IEHB 1JGVL 3QEQE 2O61A 5IFAL 1XH2A 2G5BB 4YSRA 1SXCA 1N64H 3PS6A 3WNJA 3WIHA 5D7EA 5FWRA 4WO4B 4MMZC 1NBYB 1Y0LB 3RIAK 3DXAA 3GXUB 3HMWH 5EOTA 4LU5H 3IFPB 4W9KC 4MNHB 5FDYA 3Q6GH 3S36H 5H35B 1CICC 3AMLA 4MXQD 2N01B 3FO1A 4P23C 5IT2L 1MW0A 1DQLH 5D7LB 4F57L 1R0AL 3C6SA 3UMTA 4PJAA 4JPWH 2P8MA 4YJZL 5A2AA 4DEPB 4HUNB 1WHPA 1B4TA 3J27A 4HX1B 3HC2A 4RZCB 4FNSA 4K3JL 5GZOC 4BFFA 1B0GA 3FU9A 1W72B 4YHPA 3MLVL 3RNKB 3REVB 5KYXB 3U30C 5A1AA 3BSGA 4JNXA 4HMDA 4YDIH 3ZKXB 3Q9QA 5F89B 3S35X 2XKNA 5L8JB 3QUYA 3MLTB 5T1MB 5D7KE 4PJ9B 2JI3A 4I0PB 2V33A 5EBMB 4UDUB 3NIFE 3QJHA 5E8DH 4FKEA 1XX9C 1JPSL 1U6AL 1F42A 1TFPA 4PWIA 1MHCB 4P0DA 4RMBA 2UVEA 3WFZA 3IJHA 3ECUA 4WEBH 5DZNA 2O30A 4BH7A 3VXUD 5E1AA 1OHQA 2V17H 3VG0H 3OB0K 3U1SL 1OQXA 3TBTA 2CNZA 2WJ7A 4HBCH 1WDAA 4D9RD 3K6DA 2Y6SC 4WWPA 2MOQA 3ZGHA 5JW3H 3W0WE 1A1NA 4XP9L 4YEFA 1LO2H 3D8MA 1HFUA 2DJ4A 3FQRA 4QF1B 5KTEL 4YHYB 1MG2C 1ZE3H 3I6KA 4M7KH 4KOBA 3MOBL 5ANMB 4X4MA 3KXFA 3MUHL 1L0PA 1XIWA 4KKNA 2X4PB 5B39B 4GRLD 1YA5A 2FHFA 2FWLB 2VQTA 4XOCA 4PJHF 2DWXA 2A6JA 2ZWLT 4TV3A 3O0RH 1QYGH 2C9VA 4HT1L 4NQDD 5F7WC 1CMOA 1PNCA 2NUTB 4FXKA 2B4CC 2R0ZH 3C2SA 3DJRA 2K6ZA 1P5UB 3F7LA 3QORA 5D1QE 1OP5K 2AVFA 4X80H 1MHHB 3PWLB 3IDYB 3LQAC 1IQWH 3U0PA 5T3XL 3DRQB 4BDVB 5K39B 4PJGF 5JYMA 2V8LA 4QNPE 3RAJL 2SODB 3ZRSA 5B1AB 3IJ9A 3HUJB 3D0VB 1QWHA 3M07A 1OGTB 4OLYH 4UT9A 2JB6A 2J21A 2VABA 2R59A 3B1UA 3K1KC 1L7TL 2J8UF 3DTUB 4ZTOL 3LKRB 2XYCA 2IANE 3JT2A 4ZUUB 4NQSA 1NDMA 1NAMB 1V7ML 3L3DA 4CADB 5JPNA 2DS4A 3V6BR 1E8YA 1NL0L 3RDTA 4UINH 5FB8B 2BMKA 3HE7C 4C57C 1DBJL 1ORQA 4KZEH 4FQHA 4WAFA 1YEWA 2OXHA 5TFSH 1ML0A 3WS3B 2WQRA 1D7BA 1BQLH 3QIUC 1AI1L 4GAYB 3UJIL 5INDB 2YD7A 3QZWG 4F7EA 4UM9D 1E5BA 5AAWA 2SEBA 4PJIA 1MELA 4GKOA 4A6YB 1JI1A 1WGOA 4KFZC 2AKRA 5IOPB 4TUJB 1A6PA 3FHAA 3ML9A 4HHGA 1PFOA 2EJ1A 2VDNH 3TH2T 3GNMH 1CFQB 5CR8A 3JTTB 4OV5A 4WV1C 1FYTA 1E7VA 4V1DB 4DEUA 4MNQE 3SKNB 1JZ3A 4K3DL 1F4YL 1BMWA 1DQQA 3ASOB 4R96B 1S7TB 3J7HA 5EMYA 4J8RB 4PI0A 4NT6A 5DD0L 2DI9A 1M6OA 5AB2A 3MYZA 2I9LA 4ZS7L 4QIRA 1P4BL 3IDIB 3RWHB 3F3HA 2NY2C 1ZSHA 4WI6A 1K4DA 5IQ7L 2CJUL 3P9LA 1BEXA 1R5IB 4H20H 2XICA 3MV8E 2WLLB 1G6VK 4M6OH 3B9KD 3KYKL 3S34L 4YH6A 1SPDA 5LO7A 5TDPA 2O5ZH 4XAWH 3DVNA 2EEBA 5CN2A 2D31A 2VUYA 2F8IA 3FUDA 2Z0BA 3F8UB 1DP0A 1U8PB 5D1ZC 1PG7H 4F3FA 5I30L 4YAQB 2XIDA 3LVTA 1CDUA 1GC1C 3R1GL 4X6DF 2AEQH 1CUOA 2FHBA 3BGFC 3DX7B 2CO4A 3UC0L 5BOZG 2JIXA 1NPNA 1F4HA 3WD5L 4RESB 1A9BB 3NACH 4N3UA 4XR8C 3WKNA 3KEHA 3LAFA 2FYYA 2UYLA 2Y36H 3V2AR 2QFRA 4JFDD 4U1KB 4HLJA 2CCWA 3EAKA 2N59A 2WKLA 4HPYH 5EZJA 2APFA 3QULA 3D4YA 4IGBD 1MNUH 5FGBC 4W9HC 2HG5B 4LIQL 3ABKB 43CAA 1RZJL 3V0FA 5CD5D 3S96A 3QUXA 5J6GB 1BQHB 2KDYA 2VLKB 1XR9B 4I77L 2NR6C 1BFTA 1UWGH 3H55A 4WO4C 5DRXA 2G2RB 2E56A 1EZSA 4L2LA 3H7LA 5TJWK 1HCYA 4MJIE 1MCLA 1QR4A 4JR9H 3VI4A 1TYEB 3D30A 1UXMA 5EULV 4EQ2A 4H26A 2OCFD 4R90H 3I6GB 3RPIB 3TN0B 1LO3H 3MRGB 2BLFA 4XNYL 2BOCB 5CJOH 2XU9A 4R26H 5FO9A 5K9QG 1D5MB 1W6WA 4DEPC 1R3JA 3CFNA 1U0QA 2XACC 1U8IB 4P4KA 1XB8A 4W4OA 2WBJB 3B8YA 1S7WA 5ITBH 1YYMH 1KNOB 4JHUA 2K7PA 3FUEA 2IOIA 4UT7H 1BHGA 5C09A 3VH8A 2ZX6A 3KLLA 2CHDA 4LSTL 1UM4L 2P4AB 2VC2L 3ZKXC 3ZE2E 3KS0H 2DF3A 3IMRA 4WFGD 2CZNA 1I1YB 3QIWB 2D7OA 4PJ9C 2CR0A 2QGBA 2OMNA 2OK0L 4I0PC 3VXSD 2AV1A 3MXVH 5AVSB 3TVMA 4LPWA 4R4FL 1W8EA 3NEEA 4HJIA 1NLBH 5GGQL 1MVUB 1H9DA 3X12A 4J3XA 1R3IL 3RL2B 4A7UA 2YPLA 5AZUA 3V55A 4PU2A 3VI3E 5FGCE 1HZLA 1CIUA 2I60L 1OSPH 5C0CA 3C5ZB 4JFEB 2NY4D 2MHAA 1ES0A 3BKJL 3KPMB 4U1MB 1E2VA 4NZDA 2X05A 4NB7A 2EUVA 4UILL 1XGRB 2NX5A 4HCFA 1TZIA 2H32A 4EZKA 1HILB 5T33L 1Q4NX 4DZ8A 1SY6A 1F6AB 4NYLA 4XVJL 4BCYA 4YHYC 1FO0H 2GJJA 3DETD 3CTTA 5J12B 3LKSA 1FG2A 2FGWH 3BWAB 3FUHA 1WO2A 3TBYA 2A6DB 1MIEH 3RWGB 1ZKAA 1C1EL 3KYAA 4UF7C 1MUJB 5AB0A 1MZYA 3K6FA 1YAIA 4XPHH 4P2RB 1I7RA 3FC8A 3HZVA 2KL6A 3JV6B 4NUPA 4PJ8B 1G5AA 4U6HB 1UD5A 1UM5L 5EO9B 1KLGA 1NMCB 1F2QA 3HPJB 1FHNA 2XX1A 4KOCA 3S6CA 2A1WL 1P5UC 5BV7H 1JNLL 3VFOB 1HWGB 3WLBB 1JAEA 4X7SL 3IDYC 4N9OB 3FU5A 2XWBB 1KENL 3MJ8B 2BSEA 1J05B 5E6SB 5FV1L 3ECWA 5EU3A 1BF8A 1TEGA 2YGOA 2O6PA 2PYED 2X6UA 4PS8A 5HHVH 3WGUB 3LVEA 3MCKB 4G3YL 3NA9H 4WHYG 1RSYA 1OSYA 2ZJSL 1F56A 1U8MB 3FONB 5E2UH 2P5WE 4GKSB 3P1VA 4UOZA 3A6CH 1GIGH 3JWNE 4ZT1A 5I15H 5J0BA 5JHAA 5MHSD 3H8NA 5AVTB 2Z92B 1TTFA 3CXFA 3UPRA 2MRYA 3IMVA 1OAYH 4BZ2A 2GCYB 4G8FA 2HVKB 1N10A 3SBRA 5C2UB 3QEUB 2E9JA 5IQLA 4DH2A 4ZQTA 5LJYH 1HH9B 7TAAA 3QPQC 1NCBL 1ED3A 2CLRB 5H8DA 2CCLA 1KCVL 4Q74A 1YY8A 1Z5HA 4TPRH 4Y16D 4XMUA 2X5PA 4HKZB 4OZFA 5E5UB 5FM4A 2V9UA 3JVGC 1MRDH 1OIOA 2QADB 5D7SL 2VW7A 3CLEL 1QWNA 1KIPB 1NANH 3MFGB 1J9SA 4U3XA 4N1CA 4QTIL 1KTLB 1RZIB 4ZO9A 1UADC 2DJSA 3KL0A 4K3EH 1R47A 1NA8A 4NO0D 4MBOA 1RU9H 2ATKB 1GAFH 2CAKA 2F08A 5DU7A 4PGBB 4TMPA 1T0MA 4I18A 3WENA 3PJSB 3X13A 4U6XA 5EO0B 4FQLL 5L2KB 2KDGA 2XQBH 4DUVA 4ZX4A 4YFDB 4FI7A 3IPEA 3WIHH 5BS0B 3WV0A 2DQHH 3RE0A 3UTSD 2X4UB 2V7NB 1HYRC 5I66B 1IV8A 1CXEA 5L8KB 1X5MA 1LD9A 2X28A 4XI5D 4EE2A 1ASPA 4GO9A 4W93A 1B4LA 3U6RA 1A0QH 4LQFL 1RUKH 4KXAA 2WN2A 3QXWA 3RVUC 1FL5B 4IBLT 3K2UL 4EDXB 2UXTA 3RVVD 4XX1G 5IMMB 1JHTB 1WWAX 1HZHH 2E5EA 3MA9L 2AF2A 4LPCA 1E4XI 2BOLA 5DJ8A 5KWYC 4HWEL 2AEPL 4YGAB 5BZZA 1E7UA 4HUUB 4P9HL 1J0KA 1H3PL 3QPKA 1N6UA 2VLRD 5FFLA 1YEDB 5AZEL 4MD5A 4DGIL 4E5XB 1CD1B 3U36B 4NO5A 2DQTL 2LW3A 3VXRB 5KAQF 1ZHBB 4O58L 4GRMA 4FHKA 2W9EL 4UZUA 4H2CA 5HHXH 4J3BA 4KK5D 2WOBA 4J3OG 3UBFA 5CZVL 5CBEB 1QW9A 3POHA 3RIAF 4MMYA 4FFWD 4XC1L 1SYSA 3Q8CA 1GXEA 3RY5A 2EICA 1IGIL 3H9YA 4TS6A 1NM4A 1O7SA 2X42A 1TEYA 3S3JA 4MS8C 4CVXA 3IGUA 1XZ0B 1NFDE 3HMWL 1YNTA 3EYFA 1YCSA 5LXGL 5AVXB 3Q6GL 3B56A 1T5XA 1MFAH 5EN3A 5HPMA 3R06B 1Z9PA 3TX4A 3WJMB 1PD0A 5SWSE 3ISYA 4D9LH 4C4UA 1QRKA 1JZDC 4UQDA 4ODWB 3TN0C 5ID1A 3DXAD 2UY7A 4JPWL 3NYKA 4ZG1A 4DO4A 3HAEB 3OKEB 4QHNB 4IM8A 4EPSA 1CYXA 2F19H 2W9LA 4V33A 1EJOH 4HWBA 1FG9C 5LG6A 2WBJC 2DWYA 1WG3A 5E2TH 4P2OB 4YDIL 5D7HA 3EG9B 5A7EA 1BOGA 4A39A 2XWCA 3IVKA 2QDWA 5TDNA 4XMZA 3II2A 3GMOB 3AITA 5DVPA 2X53A 5CJ5A 3QPXL 5E6ZA 3OM3B 3QIWC 1MW1A 2FWSA 3ETSA 4EQ3A 4V11A 4PWEA 2C3GA 1CPUA 3FQWB 3ABGA 3ROOA 4UT9H 3ZYJA 2XG5B 2VKXA 3WEMA 3QUYD 4WEBL 4ETYA 1IT9H 3BHBA 4QRPE 4XXCC 3JWDL 5H94B 5GRZA 3QJVB 1EEYA 5HHMD 2WUBL 2V17L 2EH8H 3K0WA 3VG0L 1CVSC 3N50A 3VMOA 2CGYA 4GI6A 4HBCL 1RK0B 2I85A 2QHRH 5IVNA 1Q9KB 3C5ZC 5F88A 5KVGL 1UXWA 5JW3L 2OL3A 2FJGB 2AK4E 1LO2L 3AZUA 3L81A 4JRWA 3SO3B 2WXKA 1BM3H 2OQJB 4M7KL 1RUMH 4Q97A 3OMIB 4NC1C 3QG7H 1YUKB 2EDMA 5F7LB 2UZYB 3PNWA 3FQ1A 3KYNB 3SD2A 1TIUA 2XFGB 3SY0A 3ZDXF 5J12C 2M26A 2J3SA 1ZVSB 3FT2B 3I75A 2VR6A 5CSZA 4HS3B 3O0RL 4DPBX 4OB5H 4PJDB 2ZKHL 3KXFD 2VDPB 3K71A 3CDCA 3DTXA 4PJ8C 5DEGB 3GB7B 1AJ7H 1XIWD 2R0ZL 3MV7A 1NMCC 3GSOB 3FAXA 5EORL 4X80L 3WBDA 3LRSA 2XN2A 3QGVA 4PY8J 4OKVA 1WT5A 1IQWL 4APXA 1E8XA 2CPUA 4PRBB 1MFCH 2WYZA 3VW3H 3OTTA 5I8OH 4LOFA 3CFJA 2EDNA 1F3RB 2GVYA 1QMUA 3GSRB 3QH3A 4B27A 5KSUA 3FULA 2YRLA 2GTWA 3PAVA 2KPWA 4QLRA 3LTVA 4PJEB 3B2MA 2Q2LA 1YVLA 1DVFD 2VDOH 4HFWA 4QY8A 3ZT6A 4B95C 5GS0H 5E1QA 4Y2DC 5F7AA 3SJVA 5GGVL 3RTQA 3TYGH 4AV4A 3LN5A 4NCDA 2WLHA 1OD9A 5D7IA 5L2JB 3S8FB 1X6LA 4F7PB 1OT2A 5IWLC 5E2VH 3CXDH 4UINL 4P3DA 3E80A 4G6FD 3SE3C 2X7LB 2OMTA 2YXVA 1NGWB 2CPCA 4KZEL 4JRLA 1W9XA 3V0VA 4MKTA 5ERWA 1H8NA 4HZAA 5A2BA 4WWKA 3QXVA 4FLQA 1W0WA 2RB8A 3HJ0A 3DVGA 5I1LB 4UIMA 2BY3A 1MVFA 2MEJB 3QYCA 5F3BA 1E4KC 3R18A 1PKQA 4IHOB 4KI5E 4ZAKA 2AXWA 3TM6A 5C08B 3QUKB 3FTUA 3LNIA 1BZ7B 1HEZA 3T5WA 2VDNL 2VC2B 3OHMB 4G80A 3TOPA 2A6IB 2GUOA 2IFFH 2QADC 1T6BX 1OK8A 4GY4A 3LS4H 4BIKA 4HKBA 1N5YH 1QPXA 5HDQH 5ALCL 3AQXA 5KZCD 1BYOA 3AWEA 4K9EL 3NSFA 3HPLB 3HMXH 4M1CC 4X9FA 2HX9A 5B8CB 5FR3A 2V3EA 4CSSA 1DCEA 4ABQA 4PJ7B 4I3GA 3BIKA 4NKQB 2EDEA 1O5PA 4MQ7B 5BXFB 3UGXA 4O02A 4WENB 3NCJH 4GKZA 3I6LE 1TXKA 3BDYH 2DWDA 4AEIH 4H20L 2F53A 1CCZA 2WV3A 4MZ3A 4YBQC 4M6OL 3MLSH 4X8XA 2H1XA 1WBXA 3FUJA 3L6FA 3VGGA 4PB9H 4HIHB 5CU9A 2P46B 2PTVA 1JPFA 2DDQH 2NQDA 2O5ZL 1L5GB 4XAWL 2JWYA 2H2SD 2NQCA 5G4MA 1CBVH 3NOIA 4UQEA 4OAWB 3EIFA 3TO4B 2X44D 1MF2H 3GSQB 4PJFA 1MIMH 3BZ4A 3ESUF 3EF4A 1PG7L 4BM7A 3N55A 3ETBF 4MRBA 4PJBB 4X8GA 3QDJE 4RGNE 3FRUA 1J8KA 1HI6A 4L0PB 3OLGA 3UTTE 3D39E 3QDME 2EIEA 1NQBA 4YR6A 3TEWA 1IEBA 1V3LA 4IKLA 3FO2A 2YFNA 5E56A 5FOBA 4DHLA 2A0LD 3H3KA 2WIIB 1QLEH 4Q6IB 1S9VB 1EXHA 4P57A 5EA0H 5ISZA 3OR6A 4JLRB 4M00A 4HPYL 1GGBH 3RGBA 5I73B 3NEOA 5JPMA 3KL5A 4N2GA 1MNUL 5DJ2A 1I8IA 5FHAH 4DFIA 2D7MA 1Q0EA 3MV9B 1JMZA 5I76B 5E4EB 5TK4A 3GLZA 1CVRA 1BP3B 4JFFA 4LNRB 1UWGL 1J9QA 2MFNA 4EIBA 4AMWA 3FH8A 2WW8A 1JHKL 4HUWA 3E7JA 4FLRA 1IKFH 2ZKMX 4ONGH 1IZJA 4HQQH 4MTMA 3VFUA 4R90L 1UD8A 1LO3L 1SY6H 3QUXD 5I6LA 3ARBA 1UT9A 4NM4H 5CJOL 4R26L 7PAZA 3WG7B 5T1JA 1SBBA 3LXBA 4MD4B 1BYPA 4Z7NB 3PDDA 2I9TB 2ICCA 2GPZA 4R4BA 2CBTA 5ADOH 1HX0A 1AO7E 4N0RA 4AJWA 1VFBA 1UVQA 4Y2OB 2NCEA 3FKUS 5DD3H 2H6PB 3HBPA 4DUWA 1YYML 2XBDA 1OAZH 4QRTB 2ZYHA 1I9EA 2HT3C 4WSKA 1HE7A 4JKWA 4L4VB 4P2OC 1N8ZA 4P5KB 5IR1A 4L4TE 4L1TA 4M7JH 1QTPA 1U8CB 4K9JA 2EDTA 1E9OA 4N2DA 4XGZA 5D2NA 5AAMA 3J07A 2A6KB 2AQRA 2Y07H 4JGUA 4L37A 5HHQB 4W9FC 3MXVL 3KYMA 4AC4A 2FJSA 1IE4A 5H4YA 3U9WA 1NLBL 1M71A 4DKAA 5LBSA 5F7YC 4JFOB 1IQDA 3UCQA 1I3RA 5IJVA 1QZ1A 4TUOB 1OSPL 3FOMB 3TVMD 3X3FL 1FV1B 3ZRCC 2R4SH 4B9ZA 5EIIA 1EEUA 1JPTH 2OFQA 1BD2E 4AZ8A 3BUYA 1BDYA 2YPLD 4BZ2H 3VE0B 1IGFH 2ADYA 3SO3C 5SX5K 1FO0L 1OW0C 4LKXA 4FG0A 2F8OA 6FABH 2RFXA 3SDXF 1E40A 1TTAA 3HG2A 1MIEL 4YDLB 5C0NC 4OZHB 4XTRD 1KJVA 1P53A 3UCRA 3IMBA 4XPHL 5DI8A 5AD0A 2YEZB 1B90A 1FWXA 4YIQB 5DVOA 5EEVA 3VVWA 4AKOA 4HS6A 1GW6A 2AGJH 4OZFH 4PSPA 4YSSA 4NBXB 5LVEA 3SGJA 3G5VA 4J1UA 5DQ9A 4PSRA 4HIQA 1KMGA 2CHXA 1AYOA 5C71A 1Q0XH 4NQEE 1UD3A 2DTMH 4NI6A 5HPOA 3CHPA 3CLFH 4XPAH 5FF6A 1U92B 4JY6B 1N2RB 3CJJA 1JNNL 3QNXA 1I7UA 3OAYH 5HHVL 3VAEA 5IOKA 5JW4Q 3SPJA 3LNDA 5EG6C 4AXWA 3GT6A 2CO6A 4UDTB 3AY4C 3NA9L 5E2UL 1ZY9A 1JFQH 2BSED 3CPUA 4DQAA 3O3DB 1XF5B 1EFXA 2XXFA 4X4ZA 4FQ2L 1T21A 4B96A 4ELDA 1C9SA 2VR8A 2CDFB 1TQTA 4Z9KB 4IU2A 1CFTA 1OAYL 3TPUB 5DC0A 2WLIA 1LLAA 3C8KA 3QWRA 4NQDB 5JIKA 1RULH 1TZHA 4N8CL 1M7DA 1FNGB 1R17A 1J5OH 2VLLB 3QXTA 4WNSA 1O5DT 2F1BA 5DVMA 3RVXC 3FB7B 2NRDA 3TO2A 1OB0A 4BQ6A 3HZMA 3B83A 4X6BB 3U2SA 4B9IA 2GITB 3IMUA 1MRDL 2OYLA 2FEDC 1E28A 1S46A 3O41B 2QELA 4E9WA 1U8KB 1RFDL 4FJ6A 4X9HA 2VRAA 4NQXA 4CC0A 3LKQA 3HHRB 5JXED 3B6SB 4K3EL 4DP0X 4LLQB 3ALXA 3KLAB 3L16A 2NW3B 1GAFL 2OLDA 4K3HA 1KEGH 2FYVA 5I5RA 3H0TA 3CFDB 5B8CC 4PJCB 3P02A 3C2AH 3KPOA 1VGKA 1I7ZB 3SYOA 3WIHL 1Z1WA 2DQHL 4Y9BA 4W4NA 5F7EH 2L3BA 5FEBA 1D9KA 1KBGH 1X44A 4TQEH 3WKPA 2YC1B 4WNQA 4ZFFA 4R0LA 4FQQA 4E9XA 3EYVB 4JX0A 2G75B 1RUKL 2CJTA 5IW1A 4Z23A 1B88A 5KVFH 3OZ9H 1Y07A 3ZMEA 2CO3A 3ATDA 4I1NB 4NPJA 5DDHA 5EEWA 1IKNC 2ICES 4NP9A 1ASOA 4L5FH 4HH8A 3TO4C 1HZHL 2ZICA 1IAKA 4PTTA 4HWBH 1IAIH 1N9PA 1YNKH 3NCXA 3ZDYF 1NCUA 1G1OA 1YEHL 3AFLA 2HKAA 3CZUB 4KTEH 4OLWH 4JM2B 2JKNA 5IK3B 5LGHH 4AIXA 2FBRA 5AKVA 3BESR 1N70A 4NN5B 5KVDL 4F2EA 4Q6IC 5MEPA 4NI3A 5MENA 5A6LA 1YMMA 4H8HA 2DQDH 4GG6F 1NGZB 3V95A 3VFVB 4ZMLA 4PRHD 4OFPA 4LCIL 5I73C 5AL0A 4BHUA 2NY3B 2XOTA 3TPKA 5IMOA 1T89A 1XHHA 5DJZA 1X5KA 4D3CH 2EYTB 3QO0A 3V7MA 4AGNA 3JV5A 2WTRA 5E4EC 4QOKB 1IL1B 2FEEL 1DL7H 3DUUB 1SMAA 2CBOA 9PCYA 3L5JA 4KI1A 4I2XA 2UXFA 4ELKA 1QO3B 3EYSH 4X9GA 4NKOB 5IB3A 2OL3H 2YA2A 2GW5A 4J3UA 1KLFB 3GLAA 1FCGA 4G7YH 4XNAA 1LE9B 1VCAA 3K80A 4X6EB 3QFGA 1WJ3A 1UWEH 3U48A 4KK8C 4M5SA 1TJXA 4Z7WE 3VGFA 3ET9F 3ULSA 2Y1YA 1NIDA 1BCIA 2BXZA 4JFDB 2DLTA 4XNMA 1U3ZA 4NFBA 4TQHA 3EJYC 1EJOL 2G9HA 2YRBA 4YDVB 5LGJB 3MACL 2PO6A 3Q6FB 2EC8A 3JWNG 4LRIA 2F74B 2VDNB 4PGCB 3C6LA 4IGBB 5EC1A 3MJGX 5E2TL 5F93C 3FCTB 2L7UA 3C75A 3ZKND 4XC3H 3WN5B 2LV4A 2VXSH 1AGEB 3MGOB 1QHPA 2IBZX 4N0UA 3VCLA 4QTHB 2WUCL 3PV6A 1NSNH 2CUAA 4WHCA 1VPOL 1HDMB 5FX3A 1VFMA 1RZGA 4NSKB 4ZO6A 4Z5RA 5ILTL 3ZBMA 3WAJA 4NWTH 1GYUA 4IBTA 4UT9L 1T7XA 1TVHB 1YMHB 2IWEA 2JCCE 3BLKA 3V0WH 1IT9L 5FYJH 4P3WA 1SJHA 4XCNA 3EJCA 3QNYA 4G7VH 3NJIA 5AZ2L 2R83A 3BP6A 4GOSA 2HRGA 3SPCA 2ITEA 4LPXA 2GJRA 5IB3B 1GZQB 2XNAB 4LP4A 4H0LC 4UNTA 4E9YA 3RIKA 4OGQC 3VRLE 3T3MB 5E9DB 1NBZA 5CEYA 1UH4A 2HVJA 3OG6B 3TWCH 1RUML 1UACH 3HC0B 5C0RH 2ADIB 3QG7L 3A4DA 4KZ0A 4OQTA 4Z7UE 4PGEA 4ACTA 3L7EB 2W94A 1L4IA 1JDDA 3GGWA 4YDLC 5KSBF 2AK1H 4P9HC 3RZCA 3TT1H 1T03H 5E8EB 5E8NA 4OB5L 3ZW3A 4TQPA 4Q58C 1QBAA 2WO3B 4B9KC 2Y1VA 4ZW3A 1IFRA 5BZDA 1AJ7L 3Q8FA 5BRZA 1PIGA 2FO8A 1SYVB 3D48R 4LGPB 1WICA 3HBZA 1NOAA 2ZWYA 4N86A 4QRUA 4A2FA 3O4LA 3BO8A 4RAVB 2AMUA 3QARA 3GSXB 4F33B 4F5CA 1MFCL 3I6SA 5I1JL 4CU6A 1L9SA 2HJKB 4QKTA 4WI7A 1XGQA 2ADGB 3AU1A 1IGTB 3MV7D 4I88A 4MAYB 1IBGL 5I1EL 3FHQA 3O3EB 2VDOL 3V9EA 4F2ME 4N20A 1K8IA 1OARL 4O02H 3ZZLA 3K6SA 1JXJA 3TYGL 5L9DH 3P4OA 2AV7A 5J6HB 1NCWH 3VTMA 1NGYB 4I48B 3CXDL 2NTFA 1UXLA 2ZKXA 4GIAA 2J5LB 1VADB 2AI0L 1AD0B 1AGDB 2YD2A 4XP5H 5FYJD 1AMYA 3RL1B 3T0WA 1CDHA 3SJVD 3LV3B 4LCWA 1J10A 4LEXH 4KK6C 1IEAA 4ZFGH 4EUPG 4XRCA 2YQGA 1HE8A 1VF5C 2NYZA 3BN3B 4PJHA 1F45A 3DO7A 4XVUD 4XXWA 2ZXGA 1AHWB 4H8UA 5GSRA 3T9WA 2ESVD 5L4JA 43C9B 2X4SA 2BY2A 5CGBA 5FPIA 4B3VA 4N22A 1HYSD 1L9PA 2M83A 4M7LT 2PYEB 4QRQB 2XPGA 3ZY7A 3HZKB 1YEKH 3LJ3A 2IFFL 4WWKD 1ZHKB 4LLDA 4TL4A 4Y1TA 4XPBH 4PJGA 1YQ2A 3SE4C 3GIVB 4ELME 5HDQL 4TTDD 5KJRH 2XXMB 5DZVA 3M17B 3MCYA 2ATPB 4BKLA 1ASQA 1J1PH 1REIA 5IVXE 3HI1B 4ZMOA 5A3ID 3C12A 3LQZB 4NZTH 3DPBB 1VEPA 2CHZA 2J8UA 2PCPA 4GUPA 4UOW0 5HHOE 1T7VA 2C7UA 1JWUB 3AQDA 3JWDC 4MAUH 5ESAA 4UMGA 3H42L 1DSYA 1SHWA 4P4RA 3X1FA 3G6AB 1UA6H 1RP8A 3BDYL 2N1TE 3PHOA 3QXDB 4GAJH 3U2JA 3P9WB 4O51B 3ZPDA 4AEIL 3VFGH 5AL8A 4JCMA 4LCYB 1URZA 4XO8A 3W37A 2V8MA 4LSPL 4Y16B 1R3HB 2DDQL 4P2QB 3JT0A 1RK1A 3MNDA 1J9TA 1BXUA 3MSPA 5DJ6A 4E42A 2XCMC 1FCCA 3IU4H 2XVLA 1MF2L 3DVFA 5EHFA 1LK3H 5D4IA 2X10A 1J8RA 4DCQA 1NFDF 1P69B 3V0DA 1S7QB 1KG0A 5CCKH 1OB1A 1RZ8A 1M7IB 1IBDA 2CR3A 2FEJA 4JK0D 2QQKL 2Y7OA 4JM2C 3UJTL 2AQ3A 2QVMA 4AYFB 1A2YB 4N90E 3UTSB 3G5XB 4NN5C 4DGWC 4HKJA 3GSNH 4XXDB 5FKAA 3MRIA 2BCMA 1GGBL 1I8KB 3EO0A 3WHE0 1YUHA 4LLMB 1I1RA 1DBMH 2DIAA 4WTWA 2NY3C 5FHAL 1S8DA 3W57A 4WCYH 2LVCA 4FJYA 5DTFB 3W38A 3AXHA 4Y19A 1UH3A 5A7BA 5T1DL 3HCVA 2PTTB 2WXRA 1XCTA 3ZU8A 3AS2A 2X4NB 4NNXB 1GZPA 5EPMA 1OT1A 3X11B 5IW6A 4ONGL 4DJMA 4HQQL 1YEIL 2JELH 1TEFA 5HYFA 1A4JA 3OMAB 3GMMA 1SY6L 3MXWL 3QZWA 4JFFD 5BNXD 2CXGA 3D0LA 5I1IL 3OB8A 4TNFA 1ZTXE 1CFSA 2EKJA 3C08L 2QSCH 3B9AA 4HG4K 4XBEH 4KRLB 2HTKD 4TQIA 5ADOL 4CA4A 2JNZA 3OAUH 1PLCA 3DYPA 1MWAA 4YDNA 4X6DA 5AOJA 3ULUF 5DD3L 1AR1D 2GBVA 4IKJA 1DTUA 4QRBA 3GJFA 2R2EA 2OS7A 3QWOB 2XV0A 4U3SA 2Q87A 3KYOB 1M9WA 4HEMA 2F7QA 4G6AD 4IGBC 3FFCA 5GIRA 3UYPA 5E8OA 3DO4A 1BIHA 4NLAA 3A6BH 4M7JL 1TR7A 3QT2A 1CDCA 3CN4A 2WWNA 2ARJA 2QTEA 3WN5C 5CD5C 1PU0A 1HEHC 1E8ZA 3KWVA 2PP9A 1SF5A 4K9EC 4HIIA 5AYQA 2AZAA 1FBIH 2ZYSA 1Z9SA 3EFOB 2O61B 2BHZA 3BVTA 2Q86A 2K0RA 4HISA 3DXAB 3IFNH 3SN6N 2W1NA 4YHZL 2G4GA 4ZPVA 5EOTB 2GJ6A 3IBEA 4JS7A 3KLDA 4ZPTA 3WI9A 1B6DA 1MCPL 5EUOF 5IJKC 4FN0A 1MJUH 3FUIA 4YNYB 1JPTL 3FO1B 4HJ0D 1P84J 3REWA 4BZ2L 1IGFL 2QMJA 4RVBA 4EI5A 3C6SB 5JHDE 1TNNA 4FFVC 1T5KA 5I1DA 2LLLA 3RKDC 1E90A 3U1PA 1FZKA 2XZCL 2Q6WA 1NAKH 6FABL 2FT8A 5DC4B 1RUQH 3NG5A 1TZGL 1CLOL 4YHPB 3N1GC 2NXYD 4K8RH 5L88H 4MKMA 2VZUA 2AGJL 4YZFE 3SDDA 4LZKA 3S5YA 1TJGH 2I25N 2XKNB 2UX6A 1C7TA 3NJHA 2JI2A 2AJZA 2Y6TE 5HHMB 1G9EA 4AK1A 3QJHB 2WXQA 3O3BA 1CXHA 1G7IA 2IGLA 3TNMB 5CEXB 4YGVA 1K9TA 1Q0XL 4TVPL 4Q6YA 4YLCA 1UT1A 2DTML 4ODTH 5FYLH 5T5FA 3CLFL 1VFAA 2E75C 2P5EA 4MAYC 4BH7B 5E1AB 1SZNA 1IARB 5HHNA 5H2BA 1MY5A 3ZZQA 3HKZA 4WUUE 3TBTB 3BMWA 3HJEA 1JFQL 4GSXA 5D71H 1A1NB 3DETC 3IWVA 4FNQA 2VERA 3FQRB 2KLSA 3BPOB 3NCYP 2WNWA 3I6KB 1UTDA 1MEXH 3NJMA 3WIIH 3BFWA 4XH2B 3KXFB 2J5LC 1KBPA 1BF2A 1XIWB 5KOMC 3O8XA 1J5OL 3L3OA 2Y7SA 1EFXD 3NP3A 2DLIA 4RMTA 1J11A 1SN2A 2B0SL 4MJ5B 2WQSA 2A6JB 1N59A 2ZNWA 3SOBH 3TT3H 1AHWC 4KXCA 4OVUA 5K1VA 5I0ZA 5KBNC 3Q5YA 1IBBA 3AG2B 4FXKB 4ANXA 3QORB 4YSEA 2F7PA 2PWDA 1PNDA 3U0PB 3WMSA 4LT7A 3RGVD 1SXAA 1GY2A 3N41F 4I3SH 4U6YA 1ZVNA 4K8RD 1P6WA 3NCWA 1KGCE 2EDYA 3L17A 2Y5TA 5E2WL 4JM4H 5I9QB 4EKJA 2JB6B 2M2DA 2VABB 3PWUA 1KEGL 4OUOA 2FQDA 4NHUA 1E27A 4KUZH 4G6FB 3QFJE 1A25A 1LEKA 1KPRA 2ZF9A 3C2AL 3TIEA 4KKQA 4O2CA 5LBGA 4FQJH 4NQSB 2MCG1 1NDMB 3QHZH 3DX3A 5EU5A 3L3DB 1ND0A 3EOBA 1KBGL 2DV6A 1P9MC 3CFBA 5FYLD 5JPNB 4B7IA 4CN6A 3RDTB 2WSKA 3GBEA 3ISWA 2BMKB 3Q3GA 1U4FA 4KDWA 4FQHB 5HJ3A 2OXHB 5CIPA 5E94A 5T1KA 5D7JA 5DJDA 5F8RC 1KULA 4J23A 4Y16C 5KVFL 3OZ9L 4G7RB 2VMDA 2B1OA 2EDFA 4F7EB 1OAKH 1EZVX 4L5FL 4PJIB 1ORSA 1TNMA 5D7LE 3E3QC 2AKRB 4HWBL 1YNKL 1QATA 1D2PA 4Y4FA 2ARWA 2YD6A 4FCHA 4M3JA 3G08A 1OAJA 1ECZA 3SGKA 4KTEL 1FYTB 4GEJA 4OLWL 1LWHA 5LGHL 4OV5B 2HRPH 1NMBH 4GW5B 3BX7C 4ZO8A 3B43A 1DQQB 2HLAA 3JZ7A 2F54A 5I1AA 4XB8A 4Y2NA 3NPSB 4NT6B 2O6FA 1WZLA 2DQDL 1M6OB 1U9KA 2GUYA 2ZXAA 3CN0A 3KGSA 2I9LB 1F8TH 1QQDA 1UJ3A 4HEPA 1OT4A 4XI5C 4ZDHA 4D3CL 2BRRH 5K1JA 2ENYA 3N42F 3EBHA 3P9LB 2XC8A 4Q52A 1YMMD 4AGQA 1DL7L 3MLZH 3FCGA 1AE6H 4JHVA 5AFAA 3EYSL 3RVVC 2UX7A 2OL3L 2CKNA 4P5MA 1JWMA 5TDPB 1QUNA 3WJLA 1YRKA 4G7YL 4XOEA 1XR8A 3DVNB 5JOPD 1PCSA 2D31B 1UWEL 1WA0X 4B53A 4P46A 1NGXA 3ZDZF 1NKGA 3OAZH 4OQTH 1M42A 4QGYA 1KGUA 3AADB 3K72A 1CF1A 2WVVA 5B4MC 3RWFA 2IGTA 1CF8H 3ASWA 3G04A 1AGBA 4FNUA 4FQ1H 3IM1A 5ANME 3D18A 4XOAA 2DOCA 5E1IA 4KK5C 1PY9A 4EN3A 1RIHH 4U1JA 4WEMB 2JIXB 1VACB 3N1MC 3SSGA 3OD3A 4FFWC 1NUNB 2Y24A 1M56B 2FYYB 2UYLB 4XC3L 2V9TA 2VXSL 1A3LH 1AVAA 1UKTA 4R7DA 2MKWA 2ICWA 1DBBH 2ZWNA 3KPRA 1NSNL 3QULB 2PO6D 4WEEA 1ZLUH 1IU1A 2VMEA 4MQXC 4WY7H 3BH8A 4DKFH 5GJSL 3BEVB 1T0NA 3KGRA 4AGPA 4DPRA 4NWTL 1NJ9A 43CAB 3U46A 1DLHA 3PFUA 3SBQA 2YAFA 3S96B 3QUXB 3V0WL 4BGLA 2F7RA 5FYJL 3WMQA 2HUEA 2IH3A 2WZPA 2WQUA 4G7VL 2CUMA 5HJBA 1RZ7H 3HUJE 5HVFB 1P5VA 4QO1A 3Q44A 3MLUH 4YQXH 5JMOC 1BVNP 3ZJAA 4H26B 2Z1PA 3MODH 4IDLA 2IWFA 2WKGA 5HHPA 4YO0A 1UACL 2LU5A 5C0RL 4UQ2A 1VENA 5CEZH 5FO9B 1NPJA 6PAZA 4EVNA 4AM0Q 4JPQA 5TGBA 2F9BT 2VSCA 4NJAH 3N1PC 4P4KB 3T3PF 5H37G 5MEOA 2VLJB 2DW5A 4JY4A 5ICYA 1JZJA 4FYTA 1S7WB 4KTGA 1CG9A 4U6VH 1TSRA 2AK1L 2JQMA 1A6ZA 3TT1L 5C09B 3INUH 1XTMA 2PXYA 3VH8B 5BUGA 1BJ8A 1ETJA 3FOLA 1T3FA 4L3EB 5GXBB 3VYNA 3MNVA 5HDBF 2BIQA 1SLUA 5KW9H 4NBZB 2AJXH 1JUFA 1AZVA 5B3NA 5E95B 2C1OA 1KPVB 2CGRL 5E1GA 2NPLX 4GQQA 2AV1B 3TVMB 1ACXA 1G7MA 3A47A 2E9GA 5D5MF 2EDLA 1MRCH 3HI5H 2D4DA 4Z8FH 2WYTA 3AUVA 3X12B 4V1DE 4QTFA 5BRZD 4IRSA 1DFXA 2XXCB 4PLKC 3O4LD 2IGFL 4O4YH 4ORZC 3TWYA 2WZAA 5DMIL 5C0CB 2VLMD 4U49A 5F71A 5TE6H 2MHAB 1F6LL 2B3RA 4O02L 3T6QC 1LE5A 4K5MA 4NZUL 1TCRA 2Y5EA 4M8RA 5L9DL 5LKNA 4LSVH 1NCWL 1LO5A 2DH2A 2NX5B 4HJSA 1TZIB 3FTGA 1BGXL 1RHHA 2H32B 2C4XA 4DZ8B 4GI9A 4XP5L 4NYLB 4GMSH 2OYMA 1GGIL 4LEXL 2VMJA 3LKSB 4CC4A 2RQ8A 1FG2B 1Q94A 1KBBA 3TBYB 4KTYA 4ZFGL 1MFEH 1YZZA 1KCLA 1VZIA 1XIWC 5HGBA 3QUGA 3GDCA 1I7TA 4HJGA 1OCOB 1I7RB 3D4GA 1SXNA 1JZ8A 2JB5H 5LUMA 1KLGB 4Q56A 5CEZD 1GYVA 4C56D 3DGGA 1NWOA 3FB5A 4HU2A 4Y4HD 4FXKC 2HN7A 3QORC 2VRQA 4UQ9A 3LXCA 4GRWB 1YDPA 3V10A 4IU3A 2D8KA 4U2YA 2L04A 1N5AA 3V5DA 3G5WA 4XAKE 5KJRL 2J88H 2P48B 1RURH 4IBSA 5EU3B 2PWGA 2I5YL 4KKAC 2ZCHH 2A83A 1T1XA 3IWUA 3U79A 2ISDA 4UIKH 5C7XL 5I9QC 4NZTL 2VN3A 4FI8A 3RWJA 5HYJA 5DK2A 4MAUL 2R27A 3W82A 2E74C 1N12A 5IV2A 3EJPA 1H3XA 1UA6L 1W15A 4GAJL 3S3BB 3UPRB 5JPNC 5DJYA 1A22B 3BXNA 4J4PD 5CP7A 5IHUH 3HLKA 3RDTC 1FI8C 3UAJD 4G8FB 3K4ZA 2VLKE 3IB4A 2HT4C 2CJSA 1X9UA 3IU4L 1ED3B 4ZSOA 1LK3L 2ZCKH 3B3IA 3W5MA 4PP2A 5AAWC 2OJZL 1UD4A 5K1NA 3QRFM 4AEFA 4P05A 4FKKA 4TLUA 5F1OB 3IJ7A 2V2WA 2XV3A 4KQ4H 4NHCH 4OZFB 1H8OA 1I1CA 3UERA 3GJFH 5CCKL 3JV0A 1W6LA 4WF7A 3TP4A 1MHEA 2MQCA 4LL1A 3BT2H 1NCHA 4PG2A 4KKRA 2ILLA 3NPSC 1T0MB 3H6AA 4I18B 1KB5A 2BZCA 5EN2A 5T3ZE 3ECQA 3PLYA 5SWZA 1PLGH 2QZ5A 3NZSA 5FYJU 5LBSL 4FQPA 3ZXAC 2FGZA 3FH5A 4U0RB 2YD5A 4L8BB 2J7LA 4XNXL 4WCYL 2H2SC 2AXJA 5EU4A 3KHQA 5J6SA 3CVIL 2J5WA 1LD9B 2CRYA 4AQ8C 4POUB 1UZ6E 4K4KA 2GTQA 3U6RB 1D5ZA 2JELL 1ZS8A 2VDRH 3WTUA 4QXVA 2APXA 4JFEE 1CT8B 4MDIA 4Y19D 1F3JA 4H0IA 5DJ8B 2XKSA 4XBEL 2B59A 5IF0A 3MRFA 3V0AC 2W0LA 4NC1E 1JYWA 2MTPA 4OJEH 5F1IB 5DHVB 1TO5A 2WQXA 3VRLF 3D2TA 4MD5B 4XB7A 1SRDA 1G9HA 2B16A 4M3KB 3BYTA 4NO5B 4KMLB 4HHWA 4ZJ9A 4WUKH 3UTPD 3A6BL 3EOAA 4GRMB 4R5TA 1URIA 2W60A 3UBXI 1J5DA 1T7ZA 2JK5A 1FE8H 2XN9D 3B2UD 3O6FA 4MMYB 1SYSB 3KBFA 1FBIL 4XVTH 3RWIB 5K93A 3ZE0B 4NNPH 1RQ5A 4XVSH 5E5RB 5C9JA 1Z0MA 1XXFC 1CTNA 3QUXC 5IB2A 3IFNL 4CVXB 1I9RH 2O93L 3KBPA 3EYFB 3NZUA 5EBWB 1INEH 3O6LH 2QQQA 3S8GB 1T5XB 2FE0A 4I0KA 4CDGC 2ZONA 5HPMB 3VQ1C 1QFWH 3WEBA 1NMAL 4GUCA 4M1GH 3LEYH 2FWUA 3F58H 3MUJA 5J57B 4ADIA 3KM2A 1RZFL 2CGZA 3CSYA 2NY6D 1NLDH 1WAPA 4JRXA 5ID1B 2X4TA 2GJ6D 1PAMA 3AXLA 3HA0A 4OLUL 4QHUA 5SWQA 4FFYH 3SGEI 4KRNA 3ZKMC 5IB5A 2C7FA 1NAKL 4OTXH 1OGAB 1RUQL 4JFVA 4KNSA 1UUSA 3VFWA 4P4KC 3MFFA 3RX8A 2APBA 4K8RL 3PIQA 4EI5D 5I17B 5GRWA 1XGUB 3L2MA 2E27H 4MBRA 1TJGL 1N7ML 3BVNA 2Y7QA 1OPOA 3IVKB 5TDNB 4R9HA 5IREA 12E8H 5LXVA 4Z7OB 1RZKH 2YPVA 4ZUWA 4V2BA 3T0ED 3HG3A 1MLCA 5FW8A 4D0BA 3TVMC 4ODTL 1FFNA 4HW6A 5FYLL 3ROOB 5CN3A 1QI4A 3CBJB 5FS5A 5C0BA 3Q9PA 4M93B 3TJHD 3BHBB 2ID5A 2M8XA 2P49B 4XMKH 3WS6A 5D1QA 3VB8A 1EEYB 3N1FC 2F8VA 5J4MA 4MASA 2GJZA 4WW2F 2CO2A 4CGUB 2OV0A 2MWCA 1OOAA 5F88B 2X70A 3STZA 1UXWB 4PV1C 3SKJL 2OL3B 4GSQA 4UZSA 3WXVH 3NDYE 5BUAA 4M9OA 1WHOA 2MQ0A 3UTQA 5HYSG 5L2KE 4HXBH 2P5ED 5J1AA 1BZQK 3S3DB 2H0PA 3LPPA 2D3NA 1MEXL 2A4CA 5CIPH 3BPCA 5HJGA 3WIIL 2R1WA 4KH2A 1IM9A 4Y9GA 3PNWB 3SDXA 1KXQE 1JI2A 3SY0B 5HYQA 3PWVA 4PY7A 5T1LB 5D72L 1XF3A 1HIMH 3I75B 5CSZB 3S37X 2VW6A 2CRIA 1W0VA 2X1PA 3SOBL 1ET8A 3IAQA 1SXBA 3K71B 3DTXB 4TRPH 2VQ1B 3MV7B 1FIEA 1QSZA 5K33A 1TKWA 3G5ZA 3X1GA 4CC1A 3FQNA 3LRSB 1BFSA 1FHGA 3HNVL 2JVUA 3SE6A 4APXB 1TTBA 2AQPA 4I3SL 1IKOP 1AMXA 3CFJB 3QH3B 3NCCB 2YXFA 5KSUB 1M53A 2GTWB 2J6EA 4JM4L 5TDOA 3NJVA 2ODIA 5T3XE 3VXRE 3UYRH 5AKTA 4KUZL 3TJPA 4XP4H 3KR3L 4QY8B 4HFWB 1LM8V 4ZUTA 1AR2A 1LXMA 1CXKA 3SJVB 4AJ0A 3RTQB 3LN5B 4ZX6A 4FQJL 1BZ9A 3KPTA 3QHZL 4TKWA 2NQ3A 5D7IB 4IBQA 3BKCH 3ATBA 4XODA 5GGSY 2JLPA 4F7TA 3UG3A 4OBRA 3BPLB 3GTTA 2X2JA 2OMTB 3B7RL 3V0VB 2AABL 2EKSA 4QMEA 3CZKA 5ERWB 5DHDA 3EO1B 3MJ9A 3QSKB 3FYEB 5SX4I 3P4MA 2D2CC 1W0WB 3DVGB 4S1QH 1T1WA 1LWRA 5D2LF 1T1YB 2EO1A 5F3BB 2IO5A 3S5LG 4OKDA 4ZAKB 1ZSDA 3WFEH 3OKMA 3WNLA 4GUQA 4M8UA 5D7JD 1HEZB 5AOMA 5T1KD 2QV4A 4PY8I 2GUOB 5GRXG 3BWUC 4M5ZH 3A67H 4DP7X 2HRPL 3EBIA 3BW9A 3MROA 3ZTDC 2EXTA 1PZBA 1KUMA 2KZ1B 3HG4A 3VWJA 4Y8DC 2ZYRA 1KFGA 4KWUA 1VEMA 3F62A 4DGYL 4YEEA 2DI7A 3L1EA 2BWQA 3ISRA 1CFMA 4HVBA 4I18C 5FW6A 1WVZA 1JXGA 2HMIC 3BIKB 1G6RH 3D9AH 2F54D 4O02B 4POZD 5MP6H 4GKZB 2DWDB 4U0RC 1FRGH 2F53B 5EU6A 3MLZL 4PIRF 1AE6L 3MU3A 2XA8H 4KKZA 1WBXB 3L6FB 5A2LH 4KK9D 1FYHB 2EZ0C 1A6UL 3ZYOA 1JPFB 2CA4A 3MBEA 1ZJAA 5D93B 1XB3A 1SMOA 1TQCB 1MOEA 2E59A 4MJJA 2O6DA 4PJFB 4A2EA 2CBQA 4OQTL 3BZ4B 4IOIA 2NSXA 3KCPA 3K1DA 2OP4L 1DEEA 1CF8L 4LHUB 3FRUB 1HI6B 1KTJA 2Y1AA 2I24N 3BKML 3HG1D 1Y6MR 4PMFA 1TFHA 4YR6B 1IEBB 1RIHL 3QISA 2Z7WA 4P46D 3FO2B 1LO4H 2ORBL 1GOGA 5FOBB 1QBMH 1CBJA 5F6IB 1FAIH 1AD9B 4X4YB 4P57B 4J3OH 5ISZB 3OR6B 1KTCA 1A3LL 4GG6A 2DD8H 1R1CA 3FDWA 4PJDE 5JPMB 4LASH 2AJUL 3M8OL 4EN3D 1I53A 4DKFL 2NY1B 1T20A 2IG2H 2P42B 5DYFA 4GP5B 1I8IB 4NLHA 5J7CC 2JJVA 1FH2A 1S9KC 1DANU 1RZ7L 4NQCA 3OJVC 4LIQE 2EE6A 4HUWB 5IM7A 1YEJL 3MLUL 4YQXL 4JVUA 1IILE 3VFUB 4PJEE 5F70A 4IOFC 4UT6A 3ARBB 1AR1B 2Q1EA 1QRNE 3UTOA 2FJHA 1TMQA 5CEZL 1YEFH 2Y3AA 4IHBA 2ZAIA 4R4BB 5I1CH 1USZA 5HD8C 1I3GL 1VFBB 1UVQB 1NKRA 2BK8A 3A3YB 2HZHA 4MZIA 1WFUA 3MRCB 2QVTA 2BERA 3I02A 3INUL 2A9MH 3ETTA 5I6OA 4J3TA 2AC0A 4U7KA 4X5XB 1CGSH 1KTBA 1N8ZB 3Q43A 1A21A 5GPRA 4AYGA 5AYUL 5IR1B 3FSOA 5DJCA 3TURA 4PGDB 5D2NB 3SQBA 1E9OB 3MCG1 5KW9L 5KBDA 2AJXL 4TLTA 4HHAA 4WFEE 1SVZA 3D2UA 1FJ1B 5C08E 2H0EA 3O2WH 3OPUA 4L37B 3KYMB 4FMFA 4JO1H 4OGXH 2PXYD 4GFXA 4PD4J 2W9DL 2XLLA 3HI5L 1MRCL 2MQ3A 1WFIA 2MNUA 2PYFA 1ODAA 1M71B 2OX5A 1KIUA 2GEQA 4FCAA 4J3OD 4M93C 4DSYA 1IQDB 3B9DA 1I3RB 5FAAA 4O4YL 2VZ1A 4B60A 5IJVB 5IBUG 1RAMA 1Z3GH 5JYLA 2G0LA 3HN5A 1MAMH 2D03H 3GI8H 1EGJA 1AOZA 1KYOJ 3QZLA 4JO3L 3GBDA 1OHZA 4LSVL 5EIIB 2C3XA 2HFEA 3V6FA 4AZ8B 2WMPA 3OAYK 1ETZA 3BUYB 5HI3C 1WP6A 5KVEH 4PJ7E 3VXOA 2NXYB 3IJYA 5CFAA 1EPFA 1A4BA 4PV8B 4GMSL 3HLAA 3I9GL 4LKXB 3I50H 4KKLD 3LRKA 1MFEL 3L4YA 4KVNH 4Z3GA 1KJVB 1P1VA 5KSBA 3S97C 1K5NA 5EUKB 5DI8B 1RZQA 4QXGH 2W8CA 3S37H 2NCMA 4HS6B 3H4HA 1R46A 2JB5L 2XSKA 5FUCC 3VWKD 2WYIA 3NIDB 5J6GA 4GXFA 2FLRT 3FT3A 5HYEA 1XMWA 5IFJA 3CIAA 3G5VB 3FN3A 5IEKA 3G7TA 5DQ9B 3T6WA 3L4TA 4PJBE 1RERA 3KLSA 4RFEA 1PYWB 1WT5C 3T65A 1MDAA 3P3RA 1XD1A 1ZEAH 3CLWA 1ZLDA 4FEMA 2YQBA 4ORGA 1DQTA 1RURL 2BNRD 3FUNA 3O2VH 1AQKL 3QDGA 4X50A 5FF6B 2IDCA 4HUMB 2ZCHL 3QC6X 3N44B 3RPKA 3QNXB 4CBZA 1I7UB 4ECNA 1SDAB 4UIKL 5AKSA 1MCRA 4AXWB 3N0PB 1HCVA 1BBJA 1KTRL 3ULAB 4KAQL 1DVTA 2YBGA 3D87B 3K4AA 5IHWA 3RTQC 1EFXB 1T21B 2F58L 4DN4H 3FQTA 3FFOA 1LILA 4BFRA 3X1NA 4XVUC 4IU2B 1CFTB 5ETUA 5IHUL 3MV9E 2WLIB 3C8KB 3BPLC 5HYJD 2X89A 5E2JA 1TZHB 4DGUA 1HKFA 1M7DB 3ESMA 1E0OB 1QSFB 1H6EA 5E4IA 2J56A 3POCA 3T2OA 5CR1A 3N5AA 4PJAF 3TO2B 1JRHI 5JDSA 4JZOA 2NY5H 2ZCKL 3HZMB 1MWAL 3E2HB 3P11H 1OGSA 4XWOC 3U2SB 5FHBH 2BW4A 1PDKA 4KQ4L 4NHCL 4TTDC 1BFVL 1PVHA 4ZAKC 4HOXA 2PPFA 1L6ZA 4Z7NE 1E28B 4JO2H 4FP8H 1MHPH 2G3NA 1I82A 4PJ6A 1T4KB 3BT2L 4PJ5A 3DJTA 3QQ9D 5F0PB 4EMZA 3AUWB 2VR9A 3CV5A 2VN6A 5BO0D 1Y6KR 3QA3A 4ZMXA 4L4VE 1AFVH 3H0TB 2OZNA 2CH8A 5G4OA 1QACA 3CFTA 2CK0L 3G6DL 1KV7A 3BRGC 3KPOB 1VGKB 3WL9A 4BD4A 5CZXC 4NCC2 3VYPA 1D9KB 1CR9H 2Y5QA 1Z5LB 2HFGL 2MCPH 4WNQB 5C0AA 2YMXH 4W6YB 4FFZA 4R0LB 1GJWA 4FQQB 3RX7A 4ZOAA 2KPNA 4WI0A 4AUUA 4NZJA 4XPTH 3L5WA 3WTTA 3BPNB 4EUPA 4A66A 4N2OA 2VDRL 5DDHB 5D93C 4PRIA 1TQCC 4F93B 1VCBC 1NFDA 3AG3B 4RCAA 3IRCA 4Y5VA 5A2IH 2ICWI 4PTTB 5IQMA 1KACB 1ODUA 4WFFE 5KANI 3TF4A 3QEQD 1IBZA 4N5ED 1ID2A 5HI5C 3SGDH 1PKOA 3U9UA 1WPCA 2Z8SA 3HHMA 4NQTA 5JZ7C 4KGLA 2K70A 1G1CA 1QD0A 4OZHE 2PNDA 4WUKL 2WAHA 5F6IC 3FU0A 5MENB 2R4RL 3B5GA 4M4PA 1YMMB 4WTZG 4WZ9A 4K94C 5CD3A 2WANA 2Z7ZA 5L0QB 2F6AA 4KXDA 5JPMC 3GI9H 3L4WA 5T5FL 5IMOB 2NY1C 5DJZB 4XVTL 4M6ML 1WD9A 2ZIDA 4FTVA 3M6DA 3QO0B 4NNPL 1JL8A 2KZBA 4D9RE 5I75B 1O6TA 2WTRB 5CXPA 3WOVA 2OTUA 1I9RL 1UC6A 4I2XB 2EVFA 4ELKB 3TNNA 2XQYK 3O6FD 4H4NA 4JAMA 2DQGH 2ENPA 3PWPA 3LZFH 4IK7A 1INEL 3O6LL 5J56B 1TENA 1PIFA 1QFWL 4MXVE 1SQ2N 3F58L 4AYDC 5D7KD 3NIGB 1ITCA 4JPKH 1AR1C 3ARBC 3WFDH 4YBHA 4TTGA 5FO2A 3MGAA 3OVUB 4ZNEE 5DVLA 1GRWA 4J3WA 3LS5H 2H2PD 4KHXH 3ULSB 5BQ7A 4OTXL 2B20A 4AH2B 4XNMB 5D4HA 1OXYA 3IU3A 5DC9B 2PO6B 1UCBH 4UU9A 3N0AA 3C6LB 1C16A 1Z6JT 5EC1B 2CBMA 1JGEA 3BJ91 4B41A 5JW5A 2YIHA 1JPST 2E27L 4RA3A 2P80A 1BQHG 2BVQB 3MRMA 12E8L 3W0WD 1EH9A 3OWEA 3F7YA 4AY0A 3H9SA 3MRRB 3SQRA 1IAMA 5D2NC 5IVOA 5AAMC 2F1AA 1RZGB 5ITFA 3EGSA 5LHDA 4Z5RB 1EANA 1J9RA 1TO4A 2R7EA 2FH8A 1T2QH 2PN5A 2WNKA 3GINA 2IC2A 5E0FA 4XMKL 5DYOA 4URKA 1E4WL 1ESOA 1WH0A 2WSDA 1SJHB 4HJ0C 4XCNB 1I8AA 2H3NA 3QNYB 2TSAA 3K6IA 5EOQH 3BP6B 2EIKB 3GRGA 4POYA 5EUOA 3WXVL 4E9QA 3Q01A 1KT2A 5K5YA 1J1XH 1NBZB 3DLQR 4HXBL 4PJCE 2HVJB 4QYAA 5D1QD 1RKRA 5CEYB 5FYKE 3UZEC 2YA0A 4O2FA 1IGML 2NXYC 1G9MC 3QCUH 5KVGE 2PW1A 4PGEB 3ME0A 1WCBA 5TF1H 1A5FH 5C0IA 3ZGIA 1HIML 2IWKA 3GGWB 4XZUA 1A3ZA 3RZCB 4GXVH 3CFIC 2YARA 1KB9K 5E8NB 1HNYA 5DCCA 1IM9D 4TRPL 4X6FA 5BZDB 3FSVA 1SVCP 1HTYA 4EIUA 4Y5YB 2C9QA 3U9PH 4X8CA 2KERA 4QRUB 3O4LB 3BO8B 1U91B 4JG9A 2YJQA 2BNQB 2XVBA 4BH8B 3AW5A 1XEDA 2M1KA 3P0VH 1XGQB 3AU1B 1J86A 3EH5B 4F15B 2ZYIA 5F7DA 1JF1A 2YEQA 3BN9C 4WJKB 3SKUD 1T7YA 2D0HA 2DPKA 3P0YL 1ZHNB 4XP4L 2RMNA 5AW8B 4AQEA 4PCKA 1LQSR 1LDSA 1K8IB 4OCSH 3NMEA 3K6SB 5TE7L 4FYRA 3P4OB 2AV7B 4W6WB 5HGDA 1Q1JL 2OR8A 3BKCL 4DN3H 4HK0A 4KY1H 3WE1A 1AC0A 1W91A 4MCMA 2E7CA 1R5WA 1I9JH 1IIKA 3LEVL 1CDIA 4OFIA 2CLVA 3VI4F 5FFGA 4MNQD 3VSVA 1O9WA 4LCWB 1PQZB 1RJLA 4QOKE 3UDWC 5I0DA 1IEAB 2ED9A 4WU7A 2HLFD 2X3AA 4N3TA 4PJHB 1J0HA 1RVFH 4LSDA 3DO7B 1ZA6A 5KN5A 5DD6A 5C0GA 1HQ4B 5GSRB 1DJIA 1M3IA 4S1QL 4HK3N 4DGVH 1XF4A 1AY1H 1WS7A 2AQTA 2DBJA 3WFEL 4OZ4A 4RWYH 5C6TH 2DBLH 5I82A 3E2HC 1QNZH 2XPGB 2OM5A 5IQ9A 4B5EA 3RPBA 4LLDB 4M5ZL 3A67L 5D9SA 5FO8A 2W59A 2WJ5A 3MV8D 4PJGB 1FPTH 3DOHA 4CNIA 1QG3A 1ROCA 5C86A 4IBYA 1CE6A 2QSVA 3DC0A 4BKLB 1NOLA 3NK4A 5IROA 3KZ8A 3AY2A 4GH7B 3CHRA 2E9WA 2EILB 5I5IA 2J8UB 4GUPB 5EU7C 4IDJL 2C7UB 3RY6A 1UENA 3SCMA 2JTDA 5ESAB 3QW9A 3AWFA 3IJSA 5E6RB 3NCMA 4P4RB 4A7VA 4LOVA 5LAXA 3PHOB 1D9KC 1FRGL 3FT4A 3QJUB 1ADQH 2PABA 2QGEA 4H7VA 4ZUSA 4JFWA 4R0LC 4I87A 4UZGA 3CXHK 3MRJB 4JG5A 4GFTB 4N2AA 3VYOA 4JO4H 4LOEA 1XEUA 3ILQD 1RK1B 3BPNC 5AOIA 4JDVA 5DJ6B 4MA8H 1UWXH 1XH0A 4CUCA 2DQIH 3DVIA 3KPSB 3L1GA 4EO5A 2DWEA 1YN6A 5BRQA 2WCGA 2OULB 4JN1L 4JQXA 4DCQB 2OMXA 3LY6A 3T3ME 1U8HA 2YK1L 5E9DE 1KG0B 2HJLA 2E9IA 4D7PA 2OR9H 2GBTA 1ZLEA 1OAXH 3MBED 1UCTA 1OB1B 1RZ8B 4JY5H 1QBML 2AXGA 3BP4A 4PAZA 4WFGE 1FAIL 2XX0A 1CFNA 3UH8A 4MJID 1OAUH 1Z32X 3WO4B 4PQXA 3OJ2C 4HKJB 3H7BA 3PQYA 2DD8L 5FKAB 3MRIB 4CRPA 1MCSA 4K23L 3THML 3EO0B 3WNNA 1YUHB 4LASL 4EN2A 1KJ3H 1GH7A 1E6OH 4QI3A 2IG2L 4Z7VF 3WAKA 5L0QC 4KTDH 4AQ1A 3F04A 4DP8X 1S8DB 4G6MH 2LOEA 4J3SA 1FNSH 1KN2L 1T7WA 4PP1C 4ACPA 5I75C 2EUXA 3HCVB 4S10A 1EGJH 2VJ0A 2VXQH 1XCTB 3CCHB 3HNSH 1GZPB 5EPMB 2AFNA 1P7KA 5IW6B 2GFBA 1C5DA 1A4JB 3GMMB 2NZ9D 3QZWB 3V4VA 2YD1A 5GQBA 4E5XG 1G84A 5AW2B 1JCKA 1CFSB 4FHJA 4NQCD 1YEFL 3L1FA 4KZDH 3ABMB 4L05A 2BIPA 5I1CL 3MRQA 2BVYA 3JWNH 4JEGB 2WTOA 1MWAB 4X6DB 1BD2A 2WNXA 2BX5A 3DV6A 3GJFB 2R2EB 2PO6C 1RZPA 4U3SB 4LRIC 1MAKA 1CDBA 3C6LC 4WWOA 1U21A 3FFCB 1A14L 3EYQD 1CGSL 5GIRB 3UYPB 5GZNA 1SJMA 4DEWA 1G7HB 4HLZG 1FIGH 2ARJB 4BXVA 4HIIB 3O2WL 2FECI 4JO1L 2PYEE 2Z34A 4PRAA 1SQMA 1Z9SB 4EZJA 4JKPH 2OMWB 2R1YA 3LPWA 3O9WA 4N2IA 4AL8H 2ZOLB 2Q86B 1JK9A 2NY6B 2YWZA 2ZWKA 4BQ8A 5I2IA 1H6UA 4JN2B 5AVVB 3D2UD 4Q7DA 2E76C 3PV7A 1MAML 4ZPTB 2Y06H 2D03L 2KLTA 2FUTA 3QP3A 5D1ZI 4TM9A 2AJ3B 3TZVA 1RY7B 3REWB 4HWZB 3A4AA 4ZQKA 4EI5B 5I1DB 3MREA 2BVPA 4MB3A 1IGCL 2EXSA 1FZKB 2Q6WB 5CFHA 2X3CA 3SD5A 1S2EA 4KVNL 2PPCA 3L2LA 4K5NA 4A37A 5BOJA 2GC7C 1P7QA 4QXGL 5J11B 4P2QE 3RZCC 3FQXA 3SDDB 4FLOA 5LCVA 2P5WD 2AJZB 1S5IH 2APWA 1HT6A 1QHQA 4G1EA 4Y5YC 1E9PA 2IDQA 1UG9A 4GIOA 1RIVL 1S6NA 4EBQL 2WVSA 4AVKA 5D5MA 4YGVB 1AS7A 4EOWL 1ZEAL 4I0CC 3UO1L 5BJTA 3L2NA 5CKGA 3V6OA 1J9CT 1VFAB 4WJ5A 1KB5L 4ERSH 3ILDA 2P5EB 3PXJA 3HW7A 4MLSA 5E6UB 5HHNB 4F15C 2I07A 2E46A 1X9RA 3UTSE 2O5NA 1JP5A 3GXDA 2V5SA 3DGCR 3MX0A 4LLVA 1DN0A 5GGTA 4QHLA 4OUUA 4DN4L 4ENEC 1OY3B 1YNTF 1DUYA 2QZQA 4EUPH 4MA7H 4UYQA 1CU4H 1DO5A 3O8XB 3L3OB 5H37A 1B3JA 4JRFA 4KRPD 1QFUH 1WUNT 2DYSB 2HFTA 5HSFA 3CHSA 3LOWA 3QQDA 5DA4A 1D7CA 4XXWC 1IC0A 2YAMA 5ESVA 5C8JA 4H88L 2X89D 4D8PA 4M56A 1UA7A 1YEGH 3P11L 3SKOA 5FHBL 1B0IA 2I7OA 4QT5A 2VAAA 3CAFA 2EE9A 4NUGH 2QTVA 4TUUA 1Q1PA 4JO2L 1MHPL 2FBJL 2LFEA 4LL4A 2WGXA 1Z9NA 1DDHA 3EDEA 4U6YB 3PAZA 4HJJH 2H9GA 1RK7A 2VTFA 1FZJA 4U1HA 3PWUB 5C9KA 5DQJB 3JTSA 1WIUA 1AFVL 1KPUA 5D55A 5T8IA 3QCVH 1E27B 3VXTA 1OM9A 1A8ZA 1SFHA 2VN4A 4N8PA 5IMKA 1LEKB 3HE6D 3IDNA 4N9GA 1KPRB 1ZHLB 1H6TA 2NYYD 1G87A 1NCAL 3TIEB 4Z7QE 4O2CB 4Q4IA 2XQYG 4LDCA 1OTUD 5EU5B 1IBHA 1ND0B 1CR9L 1CFBA 1P6AB 3CFBB 4JVPA 4A7TA 1NIBA 2YMXL 1OVZA 4LDOB 2A9AA 4OI9A 4I9WE 2AITA 5DGRA 1X5FA 2CKBA 3Q3GB 2BS8A 4XPTL 4GYBA 5HJ3B 5HGHB 3DXAE 4QXTA 4TSAH 5D7JB 5E94B 5T1KB 1KFAH 3FPXA 1F86A 5J3HC 2HRLA 4LSQH 4OT1H 3V0JA 2V5MA 2Z91A 4JQIH 1KSRA 3TIDB 2CLZB 3ZR6A 5A6MA 1UB6A 3ULUH 3OLEA 4ZD3L 1JF6A 4Y4FB 3CZFA 1CD8A 2HWZH 4GBXD 3G08B 1S78C 1M05A 1VKXB 3DWTA 2X6VA 1MNNA 4R3SA 4BRVA 5K9KA 5AW1B 5CAYB 5LLIC 3EHBD 2HLAB 4M48L 5I1AB 2F54B 1LWJA 2ZXQA 1SEBA 3VXUA 3GF8A 3W9EA 2YPVL 3WO4C 1INDL 3L7FA 5AVUB 5BOPA 2E7BA 1UJ3B 1QQDB 3O4OB 3GI9L 5KVDE 3WFHA 2C3HA 5FA4B 4ZDHB 1J1OH 4FL4B 5HHME 1AKPA 3QDAA 2H5UA 2X1OA 3MO1A 3GTVA 4LARH 5GRVK 1ZLUK 4FHBD 1X5XA 4L4JA 5DJXA 5BRPA 2Z35A 2C3VA 5JIPA 3L3KA 3LZFL 4GRLA 4P5MB 1JWMB 3UJJH 4CGTA 1DE4A 3F84A 4MZ2A 1XR8B 4BSWA 1GYAA 4OH2A 5AG9A 4P46B 1NGXB 3JVFC 3WFDL 5F9OH 1SOKA 1ZT1A 3PP3H 4AI7A 4OVVA 2FB4H 3K72B 5DRNA 4ODHH 2WVVB 3RWFB 3PWPD 1Q9LA 2PW2A 2ZOKB 1N0LA 5HXMA 3G04B 1AGBB 1U8QA 3O3AA 3D18B 1H8LA 1XQ4A 2B9AA 1V3JA 3PL6A 4FDWA 2XHNA 3KXFE 4X4ME 4Z78B 4JMXA 4EN3B 4U1JB 1II4E 2FATH 2ETWA 4UCFA 1IFGA 1XGTA 3B2UC 4KO7A 4PS7A 3CX5J 2ADJA 2EECA 5C7ZA 2E86A 5AW4B 4JG0H 3PHQB 3LYRA 4R7DB 3ULUD 3OKNA 2ICWB 3KPRB 3MHZA 3E6HA 5JTWA 3BH8B 1FF5A 2DQEH 3AT9A 3QRLA 1GR7A 1T0NB 1QBLH 4D94A 3B7YA 1NJ9B 2P80D 1DLHB 1T2QL 2J6EL 4GXUM 1AHMA 2RIKA 4JZJA 4OZGF 1MH5A 2WLMA 3H9SD 2IH3B 4ZW7A 8FABA 5KBMA 4A2GA 4LLWA 2NY6C 2P8PA 5EOQL 2XIIA 1P5VB 4QO1B 1DBAH 1T22A 5C0JA 2FZ3A 5EBGA 1OGPA 4F8QA 4UV7H 1WD8A 2V37A 1A02N 3MRNB 1J1XL 3PWJA 5HHPB 1CS6A 3K91A 3HN3A 4YO0B 3BKYH 4GIPD 1CL7I 4UQ2B 4EI5C 4X5RA 4D0CA 2BJMH 4EVNB 5TGBB 5E99H 3MJ9L 1FFPA 5DFVD 4Z3TA 5MEOB 4JY4B 5ICYB 1CG9B 2WQWA 1GGTA 1A6ZB 2IMMA 4GXVL 1YPZF 3ZHLA 2PXYB 4NKDA 2WXMA 5J11C 4JKMA 3FOLB 3S4SG 2DEWX 1T3FB 5CP3H 3SDDC 1I8LA 3M1BA 1OV8A 3MNVB 3LPGA 2YAOA 5IFHH 3U9PL 4PJIE 4HIEA 3TJHC 2A7BA 1SN5A 2C1OB 1UT2A 4OD2A 2H26A 2R69H 4U33A 2C9RA 1G7MB 3GK8H 3GSUA 4FABH 4FG6C 1RLWA 1BVKA 4WIQA 4N0CD 3AM8A 1FYTE 4RMWA 5DMGC 4IRSB 2UWEF 4MJ4A 1DO6A 1MPAH 4KXZH 3B9KA 4J39A 2DKUA 5EB9A 3P4NA 3B3BA 3NPZB 4WW2A 2W5PA 5ALBH 2J4WH 4PCSA 1LE5B 1XL4A 1TCRB 1VGEH 4AITA 4ELMA 3MV11 1IJNA 1LO5B 1ZLWH 5F7MC 1A3RL 3FTGB 5DZ9A 1RHHB 2WOYA 4KROB 3RG1C 1AG6A 4KY1L 5GISH 1ZANH 1I9JL 4J8QA 4CAGA 5ID0A 1NBVH 4UNUA 3ZDXB 1Q94B 1UB5A 4XN2A 3O8XC 3L3OC 1AZBA 5HGBB 3OXRA 3O45B 4LSSL 1I7TB 1RVFL 4HJGB 4NP4L 4OLXH 4OV6F 4AYSA 1RHFA 4F7MA 1B4JH 2WGNB 1U2YA 4H8PA 4DGVL 3OG4B 1AY1L 4MMZA 5F7FA 3UIZA 2XTLA 4RWYL 5C6TL 1F58L 1C08B 2DBLL 4BA0A 2Q3ZA 3DGGB 1G43A 1QNZL 3FB5B 2HN7B 2APVA 4R8WH 4EXKA 1YDPB 1NC4A 2AQ1A 3DJSA 3WKMH 1N5AB 3V5DB 4XNBA 5D70L 4RAUA 2BC4A 2QBWA 2R9HD 1E67A 3PHSA 1B2WH 2A83B 4M61A 4DAGL 1TMCB 3RWJB 5GZOA 5HYJB 1NEPA 4PHZA 5DK2B 3EH2A 4YHKH 5PAZA 3GXTA 4PEEA 4PRPB 1HU8A 1W0YT 4HPOL 1UFUA 1MCJA 3EGXA 4K15A 5IV2B 3LZPA 2EVJA 2ED8A 4YHNA 2ZPKH 4W9EC 3APMA 4L48A 5DJYB 3BCDA 1ADQL 3BXNB 5CP7B 3D39D 4ZFOA 5BMFH 4A1RA 3SCMD 4APQA 2IVFC 4UT6L 1BEYH 2MSPA 4JO4L 4PJXF 2EIJB 1QFPA 5B7EA 4MA8L 3ZL4L 3SPVB 3LHPH 4U0QB 2DQIL 4U2ZA 3KDMA 4ZSOB 3TBVA 3B3IB 3F7KA 5D2LA 3PG2A 1X7QA 4PP2B 5C3IA 3B37A 2ZUQB 1I8MA 3SDCD 4D0DA 2V2WB 4HD9A 2OR9L 4KPHH 3BUTA 4K7PH 3VXSA 4L29A 2F5BH 1MHEB 4Y4FC 1SDDA 3MYJA 4JY5L 3EGDB 3SGKC 2YEVB 2VLJE 1MCKA 1OAUL 3SE9H 2YRZA 1CLZH 3SZKC 5C09E 1NFIA 4CVUA 4POZC 3WEOA 1FN4A 4ONFH 1KB5B 5EN2B 1KJ3L 1UM6H 4L3EE 3TCXA 1E6OL 3V4UL 1NGPH 2MQGA 3T6VA 4N8VG 5SWZB 5HBBA 1UJ3C 3O4OC 3GPSA 1WAAF 4MSWA 3G9AB 4G6ML 4FL4C 3H9HA 2BVOB 1FNSL 3KGUA 3L4ZA 3PQYD 1EAJA 1I3VA 4NAMA 5EU4B 3BUPA 5HY9B 3GBML 1EGJL 1OM3H 3MRLA 2D3LA 1JGLH 2XN0A 2MTAA 1D5ZB 2PWHA 1YNLH 1ZS8B 1NUFA 4PIBA 5C0CE 3CC5A 3WJLC 4MDIB 5DMJB 1KELH 4MLIA 4P46C 3S5LA 4HJTA 3DYOA 2NX5E 3FK3A 3C8DA 4KZDL 4JFQA 5IF0B 2B59B 1A6TA 3MRFB 4MVBD 2YRPA 5EEZA 4KVCL 4OD3H 2VXVL 3TS8A 2XY2A 2VDKH 5LCVH 1D6VH 2G60L 4EN3C 5JHDA 1Y6NR 1M3JA 3EOAB 4OJCA 2FX7H 1CYWA 4ZOCA 4OCXH 4IRZA 1FIGL 4J2QA 4NS0A 3WKYA 2JK5B 1BD2D 3L3JA 4FQIH 1AHKA 3O6FB 1HKLL 3P2TA 2EDBA 2X6CA 3N9GH 3W9DB 3NSYA 2EINB 3MRPA 4GRWE 4AL8L 1X7SA 3LEXB 2VRKA 4AG4H 3TA3A 5C9JB 3R7QA 1C7SA 5IB2B 3VXMB 3MKKA 2GY5A 2VDMH 3DROA 3F83A 4OCRH 5GGTH 2Y06L 4KMTL 4QJ3B 4ALAL 3VG9B 3FT1A 1FP5A 1XB6A 1BVLA 3FRPG 5E6ID 4ESKA 2E47A 3GHPA 3CSYB 4JRXB 3KW7A 5I1KH 3QXUA 3WCYA 3H2QA 1ZT4A 2XJKA 3AXLB 4QHUB 3E1ZA 5IB5B 2O1AA 4WUUA 5SWQB 4F7CA 2ZX8A 3TCLA 3I3BA 4NQED 4OCMC 2AQNA 2F68X 1CIDA 1F11A 3NZHH 4M5YH 4UNIA 3VFWB 4J28A 1GPOH 1IC5H 3MFFB 3PIQB 4XMXA 3NFPA 4NO0A 4G9FA 4WHTA 2LE9A 3PDOA 3SDAD 2ZCLL 2PXYC 3BVNB 3WLWD 2Y7QB 4G5ZH 4MCZB 5CM1A 4B9GA 3HIZA 2A9DA 1EVUA 1FGVL 1S5IL 3NSCA 2BFVH 4U1IA 3S2AA 4GXUN 1P7QD 3QJOA 1ANUA 4LKCB 4C59B 3DARA 1MLCB 4D0BB 5GGVY 1FFNB 5FECA 1WFJA 2Q7YA 2IPUG 2J43A 4HSQA 5C0BB 4KZCA 1J8HA 5A6IA 5D1QB 5KOVC 4IRSC 4ODSH 4D9QE 4K55A 2GJZB 4TVPE 4M1DH 5J1SC 5DURB 1TLKA 3EJSA 2UUDH 3QUMH 4G1MA 1PGRB 2X70B 3NFSL 1KCRH 3STZB 1AZUA 3OLIA 1CURA 1YLBB 3UTQB 4P5RA 4FFZL 2H4EA 1PCXA 5J1AB 4PVMA 1HEJC 2PETA 1GW0A 2CKBH 4KROC 1ERNA 3BPCB 3MZGB 3QFJA 2R1WB 4NPKA 1IM9B 4FAAB 4MA7L 3LD8B 2VLRA 3SDXB 4WLCA 1JSYA 3PWVB 4CC4C 1E4HA 1QFUL 1PZSA 1XF3B 5B3JE 2VQ4A 4Q9QH 4DOHB 2IDUA 1JK8A 1R75A 2H8PA 1W0VB 3HTLX 2P1YA 3MJWA 5M7QA 1DJZA 1S4IA 3FQ4A 1NBYA 2FUQA 4G8IA 4G9DA 3FQUA 2QPFA 1TKWB 1SM3H 2P24A 3G5ZB 4NUGL 5TQ2H 1H15A 3FQNB 4JZNA 4K5OA 5HP5A 2TRHA 1HQRA 3S3CB 4H8WL 4HJJL 1FLTX 4OD1L 3ZTCC 4U7MA 1PBYA 3TC9A 3ILPB 1SOSA 1YYLH 4GMTL 4ANUA 5CBAA 1HZKA 3FH7A 5AW7B 5TDOB 3V8CA 4I7ZC 3HVDA 1S9XA 5DA0B 3FL7A 3QCVL 4W9DC 2WLYA 5I16A 4ZUTB 1UKSA 4MDJA 1TQBB 3ZDWA 3MBWA 1BZ9B 1B6UA 4KO9A 1CE1H 2AEIT 2EXYD 3V0IA 5F89A 2I69A 2ITCA 2K8QA 3ZE0E 2E7LA 1XSJA 4TSAL 4ONHB 2EKSB 1KFAL 2WO2B 1XD0A 3WY3A 2QVKA 1MQKH 4LSQL 4OT1L 25C8H 4JO5A 1T1WB 2Y22A 4HP5A 3K4DA 4N28A 4BWUA 1ZSDB 5AB9A 3OKMB 3ULUL 2DI8A 3H53A 4YX2H 4XMLL 2ZXCA 5E1HB 3X17A 1RPQA 2ZUQC 2YFOA 2HWZL 1A7PH 2X3BA 1OGAE 3BW9B 3GXFA 1ZV5A 2HTLD 2NMSA 3CDGA 3GZKA 1F41A 3MROB 2V3FA 3TGXA 1WZAA 2D7NA 3VWJB 4NOBA 5DS8A 4GO8A 3NP4A 4PG2C 3P54A 5HGAA 4S1SH 1BYNA 2A9NH 2DKMA 1F90H 1VLXA 3WMPA 1WA2X 4XO9A 5ICXA 3NAAL 3FJTA 3VA6A 4NRXA 3UGUA 2A73A 4E2OA 2JLLA 4Z7OE 3ARGA 2QKIB 2GYSA 2ICEB 1I85A 2FO1A 4OZIF 4OI8A 4GG8A 4LARL 5E08H 5EU6B 1A7NH 1K5WA 4LF3A 1MCWM 1ZV9A 2EEDA 4G59C 4BFNA 2DMHA 5A40E 1TTGA 3QRGL 4MNGB 3WFCH 3UJJL 3VD5A 1YECH 4H5SA 2BW5A 1OL0A 4PUBH 2OMUB 1LJMA 3VTTA 5TPWL 3NRPA 5F9OL 3QYMA 1CZ8H 2FB4L 4IOIB 1QLFB 4ODHL 1D5IH 4DQOH 3KCPB 1TLMA 4JDTH 1DEEB 4W9LC 5ENWA 3D12B 4JFPA 1OCCB 1BW8A 1WWWX 3ZDYB 4B6ZA 1IC7H 1XL6A 4BQCA 3MOQA 5E51A 1PW3A 1BXAA 1QSEA 4G8GB 2FATL 3OKKA 1MY7A 1ZWIA 5JQHC 3A24A 3LKOA 1E2WA 2G3MA 1VSCA 2ZWSA 4PREA 4XO3A 3RWEA 3WDHA 2COQA 4JG0L 5IMLB 5FUCE 4GG6B 2FNBA 4HUVA 3PL6D 1DVFA 1VDGA 1L9RA 4WTXA 2C1PA 3TA4D 5GRJH 1T20B 3MV7E 2VZVA 4WFHD 5DLMH 3G6JF 1QBLL 3O6FC 2CK2A 3KM1A 3TTYA 1IAOA 2RALA 1DSFL 4FERA 1D7DA 5DMYA 1UEMA 5TH2A 1HSAA 3OF6A 4NQCB 4TSCH 5LWYL 4KKBC 5IOPA 3BYYA 5IM7B 1DBAL 5GRUL 2H2PC 4KVPA 3LZOA 3VG9C 4UV7L 1HL9A 3IF1A 3SJVE 3IGAA 3BDBA 2WKOF 1NIFA 3FN9A 3L08A 4NZFA 3OJDB 4AYEC 3UXFA 4YSOA 1S7TA 5D7IE 2XTJE 1OCWL 2BJML 3W5NA 3JTBA 3NRQA 1HXKA 1QNIA 5DHEA 5E99L 1Q8MA 1QLRB 3H2WA 3FCSA 4X7FC 5ACLA 2XVKA 2X12A 4W68A 3I02B 4LCCA 1N4XH 2HB0A 3FTZA 4PCYA 3QAQA 5DJCB 2JV6A 4WTZA 2MNWA 5I74B 3SQBB 2R1XA 5IFHL 3KJ6H 1FL3A 4PR5A 3PGDA 3S9DB 4N1EA 5IJDC 5JUEH 4HHAB 2ZUTA 5F96H 3D2UB 3KGTA 3HI6H 3MRHA 3EUUA 1UA3A 1J48A 1A3QA 2VL5B 4FABL 4FRWA 2PYFB 1HOEA 2ZP0T 1UJTA 3IKCB 2OX5B 2R56H 1KIUB 5E00A 3E9TA 1KXVA 3VO0A 4TN9A 1MPAL 4BCXA 3UTZA 2CO7A 1JV2A 3RFRA 3WS6C 5C3LD 2PWEA 4N1HB 1GS6X 4QXWA 5ALBL 3A4FA 2G0KA 2OMVB 4FQXD 4TYUA 2EIBA 4CN1A 1HINH 2HFEB 2N56A 3NK3A 1M57B 2WMPB 1ETZB 4PWFA 3V6FB 3VXOB 5JNYB 3D3VA 3IJYB 4JANA 4N25A 5GISL 2DIEA 1SXZA 2VYRE 5JOFA 4FGMA 3HLAB 4JB9H 1NBVL 2FWOB 4B7LA 2F53E 2DMGA 4W70A 3LD8C 1HHIA 2FD6H 4Z7QF 4Z7AA 1RPUA 4LEBA 5KSBB 3VFRA 4M6NH 4OLVH 3T1WA 4F8TA 2OAAA 2WXLA 4WVRA 4YL4A 4YSPA 5G55A 1BVOA 2YUWA 5HHOD 2HAZA 1R3LA 3DUSA 1BQHA 1G0XA 2YWYA 3CFQA 3F64A 1XR9A 4KV5F 5JIQA 5AOZA 3FT3B 3KWWA 4PJFE 1MFDH 5IFJB 3SB3A 2J2ZA 1GGYA 2QLVB 5GJTL 2XG4A 3HVNA 1ZTXH 2OMBA 4OJFH