3PNRB

Structure of pbicp-c in complex with falcipain-2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
160
structure length
129
Chain Sequence
GKSLKLGNISNQTNQETITQSLSVGEILCIDLEGNAGTGYLWVLLGIHKDEPIINPENFPTKLTKKSFFSEEISVTQPKKYMQLLGGPDRMRSVIKGHKPGKYYIVYSYYRPFSPTSGANTKIIYVTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Falcipain 2
publication title Structural basis for the regulation of cysteine-protease activity by a new class of protease inhibitors in Plasmodium.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 30
structure length 129
sequence length 160
ec nomenclature
pdb deposition date 2010-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3pnrB00
2NQDA 3PNRB 2WGNB 3E1ZA 3M86A 2FO8A 2NNRA 2OULB 3CBJB 3M88A 3CBKB 2C34A 2H7WA
chains in the Genus database with same CATH superfamily
4NO5B 2JK5A 3RE0A 3LZOA 2GIYA 1CL7I 1M71A 1X5KA 2YAFA 2RALA 3PUCA 4EJ1C 5DD0L 5LNGA 2BERA 4NQDD 3QORB 2WXGA 5IEKB 3MV8E 1ZKAA 1DZ0A 3LVEA 1ZHKA 5C0RL 5E51A 1GKEA 1PCXA 3K5RA 4BSVA 5C0DA 3WDIA 3ZKND 1N10A 3O3BB 1NQBA 4LEXL 2E76C 5CIPA 5ICYA 3TO2B 5DR5H 4GSXA 1L6XA 5DO8A 3K2MC 1PNDA 1H3XA 1I4FA 1W91A 3MR9A 3QR2A 1M9SA 2EC9T 2FQGA 2B39A 3QJHA 3L6FB 5IVNA 1S7WB 2NSQA 4AMKH 1U8JA 4RFNB 1VFMA 4IRZL 1KJ2L 1MAKA 3MRQB 2E9BA 4AYID 1TUPA 4F5CE 3PGCA 4FFWD 4PV8B 1QFUL 1DVFB 5HP5A 4OGAC 1F1AA 3QJFB 4JFZL 2AXGA 1NL0H 3S96B 3TZVA 3C5XA 1KGWA 3QT2A 3NZUA 1BZ7A 2E9WA 4U6YA 3AXIA 5KZCD 2D8KA 4FQXD 2YA2A 3MBXL 4EI5B 3GHPA 2F5BL 3O9WA 3BWUC 4L8DA 3PQYA 4PRHB 4QOKB 2VLJE 4BGLA 1BD2A 2Y25A 1NGYB 2QL1A 2YUVA 3D25A 4G72B 4BUQA 2PR4L 2IDTA 2QQQA 4ZO7A 1RP8A 3KYOB 4BCXA 4HS8H 4E41A 3L4TA 1R3KB 4FHBD 3IJHA 1SLXA 3P3TA 4POZC 5IQLA 3V5HB 1X6NA 2IPUG 3QPKA 4JO8A 4NGHL 1EGJA 1U21A 3I2CL 5C2BL 3OXSB 4QF1B 4P3CH 4QXTB 4BHUA 5FF6A 1IVLA 2JLPA 4HIEA 3US0A 3NACH 3NSYA 3BOVA 3IVKB 1PLBA 3RY4A 1ZLSH 1DQVA 1S6NA 4MMZB 1IM3D 2IXQA 4YBQC 4LCYA 5LBGA 3WUWG 4AC4A 1BVNT 4X2UA 1BQHA 5LXVA 1B4LA 1RUQH 2AJSH 2R59A 3FN3A 5LNDA 1WUNT 4B41A 1DUYA 1XSKA 2YPKA 4W9ZA 3ISYA 4ODXB 4PJGE 4ECNA 5FYJD 3BD5A 2BVUA 1RZKL 2K9UA 4NPJA 2W80C 4YBHA 2EECA 5C0CA 2ZCLH 5AOLA 2A6DB 2IJ0C 2K7PA 3MRBB 4XVUD 3T6VA 1FAIL 4QXWA 3L3JB 3GO1H 3PABA 3WY3A 4IMLB 1ZV2A 1CWVA 1U8HB 3BE1H 2IH9A 3ZO9A 2CQVA 4YSTA 3MBED 1J7VR 1D9KC 1YSOA 3HBQA 1E5UI 1LO0H 4QTFA 5LGHL 2DEXX 2GG1A 3NK4A 5ECGA 1QSFE 2BHFA 4HT1L 3R7RA 3F7KA 3C09B 4G6FD 5ADPH 2GB2A 3J2PA 4R7DB 3NABH 3QJOA 4UAOC 4F2EA 5EN2B 1DJWA 1KYAA 4UTCA 1MCPH 3SDAB 2OMUA 2VAAA 1JRHH 1PLGL 2AV7A 5B21A 3B7UX 3QWNA 5FLVA 4ONHA 4A7VA 4ZYKA 2XQBH 2KQNA 4PLKC 4DERA 1OP4A 3C60C 1KJ2H 1L0PA 2F1BA 2GC7C 4JO3L 4N1EA 4LLDA 1IM9A 4G9DA 1IAOA 1MW2A 4M43H 5FHBL 5B1KA 4CU7A 4Y19A 2QPEB 4F7MB 5DMGC 5DJCA 4JFZH 1H15B 1JJUA 1FV1B 1KIRB 3F3HA 2YD0A 5E8DH 3FH8A 4XVSL 3BSGA 5I17B 3CFBA 1BSIA 4DN4L 2FJGB 4XCEB 1AOZA 2N1KA 1RJCA 2I9LB 4M48L 3GGWB 3SDCA 1QQDA 1U8MA 2GBTA 4YQXH 1NDGA 2A5UA 1N59A 5T5NG 4GY4A 1K4CB 3UIYA 7PAZA 4HALA 4FA8A 1KT2B 5DURB 1WS7A 1NBCA 4DKFH 2D7OA 4NGHH 4MA8L 3DX1A 5C2BH 4PFEA 1TTFA 3WUWB 1PBYA 1WCBA 4JRYD 4QT5B 1Z3GH 1OAZL 2ID5A 1TKWB 3ARGC 1O0VA 3WTUA 4W9LC 2QQLH 3GRGA 3V2AR 1BQLH 4HIIA 2UZIH 4LCCB 2AQSA 4WI9A 2NUTA 2X4UA 4X4MA 2Y0SA 1E9QB 3PGDB 1YEDA 4IOIA 4KZEH 5HI3C 1DEEA 3BJLA 3QZLA 5HJGA 4WUKH 3EH5B 2I32A 3CZUB 1O6SB 3GIVA 4NOBA 2R1XB 4OLXH 1U3HC 1AD0B 4G6ML 1KLFA 3RA7H 3G6JA 3MOAL 5BVPH 4GUCA 1I3RB 1UEYA 2BVYA 2CJUL 2ZWKA 3WS3A 5FUOL 5TFSL 4NO2B 2WHVA 1NJ9A 4NN5C 4UT7L 3QEUB 5ALCH 2BOCB 5DS8B 1A4CA 1SN5A 3QUXD 3FPYA 3LN4A 2WOBA 4JM4H 5F7MC 4YPJA 1FAIH 1QUNB 1TITA 4JFHD 2A9NL 5LG1A 4Y7MA 3A4EA 1G1CA 2C8NA 2B1OA 1M7XA 4YO0A 1GZPB 1IQDA 4JAMB 4R0LA 4X99A 3H56A 3GB7A 2R9HD 4HT1H 1SHSA 3ZLQC 2WVVB 4OGAD 1XV8A 3VYPA 2APTA 1KTRL 1AO7E 1RUPH 2QLYA 4Z77B 1NUDA 1CXLA 4Q52A 1NBVL 3CNKA 2WLLB 4LDCA 2OJEA 3ZW3A 5CU9A 1N7MH 4EO5A 1KCWA 1VEMA 4G3YH 2QQKL 3M1BA 4LBAA 5FHBH 3P11H 1NC2A 3GXUB 3PIQA 5EO1A 25C8L 4FQPA 4XCFL 2E46A 2YD8A 5DUML 3U36B 5KBKA 2WQUA 4Y2DA 1GGCH 4F7EA 4XVSH 3D4CA 2OTWB 2EIKB 1H9VA 2ZUVA 4DN4H 4L48A 1I7RB 3E1F1 3KWUA 3MUJA 2Y36H 1DVTA 1AR1C 1IAKB 2NCMA 4MNGE 2X6AA 2F18A 1TCRB 4YFLF 4LDLB 3OHXC 1JVOA 3IKCB 7PCYA 3W5MA 4FLHA 5I1AB 1UQSB 4ABVA 1V3KA 1OP3H 1LHZA 4JJOA 4A2LA 5T3ZE 1INDL 2E4TA 2VKXA 4YBQD 4GH7B 1RK0A 3JTTB 1CFNB 1MI5A 2ZX5A 4L0ZA 1N0XH 4CGUB 2C3VA 4F9PA 2DWDA 4U1SA 5IBUB 4YDLB 2AEQL 4BA8A 2YC1B 2Q10A 1I8UA 4M9PA 3QIWC 3GBEA 4RAUA 3KCWA 2YD4A 1Y6KR 1NMCB 2WKGA 3MN8A 4UV7H 3ZDYB 3ARRA 4LVOC 3KHOA 3MRGB 4BELD 4AK1A 3HAEG 5I15L 4QRPD 3QXUA 5IW3A 4OQTA 3STLB 2ICES 4FTVB 4KX7A 4S10A 2LAAA 4KRLB 1JWMA 1XGTA 2WYIA 4UZUA 1D9KD 3FTXA 1CDBA 4FXKA 1U3JA 5JYLA 4HKXB 4AJYV 5LGKA 1PD1A 4L3CB 5TFSH 3ZDXF 2YPVA 3ZVVA 4KQ4L 2X2UA 4AYGA 4KRPD 4MQTB 4XZ4A 4LLYA 2MQCA 4NNYA 4BDVA 2JKLA 3DMMA 1ID2A 1OCOB 4GAGL 4GO8A 3A22A 4JG0L 3WN5B 2A9NH 5KOMC 5KJRH 1U42A 3AG3B 3UADA 2AKRA 3C60D 3UTTB 3MXWL 5JHAA 1ESOA 2VIRA 5EOTB 4OFKA 1H6TA 3U1PA 3BPOB 5SWZD 4DHLA 3FO0L 4Z78A 2DJ4A 1NCUA 2KDGA 4F9LC 4ZMNA 3DYOA 1VGKB 5E2WL 2V4LA 5BV7L 3P4MA 3CZLA 3TO4D 4C4KO 2FQFA 5D7IE 2UZXA 2H7WA 4I18C 3F5WB 1I1RA 1RI8A 1RULL 1UYWL 1UFUA 5E23A 4KY1L 3U6RA 3VFUB 3T3PF 5HPMB 2C34A 3ULUH 1GOHA 1Q0YH 3R19A 4W1TA 4R4FL 2NYYD 3ARFD 3IJ8A 1U8KA 4PR5B 1KENH 1MLBA 2EUZA 5KUMA 2ADIA 3CSBA 2PLTA 1NKOA 4ZMLA 2AXFB 5DMYA 4A6YL 2ZWNA 5HGAA 1UADC 1K8IA 4E5XG 3P0VH 3JWNE 3UZQA 5KVEL 4OAWB 4JPWH 5L7XH 1T5WB 2B1AL 2BPBA 4AQ1B 3VFGH 1EPFA 4ODVL 4QCIB 5HJDA 5DEFA 4Y5XA 1WG3A 3S97C 2Y24A 5EEVA 2A4EA 3QHFL 4AENA 5HI3D 1A9BB 2Y6SD 5KTEL 3L4VA 5GGSY 5A2LH 3CXFA 4FULA 1S5HA 5EO0B 4X98B 3HAEB 1G7MA 4JO1L 1PZBA 3IJSB 3QXAB 5CBAA 4LAQH 4EUPA 1J0ZA 2EH7L 1PG7X 1AC0A 1FVCA 2YIHA 2D4FA 3FO1B 4KVNH 1JGDB 1LDPH 1KEML 2BSSB 3FF8A 1JPEA 2FL5B 2YZ1A 1MJJB 2R8SH 2C9PA 1I8MB 3QULA 2VN5A 4L8CB 4FE9A 2Q3ZA 4GQRA 3B7RL 2Z64C 1BYOA 1F8TH 2CUAA 5D2LE 32C2B 4JPIA 3TBTA 4XWGH 3D4GA 3DV4B 4YHLL 2VRAA 3ARDA 3MJ9A 3KPOB 3NG5A 5KS9F 4AG4L 1FL3A 1H3GA 4X7DC 1M1XA 2AQPA 4P23C 4OIFA 1OTUC 4OY9A 3QISA 5E8NA 1ROWA 5CEZE 3JT2A 4NUGH 4WAFA 1NIEA 4LEBA 4J12A 4XMZA 2HA1A 3DRTB 1KYFA 1OGSA 4ZTOH 3FNKA 4PBDA 4PJIA 5AUMB 5B1CA 1YDPA 1ZTXH 1VZIA 3VXSB 2R1YB 3VXPB 5LKNA 2X4PA 2AGJH 3LKQB 4AGMA 3GSXA 1RURH 4LSTL 2ESVD 3HG0A 1H3VA 1CVSC 3GHBH 2M2DA 1QNZH 2CKNA 4K73A 1FFOA 2X4SA 3ZXAC 1XB3A 3NT0A 1CF8L 4F92B 4P9HH 1T1WB 2ZWZA 4NYLA 4G11A 5E2WH 1EIBA 2HT3D 2EDMA 1A1MA 4DAGL 4LL9A 1NFDF 2Z65C 5IHWA 3L4ZA 2A6KA 2WLHA 2Y06L 4U6XA 1UYWH 1LP9F 1EZSA 5ESAB 4OZHA 5I1EH 3ULVE 3BPLC 3HI1A 4OB5H 2CD0A 2PUQT 2WQAA 2BOBA 4ONOA 5D96C 2ZQKA 2ZXEB 5A3ID 4KU1A 4PJFB 2E56A 5A40E 2LVCA 3QDMD 1NLDL 4UB0L 3WL9A 4ELKB 1OF2A 4BQCA 3N41B 3OC5A 3KL0A 4X6DE 1IJ9A 3HMXA 4ZW3A 4PU2A 4P8QA 2EDBA 2Z91A 1MDTA 3ES6B 3BO8A 4QRUB 3SDXB 2ROYA 5BV7B 5IMLB 1E2WA 4HOMA 2VZ3A 1VENA 1UWEL 1HOCB 2UY6B 2J25A 2YEQA 3QIWD 3O4LA 5EF3A 1H3PH 3TZVC 3KJ6H 1H0DB 4WEUD 4R3SB 2QVKA 4ADIA 4N2FA 3AQXA 4D9LH 4O02H 5KTEH 5CCHE 1EHAA 1HC1A 1CI3M 4N5ED 1YEKL 4GG6F 1HXMA 5DJ0B 4X50A 4PJ8D 4XP1H 5DJAB 1AQDB 4KI5D 1JUFA 3U9PH 4G6JH 4QRRA 3LDBC 4RGOL 1YUHB 2OKMA 3MNDA 4LGSB 4XO4A 4A6YB 3GRWA 1AGDA 1MHEA 5DMKB 3MRDA 3NGBC 4JFDB 4DNLA 4D3CL 5HHXL 3ZRCC 4U1GB 4WVRA 4HFWB 4G6KH 2A73B 4NSKA 5IVXF 3WG7B 4JY4A 12E8L 2H9GB 2OFQA 5BPPA 4Z0BH 3WTYA 1E40A 2CIIA 2KS0A 5DWPA 5BRZD 2XTJE 1ZV5A 1B4RA 3A4FA 2XX0A 2Y6TE 1YN7A 1S9VA 2WUCL 3NA9L 5I82A 2JQZA 2IQ9H 3R8BB 4NN6C 4P3DB 3GSUB 2EXYD 3NJFA 3KPLA 4P2AA 5LWYH 1S7RA 2NYKA 4IK6A 3DSFL 4N1HB 1WPCA 4IKKA 4PBWD 5ERWB 1Q9OB 4K2UL 2YA0A 1OK8A 3WKML 3DO7B 2O5ZH 3TCTA 2P24A 3MRFB 3S37X 1S7QA 4OBSA 2UX6A 3DGDA 1CLCA 1PEWA 1MG3C 5FGSA 1TVHB 1I8KB 4LRNL 5IB5A 1A64A 2FT6A 1GC1L 2BNRE 4CVUA 1D5IH 5JHDA 3ZU8A 1EFQA 2GVYA 2CAKA 1E4KC 1CE1H 2X0VA 5HD8C 1EO8L 3V4VB 5JOFA 3QNYB 2Y06H 2EVFA 5A16B 3LZPA 4I48B 2ZCHH 3HLAB 2NY4B 2NY6D 2O6FA 1TVBA 2AMUA 3BP5A 3SKNB 4GBXA 2MTAA 2QKIC 3EGXB 4UB0H 1NWOA 2V37A 5CO1A 3TN0C 2Q8BL 2QPDB 3V8CA 3KH4A 4IIQA 1BF2A 2CHZA 3HG1B 1ASQA 1DJXA 4ODWB 4JFOB 5IM7B 3VXSE 4U1KA 4Q9QL 3MLSH 1T21B 4Q6YA 2QLVB 1N8ZB 4AH2A 4I2XE 3O0RL 3NJGA 4U1JA 1PYWB 4FQJH 3NZHL 5AW2B 2JIXD 2CPUA 3WIIL 4DK3A 1CXKA 1UXWB 5F7EL 2P5EA 4AVHA 1XEUA 1J9TA 5G5DA 1I1YA 4HC1A 2V2TB 3AGVA 1HZLA 5LG6A 1YEFH 2YOCA 1IC7L 3D7PA 2ZSWA 4EDWL 3C5ZB 1EUTA 3SDCC 3LIZA 1KGCD 4P2RB 3T3MB 3KMDA 2BVTA 4QHLA 2K78A 4RGOH 1RSYA 2GTWA 4BFGA 1HXKA 1DQJA 2R0WH 5SX4H 3WDHA 1M05A 5F7KC 3G5YA 5DF0A 2PCXA 2CBQA 1OAKL 3D12B 1ANUA 1OARL 3VXME 3DSNA 12E8H 1FHGA 3RWHB 1LQBC 3VM7A 1WD8A 1RHHB 3CDGB 3V95A 2YN5A 3LNDA 3FU8A 4Q9CA 4G82A 3TBWA 1D5MB 5IHZA 3GSNL 1EAJA 3MV01 3LHAA 3U82B 4OF8A 3CSYB 4RFEA 3ZDZF 1SUHA 3DGGA 2EDQA 3OSVA 1V55B 2FX9L 4KXZI 5D70H 2F7QA 5IFAL 5GJSL 2EEXA 4KXBA 2VDNH 5BVJB 2ZX6A 2H32H 4S11A 4YWGH 4NXSA 2VH5L 1P5UB 3SPVA 1HL4A 4JFDE 2VSKB 3ZHDA 1QRNA 3WTWA 3V9EA 5IW6B 2H47C 4GKNB 4LRNH 4XCNB 4PPTA 4N5UA 3KE0A 1KN2L 3HI6H 5E4IA 5TJWK 1KF9B 4PB0L 2HWZL 3L81A 1R3IL 3BMVA 2FO4B 3DIFB 4JFYB 3ROOB 2P49B 4XOAA 1OSZB 2FTAA 3JWDL 4MXWH 5EA0L 4PV9B 4R0LC 3WNIA 1JVLA 4HWBL 2BIOA 1U8NB 2RGSA 1ZVHA 4JKMA 3NAAL 4MQSB 5C6TH 1D7CA 4GMTL 2NQCA 5EZIH 1AJ7H 1A7PL 4PJ5A 3RG1C 5T1JA 5B1AB 4FTDA 5IVZB 2DQHL 4JUTA 1F41A 4EXKA 1RZPA 2FX8H 1WBZB 3BQUB 1M7DB 4Q9QH 1BJ1J 2JB6B 3HB3D 3O0RH 3O9WD 1XGYH 4AYFA 3PQYD 2YPLB 4G9FB 5ANMA 5AG8A 1OPGH 1BD2D 4S2SA 5DJ2A 4DN3L 5E70A 3ASWA 4Y2DC 2MHAB 2X2IA 2ZNXA 3SE3A 2Y5QA 4YHOH 1QI3A 3QQ9D 2HKFL 5FM4A 2C9AA 1WH0A 1GMIA 5EH1A 5DRXB 2IALB 1WO2A 2E7CA 1MAJA 4GIOA 2BWQA 3B4NA 2NOYA 4M7KL 3UTPE 3DK0A 1JWUA 1CDJA 1EK3A 5AOJA 4DPBX 4ZX3A 5CUSH 5FUZH 5PAZA 7FABH 1NFKA 1REIA 2ZOLB 3H55A 3RL1A 5C71A 1I7TA 4P2QA 1GTFA 2FAUA 2LLNA 3UJIL 4D2NA 3O45B 3Q6GH 3NIGB 4OLVL 3V5DA 5H2BB 4YDZA 3GDCA 3WLBA 1P84J 2LT9A 5JIKA 3S6CA 1T0NA 3JV0A 4J1UB 3BP4B 3DX7B 3ARXA 3P69A 4Z7WF 2V9QA 4F9PC 2QR0A 4JKNA 3S3PA 1B2YA 2UY7B 4BKLB 1IL1B 1YO4A 2ADJA 3MRPA 1OTSC 3GSNH 3QXWA 2M26A 5G4OA 2NYZA 4F8PA 1QYGL 3QZWG 1KEGL 1KJMB 1MCFA 3QWRA 4MNHA 1ZANL 2QMKA 5C0CD 3TURA 4ZFFA 2YK1L 1PZ5B 2H1PH 3OWEA 1DZBA 2BK8A 1G94A 5IFAH 2K45A 5HD8D 1SJEB 5KSVA 1AKPA 3LEYL 4WEMB 4EI6B 2VM4A 1R75A 2VXTL 1NGQH 2XN0A 1WBYB 3M1OA 4FXKC 1CYXA 4S0HA 1X9UA 3OBAA 1R24A 4Z95L 5H8DA 1IZKA 4KMQA 4WWOA 5AFAA 1FFNA 1MWOA 1SJMA 3DJTA 4P4RB 4CMMB 1HIMH 2MNJB 2R27A 3T5WA 4U3XA 1NCBH 2WTPA 3DMMC 3NZ8B 5ICUA 2HVKA 1KXQE 1BVLB 1KN2H 2RB8A 5FO9A 1IAIM 1R3IH 3MDJA 2EIZB 1ACXA 3EGSA 4NQCB 3JWDH 4QAWA 5EA0H 4UBDC 2WZ6A 1XCXA 1IM9D 3LMJL 3QCUL 5HVHB 3MOBL 4Y19D 2CH8A 1PF3A 3FULA 2C4FT 1TFHA 4KUZL 4Z3GA 1QEWB 2WNXA 3K74B 3S5LG 2K7QA 3DVGA 2WBJB 3NCYS 2LTQC 2ZUSA 5DZLA 5TDNB 4FC3E 3CQPA 1OIOA 4B97A 3BH8B 1TTAA 2WC7A 4N0FA 3SDCD 1W8EA 1HS6A 4Y4FA 1P4UA 3MOQA 2FT7A 2QGDA 4WFFD 4WTWA 3IJYB 3BKYL 4DN3H 1BMZA 4M5SA 3NSXA 1PKOA 1BEXA 2DD8L 5EPMA 5IQ7H 1FZJB 5FYLE 1KMGA 1MXDA 4Y4KB 4GQQA 3RVUC 5F0MB 3VFNA 4JZOB 2ATAA 2DQCH 5EOQH 2BVPA 5FO7A 4DESA 5DI8A 3ZR5A 2JXMA 1AZVA 2EH8L 1EBPA 4PJEB 3MCKA 3HJ0A 4U6TA 4FF9A 4UNTA 4JCWA 3FQWB 3SE8L 3M86A 2K6ZA 3HE6A 1TTBA 4ZQKA 1MH5B 4OLVH 3QZWB 4OZ4A 3CSFA 3MV7B 2BS8A 2YPLE 3OMAB 1U8IB 4B3VA 4UI2A 5DHXB 3NFNA 4K71B 3CN2A 3IWVA 2X44D 4MHHG 1ILUA 2CRYA 5EC2B 3RILA 4IRJA 3M07A 1HU8A 4YXKH 1SYSB 2YRZA 3ZKXC 2LE9A 4RRPM 3TFKC 1FFTB 1OPOA 4AEIH 4AKQA 1QYGH 1IVTA 1SXZA 5SWQA 2OA9A 5DK2B 3U1SL 1J8SA 1KY7A 3DGCR 1D5XA 5DHVA 4HWEL 1TU2A 1W6WA 5MENA 5CSBA 3BMWA 2IPUK 3QHZL 1T20B 2HFTA 3WS6A 3SGDH 2GCYA 3NRQA 2WQVA 5J6GB 3O2WH 4P5TB 4Q6KA 1OGAB 1BXVA 3ARDC 4Z95H 3NIGE 1UJ3C 4K5OA 4MA1C 5C9KA 1BAWA 1JSYA 2FJHA 1C7SA 1N3NA 3RKDD 4PJCA 1F86A 4GUPB 3MI6A 3VU1A 3KBPA 1NCJA 3QC5X 3S5LB 4FLOA 1RZGB 1HWGB 4U4IA 4QD2E 4KZ0A 4QUOA 3QZMA 5ISZB 4DKDC 4MCMA 1SJXA 3LMJH 3QCUH 3QPXH 3VI3F 1WZAA 2WYTA 3EFOA 3L3GA 4G8AC 1MHCB 1F18A 1GS8A 1NC2D 1YJDL 3GBML 3NFPB 1FO0L 3MRRA 2BNQB 4KNSA 3PPEA 3L54A 4KUZH 4LKXB 4Y2DD 1Q94B 3FQUB 1ORSA 2G75A 3JYCA 1UURA 1CLOL 3FFCE 5ACZB 1PVHA 2PO6A 1Q72L 4QHNB 1UD8A 4XI5C 1G0YR 3DARA 4Z5RA 1NDMA 3PGFH 2ZXWB 3WFEH 5B8CA 1DDHA 3WFDL 1GYWA 4H8UA 2F1EA 3KVPA 4NRYA 1HI6B 4NO5A 3RI5F 1XMEB 1N67A 2WVSA 1MI5D 2E7BA 2X4OB 3QORA 1CC3A 5IEKA 5D72L 5CD3B 3THMH 5PCYA 2EH8H 4ZNCD 2ETWA 4G1EB 2O4EA 4LCWB 1YRKA 3A4DA 4BK4A 1EDQA 1OTSD 3R0MA 4QGTA 3OLEA 2FBRA 4U3CA 5AKVA 2VYRE 4KTEL 4JQIL 3L9RB 1TENA 3O3BA 4MS6A 4BGDA 3L2NA 1A7OL 2DWSA 3TO2A 5C7XH 2IH1A 5E6UB 5EEXA 3W2DH 1OCWH 3JUYA 3NPSB 4P06A 2C26A 1E9PB 1Z9MA 2HX7A 2ZAGA 3L6FA 4QNPF 3T0WA 2XKSA 1S7WA 1NAKH 1OTTD 2AK4B 3JZYA 1QX1A 4R4BB 5BUGA 3U1SH 4U1IB 3CQQA 3DMMD 3IETB 1NFIB 3MRQA 4FQ1H 4ANXA 3V10A 4XMPH 3C87A 2GY7B 4PV8A 4AL8L 2BSTB 2C1PB 2DMGA 2R4RL 3QJFA 4UBDD 3S96A 2XWZA 1YEJH 3BHBB 4NHCH 1WT5A 3UTSB 3AS1A 2HJKB 3FYEB 3NFSL 4PLNC 5EZLA 3QDJD 5D71L 3MV7E 4PSPA 1L0XA 4EI5A 4IYKA 1KPVB 2GFBB 5T1MB 4PRHA 4Y1AA 2W9EL 4QOKA 5EZJB 4AKOA 1FG2B 3F65A 1NGYA 3WAKA 3HMWH 2FGWL 3KYOA 1PL3A 1WV7T 2YAQA 2WXOA 3LPOA 2D9QB 3SY6A 4OFPA 4DVRH 1R3KA 1M7IB 3V5HA 4LO9A 1FO0H 1MPAH 1JMXA 1MIML 3OXSA 1WVZA 4LXFA 4QF1A 2ZTBA 3CSTA 4QXTA 4P4KD 3NESA 3BWUF 5KVFE 3RVUD 1E65A 3A4AA 4G43B 4JJ5B 5C3LD 3IVKA 3KYKH 4DZBB 3TVMB 2DM7A 5IP4A 1OP3K 1A6AB 2F61A 3FU5A 4I88A 3UBHA 4MMZA 3ZUCA 1JS4A 1KFAH 3KXFD 5IF0B 3VFWB 5L4IA 3BD4A 1EAPB 2KC0A 3ZE1B 1HINH 3GLDA 1F3JB 4GBXC 4F3FB 3S34H 1VPOL 2D73A 3CDYA 3HR5B 5DC4B 5I73C 2KH2B 2P9RA 3TC9A 3EJPA 4IIQC 4ODXA 4WWKB 5F7AA 4HIHA 2VDQL 4AV5A 3QDGB 2BNQE 2ZOOA 1X9RA 3GBNH 1Q0EA 2A6DA 2XKNB 4WW2B 3MRBA 4XAKE 4ZX5A 5I1IL 2HP4A 43C9B 4N2CA 2XC8A 3L3JA 5K9JL 4OTXH 3TFKD 5IROA 4CC4A 1IGIH 4HS6B 3QJUB 4IMLA 3OKNB 1U8HA 3RJOA 3BWZA 4JQIH 1SQMA 5DFWH 4U6VH 1A7OH 1AD9B 3QFGA 5EMYA 1BYNA 2XWRA 2XKUA 1E4WL 1KB3A 1R5WB 2AJUL 3LXCA 4XNZC 2QEJA 1F90H 3ZRSA 5EN2A 1GGIL 5DHEA 3SDAA 2Z92B 3ARDD 2OTPA 4OFIA 3O4OB 1DFXA 4X7FC 4NCC1 4FQ2L 1DDTA 2ZKYA 4TNWK 1J9SA 4PD4K 3QXVA 35C8H 3WKYA 2GT9B 1DBBL 4LDOB 1AQ8A 3GINA 2GIMA 4F7MA 1ZEAL 2EO1A 3QSKB 2R4RH 4LCWE 2VDKH 1H15A 1FV1A 2WBKA 1E4XL 1J1PL 5I17A 1W6LA 4H1LG 5EEZA 2FJGA 4XCEA 3OAZK 2CDFB 2OP4H 2I9LA 3H4FA 4XN8A 1A7NH 3GGWA 5F0PB 1DEDA 1QWHA 4JHAL 4AIXA 2B9AA 3OPZL 3BAEL 4HH9B 3SD5A 3D08A 4N2MA 4FYQA 1K4CA 5DC2A 4IRZA 3CCHB 3CVBA 4JGUA 4HPYL 1Q1JL 1KT2A 3ZZ1A 5CN2A 1Y1DA 5HXMA 5DFVC 2WLIB 1C1EL 2ZXAA 4N2BA 5KJ7E 2IPKB 3JWOC 1TLKA 3LEVH 4X6CF 3WUWA 5DT1H 4FI8A 4QT5A 1AZNA 2VJXA 3MTXA 1TKWA 3AG1B 1QPPA 2Q3XA 4GSQA 1Z66A 3TONA 1RIUL 4XNBA 3ZOAA 4LU5H 4JFXB 1BLNB 1ZLVK 3GMRB 5E8EB 3RDJA 3U6XA 4Y9FA 3MCG1 1E9QA 3PGDA 1BOGB 1JE6A 1MAMH 5EF1A 2CGRL 2IIJA 3E6FB 1DJYA 2HG5B 4MAUH 5ECJE 3MU3A 5H37G 5C09B 1O6SA 1G87A 1ONQB 3O4LD 2W07B 2R1XA 3LVTA 5EFIB 3HOGA 1AD0A 1FSKB 2PXYB 5F7WC 1GZQB 4U7MA 4RBPK 1X7QB 5D4JA 1I3RA 5CD5D 3S8FB 5F21B 2R4SL 4QO1A 4CSTA 4NO2A 2Z9TA 3LXUX 4H1LH 1JDAA 3QEUA 5DS8A 2BOCA 1KCBA 1QUNA 2A1WL 1CXEA 2GI0A 5K9JH 1SY6L 3FONB 4OW6A 4NQVB 1F5WA 2C3HA 1JPGB 4JE4B 4M1DH 1GZPA 2O6PA 2X4RB 4JAMA 4KJQC 5HI4D 5DYFA 1KV3A 4UQEA 1EX0A 1AP2B 1NOLA 1E4WH 2AJUH 2WVVA 4LVEA 5ABZA 3WFBL 1OAYH 4POYA 3DV6B 4Z77A 1GGIH 3HN3A 4NKQB 4XXWA 3GMLB 1BM3H 5KSUB 2VDQB 2WLLA 1QBLH 4FQ2H 3ZK0A 4KI1A 5K9QG 3PHOB 1DBBH 2HMIC 4FQQB 4JDVB 3RZCB 1X5ZA 4G71B 1KCKA 2ZPKL 3QO1A 5LDUA 2YD2A 2OTWA 3VMOA 2W88A 3TA4D 1J1PH 2VN7A 3SO3B 1I7RA 2F68X 3GJFB 4OZFB 4DP2X 1DHKA 1IAKA 4YZWA 5IHHA 2WQSA 3KW7A 4I4WB 1TCRA 1P2CB 3LS5H 5D7LB 5FGCB 3V0HA 1HTYA 3AMKA 3ALXA 5JHDD 2B5IC 5L2KB 5CM1A 1ASPA 2EDEA 3IKCA 1CGYA 3BYTA 3QJRB 4XHQA 1SBBA 1UQSA 4KTGA 5I1AA 4YEFA 2IOIA 4MAYB 1C1EH 3ZHLA 3JTTA 1MFCL 1CFNA 2J72A 5ICZB 5B4MC 4I3SL 5I18L 2X2HA 5MEQB 1YY8B 4LSQL 4GBXD 1HYSC 4OLUH 2CBOA 2HLFC 1G1KA 3ZYOA 1RIUH 1PSKH 1FGNL 2DY2A 2YC1A 3K91A 3GSRB 4P05A 2WWOA 5BZDB 3FTUA 5H94B 4PBVC 2XSKA 1AKJB 4FJZA 3VGGA 1WSST 4IRSB 4KKLD 1IGFH 1OF0A 3T2OA 3MRGA 4MCYB 1XFPA 4LVNB 2P5ED 1MLCB 1XSIA 3WJJA 3STLA 4QAMB 3KW8A 4P3WA 4FTVA 3KWTA 1CFTB 3Q8BA 2PCYA 1SHWA 1U91B 2N7SA 2CALA 2D3LA 3OJVC 4HKXA 5CXPA 1TTUA 4I77L 4BFEA 4N0CC 4M4PA 4TVUA 4L3CA 1ZPLA 3WFZA 4XRCB 5LB1A 5HHOB 4Y4FC 4XN4A 4Z3HA 4JG9A 3IAQA 1U41A 2DQIL 4LPWA 5FKPB 4JG1H 5C0JA 4ZD3L 2F53E 5I0WA 1KYOK 1N18A 1E50A 2ORBL 3CVDA 4BWTA 1MNNA 2W0LA 2E74C 4LP4A 3UTTA 2CBTA 3L1OH 5KYUB 2Z4QB 4N2KA 5EOTA 5EUOE 4XWOC 3KPQB 3SPJA 3QNFA 3OGOE 4K7FB 2P1YA 4TV3A 3FTVA 1V7NH 2IF7A 1VGKA 1QSEB 1UUSA 2AXJA 3HE6C 3H3BC 4KTDL 4GO6B 2P80A 4KMTL 3F5WA 3I6KB 4M7LH 1OQXA 1SJVA 1NLBL 3VFUA 4MASA 5HPMA 3W11C 4AV4A 1UHVA 1T4KB 4PS3A 4PR5A 2C9VA 1O6VA 4E68A 4IRJC 5DFVD 4PY8J 3PWUB 1LMKA 4HUUB 4XP9L 1KDJA 1ADWA 2ICWB 1JPSL 3S35L 1QRND 5FEBA 3U30C 2AXFA 4N2EA 5T3ZH 1UVQB 2YD7A 3VG9B 2K6WA 3BAIA 2EEAA 3RTLA 2J5WA 4XC3L 4YLQT 2VNCA 4OAWA 4UOW1 1Z5LB 4ZMWA 1EHLH 4M6AA 1T5WA 4AQ1A 4ZX6A 3NDYE 1E42A 4QCIA 5E2TH 3HFMH 4XVTL 2DQTL 3WS6C 4UTAL 5GS2H 4LKCB 1A9BA 1AZRA 2R0LH 1MHHB 4M7ZB 4XO8A 3UBXB 4M02A 3ROLB 4CMHC 3WSQL 2BP0B 5EO0A 4X98A 4GLRH 1COBA 3HAEA 3IJSA 2NY7L 3QXAA 4PJ5D 4RX4A 2AS5M 5D8JL 3FO1A 3GMMB 4F58H 1JGDA 5HYQB 4AXWA 2BSSA 3JT0A 4BFIB 4DGYL 4Y7OC 5G2NA 2FL5A 2KT6A 1MJJA 3JWNG 5DRZB 1I8MA 4LQFH 4L8CA 5MEOB 4YLCA 3TEXA 3BSZA 3H2QA 4CU8A 1MSPA 32C2A 4RQQB 3IDXH 1AE6H 4J6RH 3OPUA 4AUYA 4I77H 2R2HB 4B7LA 4JR9H 2PO6C 5JR1L 3VA2C 4ETYA 5J13C 2O72A 4YBLB 4JPQA 4ZD3H 1QSVA 3DTUB 5B8CC 4PV1C 2XYCA 5DJXB 2CHDA 5T1KB 1Z9NA 2GEEA 3DRTA 2ORBH 3EF4A 4P2QD 4QR7A 3WCYA 2HMID 5AUMA 3VXSA 1EEZB 2R1YA 1C5CH 3VXPA 1IB5A 3LKQA 2Q2LA 1AZZC 1AGEB 3I84A 3QPQC 2R0KL 1J88A 1JZ4A 2V8MA 4JE0A 2Y2TA 1SBSH 4M5YL 4XPGL 1BHGA 1T1WA 1ZS2A 2WXPA 4N2GA 5AOZA 1K72A 4YJZL 3H3PH 5IB3B 2GBAA 2OI9B 3GSQA 4L8BB 5T5NF 1CDHA 4KMTH 2ENPA 2FHBA 3CFMA 4X0KB 5HHOE 4H44C 5ESAA 3NQIA 3TJPA 3UAEA 4F37K 3VMPA 1AS7A 3JWNH 1AQKL 4PJFA 2VLME 3KPRE 3CV5A 4OGXH 4ELKA 4PGBB 3Q7JA 5E8OB 2JH2A 1S7XB 3IXTB 1GOFA 3QIBD 5B4MD 1NCAH 4RFNC 5EN3A 5HDBE 5GGTL 2MCPL 1HYSD 1BX2B 3SBQA 1FH5L 2HLFD 1YNKL 3BH9B 3RIFF 3ES6A 4LARH 4QRUA 5IT2H 3SDXA 4FOMA 2WQRA 2QPFA 2K9FB 4PJBF 2JKNA 2VDML 5IMLA 4TPRL 1DVFC 1OSPH 2CHWA 1CFQB 5EZOL 1HOCA 2UY6A 2MQ0A 5FUCE 1H0DA 4R3SA 3F8UB 2NR6C 4C83B 1SFHA 1QFWL 4QJ4B 4KUCF 5AYTA 3DWTA 3Q2NA 1G9NC 3Q1SL 1D5RA 4PREB 5DJ0A 4EI5C 2PR9A 1WAAE 5DJAA 2VW6A 1AQDA 1A7RL 1B88A 4C56B 1FLRL 1YUHA 5D8JH 4A6YA 4N0CD 1TZIB 4DK5A 4ELMB 3E80A 2QELA 5E6SB 3V0DA 4KY2A 3KDPB 1ZIBA 4Y4FD 1U6AH 2NXYD 4JFDA 4N85A 4PJ7F 1BIHA 1YHPA 4HFWA 1WEJL 2A73A 4TLKA 2H9GA 2VWEE 3IM1A 5CEZH 4QXGL 3NIDF 5DZ9A 2BJML 5HJBA 3SOBL 1UM5H 4XWOD 4P3DA 3GSUA 4PRNB 4MMZC 2DW5A 1G6RH 4UMSA 5ERWA 2I24N 5J6HB 1Q9OA 3IN2A 4JPKL 4O5LL 3TT1L 2NTFB 3VRLE 1MCWW 3DO7A 3HE6D 1FI8C 1L9MA 2H5UA 1JZIA 3MRFA 2X6BA 4R4ND 4HWZB 3C6LB 2YMTA 3RAJH 2Q7NA 4CN4A 2ALWA 4YH6A 2HPTA 1TVHA 3SBRA 2C9QA 1I8KA 4UT6H 3ULVH 4J28A 4IRJD 5J1TC 1MJ8H 3PHSA 5DZVA 5IBLC 3EG9B 4TVSa 3PWLB 3RJDA 3V4VA 3W3BA 3QNYA 4TNWF 4K3EL 4HDIB 5A16A 3MROB 4S1DC 4N2DA 4ABQA 4GW1B 5MEND 1BGXL 2EXTA 4I48A 1DJGA 2FB4H 1NEZG 1PY4A 1TDQA 3C09C 3Q2CA 3SKMB 3SKNA 3BVNA 3KLAB 3QCTH 1B0IA 1R33A 3NIFE 3CFQA 3EGXA 1ZT4B 4H20L 1MHPH 5M94B 2RCSH 3AY4C 4WNJA 2YD3A 3SDAC 3HW7A 5KZCB 1UD5A 5E9DB 3MO1B 4OUOA 3U4EB 3HG1A 4ODWA 3VFSA 5BQ7A 5IM7A 4JFOA 5IFHL 4HKJB 3II2A 2NZ1A 4L2YA 2D4DA 1CL7L 4V2BA 4CKQA 1T21A 5A7BA 4NQQA 1N8ZA 2CWRA 3HZKB 4BCYA 2VSMB 1YNKH 3MCLL 5DK3A 1PYWA 5B38B 3KBFA 2J8UF 3LKPB 3F04A 1G1YA 1AHMA 4M6MH 4KOCA 4M00A 3ULUF 1UXWA 3SE9H 3QEQB 5IOPB 4BIKA 2DQJH 2FVNA 1WCQA 6PAZA 5D4IA 3D33A 2V2TA 3BDBA 4OV5B 3PV6B 3CH1B 2KL6A 5IJKA 1N5AB 1TQVA 4Z1PA 3C5ZA 2FJSA 4OZIE 4G5AA 4W6WB 4P2RA 5I30L 1KTBA 2XN9E 2ZICA 5D1XE 1ADQL 3ZQXA 4KXCA 5FKAB 1VDGA 1G4MA 4JY5L 4LNRB 3K4ZA 4QRSB 4TUKL 2PO6D 3FSOA 1SHMA 2EE9A 4S1QH 3FBQA 1I9JH 1CYGA 2J57A 2VDMB 2LVEA 2FD6L 3AT9A 4NENB 3CK0L 1TCMA 5AOIA 4GAJH 2X38A 1RV6X 2DL2A 1KXQA 3RWHA 4HS3B 4MD0B 3VI4B 4HHWA 4DEUA 1OD7A 1RHHA 4V1DE 5TQ2H 1BVZA 2BJMH 2LAGB 3QPQD 2Z7ZA 2OQJB 5EOCL 3QORD 1AIZA 3CSYA 4LCCC 4OD2A 3EYUL 5GS0H 1CLYL 2HTKC 4HUKB 4MYPA 3MJ7B 5D7JD 5BVJA 5AVTB 4PJHB 4ELME 4HU2A 4O00A 2NNAB 1TG8A 2VRKA 3CVHL 3UBFA 3ZDWA 1P5UA 4HXBH 4KO9A 1RZQA 4AMWA 3SGEH 4ONFL 3V0WL 3TJEH 4Z7QE 1MREH 1ZA3B 3LPWA 2DMCA 3ZMRA 5IW6A 4GKNA 1J05B 4W6XB 4XCNA 2WNKA 2D3NA 1NEZB 1E27B 4PAZA 3LOWA 1BAFH 1BBDH 5C3IA 3BZFB 5A1AA 1PZ2A 3DIFA 2FO4A 1QRKA 1NCWL 4JFYA 3ROOA 1OSZA 3PRZA 4WKXA 4P5MB 2X05A 4PV9A 3IAPA 2WWKT 5LAPA 1TYEB 3QR0A 4KOBA 2P5PA 3F7LA 4OQ1A 1UA6H 4EZLA 1M6UA 1HHHB 2DI9A 3EH4B 5DC9B 2FQDA 3EUDA 2OL3L 3F7PC 5IVZA 2HKHL 3B2UC 3EFDL 3NSFA 3CDFA 4O2CB 1RZKC 3BQUA 1M7DA 2VL4A 1YECH 1T66D 2JB6A 2PTTB 4EI5D 5J11B 3MCLH 2J6EL 4UV4H 5DXWA 5F6HI 2YPLA 4G9FA 4PRHD 4QOKD 4Y1AD 2IGTA 4ILDA 3L4UA 4FNSA 1ETJA 3S88L 2UWEF 2CCVA 3X1GA 1LD9B 4AZUA 2VAJA 1U8OB 4NZ8A 3C2AH 5DZNA 2VC2L 4ESKA 4GI8A 2MHAA 5EU3B 4YXHL 3MRHB 2DEWX 3H2WA 2AV1B 2HRGA 3P02A 1IX2A 1KN4L 2OV0A 5GGUB 3DNKA 4L2LA 1LXMA 5INCB 4N86A 2IMMA 5DRXA 2IALA 3GZPA 2AERT 2V5RA 3LNHA 1HL9A 4R7LA 2O61B 3JZ7A 4JY5H 4E9VA 5F9WB 5DZPA 2MPAH 2ZOLA 5DJ8A 4EI0A 2JE8A 3O45A 1AY1L 2FD6H 3WO3B 4PRPB 3VGBA 5H2BA 5IK3B 2H2SD 5FHAH 3OMZA 3H6AA 3L3OB 6FABL 5TF0A 4Y16B 2X42A 3PAZA 2VSDA 2Z1KA 3LNFA 3QUML 4J1UA 1J1OL 3BP4A 3DX7A 3RPKA 1I82A 2HH0L 2JCCB 4BKLA 2UY7A 1IL1A 5I1KH 3C9NB 4YDLC 3PYCA 3GT6A 4IMKA 2NSXA 5DEJA 2IC2A 1KJMA 3AITA 1CLYH 2X1WL 2LFEA 4F8LA 3QUXB 4JKLA 3CHSA 5C1MB 1KJ3L 3JVGA 1UOWA 4DGVH 4HOXA 5IROD 1SJEA 3V7AE 3WJJC 1YYLL 3UMTA 4EI6A 2W60B 1HH9B 1ZHLB 3U0TB 1WBYA 1U8CB 4S1DD 1RPQA 3LZFL 4ONFH 3SHSA 3V0WH 4ZZKA 4X9IA 5IMKA 3I3BA 4CMMA 4P4RA 4M93B 3IFLH 1V05A 3NZ8A 2OXHB 3CHRA 4LMQE 5JOEA 2VQTA 2ICWJ 1J5CA 3WN5C 5ELIA 2X7LB 4ZJ9A 2I25N 3DI2B 1NCWH 2EIZA 1IILE 4NQCA 3FCBA 3QS3A 2FWOB 2QSCH 2OMXB 2DLGA 5FYJE 3NH7L 5I8OH 1X5MA 5J1SC 3CZFB 2KLTA 3VX0A 1QEWA 3CVHB 3UXFA 2YS4A 2ZKXA 2WBJA 3LQAH 1C12B 5TDNA 3EJSA 3BH8A 2EO9A 3FS9A 4DCQB 3FFDB 4K9EC 2YARA 2WVTA 4LLVB 1GW0A 5C9JB 2GY5A 3IJYA 4L23A 1QLEH 3S3BB 3T2QA 2YRPA 3D2UB 5TPWH 5HYIA 1K6QH 2VC2H 3GLEA 1FZJA 4AJ0A 4XTRD 1JV5B 4HWBA 4UCFA 4Y4KA 5DURD 1ED3B 3S0PA 1PIGA 2APVA 4JZOA 5HGBB 4YL4A 3OB0H 3ULSB 4OLYH 2XLLA 4A7QA 5DQDH 2ICEA 2GKIA 4IHBA 3O3UN 4MZ3A 3RVTC 3TYFB 2OL3B 1JGIA 4IGBB 5EB9A 1JDCA 4PJEA 1JHLH 4XMLL 1CF1A 1LQSR 1WHOA 2MWCA 3ECUA 3QRLA 4AQ1C 5JQ6L 3FQWA 2EDNA 3ESOA 1AY1H 1MH5A 4CN6A 2LQRA 3QZWA 2CBMA 1VZGA 2HTKD 3MV7A 4QHKI 4DZ8B 2LFGA 5CEXB 3CFIC 1U8IA 3AU0A 1BECA 1X4YA 3QUMH 1IBHA 4QRPB 4TVPL 4XOEA 3WIHH 3O41B 1SXNA 1Y6NR 1NCCL 1FYTD 2HH0H 2X9WA 5EC2A 1EAQA 2WSKA 1SYSA 5CGYC 2V2WA 3CMOH 3FTWA 4KH2A 1PZDA 4UT9L 2DI8A 1ZLWH 2PNDA 2EXWC 1URZA 1HNGA 4KRPB 4FQLL 5DK2A 3LHPL 4JRYE 2AXHA 3K72B 3QBTB 4WFHD 3UYPB 4ZUWB 1IC5H 1S9XB 1T20A 1YYLH 1ZHNB 2ITDB 4NO3B 4WCYH 1PJWA 4TNVF 2MTPA 4P57B 1CFBA 5J6GA 5EORL 3DXAB 4BQ9A 4P5TA 1OGAA 4JFVA 1U95B 3RRQA 2R69H 3RFRA 2H6OA 2OZ4H 4GUPA 3MGOB 4NP4L 2PPAA 2B3RA 4PGCB 4YHIB 4YHYB 3S5LA 3IFOB 4PVBA 1MCLA 3B2UD 4L4VB 2ZX7A 1FIGL 2JCCE 4AEHH 1FC1A 1RZGA 1TJXA 4EIBA 4WGVB 5ISZA 3KPSB 3TO4B 3SB3A 4E42B 4XODA 4JFEB 3X3FL 3PXLA 1MHCA 3NFPA 5IB2B 2FJFB 2BNQA 4LKXA 1M3JA 1Q94A 3FQUA 1JXFA 5F88B 2VSCA 3BYYA 3ARFB 4NO0D 4BCZA 3ZMNA 4JQVA 5DGQA 5FYLH 5ACZA 4BFNA 3BAYA 3E8UL 3RIAK 4QHNA 4I3RL 2J44A 3SE4A 5T3XL 3IEAA 3ARTA 5MP6L 3RTQB 4QKTA 3T8MA 3X12B 3DOHA 4UQ3B 4RZCB 2CJSA 3PY9A 4NZJA 5LUMA 3BZ4A 4TRPL 3NCJL 4PLOB 1HI6A 3O2VL 2YKLL 5KEZA 5E6YA 3AXHA 4JY6B 1IAIH 2X4OA 4L9LB 3HBZA 5CD3A 3V9CA 3VTMA 4AUUA 3BZEB 2BDNH 3DTXB 2EEDA 4G1EA 2PN5A 4LCWA 5CEYB 4XNXH 4YUEL 4PGJA 2HT4C 3VSQA 2DM2A 5JQ6H 2FIRT 3ZN6A 5DEZA 2ATPB 1E90A 4RMUA 3L9RA 3SQOL 3V4PL 1DN0B 2CU9A 3DHPA 4ZUTB 2AEOA 4LSVH 3DJRA 5ICXB 4FABH 4ZSOB 4HFUH 4TVPH 3IDYB 3MRIB 1FE8L 3QZOA 4FTVD 1NCCH 1YEGH 4MFHA 4GRWB 5I23A 1J12A 1E9PA 1DR9A 1P7HL 2Z0BA 5CFHA 2I60L 4KROB 1FNSL 4J3VA 5IJVB 2AK4A 3QZPA 4R4BA 1UCTA 1KB5H 4U1IA 4BZ1A 1OD9A 3IETA 5C0NC 1NFIA 2OMWB 4UQDA 3VX1A 2LR4A 1NIFA 3HC3L 1JTOA 2Z8SA 1RU9H 3FJTA 4U1GC 4CA4A 4ENED 2BSTA 2C1PA 3HE7B 1Z9OA 1TXKA 3FU6A 3FFOA 4JLRB 1OE3A 1KBPA 3O11B 4YSRA 3BHBA 3BP7B 3UTSA 3UTTD 3D3VB 2HJKA 2BSBA 3V8OA 4A38A 3QXDB 1SVCP 4F7CB 4NP4H 1KPVA 2GFBA 4QRPE 5T1MA 3K71B 1KIQB 1IU1A 5EZJA 4P48A 3HCVB 1FG2A 2XNAB 1FIGH 3QARA 4YVNA 1HDMB 2CBPA 3B43A 5DVLA 4MNQB 3DA0A 1R5IB 3H4HA 2P80D 2ENJA 1M7IA 3LKNB 3U9WA 1SHXA 3TV3L 5JXAL 1EHXA 4B0MM 4I5BA 4JRXB 4KV5E 3QDMB 4GEIA 4IBSA 3UAJD 4XNDA 3S2AA 15C8L 4G43A 4JJ5A 3DXAE 4DZBA 3TVMA 2YLHA 4RGMB 4CSPA 2EVIA 1FFQA 4H0IA 4NPKA 1A6AA 3RVTD 4MWFB 3HNVL 2CLZB 4ZOEA 5T3XH 4H88H 5IF0A 3VFWA 5T5FH 3EBHA 5SWZE 4ODHH 4EDXB 4E0RB 5DD1H 4AM0B 3FL7A 2NY4C 3LRSB 4MAZA 1BQSA 1UWXH 4DGIL 1F3JA 1CR9H 4KZCA 4TRPH 1CLVA 3IGFA 4F3FA 4M29A 2WLMA 1WFOA 3SQBB 3KPSE 1QLFB 3HR5A 1ZPUA 2J43A 3MLWH 1NSNH 5A2BA 4GUOA 4WF7A 2COVD 4WWKA 2AVFA 2CRIA 3TBSB 2BOLA 1VACB 3QDGA 4I1RA 2DIAA 4H8PA 3MNWB 2DTML 4XOBA 2V2XB 1XH3B 4WW2A 4X6BB 5CGYD 4RX4D 3RUGB 43C9A 4ZZFA 5AENA 2X9YA 4HS6A 2EXWD 3SGKA 3OKNA 3NEOA 4NPYB 1EQWA 2YSTA 5DMIL 4KHTL 3KM1A 4PJ9B 1AD9A 4ANWA 2ZKHL 2K0RA 5IJKC 3C5ZC 1R5WA 1KYUA 3PP4L 3ZE2F 2I26N 1JK9B 4XPAL 5BRZB 4K94H 1P6WA 1C16B 2XY1A 2Z92A 5A2CA 2IANB 2OM5A 4ZS7H 1SZNA 3CHPA 4Z7OF 1CD9B 3APDA 3ISWA 2EYSB 5CZKA 2GT9A 3CGTA 3E38A 2MCAA 5I26A 4HZAA 4F2FA 1GXEA 4R5XA 3TBBA 1OAQL 4N25A 4U1NB 5FGBA 3HG4A 3V0VB 4IJ3B 5C0BB 4JQIA 1TNNA 3V4PB 5G55A 4CW1A 3FUFA 3EFFB 3FSVA 3QXTA 4Z3IA 1NMBL 3VXSD 1A14L 3CE1A 4PHZA 3KS0J 4JDZB 2CDFA 4IBYA 3SDYH 1UM4H 2OS7A 1T5KA 3FUIA 2I7OA 3IMSA 5LBSH 2UUDH 4AYDC 3WTVA 3S98A 1LK3H 1OLZA 4HH9A 5SX4I 4HF5H 4PJAE 1JPTL 3RVXD 4KKPA 1H8NA 3CCHA 4B9FA 4HZ1A 5KVFH 3MUHL 2WLIA 4G8FB 3OMIB 1P5UC 3WE1A 3GS7A 1A9VA 2IPKA 3ZZLA 3TV3H 4XN1A 3PP3H 3IMVA 5CGMA 1EEUA 4PRAB 2XWEA 1BOYA 1G84A 1DJZA 1T1YB 3K2UH 3N42F 4FNRA 4JFXA 1A6UL 1BLNA 3GMRA 5E8EA 4ZW8A 1T83A 2AANA 2ZXGA 2AQRA 2A7BA 3KD4A 4JKPL 4KJPC 4MQXC 1ZGLM 1VADB 3E6FA 3T4YB 3UPCA 2JIXB 2HG5A 2UX7A 4K3JL 2CIKB 3QUHA 5C09A 4HHGA 4BEIA 4ZFQA 1R4XA 3DO4A 1ONQA 2W07A 4U7KA 4N3TA 4KWUA 3GRBA 2PXYA 1FAKT 4DSYA 2VJ0A 1GZQA 1X7QA 4YDJB 3T2NL 4RSVA 1XIWC 3BQUC 1KELL 2WKOF 1KZQA 4XX1G 2LW3A 2DTMH 3BT0A 3LRHA 3ZZSA 2QTEA 2NY3B 3QDME 2J8HA 4IBLT 1J0IA 3FONA 2B4CH 1BZQK 3EOAB 4NQVA 1MCEA 2DF3A 5DS1A 3ZTNL 1JPGA 3LKSB 5DMIH 5C0ND 2X4RA 2X6MA 3OWRA 4KHTH 4JFDD 4RCAA 4FJYA 5DJZB 1QTSA 1QWUA 4WO4B 1AP2A 3L48A 2XJKA 3DV6A 4XPAH 3A23A 3GMLA 5KSUA 3DUSB 3CFNA 4MZ2A 1LO2H 1PKQB 1NGPH 1M71B 1T80A 2PCFB 2X0WA 4LHJB 5CLXA 4G5ZL 4NT6B 5B1BB 1IGCL 1J5OL 3BKJL 3PHOA 1QNIA 3F6JA 4FQQA 4JDVA 1A6ZB 3TBVB 5EOCJ 3BGFB 1OAQH 2CK0L 3PREA 1VA9A 3RUGE 4KO5A 4KI5E 2DOCA 2JQAA 5DHYB 1IE5A 5DA4A 4ZX4A 5BXFB 3FCGA 4UAHA 1CXFA 1G7JB 3RWEB 1A14H 1J9CT 3E7JA 3GJFA 4OZFA 1WZ1L 1IBFA 2G3MA 3HG3A 4IMKC 5I6OA 4I4WA 3DX8B 4GS7B 5JW4Q 1P2CA 5D7LA 1ZK5A 1I4FB 4EE2A 5BRZE 5L2KA 3LZNA 5DWUL 1JPTH 5DHDA 3QJHB 3ME0B 3P3RA 2DQDH 1MFNA 3HRPA 4IBWA 4MAYA 1MFEL 1KGXA 4XMKH 3IE4A 5ICZA 1FH2A 3VRIB 2NY4D 4MXQC 5IKCB 2DBLH 4HXAH 4N0UE 5MEQA 1ODAA 1YY8A 3NJXA 4UQAA 5AVWB 5H37A 1GJIA 3EO1B 3FQXB 5BOJA 1CTNA 3HG1D 4B9JA 2AFNA 2ZYHA 3GSRA 3AAZA 4TTDC 1U33A 1JNNL 1V3LA 3X11B 5BZDA 3EXLA 5H94A 2CO3A 4F7KA 1S9KC 3H9HB 5JHLA 1AKJA 2RD0A 4L8DB 5CAYB 5HVHC 4IRSA 5TDOB 3VSVA 3BLKA 4RWYL 1BD2B 1JVKA 1EVTC 2WO2B 3EOTL 3IDMB 3HIZA 4MCYA 3BEVB 4BSWB 2A74B 3EO9L 4YNYB 1DSWA 3EGDB 1DTUA 1CFTA 4ACPA 1U91A 1CBJA 2TRHA 3T2NH 5JIDA 1WTGT 2G0KA 2VZOA 3GZOA 4XRCA 4B5ZA 1EA9C 5HHOA 4P2RD 1T1XB 3BAJA 2J88L 1GKOA 5FKPA 3B8YA 2HRPL 4I1NB 3ZTNH 4GSUA 2NW2B 1AHWB 5F7NC 4S1RH 4Y4KC 4ES9A 3UPAA 1ZT7B 1F58L 3G5VB 4MJ2A 3ZR6A 4N2OA 2NY5C 4BH8A 5KYUA 3SJVB 3WNOA 2Z4QA 1BQHB 3KPQA 1GHFH 2AJVL 4HJJL 4MMXB 4KKAD 3VXUD 4K94C 2YGOA 2IPTH 4K7FA 2EDTA 2H0EA 1T7XA 2CGYA 1OWRM 3R1GH 4XMUA 1QSEA 2EDWA 4MVBC 4ODSH 4G5ZH 2P28B 3KPMB 3HZYB 4UWQB 3IU4L 5C0CB 1IIIA 3I6KA 1SY6A 2GPZA 1CBVL 1KGCE 1QP1A 1O5PA 3BUTA 3OKEB 4ZUUB 4JM2B 3PABB 1FVEB 3VFRB 5E6IB 1P4BL 1T4KA 2IDUA 3GNMH 2DTSA 3PWUA 4WHYH 4UDUB 3ZTJH 2GHWB 4HUUA 4Z8FL 5BMFH 2ICWA 1E8ZA 2Y9RT 3B5TA 1P6AB 2EDRA 1AGCB 3L3HA 5GIRB 1ACZA 3ZYJA 1UVQA 3O6KH 4H2AA 3RBSA 4ANKA 3VD0A 1PZCA 5L4MA 3CC5B 2AITA 1HHGB 1Z5LA 5K93A 4KGLA 4M6OH 5AW6B 3Q48A 1BM7A 1ZHBB 4ONGL 1XCWA 4E36A 4LKCA 3S9DB 4KJPD 4P5TC 1TT6A 4ZFZB 1MHHA 1T0OA 3UBXA 3KEHA 3ROLA 3Q0HA 1Z0NA 2BP0A 2DLIA 4HJ0C 1K8DB 1SM3L 2XWJB 4Q74A 4QXUH 2E7LA 3A67L 1MJ7L 3T3PB 4GT7A 3F7YB 4U05A 1M4KA 5DD5L 4HW6A 1F4XL 4Y8AA 3GMMA 2XPGB 3BQUD 2AQ3A 5HYQA 4N2IA 3EKCA 4B27A 1IC4H 5I1GL 2FBJH 1QG3A 2YPLD 4G9FD 2A83B 1DCEA 1PW3A 1QABA 5DRZA 4Y2NA 1GOGA 1A6WH 3DURA 3EOTH 3QR1A 3CLWA 5D5MB 3SGDI 1EFXB 4K0OA 5MEOA 4Q9RH 1C08B 3IS0X 3BVXA 4RQQA 3P3YA 1YNTF 2ZKWA 3U1QA 4MS8C 2BY2A 4JQVC 3UO1H 3JBG7 2VE6B 2R2HA 1X5JA 3PL6D 5GGSB 2IV9A 3IF1B 1UZGA 2H2PD 4QEGA 3L17A 2J88H 1PCSA 1OB1B 4PJGF 2DQ6A 2L4OA 3ZTDC 2HRPH 4LIQL 1UB5B 2B4CC 3PLYA 5DJXA 2C9UA 3K3QA 5T1KA 1MCIA 2NZ9C 4UILL 3BQVA 4YDIH 4NOFA 4W9EC 2X4UB 2WUBH 2VMDA 3DJZA 1EEZA 1YC8A 1FBIH 5HDLA 1XXDC 4U31A 1DEEB 4XP6H 1AGEA 2OSXA 3GPSA 4EEEA 3WHE1 2VXQL 3BIKB 1BD2E 2EE0A 4MJIB 4LSUL 4ZPVB 1WZMA 2DQGH 3D1MC 3L5WB 4MHHI 3WNPA 3F6LA 5IB3A 3SYQA 4PS7A 4L5FE 3LY6A 4L8BA 3IU4H 1U3YA 4WLCA 5AB0A 1PFCA 2I85A 4X0KA 5LXGH 2F7IA 4KKQA 2ENQA 2XV0A 4XC1H 3OD3A 2C4XA 1P4BH 2IGFL 2WNGA 1T04B 3NPSC 4M1CC 5CCGE 4YO0B 1INEH 4PGBA 1TTCA 5E8OA 3O6FB 4GFTB 1S7XA 1FC2D 3IXTA 2JB5L 2Z8RA 3QAZC 4MXQD 5AB2A 4CBZA 4W68A 5LAXB 3SJVE 4Z7NE 1BX2A 4Z3TA 5FV1L 5KBNC 3BH9A 1M2VA 1JPFA 1WP6A 5FYKL 1CFQA 4NQCD 2OJEB 4L4TB 1MW0A 3E9TA 4TTDD 1SXAA 5E1AB 1E7UA 4JANB 1SVBA 1AXTH 4NWTH 1QI5A 3D05A 2CNZA 1CK0L 4LHUG 5EU6B 5C0CE 1UT2A 2Q20A 3IPFA 1R47A 3NSDA 4L8SB 4PREA 2ZG2A 1PAMA 1SM3H 4LDEB 3A67H 4Z3FA 4ZFOL 2VDPH 2WBJD 4UU9B 4C56A 3JSSA 1JL8A 1F4XH 1TZIA 2A9MH 4ELMA 2H45A 2M1KA 2ED9A 2WQ8A 4XMTA 1S7TB 3B2XA 1VFAB 4LLWB 4NUPA 4UTAA 2Z8WC 2TRYA 5BO1L 2VXVH 4FG6C 2BIHA 4LPTA 4Y4KD 1SOQA 2BRRH 1B0GA 2VDOH 2K8QA 2D7MA 3D09A 4YEEA 1CDUA 4PRNA 1AR2A 4G1MB 5AB9A 1AAJA 4LSPL 5ALBL 2Q8AH 1DLFH 5JDSB 5E9NA 3A6CL 1K9TA 4XXCA 1KCUL 2X9XA 2ARJQ 2NTFA 4GG6B 4LLQB 4YHML 1K4DB 2X1XR 3MODL 1YJDC 3IJEB 4HWZA 4J3OC 2AAVA 3C6LA 3MV7D 4G6AC 4WTZA 1AANA 3QRBA 3K1KC 3ZL4H 4WFFE 3ALWA 1U2YA 2F8VA 4N87A 2A2QT 1YUKB 3JV4B 3BZ5A 2R0ZH 5D5ME 2EICA 2CM6A 2XA8L 3ABMB 5IVXB 3GC3A 3EG9A 3SGKC 3PWLA 3ZHFA 2K4WA 5IMOB 1A4KB 3V6ZB 4GFXA 1ACYH 4HDIA 4XP4H 3MROA 2FECL 4GW1A 2W65B 2B59A 1ETB1 1RVFL 3B7TA 3SKMA 2J1KA 5E08L 3KLAA 4X4XB 4A1RA 3A6BH 1ZT4A 4Y5VB 1NGWB 4AYEC 4P5TD 1OGAD 2OBGA 4X4ME 3MO1A 5E9DA 4XN7A 4JX0A 4Q9BA 3U4EA 3FUJA 4LPUA 4DTGL 3QDJB 1JNHB 4HKJA 5JHMA 2OMTB 1YNLL 3HZKA 3Q43A 2ZJSL 2BHYA 1UOVA 5B38A 3LKPA 2DDQL 4GOSA 3WLWC 2MNUA 5FM5M 4AGOA 3QEQA 3G6JE 5IOPA 1VSCA 4D0BA 5ISZD 1L3NA 1T1ZB 4C55A 3FXIC 4MJJA 3B9KC 4ZO9A 1I85C 2A4ZA 3D48R 3PV6A 4OV5A 2EYRB 3CH1A 5SX5H 1O6TA 4TTGA 2WXMA 1N5AA 2PPDA 4N8VG 2AVGA 5GRYA 3CHOA 2CHNA 1TJMA 1MIEL 4P4KB 1TO5A 3N40P 1TMQA 1XCQB 4YFEA 2IEPA 4MS8D 5AYQA 3KLHC 5FKAA 3SZ6A 3CD4A 3ML9A 5GGTA 1GRWA 4I87A 2E0PA 3NA4A 4LHQB 4R8WH 4QRSA 5BZWB 1JYVA 3VWJB 1K8IB 3OB0K 1SEBA 4NENA 3KXFB 1BG9A 3UZQB 4JN1L 1YAIA 3CVIL 4H8WL 4FA6A 1BFSA 1W16A 2NZ9D 4HS3A 4MD0A 3VI4A 3TEYA 1PTZA 3FHAA 3ZX1A 2ZG1A 2DL9A 2EQDA 1WFIA 1J0JA 4JHUA 2OQJA 3FOLB 4TUJB 3H3KA 1RQ5A 4MCZA 1T83C 2FNWA 3OAWA 3DYPA 3UEZA 3W0WB 4IW4C 1MWAB 3A6CH 5H35B 3MJ7A 1KCUH 3FT9A 2WYHA 3TPUB 2BIMA 1RZ7L 5IW1B 1ND0B 4PJHA 4YSOA 5H4YA 1GL4B 2NNAA 1FSKC 2C1OB 2PXYC 5DMKA 1ZK9A 2R56L 1ZLWK 1S78C 3QJSB 4PGEA 5IMKB 1ZA3A 5D93B 4QRQB 1BZEA 5KW9L 2BINA 3UBGA 1J05A 1NEZA 4M1CD 2OTUB 2QSQA 2VLRD 2HTLD 3BZFA 2WP3O 4GQ9H 3N85H 4NM8H 1N4XL 1JGVH 2AK4D 4AJWA 3HNTH 4P5MA 4EXPX 1MI5E 2HLEB 5IREA 5JXEA 1NH6A 5DEGB 4ZMZA 3DUHA 5D7IF 1RMFL 4I3GA 3CWGA 4W4NA 3ZDZB 1IT9L 1MW1A 1HHHA 3Q8CA 5CJXA 1D6VL 3QJVB 3UTSD 4FFYH 5B1JC 2OMZB 1O9VA 4O2CA 4DTGH 1JFHA 2ADFL 4W9CC 2L7UA 2YZ8A 2NMSA 5AAMA 2PTTA 4MXVE 4L3EA 1MVYA 4N8VB 5B39G 3OXRB 5EWIL 3BKML 2OMNA 1A5FL 1LD9A 2BVQB 1HHIA 1U8OA 3WNMA 1XBDA 5FB8B 4Y9BA 3OC8A 5HYFA 1PNCA 3QS2A 5EU3A 3MRHA 3QUKB 5D1ZB 2AV1A 4HWNA 1A7BA 1L0QA 3I9GH 4ODBD 5GGUA 1QZNA 1EHNA 4WI5A 5INCA 5DDHA 1MIEH 4FG6D 3FB6B 4YC2B 4XPTH 5B3JE 2O61A 3BRDA 3TVMD 4U1LB 1A3LL 4W93A 3NK3A 3MJ8B 2X2YA 5K69A 3MRKB 2JSFA 4GIPD 5L6YL 3GI8H 3QDJE 4FZ8H 4G7YL 1F6FB 4K8RC 43CAB 2AEPH 2XTLA 4PRPA 5IK3A 4NX0A 3VG0L 1Z9LA 4B50A 3L3OA 3B34A 3U25A 2BO0A 1NPJA 4Y16A 5E2VH 4FZEL 3KDMB 2O5YH 3HN5A 3L4XA 5TE7H 3ASNB 4M4RA 2BP3A 1B0RB 2JCCA 5CP3H 2H6PB 5CJQL 3C9NA 3ESPA 5CR8A 1J1XH 4WWKD 2HJFB 3X17A 5CR1A 1FNAA 3ETSA 1N2RB 5D2LF 1ADQA 3ARVA 1DO6A 3QDGD 2HZHA 2JI1A 3ARSA 1BXXA 1IARB 2QADB 4KKRA 4FP8H 4H8VA 4NDMB 2XIIA 2R39A 3TIDB 2BFVH 4NJAL 2W60A 1HH9A 3Q5OA 3U0TA 1U8CA 2R56H 1PX4A 1N5YL 3VD9A 2EC8A 4BE5A 2ITEA 3KXFE 3NTCL 1F2XK 3IDJB 4HGMA 4NSKB 5I5MA 2J5LC 5AZ2H 4DP5X 1PD0A 4IK7A 3WO4B 3POCA 1NAML 2E27L 4B9GA 2OXHA 2QV2A 4TQEL 1MUJB 3IDNB 4FQIH 2FEDC 1DQDH 4JHZA 1FNHA 1DL7L 2X7LA 2JKIS 4M3JA 3HRZB 4ATWA 1TQBB 3MLZL 4B9YA 3RFZB 3KLQA 2E6JA 2OMXA 2NX5D 2OJZL 1S7RB 1I3VA 3X13B 5K9QI 4ZW5A 2D7TL 5L4FA 3T0DA 1PFOA 3FAXA 3W0WE 3WLWD 1P7BA 3CZFA 3FF7A 3ZGIA 3QO0B 5HJ3B 5AW3B 1D6VH 1I3GL 1SMOA 1UCBH 2X09A 3CVHA 3HZVA 2COQA 4GMSL 4QTIL 3L1EA 2C5DC 1G7PB 3MNVB 3CZGA 4HCRL 2D7PA 5ENWB 4MDIB 4XH2B 5ILTL 1C12A 5IQOA 2BLFA 4EQ3A 2BHUA 1DLHB 5FUCC 3STBA 3U4BL 3D07A 4DCQA 3FFDA 4LLVA 5HDOA 5C9JA 3H2PA 3MLVL 3G5ZA 3P77B 4X6DF 2OK0L 4XX5A 3D2UA 1ECYA 5EC1B 3MLUH 4JO4H 3TV8A 3B2PA 5LCVL 3TNNB 1JV5A 4DQOH 3K8LA 4PWHA 1ET7A 4WWID 1ED3A 5I76B 3ARQA 4A7GF 5HGBA 3GKZA 3ULSA 3EADA 2VDLL 2EILB 1Y6MR 3VG9C 1LO3L 3TYFA 2OL3A 3K80A 4RVBA 1U58B 2LU3A 4IGBA 2YQGA 3SEPA 3C5SB 4G8GB 1TZGH 2EADA 2ZXBA 1IGYB 1FL5B 4GEJA 2RIKA 4FEMA 3PNRB 2VWEC 4PJIE 1A3LH 2J6EA 4EIUA 1FNFA 1JGUL 4OFYD 4HLJA 3GD1C 5ADOL 4DZ8A 5CEXA 3ILDA 3O2DH 4NWUL 4M7ZC 1GIGL 3PNWB 5C09D 3LB6C 4QRPA 1SJHB 4FZEH 3O41A 3VNZA 3TU6A 4OCSH 4OD3L 2E7LC 2PXYD 4XO3A 2ISDA 3NBNA 2EDHA 3CXHK 2OX5B 1S78D 4NP9A 2BCMA 3CFUA 1Z9SB 1HAWA 5FA3B 5AVQB 2ZSWB 1YMMA 2WXRA 4IHOB 1USZA 4LFHG 4OZHE 4CDHA 1J10A 1BMWA 4LK4A 4XNAA 1UG9A 5I1HH 1EANA 2PWGA 5ITBL 2BCKB 1WA2X 1C5BL 1YG9A 4OIIH 4OLZL 3UYPA 2W1NA 3VU2A 4QJ5B 2CNYA 1A3QA 1S9XA 2DJSA 4YSEA 1ZHNA 4NO3A 2ITDA 4QYOB 3T77A 5E1QA 4HA1A 2EIDA 3DXAA 3LRGA 5D1QB 2CKBL 3WJLA 3FYIB 1KYDA 4ODUA 1U95A 2DPKA 4GKSB 5FW6A 5FYJH 3MGOA 3T6QC 1NAMH 1RH8A 4TNFA 3UYRL 4PGCA 3SYOA 1UWGH 1TSRA 3QWQB 3L16A 4YBLC 3IFOA 4BRJA 3UP6A 4L4VA 4F7PB 5CJ5A 5C08B 3TO4A 1HKFA 1PX3A 3KPSA 5KUKA 4E42A 5GPRA 2EVGA 5IGXH 2CRMA 4JFEA 4JM0A 1T0PB 1CFVL 3VXRB 5IB2A 2FJFA 1PMYA 4BZ2L 4RISH 3ARFA 3GM0A 2HXAA 4W9KC 1JZ8A 2NRDA 3LJ3A 5AL8A 4XB7A 4ADJA 4I0PC 5D7LD 1R19A 3MLVH 3VQ1C 1RIVH 4HIJB 3RTQA 5L2KD 3X12A 3FUNA 1NC4B 1S46A 4UQ3A 5AZEH 5HYJB 4YDNA 2AJXL 4RZCA 3H1ZA 4YDKL 2KZKA 4YX2L 4CVZB 2EDDA 3KS0H 5JIHA 1DSFL 1MJUL 2NY2B 2VUKA 4K8RD 4MAYD 5AYUH 1WAPA 3KVDD 4A67A 4LP5A 4JY6A 1X7SA 2OCJA 1HQRB 3BLPX 1DQLH 3N40F 5HDQH 1NBQA 4L9LA 4NC1C 5F7BA 1LO3H 4L18A 3D4ZA 3ESUF 2X1PA 2QZ5A 3BZEA 2TSAA 1U30A 3DTXA 1FCGA 2J2ZB 4PJ5B 5CEYA 3VI3B 4A2MA 5EZPA 4XPFH 4OR1A 4B9ZA 4F7TB 1U2CA 1NEPA 2FWUA 3O3DB 4HIXL 5GJTL 4JVWA 5AAWC 3ECBB 1S3KL 5I0VA 1JGUH 3EHBC 2ATPA 2E9GA 1AKJD 1DN0A 3MRMB 4M8RA 2YXVA 4ZUTA 4IRSD 4OCYL 4O4YH 5ICXA 1GIGH 4ZSOA 5TF1H 1TZOA 4PWEA 5JHDE 1JNLL 3QCVL 4X83A 5IWLA 1GYVA 3CN0A 5DJ6B 5HI5C 2YMOA 5I6KA 4RAHA 2VDLB 5IHUL 4RLDA 5IJVA 3L5XH 3QQ3B 4XCYB 3OSKA 3T65B 5D2NB 1R0AL 2OMWA 4ODTL 3NN8B 2FEDD 4OLZH 1C5BH 2R7EB 2AJZA 3FCUB 3HE7A 2VLMD 3EZ8A 5HGHB 3BN9C 2FX7L 1YQVH 4U0RB 4JLRA 3MRLB 3CXDH 1U8PB 1U3NA 3O11A 4N24A 3BP7A 4UF7C 2CKBH 3D3VA 3RU8L 3K4DA 4YSDA 1AZBA 2DV6A 3QXDA 4ZTPL 5IB1B 3MACL 4F7CA 3UYRH 2WB1A 3K71A 1QFHA 4K5NA 2CPCA 2P5EE 5FC9A 1KIQA 4UT9A 3HCVA 4XXCC 1QSED 1HDMA 2ADJB 1RZJC 4MNQA 4P59L 2CRZA 2VO5A 2WOYA 4XB3A 1R5IA 2JNZA 4WGKA 3N1GC 3ZKNC 4ZFFB 4N8CH 3ISRA 4GSDH 3C6LC 2ALAA 4LL1A 4PW3A 2Q5BA 2UV3A 3RLSA 5C0EA 2V9TA 4HV8B 4JRXA 5E4EB 5I8KH 3QDMA 4Q0XH 4IJTA 4PH8A 4D8PB 4RIRB 1JZJA 2ENYA 3PJNA 3QIBB 4UINL 3WV0A 3NSCA 4MWFA 2ZAIA 2CLZA 1XBRA 5F96H 3S35X 3QYNA 4EDXA 3CAFA 4WFGD 3OKKB 2TSBA 4AM0A 4E0RA 1HSBB 3VTTA 3LRSA 3UIZA 2IWFA 2GJZB 3D5OF 1IBBA 1RUMH 3AFLA 5IHLB 2Y2YA 5C08E 1QLFA 2IBBA 3HS8A 2X87A 2R23B 2ZG3A 3NZSA 3LB6D 5GRXG 3Q01A 3FN0L 3D69B 3TBSA 2WGNB 1VACA 4KXAA 1UEMA 4X6EB 3AVEA 1B2WL 2BIIA 3MNWA 1A0QL 2V2XA 1XH3A 2GK0B 3DVGB 3BCDA 3QH3B 4NZDA 4X6BA 3RUGA 4ALAL 3IGAB 1S3KH 2AXWA 5FA4B 1TPXC 1A1OB 4NPYA 4DVBB 4LSDA 4AQ8A 5GISL 4TOYH 1QRNE 3DJSA 1RUKL 2NXYB 6TAAA 4PJ9A 1I53A 1ZD6A 1UD2A 3W9DB 5C6WH 5GRUH 5DLML 1S5IH 3QCVH 4GKOA 1OAXH 5HYJE 1MNUH 3CU1A 2K3HA 1UGNA 1PZUB 1JK9A 2ZONA 1C16A 1LILA 4YHZL 1ZVSB 2A9BA 4KAQL 5IHUH 3UG4A 5FV2A 4AYSA 2IANA 1OP5H 4DW2H 1PX8A 3CIAA 5CJBA 2EYSA 1R0AH 3CJJA 2N0MA 4WK4B 1NUNB 2Y3AA 4U1NA 4PJ5E 3V0VA 5C0BA 2JELL 5T1KD 3V4PA 4NRZB 3AM8A 3A47A 3EFFA 3H9SD 3QZNA 1JZFA 1QFWI 1V8HA 3DVFA 3RU8H 1FGVH 4JDZA 3OB8A 1LM8V 3I3EA 1UKQA 5DR5L 1IC0A 2WV3A 5ANME 1ES0B 5DZAA 3HG5A 5DUPL 3AREB 3F00A 2AJ3B 1PG7W 2O6EA 2PETA 3C2SA 3UMNA 2PP7A 4OJFH 1CXHA 5E5RB 4FNQA 2B9BA 3S48A 4AMKL 1MCOL 2ARJB 3QIUB 2E5EA 4G8FA 3TYGH 1RLBA 2XFXB 4E9YA 4NUMA 2HFEB 2XVGA 1CT8B 1BYPA 1NL0L 4PRAA 3N9GH 4E9QA 1FF5A 1T1YA 3DHMA 3NRPA 2YBRB 2BXYA 5HTSA 3GFUA 3L08A 4X8GA 4CVXB 4ZW7A 3RHWF 1O7VA 4Q2ZB 4UAOB 1WC7B 1L6ZA 1I75A 1XXFC 1VADA 4KO6A 3T4YA 2JIXA 2BP5M 3OLDA 2CIKA 3RWFB 1DQTA 4JMNA 1QUPA 4W81A 1GYAA 1ITCA 3OR7B 5CJXC 4HS8L 3SGEI 4OFVA 4YDJA 1IQWL 1R34A 3LRKA 3Q8EA 3DRQB 2FH8A 1FRGL 3FPXA 3LIUA 4XPBH 1CLZH 5AAMC 4HOWA 2PP8A 4U3SB 1HK6A 5HI5D 3N04A 4P3CL 3B2DC 1ORSB 1CB4A 3T0ED 4C56D 1G0XA 1NIBA 5KOVC 2OXGB 4X6CB 3PWNB 3NACL 1D5BB 3HC2A 3EOAA 3L3IB 4HGWB 5GISH 3U0PB 4BXSV 5KVDE 4WU7B 2OR9L 1RUKH 1ZLSL 1NM9A 3AJ7A 3NCWA 3W56A 3K6FA 5DJZA 5DLLA 4WO4A 2ARWA 3IJ9A 1W15A 5SWSB 1RUQL 4XNMB 4FLRA 5CN1A 5I74B 1ZIAA 3K6OA 4XBPB 2DBJA 1MCHA 5DFAA 3WKQA 4G7VH 3DUSA 1SN2A 1NPNA 1PKQA 2PCFA 3V5KB 1EEYB 3GMNB 4NT6A 1YMHB 4LSSH 1W0VB 3POHA 4R5TA 1TJHL 1F13A 3ARGB 3TBVA 1A6ZA 3S4SB 2ZCLL 2J73A 4DT2A 1P7QB 4IKJA 4CN1A 4OKVB 5D7JB 1HZHH 2JELH 3GO1L 5DHYA 2GSIB 2XHNA 5BXFA 2EZ0D 1AI1L 3LS4H 3JVFC 3BE1L 3GK8H 1G7JA 2AZAA 3RWEA 1EXUB 1SOSA 4LASL 1RIHL 4RMSA 1Z5HA 3C6LD 1LO0L 4MB5A 5FX3A 1QW9A 4XPHH 5DD3L 5KBDA 2IH1B 3DX8A 4AQOA 5DUPH 5ADPL 5KVGE 3A24A 3NABL 3QUXC 3NIGF 1LE5B 1ZAGA 1P6FA 1DBAH 3OF6D 1MFVA 3OVUB 4M5ZH 1MCPL 4QPEA 3WHXB 4H0HB 1JRHL 3ME0A 3NOIA 5BW7A 4LSRL 3BKCH 1MCOH 2XQBL 1DBJH 3P0YH 3OHMB 4M43L 3VRIA 1K2DB 2R9HC 4DUWA 3MJWA 5IKCA 4M93C 1RCYA 4BBWA 3EO1A 3FQXA 3PG2A 2F19H 2ZT9C 5E8DL 2RTTA 4U3HA 1HQ4B 5E9DD 4DO4A 4XVOA 5BJTA 5EZLB 2QGBA 3WY2A 1OOAA 3X11A 4ETQB 3D6GA 2PWEA 3H9HA 4X5QA 2QMJA 1XVSA 1W72H 3B37A 4Y1AB 2YSSA 5TDOA 1JN6B 4YQXL 1LJMA 4BSWA 3IDMA 4HEPG 3BEVA 1FHNA 3QEQD 2A74A 1VF5C 1M42A 4YNYA 3EGDA 1Q1PA 1E2ZA 2AJYH 4JPVL 4AZ8B 4DKFL 2FE0A 1IQWH 1CIDA 1OSEA 1FRGH 3VAEA 4NS0A 1NKRA 3M45A 5MENE 1Y18B 4TSAL 1F3DH 1T1XA 1T3FB 1Z3GL 3K6IA 3MLYL 3VVWA 2W81C 2QQLL 3SPHA 2X41A 1HSAB 2NW2A 1BQLL 1AHWA 2OR9H 4R26H 4A2EA 1GPOL 2UZIL 1ZT7A 1FA4A 3QG7L 4PJCE 3G5VA 3ZE0E 4PTUB 4KZEL 4OSUH 3SJVA 2JKSA 2C3WA 5LHDA 3FB7B 4WUKL 3BH4A 4CADB 4MMXA 4UDTB 5F9DC 3PXJA 1IV8A 1B0WA 1XGRB 2E8ZA 2FUQA 4IGBC 2E3VA 4OLXL 5TGBB 3U2IA 3RA7L 2WZ0A 5BVPL 4P2OB 4HIHB 3ZMEA 3KPMA 4OUUB 5L8KB 3HZYA 1TJHH 3ARBB 5JDJA 5E4AA 3MCYA 5ALCL 2DLEA 2CSPA 3FHQA 2GI7A 4JM4L 3OKEA 4ZUUA 5I24A 5ID0B 4JM2A 2APFA 4LPYA 2BZDA 1FVEA 3VFRA 5E6IA 3X1NA 4B9KC 1AI1H 3T0AA 1WIOA 5I6LA 1QKZL 4LASH 1RIHH 4R97B 4UDUA 5GGRY 4X7SH 2X0UA 2I69A 1MCSA 1AGCA 5DD3H 5GIRA 5J12B 5I5IA 1M3IA 1WJ3A 1DP0A 1MQKH 5F71A 4KRPC 3QEHB 3P4NB 2BRQA 1D5ZB 1RUPL 4XAWH 1GSKA 4Y5YB 3CC5A 3RBGA 1HHGA 5JZ7C 1LK2B 1L7TL 2YJQA 4LSRH 4UZSA 4TULH 1N7ML 1TR7A 1U3ZA 1ZHBA 3RX8A 5JXED 4G3YL 4ZFZA 1KBGH 2IMNA 3WJLC 3P11L 2EKSB 3TLRA 3G04B 2CK2A 4JDEB 3AUWB 5D4QA 2YEZB 1GGCL 1K8DA 2XWJA 4KJWC 4DP4X 1L9RA 4YHYC 2WXIA 3F7YA 1M7UA 4R96B 2Y36L 4KXDA 1XGZA 1B9KA 2XPGA 3EDDA 2ITCB 1NKGA 5FK9B 3TO4C 4L3ED 2WMPB 5JO5B 3ELAT 5ITFB 2A83A 2QSTA 3SE6A 4Y1TA 2XX1A 3CPUA 3HHSB 2XBTA 3EH2A 1EFXA 4KDWA 5D5MA 3BUBA 4JB9H 1KJ2B 4ICXA 1C08A 3D85B 4HJUA 3TH3T 2NYYC 3ARFC 4JPVH 3SODB 1KTCA 5MERB 2P48B 4HLZG 4EN3A 2RHEA 2VE6A 5E5MB 3T6WA 2MCMA 5GGSA 3IF1A 3HKZA 4TSAH 2H3NB 1SFDA 2K1MA 3MLYH 1N0XL 3VD2A 3QHTC 1LL1A 5FWRA 1OB1A 4NNXB 4EIGB 5J5EA 3HZMB 5AKRA 5E0FA 1UB5A 3C8HA 3WTTA 1GPOH 3HI5H 2VO8A 3QG7H 4XCCH 5IIEB 4PRPD 5HBBA 3MVSA 4UV7L 2Y6SC 3LXBA 4PRHE 2ZP8A 4Y1AE 4QOKE 4Y16D 3RIKA 3BIKA 4L9LC 4MJIA 5JPNB 4ZPVA 4DP1X 5CMAB 5GS1B 1FYTB 3O6LH 3L5WA 4ZS6D 1GAFH 1PZAA 1NTDA 1FZMB 5HDRA 1ZSDB 2QVTA 2CUMA 4URTB 4WUUB 1OSYA 1TSHA 4QO1B 2W91A 1HOEA 3GQFA 1E7VA 5KS9A 5KJRL 2WN3A 1CZ8L 5IWLC 1T04A 1CXIA 1QKZH 2KDYA 3C8DA 1IAII 2IDQA 2PYEA 3ARUA 3O6FA 1MRCH 4J3XA 2RA1A 4KROC 1XMWA 1UFGA 5HHVH 4HJIA 4TL5A 5LAXA 3JQOB 4PTTB 1N6QH 4HLZH 3APMA 5M7QA 4OJCA 1L7TH 3P2DA 3HE7C 1EZVX 5JHBA 1ID5I 4FGMA 2X3CA 3E2HB 4L4TA 5E1AA 4JANA 2Q3AA 3HPJA 4YZFE 3MA9L 4GO9A 3ZUNC 1A6VL 3RKPA 5D55A 4R90H 5EU6A 5CIPH 5AW5B 2D03H 5I2IB 4FLSA 3ENEA 5GHWH 3ULUL 4L8SA 2QBWA 2VXUL 1Q0YL 3QVAA 3QO1B 4NO0B 4FERA 4UU9A 1KENL 4L1LA