3TZVD

Crystal structure of an inkt tcr in complex with cd1d-lysophosphatidylcholine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
95
Chain Sequence
QRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEDEYACRVNHVTLSQPKIVKWDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Invariant Natural Killer T Cell Receptor chain A
publication title Lysophospholipid presentation by CD1d and recognition by a human Natural Killer T-cell receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 95
sequence length 96
ec nomenclature
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tzvD00
3BMVA 5K9OB 4NQSA 1DQJB 1FN4A 3KPMB 3OAZH 3MA7B 1SVZA 1UCBH 4MJ6B 4QNPE 1MQ8A 4ONOA 1NEZB 3PQYA 4WTXA 1IBGL 4FFVD 5DJYB 4JKWA 4NN5B 2WBJB 4CMHB 3MR9A 1I9JL 2C9AA 2B5IB 3L3KB 3V52L 5IFAL 5D2NC 3WFCL 2GFBB 4ELKA 2JJTC 1ZLVH 1RZJL 5CP3A 5SV4A 1TZIA 1IAII 5CEXB 3HZVA 3HPLA 1OARH 3RTQD 5F7DA 3G5VB 3THMH 5BVJB 5I16B 4PJDE 1YYMH 5F7LB 5JIPA 4HS3B 3IXTA 4KDWA 4LOUD 2YZ8A 3OKNB 4Q6YA 1RZGA 5AUMB 3GJFB 4RMSA 2C3WA 1DUZB 1FH5H 4YXHL 1A14H 3ZDZF 1UYWH 2YXFA 1V3MA 1BM3L 1X3DA 3CFCH 3GSVA 3PQYE 4LGPB 5L2KA 3OX8B 1CTOA 3BMWA 1CFVH 1D9KC 4P2OB 3D69B 4GQPH 3EOAA 2QADC 3BKYH 4YX2H 1MEXH 5DURB 1DDHA 1OP5K 3HG1B 4HUKB 1JWSA 2WBJD 3LS4L 3PV7A 3KJ4B 1YMHB 1NBZB 2HT2D 4NP4H 1G6RH 3Q48A 5HYQB 3VFNA 2NQCA 1A1MA 2Q20A 3RWGB 4E41D 3HE7D 4N8CL 5HVGB 2A0LD 5DMGC 3L3OB 2QR0B 4KGLA 4Y19B 1H3PL 3MGTB 4ZFFB 3MLUL 4CVXB 3MJ7B 2VDPH 1A3RL 1I8MA 1QQDA 2JK5A 1FDLH 3IAPA 3WNMA 4FNLH 1MFCH 1QKZL 3PP4L 1P5UA 3TFKD 5I73C 1U58B 4NNYB 3MFGB 4R0LB 5L2KE 2BC4A 4CU8A 3OV6A 5CMAA 1MCPL 2MKLC 3U79A 5JW5B 5T3ZD 3WD5H 5K59E 3I6GA 5FYLL 1YNKH 4RMWA 4M8QA 5EWIL 32C2A 4PJFB 3BQUD 1BJMA 1YEIH 4P23A 2Y7QB 2CPCA 5JW4Q 4YXLH 3TBWA 3W2DL 3HG1D 1LDPH 3DX6B 2OTUA 3GMPA 2BNRB 3BAEL 5AD0A 2AXGA 1YNLH 4JDVA 2AKRB 1MVFA 1AJ7H 1Q0XH 1MCDA 4ERSH 4L8DB 3V5DA 5E6IA 5AWNH 2YOCA 5ID0A 5A40E 4Y19D 4KHXL 1CD1A 5EFIA 3OJ2C 2QKIA 2BRQA 1DN2A 5BVPL 1E27B 1J1XH 1JF5A 3ZT7A 1DZBA 2G5BB 5T5FL 4PJGF 2ERJC 3IDMB 4D0DA 1NGYA 2CDGA 3FOLB 3QO1A 5IVXB 3N1QC 4JANB 2PKDA 4PB0H 5GZND 3O6ML 4RX4D 5GGVH 1KIQB 3G04B 4JKPL 1FORH 1CYGA 1VERA 2NW3B 4NKOB 3Q3GA 4JO4H 3BT2H 2P5WA 4NC1E 4WW1B 5AYQA 1BIHA 1EERB 2EDOA 3MODL 5H37G 4YFDB 5K9OA 4WI3A 1DQJA 1RIVH 5MI0B 3MA7A 4PRHD 1CI5A 1A1OA 3SCMD 3QEQB 4K7PL 4G7VL 2BNRD 1NEZA 1T89A 4GW4B 5DJYA 3DUUB 3TV3H 1URLA 4G6JL 2NZ9D 5CSZB 4IDJH 1W0VA 3L3KA 4HUMB 2GFBA 4DGYL 1DBKH 4UDUA 2I24N 4Z7QF 1KFAH 5CINH 4QNPF 1EMTL 5F21B 1CICA 4R7DB 4HAFA 1QVOA 1TDQA 4TQEL 4G5ZH 3G5VA 2EDTA 3PGFH 4U1SB 5BVJA 5I16A 2ZUSA 5IT2H 1RMFH 3GMOB 5DLMH 4Z0BH 3S96B 3G08B 4P49A 3L3JA 3F5WB 4XP9H 2P5WE 4TTGA 1NCDL 3OKNA 1G9MH 3HUJF 3GJFA 5AUMA 1TTUA 1B0WA 1DUZA 2BSRB 2VAAA 3GSUB 3HNSH 3H0TB 1QSVA 1MLCB 5JA9A 4XVSL 4P2OA 3D69A 2E7LC 3MCG1 3FTGA 4X7FC 1I3UA 1F4XL 3TGXA 4U1JB 3HRZA 1ZA3B 1BZ7B 4MMZC 1UZ6E 1GPOL 3GRWH 5T1DH 4GXVL 4F8TA 4ONFH 4YUEH 5IV2B 4K71C 2X4UB 5ID1A 5JHLH 3ZKSD 5HYQA 1CLYL 3DX8A 4U4BA 3SDCB 1UA6L 3RWGA 2YXMA 4JO3H 1MQKL 1A6ZB 3L3OA 2QR0A 1DL7H 3PL6B 3EYUL 1QBLH 1UENA 3MGTA 4WRLA 1N64L 4CVXA 3MJ7A 4X7CC 3BKMH 4I0PD 3QXDB 4K7PX 5IESL 1GCFA 1H3XA 1B4JH 2R0LL 1HYSD 2J4WL 1R5WB 4NNYA 4HXAL 3LB6C 4M43L 5CCKL 1FGNH 3BE1L 2VH5L 3MLPA 4LARL 7CGTA 5JW5A 4YE4H 5EO9B 1F42A 2O5XH 4DKEL 4TSAL 4DW2L 2IF7A 4PJFA 2Y7QA 4H25B 1MH5B 5D1XB 2AEIT 1YY8A 4FQJL 4PJIA 2MSPA 5DZNA 4PV9B 5F7YC 2AKRA 5K59F 3FAXA 4F2MB 2VR9A 4PJAB 5E94B 2MQ3A 4A2MA 3AS1A 3LMJL 4L8DA 3SE8H 3VRLE 4G8FA 4OUOA 3AREB 5ESAA 3BDBA 1OAKL 4HKZB 1GAFL 4RFNB 3D85B 4NBZB 1MLBA 3D87B 3VFWB 1JWUB 1S7WB 2FL5A 2NY6C 1E27A 2G5BA 1LEGB 4M93B 4PYGA 1WWAX 1CDIA 4DVBB 4R4FL 5C3TA 4NC2B 4OGAD 5IVXA 3B3IB 3OR6B 4PJFE 2DMKA 5F9OL 3RY5A 1CXFA 1VACB 3I6LE 3G04A 5GJTL 4NKOA 3EFFA 4AQOA 1CGVA 5DYOB 5D1XD 4QTIL 1RFDL 5TFSH 1E6JH 5IQ9B 1J1PH 4Q9RL 1TJIH 3QEQA 1RUPL 5F7MC 4WHTB 3MXWH 5L8JB 4MA1B 3DUUA 1L0YA 4WU5B 3UTSB 2F8XC 2XZQL 3D2UA 1OGAA 2YD4A 4NN7B 5CSZA 2HJLA 3L7FA 4N0CC 1FNEB 4HPOL 4TTDC 3ARED 3VXNB 5EU7C 1IAKB 4NC1C 1AH1A 1R5IB 3D85D 3Q2CA 4R7DA 3GI8H 1SBBA 4HS8L 2X4RA 4PP1C 5IVXE 3F12B 5INDB 2DN7A 5DC4B 4J23A 4XNUH 1S9XB 3G08A 3HC3H 1JGDB 3CXDH 1ZTXL 4DTGH 2BSRA 3GSUA 1WCBB 3QEQE 1BAFL 5GJSL 3H0TA 4JY4B 1MLCA 3LH2L 4NM8L 4CADB 2B2XL 3H9HB 1OGAE 4KTYA 2IMNA 5KSAC 4U1JA 1AY1L 1MCQA 3QEGH 3T4AB 1LO4H 1IGCH 1BZ7A 1ZA3A 1JRHH 3UTSD 5LQBH 5IV2A 5DMYA 5I1GH 4ZD3H 2X4UA 1TQCB 5IHZB 5B38G 3SDCA 5BS0B 1T89C 1AD9A 5SWSB 1AP2B 3V6ZB 5FYLD 1T7XA 2CO6B 4NN5C 1A6ZA 4YDIH 1S8DB 3H42L 5IHBA 3PL6A 2BFVH 1KOAA 1UZ6F 3P73B 4M6ML 4NDMB 5GRVL 4DCQB 5CJXA 4DAGH 3W81A 4YFLI 1R24A 1C8PA 4R4BA 1CICC 1R5WA 4MA3B 4EUPA 1E4JA 4HT1L 4XC1H 5EU6D 5FCUL 3EYQD 4NQUA 3IYLW 1EO7A 2FGZA 1D5ZB 5C6TL 5EO9A 2VDRH 1KEMH 4CVZB 4TOYH 2E6JA 2D7NA 1ITBB 5CBEB 1T7YA 4H25A 4KUCD 3EJJX 1MH5A 3ZT5A 3V4UL 3S8WA 3ZL4H 2W65B 4JM4L 5CSGA 4ZYKA 2HT4C 4P2OC 1MRFH 5B4MC 3I9GH 3RPKA 4F2MA 2YWZA 3RFZC 4PJAA 5LGJB 3X3GL 3VG9B 5BS0D 3O11A 1YECL 4JPKH 1NEUA 3U0PB 5JA8B 1E4XH 3KJ4C 3F7YB 1OTSC 2VZUA 1MWAA 1IQDB 2PTUA 4Y8AA 4ODUA 3UJJH 1JWUA 5K9KB 1A7BA 4JDZB 3GB7B 5LBSL 3ROLB 1GGTA 1NPUA 4PGCB 1RULL 2D7TH 2OR9H 3L1OH 3VU2A 1LEGA 1CLOL 1Z6JT 2P45B 3F6LA 4NBXB 4TVSa 2DQTH 4DVBA 1JVKA 5CGTA 4LHUB 4HG4K 2D0HA 4UB0L 1ZHLB 3B3IA 3OR6A 1OB1B 2AQ1A 4GKNB 4GG8B 3NCBB 3LHPL 1VACA 4JHWL 2HYMA 2Y36H 3PGCB 4QHNB 3FRUB 4OLZH 4XXDB 1V05A 5DYOA 4ZPVB 2APBA 4OFYA 2CLZB 1BREA 4PJAE 3E2HB 1GVIA 3WIHH 4KZDH 3FZUD 1HINH 3O3DB 1EJ6A 3RIFF 4WHTA 1A7PH 2JB6A 4JFDD 1SY6L 1S5IH 3MRKB 3FFCA 4WU5A 3QCTH 4JZNB 3SDYL 3NMEA 3X12B 1BFVH 3EJYD 4PJHB 4PRPB 1IAKA 5I8CB 9CGTA 5SV3A 4EXKA 1VFAB 4QWWC 5L88L 1G7HB 3P4NB 1FL3A 3K4DA 2QHRL 2OJEB 4KZEH 3IRPX 4R6UA 2VDOH 1YN7A 3FO0H 2PR4H 2FGWH 3O0RH 1FSKB 2R0KH 4XVJL 2DMBA 5INDA 2VLKD 3EJZC 2BNQA 3OKYA 5FOBB 1NCBL 5EC2A 3EOTL 2YSSB 1S9XA 2Z91B 1F6FB 3U7AA 2WINB 4DUWA 4FQCL 5I76B 1JGDA 2YK1H 1F6AB 2G60H 4DUVA 3C8DA 2OJZH 1WCBA 2FECL 4XP6L 2A1WL 4NRZB 2X4SB 3P4MB 2DM4A 3FFCE 4CADA 3PJSB 3W9EB 4PUBL 2BXZA 25C8H 3T4AA 3IDXH 3ARFC 1BBDH 1U8IA 1QBML 3LQZA 5FYLE 3DETD 1F97A 1PG7W 1TJGL 4K2UH 4PRID 5IHZA 2Z93B 3BWAB 2VB5A 1OLLA 4PRPD 5GGTA 2VZVA 5SWSA 1H0DA 5A43C 2AJ3A 3FT4A 3EO9H 1S8DA 1T0MB 2BNQE 1P69B 2VSDA 3P73A 4WHYH 1CZ8L 4NDMA 4DCQA 2QQLH 3CMGA 4HV8B 3FB7A 1B4RA 4AEEA 4GMTH 1IAOB 5I1JL 4J4PC 3G9VA 3K3QA 2FYYA 2HT3C 2K3TA 3P2TA 5EB9A 5DMJB 4RFEB 3V6FB 5HI5C 1NQBA 1F90H 3ECBB 3TJEL 5ADOL 5CEZD 4X83A 2FR4B 3QHZH 3QA3A 4QHUB 2PN5A 3WSQL 3L5XL 3QDAA 1M71A 3WFEH 5D93B 5EZLB 5SWSE 3CX2A 2Y5TA 1L7TL 2ATKB 4KDTA 2VXSL 5I2IB 4OZ4B 15C8H 1A7QL 2HAZA 1MCOL 3NN8A 5LGJA 1SYVB 3RL1B 4XPBL 4HDIB 1IZJA 3IDNB 4POZC 3RJQB 4XTRC 5MEOB 3U0PA 2RBLA 3F7YA 4OI7A 3B6SB 5AEAA 4PD4K 5D96B 4JFXB 5F7EH 3SDCC 2OSLB 2DBLH 5K9KA 4JDZA 3GB7A 3ROLA 1Q8MA 4PGCA 5KVFL 4DKFH 5I30H 4BSWB 3WUWB 4LDOB 1DVFA 3CFBB 3FT3B 1U3JA 1PAMA 4LHUA 5CJXC 1ZHLA 4JN1L 5I1IL 3NA9L 4GKNA 4GG8A 4OLXH 1HNFA 3P4OB 1T1XB 3PGCA 1EX0A 3FRUA 2DD8H 4KXZH 4XXDA 1RSFA 3WN5B 4JLRB 4ZPVA 2AP2A 2P8MA 3TT1L 1G7MB 3EOBB 2Q1EA 5TE6L 3C5JA 4NN6B 3O3DA 4OIIH 1PLGH 2RJMA 1CL7H 4KDVA 4PLKD 2EE2A 3T4YB 5HHXH 4YHKH 3CFKB 4YDJA 4Y5VC 4JZNA 4GOSA 2I07B 4JRYA 3X12A 3MOAH 3NCYP 4PJHA 2IG2H 2IAMB 5I8CA 1B0GA 3F8UB 4NM4L 1UWGL 4X5XB 3U36B 1AIFB 5T3ZH 1G7HA 1MJ8L 1UXSB 5DT1H 1PX4A 2OJEA 1QFWL 1XR8A 4ONGH 4WUKH 3LEVH 1IGJB 3Q1SH 2M2DA 5EU4A 5IQ7L 1CFNA 4XAWL 5C6PB 2YSSA 5TDPA 1WICA 3MTRA 1N3NB 2DTSA 5DVOA 1L7IL 4HQQL 1O5DT 4UV4L 1A6TB 1F6AA 2R29H 4YQXH 2M26A 2A38A 1JWMB 5DQ9A 5HHOD 2YC1B 2ORBH 4J3XA 4NUJB 1I9IH 4MDJB 4NRZA 2X4SA 3H7BB 3P4MA 5CJOH 4Y5XB 5T5NF 3PJSA 2YMXH 4JRYE 3W9EA 2WIIA 1FVEB 4MNQB 1EJOH 2GHWB 4PJHE 2RCSL 4PRPE 4XVUC 1MIEL 4JB9H 3IFLH 4KGJA 4WI6A 1EO8H 4GRLA 4KAQL 2VXQL 1GGBL 5LAXB 4M1DH 2F9BT 1IGMH 4WV1B 1G0YR 2FSEB 4QRRD 4LRNH 3B2UC 4APQB 3ZHLA 4U1MB 4OLUH 4OF5A 5J7CC 4BYHA 2X2YA 4O4YL 4HC1H 4JHAL 4L4VB 1MF2H 1D9KD 5SWQB 1ACZA 4N0YH 4HV8A 4F33B 4Z18A 1IAOA 5DGQA 3O8XD 1A2YB 4OBRA 4XGZA 4O9HL 2ZG2A 4OZGB 4MXVF 4RFEA 3S98A 4HHAB 5T1KD 2I5YH 3ECBA 3MLXH 4NO3B 4TUOA 3FT2B 2HLAB 4AEFA 1LD9B 3T09A 2FR4A 1J1OH 5DMGD 1KB5H 4QHUA 4EDWH 2IADB 4I77H 5C6WH 4KQ3L 5L6YH 5FECB 4FZEL 4MNQD 1BD2B 4HFUL 3R4DA 4V1DB 3BKCL 4K9EL 1K6QH 3N85H 5ISZD 2X9XA 2ATKA 2BY2A 4KUCF 5B8CC 1IT9H 4OZ4A 4U1KA 3EIFA 2XY2A 1M4KA 1SYVA 4RDQF 3RL1A 3QG7L 4HDIA 3IDNA 2ICWJ 4PR5A 5MEOA 2CIKA 3T77B 5E99H 2Z35B 5AZEL 2IEPA 4JFYB 1CLZH 1TQCC 3LRHA 3PF2A 4JFXA 4L4VD 2ED9A 4OI8A 1T20B 2OSLA 3OXSB 4HIJA 5ACZB 5C0CD 2A6JB 4Z8FH 3BESR 4C56B 1UH4A 4BSWA 3QPQC 3CFBA 3BIKB 4JFPA 4Y1AB 3QNXB 2PW1B 4KV5F 5A16B 2E9IA 5KVDL 1OAXH 1YMMD 3GFUA 4KJPD 4RAVB 3P4OA 1T1XA 1C1EL 2R2BB 3WN5A 4JLRA 5JOFA 4L5FL 2CKBH 4RGOL 1BD2D 1G7MA 3DMMB 1OAQH 4V1DD 1IRAY 3EOBA 2R4RL 4EVNB 1LO3L 3T4YA 1A7OL 3CFKA 2UWEB 1HQ4B 1KCVL 4NZJA 1E6OL 1I75A 5FGRA 2IAMA 5FUCE 3KHQA 2PYED 5IR1B 1KTDB 4X5XA 3U36A 1AIFA 3MOBL 1AHWC 1UXSA 3MXVH 4GS7C 2X09A 4KK5C 1I3RB 4V2BA 3RUGA 3UJTH 3G5YB 1FV1B 4XPHL 1IGJA 1IFHL 5DUPH 5IJVA 1LO2L 4NFDA 3SEPA 4OZFB 5ANMA 3ILQC 2CK2A 2BVQB 2VWEE 3O6FA 1N3NA 4HKXA 2A74B 3CH1B 5D8JH 3BRDA 1DVFC 2OYPA 1RU9H 3RGVA 1JWMA 3C9NB 3ZKNC 1SMOA 2VDKL 2YBRB 3MA9H 5HI3C 4MDJA 3BPNB 3H7BA 3FRPG 5IJKA 3QR2A 4Y5XA 5TH2A 1FC1A 4K7PY 5E9DB 4Z7NF 4UAOC 4XPFL 1FVEA 3DI2B 3K2UL 2DKUA 5E5MA 4R4ND 4URTB 4GBXD 3NIDF 4R8WL 1I9JH 5LAXA 1F4HA 2KDGA 1AXTL 4WV1A 1FHGA 5FFLA 5IFAH 3V52H 4RBPK 3WFCH 3C87A 4C4KT 3NA4A 4J3TA 4APQA 3RUGE 4U1MA 3QULB 3FB5B 4PY7B 4R97B 5IHUL 1RZJH 2XWTA 4XCEB 5I66B 4IRJB 4PJHF 5ALCL 3O4LB 2P4AB 4OF7A 2I9TB 5SWQA 3RVUD 4X4YB 1D6VH 5FGBC 1SY6A 1MCKA 4I2XB 4OZGA 1FSKC 4WHYG 4HHAA 2QSVA 2X6MA 2HLAA 4YGVB 4KKLC 3BPOC 3CIQA 2IC2A 3IU3A 4HD9A 4MNQE 4WWID 4QHKJ 5E5RB 1BM3H 2EEBA 1JTOA 2IADA 1Y6NR 4OLVH 1YZZA 3SDDA 3K80A 4ODTH 2D3VA 3QHFL 1T4KB 5F44A 4EZMA 4JQXA 3LS4H 4K8RC 4J3WA 4F15C 5D7KE 5HGGS 4YBLB 2AAVA 1GC1L 1U95B 4P4KD 1HH6B 3PV6A 1KJVA 4N8CH 1TLKA 5IHLB 4GRLC 3T77A 3VFPA 4WEBH 4IRJD 3RVTD 4JFYA 2NNAB 1H3PH 3MJ9A 4P46B 3DURB 3O4LD 3T2NL 2HRPH 1T20A 1A3RH 3OXSA 1Z3GL 5ACZA 4OZGE 4PJ8B 3VWJB 1BMGA 4Y4HA 4C56A 1QKZH 3ORJA 3PP4H 1GGYA 1FYTD 1U2HA 4DN3L 4TVPL 5HHMD 5C0BA 3TBYA 1NUFA 3BIKA 4Y1AA 2EEAA 1N5AB 5A16A 1KT2B 1BD2E 2E27H 1UM5L 2FO1A 1RUAL 5FYLH 5EWIH 3AGVA 1ROWA 4OCLC 5GRZA 1B2WL 3DMMA 4XI5D 2F19H 5TDNB 4KVCH 1Q9LB 1UFUA 3BAEH 4GT7A 4XBPB 5ERWB 4HXBL 4M1CD 2UWEA 4JFZL 1HQ4A 5EIIB 1HWHB 1NSNH 2MOVA 3IDYB 2V2XA 3REWB 3VE0B 2AGJL 4X7DC 4C56E 5IR1A 4KHXH 4NWUH 2VSCA 3LKRB 5C0BE 5I9QB 4HIHB 3DHMA 4D2NA 4EOWH 1I3RA 4L1DA 2P8PB 4Y1AE 3VWJD 2AJZB 1OY3B 1TITA 1FV1A 5E2WL 1VCAA 2F58H 5D96C 3FO1B 3JWNC 4P5MB 3QDGB 4OZFA 1HSBA 4UTAL 5F9AC 4LMQE 1NFDA 4N1HB 3MZGB 5HDBF 4DGIL 5TPWL 2DQCL 3PP3K 1T22A 5HI4D 3O6MH 2IPKB 2X70A 4N0CD 1DSFL 4ZODA 4KROB 4TTDD 2Y06H 1T66D 2XN9B 1U93B 3C9NA 2DRUA 5DSCB 2CR3A 2YBRA 3SJVD 2LU4A 3MODH 2R9HD 3CJJA 2UWEE 3OJDB 5JHDB 5J89A 4PGZA 5E9DA 4K7PH 4G7VH 1BFOB 1YEGH 3VXSA 2WK2A 5CKAA 5GS0L 1FPTH 1Q9KB 4ZDHB 3X13A 1ZLSH 3SE9L 4KJQD 1IAIL 4FQPA 4XNQB 1ZT7B 2H6PB 4PY7A 2CLRB 4XCEA 1EMTH 5EBMB 3C60B 1XFPA 4TQEH 1BZQK 1NFDE 2I9TA 2IAMC 4X4YA 3L7EA 1NMCB 5A2JH 2NTSP 1ZSDB 5KSAD 5FYKL 1NCAH 4LEOB 2ZUVA 3BZFA 4JPWL 4HMDA 5E4EB 4I2XA 4R7NB 3C08L 4MNHA 3EUUA 4KKAD 3VGAB 1T03L 2PTTB 3E6HB 4G80B 4KROD 5CJ8A 4YGVA 1U8HB 4ZTPL 5CJQL 5E9DE 5BW7A 5E8DL 1KCUL 2HN7B 3VXSE 3KLHD 4RMUA 3LN5B 3O6FC 1JRHI 4LPUA 4G6FB 2W0FB 4XNYH 1F4XH 1J18A 3RGVC 1T0NB 1T4KA 1GPOH 5IBTH 1Q1JH 5DHVH 4HUWB 4Y5XC 3HS0A 1U95A 5GGSA 1HH6A 2LU3A 2Z31B 1MQKH 2L7JA 1OCWL 2NNAA 4Z5RB 2FLRT 3QT2A 4P46A 4I2XE 4FFWD 2M8XA 5SWZA 3SGEH 4GRMA 1MNUL 4JREC 3GM0A 4PJ8A 3QO0B 4EBQL 3ULSB 5D7LD 2R0LH 5JR1L 1NGZB 4HMEA 5E2VH 4RA0C 4UT6L 2P48B 4P5KB 5C0EB 4M4RA 4HXAH 4WO4B 5DHXB 2HT4D 4M43H 4UI2A 3FAWA 3BE1H 1YEHL 5CCKH 2VH5H 4WY7L 4LARH 1N5AA 2BK8A 1J5OH 1PZ5B 3GSOB 1KT2A 1JF1B 3V0VA 3WO3B 4NZRH 4TSAH 2BZDA 3LAFA 4G6FD 5KN5A 5MP6L 3N50A 4HEME 3FCTB 2GQHA 2H32H 2NX5B 5IBUG 1Q9LA 1I4FB 1OWWA 5ERWA 2ADJB 2EDDA 1E4XI 3SDDC 1QG3A 2XNAB 5DR5L 3OF6D 4YBQD 5EIIA 2DQDL 5SWZE 3RVWD 2UY7A 4Y4FA 4JQXC 3W9DB 5J13B 3NGBC 2DWEA 4FXGB 5CEZH 4FXKA 3ARGB 4Z0XB 5F89B 3LKRA 3GJEB 4HIHA 1HHKA 3BPLB 1ZT1B 2P8PA 1R3HB 1AGEB 1LEKA 4QRTA 1UADC 2AJZA 5DD5L 4MLSA 1CR9H 1EFQA 2OQJA 2D2OA 3FO1A 3T04D 3QDGA 4R4FH 4ALAL 3KYOB 3S6CA 4N0UB 1CDCA 2VL5A 4XCYA 4Y4HC 1FVDB 2W1NA 5F9OH 2IPKA 4LP5A 1NH6A 2XN9A 4PJBB 1U93A 5L2JB 5GJTH 2H1PL 1YC8A 4WWKC 4QTIH 4F7CB 5JHDA 1RFDH 2C3GA 4Q9RH 1BFOA 1RUPH 1TJHL 5FHAL 3NACL 3KPPB 1U36A 3LOWA 3T2PA 1SJEB 4U1IB 2ZPKH 5EZJB 2DQHL 3RU8L 1FRGH 2DL9A 3MMEB 4M8VA 4XNQA 3WJLA 2H6PA 3PG2A 5E2UL 3ARGD 2ZOLB 3O6KH 4IMKC 5EBMA 3MJ6A 3QDGE 5FM4A 3C60A 3DVGB 4WU7B 1UXWA 5GS2D 4TUJB 5DA4A 4LLMB 2APTA 2HVKB 1ZSDA 1F00I 4LEOA 1SM3L 3ARFD 1DUYB 3GUTB 2XN9E 4Z7UA 4R7NA 5HY9B 1TXKA 3HAEH 1INQB 5E1HB 2PTTA 2RQ8A 3E6HA 4G80A 5JHDE 2O61B 2EKSB 1HIMH 3C8KB 1KJ2H 3CPLB 3LN5A 3R0MA 3B43A 1AO7B 3LH2H 2L7UA 2K7QA 2B2XH 3V0WL 4HJGB 4TVPD 2C3VB 3BO8B 5KVMC 1T0NA 2AJVH 3KPNB 3G6JB 5I74B 4OQTA 4HUWA 4J4PD 3GSQA 4M3JA 4PTUA 2DLFH 1A6VH 2Z31A 3WKMH 5JXEA 4S11A 5J0BA 2XXMB 4X8JB 3VI3E 3BXNB 4LCCA 4Z5RA 3FJTA 4XVTL 4FA8A 3O4OC 4ODSL 3F7QA 2YRPA 3QO0A 1Z9LA 3EYVB 3QUYB 2C1OB 5CD5C 4P5KA 1F3DJ 2R1YB 5CGYD 5T5NG 4WO4A 2HLFD 2F74A 3DJ9A 3IFOB 3NABL 2WP3T 3GSOA 1JF1A 4OLWH 1NGWB 4POZD 5C6TH 4UMGA 3WV0A 2AK4A 4IIQC 1KYOK 5FYJE 2VQUA 3RPIB 3EBAA 4PV8A 1KLUA 3NH7H 3R06B 3JVGA 1Y18B 2X4TB 3FN0L 5BW7C 2AQ2A 5JOPE 3K0WA 2NX5A 2D0GA 3ILPA 3WXVL 3PHOB 1XIWC 2ADJA 4LVNB 4OCWL 4DZBB 2R23A 2XNAA 1YECH 2V6HA 1C5CL 5TQ2L 3W9DA 5TE7L 5IG7B 3DVNA 5JXAL 4PRNB 1E28B 4FXGA 1I8LA 4YBLC 4Z0XA 5F89A 2Z92B 4L9DA 3GJEA 3L5HA 5GSVB 2VQ1B 1V3JA 1ZT1A 2ICEB 3PHSA 5LBSH 1AGEA 4XCFL 1JHKL 4OJFH 1RULH 1GZQB 1INEL 3QUYD 3DARA 2YUXA 1OAZL 1IM9A 3HR6A 1CLOH 1T5XA 5H8DA 5GS0D 4NHCL 4P46C 1Y6KR 4ZUTA 4JGUA 4Y2DB 4CJ1A 2AK4E 1WEJL 5SX5K 4N0UA 4KXZI 3LHPH 3MJ8B 1T2QH 3T0EB 5B39G 4JHWH 5L2JA 2NX5E 4PJBA 3RWJA 4L8BB 3VFVB 4RDQG 1CL7I 5J1TC 1OGTB 4ODXB 5IGXH 3S36L 5DEGB 1I7UA 1MRDH 2XTJC 4PJ5D 3QIWC 4YFEA 5C0DA 4QRSB 1MFNA 3LZFH 3W0WA 2BNUB 1OAYL 1V5JA 3KPPA 3SDYH 1I85C 1W72H 3C6SB 4J1UB 4I13B 4U1IA 1CFQB 3MMEA 2B4CH 3HFML 4JDTL 4QRUB 3VMPA 2ZOLA 5L88H 3JTTA 1PG7L 3H8NA 4P5TC 5E1AA 3DVGA 4WU7A 4Y4FC 1KCLA 3IDYC 1X5YA 4N0UE 4WHCA 4XVJH 5L0QB 1MFDH 4X6CF 4TNVF 2HVKA 2COQA 3CSGA 2YN5A 3SHSA 4Y2DD 2XA8H 1DUYA 3EOTH 5JIKA 1YYLH 4PJBE 1FZJA 2W92A 1WBXB 5HY9A 1S9YB 4FQCH 1INQA 1Y6MR 1G7JB 4IHOB 2Z8VC 3T0ED 2EKSA 3C8KA 2ZUUA 1MCSA 4TVPE 2A1WH 4Y88A 3VH8G 2R2EB 3CPLA 1FZMA 4G6KL 3W0WE 4KMQA 2ZP0T 1AO7A 5D70L 3QPXH 4BSVB 2CMRL 1MFAL 4D9LH 1NKRA 3HI5L 2C3VA 3SKNA 3BO8A 3VGBA 5DJAB 4LLUB 1MRCH 3G6JA 4HWBL 4L29B 4OUUB 4WI7A 1TJGH 4NJAH 3MQIA 5DUBB 3ROOB 1EHNA 5C2BH 1TTFA 4FOMA 4NPYA 5CGMA 5CP7B 2W0KA 4X8JA 4U33A 3BXNA 2EXYC 4I3GA 4PJEB 1RUKL 3OKDB 5E24E 3S36X 5IB5B 4OSUH 3OB8A 1JIBA 5IMOB 4AIOA 3DTXB 3DIFB 5I1JH 3NIFE 1T7WA 2R1YA 2VNCA 1GGCH 3IFOA 3VI3F 3EYOA 3T08A 1AO7E 3AUVA 4KJWC 3TJEH 3FQRB 2VZSA 5F9JA 1HQRB 3QXWA 1NGWA 4MQ7B 4CKVX 1F02I 2FB4L 1VA9A 1KIPB 3G6JE 5IMMB 3VGAC 2FBJL 3RPIA 4J6RH 5ILTL 5C70A 3EAKA 3QFJB 3SKMA 4L4TB 3R06A 2JJUA 1Y18A 2IBZX 5CJBA 1L7TH 3PHOA 3DRQB 2YN3A 1YPZF 4FQXA 1G9NL 4Q6IB 4DZBA 3I50L 5HYSB 5I75C 4XMLL 2BVEA 4WJ5B 5IG7A 3LEYL 4Q9QL 3TP4A 1WTLA 1YEKH 4NZTL 4NO5B 5DD3L 2Z92A 2VTFA 1B6DA 2Z31C 2YRZA 2VQ1A 5JXEC 2ICEA 2IQ9L 1L0XA 5KVFH 2IPTL 2AS5M 2R15A 5H2BB 2AI0L 1GZQA 1HNGA 4LCCC 1GIGL 1X44A 4JG1H 5EU3A 3PABB 3MLRH 1WAAA 4JN1H 1CDHA 1EHXA 5I1IH 5FK9B 1G7PA 5ICYB 1U3HA 3T0EA 4XHJD 3UO1L 5IBLD 5FYKE 4WO4C 5F7KC 5BOZG 4L8BA 3PGDB 4UQ2A 1QUNA 2HMID 1OGTA 1H5BB 4KY1L 1UWEL 1ND0B 3QFJD 1BFSA 5DEGA 3TT1H 3TIEB 1ZLWH 2GJ6D 1AGFB 3FHAA 3RIAK 2BNUA 2WLZA 5J1AB 1EV2E 4WI9A 3V4PL 3JVGC 3C6SA 3TVMA 4J1UA 1XCTA 3RGHA 4JFHD 4NM4H 3JWDL 4H0GA 1T6WA 2HTKC 1RZIB 2J7LA 4MS8D 4AK1A 3MRRB 1IARB 5HI3D 5IFJB 1AXSB 2JJWA 3IJHB 4F7MB 4NNPL 1QFWH 2J8UF 1WAAE 4NFCA 4NQVB 2O5YH 1I8LC 3JWOC 5BRZB 5EOQL 5IQ7H 5D71L 4HCRA 3T0EE 2ZUQC 4LSPH 4ELMA 2WV3A 1S9YA 1TNNA 5CEYA 4QLRA 1L7IH 4HQQH 1G7JA 4DFIA 4UV4H 1MPAL 3VGFA 4H8WL 1BQHA 4J3UA 2VLLB 1MAKA 2QTEA 1FBIH 1KN2L 2A73A 2V5MA 2LQRA 1ZVYA 1LO0H 4BSVA 2Q7NA 3HAEG 1UB5B 4TRPL 1GGUA 3WXWL 1KCSL 3B2VL 5FCSH 5DJAA 2RCSH 1OPGL 2CSPA 4TNWK 2VMFA 4KAQH 1BF8A 1GGBH 4S1DC 1M6OA 3CU7A 4OUUA 4EN3B 2VR4A 1EDQA 4XPTL 1MCRA 5DUBA 2XZAH 3PXJA 5CP7A 1MY5A 1KACB 1XGTB 4XC3H 5EN2A 4UUJB 4O4YH 2VUOA 4JHAH 3WUWG 3U30C 4G8EB 3OKDA 3DYOA 3RDTB 2HTLC 4MX7B 4PRAB 4O02L 4ELME 3IVKA 4AMKH 3RX8A 5IMOA 2R0WL 1KGCD 3KXFA 3NCFB 5E4IA 3DIFA 3ARZA 1D6EB 2IFGA 3QP3A 4ZSOB 1DQML 1O7SA 4LAQH 1SEQH 3W39A 1VPOL 3ULUL 4M02A 1CDJA 4D3CL 3U9PH 3FQRA 3GIVA 1BEYL 4TSBH 4XP4L 3QQ3B 3DGGB 1KIPA 1N2RA 4KQ3H 5IMMA 3UTOA 4HFUH 1QSEB 4L4TA 1NLDH 5EUOA 4K9EH 3U0TA 1KG0B 1OSZB 1JYWA 3DOSA 1BLNA 1K4DB 3DRQA 4LGRB 1NANH 4Q6IA 4MGXA 4OCRL 5TQ0H 3MRHB 3G6JF 3D1MC 4FFYL 4EI6B 1HHIB 1DN0B 4WJ5A 1EEQA 3KXFE 1FAIL 2MCG1 3W82A 1CIDA 1CIUA 4DEPC 3E6FB 4KRPC 1OM3H 3O6LL 3INUL 4NO5A 4P2QB 3AB0B 2BMKB 1MI5D 1PZUB 2EDXA 2XIDA 3HE6A 4HWZB 5HVWA 1G7LB 1WT5A 2DQUH 4WTWA 1R3LA 35C8L 1S7UA 4JZJA 1CF8L 2X89A 3PABA 3L5JA 3GMQB 2VISB 5FXCH 2YPVL 5FK9A 2YPKB 2NY2C 1N59B 2HVJA 3PHQB 5ICYA 3QFJE 4L4TE 1YNTB 5EUOE 3HB3D 4LCYA 2Y1VA 3KWWB 3SPVB 1CD0A 3PGDA 1C1EH 3FO9A 4L5FH 4RGOH 1ND0A 1ZVSB 3TIEA 5DMIL 1LO3H 1AGFA 4MVBC 7FABH 1JZ2A 1BZ9B 4JFHE 2JLLA 5J1AA 1HCVA 4JFFB 1DBJL 3TNMA 4X9IA 1E6OH 2KH2B 5IVZB 3LIZL 3WE6B 5F1SA 5CSBA 4YDKL 1B3JA 3MOBH 4FQXC 1G6VK 1RZIA 2YA1A 3RWDB 3MRRA 1T80A 5F8QC 4NQED 5IFJA 1AXSA 5ENWB 3IJHA 1ZLUH 3DSFH 1EFXB 4JFEA 4OD1L 4PBVC 1IFHH 3VXTB 5BRZA 1LO2H 4NCDA 1S3KH 3KVQA 3IFPB 3BD5A 2WANA 4LLYB 5AYUL 1Z9MA 2NY0B 2F53B 4PG2A 5C0RL 3TO4A 1MFEL 2VDKH 4GW5B 3ZYZA 4X9GA 2EZ0C 5BO1L 2EECA 3B9VA 1NAMH 2UY6A 4F80A 1NBYA 1U3HC 1UB5A 4XPFH 3IS0X 5IM7B 3KDMA 4HKBB 4H20L 4JFFD 1MCNA 4EN3A 1ZK9A 3L3IB 3THML 1P84J 3S4SB 4HJ0D 1PQZB 4IDLA 1KEGH 4JFEE 3G6AB 1JMZA 1RZ7H 1XAUA 5IHUH 3PDGA 4BKLB 5FO7A 5BRZE 3BGFB 4UUJA 3TVMC 4G8EA 3RDTA 4PRAA 1EFXD 3OKMB 1J0YA 3OKLB 4FABH 4F9LA 1FH5L 4R2GC 4QHLB 3ARXA 2EC9U 3CFCL 3VRIB 2AERT 4Y2OA 1RJZA 4HF5L 1VENA 3BKYL 2F53D 5DJ0B 2FX9H 1MEXL 1P53A 1U8JB 1CK0L 1CE6B 3T8XA 3QUXB 4U1GB 1IM3B 1G6RL 1VEOA 3DGGA 3I75B 4NOBA 2R8SH 1WLHA 2ARJQ 3AAZA 5GS2H 1QSEA 3QHFH 3HHRB 1KG0A 2VDNL 3RZCC 1VKXA 3WFHA 2VDPL 2VYRE 3L3DB 1FDLL 4FNLL 2JJSA 2RFXB 3MRHA 1A9EB 3N1FC 1YQ2A 4EI6A 1HHIA 3SGEI 3MBED 3M17A 5TF1L 2DMCA 3E6FA 1BF2A 4PJXB 2HJFB 4K3EL 4P2QA 4OZFG 2WBKA 1Z3GH 4HWZA 4PJEF 1YNKL 1V7NH 1G7LA 2B20A 1RIUH 3DXAB 4N8VB 3GBMH 5IB3B 4K7FB 2RIKA 5F1IA 1WGOA 2VISA 1N59A 2FLBT 1VESA 2BSTB 3PHQA 4UIKL 1YNLL 1QSEE 2GEEA 3HZMB 5CILL 1YNTA 1RUAH 2AJXH 3FQTB 4ZTOL 1BQSA 1T1YB 4YHIB 1Q0XL 3KWWA 3X3FH 2QBWA 4OBSA 5AWNL 3CK0L 1B2WH 1HDMA 1ZVSA 4Q97A 3LKNA 3FQWB 5HJ3B 4LAJH 4LVOB 1HCFX 2BHZA 5J11C 1MCIA 3C2SA 4P3DB 1FFOB 1J1XL 3OGOE 2NY4B 3VXUA 4P2QE 4QCIB 4PJ7A 4DOHB 2AGJH 5IVZA 3HZYB 3D9AL 4S0SD 3GJFK 2WIMA 4KK9C 3AXLB 5EG6C 1U8KB 4Q6IC 4AG4H 3RWDA 4PB0L 4JM2D 3UTTB 1ES0A 1S7VB 3O2WH 5GGVL 4MJID 3O2VH 4WWKD 1YY9C 1BWMA 3S3JA 4JO4L 3DXAD 3P9WB 3BT2L 1Y0LB 4UTAH 3IFPA 1RIVL 2NY1D 4IRSB 4JHBA 4LLYA 4R3SB 3TBSA 4DGIH 2DQCH 3QDMB 3HE6C 2HFTA 1WT5C 4U6TA 3TV3L 2E6QA 4JZJC 4ZFGH 4W70A 3QFDA 4IDJL 4MD4A 3ZKQD 4GW5A 1I1RA 3H3KA 1DBKL 2XPGB 3MNWB 4QKXB 3ZHDA 1JZ8A 3EHBD 4KI5C 1KFAL 4PJCF 3VXUE 4BK5A 5CINL 1YUHB 4U49A 2YS4A 1S7RB 4PJ7E 4YNYB 5IM7A 2PO6B 3CUPB 5GS0H 4G5ZL 3ULUD 4ZOBA 5D6CB 4HKBA 4TN9A 3L3IA 5TJWK 5IT2L 4ETYA 1P4LB 5E95B 1PQZA 3QNYB 4XB8A 1GJIA 5DLML 4Z0BL 5I6XC 4N90D 3B9AA 4GRWB 3UX9B 5HBBA 4XP9L 2P7TB 5D1ZB 3U7WH 4BJLA 1AR1D 1IMHC 3OKMA 1BGXL 3OKLA 2D7OA 3O3EA 3CVHL 3UYRH 4HIXH 3VRIA 4M4PA 1JP5A 3V6BR 2CRYA 2AJUH 1RZKL 1MWAH 1I8KB 3OB0K 3MV7B 3QDMD 5DJ0A 1KJ3H 1U8JA 4YC2B 1T03H 1CE6A 5C9JB 4ZOAA 3QUXA 5T1DL 4ZTPH 4JG0L 4MD5A 1Z2KA 5E8DH 1KCUH 2ENSA 1IM3A 3REVB 5JHLL 4L3CB 4EIZC 1WFOA 1PY4A 5JDJA 2ZCKL 3I75A 1QA9A 2XICA 2H41A 5CIPB 1HXYB 3VCLB 3TO4C 2JJVA 3U2SA 3L95B 2PO6D 5DK2B 4LSSL 1KELH 4JJHA 3BKML 5MENB 3L3DA 1KPRB 5GRJH 3QCUL 5GS1B 3O9WD 4FFZL 1B4JL 4KRLB 2RFXA 1A9EA 4LEXL 2FHFA 1OCWH 3ARYA 3VD5A 1JGUL 3EW3B 1CTNA 2APFA 5E2TH 3MLZL 1XH3B 1JJUA 2AV1A 2HJFA 1HHHA 1MNUH 1QYGH 5FO9B 2O5XL 5ECJE 3JV6B 4EBQH 4I3SH 1TQBB 2CDEB 3MYZA 4UT6H 5AAMA 2CO7B 2Y25A 3RDTC 5IB3A 4K7FA 4F9LC 1YEHH 4WY7H 1MCFA 2VE6B 4FG6C 1GOFA 2XWBB 3HZMA 3FQTA 5IFHL 1T1YA 2LTQB 3G9AB 3PWPB 4KKNA 2YHGA 5MP6H 1QBAA 3FQWA 5HJ3A 1I3GH 3ESUF 1AFVL 5B38B 4P3DA 2FDBP 2LV4A 5MEND 5C2UB 2KZWA 1FFOA 3BGAA 4M1GH 2ICWI 4Z7VF 3QDJA 1IC1A 3QH3B 5DHYB 2DQDH 2R39A 2DJSA 1G6RB 3OKKB 2EH8H 4D9RE 1IL1B 1U8KA 5C0AB 3DXAE 4KRMB 3TA3A 3VXMB 2IH1A 4MJ2A 3UTTA 2ATPB 4C59B 1S7VA 3UTPD 3MGOA 3R1GL 5DD5H 3RHWF 1A6AA 4OF8A 5GGTH 1YEJL 1NBVL 2XTJD 4NKMA 2BVOA 1Y0LA 3CSPA 3SKJH 4ALAH 3AB0C 4IRSA 3PDOB 4O2FB 4R3SA 1E6JL 1J1PL 4J3SA 4LSVL 1ZGLB 2EXWD 1IC7H 5F9WC 1P2CB 3SDXF 2VKWA 2W9EH 1JZ3A 1JNNH 3PWPD 2YKLH 3BOVA 5EZOH 3MNWA 2XPGA 4P5TD 1NLBH 5HGHB 1QHOA 2LABA 1YUHA 2QJDA 5C7XH 1TMCB 1S7RA 1TJHH 3K1KC 4YNYA 5FHAH 3D48R 3BH8B 3NACH 2PO6A 3GI8L 3PE9A 4ZNCD 5D6CA 2BOBB 3PNWA 2AQ3A 4H5SA 2DQHH 4WTZG 3UTTE 2FH8A 3QNYA 3M8OL 5E2UH 3WIFB 3HC3L 1H3UA 4RAHA 4K3HA 3VXMD 2DKMA 2P7TA 1KB9J 5D1ZA 3CXDL 3S34H 1A47A 3LQAC 4BA8A 4LCIH 2B1AL 2DYPB 4BFBD 1J05B 3GO1L 3QDME 2DQGH 1G9EA 2A6KB 2CRMA 1X5ZA 3ALWA 3PWUB 5LWYL 4ODWA 3MV7A 2WWMC 3QEGL 5HPMB 5DTFB 4K3DH 1ORQA 1JRHL 1KF9B 3CDCA 3ET9F 5C9JA 2NYYC 5D2LB 4D0CB 4WCYL 1D5MA 4L3CA 5JQHC 4PFEA 1MCJA 4JY5L 4LCWB 4MQTB 1WTGT 3V0WH 4MQXD 43C9A 1U8NB 5CIPA 4RRPA 4YDIL 3VCLA 2EDRA 4WFFE 5D4QA 4ENED 5DK2A 3GK8H 1AKJB 4GRWE 1KPRA 2OM5A 5F9DC 1PDKA 3ARDB 5GS1A 1N8ZA 3ULVE 3LN4B 43CAB 3BRGC 1QR1B 1OP3H 1CG9B 4YHLL 4FQ2H 4F57H 4XC1L 2DBJA 4NOFA 3MYJA 2KKQA 5I15L 5INCA 2VQTA 4EIGB 1XH3A 3MLSH 3TO2A 2DYPD 1XF4B 5D6DA 5KZCB 1WZLA 4HBQA 2VDRL 3MV7E 1KEML 5FO9A 2H26A 5IVNA 3JV6A 4NKDB 3KLSA 3BGFC 3BDYH 4QRPD 1BX2B 5E0QA 3U4AA 4XNXL 1CXLA 1S5HB 2VDMH 4P3WA 4S1QL 1KXVC 3NABH 1PW3A 5CZXC 5I19H 1JYVA 2J5LB 2VE6A 4ZMAT 3CAFA 3GGWB 1MRFL 1RD6A 3ZYIA 5EZIL 5CZKA 3I3EA 5D7SH 4LCWD 2UVEA 2Q6WA 1UM4L 5MENE 1D7FA 5T3XD 3WLBA 2H8PA 3M45A 5B38A 1I1FB 2AEPH 1CS6A 3UJJL 3NPSB 1S78C 3ARDD 5CS7A 1NL0H 2VLRB 5CZVH 3QH3A 3L1OL 2OR9L 5DHYA 3QIBB 3V5KB 4YAQA 2DQTL 5TQ2H 2ZWLT 4XZUB 5JXAH 1G6RA 3OKKA 3EGSA 1JNHB 3QWQB 1IL1A 3BN9C 3SY0A 5C0AA 4C83B 4FTVD 2GY7B 5BJTB 2Y36L 4NZDA 1JHKH 1INEH 3HKFA 4ZUWA 4PJXF 4NHCH 4JM2F 1NC2A 3VFGL 1WEJH 3PDOA 4O2FA 3WIHL 4KZDL 1HINL 1ZGLA 1AGCB 1CGSH 1P2CA 1IKNA 4PP2B 3L3GB 1A7PL 1EGJA 3MV8B 3MRGB 2I9LA 1XGUB 1BFVL 3SE3C 2DM3A 4L8SB 3S36H 4B50A 1A9BA 3DVIA 2V9TA 5HDOA 2PXYA 3JV0A 4DZ8B 2FEDC 2YD6A 3QISA 4HGMA 2VDOL 1OAYH 3FO0L 2BOBA 2CK0L 3O0RL 4OZHF 3RBGA 5HDLA 2R0KL 5F6HJ 5C0AE 3TN0B 4LVOC 2P43B 1IEHA 3AMLA 5HSFA 4Y89A 1QFWI 3ULUF 1EBPA 3WIFA 1PG7H 1N4XL 4FHBD 2NY4C 5ADPL 4KKCD 1FYHB 2QV2A 2X1XR 1M05B 4HPYL 3RWFB 3TA3C 3PWUA 3OXRB 4H88H 4HZLA 4W4NA 4R90L 3NAAL 4S1DD 1N0XH 2YD2A 1KBGL 25C8L 5HPMA 1BBDL 3RKDD 3MV8D 3DO3A 3RNKA 5D2LA 4IRSC 2NLJA 1IAIM 4K2UL 1X4XA 3Q5TA 4D0CA 4ETQA 2EE6A 1IGYB 4G6KH 3WLWC 1UVQB 5D70H 2FJHA 3T0WA 3EO9L 1MFAH 1U8NA 3HI5H 5JTWA 4QRQB 3AVEA 4WW2A 2NY3C 3X14B 2PETA 4HWBH 5ITFB 2QQLL 1QFPA 2ADFL 4HH8A 1YDPB 1AKJA 5L7XH 4O58L 1NAKL 4YHMH 1A4KB 3HMXL 1I1AA 4GMTL 3LN4A 4NHUB 5I1AA 1HOCB 1QR1A 1CG9A 3ARVA 4LIQH 1CVSC 2WUCL 1QR4A 3OAUL 1XF4A 2VR5A 1Z9OA 4XBEL 2MMXA 2BVYA 2X7LB 5FIEA 1RJYB 3QHZL 4NQXB 1QSFB 3FONA 2IBBA 4ZO7A 5D1ZC 1LE9B 1PFCA 5JQ6H 3ULVC 5D2LE 1BX2A 3UZQA 1S5HA 2CJUL 4XT1C 3HZKB 2BCKA 1V7MH 4UILH 1MCLA 2B8OT 3GGWA 4XNMB 3W11D 15C8L 3MC0A 2X4OB 1P7QB 3MRPA 2FB4H 2OP4L 2R2CA 4AENA 5A2LH 2GT9A 4KRPD 3MFFA 4A6YL 1NANI 1XGRA 5E7FA 1NC4B 1I1FA 2HFGH 4PJGB 5F7EL 2DBLL 4POYA 4OF3A 5J9PB 1G9NH 3I50H 2VLRA 2JCCF 4XMLH 5I30L 3GRWA 2V7NB 3QIBA 3CXHK 3V5KA 3U4EB 2NY2D 4W6WB 4XZUA 3LEYH 4N1CA 1JNHA 4XP1L 3TWCH 3D3VB 3GMRB 2YR3A 5GS1C 3NCJH 4NRXA 5DD3H 3MRFB 4C83A 2IQ9H 4G7YH 4OLXL 3QQ9C 1IQWH 2EC8A 1QSFD 2IPTH 1GIGH 4WFHD 2Y6SD 3OG6B 4ZPTA 4U1NA 4XAKE 3LSOA 2FATH 4RNRB 4U7KA 1H3GA 3A6BL 4QF1A 4AEIH 4OIIL 1PLGL 1AGCA 1CL7L 1IEAB 1J0JA 2OZ4H 3QI9A 1PX3A 4PP2A 3L3GA 4O2EB 3T1FB 3S5LB 5LJYH 3MRGA 3UO1H 1P7QD 1N7MH 4MAYB 1MSPA 4OZIB 4UOJA 3MOAL 3MLYH 3LN9A 4L8SA 5DS8B 1JPGB 5C08D 3GKWL 2VLRE 3FQNB 4LLAA 5T3ZL 5DT1L 2LTQC 1I1YB 3C09C 4AYFA 1F11B 4LKXB 3LQMA 1SJXA 3UJIL 1UACH 3RI5K 3TN0A 5E56A 3V5HB 2X42A 2VDQL 4H26B 5I71B 2GSGB 3HUJB 5D1QB 3I02B 5DO2C 3ZE2F 1PEZA 4WFGE 2DM2A 2N7BA 1EEYB 1GOGA 2R29L 2ICES 5HVHB 3O2DL 2ORBL 1I9IL 3RWFA 2V7HB 1NMBH 5D71H 2VERN 3GBNH 3OXRA 4N5EC 3IKCB 4P9ML 2YMXL 5BXFB 2EIEA 2F5AH 4KUZL 4NRYB 2KPNA 1EJOL 3B9KB 4M3KB 4H8WH 5E8PB 1IGML 5JIIA 4P2RB 3KS0H 3KYAA 5DVLA 4HULB 2GUOA 4BK4A 1UVQA 5EOTB 1FO0L 1IKNC 4NO0B 4OLUL 3RVXD 2P5ED 2XRAH 1KCSH 4P4RB 3T3MF 4D9QE 5HYSG 4R2GD 1OPGH 3AU1B 1A7NL 4LPXA 4HC1L 2EDQA 1DBML 5EOCJ 3X14A 2FWOA 5ITFA 1TPXB 3LKOB 1QSZA 1YDPA 3RA7L 4N0YL 2PXYC 5I1HH 4GJTB 1WWCA 1TCRB 1A4KA 2OR7A 3QXTA 4LQFH 2FD6L 4NHUA 3MOQA 1EIBA 2XQYK 5IF0A 3P30H 5EO0A 1K85A 2IJ0C 2I5YL 4NO2B 2P1YA 3ZTJH 4EJ1C 5BOPA 3C5ZA 3TF7C 1OP5H 5GRVK 2X7LA 3GZKA 1J1OL 1RK1B 4LSQH 1DQQB 4LLWA 4NJ9H 1KB5L 4NQXA 5D9SB 4EDWL 1DQMH 4I77L 1JHTB 1LE9A 8FABB 3RZCD 1FE8H 1SJHA 1X4ZA 4RCAA 5DQJB 3VWKB 3HZKA 3ULUH 1ZOXA 3SO3C 2V5RA 3N85L 4ZAKA 4XP4H 4XNMA 1T1WB 3HN3A 5ELIA 5AG8A 3HPJA 3SE4A 2X4OA 2NXYB 4OTXH 3AS2A 5C0FB 1MCCA 1NC4A 4PJGA 3OKOB 4U6YB 5LG1A 4KMTH 3WS3B 2KBGA 4WW2C 3JUYA 2V7NA 4FFYH 2A6DB 4M5ZH 4RA3A 5GISH 5KVEH 1FAIH 5BCAA 1QSFE 1K2DB 3D3VA 3GMRA 3H9ZA 3O6LH 3INUH 1X9QA 4EI5C 1I1AC 1OAXL 3MNVB 3MRFA 2GIYA 3S37H 1QO3B 4F7PB 2EEDA 4YK4C 3BZ4B 4QXGL 2CKBL 3VWKD 4GAJL 4PGJA 4RNRA 3RWHB 2UZIH 3KPOB 3BUYB 4I4WB 1BHGA 4ZS6D 1O0VA 5DGRA 1IEAA 1ZXQA 1NCTA 3MV9B 3T1FA 4QO1A 3U6RB 2NXYD 2YD8A 4MAYA 4WIQA 1C5DB 4IS6B 4KK9D 4PJGE 5ESQB 2ITCB 5HHVL 4J3VA 4P9HH 5IROC 3T0DA 3W5MA 1EHLH 1YEEL 5DMIH 3FQNA 3I84A 3QWRA 4OD2B 3OHXB 5JW3L 2IH3B 3BIBX 1G7QB 1G9MC 1F11A 4LKXA 4U7MA 5ESVB 2R4SL 5C07A 3VFSA 3RTQB 3D3VE 3UJTL 1KSRA 1FG2B 2B1HH 3ME0A 4B7IA 3V5HA 2C3HA 2V2WB 3LIZH 4OLEA 3HUJA 1K3IA 3NPSC 4Y16B 5D1QA 1UB6A 4M7ZB 4Z77B 4A6YB 3QIBC 5D8JL 4X6DF 4PG9B 1H3TA 1RU9L 1TZHA 4LGSB 2XY1A 1K8DB 1UJ3C 3BD4A 3MA9L 4ZOCA 2V7HA 1LO5A 3OGCB 3IKCA 4Z7QE 5BXFA 4OZIE 5AYUH 4NRYA 3B9KA 4RMTA 3MV9D 4M5YH 4KFZC 3VXQA 5C0RH 2GITB 2X4NB 1MFEH 4P2RA 5DD6A 4NT6B 5C0GB 5KAQF 5C07E 1U91B 5BO1H 5FGSA 5EOTA 4D94A 1KLFA 3QI9C 3HE7B 4NO0A 2W0LA 4E41B 3LRSB 2ADIB 4WVRA 5F1KC 4P4RA 3RVVD 2R1WB 3HLAA 3AU1A 4LPYA 3ZDXF 1KLGA 4H1LB 1P6FA 3HUJE 4Y7MA 3WIHA 4H20H 3LKOA 5IOPB 4JY6B 1BWWA 1TCRA 1D6VL 3EFDL 4F37K 5DK0A 4YIQA 4Y16D 3CFDB 5BV7C 1QZ1A 1KPVA 1T6VN 5EU5B 1TZGH 4RIRB 1KXQE 3N1GC 5E7BA 1S9KC 2BSSA 1RK1A 4XMPL 3QG6B 1FGVH 5D9SA 1F4YH 1KENH 3CNKA 4OLVL 3BQUB 4HF5H 5JDSB 3GSNL 2NY5C 4YHYB 4P2RE 3EO1B 1U8QB 4M61B 4ODTL 4YGAB 5DQJA 3CVIH 1CK0H 4HWEL 5HYFA 5EULV 3QIUC 5CKGA 3FRPA 3VG0H 4ZXBC 1T1WA 1BOGB 4OGYH 4LKCB 3U83A 4ZFOL 1X5FA 4X9FA 3BFOA 1FAKT 4JJ5B 5C0FA 1S9VB 4WUUA 4WEBL 2AVGA 4ORGB 3ZDYF 3BZEB 3QRGL 2VDNH 2FHBA 2HRPL 4GSDH 4WFEE 4U6YA 2J6EH 2HJKB 1HKLL 1JV5B 3HC4H 2Z8SA 3WBDA 1P5VA 5HD8D 4MA8L 1T0PB 4PYHA 2A6DA 5D5MF 5K33A 3C5SB 5TF1H 3VXOB 1K2DA 1FIGH 4E0RA 4K3EH 2EDLA 4LVHB 4K94C 3MNVA 5T1LB 3B9DA 1QO3A 4F7PA 1NCNA 2E27L 3GHEL 4P3CH 1ZHKB 3BZ4A 3C5ZC 5J6HB 1EHAA 4KK6C 1B90A 2F19L 1LHZA 3RWHA 4PRHB 5C0IA 3BUYA 2VIRA 3Q6FB 4I4WA 3KYMB 2X1QA 3NIGF 4KVCL 3SCMB 5ACLA 2AEQL 1QOKA 4L9LC 1IC4H 4UIKH 1RURL 4NFBA 4WUUE 3UDWA 5CILH 4ZTOH 1TVHB 2FHCA 3U6RA 4JPVL 2R69L 1C5DA 4IS6A 5ESQA 1N26A 1YJDL 1NSNL 1RUQL 5B22A 3CK0H 4ZAKC 3F62A 1KB5B 4LF3B 3DX7B 3S4SG 4QOKD 3RL2B 4NWUL 5HHPB 3SE4C 2Q87A 2OS7A 3MUY1 4OD2A 4G9FD 4XH2A 1XF2A 4EOWL 3IGAB 1BIIB 2IH3A 1G7QA 4ZUVB 3BP4A 3RTQA 1AC6A 3KR3H 1U8LB 3WHXB 1FG2A 2F58L 5KJRL 4UDTB 2V2WA 5IB1B 3D9AH 2NTFB 1SJVA 4Y5YC 2DS4A 5IK3B 3SBWA 5T1LD 5HYJB 5HGAB 2RHEA 3KPSB 2Y06L 4PG9A 4WEUD 3IS1X 5T3XH 1WWWX 3MV9E 3WFDH 3NFSL 3KPMA 2QQNH 5E8EB 4MJ6A 1YEGL 4NQCD 4G6AC 2BVUA 2WBJA 2OMNA 3DWTA 1CDUA 1FPTL 2X4NA 4W81A 3DUSB 1ZLSL 1R3KB 4NT6A 5C0GA 5IBUB 1ZHBB 1K4CB 1A5FH 2GK0B 1UKQA 4E41A 3HE7A 4PGBB 3LRSA 4OZIF 1U41A 1BJ8A 2R1WA 3K7UA 4ZFZB 1LK2B 1BQLL 2YA0A 4ONHB 1HYRC 2CKBB 5CEXA 4XNZC 5IOPA 1P4BL 4JY6A 1DJSA 4I0PB 4NCC2 4FP8H 5DWUL 1JTTA 1NCAL 4X99B 4E5XB 3DECA 4Y4KB 4PGDB 4HS3A 3CFDA 1LK3L 4NKQB 3C6LC 1KC5H 3U0WH 4N8VG 5HYJD 5EU5A 5KSVB 3KPSD 1OSPL 5I71C 1BGXH 3S97C 1MELA 4LK4A 3CVHH 4E42B 1J8HD 3WJJA 1CE1L 3OX8A 2EDEA 3BQUA 5JDSA 3V4VH 1RZKH 4XNYL 1EPFA 3EO0B 3EO1A 4M61A 1KTLB 1KB9K 3HG1A 1XGPB 5IBTL 2P44B 4E41E 1JFQH 1Q1JL 4JG0H 1G0DA 3CZFB 1DP0A 1NBZA 1YMHA 1CT8B 5MERB 5HHQB 4LKCA 2ZCKH 3B9KC 4JJ5A 3ETBF 1S9VA 3SDAB 3QSKB 2Q8BH 4F58H 4ORGA 2UUDK 6FABL 4Y19A 3BZEA 3CSBA 4ZFFA 3VJ6B 2YRLA 4LSSH 5IMLB 1Z5LB 1JV5A 3QCUH 3L3HB 3K2MC 4FFZH 5M95B 5E2VL 4I0CC 4Y4KD 4LEXH 1JGEB 1U58A 2AW2A 5T3ZE 4FZ8H 4M62H 3U7YL 1TPXC 1JGUH 2ZCHH 3G5XB 1DTUA 4R0LA 3VXOA 4WEMB 4YHOH 1DANT 3MLZH 2KL6A 1J5OL 2HH0H 4NSKB 4RX4A 4NZRL 3HG1E 4HC1A 1ZHKA 4HUNB 2QHLA 3QXUA 3TZVD 1RZFH 1WITA 5J6HA 1DEEB 1S78D 4PRHA 5JPMB 3DX6A 3MGAA 3Q6FA 3SCMA 3KYMA 1L4IA 2I60L 2DI8A 2BNRA 4ZG1A 3TJHD 3VMNA 2NXZC 4HKJB 1ERNA 2RR3A 1TVHA 4DKDC 4Y19E 5IFHH 1Q9WB 3SDAD 3H9YA 1WWBX 5CEZL 1KB5A 3DX7A 2XOTA 5HHPA 1AFVH 4P59H 3RWCB 3GSNB 3IGAA 4XWOD 1BIIA 1KIRB 3KPQB 1BVLB 3SO5A 4JZOB 1U8LA 2DKSA 2EKJA 3TYFB 1CR9L 1TNMA 4CBPA 1D5XB 4WNQB 3IDMA 2CUHA 3MJGX 5IB1A 4Z95L 5GPRA 4UU9B 4ZFOB 2OI9C 3FOLA 1QBBA 5IK3A 1NFIB 4JANA 2AXHA 1ULVA 4JAMB 1FLRL 5HGAA 1KIQA 3R1GH 3CDFA 4PRHE 2NW3A 1YEJH 1NBVH 2BNRE 3IDGB 2FEDD 4WW1A 2X41A 5FM5O 4M7JL 1GGIH 3VD3A 1DBBH 5E8EA 4LSVH 1MAML 4GW4A 3A0OA 4F3FB 4HW6A 4P23C 4RRPG 3DUSA 1I7RB 1R3KA 2ZPKL 1NGQL 1ZHBA 3F6IA 2GK0A 1FRGL 1WBYB 4FFVC 3UDWC 2X5PA 3O6KL 3IETB 1LK2A 4ONHA 2IANB 1UH2A 5KSBF 5E6IC 1R3IH 3ARWA 4I0PA 4U1SA 1C5BL 5EDXA 5IW6B 3H9SD 4AZ8A 3FL7A 3M8OH 4E5XA 3GMOA 4PGDA 1DQLH 3S96A 4QT5B 1AXIB 3D39D 2NW2B 5DRNB 3RTQC 3KAAA 3F5WA 5EU6B 1KJMB 4LNRB 1D5IL 5F93C 2B1AH 5JIHA 4IOFC 3ZKXB 3GO1H 1HIML 3T2QA 5K9QG 1NCUA 3DLQR 4S1SL 1YEFH 4HEPG 1MHHB 3P77B 1WIPA 1KJ2L 3SBWC 5LWYH 3RY4A 3O3UN 1JL8A 5B39B 3EO0A 5FV2A 5IEHB 3UC0L 1KTLA 2AJVL 4P99A 3OAYK 1OAUL 3CZFA 3UBXG 2DLFL 1CT8A 4WCYH 3RRQA 3X11B 5MERA 4OCYH 1A6VL 2C4XA 4JY5H 3OTTA 1LQSR 3WKML 4W6XB 4KK8C 2DIBA 3ZT6A 2WBJC 4CMHC 5MEPB 1IEBB 5ACMA 2I26N 2HT2C 4G42B 2B5IC 2IAND 3VJ6A 2E9WA 3Q6GH 1U0QA 2A0LC 3L3HA 3QXDA 3BP5B 1WSST 3BGMB 1SEBB 3M1BB 1OL0A 4YHLH 3KYNB 1XF3B 2I25N 3MLVL 4D8PB 4Y8DC 2EDFA 5I15H 3DPBA 4XX1E 4X6FB 1HHJB 4OLWL 1P4IL 3TFKC 5IUSA 2VLJB 1HZHL 2JIXD 3KPRB 4XNXH 5D1XA 3NH7L 4S1QH 3RY6A 5JPMA 3VH8B 1IGTB 1JMXA 4PV9A 4JFDB 1IZKA 4YHYC 5EZIH 5E03A 1ZGLM 5E94A 1Q9WA 1UM4H 3AREA 3ARSA 4P48A 4HKZA 5IW1B 3D85A 3RWCA 3VFWA 1S7WA 5IP4A 3TCXA 3TYFA 2O5ZH 4OJFL 1BJ1J 2VLKB 5J3HD 1D5XA 5DHVB 4WNQA 4UU9A 4OD3H 4ZFOA 5CFHA 1NFIA 3VDCA 1T2QL 4JAMA 2X1OA 4JGJA 2D4DA 2VLJD 4Q0XL 1C7SA 4R0LC 4MAUL 1LP9B 1TCMA 3I85A 3CDGB 1OTUD 3KPRD 1LILA 5IGXL 2NR6D 5GZNC 3VFGH 1MRDL 5DJ6B 5IQ9A 4X0KB 5CAYB 4U6HB 4F3FA 3LZFL 1ZKAA 3UTSA 4YZFE 1I7RA 1W72L 4U3XA 4IJ3B 4PRIB 3TIDB 2FX7H 3SCMC 3FMGH 1FNEA 4CN1A 2CH8A 3VXNA 2B4CL 1WBYA 3STZB 1R5IA 1OTTC 2OL3H 5E6YA 2GJZB 2ZNXA 2FJGB 2EDYA 2H32B 2CK0H 2IPUK 3GMNB 3F12A 2JKXA 1MFDL 2WZPD 3VD9A 1F4WL 3CLFL 5IW6A 2XA8L 1KXTB 1YYLL 4QT5A 1JGVL 2MWCA 2NW2A 2UZYB 2W91A 5EU6A 1N4XH 5ADPH 4K3JL 4YWGL 3B5GA 4LNRA 4G6ML 5DFWH 3QUKB 4LSUL 5J6GB 5GXBB 2H2SD 1Q72L 5D7JB 2UZXB 5KBNC 4HPYH 1EO5A 3QWOB 4JY4A 2ESVD 3FB6B 3KYKL 5BMFH 1QRND 3QPXL 3BP6B 3LPWA 4R90H 3UTSE 3ZKMD 3H9HA 3IXAB 3NAAH 3G5ZB 3VGGA 2MTPA 4D9LL 5B39A 1INDH 4CN4A 1EK3A 1KBGH 2XI9A 1KPUB 3IU4H 3FB8B 1MRCL 1WFNA 1UWXK 1K9TA 5MI0C 4NJAL 3X11A 5DJZB 1M7IB 3CFJB 1KUMA 1MUJB 1J10A 4S10A 4MCZB 5BS0A 5C2BL 4N0FB 2YPLD 1AP2A 3V6ZA 3HC0B 1LDSA 1B9ZA 5MEPA 1IEBA 2CGRH 4MXVE 3ARBD 1CGXA 1A1NB 2C4FU 4OSUL 2ADFH 3QUZB 5GGRB 1GH7A 4O58H 1NAKH 5EU6E 5I18L 3HMXH 3WIIH 1KYOJ 3BGMA 1SEBA 1KCRL 3MX0A 4I18B 4MA3A 3KYNA 1GGCL 2WUCH 1A8JH 2F8VA 3IB4A 2CIIB 3OAUH 4X6FA 4ZO9A 1HHJA 5D7JD 1HYSC 4XBEH 4NQDD 1D5ZA 4S2SB 4KKBC 5F6IB 2MHAB 1ZMYA 4CVZA 4PJ9D 3KPTA 1WK0A 5KAQG 1HILB 5CBEA 5FUZH 2DICA 4J6RL 5ITBL 2CJUH 2J8OA 2W65A 5BS0E 3TPKA 1JYXA 3VH8A 5ICXB 1IGTA 5CWSB 1CCZA 4JFDA 5JW4R 3HAEB 3CU1A 5C09B 4KPHL 2OP4H 4X98B 2H2PC 1EZVX 1EXUB 4EI5D 1AGDB 4A6YH 2BDNL 2Z8WC 1KJ2B 2DQJH 1IQDA 4KV5E 2ZCLH 4KU1A 3VXRB 3KJ6L 1YEKL 4KTDL 4RGND 1W8OA 2YEZB 3QUZD 4JGMA 1HN1A 1X5GA 5DZOA 1U3YA 1RJCA 4NGHH 3PL6C 1NGPH 2CXKA 2VLKA 1CD8A 5DHVA 1WCQA 1L6ZA 4JG1L 2EIZB 5EIVA 1T1ZB 3MLRL 4OGZA 3BW9B 4HMCA 2VLJE 4XP1H 3GNMH 1OB1A 1IJ9A 3RAJH 4O51B 2Y4SA 3N06B 4QHNA 1IGIH 5HHOB 1LP9A 1WJ3A 4H1LH 4JFDE 2CLZA 3SOBH 1RUML 5DJ6A 1RZJC 2CLVB 3A6BH 1B6UA 4X0KA 4AH2B 2PNDA 4D0BB 1I9RH 3ZYJA 3QXVA 3MRKA 5C09D 5LGHH 5D1XC 3MRDB 3SGKA 3TIDA 4PRIA 4QRRB 1KIUA 4PRPA 3D5OF 5KTEH 1Q0YL 5A3IC 5CUSH 2VUYA 3GKWH 5MHSD 3STZA 3LVEA 1VFAA 2CRIA 4LCUB 3VXRD 2VLKE 4N5UA 3P4NA 1JBJA 2VZ1A 3MRMB 2GJZA 4L3EB 3F7PC 2GJJA 4FMFA 5FUOL 2H32A 2QLVB 3AREC 3UJIH 1D9KB 1EEZB 2O5YL 3GMNA 4YZFF 3EDKA 4RFNC 2QADB 1BBJB 2VDQH 5FOBA 3OG4B 2WMPA 3HMWL 2Y5EA 3O8XB 5FM5M 4LSPL 2Z91A 1A6UL 4Z7NE 3TH2T 1LP9E 4JR9H 2WINA 5AZ2H 5I76A 5KSUB 5T1KB 2XKNB 4M93C 5TE4H 2ICWB 2ZSWB 3NIDE 3QUKA 4U1HB 5J6GA 1FNSL 2VLMD 3O2DH 5T33H 4EDXB 1EUTA 3FB6A 2VITB 2EIDA 1FBIL 4KJYB 4GFTB 4RBPH 1LO0L 3BP6A 4BQBA 4P9MH 1XGYH 3IXAA 4YBHA 3G5ZA 4KUZH 4PRIE 4JEGB 1KPUA 3ESVF 3FB8A 5ISZB 3BHBB 4JO1H 5DK3A 2Z93A 3BWAA 5DJZA 1MUJA 4MCZA 2XZAL 5GQBA 4ZUSB 1FO0H 4LHJB 3MCKB 4MA1C 1T0MA 2APWA 4XC3L 4NN7C 5K9QI 4L3ED 1A7NH 4HFWB 3S3PA 3DBXB 1A1NA 1DBMH 5EBLB 4AEHL 4AMKL 5C0CB 3RA7H 1WC7B 3VW3L 1LE5B 2QADD 4QGYA 3TT3H 1VFOA 4CNIB 2FD6H 2Z9TA 5CEZE 4OIBA 1I7TB 4LAQL 5JNYB 1SEQL 3QIUD 4O2CB 1W72B 4LLDB 4ZXBD 3V6FA 4LSRL 3UBXI 3U9PL 2CIIA 3UCRA 4TSBL 4K23L 5F7WC 2J3SA 1YMMB 4GO6B 4X4XB 1JPSL 3LQAH 1UG9A 2DQEL 1HILA 3EYQC 1VADB 4X9BA 5H35B 4N9GB 3S5LG 2EYTB 2RB8A 5L9DH 3VMOA 4MA7H 1NLDL 2Y72A 4UOW0 5EZLA 2X4QB 5CWSA 5I2IA 2JE8A 2ERJB 2WSKA 3HAEA 1FIEA 2AJYL 2ITDB 4X98A 5TQ0L 2XA3A 3M07A 2F54D 1EXUA 3FO2B 3B83A 3TC9A 5C0JB 1KJ2A 2PYEB 3B6SA 4UNUA 2YUVA 5J4MA 3VXRA 1OM3L 3NCMA 2CDFB 3IJYB 2HKFH 2YEZA 2W0PA 3MROB 4MNGB 5H94B 4KK6D 4R96B 1NBQA 3MV11 1CFSB 2DQUL 3WUWA 2V17L 3OPZL 2VZTA 1VB9A 4WI5A 3FT3A 2EIZA 1M7DB 1T1ZA 3BW9A 5B3JE 1I8IB 4IOIB 3D0LB 4O51A 4U2YA 1SYSB 3V9FA 3VFTB 4BUHA 5HHOA 4XB7A 1DEDA 1FFPB 4QXGH 3O41B 4GAJH 2FX8L 4WDIB 4LSDA 4D0BA 1EUUA 1J12A 4E9LA 7FABL 1P6AB 4PLOB 4GBXB 4DN4H 3MRDA 2I07A 4LDEB 3VXRE 1AD0B 4QRRA 2C7UB 5HHVH 4B0MM 2R0ZH 3ARQA 4KDTC 1YEEH 2D03H 5HDBE 2W9DL 3DROB 4LCUA 5JW3H 1UEYA 3VG9C 4L3EA 4RISH 12E8H 3UYPA 3PP3H 1DFBL 2R4SH 3GI9H 3DSFL 3EJYC 3GIZL 2V9RA 2UYLB 5GGUB 1D9KA 1EEZA 5DJ8B 4HK3J 1BBJA 3T3PE 3K81A 2AABH 1S3KL 4LRIA 3O8XA 2VXVL 1REIA 5HHOE 5A1AA 4K71B 4G3YH 5T1KA 3TNNB 1A6TA 2ICWA 2ZSWA 4QTHB 2D7QA 4FXLA 1GZPB 2YC1A 4UZGA 4EDXA 4NUJA 2VITA 4UINL 4YHZL 3NZHL 4KJYA 4I0KA 1NAML 4ELKB 4MNQA 4QRRE 1LP9F 4OGXH 5ISZA 2MQ0A 5L8LB 1TZIB 1X5AA 3HZVB 3E2HC 2FSEA 4BFIB 5C1MB 4P4KB 4L3EE 1A64A 4M7LL 1KEGL 3Q5YA 4ZUSA 2A2QT 1RZ7L 2HFEB 1RY7B 2APVA 1MHCB 4MB4A 2J88L 1T7VA 5F6HI 5EBLA 4L4VA 3STBA 4FABL 3PXHA 4OF6A 5C0CA 2NY7L 4F33A 1RVFL 3EFDH 5E8OB 4CNIA 1FYTB 5HHMB 1A2YA 5JNYA 3GSVB 2X44D 4O2CA 5L2KB 1W72A 3CX5J 3OZ9H 1P7KB 4LLDA 2FX9L 2R56L 4OIAA 4NO3A 3CH8A 5E6ZA 2DIJA 3FT2A 4S0TD 1LD9A 3PQYD 4K55A 4UOW1 4JCMA 1YMMA 1JWSB 2ICCA 4X4XA 4XMPH 3AC0A 4BZ2H 5I17B 5ISZE 4PTTB 1VADA 3GSNH 5H35A 5FECA 2R8SL 2EYTA 2BRRH 3S7GA 4U2ZA 1BD2A 2Z8RA 4V1DA 2NY6B 4XWGH 1ITCA 4HWEH 2ZZUT 4EQ3A 4CVUA 4LPVA 3ZTNL 1FCGA 2OK0L 2ITDA 3LB6D 4UV7L 4L4VE 3LKSB 5HTSA 4MB5A 1I9EA 4L3AA 5C0CE 5C0JA 2Z35A 2PYEA 3QRGH 3CSYB 3IJYA 5D72H 2BC4B 1HKLH 2A6JA 3OQ3B 5DJCB 1NDMB 3UAJC 1V7NL 4MA8H 1CFSA 2XV6B 3EDFA 1RIUL 1MOEA 3GBML 3I6GB 3VI4E 4WGWB 4YJZL 5L2KD 1YMME 3C2AH 4M8QB 4HZAA 32C2B 3QNXA 2PW1A 4LPTA 2WM0A 4PRBB 1I8IA 2WBWB 3FQUB 3D0LA 4RAUB 1RI8A 1SYSA 4V1DE 4RAVA 2AJXL 5AD0B 4Z6AT 4Z7OF 2AXGB 1UT9A 1HXMB 3GHEH 3X3FL 3SJVB 2R2BA 1A7RL 1FFPA 3OJMB 4DWHA 3O41A 5DVKA 4HH9B 4EVNA 2NY6D 1N5YL 3BISA 5B3JF 4WDIA 2GTZB 2AEQH 5ID0B 1EEUA 4NQTA 1P9MA 1RURH 5EIQA 5GHWH 4GBXA 5EFIB 3ISWA 2PYEE 2QKIB 4JPVH 2R69H 5D93C 3WFBL 1AD0A 1T21B 4H1LG 1YJDH 2Q7YB 1RUQH 2C7UA 2JTDA 1MHPH 3QXAB 4PLKC 1F3RB 3DYPA 4OLYH 1W0WB 3WKNA 5FHBH 3DROA 1KTDA 4AG4L 2CDGB 2H9GB 2X40A 4X6CB 3MCLH 2AK1L 2OLDA 5TGBB 3QO1B 2WWKO 3O2WL 1D5BB 4M7KL 1VFBB 1FVCB 3O2VL 2UYLA 5GGUA 3G5YA 2E7LA 3RBSA 5DJ8A 5KJRH 3P0VL 5KSAB 3D18B 5DFTA 2BVQA 5LCVH 4P23D 2CUIA 5FUCC 5KW9H 5FDWB 3TNNA 2A74A 1A1OB 5EBGA 3CH1A 4QTHA 5E8NB 4ZFGL 4KC3B 1GZPA 2IFFH 3VFRB 3T3PF 1W0VB 3NFSH 5GGRY 4MXQC 1DLFL 2V2TB 4PP1D 5E6ID 4UDUB 2VWEC 3K4ZA 2J12B 3WN5C 2DLHA 1CICB 3S35H 1QVOB 4BFIA 4NN6C 5JPNB 4P4KA 2EICA 4YLQT 1AE6H 2BHUA 4C55A 3QULA 1KTRL 3FB5A 3GSXB 2HFEA 4MD0B 4IOFD 5I66A 4IRJA 1MHCA 1BQLH 4Q2ZB 3U7WL 3L3JB 3O4LA 4CRPA 3GSRB 1P4BH 1NMAH 1RJLB 1ZWIB 5DWUH 3UYRL 5DC0A 5D7LB 1UM6L 5E8OA 4HIXL 2VAAB 2EDWA 1FYTA 5ALBH 2P5WD 2AJUL 1F58L 1LK3H 1MWAL 1JNJA 1P7KA 1KJ3L 2DTMH 1PY9A 1CQKA 3ARTA 3QZWG 3FTGB 1OSPH 3HRZB 3BKJH 4JO2L 2DDQH 3O8XC 4LRIC 4KK8D 1CE1H 5I17A 2FO4B 1QLRB 4PTTA 5ID1B 3DX8B 2QQKL 4X5WB 1YPZB 3QHTC 3P0YH 3E8UL 2P42B 2XTLA 2PTVA 1KELL 1CICD 3NVQA 5IJKC 1EAPB 5GRJL 4ODHL 3P40A 4AIZB 3O4LE 3PWJB 4BFEA 3LKSA 2YD7A 1AI1H 2D31B 4WV1C 6FABH 5E2TL 1FYTE 1EGJH 3DURA 4L1HA 5HHME 1NAMB 3CSYA 1OQXA 4APQC 3RIAF 1FFNB 1QYGL 5T1MB 4UBDC 5DJCA 3VWJA 1NDMA 1JZ5A 4I3SL 4ZS7H 3PIQB 3VD7A 2B0SH 3U7YH 4P2OD 4YEEA 5B4MD 5M94B 4PRBA 2YD1A 2N4IA 5DURD 3FQUA 1YY8B 4RAUA 4PJIB 4AY0A 4OFIA 2GW5A 4F8QA 1OTSD 1JCKA 4YR6B 1HXMA 3SJVA 2Y23A 5I1KL 1CGUA 3VI4F 2B4CC 4NZUL 3BVNB 5TDNA 3Q5OA 4HH9A 1I3GL 2I60H 4G8FB 4KJPC 2GTZA 5ESAB 1QNZL 4XBPA 4HWUA 4M1GL 1MLBB 4BFGA 2FJFB 2FL5B 1T21A 2Q7YA 2BVPB 2E8YA 3SKOB 3REWA 3VE0A 3QXAA 2EH8L 1JK8B 1W0WA 2J8UB 1NCCL 2XT1B 3E3QE 3WNKA 2H9GA 4X6CA 5SX5H 4TNWF 1QFOA 1PD6A 3V6OA 5TGBA 5JZ7C 4ZUUB 1D5BA 1ZS8B 1VFBA 1T3FB 1FVCA 2EDBA 5GGTL 1CGWA 4NUGL 5F7HA 4P5MA 5KSAA 3SKJL 4BZ1H 3D18A 3ARFB 4Z95H 3FN9A 3EFFB 5EU7E 1IC5H 5KANG 3SJVE 1A4JB 2W59A 3I6LD 2XQBL 4XX1G 1IC7L 3WDHA 5FDWA 2ARWA 1FLRH 5E8NA 1MREL 5DSCA 2W9EL 1OTTD 1FNLA 4QWWD 1JNNL 3IAGC 4DQOH 3VFRA 2YKLL 2VDLL 5EZOL 4M7JH 3D2UB 1OGAB 3OJDA 2P47B 4MYWB 1NLBL 4O5LH 2HJLB 4QEGA 3L7FB 3WMSA 3AS3A 3OAZK 1QFHA 3VFMB 1MAMH 2V2TA 1CFTB 4OV6F 5C7XL 3EJZD 1L9NA 4ZDHA 1Q9KA 2XFXB 3DMMC 4X6CE 1NGQH 2X4RB 5JPNA 1T83A 1W8NA 4QY8B 3V6OE 1ZT7A 5FOJA 1P9MC 3GSXA 2CLRA 4R4NC 4LPCA 2P49B 3KLAB 4GBXC 4MD0A 4PS4H 1ZLVK 4Q2ZA 3V2AR 3QEUB 3S34L 3V7MA 4I1NB 4LCIL 2X1PA 3GSRA 2VOTA 1KN4L 1RJLA 1ZWIA 2DQGL 1C5BH 1XEDA 5D7LA 3KGRA 2FNBA 1Q94B 4PJDF 1EZVY 3RVUC 4K3DL 1D5IH 2OMBA 3QEQD 1U8HA 3MPCA 2C5DC 2HN7A 4S1SH 5JW4M 2FO4A 3D2UD 1OGAD 1QLRA 3IRZA 4I9WD 2W0FA 1DCLA 3UC0H 4X5WA 1AD9B 3T1WA 1YPZA 4U6XB 1UGNA 3BPNC 5ETUB 1OAUH 1PGRB 1SQ2N 3GK8L 1I3VA 3NFPB 1EAPA 2HT3D 1G1YA 4XXCA 3H3PL 2E3VA 5HI5D 4AIZA 3OF6A 3PWJA 3QUMH 3P9MB 4OB5H 2D31A 1R24B 4FQ2L 4F57L 4R4BB 4KKBD 4JVWA 1WZ1L 5D7LE 5IB4B 2C26A 3MLSL 4P4KC 2E7BA 4WTZA 4EUPB 1NAMA 1EBAA 4TYUA 2K7PA 3BDXA 1U6AL 1FFNA 4YDLB 5T1MA 4R97C 3ULSA 1NGZA 4IRJC 3BDYL 3RVTC 1HK6A 2HG5B 4U6VH 4QXWA 5JO5B 3PIQA 5C0EA 4GMSL 1D3CA 3MLVH 2VDML 1FC2D 4Y5VB 5DD0H 1ADQH 5I19L 1PZ5A 2H2PD 4DGVL 5BV7H 4XTRD 1VGEH 1P4IH 4LLQB 2OCFD 1ZA6B 1YPZE 4OCSH 1HHGB 4V2CB 4ZYKB 4W6YB 5D7SL 1HZHH 4YR6A 4XPAH 3SDCD 3O11B 1LVEA 3BVNA 3FCTA 1EVUA 4TULH 4PJ5B 4NYLB 2NY5H 1I4FA 3PL6D 2AEPL 5E00B 1MWAB 2MNUA 3OBAA 4YPGB 3DVFA 1U42A 3LPFA 1NL0L 4ODUB 5CZVL 2FJFA 5F96L 4K8RL 4XI5C 4ZO8A 2BVPA 4PIRF 3SKOA 5EORH 1OW0A 1JK8A 1CU4L 1ZT4B 2J8UA 4M1CC 3ARGA 2L0DA 3N0PB 4EKXA 2EYRB 3DUHA 4ZUUA 1R3HA 3U48A 1ZS8A 1OHQA 1T3FA 4CL7A 4OFPA 2ZG1A 4OFKA 5HGBB 3ARFA 4PJIE 3V7AG 2VL4A 3KYOA 3EYFB 4PJ8C 1WQVT 3VWJC 3KG5A 1A4JA 1CGSL 1FVDA 3E3QC 3BEWB 5GGQH 3EYSL 2G75B 1QACA 3W5NA 5A3ID 4Q0XH 5A2IH 5MEQB 4K94H 2JB6B 4MAUH 4GKOA 3FFCB 4KVNL 1MVUB 4X7SH 5HI4C 4F7CA 4KTEL 1C16B 2ZJSL 3VFMA 1MIML 1T66C 1CFTA 4JQIH 2RGSA 2V9QA 2O93L 2J8UE 2R9HC 1FL3B 2XFXA 4J4PA 2X9YA 1SJEA 3QCVH 1YN7B 5EZJA 4QY8A 4BH7B 2LAGB 1JZ6A 2BNQB 3KLAA 5EC2B 1AQKH 3QEUA 4TUJA 4KJQC 4LLMA 3SQBA 1N6UA 4RGMB 1F4WH 3CLFH 3GSWB 5KOMC 1UJTA 5I9QC 4XVUD 1C08B 4H88L 3GUTA 2WLYA 3V6OC 1Q94A 1JGVH 4OFYD 1N0XL 4RMRA 1GOHA 4K9EC 5B8CB 4K3JH 3G6DH 4YWGH 1RPQA 4G6MH 4RWYH 4LSUH 2P24B 3WNNA 3B2UD 4I9WE 1Q72H 3CD4A 4GLRH 2O61A 3H3BC 1U8IB 3KYKH 3FFCD 3LQZB 1F2QA 1JI2A 4KKAC 4HJGA 4KROC