3TZVD

Crystal structure of an inkt tcr in complex with cd1d-lysophosphatidylcholine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
95
Chain Sequence
QRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEDEYACRVNHVTLSQPKIVKWDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lysophospholipid presentation by CD1d and recognition by a human Natural Killer T-cell receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Invariant Natural Killer T Cell Receptor chain A
total genus 13
structure length 95
sequence length 96
ec nomenclature
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tzvD00
4D0DA 3DOSA 1TVBB 4AENA 3VGHA 4OUOA 1DL7H 3QUMH 3RKDD 2HKFH 5I66A 1KYOK 1S7SA 4C56B 1UB6B 3FOMB 3CMGA 3FO2A 2I26N 3EYSH 1N3NB 2VDKL 2F19H 3LEXA 3TCXA 4Z7VE 5ITFA 5E8OB 1X7QA 2FYYB 5GGQH 5C2UB 3S34L 5JA9A 2EDBA 1K8DA 2DKMA 4M61B 4G7YL 2XZQH 1KPRB 1FBIH 4LHUD 3EGSB 3QO0B 4LSPL 1INDH 1X5IA 4NKMA 3V4UL 4I4WA 2CRMA 1G7QA 3OGOE 2R0KH 1NBZA 4H8WC 2DM3A 4KHTH 3KLAA 5EUKB 3VWJA 1MAMH 1JUFB 1KTDB 5F3BA 4W70A 4X5WA 4M7KL 2DTMH 2GY5A 1MUJB 4OKDA 4UILH 4YE4H 2VZTA 4WDIA 4GH7B 4HXAH 4N1EA 5DZOA 4PGJA 3D6GA 4HUWB 5DS8A 4OT1L 3IDUA 2IEPA 5L2KA 4Y5XA 5F8QC 3VI3F 1TLKA 3HUJE 3KPSA 3MGTA 1RIVH 3KHOA 4XWGL 3QIWB 3GSRA 5L7XH 2BDNL 1CXHA 4HIJB 4LSSL 3SQOH 3U4BH 3UTOA 4F57L 2VXVH 4NPYA 5I1GH 3IKCA 3EOBB 3O81A 3QFJE 3ULVF 4FFVC 4ELMF 3LIZH 1RK0B 4R96B 2H8PB 1PQZB 1Q0YH 4F7MA 3PDGA 1I3VA 4Y4FD 1LO5B 4JQIL 4UQ2B 3O2VH 5ICZB 4XBGA 2ORBL 4LCIH 5C3TA 1FLRL 5MEQB 1F4XH 5L9DH 2GTWB 3BRGC 2Q87A 1X5AA 3LH2H 2XPGB 5L0QB 4G8FB 4LHUA 1V3LA 1R5WA 5F7MC 2A73B 4H0HB 1AGCA 3NN8A 4PTTA 4HH8A 3HB3D 3EO9H 3NVQA 5KSAD 3C2AH 1Q9OA 1QLRA 1IGIL 4QRRE 3HMXH 3VFSA 1ADQA 4JFZL 1FGNH 2ADIA 4QY8B 3UYRL 3VDAA 5DJXB 4PRHE 1KNOB 4F7PA 4OF3A 2NTFB 1GL4B 2FIKA 4IIQC 4OZGF 3ARTA 4EBQL 4PRDB 1F3JA 2P43B 1P53A 2H2PC 2NXZC 2D4DA 2F53B 2C1OB 1LVEA 3W9DB 5DEFB 4FABH 2PNDA 3MRIA 2ITDA 3OXSB 2C3HA 2EXYC 4N5UA 4MNGB 4X0KB 3ZDZF 1F58H 1G7PA 3MJ7A 1JYXA 4R96A 1R5VB 2ZUTA 4NJAL 4P57A 4FOMA 4RGOL 5KVDH 5I8OL 3QAZC 3ZE1E 5C0AB 3FO1B 2A9MH 1KN4L 3HG1E 5AUMA 3U30C 4ZAKC 4XWGH 1B2WH 3MX0A 4XPGL 4KI5E 3O3AB 1NGQL 4OD3L 4D0BB 4KQ3H 1FH5H 5ACMA 1EEYB 4E41D 1LD9A 5IVNA 4JFDA 4JFEB 2IGFL 3AREC 3ULUE 4IMLA 1YEIL 5F7EL 4AG4L 3C8KB 4I0PD 5KZCD 2FB4H 3P4NA 1I3RA 2IPTL 2QADC 3HE6A 3PWVA 5ISZD 3SE4A 4D9QD 5E08H 4NJ9H 3EZJB 2XWBB 5DVMA 4JFDE 3RAJH 5CSGA 2F53A 3WFDL 3NPSC 4BK5A 4F9LA 4OGZA 3BEWB 3HRZB 4PJ5D 4KHXH 5ISZE 3IDXH 1CE1L 4IRJA 5MP6L 4HFUH 1JHLH 5H94B 4KTYA 3V6OC 3BH8B 3PQYA 1KCSH 2GTZA 2V5TA 4XNUL 4APQB 3AROA 1GXEA 2HT4D 4G5ZL 2DYPA 1UWXK 3FO9A 3ZTNL 3D0LB 1KB5L 3EJJX 1REIA 5KS9F 1MREL 2XPGA 3RUGB 4Q9QH 2SEBB 4FQIL 3VXOA 1HHKB 3QPQD 1MAKA 1JV5B 4Z76A 4XTRD 5J6HB 1N59B 3MRHA 3I6KA 4PB0H 3EO1A 3VJ6B 2DI7A 3DO7B 2WUCH 2OX5A 2VAJA 4M48L 3B2UC 2ED8A 3RVXC 2W9DL 4I48B 3BO8B 3TBVB 3DX6B 2D0FA 2CLVB 4TTDC 3SE3A 3VMOA 1RJZB 3RUGE 4ODSH 2XN9B 5HVFB 1CXFA 4LGSB 3ZKNC 4QXUL 1KJ3H 3D39A 1AO7B 1ONQA 5EU7E 2G2RA 3WUWG 2GT9B 2NW2A 3OBAA 5CEYA 2IQAB 2VLLB 4YBQC 5EU5A 3WXWL 1EEQA 1YA5A 3F7PC 3LQAH 2NX5D 1AHWB 1DZBA 3KAAA 2PCPA 4WFHD 4N8VB 5E1AA 3QWRD 5SV3A 4XP1L 3PGFL 5IESL 4G3YL 5DJZA 2P45B 1YJDC 5IW1A 3RL1B 3BRFA 5FHBL 4LVEA 4NQVB 2V5YA 2R1XB 3ARXA 1P4LB 2FO4A 5MI0C 3LQAC 4MYWB 1GIGH 3QIBC 3INUH 4X4MA 2FEEI 3IFOA 1C5DA 1I85C 2ZCLL 3IRZA 4XCYB 4YXKH 1G6RL 1KV3A 5DO2D 3TFKC 4I77H 1G7LA 1FG2B 3AXLB 4KROD 4LEXL 4H5SB 2WZPD 2VDML 1A7BA 5DJ0A 2NPLX 1OPGL 4L8DB 5DT1H 2YBRA 1IM9A 1U8QB 4HIHB 1ZA6A 4XRCA 5TE6L 3P77A 1AGDA 3QBTB 3RP1A 4ODUA 3H9ZA 3PG2A 2RFXA 1LWRA 2VL5B 3MRQB 4NBZB 4IRJB 4IOSD 4M43H 4J1UA 4RMVA 2DQUL 3GMMA 4FFZL 4OLXH 5GGQL 4FZEH 3L3HA 4N9OB 1RUKH 3RIFK 1U3HA 2IG2L 5CBAB 3QCTH 3QEUA 5JR1L 1R3JA 2AK4D 5BZDA 3MBED 5HYFA 2WBJA 3BWAB 3IAGC 3WKNA 1Q1JH 5CINL 4BA8A 1DBKL 3BGMA 4EIZC 3DUHA 3GMLA 5CHNB 2AXFA 4P2RE 1I1AB 4P4KC 3BHBA 1MRCH 2P44B 3BH9A 4RIRA 4P9HL 1ZWIB 4EVNB 4NC1C 1JGLL 8CGTA 4GRMB 3EJZD 5DEGA 2MCG1 3H3BC 1NFIB 3HCVA 4U6VH 5D93B 3VH8A 1BZ9B 2VXUH 5T1KB 3FB8B 2GK0A 5KANG 1NL0H 4RDQG 3KYNB 1GGCL 4XVSH 4HEPG 1I8KB 3TT3H 4JO4H 5C0NC 1NKRA 1XR9A 4ODWB 2YUWA 1H5BB 1U8PA 1OAQH 5IB2B 1WWAX 3QNXB 4DN3L 1IEAB 4U6YB 4NPYB 4X4ME 4I0PC 4KKLC 1J1XL 4BSWB 1MVUA 4UINH 1JPTH 1IC5L 5GZOD 3V5HA 3QIBD 3KG5A 4YPJA 1J5OH 2JB5H 5F6IC 4ZTPH 2MMXA 1OD9A 3PWPD 1CLYL 2JB6B 5CWSA 5DMKB 4MAUL 5A2KH 2UYLB 4KJQC 1P1ZA 1TJGL 5CMAA 1CFBA 2R29H 3FB5A 1SVCP 4PJXF 4UQ3B 1EGJA 5LJYH 2QSCH 2BOBA 2FYYA 1J0KA 1VCAA 3CSGA 3MRPB 3QDMB 3QXWA 1WITA 1OSPH 1BJ1H 1NC4B 4NQEE 1FO0B 1FFOA 4V2CB 4WJ5B 4W4NA 3DX9B 4XXCA 4FG6C 4OFIA 1HQ4A 4LDEB 5I18H 4ZXBB 1UKTA 4OF6A 4I4WB 2CKBA 5HHOA 1K2DA 1UM5H 5ANMA 1D9KA 4BQ6A 3T04D 1D5XB 2X4TB 1CK0L 3IT8D 4Y1AB 2DQGL 4PGBA 2APXA 5HHXL 1TJIL 3WUZA 4HPYL 1MIMH 3QXAB 2CK0H 1NC4A 1HHGB 4XNYH 1D5BA 2CXKA 3HNTL 2DQTH 2W0FA 5DD5L 1LDPH 4Y88A 4U05A 1KCVH 1CFVL 2XTJD 3ROOB 3C60A 4LF3A 3QNXA 2IANB 5DC0A 2X4RA 4MZ3A 4RFNB 1ZVYA 3T0EB 1MEXL 2VWEC 3RBSA 4DN4L 5I8OH 4JRYB 3Q1SH 5F7WC 1OAQL 2ZP0T 3O8XD 1JYNA 2X4SA 1H3VA 1TTUA 2BRRL 2PXYA 5DHVB 3CXDH 3UTTB 4WHYH 1KJ2B 4OD3H 1FHGA 4TTGA 1J11A 4PB9L 4KMTL 2ICWJ 1PGRB 4JLRA 3VI4E 5B3JE 3ZSSA 4DKAA 2OSLA 1S7RA 4CKVX 4D94A 4PGCB 4PRPE 5JIHA 2VB5A 4MHHG 3ZHLA 4Z77B 1AJ7L 2ZKHL 3NIGE 3UTSB 4ZXBA 4IS6B 1RZJC 4H0GA 4M8QA 2VDNH 3B9EA 2GCYB 4MLSA 3DV6A 3DGGA 2V2TA 4XPAH 3DMMD 4FHBD 3JTTA 2VLKE 1B88A 2I07A 3QIUB 3ARDB 2VZOA 4YK4B 4APQA 3O4OB 1KSRA 5CEXB 1RZ8B 4Z7UB 3ES6B 2ED7A 3EDKA 4LASL 1DFBL 4DFHA 2CJUL 2RCSL 3GNMH 2X42A 1OHQA 2N7BA 4FQQB 3ARGA 1HEZB 1VEMA 1K4DB 3DRQB 4GBXB 4P2QB 3P9WB 4JY6B 3SDCA 3RNQB 1QZ1A 2PETA 4FNLL 4JRXA 3O9WA 2MWCA 5H8DA 4OZFB 3K4DA 3WMSA 4D0CB 4FQIH 2R2CA 2YD8A 4PRAA 4EXKA 5I73C 5JW4R 4PJFE 1A5FL 5HD8D 2JK5B 1GGYA 1QFWM 4RMRA 5JPNB 3O41A 5D2NA 2Q76B 2X70B 3OTTA 3BPCB 2ZWLT 2EDDA 4CVZB 1HH9B 2CLZB 3QUZA 4ALAH 3NTCL 3Q5YA 1PX3A 1MFCH 1EFQA 3QDGE 4FQHA 4M5ZL 3RX7A 4WI5A 1BOYA 3RWCA 5C0CD 3QNYA 5DC9B 4PREB 3GI9L 4YUEH 3VFWA 1OTTD 1C1EH 1F5WA 4Q9CA 2M8XA 2YKLL 5ESQB 1M05B 1AJ7H 1I1YA 1JUFA 5GSVB 5D7LA 4Q9RL 3BO8A 2WBJD 1UZ8A 1XF4A 4NUJA 3TT1L 1AR1C 4K3GA 4D8PB 4PJBF 2BHZA 1NCAL 5ETUB 4MHHI 1YJDH 3MRQA 4LLVA 5TDOA 1F00I 1IAII 1MCRA 2NY4B 3GMNB 3MRNA 4N8CH 4UT9L 3FRUA 1QO3A 1G6RH 4OF5A 4YDJA 3G08A 3VFOB 2KKQA 4P2YA 5C0BE 4OUUA 3S4SB 1CIUA 1KCVL 4I3SL 2DTML 5JPMB 1WGOA 3QA3B 3WFEH 1LP9B 1KXTB 3ARSA 5ICXB 4XI5C 1KCRH 1G9MC 3FJTA 5D2NC 5T1MA 1VGKA 2Z91B 1RULH 3EOTL 1HHKA 3EAKA 4M8QB 1RFDH 2VDOL 3DURA 4Z9KB 4LNRA 3OX8A 4HG4J 2JIXA 4NP4L 5DZLA 1Q0XH 5JLZB 3PWPA 3IFOB 1TCMA 3W9EA 1WVZA 3SO3C 4OF8A 1P7HL 4M6OL 5HHNA 4N0YL 1BQLH 1OF2B 4O2EB 1FIGH 1E4WH 5D7KD 3RGVB 4BFBD 3T2PA 1JNNH 3CVHL 3STZA 5JIKA 2HH0H 3EO0B 3BD4A 2VLME 3TGXA 4HFWA 3ARGC 4XRCB 1SY6L 4RMTA 2NY3D 5DI8A 4XMPH 3K4ZA 4K2UL 3G5ZB 4XP4H 4F3FB 1FLRH 2A6DB 3U0WH 1DBBL 1JFQH 2ZKHH 3WNKA 2GSIA 1H8OA 3C5JA 2EIZA 3D39B 4MXVE 4JFFE 4POZD 4G7VL 2P8PB 3LZFH 2ZSVB 1F8TL 5JHDD 4HWZA 4LSUL 5DK2A 2LVEA 1XGYL 3O45B 3OXSA 3HE7D 5E8NB 3V8OA 3RX8A 1QO3B 2PTVA 3ULSA 3EO1B 3VJ6A 5IMMB 4OZIE 5LWYH 1FYTD 5HVHC 5T1DL 1OWWA 3CX5K 4P57B 1U8NB 2E7HA 3QCVH 4HF5L 1A64A 4NRXA 4LU5L 5I1GL 4U1JB 2G75B 1Z3GH 4PJ7E 3CC5A 5DRZB 1LO4H 3RWDB 1BFOB 1ETZB 4HXBH 4G6AC 2BVUA 2IALB 4GO6B 3WFBH 5HYJE 3D0LA 2I27N 3MUGB 3PWNA 3KPTA 1U0QA 3OJDA 5C0JA 1ZHNA 3SKUD 3C5SB 2VLKA 4X99B 5IKCA 1XF4B 3MCKA 3MV01 4PJ9C 3VFUA 4WI7A 4MNQB 3KJ4C 4U1JA 4CNIB 3HAEB 2FL5B 3NCCB 4XH2B 2HT3C 4OJFL 4FQ2L 1A14H 1X6NA 1MCCA 3VFTB 1WV7T 2WW8A 2EDLA 4GW4B 1NAML 4WUKL 1MI5E 3HNVH 1IE5A 5T1LB 5I18L 1NL0L 2F8XC 4RBPK 4IRJC 4P2OC 1UH3A 4ZQKA 2GUOA 3P0GB 4KZEH 3U4EA 1JVKA 1NBYB 5SWQA 3QQ9C 3PQYB 4NCC2 2FD6L 3S88L 1JWSB 1MI5A 3NH7L 4PJEB 5GGVY 1SHMA 1WFNA 3AFLA 5CEYB 3VW3L 4ZUTA 3FB8A 5IEKA 4C56D 2VO5A 3BW9A 1BWWA 3MLWL 1MUJA 3TYGH 5MEOB 4FA8A 2GJZB 5JW4M 2X4RB 1ZVSA 2DJ4A 3FMGL 4ZSOB 1QFWH 4H8WH 3THMH 4ZMAT 2VL4A 4WFGD 5GGSA 3WJLC 4CRPA 5EBMA 4HCRA 5E2TL 1IM3B 1FP5A 3ZT5A 4PRHD 1X5HA 1OL0A 1ZT7B 4YIQB 4L4TE 3U82B 4ZAKA 3QWOA 3DJ9A 2OZ4H 5DJ6A 2AEQH 1CLCA 5CD5C 5DHVH 3GJEB 1EVUA 4U1KA 2BVYA 3FFDA 4PP2A 3GIZL 5C0ND 2VXTL 5HHMB 1QRND 3ARFC 1UWXH 5GHWL 1HSBA 1XGUA 2W65B 2F8OA 1A47A 1EPFA 1DVFC 4MVBC 2JJTA 3I02A 3TBYB 5I8KH 4K3JL 4NRZA 4LRIA 3BIAX 1FL6B 4Z0XA 4XVJL 4FTVA 4LBEB 3WSQH 5DA0B 1OTSD 2A73A 4BQBA 4S1SH 4HAGA 3F7VA 2BOBB 2NZ9D 5FUCC 3UTTA 2HRPH 1OTSC 5GJSL 2V17L 4G9FB 3LB6D 1N7ML 4KRLB 2VXQH 4YDVB 4XNMA 3SDAD 1KJ3L 4GG6E 3DPBA 2EE6A 1HDMB 1ZLWH 3HC4L 1U93A 1F3JB 2P8LB 4PJFF 5ENWA 1S7XB 1WZMA 4HCRH 1NCTA 4WFED 5BRZD 2ADGB 4ELMB 4OCSL 1MCBA 2IC2A 4CMHC 2VITB 2NNAB 1ORSA 1IFHH 4Z7WA 3QHTC 3KNBA 1L7IH 4EN3D 3CLFH 3O6KH 3IETA 4I0PA 1N0LA 4PG2A 1KELL 4MA8H 1RIUL 3OAUH 3C09B 3TBWB 3JWDH 2VXSL 2X70A 4JG1L 4QRPE 2BSED 1I9IL 1X4ZA 1T03H 4I8DA 1A4KB 4POYA 4X83A 3WIFA 3WE6B 2BERA 4O2CA 5GRXG 2W9EH 4BZYA 3IU3B 4M1DH 3F7VB 2OQJB 5HPMB 4EQ2A 4YNYA 3AAZB 1CFQA 4F15B 1GRWA 3CFDA 3BP5B 1D5IL 1SJXA 3SJVB 1J05A 2DQEH 1H3WM 5I1EH 3WXWH 4LPVA 2V7NB 4M43L 2EDYA 3H7BB 3NFSL 5FKAB 3FAXA 5B8CB 3MRMA 1F4AA 4ZFGL 25C8L 1A3QA 4F58L 2Y6SD 4TRPL 1AQKH 4EOWL 4IMKC 1IGTA 3QCTL 4ZAKB 5DD1H 2NY7L 3GMQA 1INEL 2RHEA 3QEQE 5K93A 5C0AD 4L4TA 3SJVA 4AZ8A 3HZVB 5DJAB 3BOVA 4A6YH 1Q9KA 4PBWD 3AVEA 3QG6A 4L8BB 1FV1B 1MRCL 2VZ1A 3QUXC 3VG9B 3RVXD 1KCUH 2JCCF 2NY2C 3DSFH 2IMMA 5DT1L 4KI5F 3TNNA 3I6GB 1EJ6A 2J1KA 4I0PB 1U91B 1RUAH 1EUTA 2BK8A 1J1PL 2ATKB 4NKIL 3LQMA 5F1KC 4ZS7L 4KJWD 5ERWB 2ERJB 2C3VA 1CFNB 1I9RL 3RRQA 4JKKA 4DTGL 5HSFA 1HOCB 2X4OB 1A3RH 3QDGB 3SDDB 3WYRA 1GC1L 1N6QL 3LKSB 1WFUA 4FQ1H 4NO3B 1TTFA 2M2DA 2PKDA 2WLZA 5IP4A 2AAVA 4HWZB 4I9WD 5DK2B 1VHPA 1LO2H 2EICA 1DBJL 1KYOJ 2J8OA 4IJ3B 2IQ9L 3CK0L 1GGIH 3MJ8A 1BBJA 1YMMB 4NNXA 1ACZA 4WO4A 1W2KT 3MV7B 5GRUH 1KPVB 4MA3A 1TETL 1QSFB 2LU4A 3M8OL 5E9DA 3MGAA 3WUWA 3FB7A 1HINH 3RWHB 5I76B 2ZCKH 4TSAL 1CL7H 4L8BA 4LLMA 3DUUB 2Z92B 4XNUH 3QEGH 4KDVA 1U36A 5J6HA 4L4TB 2UWEF 3KPOA 4NZUH 4JR9L 4K23H 3BWAA 4EI5A 3IFPA 4LCIL 5EB9A 4QCIB 2QR0B 3WEXB 3SE4C 4YX2H 3TZVC 1OSZB 3OZ9H 3HAEH 1E4JA 4IIQB 3G6JA 3WDHA 4YHYB 4GRWB 4XAKD 4OLEA 3W0WE 4M6MH 3D85A 1SBSH 4HS8H 2XIDA 4WI3A 3BI9X 4PJEE 1N0XH 4C56A 1NLBH 3PQYE 1FVEA 3IRPX 3QUXD 4X99A 1YEIH 5F7EH 4MD5A 5HYSB 5E9DD 2E8YA 2V9TA 4ONHA 3P4OA 1U3HD 5EORL 5F9DC 5T5NF 1NPUA 2G5BA 1JWSA 1MI5B 5HI5D 4QRPD 2O5ZL 1DEEB 4KC3B 5DUBA 2O61B 1A7PL 5DD0H 5IHBA 3W11D 4XCYA 3L1OH 5SX4I 3EYVB 4EXPX 3VXRA 2EKSB 1BQHB 1U2HA 5JZ7C 3FRPG 4HFUL 4UIKH 5KN5A 5F9OL 1FFNA 3P40A 2FRGP 3G5XB 4JN2B 1G7PB 5D1QA 1GGBL 5L2JB 3Q2CA 3M1BB 1IGFH 3HE6C 4KUZL 4GG8B 3DYMA 3FFCB 4G5ZH 3KPLA 2DBJA 5J6GB 3MRGB 4XPGH 3VFUB 3BE1H 4MJ6A 1B3JA 2OJZH 4XNYL 4JDZA 1QFUL 5TE4L 2EIZB 2UUDH 3GKZA 3J8F7 3FRPA 5IF0A 3GSVA 5FO7B 4HH9A 3J7HA 3W2DH 1VADA 2MKWA 2OI9B 3CU7A 4TN9A 1VGEL 5TFSL 5C0EB 5FM5M 3QDJB 1IAMA 1X9QA 5DJDA 4C58B 4NJ9L 1UJTA 1FGVH 1MAJA 5IB5B 4DKFL 5ESAA 5F3HA 3RY5A 1JGUH 5T3XE 5HGDA 1AXIB 1AGEB 5CLTA 2APFA 1HE7A 3SKJH 5JQ6L 4G9FA 4W4OA 4NWUL 1KXVC 2VDLL 3NCBB 1N8ZA 2D2OA 2KL6A 2VXTH 3K0WA 3TWCH 2DLHA 2H3NB 4YE4L 4POZC 1AD0B 5IBUB 1RZ7L 5I1LA 3LCYA 1MF2H 5IFHL 5JIIA 1NGZB 1ZHNB 4NO0A 5D2LA 2XV6B 5D1QD 5BOZG 1FZKA 2NY3C 1KCKA 2BNUB 1O7VA 2VLKD 1KJMA 5CBEA 3STLA 2IH3B 1JN6B 5DWUL 5GJSH 3FFDB 1FC1A 2F54D 5GGRY 2E3VA 5F6HJ 4U1HB 1VEPA 5CCKL 4KKCC 1P2CA 1FVCA 2EH8H 1XGRA 5FECA 1BM3H 4OGAC 1QHPA 4D8PA 3FOLA 4QRPA 3HI5L 2Z93A 2YZ8A 3QEGL 3TP4A 5E8DL 4CVXB 2OR8A 3O0RH 2G9HA 2DI9A 4LAQL 3UPRA 5BCAA 4JY4A 1AI1L 2XT1B 4Q9RH 2V9QA 4ZYKB 4X7FC 2GJ6E 1CFTB 1RAMA 4PY8J 1U9KA 3HC0B 4QXUH 2ZSVA 4PJCB 5TPWL 1NC2D 1YC8A 1I7ZB 4XCCL 4I3RL 4A2LA 3LKRA 1J18A 1K8IB 3DURB 3O3AA 3MUJA 1YY8A 3FT2A 5JOEA 3QQ4A 1Q8MA 4K7FB 3HMWH 4WV1B 5KSAC 2X9YA 3OR7B 3VXPB 3ARQA 4EJ1C 5IWLA 1AE6L 3VRIB 2HJKB 3L3OA 4S1RH 4CGTA 1AD0A 2V17H 2JKXA 3QUYC 2DJSA 2CQVA 1VFAA 2P5ED 3MV8A 3SE9L 4ZNEA 1CTOA 2EH7L 5I6XC 4HC1H 3BN9D 4FQCL 3Q6FA 4YZFF 1X5KA 3DHJA 3PHSA 4UUJA 3C5SA 5K9JL 1E6JL 5I75C 1IFHL 3KPMB 1XR8B 1G9EA 5EOTA 4UQ3A 4QF1B 3K2MC 1S7SB 2DQJH 4JRYD 4AIZA 4GKZB 4RNRA 5F7NC 2JCCA 4DUXA 4K3DH 1WBXA 1SJEA 1P7QD 3JV4A 5FM5O 1EDQA 1CFSB 4OSUH 1TQCB 1IGYB 5DHXB 5CIPA 2VLJA 2GITA 5D1XD 4DAGL 3BKJL 2E7LA 3VFRB 1KB5H 2WP3O 1MSPA 3TO2B 4LLUA 5HYEA 2JB5L 3QEHA 3O3BB 4RAVB 5IHZB 1INQB 4BH7B 1E27A 5KTEH 3IETB 4UOJA 4K94H 3ARGD 1XF3A 1S7QA 2BCKB 5TPWH 1G7QB 3BPLC 4L5FH 2YUXA 1A0QL 3NIGF 4HK3J 2X4TA 4U1HA 3S6CA 1L0QA 5D72H 2Q7YB 1MWAA 1S5IL 5T5FH 2XN9A 3MLXL 4GS7C 2FX8L 4DVBB 4L4VE 1OARL 2B20A 4UB0L 4QOKE 1HXYA 3OKNB 5JUEH 1FVDA 2NY7H 4YLQT 2YSSA 2P48B 5C09B 4GAJH 5C07E 4PJAE 3W0WA 4JM2D 3QZWA 3B2VH 1RZGA 1AXSA 4TSAH 3CFCH 3IS0X 4MAYA 5EDXA 1PSKH 1UQSA 3C6LD 1GZQA 3DBXB 3LS4L 3OKKA 5DD5H 1V3MA 4X4YA 3FQNB 3OV6A 4PJAF 3LKQA 4F33B 4HHAA 4R2GB 4NYLB 2WBJC 4G8GE 4PJEF 3ILQD 3CPLB 4OM1L 1XF2A 3C6SA 3UYOD 2EEAA 3HZMB 1PLGH 1FRGL 3VGFA 4LLWB 4KTEH 5D7SH 4O2CB 4XHQA 1TZGH 4LQFL 5CMAB 4MA1C 4FQ1L 1YEDB 2J4WH 4XPHH 3LMJH 3OG6B 3RHWF 2YD3A 1FL5A 1PKQE 4OKVA 3C5ZB 2ARJQ 3GMPB 2PYFA 4JZOB 4LLYB 2D0HA 1ROWA 2YC1B 5H2BA 5DVNA 5TQ0H 5H37H 1A6ZA 3LN4A 3OWEA 3PWLA 4HKJB 3ROOA 4XBGB 4E41E 4PP2B 5FYJL 3MREA 1LHZA 1M05A 2Q7NA 5EC1B 1T04A 5D8JH 3HHRB 4Y5XC 1XH3B 4GQ9H 4U3XA 3SDCC 1G7MA 4I2XB 1XIWC 3RAJL 5ERWA 1PW3A 3EFFA 4ZUUB 1GJIA 4EI5C 3B8SA 2QHRH 3QR2A 3KLHD 3MLTA 1XGQA 1S9WA 4UB0H 4Y16A 1FG9C 4C57C 3DTXB 1YEEL 5IGXH 3TVMA 2EEBA 4HHAB 4OLUL 3WIFB 1YEJL 4X9GA 4WTZG 1ZWIA 4EVNA 3MJ8B 3P4OB 5CSZA 3ECBA 2R4SL 4WU7B 1NLDH 1NCUA 7FABL 1O0VA 3QI9A 4OCYH 2RGSA 3RY6C 3R1GH 2YEZB 2DBLL 3U4BL 3GMRB 1NEZG 5HDOA 4RDQF 3LEVL 3ZYJA 5E6YA 5I1JH 1HHHA 4WTZA 3S35L 3ZL4H 2VXQL 4YAQA 5C9JA 3MQIA 2ORBH 1E4KC 4Y4HC 2AABL 4WCYH 3RGVD 4JQIH 4WIQA 5DVLA 5K59F 4X6BB 1OAUL 1TVHA 1RSFA 1UWEH 4W6YB 2XZAH 1RFDL 3ZTJG 4NHUB 4GRWE 4U6TA 1XZ0A 2DQCH 2VR5A 4QOKD 2ADIB 2NY3B 1A7PH 4K94L 5DD0L 1BQSA 1JPSH 1S7VB 3G5YB 3A0OA 3ROLA 3NAAH 1WT5A 4XPAL 2NLJB 4G8GD 1N5YH 2J5LC 2JJWA 3G9AB 5D7LB 3RVTC 5C7XL 3CVHH 3RI5K 1QFOA 3U7YL 4MGXA 4JKPH 3TWCL 4JFZH 4PJDA 2DMKA 4N0CD 5C0EA 4NQCA 4Z7NF 5J8OA 5DYOB 1ZGLA 3MACH 1F4WL 2E6JA 3DNKA 3KVQA 4NYLA 5EU7C 5EU6D 1IAOB 3MRFB 5JXED 4G80B 4LLQB 1ZOXA 3BKYL 5GRJH 1VPOL 3QIWD 3BGFB 3C5JB 3D18B 5BV7H 1NH6A 2FLRT 2KPNA 3RZCB 4YDIL 4Y5VB 5CJBA 5TFSH 2NXYC 4QRQB 4RGNE 4Y4FB 4LSRL 4IMLB 4RGOH 4BH8B 4GAYB 1FNGA 3KHQA 5DJZB 5BZDB 3QI9D 2AJVL 5HGBB 3SGKC 3LHPH 1KN2H 5KG9B 3IKKA 3MCKB 3GB7A 1QRNE 2VZSA 5A2LH 1ZLWK 3VD5A 3NTCH 2BNUA 4LVHB 1DLHB 1NGQH 2YWZA 2XG5A 3D0VB 1KC5H 3BW9B 5J57B 3HS0B 4LDLB 1UADC 1W8OA 3ZL4L 1TZGL 4LQFH 5C07D 5GS2H 2IALA 2LV4A 3OKEA 3I6KB 2RR3A 4RBPH 1I7TA 5FYJU 1YEGL 3EBAA 5L0QC 5INCB 2FHBA 1UWEL 4I48A 3MRDB 3TBVA 3B9KD 3JVGC 2YHGA 2DQFB 1A1NA 3RWFA 2DQDH 1JMZA 2CGRH 4FQXC 3CSPA 5CZXD 1YN6A 4Z7VB 4K8RH 3B3IB 2GAZB 2XKNA 1CDGA 1RZFH 3H3PH 1NAMH 1I9RH 4DTGH 3WHXB 4ZPVA 5B38A 2EH7H 5KSVB 5A16A 3N06B 4R9HA 5I17A 1I7RA 5EO0A 2R1XA 2B1HL 4XNZB 4CMMA 2H1PH 4N1CA 3LV3B 4L1DA 3RVWC 1CGYA 3V0VB 5I0ZA 5IW1B 4KK5D 5DXWA 4JANB 3IYLW 4U6XB 1RUPH 3O8XA 4QTHB 5DJDB 4PJEA 4CU7A 4XBEL 3MO1B 1G6RB 2RBLA 2C1PA 3KYKH 1JJUA 2LFGA 4JFED 4F37K 5CBEB 2AP2A 4TSCL 4IRSA 3AREA 5KS9B 3U48A 1FG2A 3AXLA 1R3HA 3ZHKA 1MFNA 1AD9A 1U8LA 4HJJH 1ITBB 2HKHL 4GSDH 4TYUA 3HNSL 2F74B 4NQUA 1ZS8B 1KB5A 5T1LA 4G8EB 4ODVL 5DZNA 3O3DA 3ZLQC 3GHEL 3EUUA 1VERA 4TNWK 2A38A 4BZ2H 3JWNC 4EN3A 4M48H 3RPKA 1IAIM 1HHJB 1C08B 3RTQB 1SYVA 2NR6D 4K2UH 5ESVA 2HKFL 4FZ8L 4WW1B 2NY6B 3VWKD 4F7CB 3WLWD 2A6IA 5M7QA 4BUHA 4HPOL 5J1SC 5J11B 1SJEB 2Z35A 1A1NB 3RWFB 4HWEH 5IEKB 3U9UA 3MLVH 4KZDL 2I9LA 3PV6B 2CUIA 4NSKB 3T2NH 3TNNB 4PUBL 1MOEA 5F96L 1FC2D 3LS5H 3WD5L 3N1FC 4FN0A 1P7QA 1TCRB 1HWHB 1ACYH 4LLDB 3L3GA 2A6KB 4PJIE 4GRLB 3CSBA 1QFPA 1UFUA 1JHKL 3D2UB 1BFVL 3GRWL 2YD4A 3SDXB 1MCPH 1Z5LB 2R4RL 4U1SA 4G8FA 3OMZA 3CMOH 4KHTL 2BX5A 3ARYA 1UQSB 4WRLA 4GLRI 5ADOH 2Q3ZA 4TUKH 5EPMB 2Z4QB 4HWUA 1BAFL 3CDCA 5DJ6B 3O3DB 1ZSDA 3WNLA 3BVNA 1XT5A 4AEFA 2ZUWA 4K7FA 4WV1A 2X1QA 4YDLB 3EJYD 5D6CA 4OT1H 3MOAL 2OQJA 4KUZH 5HPMA 5FGBA 4L8SC 3GO1H 1R3LA 4R8WH 4RMWA 4GKSB 3IJHA 1LO3L 1PBYA 4HS6B 3BZ4B 5GXBB 1WCBA 1MLBA 1I1AC 5EZJB 3X11B 4M5YH 1N0XL 4U2YA 3QT2A 3U0PB 4PGEB 3K74B 1IAIH 4WI4A 5D70H 5D7IF 3SJVD 2VDQH 3UPRB 1N5AB 3L3JB 4MDIA 1RUKL 1WWBX 1S7WB 4FZ8H 3SKMB 2C4XA 4KFZC 3PDOB 4Y5XB 4O00A 3U7WH 5IT2H 3UJJH 1R6VA 2VKWA 5DQJB 1LE9B 3B2VL 5IVZB 2WP3T 3C60C 3MJ9A 1B0RA 1J0JA 1WCBB 4P2RA 4KROB 3JXAA 4U2ZA 3IVKA 3B9KC 3SGDH 4S1QL 2DF3A 1CLOL 2ENSA 4Q9BA 3ZZ1A 4U6HA 2BSRA 2BVEA 3IDJA 1ZLSH 2ZUUA 4DEPB 2WWKO 4XBPA 1QSED 5GRVK 1T89A 2FH6A 1NBZB 3U2SB 2YEZA 3GNML 3S98A 5SX5H 5DR5H 3PL6C 5I71C 1UVQB 3CCHB 5ADOL 2V2XB 4I13B 4JAMB 1IMHC 1Q9OB 4XXCC 1DQJB 3RX5A 3VXUD 5IVOA 1JNNL 4OZIA 1J88A 2D0GA 3QQ3B 1M4KA 3QDGD 3SDDD 3P30H 1BQUA 3O6KL 1Q9WA 4IBLT 4OGXL 1HSBB 1XGUB 3MBEB 3A6BL 1CTNA 1DBAH 4W4OC 5LBSL 2AI0H 4S1SL 2YRZA 4P5TC 2MQCA 5SWZB 4OZGA 3MPCA 1U3ZA 1U8PB 1EMTL 3IDIA 3P0VH 5FO7A 1DN0B 3K1DA 4PG2C 5DUML 1S9XA 1G0XA 1DDHA 2LAGB 4X6CB 3DUUA 4PLNC 5IR1A 1RJYB 3U7YH 5DYOA 1FLTX 3UJIL 5ITBL 5HY9B 3WIIL 2R2EB 1MFDL 3NIDE 5AUMB 4LHUG 2G60L 1FV1A 2ZG2A 4QYOB 5IIEA 4PJFA 3BAEL 3KLAB 3NCYP 1WZKA 1S9XB 4JY6A 5FYLD 1S7VA 2D7MA 3G5YA 1OP5H 4RGNC 2F15A 3MLYL 2VITA 5BO1H 4HGKC 5E5RB 4JFHD 3IDXL 3N0PB 4O2EA 4AMKH 1NCDL 2B7DT 4JZJC 4PGZA 1FZOB 4R0LB 1JK8B 3X13B 2R9HC 3D25B 2J2ZA 2E7MA 4GW5B 5DK0A 1JGDB 4F15C 4OLVL 3H7BA 4MJIE 2EYRA 1WZLA 1QFHA 3NPZB 4XVUD 5FYJD 1YECH 4L8CA 5K9KB 2CRZA 4JFYB 4MJ2A 3CJJA 4M1DL 5C08B 3MBXL 5FF6B 3F7QA 1CLZL 2HRLA 4M6ML 4Z7WE 3G08B 4DFIA 2FEEL 2VYRE 3HNVL 1AQDB 3DETD 1GC1H 1N6QH 1I8IA 1NCCL 4TPRL 1YEHH 4HWNA 3MA9L 4U49A 2BSRB 2WLYA 3GJFA 1F4XL 2GTWA 4BFGA 4M1CD 1TVHB 2QADB 1FNHA 2ESVA 3ZKQD 5E99H 4FQJL 4M1CC 4ERSL 5I8CB 1INDL 4PREA 5K9QG 3CFBA 1G6VK 3PWUA 2J6EA 3FFCD 2NXZD 5IF0B 1T2QH 2AKRB 1UACL 2VIRA 3MREB 5EC1A 2D9QB 2XWJB 3F7YA 5GS2D 1OP9A 4S1QH 4QTIH 4V1DE 1YZZA 2YD2A 3H0TA 4OB5H 3EJYC 5IEHA 5D71H 3UTTD 4R7DB 1NAMB 4HXAL 5FDYA 5HVWA 3EOBA 4PJ8A 4NKQB 4U1MB 4OZGB 3KPNA 4OIIH 2J8HA 1S9WB 1RJZA 3P9LB 1QYGH 3ZYZA 2E9IA 3QHFL 1ZEAH 4P2CG 5LGKA 1Z3GL 2EC8A 4NDMA 4Y5YC 4E5XA 4WHDA 5HDBE 2MQ0A 2AEIT 1RK1A 2HMID 1H9VA 3KJ6H 4OCLC 2Y06L 4MS8D 4JDTL 2VWEE 3FQUA 1MCWW 4HGWB 1TQBC 2V6HA 2VQUA 4YHNB 3DVIA 3S3SA 3BZEB 2JCCB 3V6FA 3ARBA 3MOBL 3PWLB 3ARDD 1MAML 3CNKA 1MHEB 5E8OA 1KELH 4MA8L 5I2IB 1DQML 1OWRM 4NHCL 2XRAL 4YPGA 5T5FL 1Q72L 1UXSB 3I75B 4MCYB 4OUUB 4XPTL 4GW5A 4KWUA 4IDJH 5D1ZD 3EGSA 5DF0A 4NNYB 1T21B 1FGNL 5IM7B 4KGJA 2NR6C 3HZKA 4P2QD 5E99L 3BP5A 5KSBE 4FFYH 4E42B 5GS0L 4MQSB 3VFMB 4M02A 2WUBL 1IT9L 5HGDB 4J3SA 4XCNB 1RIHH 1LILA 1AY1H 2Z31B 3L3DB 1RIVL 4P9HH 1KFAH 2FX7H 1R0AL 1PSKL 2AQ2A 4XVTL 3HS0A 4NN6B 1BIIB 2Z93B 5FUCE 3O45A 1NAKL 3E3QE 3L7FA 5IQ9A 5IQ7H 3FFCE 4CW1B 4BZ1H 4JFEA 3CFJB 4LL9A 5JW5B 3RVWD 4LFHG 3OR6B 4X80H 1XIWA 3V52H 5FYKH 4O51B 5F88B 1MRFH 3TFKD 1B2WL 5IUSA 2NY5C 3T0EE 2DQEL 1DVFB 5I1EL 5IKCB 1U8IB 5MERB 4WWKC 3HG1D 3BP7A 3MCLH 4Z78B 3BN9C 4LGRB 4AG4H 3V5DA 5EO0B 4JN1H 3VFPB 4QKXB 4JHWL 2XZCL 4MJID 1ND0B 1R3KA 2R29L 3MRJB 1BZ9A 1T22A 4PJCF 2FJGB 4NQEA 4A6YB 2B0SH 2YOCA 2ICWA 3ELAT 5EU6A 4JQVA 1ED3A 3PUCA 2IF7A 2G2RB 1HSAB 4P5TA 3PP4H 5FFLA 3UPAA 2DYPB 3BIKB 1FNSL 3W9EB 4NO2B 5FOBB 2EDFA 2ARJB 5BS0D 3NZ8B 5KSBB 3NFPB 1X5JA 3PDDA 1E4XI 2A74B 1HQRA 1SY6A 3TNMB 3WS6A 1T3FB 4UTBL 1BM3L 2CMRH 1QUNA 3GMOB 2JTDA 3MRCB 5EOTB 3GKWL 5D1XB 1WUNT 1I7ZA 2AJUH 2R4SH 1FQ9C 4B41A 3KXFD 1ORQA 3GO1L 5D7IB 5GGRB 1MWAH 4U1SB 4YHIA 4UIMB 3NPSB 1BLNA 4WI8A 4GLRH 5B4MD 2R56H 4YXKL 1OT2A 3SKOB 3RGHA 3I9GH 5LQBH 3IFPB 5FKPB 4W81A 5AAWA 2JJSC 1WCQA 1A7QL 4Y2DA 4NQSA 1TZHB 4O9HL 1Q94A 4YGVA 5F7YC 3EHBD 2A2QT 3QUYB 1HNGA 1C12B 5DD3L 3KYAA 1GGIL 2ZOKB 2DKSA 1AGDB 2ZNWA 3K4AA 3OKNA 2GYSA 2AJSH 1F13A 3ULSB 1CG9A 3V9FA 2WBKA 3D5OF 2VSCA 4MDJB 3U0PA 5C0BA 5EBGA 4Z7OE 1NBVH 4IJ3C 3GHBL 1HWGB 4H88H 4NRXB 1OTUD 3K80A 1GSMA 2X5PA 4XMKH 3FB6B 1FCGA 3AY4C 1CN4A 4DGYH 3UCRA 4UDTB 4YFLF 3O9WC 3F12B 2QQNL 3HC3L 2R0ZH 4M6NH 3LQZB 1GGTA 3C6LB 5JIPA 1LEGB 5EPMA 5GGUA 4ZODA 1G9NC 5J12B 5JOPE 2FECL 1S7XA 4YH6A 5ALBH 4UT7L 1CFNA 1AFVL 4WW2F 4CVXA 5GGRA 3CZFA 4QXWA 3IJSA 4XP5L 1OGAB 5IB4A 4JFXB 4P3CH 1QLFB 1OD7A 3HG1A 3L3GB 2B5IC 3H9SD 1UVQA 3EW3B 3TV3H 5DUPH 1ZANH 2XTJE 1OVZA 3HPJA 5IHUL 4Q7DA 4WWID 3BDYL 3P11H 2HFTA 3DGGB 4QRSB 2ICWB 4L29A 2J4WL 4G6FD 4PLJD 2CDGB 5DHYA 1D6EA 4UINL 1BD2B 3RKPA 1DBMH 5KVMC 5L2KE 5IW6B 3ESUF 5GGVL 5JORB 5DMKA 1AXSB 5T1LD 3DI2B 5LXGL 3FRUB 4P2OD 3P4NB 1F45A 1E0OB 2YSSB 3LQZA 2AXGA 1NFKA 5F1IA 5D8JL 2ZSWB 3UBXG 5ILTL 2EXWC 3W0WD 3QULB 1JGUL 3ZE0E 1A8JH 4F8TA 6FABL 2QSCL 1SBBA 3KPPA 3LEYL 3IF1B 2YD7A 4K8RL 4Z6AT 2W60A 1JTOA 4AQ1B 4OF7A 3VU2A 1VA9A 4OD1H 2COQA 4P2QA 4MWFB 4X4ZA 4YK4C 3T2OA 3RA7L 5JW3L 4KK6C 3QIUC 4OZIF 3RY6A 3VMNA 4MA7L 5ACLA 4QTIL 4HX1B 5HYJA 3LS4H 4KTDL 2E27L 5F93C 4DKFH 2I5YL 3GMPA 4LLYA 4X6CE 1YNKL 5FYKE 2XA8L 1DQDH 3TPUA 2OK0L 3HNTH 3C60B 4LF3B 1QRNB 4ONOA 5FHAL 3TVMC 3CFBB 4L5FL 1RHHB 3I6LD 4JRXE 2VDLH 3FT4A 3EYUH 2X2YA 5SWZE 5KSVA 4GG6B 4HUVB 1UXWA 1DQQB 1A21A 5CKAA 2DL2A 1VFOA 4FFWD 1DUYB 1UZ6F 1JPTL 4M8VA 2Y72A 5DHYB 1T4KB 1M6OA 2FGWL 3QXTA 2IPUG 1A7RL 3VRLE 5F9WB 3GK8L 1HEZA 2HTLD 3EDDA 4RX4A 5HGAB 3FO9B 3QFJD 3WFDH 2KUTA 2P46B 3MNWB 1KNOA 4F7PB 2EIBA 2X05A 3UTSA 1C16A 3FN9A 3FONB 5HHOB 3GMQB 2NZIA 2DLIA 2FX9L 4RMQA 5F1SA 4HKZB 2X41A 3HN3A 5HHME 1Z9SA 3MUZ1 2OSLB 1ZMYA 1FIGL 3I50L 2OYPA 1I9JH 3BUYA 5ID0B 1LO3H 1YEKH 3MLSH 4BH8A 2GCYA 5BRZB 1C5CH 3D25A 1LO0H 3WIHL 2Y5TB 3WL9B 5F1NA 4TQEL 2QR0A 3WNMA 3S96B 4NQED 5D7KE 2A9NH 4LIQE 5EO1A 5EU3B 5KOMC 2N56A 5KJRH 4KV5E 1INEH 3QRGL 1IQWL 3IAPA 3T65B 4OQTL 3UJTH 3T0EA 2VLRA 3CFDB 2CDEA 3OPZL 1MCIA 1ZT1B 2BFVL 1CICC 2XOTA 4XVTH 1U92A 1GOGA 2Y4SA 1H15A 2R2EA 4B5EA 2JK5A 4ELKA 4PJBA 4AT6A 5KW9H 1NSNH 3A67H 5J9PA 4G8IB 5D2NB 3EYOA 1E28B 2W9LA 5C0BD 3HKFA 3U30B 3N1GC 1U8MB 4NDMB 1SVZA 3QCVL 4WFHE 2ESVB 3H3KA 1FVEB 1A3LH 3L7EB 4WI9A 2JJTC 4WW2B 2PYEA 2MPAH 3EKCA 2CLRA 1G9NH 4LVOC 5IMKB 1EFXD 3FQXA 4KAQL 1PY9A 4NOFA 2AQ3A 3UX9B 3OKDB 3RUGF 5FDWA 2J7LA 4X6EB 4S2SA 1F11B 4G9DA 1A9BA 1H5BC 2IPTH 3W81A 1D5ZA 1U91A 1PG7L 2CIIB 1QLEL 3P0YH 7FABH 1A6UH 3FO2B 3BESR 4HZAA 3QWOB 4MCYA 4OFPA 4QY8A 2OJEB 3RWGB 3TM6A 4F2MB 2QQQA 1V5JA 3QPXL 2FX7L 4QXTB 5FOJA 1SEQL 2ARJA 3OGCB 4KHXL 3SPVA 3DX9A 4YO0A 3SDXE 3RWJB 1EHAA 4JQXA 1MCQA 2AJXH 4GAFB 4Y4HA 3R0NA 2DLGA 1G0DA 2D9CA 1DLHA 5GS1A 5JW3H 4K23L 1UZ8B 3HI5H 1IRAY 4K7PY 4YQXL 2VDRL 3QAZB 2DB8A 3MV7A 1D5MA 1YY9D 2OR9L 5JMOC 1CGTA 2X1PA 2L7JA 3RVUD 4I18B 3JWOL 3ARUA 3VXUE 4GOSA 1CGSH 1BFSA 2DQIL 3PHOA 1DP0A 1N2RA 5FF6A 1OARH 4FP8L 4I3RH 4PJ9A 1EX0A 3L7EA 5E5MB 3D3VA 4JRYA 4PV8A 3U79A 3MACL 1F4WH 1CL7I 1IGCH 4NCDA 3KPSD 5IFAL 3M1BA 3MXWL 4OKVB 4JQXC 5GQBA 2J88L 3IU4L 4JO3H 1Q1JL 2CXGA 5CINH 1CFTA 4UDUB 3MRBB 4R3SA 4RNRB 2AXHA 4GKSA 4ESKA 4D9QE 4HT1H 4B53A 3MRLA 1KJ2L 4OZ4B 1JN6A 3O4OC 3BPOC 1MFAL 1X3DA 4PJIF 4EEEA 3VGAB 1FDLH 2R2HB 4BM7A 3EO0A 1MELA 1K2DB 3DO7A 2NY0D 4OCWH 1NDGA 4U1LA 3JV5A 2P5EA 1BGXH 3MR9B 2L0DA 4LCUB 2Z31C 3N85H 4LASH 4ENED 1FNEB 1WICA 2BXYA 2DWEA 3E2HB 4MQTB 4OCNC 3TT3L 5HYSA 3OKMB 3PXHA 4BFEA 4IHOA 3RWEA 4TSBH 4DGVH 3OG4B 1UM6H 4HDIB 2A9NL 2X4QB 3DYPA 3VFTA 3L3KA 1ZT7A 5CILH 2PYEE 5D1XA 3LOWA 5IB3B 4MSWA 1BF8A 2NY1B 1MJUH 2EYTB 4Q74A 2P24A 1K8IA 2GJJA 4Y16C 3B4NA 3CXHK 1JRHH 1U3HB 2DIBA 4TUJA 1YN7A 3MRMB 4GXUM 3C08H 1I75A 2K9UA 2R0WL 3GFUA 4OQ1A 2DM4A 1LE9A 3V7MA 4CDHA 4UT6H 3IJSB 4LP4A 1T22B 1MFCL 1R24B 3HAEG 1GZQB 3DBXA 3I84A 3NCMA 3KLHC 4M5YL 9CGTA 5DI8B 3E6HB 4KRNA 3RDTA 3NOIA 4JO2L 3U0TB 2YMXH 3FT2B 5D72L 1HCFX 1RMFH 3VXMB 5CUSH 4E41A 3SKNA 4V1DA 4C4KO 4LCWA 2XACC 4OI8A 1K9TA 2OR7A 5IVXB 1TJIH 2YPLE 3FB6A 2HT3D 5F88A 3IDIB 4NQDA 5BOPA 4XH2A 4L8SB 5DMJB 1QPXA 4OZGE 1QSEB 5CD3A 1LDPL 1F6LL 1SYSB 3ESVF 3MODH 2YC1A 3MRFA 5SWSE 1T1ZA 5EZJA 5D2LE 32C2B 5CP7A 4V1DB 3X11A 2F5AH 4LOUC 3EDJA 1EO8L 3NA4A 4ZYKA 5C6TL 4GMSH 3T0AA 3ORJA 4OB5L 4UTAL 3AS2A 1IKNC 4QYOA 4WHTA 3O6MH 1CD8A 4MMZC 4NN5B 43C9B 1EHNA 4TRPH 1OQOA 5TGBB 4OLYL 3RNQA 2AW2A 4P5TB 5C92A 3MRHB 4YHPA 1AKJB 4YDVA 2EDTA 1U3HC 2ADJA 3OAZH 3VGDA 4J6RH 1KPRA 1DDHB 1RQ5A 4KZDH 1M7IA 4OGAD 1CR9L 1G1CA 2X44D 3CFKA 2APVA 5D96B 1XAUA 1P6FA 3CLEH 4PRBB 5LBSH 4JFYA 4WHCA 5FEBA 1OP3K 5T5NG 3LDBB 5FKAA 2QL1A 4XP4L 3F6LA 3SEPA 2DAVA 1QBML 4UUJB 1L7TL 3UMTA 4BQ8A 1GZPA 2FBOJ 1M7IB 4JKLA 2ITCA 3V52L 4HUVA 2H32H 1KJ2H 4ZNEE 2BMKB 1FSKC 5D9SA 5I1IH 1XF5B 15C8L 4JFXA 4MB4A 1DLFH 3UAJC 1IILE 4O02H 4X6FA 1UM5L 3SKMA 3EYOB 3VRIA 3RVUC 4MDJA 4ZPTB 1X5GA 1WAAE 5FUZL 1YEFH 2APTA 1P7KA 2X4PB 2G5BB 3QUZB 2CIKB 4TSBL 4DGVL 4Q0XH 1KTKE 2OL3B 3O4LA 4X6CA 3MJGX 3WHE0 2MNUA 5BVJA 5L8LB 5F6HI 1WAAF 4NRYB 3MFFB 1ZGLB 2M1KA 4RWYH 5FCSH 4E41B 3ALXA 5CIPH 5DO2C 2BJMH 2CGRL 5L2JA 4RQQB 1N5AA 3L3JA 4NQDD 1CZ8L 1VENA 12E8H 1ZS8A 3OJMB 1X4YA 3S3JA 2XA3A 2EDHA 4AIOA 5DRWB 2ZOKA 3V7AG 2R0KL 1EEYA 2YPLD 4Z77A 5IJKA 1BFOA 4MNGA 5DVKA 3H2WA 2AJYH 1OTTC 2JE8A 5AYQA 1NCNA 1XGPA 3D69A 3GIZH 2HP4A 2AV7A 3TH3T 3FONA 4EUPH 1TJHH 5DFVC 3ARDA 5JUEL 3HZYA 2XZCH 3QJHA 43C9A 4KK5C 1OOAA 1TVDA 2HLFD 1P7QB 5J0BA 2V2WA 5JNYA 4G6JH 3QPXH 2AGJH 1I7TB 4WTWA 3T8XA 2EDNA 3TA3C 3HNSH 3ECBB 3KYOB 3TYGL 4EN3C 3MODL 4X6CF 1IGJB 1BP3B 5EBWB 2AVGA 3O41B 3UBXI 4YHMH 3RIAK 4NZDA 2VXUL 3I6LE 5ELIA 3GRWH 3RZWA 3GSUB 4H26B 1BVKB 3V4PL 1YUHB 4PJ7A 1N4XH 5CP3A 3TJHC 2ILLA 2KZWA 1LO5A 1YPZB 4R90L 5E2UH 3NGBC 3L5IA 5AWNH 3FO0L 4RZCA 3VFGH 4LLMB 1I8LA 3CVIL 4IOIA 4KKCD 4PRPD 5IBUG 5C70A 3V0VA 1FL3B 4UV4L 5JO5A 2A0LC 2D7TL 2PXYB 5DHVA 4NNYA 5HGBA 1K6QL 3FFCA 5KVDL 4Z5RA 1NCCH 5GS3A 2Q86B 4N5EC 1KBGH 2YRLA 4WI2A 3RQ3A 2BHUA 5C09D 3DO3A 1KPUB 4X9FA 4JM2B 3VRJA 2DQDL 3LPWA 1T0NA 2ED9A 5E56A 3CXHJ 3IXTA 3S96A 4NWTH 4D9RD 4NWUH 4R2GC 4OZFH 4NHCH 2VUYA 1OM3H 2CPCA 5IB3A 4HKXB 4R2GD 3MNZB 4JPVL 4LARL 2MTPA 4KK9D 4PG9B 5JOFB 2OMNA 4HQQL 2Y9RT 5D2NE 5LWYL 4X7EC 3RWJA 4JY5H 1QFWI 1NCBH 1JGVH 1MIML 1CLZH 3JZ7A 1U8MA 3O8XC 4YZFE 4ZO6A 3KPSE 4ZD3H 3ULUL 3RWCB 4PJIB 1AC0A 1UENA 4Q0XL 4YHML 5C0FA 4L3ED 4L8DA 4NN6C 3VH8G 3CDYA 1JPGA 2NY4C 4MS8C 3GI8L 1DVFD 1B90A 4Z0BH 3BSZL 4R7NA 1DQQA 3KR3L 4H1LG 2QQLH 3VI4F 2BRRH 1X5ZA 1B0WA 5B4MC 4NQVA 2FIRT 3BP4B 1M1SA 2LABA 1U8OB 1W0YT 1LE5B 2DI8A 1DVFA 2GJ6B 2P8PA 2Q86A 4ETYA 4G43B 1UYWH 3R4DA 1SJVA 5LGHL 1HH9A 5KAQG 4H1LA 4ODXB 5ANME 5C0GB 3VFRA 1CD1B 2WINA 5BS0B 1XGRB 4K8RD 5FECB 3ARBD 1TXKA 3MV9B 4N0RA 2IH1B 4GRLC 3VXSA 3CK0H 2F58L 1CS6A 3EYQD 4DCQB 2BVOB 4LSVL 1B9ZA 3KXFB 5DJCA 3VD7A 1SJHB 4Y0GA 3HFML 3HMXL 3MFGB 1AY1L 1KIPA 4XP6L 1MY5A 3RDTD 1K8DB 4EZMA 3QG7L 5HJ3B 1F11A 2BXZA 2XI9A 3PIQB 3V4VH 2Y5EA 1YDPA 3G6JB 5K9JH 2J5LB 2X4QA 4EBQH 3QIBB 4J3TA 4P2RD 4YHOL 4F37F 2KDGA 1JI2A 1JGVL 1MFBH 1FZOA 4R0LA 4Y8AA 3DVFA 3X3GL 1ZTXL 4MXWH 4ZXBC 1AGEA 2C4FU 4WFFE 5DDHA 4ZS6D 4PV9A 3QIUA 2I07B 2BVQB 3DV4B 3HI1B 1BOGB 4Y4HB 3L3KB 3B9KA 3HLAB 1CE6A 3ZE2E 5HYQA 1H3PL 2HJFB 5SX5K 5EU6B 1A9EA 5BW7C 3CAFA 3TIDB 4AENB 3EJZC 4HBCH 5DJYA 3AUVA 5A1AA 4JG0L 4WUUB 3S36H 4TNVF 3FT4B 2HRPL 3IJYB 4R97B 3CZFB 3RZCD 1R3IL 3WCYA 4P99A 4UMGA 3NZHL 1T1WB 3C6LC 2IBGA 1J86A 1ZHBB 4JGMA 4MQXD 1BHGA 1OGAD 4M7KH 1YEHL 4UNUA 1BD2E 4BFIA 4FXLA 1OM3L 1KB5B 2GKIA 1CE1H 4X6FB 2J6EH 2LTQB 1MF2L 3GJFK 1FNAA 3OL2A 2Z9TA 2OXHA 3QXUA 4Z18A 5C0IA 1RUQL 2XTJB 2VC2H 5HHVH 4DUVA 1AD9B 1S7QB 1A4KA 4P4RB 1QQDA 4ZUSA 5CJOH 1KULA 4P23B 1U3YA 3QEHB 1A6TA 4PRNA 1A4JB 5K9QI 3EIFA 3QEQA 1MNUL 2GK2A 4ZOAA 5HYJD 3HI6L 5HHPB 1MHPH 3TYFA 1DQLH 1RJYA 2YD5A 1NFDE 5FCUL 2C4FT 1OCWH 5I8EA 3DWTA 5EUKA 5A40E 3QCUL 3DIFA 2AEPL 4XPFL 2AV7B 1J8KA 1OAYL 3U4AA 4GRWF 4M93C 3FMGH 1EH9A 4PV9B 3DMMA 5D71L 5FYJE 1CYGA 5ICYA 3U4EB 2W65A 2Y6SC 1D6VH 3GSXA 1D9KB 5EO1B 1Q0YL 2B4CC 2SEBA 1T7VA 5F72S 1RY7B 3W0WB 5CJQL 2FH8A 4EUPG 1UKQA 3P4MA 4ZOEA 4GG6A 4HK3N 1NGYB 3VXTA 4N8PA 1JV5A 1AKJA 1G9MH 5C0JB 3IGAB 4WEBL 3M45A 1CGSL 2F5BH 4GUPA 4N0YH 1YY8B 2YXMA 3QZWG 4LRIC 3ULVD 1LK2A 2C3XA 5F9OH 4G8EA 2CMRL 5C86A 1CLYH 5EU4B 2QQNH 2BY2A 3HC3H 4KUCD 3BEVB 1P5UA 2R2HA 3O2WL 2CKBL 4YHZH 4ODSL 5IVZA 1R5WB 3U83A 2G60H 4MXVF 5E6IC 2GK0B 4PYHA 5IESH 3F65A 4B7IA 4J3OC 4U6HB 2BY3A 4C55A 4GQPH 3RA7H 3C60D 5BO1L 1CGXA 4RWYL 1V7ML 2H2SC 4BSJA 1YMME 4U1NA 5B22A 1XGYH 1MJ8H 1S3KH 2QQKL 4JPKH 3L5WA 3T3MF 4QWWD 5L2KD 1Q94B 5F8RC 4PJ7B 4YQXH 3VWKB 5H35A 3CVHB 4PJXB 3TCLA 5E6IB 4M62H 1P6AB 5T1DH 1RI8A 2WWMC 1KFAL 1SMOA 3U46A 2B2XH 1AR2A 1CFSA 1JYWA 3FHAA 5D5MB 1KUMA 3MTRA 3TH2T 3P73B 4M5ZH 4OBSA 5FYLH 3C5ZC 4X7TB 3SDYL 2EDKA 2XZQL 2EE3A 5CEXA 2Y5TA 3Q5TA 4U0QB 1RZJL 5C0CB 1JF6A 3TA3A 3GSUA 4H26A 5ALBL 4GUPB 1W0VA 4HIXH 2BZDA 3IS1X 5E24E 3BXNB 4GBXA 5IK3A 4HJ0C 5D5MA 4I18C 4LSQH 1FFRA 4Q2ZA 5HHNB 2R2BB 2EECA 2H41A 4FQ2H 2EZ0C 1CLOH 2VISB 4MAYB 4WWKB 2VLJD 2Y7QB 1BBDL 4OBRA 2HFEA 1BMGA 4Y2DD 3T3PF 1IC7L 5GRZA 4IEFB 3CFEA 3BXNA 1DANT 3MSPA 4OZHB 4U1NB 2VDNL 2YRPA 1S9YA 1MRFL 2CLZA 4DW2L 4M6AA 2J12B 4ZO7A 2OLDA 4KDWA 4KKAD 5E8EA 3CVHA 2FHCA 4WV1C 3ULUH 4LRNH 1RUMH 4YXLL 5ICZA 1LP9E 1AIFB 1A6AA 3DX7B 1CU4H 3BISA 4JFOB 2EEDA 1DQTA 5I6XB 3NIFE 4DVRL 4KU1A 4PP1C 1BQHA 1PD6A 3B9VA 2R69H 5F6IB 2LU7A 3WFHB 1EFXB 1KBGL 3V6ZA 3DSFL 4HUXB 4AM0B 4CVWA 2VZUA 2WUCL 1DBAL 1HILB 5E2JA 3ARFB 5AYUL 4R97C 2DKUA 2Z31A 3L3DA 5EOCL 5I9QC 1LE5A 4CAGA 3C9NA 2ZG1A 1NEZA 5KVFH 1J1PH 4M4RA 3C8HA 1T6WA 4BKLA 5ISZA 1BQHG 3LRSA 4ELME 5FA4B 1KACB 4H1LH 3S8WA 1N64L 1MFDH 4PBXA 4XHJD 2BSSB 2DMBA 4WY7H 3WIHA 2VQ1A 5IB1A 5C6WH 5JW5A 5D2LB 5JHDB 3VWKA 1FZMB 3GMNA 3V7AE 1WC7A 1UCBH 2V5RA 2NY6C 3WSQL 3FN3A 5L6YH 4P4KB 5EBLA 3BE1L 1A2YA 2CKBH 3UTPD 4LSDA 4RX4D 5J3HC 3WEXA 4N68A 4J1UB 5FK9A 1P2CB 3PWPE 4HF5H 2KH2B 1NMAL 5T3XD 3A6CL 4I77L 3M07A 4Y4FC 2ZCLH 3MGOB 3F58H 3CSYB 5D7JA 2V7HA 3CDGB 3OPZH 4K55A 5JOFA 1PDKA 4GAGL 1OGAA 2H45A 4HIIB 5EBLB 1WIOA 1OW0C 5SWZD 2A9ML 1NGZA 4DW2H 3VFNB 3FQXB 2H32A 2E9WA 2EDRA 4J4PA 2WQ8A 2VDPL 4YC2C 5EG6C 3WN5B 3HUJA 1HHHB 5D7IE 1CFVH 4Y16D 4MNQD 1KLUB 1QR1A 2FNBA 2VXVL 4LKCB 4Q6IC 4U7SA 1I9IH 3F7YB 5T1KA 1XFPA 1VACB 2V5MA 3IFLL 1BX2A 4LPYA 2VXSH 3AM8C 4JG1H 3D1MC 2J8UB 2GFBA 2DWEB 4YDLC 1CT8A 4JB9H 1KEML 5CEZH 4KK8C 5BQ7B 1H5BA 4JPWL 4RCAA 4PS4L 1CGUA 1JCKA 1R24A 4X7SH 5C71A 2HAZA 3TVMB 3GGWA 4Y4KD 3MLUH 3UTSE 3P0YL 3T0VA 4OQTH 1U8LB 5LXGH 4HH9B 3ZE0F 3WNNA 3U0TA 3NH7H 4N8CL 4QT5B 4UT9H 1F6FB 3EO9L 3V4VL 3TPKA 1P84K 1ZT1A 1KCLA 3ZTNH 4BQCA 3B6SB 1T66D 1YQVH 1MREH 2MHAA 3PWJB 25C8H 3BGMB 3IXAA 3UO1H 4DKDC 4R7NB 1T1YA 4GKZA 1GGCH 4CN1A 1WIPA 4OD1L 5T3ZE 5I8CA 5DFTA 3WHXA 2NY2B 4NP4H 3EYVA 2OZ4L 2MOVA 3CX2A 1FIEA 3IGAA 3TEUA 4HGWA 3LZFL 3X12B 4FNLH 4NT6B 4H25A 5E7BA 1HHIA 1U8QA 4QGYA 4QXGL 3JTSA 5DDHB 3ARWA 4L4JA 1D6VL 1TPXB 4JDTH 1J9CT 1MFEL 3KGRA 4UT6L 4PJ5B 4LLDA 4IM8A 4ONFL 4X8XA 3IDYC 5ALCL 2PN5A 1H3GA 1P4LA 4K3EH 4XNQB 1YMMA 3GHBH 4NNXB 2QHRL 2YD9A 4ALAL 1TENA 2ICWI 4G7VH 1T1ZB 5D1ZA 1II4E 2IAMC 4HDIA 3SDAB 4KDTC 4KROC 3V5HB 4TTDD 4LFHD 1VEOA 1L9MA 1MPAL 2VDRH 2MHAB 5D5MF 3BD3A 2EIDA 1XMWA 3I2CL 1U8OA 3GMLB 5CHNA 1ZGLM 2Z0BA 1UCTA 2I9TB 3VFVB 2XKSA 5CGTA 1FFNB 4AIXA 3T3PE 4EI5D 3LKNB 3V5KB 4JPIB 3U1SL 2ZCKL 1EGJL 4KVNH 4NZTL 3G04B 4TVPE 3TZVD 3IFNL 4K9EL 1NMAH 3LN5A 3QULA 3E8UH 2C1PB 4OLWH 2N7AA 1RIUH 3MRKB 4YX2L 5I1KH 1CT8B 1AGFB 3VFMA 4LLWA 5F7HA 4S0SD 2WMPA 2IH3A 5C0RH 1LP9F 3OKOB 3WFEL 3UC0L 4ELKB 1AO7D 2D03L 5AWNL 5FO9B 3T09A 2VE6A 2JELH 4Z0XB 1S5IH 4PB9H 1FFPB 5D1ZB 4MSWB 5B8CC 1ZSDB 1D5BB 1OB1B 5IJVB 2YS4A 4ZUWB 1NGYA 2O26U 3B5HA 1U2CA 4KQ4L 5IBTL 5T33L 1XR8A 3X14B 2YK1L 5IMKA 5SX4H 5GGSY 3UAJD 1WZ1L 4JAMA 1FNEA 1HDMA 4FMFA 1WWWX 1NCWH 4G6ML 3F5WA 4HJGA 2NX5A 4YDKH 3GSNA 1T5WB 3QJFA 2Q8BH 4GRLA 3QXDA 2HT2D 3KYNA 1RZIA 1DLFL 4L3EA 4UOW0 4ZDHB 5LKNA 2OJEA 3RWGA 3DX8B 1G7LB 5CSZB 4JHZA 4OD2B 1KPVA 3HUJF 1MCDA 3MXVL 1JFQL 1PQZA 1DFBH 4PJHA 1W0WA 5IMLA 1A6PA 1CI5A 3T4YA 2HTLC 1JNJA 1KC5L 1KXQE 4HKXA 3F62A 4XPBL 1X44A 1BZ7A 1QSEE 2QKIB 2YN3A 4NOBA 3IVKB 1C5BH 2B4CH 4BFIB 5LVEA 5C08E 3IDNA 5H35B 2YPLB 2Y07L 2VABA 3PV7A 2PW1B 3OXRB 1TNNA 1GOFA 5TJWK 3VXUA 2D7NA 2DN7A 4MJIB 3WFCL 5HBBA 3UYPA 3PGCB 4PJFB 4GQ9L 5LCVL 3BZ4A 1TITA 4OCRL 5D9SB 4LPTA 1BD2A 4JRXB 5BVPL 1J12A 2ITDB 4H88L 2FR4B 4BUGA 1NBVL 3MV7D 1LEIA 5KBNC 2ZCHL 3PXJA 1CDJA 4MWFA 1IGYA 5AG8A 4NO0B 3ULVH 3TA3B 3O11B 2Y1VA 4GW1B 5LGHH 2F5AL 5DURB 1FN4A 5T1KD 4M6NL 3BRDA 5IFAH 1FORL 2IADA 4CNIA 4LIQH 5DK3A 2X89D 3WD5H 4L4TD 2VISA 3VFNA 3LKQB 4OLZH 3DV6B 5L88H 2Q8BL 3OQ3B 4WEUD 1NCAH 3E2HC 2HVKB 2H2PD 2O5XH 3MV11 4WFGE 4LCWD 2Y25A 4XTRC 2FDBP 2YXFA 1W72L 1JTTA 3CFCL 1NQBA 3KXFE 4HX1A 4MNHB 4L29B 4PRPB 1QRNA 1JF1A 3CCHA 4K7PH 2UVEA 3QHZL 3PGCA 1Q9LB 3QB7C 5B39G 1FVDB 4M9OA 3UTQA 4KI5D 4DK3A 4WI6A 4DKEH 5E5UB 4LAQH 5HGAA 3WV0A 2PW1A 2Z8SA 1FPTL 4RZCB 5HDLA 5E9DB 1T4KA 2B1AH 2ICCA 3L95B 1OTUC 3OAYH 5M94B 2D03H 1KIQB 4DN3H 1GYAA 5KVEL 1U92B 3MZGB 3B5TA 1N64H 4LGPB 4LKCA 4M6OH 3TJEL 4QRPB 4OCWL 3F8UB 1TFHA 5F96H 4I3GA 1S78D 2YA0A 1GVIA 2HFGH 5KAQF 3QUZC 5IQ9B 1GHFH 3DX8A 5E6IA 2DOCA 5E0QA 5E6ZA 1U6AL 2PO6B 3SO3B 4ZFGH 1T5XB 4P46C 3SGJC 3TN0C 3B3IA 3AS1A 4PRIB 4UAOB 2CDGA 5BRZA 1Y0LA 1A3RL 4JFDB 4KH2A 3RNKB 3B8YA 2PYFB 4JZOA 3SE3C 3BUYB 3T4AA 5ID0A 2E9JA 1IQDB 3LSOB 3RGVA 4QCIA 1IVLA 2IAND 3DVGB 5KSAA 1MJJB 1P4IL 3ARDC 4FTVE 5DJXA 1XGTB 2A6KA 4U7MA 1JF1B 5BV7C 1F8TH 3K8LA 4YR6B 4YWGH 2D7PA 1WFTA 3O8XB 4IRSD 2CLVA 5T3XH 1MLCA 3FCTA 4G6FB 1BD2D 1OAXL 3VXNB 3ROLB 3ILPB 1N6VA 3MA7A 2XA8H 5LGJB 1VSCA 3MOAH 4HIHA 3QDME 3RNKA 1M6OB 3NFNB 5A2FA 2NTSP 3VCLB 4FRWA 4QWWC 2C3GA 4HV8A 2JLLA 1ADQL 3UPCA 8FABA 4AYFA 3H42H 1K5NA 2H2SD 5DSCA 5FV1L 5FDWB 4PJGA 1X5YA 3GSNH 1JZ8A 1JTPA 2QQLL 3V6OA 3CDFA 4AL8H 5KTEL 4WGWB 1MHHB 1K6QH 4Y19A 3SDCD 4FQLH 2ZNXA 2WK2A 5J6GA 1BZQK 1AH1A 3P4LA 4NFCA 4YBLC 3HE7A 2EE9A 3CLFL 4HKBA 5ALCH 1C7SA 3RKDC 5BVPH 3CXDL 2NX5E 1NJ9A 1WBZA 5I8EB 1L0YA 4OM0L 4QRUA 2GW5A 1EO8H 3TIEA 2HVJB 3GIVA 2FX8H 1CD1A 2ATPA 3MLXH 3LN5B 5HI4D 2X1WL 5MENB 4OFKA 2CO7B 1Y0LB 4NBXB 3RHWK 4MJ6B 4PY7B 1JZ7A 1ZLSL 5DEGB 4QRQA 4M7LH 2CUMA 4QNPF 5DFVD 2VR4A 3ZKXC 1KLFA 3R06B 5GSRB 2AKRA 1I8MB 1FNGB 3ABZA 4Z7QE 1T1WA 4YXHL 3W11C 1IQWH 4OI7A 1AQKL 1WF5A 5D6DC 5EFIB 5F1OB 4FFVD 3T0WA 4ODVH 3TO4C 3NCEB 4UIKL 1EAPA 3KS0H 1A9EB 3QFJB 1KT2A 4MA1B 3T08A 1EEUA 3GMMB 4NBYB 4LAJH 3MJ9L 3K7UA 4S10A 1OGTA 1Q9KB 3L9RA 3LN9A 4OV5A 1BOGA 1X5FA 5AZ2H 3TYFB 5DMGC 5HHPA 2BVOA 1RUAL 4XXDB 3LKOA 2UWEA 5FOBA 2XXMB 5DRZA 4PUBH 3MRBA 2BVPB 3FQNA 5KVEH 1HSAA 4P0DA 5DD6A 5TQ0L 3TESA 3DRTB 4FQCH 3TLRA 3HRZA 1AXTH 1AGBA 2RJMA 4TPRH 5FA3A 3TF7C 3RU8H 3SGDI 1KIPB 5CAYB 1FCCA 4OZ4A 4XP1H 4DQOL 4N9GB 4PIRF 4K71C 3KLDA 5T3ZH 5SWSD 1SEQH 3ARZA 1X7QB 2XKUA 4WW2A 2BNRA 1S7RB 2X4UA 2VN4A 1JZ4A 2F74A 5D1ZC 1WFOA 4GMTL 4HWBL 4ZOCA 1U58B 5ETUA 4DVBA 1SEBA 3UP1A 4OD2A 1R3HB 5FV2A 3S37L 2E7CA 4PGEA 4ODXA 3RTQA 4PJ5E 4ZUSB 3ZHDA 2WIIB 1KEGH 1NGPH 4NC2B 2P4AB 2ESVD 2VAAA 4NUGH 4AH2B 2DS4A 3EDFA 1YYMH 2K7PA 1FO0L 4OCSH 1A7NH 4MQXC 2A83B 3D3VB 5DWUH 3LD8C 2X7LA 4LRNL 4XC3L 5C0DA 1LO4L 3BGAA 4X9BA 1RZIB 1YNTB 2H32B 5I73B 4HMEA 4PGDA 1S8DB 5DS8B 1FO0A 1RZ7H 1V7NH 5ITFB 2W59A 3GHEH 1ORQB 1DEDA 4NKDA 4RGNB 5I2IA 3VXQB 1NCWL 2C7UA 4L4VB 4FQJH 1U93B 4XCEB 2LAAA 4N0FB 3GMRA 5AZEH 2VL5A 5BS0E 4Z7NE 4NQCB 2A6JA 1EHLL 2V2XA 5GRVL 4DCQA 1CVSC 1FN4B 4NQXB 1ZHKA 1IC1A 3E6FA 1N6UA 1J8HB 4KPHH 5B21A 3RPIA 3S9DB 3VWJB 2DL9A 1BVLA 4JZNB 4TOYL 1IGMH 3ULVC 5A2IH 5ECJE 3Q6GH 4LIQL 3G5VB 3QNZA 4OTXL 2IBBA 4P5KB 4QT5A 5HHQB 1YNLH 4YNYB 5CZXC 5KZCB 1SM3H 1VPOH 3VMPA 5K9OA 3QXVA 2R23B 5GISH 5ISZB 4R26H 4EOWH 3QNYB 2FJFB 5IMMA 3L1OL 4ZFOL 1CGVA 2OS7A 4RISL 3PWJA 2O5YL 4BH7A 1MNUH 4PLJC 1I85A 3BIBX 5I19L 3ALPA 1UWGH 3KPSB 3MGTB 3OKLB 3EYFA 3GKWH 4JREC 1A1MA 2AJVH 5LCVH 4KJQD 4WO4B 1F97A 4R7DA 1VGEH 3DVNB 1U8HA 3DUSA 4JFFA 1RJLB 4Z7WB 4PGDB 3FQTA 3GZKA 3BJLA 2HLAB 4RFNC 2BNRE 1DE4A 4KKBD 2AJZA 2BSTB 4M7JL 4M00A 4F8QA 4OCXH 5CKGA 2PTTB 1EFXA 3V6ZB 4HIIA 1OY3B 3GJFB 4WEBH 4M9PA 4MAYD 1QVOB 3VE0B 2K3TA 4ENEC 3WKMH 3BPOB 2IQ9H 4HD9A 3MCLL 2ZUSA 1C8PA 5HHQA 1IKFL 3E6FB 4KY1L 3U6RA 2PW2A 1GZPB 3I3DA 3O6FB 4QRRA 1JNLH 1NLDL 4O5LL 3PABB 2J3SA 4X4YB 2O93L 4KPHL 4PBVC 4I2XE 2VRAA 1OB1A 5IJVA 1ZK9A 4DZ8A 3DXAA 2V9RA 3R8QA 5FGCE 2XN9D 2ZUQC 5C2BL 5JTWA 3MRDA 1N3NA 3CFKB 2EDEA 4PRHB 5DLMH 1S9VA 4YDJB 3VFOA 4YWGL 3O6FA 1ZVSB 4QRRB 1A6VH 4NKDB 1QLFA 2WWMD 2ENYA 1PKQB 3WO4B 5C3LD 2FHFA 1MCFA 1B0RB 3LRGA 3V6BR 3OZ9L 3ARFD 1KTRL 1QPPA 4ZS6C 5DRWA 2OMBA 4R6UA 1PX4A 5JDJA 5IROC 5MEQA 3NAAL 4PG9A 3VGBA 5C0CA 3U36B 2PUQT 5CSBA 5C8JA 3MMEB 3TBTB 3VFWB 3FB7B 4G8GB 4OLXL 2HLAA 4UV7L 3PGDB 1ZLVH 1ZXQA 5IIEB 1BF2A 2P5EE 1T1YB 4MXQD 4HS6A 2BMKA 1QBMH 1T20B 5HGGS 1I1CA 2H6PA 4JCLA 4FTVD 3Q48A 4HKBB 3T65A 2N4IA 1HYSD 4CADB 1ZGLP 3HUJB 4KKNA 2VDOH 2DLTA 3DROB 2MFNA 5GIRB 2D3VA 5C09E 1QOKA 2IFFH 2E7BA 1JHTB 5DUMH 5BMFL 1CCZA 4ISVB 2EO9A 5JPMA 4Y19E 1S3KL 1K5NB 2QQKH 2CIKA 4N8VG 3QXAA 4CU6A 4QHLA 3S36L 4IRJD 3D85D 5FGSA 1HH6A 5E4EB 5EUOE 2PYED 4PRPA 4S1RL 3BQUD 1KENL 3ARFA 3VXSE 4N1HB 2FGZA 1UB5B 5IBTH 5T33H 5TDNB 4RFOH 4ZTOL 1A6UL 4M62L 4V2BA 3VG0H 4AEHL 2JIXB 2QSVA 4TNVK 4NM8H 1V8HA 1GAFL 3GSWA 4XPHL 1A7OH 2DQHL 1MLCB 3FCTB 4PJGF 3T3ME 5HI3C 1G0YR 4AL8L 1HH6B 1DN2A 3AM8A 1I1AD 1RUQH 2G75A 1NC2A 4KXZH 4PJBE 4HW6A 5ID1B 5FYJH 1IZKA 3CIQA 1NFDA 3B9DA 3LEXB 3S34H 4XAWH 3BEWA 4IIQA 4ZNCD 3SCMB 5FB8A 4JDZB 5JQHC 1OP5K 3PWNB 3GSWB 1ZANL 1X4XA 8FABB 5AYUH 2VMFA 4EI6A 2NXYD 1MJ7H 2JCCE 4IOFC 3VCLA 4F3FA 1JNHA 1L7IL 3TH4T 4J2XA 5J12C 4XPTH 4P2OA 3MRKA 1CD9B 4TVPD 4KQ4H 4OLUH 3KPRE 4JB9L 4EDWL 4LPWA 3FZUD 5HGHA 3QUZD 4YXHH 1MCNA 4QRUB 4AH2A 1CQKA 3UZVB 1AHWA 3O2DH 2WM0A 3KPNB 5KG9A 2DM7A 3PWPB 2IFFL 3V95A 4QHLB 2EC9U 4KJPD 1NAMA 1S9YB 1SEBB 3F12A 2CDFA 5MEPA 2CDEB 5J89A 3QCUH 4XPFH 4PYGA 2NY2D 5E5MA 2P49B 2ZUQB 3B5GA 3QDMD 1I3GH 1NUNB 3MRCA 2Q8AH 3SKNB 3PGDA 5ID1A 1NC4D 4F7EB 4GG8A 3PDOA 1VESA 3G5ZA 5DUPL 3ZO0A 5AD0A 5CJQH 5IVXA 1KJVA 1HKLL 4ZXBD 3HR6A 5CD5D 1BJ8A 4Q6YA 4KKBC 5E70A 1F4YL 2GT9A 4PJAA 1NFDB 3Q6FB 3PJSA 4ONHB 1XF2B 1J8HE 3GUTB 3FT3A 3S3PA 4MNQA 5A43C 1NJ9B 1WBZB 3VWJC 1ZEAL 5HHOE 1E4WL 1QSFE 4NQCE 3ET9F 3ILPA 2FCBA 3MA7B 5D6CB 1UXSA 5IB5A 5L9DL 4QEGA 2ZPKL 2W9DH 1Y6NR 4YBQD 3P9MB 3DXAE 4KTEL 5D7SL 5BXFB 4NRZB 1M7XA 2FSEA 1T21A 5JA8B 4O58L 1I7RB 5TQ2H 5F7UA 5HYSG 4LP5A 3QUML 3X17A 4NKIH 1G9NL 1RVFL 1FPTH 4XGZA 3D2UD 5TH2B 3MNVB 4HAFA 3L5XH 3QQ9D 2I9LB 3PV6A 4GT7A 3RWEB 43CAB 3A6OA 2UUDK 5CUSL 3MYJA 3C6LA 4PV8B 4Z7QF 3O3EB 1HNFA 1S8DA 4ODTH 4Q2ZB 4KRPD 1NGPL 1LO2L 2WV3A 1HHJA 1E6JH 5CLWA 2CJUH 2RCSH 4HMCA 2Q6WA 2UY6A 4O51A 2C5DC 3KPOB 4LSPH 4UNTA 5HDQH 1U6AH 3RFZC 4YR6A 5HPOA 4I18A 5F7LB 2XXCB 1DANU 1GIGL 2GJ6A 4GW1A 1FNLA 5IMOA 3G6AB 3U9UB 2WIIA 4L9DA 1NDMA 3D0VA 3QIWC 3QUXB 3VG9C 2F19L 3W5MA 5EA0H 4NNPH 4QRTA 4P49A 2OM5A 3HZKB 4LEXH 4PJ9B 4GS7B 1Z9MA 3SDAA 2HT4C 4IMKA 5K33A 4QXGH 3T0XA 2G5RA 5T3XL 4NQTA 2L7UA 3C8KA 3MLRL 2HT2C 1RUML 4YXLH 4HIJA 4QHUB 3FB5B 1N2RB 4ONFH 1MCKA 1D5ZB 2R0ZL 3VXQA 4YHNA 3AS0A 2GAZA 5DUBB 2F5BL 4I1NB 2O61A 1OT1A 1WTLA 3VXRD 2ATKA 1R5IB 5HVHB 2X40A 4R4BB 2Q3AA 4NM4L 2F58H 1KCSL 3K8MA 4EDWH 7CGTA 1QEWA 4HC1A 5A3IC 1PKQA 5FXCH 4R26L 2CR6A 5ANMB 3MV8B 4LQ1A 2XWTA 3IAQA 1CDBA 3AC0A 2A6JB 3HRPA 1EEZB 2NMSA 4L3EB 5CCKH 2X89A 1XCTB 3V0WL 4DZBB 4X7TA 1CE6B 1UWGL 2E8ZA 4NZRL 4DVRH 1EBAA 1HI6B 1FYTE 1ZHKB 3GSOB 1BBJB 2D7QA 1IJ9A 3EDEA 1EGJH 4OM0H 3SQOL 1HXYB 3QISA 3VXUB 2R1YA 4U6VL 2E9BA 3LD8B 4GXVL 3X14A 2WNGA 4JKMA 3ALWA 3SY0B 3DYOA 5DVOA 3QDJA 5FM4A 3RZCA 1L9NA 2GJ6D 1IGFL 1KIRB 2AK1L 2NQCA 3BT2L 4LLAA 4ZUUA 5AAMA 4K71B 3K8KA 2X4UB 3QWRA 4ZUWA 5M95B 3OAYK 1FRGH 1A3LL 1CDHA 3LAFA 2QLVB 4UU9B 2FJFA 5MENE 2VABB 2WBJB 3V0AC 5DGQA 1QFUH 3BFOA 2W0PA 4GKNB 1UB6A 3FOMA 5JXAL 1CXEA 3IDGB 5B39A 1HIMH 3ARBB 3KS0J 3JUZA 5F71A 1I1FA 3GB7B 2R39A 1KF9B 3NACL 1ACYL 2WQRA 4WFFD 3UJIH 5ITBH 3NA9L 4NJAH 1F2XK 3LDBC 4JZNA 4PJ8B 4J12A 1MQ8A 4J8RA 4P4RA 1KLUA 5IV2B 3N50A 3PL6B 4P23C 4X7DC 2F54B 3MXWH 1YPZA 1RZKH 4AEIL 4Y1AA 3RDTB 4ELMA 4MB5A 4NQSB 3U9PH 5IR1B 4ZQKB 2VSDA 1RVFH 5JQ6H 4XX1G 1DSFL 3WDIA 4LSUH 5CIPB 1BREA 1A9BB 2VKXA 3T4YB 1P84J 4M3JA 3WDJA 1BECA 3GBNH 4NHUA 3N1MC 1HI6A 2B1HH 1BEYH 4NN5C 1DQDL 4WUUA 2OCFD 3QUKB 1XIWD 4KVCL 1RZ8A 4Z7UA 5E08L 4HKJA 3U7WL 5IT2L 2VDPH 3M8OH 2P24B 1JWUB 5EZLB 3INUL 4K3DL 5IVXF 1HQRB 1ZVHA 1Q9WB 5HHXH 2XFXA 3ZE1F 3BKMH 3OKOA 35C8H 5E8PB 3MYZA 3BYYA 1I4FA 3L3IB 2IAMB 3QHZH 3ARRA 3JUYA 4DWHA 3QDMA 3REVA 2EH8L 5JHDA 4G8IA 1LEIB 3D39D 5EA0L 3C6SB 2FB4L 4PS4H 1UB5A 4GJTB 2DQCL 2D7OA 4LMQI 4WTXA 5I1DA 1HHIB 3KNBB 3I02B 3O4LB 3FQWB 1KCRL 2HJKA 4KKLD 1JWMA 4TUOB 3KPPB 5JXAH 2ZUXA 4PRID 3W5NA 4Y4FA 1RJCA 4FFZH 4R0LC 1C08A 1FYTB 1QBLL 1ZKAA 1EUUA 2UVFA 4O2FA 4WFEE 3DHMA 4LHQB 1FAIH 2HJLA 4X4XB 1LGVA 3NCFB 5L8KB 1IGJA 3BHBB 4MLIA 2ICEB 3ZTJH 3MLZL 1EK3A 4HBQA 4XNMB 4U7KA 4XC1L 1UCBL 5HYJB 3PWUB 4WDIB 1P7KB 2X4PA 3L95A 3N9GL 3NFNA 4PLOB 2O5ZH 3HCVB 3WS3A 4PRAB 3MLTB 4B7LA 1JZ5A 4D3CH 4XNZC 3CPLA 3KPRD 4GKNA 3L3IA 3V0WH 4URTB 3P30L 1MY7A 4JFQA