2GJJA

Crystal structure of a single chain antibody sca21 against her2/erbb2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
255
structure length
236
Chain Sequence
EADIVLTQTPSSLPVSVGEKVTMTCKSSQTLLYSNNQKNYLAWYQQKPGQSPKLLISWAFTRKSGVPDRFTGSGSGTDFTLTIGSVKAEDLAVYYCQQYSNYPWTFGGGTRLEIKRGEVQLQQSGPEVVKTGASVKISCKASGYSFTGYFINWVKKNSGKSPEWIGHISSSYATSTYNQKFKNKAAFTVDTSSSTAFMQLNSLTSEDSADYYCVRSGNYEEYAMDYWGQGTSVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords A21 single-chain antibody fragment against erbB2
publication title Epitope mapping and structural analysis of an anti-ErbB2 antibody A21: Molecular basis for tumor inhibitory mechanism
pubmed doi rcsb
source organism Mus musculus
total genus 57
structure length 236
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gjjA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gjjA02
2X4SA 1D5IL 3S37H 3HUJE 1F8TL 4X6BB 1JZ4A 1CICB 1KXVC 1CE6A 1U8IB 4G6FB 3L6FB 4TSAL 3OJ2C 5JDSA 4GRWF 3CGTA 4JG0L 4FQQB 1LEIB 3L5IA 5A2IH 1U8QA 4OLXH 5D9SA 2MHAA 4Z7OF 3MJGX 4LQ1A 1IKFL 5F7DB 1JRHH 4ZUWB 2UV3A 5SWZE 5IMLB 1G7PB 2H6PB 1DQML 5GRWA 1JYNA 5DFVD 1KFAH 4FQCH 4PJCE 2BK8A 1BECA 4NZTH 1E4XL 1KIQA 4Z7UF 2V6HA 3B43A 1KN2L 1YEFL 3G04B 1I1FA 5I17A 1U8OA 1NGYB 4I48A 3SDDC 2YPLB 1KTRL 5E8DL 3ULUF 2XFXB 3U0WL 4E41A 1MFCH 1TQBC 3L1OL 2X6MA 3BDXA 2XN9E 4I0PD 4OIBA 3KPQB 3S9DB 1XAUA 4IMKA 1AR1C 4MA8L 1QSFA 1P7QA 4K3DH 1HIML 3DGGA 4Y1AB 1IGMH 2QKIB 3W0WB 1A7QL 2CPCA 3QDGE 1WBYA 5IMMA 4KI5C 2P5EE 1PLGL 1U3JA 5CJ8A 1T04A 3ARYA 5T1MB 1U6AL 3DURA 4MAYC 1ITBB 2DIAA 3FO2A 1D5ZA 3GRWA 1XGTB 1GAFH 2JJTC 4LPYA 1KT2B 1CU4L 2NW2B 3V6OA 2OK0L 2AABL 4AEHH 3ZTJG 3O2VL 4UT9H 3PP3K 4HHAA 5DMKB 3CAFA 4JHBA 3ZKSD 1NBVL 3RNKB 2Q76A 4NN7C 4HWZA 3BRDA 5BXFB 1T4KB 2Y9RT 3H9SA 3P30H 1A7BA 4D94A 1KJVA 1MJ8H 2A6DA 4X99A 4GAGL 2MJWA 3RWIA 4LU5H 4HZLB 5DHXB 5KVEL 1ADQH 3RZCB 5DVKA 2VL5A 4TVSa 2ATPA 4X5LA 1QLEL 3C9NA 1CFVH 1MCJA 3BDBA 5KVGL 2GAZB 3BGFC 4L1HA 5K59E 1NFDF 4UU9B 3UBXI 3CX5K 3DUSB 1M05A 2J3SA 2X4RB 4GOSA 1IC7L 3IDYC 3ZYZA 2O5ZL 1K4CA 1G9EA 1VKXA 2B7DT 4Y5YA 5ITBH 1GGCL 2BOCB 4WI6A 5D1ZD 3RVXD 1X6NA 1J8HB 3QEQD 3QNXB 1JZ7A 1OARH 1TPXB 1X5ZA 3V4UH 5KW9L 4JM2F 3JWDC 2MQ3A 1T5WA 5C0FA 2IMNA 5DEFA 5HI5D 4M00A 1YPZA 3CFEA 1XF5B 2HFFA 1TVBB 5E5UB 2X4QA 4K55A 1W8NA 5EO0B 3X14A 2ZOLA 5IF0B 4TOYH 1E4JA 4OLUH 1S7SB 1RULH 1SHMA 3HZKA 5F1IA 3QNYA 1ZT1A 2HRLA 3IDMA 3VA6A 2RBLA 3PGDB 1E6JL 2ZUWA 2RIKA 4RGOH 1AD0B 1ES0B 4JANB 2QSQA 1PZ5B 4YQXH 1OCWL 4BH8A 4G7YH 1P1ZA 2GIYA 1E28B 3SJVD 3GSNA 1FFPA 4DOHB 4HBCL 5EIIB 3O6ML 1BQUA 1GIGL 1T83A 4XNZB 4O02H 4Z77A 2XZQH 4ELMA 1RUKL 3BI9X 3TA3C 1UB6B 5EC1B 1Q9WB 2D7PA 1QUNA 5F7FA 1WBZA 3OAZH 4LRNH 1A3LH 3U36B 1ZHNA 3F7PC 3WFDL 4IDJH 4WW2B 4HULB 5BZDB 2W9LA 1BZ9A 5AYQA 5DUMH 4OFYA 3RWHB 4NYLB 2HYMA 1E0OB 5HDQH 5I74C 3EYFB 1YEEH 4KAQH 4MJ2A 3QUZB 2DYPA 1MHEB 5BV7C 1F4WH 3E0GA 4QHLA 5IVXF 5IR1A 1MH5B 1IRAY 4YBQD 3MV11 3DHMA 2N7BA 1KGCE 1QG3A 2W0FA 3GIZL 4S1RL 4AM0A 4P23A 2YRPA 9CGTA 4XP9L 3NA9H 4L3ED 3WLBA 2EDNA 5M7QA 4NKOA 2NQCA 5DD1L 4GFTB 4LOUD 3WIHH 4M43H 2IPUG 1T1WB 3FQUB 4LSUL 4POZC 3HAEA 1MREH 4JVWA 1I85A 4YO0B 2R2EB 2R39A 4MCYA 1NGPH 5ENWA 2YD7A 3LH2L 2AJ3A 2BOBB 4M48L 5HPOA 4F58H 5EBGA 4XXCA 5I1LA 3ILQC 3QBTB 1RSFA 4N8PA 1OGAD 4D3CH 3ES6B 5GGUB 2AP2A 5CEZE 4BSVA 1ZLSL 4YC2C 1HH6B 4KI5E 4M1CD 5J13C 3CU1A 2ID5A 1FL3A 2Y07H 5D2LF 2AJYL 3ARDB 1QLFB 2CLZA 5MHSD 4HKJA 1RZKH 4A6YH 1CD8A 3CLEL 4L8BB 1A1MB 4LSRH 2C3HA 3FJTA 4QY8A 4S0SD 3ARGD 1VSCA 4D8PB 3DWTA 1B0GA 1L7TH 4GW1B 4YFLI 2F53A 5FGCE 4NKIL 2MPAL 1NUGA 3W9EA 4RMWA 4PLNC 5KSAB 4LHJB 3RTQD 1UCBH 3VJ6A 3RUGE 1LQSR 3U30C 4P3WA 1RU9H 1HEZB 1XH3B 4LKCB 4YHNB 2H32A 4OD2A 4RGMB 3S88L 1HXMA 2UVFA 4JFFE 4DFHA 5C0JB 5E6IB 3QUXC 1CICD 1TZIA 1T5XA 4G6FD 5IFJA 3AREB 3M8OH 4ZUUB 1KIRA 5C0RL 3GMRB 5L8KB 2QR0B 4FFVC 3KR3L 5GIRB 4CN6A 1DL7L 4YR6B 1JMXA 1NCAH 2PETA 5KVDH 2EE6A 1E4XI 3PWUA 3E8UH 1BQHB 3X3FL 1LO3L 2FJHB 3P11L 3EGSB 2GYSA 1FV1B 2DLFL 4NSKA 2PYEA 1SY6L 2DLTA 4NKQB 3CLFL 5EA0L 5SWQA 3JV6B 1R5WA 3T65A 1Q9LB 2VLJB 4M7KL 1OLLA 4WW1B 5JIHA 2YPLD 4XPHL 3LB6D 3OR6A 4OSUH 2GITA 3I50L 2DQHH 3KPSB 2CKNA 4MDJB 1DN0B 2FH8A 3MODH 5ICZB 3THMH 2F53E 3S96B 4JN1H 4HUWB 5DQJA 1A5FL 2W59A 1MJJB 4OLWH 3C5ZC 5TDPB 3W0WD 2EDJA 1TVHA 3IS1X 3BIKB 2NY4B 4EI6B 5D7KD 3RNQB 3VDCA 4YNYB 3MV8B 3P73B 5KZCB 3FB6A 1U8PA 4UOW1 5T1DL 3WCYA 1N64H 1CDUA 4WU5B 4LPWA 3TJHD 5BVJB 4I9WD 1FZOA 3PWPE 3QI9D 1GC1L 4W4NA 2AS5M 5F7HA 3MOBL 3QG7L 5JXEC 3UTSE 3V5KB 5KOMC 1UQSB 2Y5TA 3QEUA 2E6JA 3I6KB 5BRZA 3VXRA 3BZEB 5CWSA 5CGYD 4G8GE 5I30H 3HE6C 3DV4A 3JV4A 5ID1B 3L5XH 4LDEB 4MNGE 1QFUH 4EDXA 3OPZL 4G9FB 2R1YB 5DK0A 3VXNA 4NQDE 3AXLA 1MAML 4GXVH 2F8OA 4HWBH 1N2RA 1P6FA 1BF8A 3C5JA 1JHLL 4LGRB 4KPHL 1YMHA 2CUIA 4D0BA 2WUBL 2B39A 2FBOJ 1UZ8B 3BFOA 3L7EA 3N1PC 4PG2A 1XGYH 3PP3H 5BS0A 3JTSB 2DQTL 2FB4L 4U0RB 5T3ZE 4EUPA 4ODHL 1VADA 4G42A 4M1DH 4XVJH 3T3PE 3ZDZE 1RK0A 3VI4E 3DLQR 3SPVB 5JOPD 4LSVL 3QDGB 4LP4A 4M6AA 2P5EB 3TBTB 2DF3A 1CD9B 2VZSA 3RBGA 1R0AH 3TYGL 4OZGA 5I8OH 3R0NA 1WZKA 2V7HA 5T1LB 4ZPVB 3KXFB 1HINH 4XVSH 3TP4A 4WHTA 2H1PL 3G5VB 1UJ3C 2G5RA 1DUZA 1LO4H 4X80H 3SEPA 3VH8G 1Q38A 3ALXA 3U48A 4LHQB 2OMBA 4PRDB 1ZEAL 2YC1A 3FQNA 1S7TA 3OJVC 3UDWC 1QQDA 1F90L 1KPVB 3D0LA 4JZNA 2IPUK 4JFEB 2OTUA 4YHOL 1CGXA 2BMKA 2C3VA 4H1LA 1HHGA 1EFXB 5FGSA 1CLCA 1AC6A 2NXYC 5I1AB 3MLXH 1GHFL 3D5OF 2ATKA 3QUYC 3UJJL 2AXFB 4LNRA 1ZTXL 3GI9H 4E5XB 4HS8H 3Q48A 2A77H 1KCRH 3MRLA 3V79C 2HP4A 3TVMC 4MD4A 5D6CB 1DBKH 3LKQB 5JOFB 5EBWB 1JNLH 2DRUA 4XB7A 4KRLB 1RZFL 3GSWB 1TTFA 1NGZA 5GRJL 4F8QA 2V7NA 5EFIB 1MJUL 4Y16B 5HYFA 3TNNA 4FABH 1N5YH 1RHHA 4JVPA 1JGVH 1I8LA 1UZ6E 1YY9C 2VUOA 4GO6B 2IPKB 3CDCA 3HPJA 4R4BA 5FHBL 3RA7H 4F7TB 3X11A 4PRHB 2BSTA 4LSTL 3GMQA 3HTLX 1IAKB 1ZKAA 3BN9D 4KKAC 5BVPL 3GO1L 5D1ZA 4CJ0A 3BT2H 4JDTL 1AHWA 3MRQB 1F42A 3S34L 3OAUL 2R2BA 2CIIA 1OQXA 1J1PL 2Z31A 3DUUB 4X8JA 4NQTA 5EZLA 4Q6IA 4HFUH 1MCRA 4JRYD 1SYVA 4YHIB 4OCSH 2DLIA 4DN3H 4JKWA 5E8PA 4JLRA 4I2XE 3MZGB 5FA4A 3RY5A 3VFVA 5CBEB 1X44A 4JVUA 3EO9L 4BA8A 4EDWH 4Z7VB 1JTOA 2OCFD 3C2AL 1QD0A 2VC2L 3UTTE 2OBGA 5DI8A 3O4OC 2YPVL 3FO0H 2GHWB 4Y4HC 1E4WL 4TVPE 3EZ8A 2HTLD 2P8PA 3V4PH 2HVJA 2Y1VA 2GKIA 2O5XL 4CU6A 1QA9A 1B2WL 5ITFB 32C2A 4TQEL 4JM4H 3QA3A 4BJLA 1RJYB 4U1HB 1XZ0B 5DJZA 1WK0A 1KPRB 4LL9A 2Q1EA 2UZYB 3FB5A 4ZFFA 2ADIA 4QT5B 2DKUA 4JRXE 1AC0A 2JIXB 4P2CG 1H8SA 4LRIA 4P2OA 1R3IH 3AU1B 3BP5A 1GGUA 4LLUB 3VFNA 2UWEE 3WSQH 4NO2B 5E4EC 2FECL 3HC4L 4U3CA 1ZLVK 5F3HA 1T6VN 3P9MA 4X7FC 5JIPA 3FONA 4OGAD 3F58H 1A9EB 5AAMA 5E6ID 1IGFH 3RFZC 3Q3GB 5LQBH 4WI8A 5AG9A 1EERB 4WDIA 2DIBA 3ARED 3WN5A 5E08H 1FGVL 1TQBB 3O0RH 1U2CA 4D9LL 5DMGC 1R24B 1UVQB 1C12A 1JHKH 2XTJC 2A6KA 1A1NA 3CX5J 5HTSA 2FR4B 4JZOB 4UQ3B 4K3HA 3LRGA 3U9UB 5HPMA 2P8MA 4XVTL 4MAYB 3OX8A 4HIHA 1FAIL 2R2CA 3FKUS 3LHPH 3CC5B 1YQVH 1FO0L 4EVNA 5IT2H 1IGYB 5HGAA 3QDHA 4F9PA 2NY5L 3QWOA 2VLJD 3HHRB 2LVEA 3S4SG 4NN7B 4DGVL 4GMSH 5DR5L 1XGPB 2JELL 4XZUB 3ZTJH 1A1OB 4HT1H 5C6WH 5FGCB 5FYJU 4G8FA 1GZPB 1K4DB 4IOFD 5DC4B 4WCYH 3RUGB 3HC0B 1DBJL 4YDJA 4Z7UB 4YIQB 4U7MA 5T5NF 4NJAH 5IQ7L 4OZHA 4WUUD 3MV8D 3RVWD 4PJ5D 5KZCD 3D69B 2X9YA 4GBXC 1D3CA 1JWUA 3LV3A 4S1SH 4U4BA 1MCWM 2EYSA 3NBNA 4KJYA 4Y4FC 3MUHL 3BGFB 2XZAL 3QPQC 3RVUC 3NIFF 1ACZA 3IDYB 4GRWH 5TGBA 4KVCL 1BEYL 2DI7A 4R4NC 2QTEA 4DZ8B 2YD2A 3OKOB 5TF1L 4X6BA 3RWFA 4HUXB 2A9MH 2JCCB 3C6SB 5CHNB 4N0UA 5SWZD 1IM9A 3SGDI 3UO1L 5I2IA 1HQ4B 3ARWA 4XAKE 4JFZL 3VMOA 1LEIA 1FH5H 1O7SA 5EZIH 3V8OA 1G7HB 4LKXB 4XCFL 5E00A 5TE4H 3FB7B 4RFEB 3TH2T 1S5HA 4ZUWA 4O00A 4CDGC 5IMLA 5KN5B 1G7PA 1C8PA 2AEPH 2H6PA 3SGEI 4R90L 5SWSE 4O4YH 12E8L 5F6HI 5GPRA 2YEZB 3MBXH 3ULUH 1S3KL 2VO5A 3P0YH 4Q97A 1T22B 5I71C 3K0WA 2AJSL 1J9CT 1E6OL 1JV5A 3G04A 3MRJA 1QRNE 4MJIE 5FKPB 5C08B 3V7AG 5KTEH 2YPLA 5E1AB 2AJUL 1OAQL 2XFXA 4EEEA 1DEDA 1BFVL 3QDGD 1QZ1A 3TA3B 5IJVB 2P5ED 4HIJB 3KPQA 3VXME 1YEDB 4LLWB 5IG7B 4K94C 4OJFL 4DGYH 5T1LD 1DR9A 1DFBL 4Y1AA 3KXFD 4X9HA 3V8CA 1CLYH 5ERWB 3WS3B 3NCJL 3TH4T 5FO7B 4M6NL 3CFDB 5T1MA 5HYJA 4U33A 5I74B 4G8GB 2B4CL 2W92A 3QO1B 3C2SA 1XGTA 4KK9C 1KT2A 4X6FB 2NW2A 4GMTH 4FG6D 4JFED 3TT3H 5BV7B 3CVHB 3FMGH 1NUNB 1Q0YL 4NHUA 5J89A 3LEYL 2FYYA 3I2CH 4RAHA 1T4KA 2CRYA 3HG1B 5BXFA 3O3AA 3U2SB 5IM7B 2X70B 3ME0A 4RMQA 2UYLB 2YHGA 2HH0L 3RZCA 2C3XA 4PJAE 4OLYH 4U1LA 4JO3L 4NQXB 5DK2B 5ISZB 3KLSA 4Q9CA 5CUSL 1IM3A 1KELL 3M45A 4Y16D 3EYSH 3W11C 1P4IL 4P9HL 4FMFA 4I3RH 4ZOBA 4V1DE 4KK5C 3DUSA 4XWOD 1PJ9A 3AM8C 4N0CC 4NJ9L 3VXSB 2X4RA 1KLFA 3TIEB 3SGJC 2M26A 4UBDD 4BZ1L 3UTZA 1JF5A 4UAOB 1KN4H 4YC2B 1J8HA 1I8KB 5EWIH 2FWOB 3QNXA 1RFDH 5J13B 3EDKA 1Q0XH 3T4AA 3NVQA 2E6PA 3MLZH 1W0VB 4PJFF 1L9MA 4WWKC 4HD9A 2GCYB 4NUJB 5IVXB 1N8ZB 2WWMD 4OFVA 3TV3L 1V7NH 3ECBB 1TVBA 2VXTL 5DLML 4PJEA 4YEEA 1YDPB 3VFGH 2I24N 5LGJB 2VZVA 4FQXB 5EO0A 2ORBH 2YUWA 1S7SA 4IRSC 4M9PA 5K33A 1HI6B 1F45A 3ALWA 5DD6B 5GS0L 5LWYL 3PGDA 2M2DA 1JJUA 3FN3A 3PWJB 3U30B 1PZ5A 1NLBL 1RIUL 2R2HA 1E28A 4U6YB 3T2NH 1RJCA 2OJZH 1S7VB 2CQVA 3BXNB 3DOSA 2AQ2A 3WIHA 3QUXB 2HAZA 2AJXL 4N1HB 1N6QL 1JN6A 1UB6A 3QNZA 5EC1A 1Q9WA 2ZSWB 1H15B 3QEHB 1XCQB 4JR9H 1MQKL 1FN4B 1UGNA 5FK9A 3U1SH 4BH7B 3MNZA 2JIXD 4WW2A 5BZDA 5D2LB 3FT3B 4KUCD 3CMGA 3MA7B 5DS8B 1CR9H 4UV4L 3LEVL 3FO1B 1KULA 2GJ6E 3QUZA 3FT2A 2A6IA 3QO0A 1MHEA 2VN7A 4U1SB 4PJ8B 1V3MA 5F7EL 4CMMB 2ZPKL 3IFNH 4MQSB 1Y0LB 4UTBH 4AYFA 1A6VL 4A6YA 4QKXB 4NC0B 3S36H 4HGMA 2LU7A 4FQPA 1TNNA 5ETUB 3SDDD 5TE7L 3FRUB 1QEWA 1J1XL 4Y4KC 2R0KH 2W0KA 2AK4E 2Z92B 5HVWA 3LS5L 3JWOC 3VW3L 4H88H 3QCUL 3BD5A 3C5ZB 3QXWA 4YPJA 2R2EA 5CEZD 3CVIH 3MV9B 2UUDK 4LEOB 4KI5D 5E2TH 3VD4A 1RZ8B 2BOBA 3BYTA 4BKLB 1HILB 1CZ8L 3P4LA 5DHVH 4KWUA 4MAYD 1ZLVH 2HJKB 2F5AL 4PRPE 1CT8B 2IANA 1EO8H 4MQ7B 4CVZA 5GGUA 1CYGA 4OD1H 3PDDA 3ROOB 2ZCKH 4M1GH 2JLLA 3ARDA 4JRXB 1QFWM 3HE6B 1QLFA 1FVEA 1U3HC 5E2WL 4L8BA 1LDPH 4CW1B 1A1MA 4KQ4L 4FTVB 5ALBH 4PJXE 2UWEB 1RUMH 5FIEA 3NOIA 1DP0A 4D8PA 1TJHL 2Q6WB 2QQLL 1KJ2B 2GJZA 4GW1A 3SE9H 4YXHL 4U1IB 4U3HA 1SJVA 4KKNA 3PXJA 4EN3C 5KSAA 1XR8B 1JWMB 2AV7B 4UDTA 1IQWL 1RURH 2XQYG 1LK2B 2VDPL 1HEZA 3N06B 4GSDH 5IB5B 4JB9L 1XH3A 2CGRH 4LKCA 4MD5B 4TUJB 5BMFL 1PKQB 1QFWL 1K9TA 1MHPL 3QWRD 4S0TD 1D9KC 2W07A 5C0JA 5DFWH 2E8ZA 4JHZA 3QJHB 4PY7B 1RAMA 5HHNB 2H41A 4GLRI 3RKPA 1MFEL 1W2KT 4M5ZH 3AREA 4KZEH 1YNKL 1FIGH 4RISH 4CBPA 2OJEB 3IFOA 4ZUUA 1RIVH 2KPNA 3OWEA 4MDIA 2QR0A 4S2SB 2G2RA 4PRIE 5IV2A 4OIIH 2ZOKB 4YR6A 5DVLA 2E7MA 3R1GL 1C5CL 2BXYA 1JUFB 1BQHA 1KV3A 4XMPL 1UJ3B 2FJHA 1KJ2H 3EGSA 3N85L 1LO2L 5IB3A 1JPFB 1EAJA 2BNUB 1BIHA 1WTGT 1KIPA 4HWNA 5I8KL 4D9RE 3JV6A 1YN7B 2EYTB 2P5WA 4EQ2A 2FBJH 5C08D 4ZTOL 2NXYB 1UT9A 2HN7B 4WW1A 3QUYB 2DQEL 1P4LB 3TA3D 3KPSA 4HWBA 1DN0A 1YMMA 4IBLT 3LD8C 5L9DH 3S96A 3TVMB 3KS0H 3WLWC 1CFBA 3LQAH 5E2JA 4OZFH 4HSQA 5TDPA 4EI6A 5D96B 4WFGE 4YNYA 5LBSH 3P73A 3NIDF 5DD3L 5C8JB 2ZG2A 4BUGA 3GK8L 1EEZA 4G8GD 4WU5A 5BVJA 2DQIH 3EYUH 4ZSOB 3OXSB 2DQJL 4NQEE 2AI0H 1RV6X 4Z5RB 3DXAB 4PGEB 1AJ7L 1WBXB 3V5KA 3WDHA 1UQSA 3QFJB 1NBYB 3I6KA 1NMCC 3VXPA 4NQDD 3OKDB 5GS1C 1J5OH 1LP9E 1OWRM 1IKNA 1XIWC 1CDYA 2VXSH 4ELKB 4G7VH 4MLSA 5FO8B 3B9KC 4JQXC 5IIEB 4G9FA 2R1YA 3GJFK 4IIQA 2A83B 3BGMB 3STLB 4TTGA 2DI9A 4GAJL 4POZD 4X6CE 2WW8A 1YEHH 1O7VA 5T3ZD 1N4XL 2VZ3A 4NN5C 5ILTL 1TMCB 4K3EL 5BZWB 2DQFA 4W81A 1A3RL 1UA6H 3BZFB 1IEBA 1UZ8A 2C9AA 4MJIB 1OW0A 3VXSD 2VE6B 1JNNH 3GSQB 3MLVH 4S11A 3ILQD 3EJYC 3JTSA 5HGDA 4P48A 2X09A 1VCAA 1QLRB 5JUEL 3GSNL 1LEGB 2PO6B 4WO4C 1U8KA 4MD0B 5K9OB 5EU3B 2AXGA 3SPVA 4MA7H 4OF6A 4G6MH 4LBEA 3BPCA 3TBTA 3CUPB 3PDGA 3PQYB 3KJ4C 2VLRB 4ZPVA 1I3VA 3KXFA 3BKYH 5CKGA 1RHFA 3G5VA 1QP1A 1XMWA 3GGWB 4U1NA 1AY1H 1MCWW 4ZPTB 4PRDA 5ID0B 1KPVA 5I6XC 4JFEA 5E4EB 1X5HA 2J8UF 4GW4B 1EFXA 5I1AA 4NO5B 1H0DB 4PJAB 4PR5B 1DBBH 2QV2A 3QUXD 3ZE1F 1HCFX 3DX7B 4E5XA 2JJWA 3S4SB 4PTTB 2VDOL 1AI1L 5C0DB 3ULVL 1VERA 4HX1B 1BM3L 2XXCB 1V05A 2XOTA 3UJIH 3D48R 5JOFA 5EBWA 4NZRL 3TBWB 4J2XA 4PJIA 3RVTC 3BD3A 3GSWA 4FQ1H 4NNXA 2XTJB 2ZJSL 5KVFH 3FQWB 3VXTB 3IJYB 5EFIA 4O9HH 4V2BA 4PB0H 4PRAB 3OKYA 2OYPA 4OCNC 3CSPA 1FCGA 5I1EH 4NC1C 4PY8J 1HDMB 2VDKL 2IPKA 5F88B 1MRDH 4F7TA 4PRHA 1LO5A 4O58L 1CG9B 4IRZL 1IAKA 3Q6FB 1V3LA 5H2BA 5HHVL 3ZKQD 1QO3B 2N1KA 3NZ8A 1JK8B 3O81A 2OI9C 1DDHB 1MWAH 1EV2E 2OL3H 2XQYK 3IDIB 3AFLA 4MS8C 4M5YL 3DUUA 1F6AB 3MYJA 1LNUB 3OKNB 4ETQB 5CINH 4H20H 4YHIA 4NCC2 1P4BL 3F7QA 1YY8B 1CF8H 3D2UA 3GKWH 4TVPD 5GJSL 1PG7W 5CBEA 4GBXB 3VGAC 5EUOF 4NWTL 4Z7VA 1G6RB 1N59B 1D5XB 2PF6A 2VXQL 3QT2A 3WKML 4Y4FB 3L5WB 1BAFL 2E7LC 5T3XH 2EH7L 4R2GD 5JXED 3CSGA 5DMIL 2D7TH 1U92B 5IROC 1BZ7A 4JRXD 4HPYL 3RI5F 1OM3L 3JBG7 1LGVA 4O5LH 1RJYA 5I73C 2PNDA 1XZ0A 3OJMB 4XNMB 1C08B 3IJHA 5DYOB 1KPRA 4HCRH 2GJ6B 4QT5A 2UUDH 2ZUYA 2JKXA 1PEWA 3HNTH 2JIXA 1QFWI 4Y7MA 5CZVH 3AU1A 4LLUA 2VKXA 1KG0B 1NLDL 4OF5A 5EUKA 1JFQL 4ODVH 1DSFL 2I5YH 3PDOB 4M93C 1HWHB 4AEEA 5KAQG 3IDUA 2IH3B 4PP2A 3Q3GA 2OX5A 3O2DH 4EBQL 5I1IH 5FHAL 4IS6B 4OLZH 4TYUA 2EH8L 5E8EB 4WEUD 1D5IH 1R3KB 4PGZA 1R24A 4Z76B 2CRIA 3D39B 1S9KC 5KS9E 1MIMH 1EHLL 1SQ2N 3HN3A 3QB7C 1YJDC 1Z9OA 1MI5B 3LOWA 2E6QA 4HMDA 2FR4A 1J18A 4PJ7B 1X6LA 4XPGH 4UQ3A 3EO0B 5BOZG 5DJ2B 5GRXG 1KB9K 1IKFH 4NWUL 1H3PL 3UP1A 1IL1A 5HYQB 2JJTA 3CC5A 2YD5A 5DJ0B 1IGYA 1UC6A 1QPXA 8FABB 2E3VA 3BPLC 2NXYD 3U6RB 3F7RA 1NJ9B 4L3AA 5IEHA 3IJSA 1XGPA 4UIKL 4OCYL 4XZUA 1A1OA 3W39A 2NY6C 3QZWG 4UINL 1GZPA 5ABDE 3T04D 3PV6B 3TVMD 3LKRB 2ICWJ 3NIGF 4C4KT 5LXGH 4Z7UA 5E8DH 5DJYB 5B3NA 1FE8H 4X6DF 5ICYB 5DC0A 4XB8A 1FL5B 2VLKE 3D69A 3AMLA 3V52H 1U58B 1NAKL 2E8YA 4NBZB 3ZKNC 4K23L 2MCPH 2A38A 5AUMA 3B9AA 1PLGH 2PCPB 3QFJD 4BELD 3QCTL 4KQ3L 4XAKD 4FXLA 4AEIH 4KKAD 4K9EC 4X7SL 2DLGA 4DZ8A 2IAMC 3OKOA 3O2VH 4OCRL 1QR1B 4NC1E 4G6AC 2JCCA 1T89C 3NCYS 4QXWA 3VFMA 5E9DE 1V3KA 5CLWA 1HQ4A 5FYLE 4Q2ZB 3QUMB 1FYHB 1G7HA 4LKXA 3K81A 3MBEB 3ARXA 3FB7A 4RFEA 3QFDA 5KN5A 2IFGA 1AO7B 4IRSB 4OQ1A 1QRND 4MJID 2Y4SA 4Z7OE 2YEZA 3SQBA 3O41A 4F8TA 4HKZB 4RMTA 4S1QH 1RMFL 3WFBH 1ZSDB 4QHNB 3BHBB 2ZKHL 3IB4A 1OF2A 4Y4HD 1DQQB 1INDL 2NZIA 2JB5L 4LEXH 2CMRL 5FKPA 5C08A 1C16B 3B5GA 3OKEB 1WSST 4JAMB 5F7NC 4YXKH 2X7LB 1NFDA 5SX4H 1ZHLB 3GJFH 4M7ZC 1NL0L 3OKKB 4XRCB 5JQ6H 3TA3A 5IJVA 2AEQH 1JI2A 2FLRT 1TLKA 4HIJA 4M6ML 4R97C 4LLWA 5IG7A 5SX5K 4I8DA 5EOQL 4TNVK 4YHML 4XP4L 4KH2A 2Q86B 4JM2A 4ZS7H 3AS2A 3CFDA 3BIAX 4KKBC 4AENB 4CVXB 3QO1A 4JO1L 1UWEL 4LP5A 3AVEA 4U6XB 1E6JH 1B0RB 1KYOK 2ZNWA 4H0IA 2IQ9H 5FM5M 2FJGB 2YD3A 3HG1A 3TPUB 3U2SA 5HSFA 5TE6L 3UROR 3P4OB 1N6UA 1XGUB 1GIGH 1QYGH 5EU6B 4KGLA 5DMGD 5IB2B 2LAAA 4Y4KB 2Z8RA 2XTJD 4JDVA 4NQXA 4Z7QF 5DK2A 5ISZA 4YGAB 2XTLA 4I13B 3HRPA 3BWAB 1N7ML 1NAMB 2APFA 5DURD 4XNXL 3PHOB 3UCRA 2A0LC 2KQNA 3WE6B 4HPOL 1C1EH 3MGOB 5FYKU 3VXSA 5BW7C 3TIEA 4AIZB 1PW3A 3BUYB 1F3DH 1JNHA 3C8KA 4M8VA 4XBPB 3UTPD 3ZTNL 1SBSH 5DA0B 1I8KA 2FWOA 5MEOB 2IALB 1CBVL 5F9DC 4YDLC 1W0VA 5D7IF 4NNPH 3LZFH 2GCYA 2R0ZH 4NUJA 4S1RH 2P46B 5IVXA 5C9JB 1U3HB 4LAQH 5I66A 4P5TC 3BP7B 4J3OC 4ONGL 5I1JH 1YDPA 5LGJA 4FQXA 2AJZA 2Z8VC 5KSBF 1JZ6A 4GBXD 1T2QH 1HI6A 2VYRE 4PJDF 5DD6A 4EN3B 2JJSC 1NEZB 4LAJH 3VFRA 4Y4FD 3ARBB 4RBPH 3PWJA 4Z7WE 3QPQD 3W9DB 1KLGB 4K7PY 3RVUD 3ABZA 5TDNA 4X4YB 4NIKB 5J57B 5D7LB 1NC2B 4U6YA 4QNPE 4PLOB 1S7VA 1CLOL 5I1GL 3RWEB 4O2EB 4R4ND 1D9KB 3I3EA 2OQJB 1EH9A 2P8LB 5DD0L 2VNCA 1MIEH 5C0EB 1WT5A 5HYIA 4WV1C 4LCIH 4PS4H 1H15A 2F58L 3QEHA 1KJMA 1MCSA 2GJ6D 4BM7A 3CSYA 5GSVB 1FN4A 5DSCB 4BH7A 5I1DB 1INQB 4P5KB 5D2LA 3FT3A 5K9JL 1JZ3A 1MRCH 5DS8A 3QAZC 2IH1B 3FO1A 1T1ZA 2GSIB 1F6FB 4P9ML 1TCRB 4U1SA 4PJ8A 5H37G 1OVZA 2QSVA 4B53A 1Y0LA 3RI5K 1B4RA 3U46A 3S37L 1A7PH 2AK4D 5D2NB 1OAZH 4HJGB 2XKSA 3DX9A 5ETUA 1X4YA 1OLZA 1AQKH 1MOEA 3FRUA 1UKTA 3BH8A 2Z92A 4OLXL 3WHXA 5MENB 4PRPD 4U7KA 3KLAB 1JRHL 3C5ZA 1FL6B 4E42A 1CXLA 4L4VE 1KENH 2HRPL 3MV9A 4WTZG 5C0RH 4YH6A 1RZ8A 4KV5E 3RHWF 1FFOA 1EJ6A 3DI3B 1HILA 4FQCL 4HKXB 4YHZH 3IF1B 2HJKA 2PR4L 5GGTH 4KK9D 4NO0B 3J8F7 1CT8A 4MQ7A 2CRZA 3P11H 2IJ0C 1NMCB 1NDGB 1EDQA 4P46C 1LHZA 5HI4C 5GS1B 1MFCL 2BRRH 1IGTB 5IEKB 3HE6A 1ZA6A 1S9YB 5EA0H 3B9KB 4X8XA 3G6JF 4R3SB 5HDBF 4CW1A 4K3DL 4LLAA 2OXGA 4FTVA 1IGML 2RB8A 2HMID 4U1MB 1IILE 4OF7A 2W1NA 1ACYH 3QXDB 3M1BB 1RK1B 1KJ2A 3QXVA 4U1IA 5CBAB 3VMNA 4NN5B 1EAPB 3W11D 1XR8A 2WAHA 2Q7NA 1GAFL 2AV7A 1F3DJ 2VWEC 3MRDB 2APVA 5F7YC 5CD5C 3AY4C 4JPKH 4KK5D 4AEHL 5H35B 3O45B 3VH8A 4UT9L 5CMAB 5T1DH 5IB5A 4MD5A 1PKQA 4JCMA 4D0CA 4PJGB 3MNWA 3WNOA 5KS9B 2O61B 3QJHA 2R0LL 1MJ8L 4PY7A 1CI5A 4FQIH 1IC1A 2CLVB 4LU5L 1K3IA 4WWKD 5DQDH 2FX7H 1HSAB 5ESAA 4XC3H 1T03L 3UBXG 1UXWA 3MXVH 5L6YL 3KJ4B 1JZ5A 2ZOKA 1CFVL 4X7DC 4Y2DB 2I07B 1Z3GH 4D9RD 4IRSD 1F11B 1UJ3A 2DM4A 1XGRB 2RFXA 1JHLH 4LSSH 1JPFA 5BO1L 2BNUA 5FYJH 4HIIB 3UDWA 5ITBL 5ANME 1CWVA 4ZO9A 3RDTC 5T33H 4IM8A 3IKKA 1YN7A 1OARL 2EYTA 3U79A 3V4UL 1CL7H 3A6CH 1Q8MA 3QUYA 1CXIA 1P4LA 2WP3T 3O2WH 1FNSL 4XBGB 3TVMA 1NFKA 4GAYB 5CCKH 2D9QB 1FG9C 2DL2A 4TOYL 2KDGA 4LSVH 1NH6A 1RULL 4KRPC 5EBMB 5B3JF 4KXZH 5C8JA 4HW6A 1TJIL 4RGOL 1M7IB 1KCSL 5F7UA 4ZSOA 3OXSA 4YQXL 2F8VA 4RSVA 4PREB 4Z5RA 3DXAA 3BEWA 4N8VG 1W0WB 4OLEA 4OZIF 3DX6B 3QFJA 3OKDA 4O02L 2XZQL 3DJ9A 3EYOA 2BFVH 1AIFB 1IZJA 3VFOA 1F90H 4OI8A 4ONFH 5KOVC 4QTIL 4ELKA 5FO8A 5EZOL 3DBXB 2HLFC 4LRNL 3DV6B 5SX5H 5IIEA 1ZGLB 2D2OA 3KJ6L 2DTSA 5EU6D 3OB0K 2IG2H 2A83A 4IDJL 4Y4KD 2J8UB 4QRQB 3STLA 1OGTB 3OF6A 4R8WH 4ZYKB 5DF0A 4ZUVB 6FABH 5AAWA 5HDQL 4LCWB 1YEEL 4KAQL 3GMMB 4KDTC 3IFPB 3BZFA 2WM0A 1Z5LB 3QQ3B 4WVRA 3UC0H 3VGAB 4D0DB 2VE6A 3F5WB 2AQ3A 5FA3B 1FNHA 5C07B 5B21A 1AGBB 5MP6H 3E3QE 2QQKH 4ZD3H 3BQUC 1OP3K 1QLRA 1SMOA 5IVZB 1LEGA 2X1OA 1RZJH 2PO6A 5K9OA 4NM4H 4LSTH 2J4WH 1A6UH 1UH3A 3WIHL 5IWLC 3D18B 4M43L 3OMZA 1U3HD 5I73B 2H3NB 3PQYA 4JPVH 2VLRA 2V2XA 3VGGA 1Q94B 1NGPL 3C5SB 1OOAA 1J1PH 5DJAB 1DLHB 4NO3B 4EN3D 4F58L 3E6FB 4FQJH 4QXUH 4ZPTA 2P45B 5ID0A 4J3XA 5DZOA 1U93B 4D3CL 3WIIL 5HDOA 3DSFH 2Q3ZA 4NZUH 1XF2A 1VEOA 1AXTH 1U95B 7FABL 3N1MC 2EDFA 3V95A 1LEKB 3LPGA 1MWAA 4NO5A 1H0DA 2OL3A 1D9KD 2VWEE 1RZKL 2R23B 3DX7A 4A6YL 3RWGB 1DQLH 3S4SA 4NDMB 4PTTA 4GRLA 1WEJL 5C0DA 4LSRL 5JR1H 4HX1A 3AROA 4F2MA 5IKCB 3TBWA 4Q58C 2O5XH 1BOYA 1L7TL 1JF6A 4C58B 1NGQH 1UCTA 3UZVB 4MAUH 3V5HB 3FQWA 3IJYA 1UCBL 4PRAA 1AGFB 3T0XA 2BHYA 4OUUB 5L88H 1FGNH 1RU9L 4OCWL 2QHLA 2KZ1B 5CSBA 1NANH 1NMAH 5F88A 1I7TA 4C56E 1CG9A 4MZ2A 4R96B 4ZXBA 3Q6FA 1QO3A 1J1OH 3BP4A 3TCLB 3WJLC 1QKZL 3A6OA 3BPLB 1NGWB 3M8OL 2IFFL 4HCRA 5CKAA 4Z8FH 4XWGL 2DL9A 2NY6B 1A47A 3Q6GH 2ICES 2Z8SA 1G0XA 3EFFB 3JUZA 3CFJB 1NCAL 3WLWD 2AV1B 1LNUA 4ETQA 5KVDL 4Z7WB 1FGVH 3E8UL 1YY8A 4AZ8A 3GB7B 4MWFA 3MUZ1 1P6AB 1YJDH 5D1XC 1N59A 4Y4FA 2FIKA 3L5WA 4NO0D 1BLNB 2XYCA 4ZAKC 3TZVA 1QBMH 1L7IH 3O2DA 3VRJB 4XVTH 4KJQC 1U92A 4QXGH 2X2YA 4OSUL 5GGQH 3G5YA 2DQHL 1FO0H 2IAMB 1XIWD 1UH4A 3GMLB 3MODL 3THML 3B9KD 4JN1L 4XNMA 4HS6B 4OLWL 1C08A 5DYOA 1I1AA 3RHWK 4NKDB 2VQ1B 3UZQA 3B83A 1MRFH 2J5LC 4LNVA 1KG0A 2EYRA 1KYOJ 1FAKT 4WIQA 3EJYD 3PDOA 1YYML 3FFCE 5AEAA 4RGNE 2NX5E 4HIXL 2XICA 1CFSB 1RPQA 4MX7B 5CILL 3L5XL 1T0NB 2IH3A 4XP1H 3QJFB 2J7LA 3GMNB 1QFUL 4WO4D 4QO1A 5H94B 3VDBA 4HUMB 4IS6A 3OSKA 1TCMA 4M7ZB 5I1CH 1R3KA 3TCXA 4GXVL 4HWBL 4LHUD 1WCQA 2F9BT 3D39A 1LK3H 4R97B 2A9NH 2DMKA 3G08A 3TBSB 1MI5A 3UO1H 4PJ7A 4JZJC 1QSEA 3LVEA 1QSZA 1XGYL 5JHLL 2E9WA 3KDMB 2BDNL 3QRGL 4X0KA 5ICXB 2X4PA 5HYQA 5DJ0A 3T77A 1I1YB 1QBLH 2N56A 8FABA 1ZHBB 4WY7H 4WTXA 3U6RA 1S3KH 1NJ9A 3UPAA 5B8CC 3D85B 2VLKD 5MEPB 1EGJH 5E0QA 1R0AL 1YEGH 2EDHA 3PV6A 5I8OL 3LKRA 2HJLB 2FX9H 4Y88A 2EE9A 4JFDB 5DJYA 4Z0BH 5DZLA 1HINL 3EIFA 3MRNB 1E4KC 4XVSL 3RVTD 3SDYH 3DVNB 3BUTA 3GSOB 1MSPA 2D4FA 1FL5A 1U0QA 1LO4L 4X80L 4F33B 1U58A 3TN0C 3KPRB 4K7PH 2V2WA 4XCYB 1N3NB 5LJYH 3A67H 3SDCB 2PCPA 4QRRE 1TXKA 4KTEH 3MLXL 3ZKXC 1ZV5A 5FYLD 3GJFA 3GI9L 4HS8L 1A14H 1C5DB 2A77L 1KCRL 3KYOB 3NIFE 5J1AB 3RIFK 2B20A 1QR1A 3CH8A 4YDLB 3G9AB 4NPYB 4QOKE 1DBKL 1QR4A 4HG4K 1JNLL 5ESVB 2N7AA 4MS8D 1SJHA 4X6EB 4Q2ZA 3WDIA 4WI3A 4I0PC 3C08H 3CMOL 2E9JA 1FP5A 3KLHD 1A6AB 4AT6B 3MBEA 5EZJB 4UIMB 5ANMB 3X13B 4LCWD 1X5AA 4FABL 1MCDA 1N5YL 1AO7A 1B6DA 3EDJA 3FCTB 3RA7L 5EH1A 5TF0A 1KELH 1ZSDA 1AFVH 1P4IH 4WEBH 3BHBA 4P9HH 5TDOA 3BT2L 1DQQA 3I6GB 2HVKB 5EU4B 5JPNB 3C60D 1C16A 4JAMA 2VRAA 1P84K 2X7LA 1ZHLA 3OB0H 3OKKA 4XRCA 4CADA 4L29B 5L2JA 4HFUL 4F9LA 5C0CE 3RGVC 4OCSL 3DNKA 4J1UB 4DN3L 4FFZH 1R5IB 1FBIH 5DRWA 1HOCB 1EPFA 1RY7B 4J7RA 3RQ3A 3OTTA 5F7LB 2Q86A 4EDWL 4HQQH 2MKWA 1EXUA 3NCYP 1N5AB 2FX8H 4UT6H 4AENA 4CVXA 2M1KA 2XG4A 1MCFA 2AEIT 1EZVY 1MHCA 4FZEH 3IDGB 1OD9A 1OP3H 2PUQT 3KVQA 4QHUB 3SCMC 4Q74A 4FRWA 4GW5B 2YBRB 5I19L 1BZQK 1SVCP 4OCMC 4JM4L 4PJDB 5CD3B 2VDQH 3TPUA 2VITB 4CKVX 5H37H 4X9IA 3P4OA 2WBJC 1OAXH 2VL4A 2WSKA 3DMMC 5EU6A 5F97E 5DTFB 5DUBB 1J0JA 4Y4KA 2AJXH 1T66D 1OP9A 1R3IL 4H0GA 1L9NA 4DUVA 4RIRA 4XPAL 3UYPA 3BWAA 1A21A 1NAMA 1EBAA 3WSQL 3PHOA 4U1JB 3WE6A 2EIEA 3MGOA 1YEIL 1NCUA 4QRPA 4AIZA 3BUYA 4O51B 3F58L 1JCKA 3DGCR 2Z4QB 4DZBB 1IGFL 3SE8L 2DICA 1IJ9A 3RL1B 5LQBL 5EN2B 4PGDB 4P46B 5E08L 1CTOA 3RWDA 4Y19E 5T1KD 2ZPKH 2D9CA 3QCVH 3O0RL 3WD5H 1GC1C 2NY6D 1BBJA 3IGAB 3PWLB 5DVOA 3NTCH 1MFDH 5C9JA 1JHKL 3BP7A 3VU2A 4P3CH 4PJFE 4PLJC 1MCHA 1YC7A 4PGCB 5TE7H 3QXAB 1R3HA 3UBXB 5DA4A 5B38B 3VCLB 3C6LA 4Y2OA 3FHAA 5FV2A 3SO3C 3GSUB 3QCUH 3FFDB 3ZKND 3ARBA 3LHPL 5E2UH 1KLGA 1AXSA 5D71H 5F7WC 5D7LA 1NC2A 1CZ8H 2LE9A 4GMSL 5CJXC 5F21B 1D9KA 2IAMD 4HT1L 2P8LA 2G9HB 2MSPA 1W0YT 4G6AD 5C0EA 4JQVC 3EYVB 4WCYL 2YRLA 4P2RA 3ULSB 5KSUB 5GSVA 3B8SA 5DSCA 4P2QB 3MRBA 4L9LB 4RZCA 5E2WH 4C83B 5I1DA 4S1SL 5EORH 2R0WH 5GGTA 4ZFGH 4OI9A 1U3ZA 2GSIA 1FIEA 4ESKA 3G6JB 3TO4C 1TCRA 1T7ZA 2VABB 3MOAL 4JKLA 4ZOCA 5EO1A 2X4NB 1FPTH 5E1HB 5D93C 3RDTB 5D2NA 2DQGH 1MCOH 2A9ML 4J4PA 4HLJA 5FM4A 4JFYB 1D5MA 1XGQB 5BMFH 3LMJH 1BIIB 1HH9B 2JTDA 3ILPB 3ZSSA 5EZIL 3STBA 2BJML 5MENA 5TE4L 2Y7QB 3KLAA 1K8DB 1YNKH 2IGFL 1P7KB 3WHE0 3ARGC 2AEPL 1WIPA 4NQCA 4KRPB 3MBXL 1RI8A 3O4LB 3ULUL 4KKBD 3P0YL 1C5CH 1F13A 1HHJB 3QIWC 4NO0A 3SQOH 4QRTB 1BHGA 2GFBB 1YQ2A 3BKJH 3CX2A 4LGPB 5FUZH 3UAJC 1BGXH 1JIBA 1LO2H 1NDGA 2Z9TA 5GS1A 1OTTC 3D85D 1IGTA 5IEKA 1KCLA 2ZCLH 2BNQE 5C0BB 4Z7NF 1S9YA 4JQXA 5D7JC 4BSJA 4DGYL 4R3SA 4MJ5A 3QYCA 3MGTB 1EHNA 1HE7A 2GTWA 4U1MA 1CLYL 2OP4H 3QXDA 1YEJH 1RK1A 3M1BA 4YPGB 1OWWA 2WINB 5CBAA 3SE3C 1OHQA 3FFCB 2NX5B 5I0DA 4JQIL 1EAPA 3KPRD 5CJQH 2EICA 4AY0A 3MRDA 4PJ9C 3TT3L 2A0LD 2EIDA 5H35A 3O45A 2FO4A 1LE5A 1U9KA 1DJSA 2V17H 5CMAA 3FMGL 4LQFH 5GGSY 4ODTL 4LCCC 3BQUB 4WNQB 3LKNA 3L95A 4JEGB 1TNMA 3KPLA 1AJ7H 3VXQB 1UENA 1TIUA 2CLVA 3DI2B 2EDKA 3N9GH 4JRWA 3K1DA 5GISL 4OLYL 4P5TD 3BPOC 1IAIM 2AKRB 1FCCA 2A74B 3O6FD 4YBLC 5HJ3B 3EYSL 4I3SH 4Y2DA 2I07A 4I3RL 2YKLH 1F11A 1XGRA 1NCBL 3BMWA 2NY7H 5J06A 4KRNA 3QDME 3ZHLA 4KZDH 5ILTH 4HIIA 4K3EH 5HGHB 1KN4L 4RWYH 5EWIL 5BV7L 1RFDL 3SDAA 3VWJB 3MLZL 3NCBB 5CEYA 5D6DC 4PUBL 4XP5H 5IBLC 1G7IA 3EO1A 5FOJA 1V7NL 3REWB 4XBGA 3FT4B 1KUMA 3BYYA 2WV3A 4GAYA 5C0AA 3VFGL 3GNMH 4MXQC 3VG0H 2ORBL 2OSLB 4WU7B 1X3DA 4QRRB 3GMPB 4GRMB 1YNTB 1M7IA 3NCEB 3MFFB 2FEDC 4PREA 4YHPB 1FFQA 4QOKB 1W0WA 2OJZL 3KPTA 3DX6A 5HYEA 2XNAB 4G9DB 1AIFA 1G7JA 1GH7A 5JW4N 4I0CC 3WDJA 4WW2F 4YDKH 4NQVB 3O3EA 3GBML 3G9VA 3ORJA 5HHOE 1ZGLA 4JR9L 4IHOB 2FHFA 3IFLL 3V0VA 4QWWC 1AGCB 2J8UA 4QRQA 3CH1B 4RX4A 3ZDXF 1BVLB 1AI1H 3GDBA 3NPSC 5HHMB 3KWWA 4ZYKA 5KG9B 4ZUVA 1CR9L 2DI8A 1BD2E 4NZRH 4LCWA 3DIFB 3GMMA 2XKUA 5IHLB 3IFPA 2XT1B 3PL6C 1Z5LA 2W0PA 4KHTH 2VZUA 5D1XB 4D0DA 1F4XL 4UTBL 5FA3A 2E7LA 5GZNC 5C07A 2I25N 1AGBA 4ZAKB 3CNKA 3Q5YA 4WI9A 3CK0H 5IVZA 2IC2A 3S36L 5JW5B 1A64A 4TSBL 4P46D 2VDKH 2XZCL 1ZT4A 2UVEA 5HI4D 5C6PB 2I60L 4O58H 4IRZH 3O6KH 3MRIB 2FLBT 1I9IH 3D18A 2R0KL 1MFBH 1ZXQA 4FOMA 4GQ9H 1JWSB 3W5NA 4H88L 1GGTA 5EBLB 4WFEE 1Q94A 2NXZB 3C5SA 1ZGLP 5E2TL 2H9GA 2J5LB 5DJAA 4NO3A 1V5JA 1RUPL 1T21B 1EO8L 1U93A 5LCVH 2BSSA 1F58H 4OD1L 3OKMB 2ZCKL 1F4HA 2PTUA 4M1GL 4MSWB 3WKMH 4PV9A 3P0VH 4C57C 5LGKA 2BVOB 4WFFE 1LEKA 3VI3F 2Q8BL 3DO7A 2PW2B 5CZKA 2KZWA 3RWGA 5EUOA 4NDMA 3H9HB 2BVPB 3NN8B 2VISB 3SKJH 2FIRT 5C09E 4KDVA 5INCB 4GXUM 5IKCA 5C7XL 1RUML 3ZE1E 2X4UB 3QZWA 5FYKH 1DZBA 5HGBB 5SV4A 1OM3H 1MLBB 4C56D 4KGJA 3T0EE 5EB9A 3O8XC 1CXKA 3N1GC 3WFCH 4JZJB 5FCUL 4YDVB 4M7LH 1RURL 4OUUA 2XY1A 4IDLA 5C0NC 5I0ZA 4PLKC 4GSDL 3BMVA 4GUPB 2EDEA 1T0PB 1C7TA 2VB5A 3LY6A 4R96A 1J87A 3RDTD 4HG4J 3MQIA 1S9VB 4G8IA 3TCLA 3U0PA 3L3KB 3ZDYF 1NGWA 3HFMH 5I75C 1YA5A 5KJRH 4M5ZL 4KZEL 1FIGL 4RISL 3WUWB 2HTLC 5B8CB 4CJ1A 2B4CC 1GOHA 1RIVL 2K7QA 2X89D 2X4TB 5A1AA 2XA8H 4YUEH 3EFFA 4RRPG 1UYWH 4M61B 2AV1A 2HKFH 1M1SA 3CZJA 4CMHC 3TT1H 1MFAH 2ITDB 3QQ9C 2F54E 4PV8B 3INUH 4KRPD 1KJ2L 5IHZB 3NACH 1MVUB 1FZKA 3TN0B 4R7DA 1VFAA 4BSWB 2PXYC 3WNLA 1A0QL 1BLNA 4LPTA 1P84J 3T09A 2YN5A 5JXAH 3RAJL 2FBJL 2EXYC 3RX8A 3ZKXB 4P49A 4XNQB 2IAMA 1M7DB 5C0BD 1YN6A 3GMLA 5F93C 5DWUH 1F5WA 4YLQT 4DKAA 1KLUA 1NDMB 3LQAL 1AXIB 1F3RB 3MJ7A 1I4FB 2BHUA 3RRQA 2XIDA 1WFTA 4NKDA 4I0PB 3K74B 4UINH 2VQ1A 3S35H 1QBBA 5D7SH 3FFCD 3MUGB 4RGND 2NX5D 2DQIL 3EYUL 3QDJE 1EK3A 1M7XA 3QIUA 4POUB 5D5MB 2B8OT 2XWTB 5HHQA 2FZ3A 5MEQA 1J5OL 3GSRB 3BQUD 2YWZA 4MX7A 3KHOA 1EGJA 1J86A 1T0NA 4G7VL 5F9JA 3GMNA 1A9BB 5GS0C 1FC1A 4PBXA 1FC2D 3CIQA 3SE4C 4PJBB 1IC5L 3MR9B 4ZO7A 4DAGH 4JFQB 1KBGL 1X5YA 2MMXA 3RGVB 1YEHL 4L3CB 3TEUA 1F2XK 1UA6L 2HT2C 5GGVY 3RL2B 5GGRY 3OR7A 3P77B 4UNTA 4W4OC 1JNNL 4YE4L 3MLVL 4KDWA 3T2PA 4F7PB 3V4VH 1IAII 1I3RA 4IRJA 1I1YA 1PG7X 4G3YH 3ESVF 1ZHBA 4X9FA 3K2MC 2SEBB 2WNGA 4POYA 2ESVE 4MA7L 4PJHE 3I3BA 4P3DB 5MEPA 3QEQB 2KL6A 4J3WA 2WBJB 4F80A 2CMRH 3H2WA 3MRHB 1U91B 2HJLA 3SY0B 2HJFB 4JFDA 1ORQB 3BKYL 3G6DH 1WAAE 3DVNA 3GSOA 4QRRD 4UOW0 4N0YL 1AY1L 3O9WC 1LE9B 1GGIH 5KANI 4F33A 4LLMA 3DTXA 3KPRA 2VOTA 4X6DE 5J6GA 4P57B 4XCYA 1KC5H 4MHHI 4P2YA 4YHMH 4XP4H 3O11A 2NY1C 2L7UA 3H3KA 4QOKD 4GKSB 3B6SB 1I7UA 4N68A 3SDCA 3P9LA 4FXKB 3MROB 3V0AC 3LQMA 2IQAA 1DBBL 5K59F 1C5DA 3KYOA 2GY7B 1HWGB 1IAOB 4NPYA 3UJIL 1BX2B 4IMLA 1VEPA 4ODBD 1PSKH 4FQ1L 1I1RA 3ZKMC 3HZYA 5FFLA 4O9HL 3MUJA 4PB0L 1T1YA 2J88L 4UIMA 3X13A 2CIKA 1SJEB 5F9WB 2EDYA 2P7TB 1DQDL 4XAWH 4JKKA 3SO3B 4PRBB 5D1XD 1QFHA 2JJSA 3FCTA 2ZUUA 2VR4A 4U1KA 1IC4H 1UEMA 5F44A 4ZAKD 2J6EH 3FB8B 4XNXH 3TBYB 2ZCHH 4HLZG 5C0CD 2HVKA 4Q7DA 5E7FA 5E5RB 4KJQD 5TH2B 5DJDB 1MWAL 8CGTA 4H5SB 1WLHA 4OD3H 1UWXK 2OTPA 1T3FA 3ZTNH 5J12B 5DUPH 4L3EB 5CINL 4H20L 4J1UA 4UZGA 3BEVB 4Z7VF 4JDZB 2AERT 1IE5A 4RMRA 1HOCA 4GJTB 1P2CB 3GKWL 5AZEH 3KYAA 4KJWC 5D7IA 5GGSB 1KTLA 1S9WB 4APQA 4ONGH 3WL9B 5T3XL 4WTZA 3QULA 1ZVHA 3QIBC 3TO4B 4IMKC 1EMTH 2D7TL 5ESQA 2ARJQ 4GW5A 1OGAB 2YBRA 4RDQG 2CUMA 4M7JH 4PJDA 5CD3A 1JBJA 4I4WA 2VITA 4O5LL 4H26B 1NC4B 1JGDB 1CLOH 4HCRL 4KUCF 2DMBA 2R4SH 1CGVA 4M3JA 3SGDH 4ZFOA 3V6OC 2XPGB 4HJ0C 3S8WA 2WWMC 4MNQE 1NBZB 3TC9A 3I6LE 5CZVL 2F58H 2VDLH 4LMQE 2A6JB 2LV4A 3ARGB 4X5WB 3X17A 3VFPA 3ZT7A 4L4TE 1XR9B 4XC1L 4Z7QE 4ODVL 4U1JA 2I5YL 4AMKL 4N9GB 4ZO6A 1F02I 2E5EA 3PWNA 4O51A 3QIWB 5F3BA 2FD6H 4DZBA 3KPPB 5K9KB 2BNRE 2P44B 3LN9A 3O2DL 5EN2A 4PGDA 4P46A 5FGBA 4OLZL 1E27B 3GHBH 2NMSA 3IGAA 1MIML 5D7JB 5DC9B 4KI5F 1OPGH 1DQJB 1R3JB 2BP3A 3MLUH 3PNWB 1K85A 4Y5YC 4PGCA 3QXAA 4XPGL 4L8CB 3VD7A 4ZUTB 3UBXA 3VCLA 3TN0D 4GKOA 3FFDA 1I1CA 3LN5B 4PJ9B 3CSBA 2HRPH 5C2BH 5KSBE 2B1AH 5C09B 3V5DA 1ED3B 3UPCA 4HMCA 2PR4H 4LCCB 3RUGF 1FNLA 5ALCH 1P9MC 1T7VA 1DVFD 3EYVA 4JJ5B 4GG6E 3ULSA 5LXGL 4H0HB 4P4RA 1FE8L 5TJWK 1CGUA 3MMEB 4LSQH 4GKZB 1J05B 1LILA 3BPOB 1YUHB 5L2KE 4P2QA 4K94L 4L9LA 3V52L 4C83A 2P49B 1FNGB 1T83C 1GZQB 5IBTH 2MCPL 5IMOA 3HMWH 2NNAA 4RA3A 3G6JA 4MJ6B 2XKNB 1EA9C 2JCCF 4AEIL 3QI9B 2X4NA 4MYWB 4OGZA 3SDXB 4N8VA 3G5ZB 4G8EB 4HAGA 2Z93B 4JY6A 4EI5A 5FAAA 5DDHA 2Q7YA 1A7RL 1BIIA 1HH9A 2R0LH 3RGVD 3HR6A 3X12B 5ACMA 2Y7QA 4F7MB 5E99L 1P7KA 5F89B 1T03H 3BH9A 3O4LA 3ULVC 5L6YH 2R1XA 4S1QL 3MREB 2GSGB 1KXTB 3WFBL 2OR9H 5IHUH 2FCBA 3MV7B 4XXDB 2BNQD 1BFSA 1HHJA 4QRTA 2GFBA 4BZYA 4OCLC 4LEXL 3KNBB 4XVUC 4QHKI 3SCMD 4JPWH 2NTSP 3GUTB 5MERA 1I85C 4YXKL 5BO1H 3NFNB 2YA0A 4E41E 5JQ6L 4JG1H 5C86A 3A6BL 2AEQL 4HEME 4OTXH 4HUNB 2WBJD 2FDBP 5FEBA 2W9DH 2JF1A 3DMMD 3LIZH 3VFTB 1QSFE 2X1QA 3WFHB 4BYHA 2R4RH 4XCNB 5IB1A 4YAQB 4YPGA 3NPSB 5JHDB 2WIMA 3NH7H 1FNSH 2WINA 1N0XL 4ZS7L 5HDBE 5F6HJ 2Y6SC 1IBGL 2EDWA 1INEH 1BF2A 3BIBX 3ARSA 4KDTA 3PL6B 3MRCB 4CRPA 3CFIC 3BZDA 3V6OE 5TFSH 2M8XA 5MI0C 1TJIH 3PWVB 5I18H 4HDIB 1KCSH 3D3VA 2HT4C 4WNQA 1JVKA 2IQ9L 2ICWI 3H9SE 1WWBX 3NGBC 3VXQA 1ONQB 1CK0H 5IUSA 1RZGB 3WEXB 4LK4A 4MQTB 1QYGL 3RPKA 3I3DA 5IWLA 2ADJB 1W72B 1X5IA 4OZIA 4JFXA 2Q3AA 3N1FC 4QTIH 4HWEH 4PLJD 2WANA 2A74A 5EZOH 1C5BH 3T3PF 3ZDZF 2LU4A 4YGVB 5HJ3A 3KJ6H 4DCQB 4QRUB 3BRFA 1G84A 3PGCB 1OD7A 1C1EL 4KHXH 1Z2KA 3T3MF 3ARFC 2ESVB 3HI5H 4PJHB 3H0TB 5GS3A 4XX1E 1SBSL 2R69H 1UB5B 1IMHC 25C8H 1B4JH 3VWJA 4DUWA 2NLJB 4NNPL 4GS7C 3LZFL 2R0ZL 3MRRB 3CU7A 4LAQL 1YPZE 2FNBA 3MJ9H 5HI3C 1OAYH 5I1JL 3BOVA 3LEXA 5JW3L 3HLAB 5KSVB 1J0KA 4PRNA 4OQTA 5E8NB 3JWOL 1T2QL 2J12B 4GRMA 1QVOB 4JRYB 3E1F1 5JZ7C 5DJ8B 2WQRA 3CDYA 1NAML 3D3VE 5B3JE 4YHPA 4ZNEA 3TO4D 1HKLL 2V2TB 3P4MB 4XP6H 1L6XA 3WIIH 4ELME 4G9DA 4X4XA 1UWXH 3ISWA 3JV5A 4ZS6C 4L9DA 3P4NB 4JFHE 1G9NH 1MIEL 1HKFA 1UZ6F 5F7KC 1ODAA 4LCIL 4PS4L 7FABH 4GLRH 3VXUA 4BQ6A 1NC4D 4NQVA 3HMXH 5GGRB 2KKQA 5FF6A 5JDJA 1AGCA 2QL1A 3WS6A 1BVLA 1I9RH 5CEXB 1WEJH 4U6HB 2ARJB 4X83A 1U8NA 4NZDA 1MRCL 4XCCH 3QHZH 2GTZB 3EJJX 1SEBB 2C7UB 3DIFA 4DVBB 1X5GA 3ZE2E 1J0IA 3VD9A 4S1DC 3BGAA 1CLZL 1IEAB 5EOCH 3QIWD 1A7PL 3L3IB 1UM4H 1OAZL 4QYOB 4ZAKA 2XXMB 4OCWH 1EHAA 5JW5A 3UAJD 5JOEA 3ULVE 5E94B 1OTTD 4WFED 5LVEA 3WFZA 1AQKL 3OZ9H 5FKAB 4BK5A 5D7JD 4PG2C 1QKZH 1Q9OB 5EBLA 2IFFH 1CGYA 5IGXH 1WCBA 1KENL 4X4MA 4XWGH 4ZFZB 2W60B 1FYTB 5EO9A 1DANU 2X10A 2J8OA 4YHZL 5DMYA 1QFPA 5GGTL 1NSNH 4PJ9D 1JGLH 1K2DB 4DKDC 4N5UA 1J11A 4RAUA 5C09D 1EJOH 1XFPA 1AGDA 4F37F 3RP1A 2BRRL 4QXTB 1B3JA 3BW9B 4P9MH 2UWEF 2PW2A 4EOWH 3AC0A 4NUGH 5J11B 3H9HA 3T0ED 1HCVA 5AD0A 2VISA 2H26B 1S7UB 3MRPA 3BP6B 2NY0D 3T08A 1ACYL 2X4UA 4HS3A 5HGBA 1NCWH 4HIEB 3H7BB 4W6WB 4QTHB 4MZ3A 1MLBA 4FQLH 3BPNC 5DRZB 3PGFH 2BNRB 4NQUA 4JZJA 4JPKL 2Y72A 4UNUA 4YDVA 4WUUB 3OQ3B 3DRTB 4PJ5B 3IDNA 4GUPA 4X7TB 4LARH 3HUJB 3EOAA 4DW2H 4WI5A 4XBEH 2FEEL 4R2GC 3EJZC 1KCVL 1S9VA 3L3GA 5I16B 1EEUA 4HZAA 4FQIL 2BXZA 4WRLA 1T2JA 4O2CB 1YYMH 3WUWA 1AD9B 4ISVB 3R0MA 3GKZA 3RPIB 4HIXH 5IBLD 5DQDL 1EVTC 4X4ME 2FX7L 5CILH 3G5XB 4XC3L 1I8LC 4AH2B 3MXVL 3VXOB 1CCZA 5IP4A 1RIHL 2I9TB 4M61A 4MXQD 5SWZB 4YK4C 2GY5A 1Z3GL 3R06B 4W68A 2Y06H 3PP4L 4PV8A 15C8H 2YD4A 3O3UN 4PJCB 5IHZA 3ZSTA 1AKJD 4LSSL 1MVUA 1AHWC 1CFTA 5FYJL 2PYEE 2YPKB 5SX4I 4BSWA 3MV7D 2GUOB 3L9RA 2FEDD 5AYUL 3OHXB 5T33L 4LVNC 2NY1B 2Z31C 1CIUA 4LCYB 5J1TC 1RQ5A 2V5MA 4Q6IC 4H8WC 5JHLH 1CL7L 2BDNH 3A6CL 3QRGH 3ZE0F 2XN9B 4C4KO 4XNQA 1XF4B 3O2WL 1M7DA 5L2KB 1II4E 4NNYB 1G1CA 1G9MC 1F2QA 1L6ZA 5IESH 4I1NB 2ZUVA 3IU3B 1NDMA 5CCKL 3BVNB 1BVZA 1I4FA 4QWWD 2MFNA 4I0PA 3VFWB 5JHDD 1JF1A 4LLYB 2RJMA 3MUGA 2X4SB 4TUOB 2V5SA 5GRYA 3PL6D 4Y5XA 5D5MA 3V6ZB 1CE6B 2XI9A 2C4FU 5GZND 3CFBB 5BRZE 5I15H 3V6FB 1OAKL 3B9VA 3VXRE 2BFVL 3SKMB 1PX4A 3GSRA 1BQSA 2ZUQC 4ONFL 1FJ1B 4WHDA 5CGTA 3MACH 3IETB 2MHAB 1CDCA 2NY2C 3CZFB 1A9BA 4LRIC 4P2OC 4DTGH 4P4KC 1HYSC 4G5ZH 1PVHA 1U42A 2IG2L 3D9AL 2BSED 4HLZH 4K8RC 4PJBA 3MR9A 4R8WL 4JFQA 3T0DA 5AZ2H 2Z35B 3FOLA 6FABL 4L3CA 1FG2B 2DM2A 4YX2H 4LASH 2YS4A 3UC0L 3P77A 3CMOH 4WENB 3WN5C 2ESVD 5BS0E 3MJ6A 5MP6L 4ZD3L 2QQKL 4R7NB 2VUYA 2E7HA 3QIBB 4D2NA 1RZJL 1WWAX 3DGGB 4NM4L 3OL2A 2J4WL 1ZWIA 2SEBA 1A6UL 5J4MA 2E9BA 5GHWH 3BWUC 4P3DA 2Y25A 3QEQA 2B1HH 2K3TA 1T04B 4OZGE 3MRHA 1U91A 3LRSB 3WXVH 3FO2B 4JPVL 2HJFA 1D5ZB 1ZOXA 3EW3B 5GRVK 4M62H 2WQ8A 4HHAB 4ZOAA 1ZE3C 2XY2A 4FQJL 4QXUL 4XI5C 1FLTX 2YMXL 3O8XD 4HWZB 3B4NA 5FOBB 4U6VH 3DSFL 2J6EA 4O2FA 4PJAF 5C0ND 5EPMB 4NZUL 4PLKD 1N6VA 1AXTL 5DD5H 1NUFA 5JTWA 4OAWA 4FXKA 1AP2A 4MQXC 4NGHL 1HK6A 1DQLL 4Z0XB 3SJVA 5JR1L 4OM0H 3QQNA 1BX2A 4P5MB 3GM8A 5I19H 1CE1L 1NGQL 3GJEA 4OBRA 4MAUL 4UTAH 1DANT 4HXBH 4I5BA 43CAA 2HTKC 4Y5YB 3QQ9D 3LS4H 2VIRB 1SJEA 5DRNA 2C1PB 1FGNL 3SGKC 5L88L 2P7TA 4M9OA 1G7MB 2XACC 1NMAL 1CD1B 4PRBA 2PXYD 4BZ2L 3AAZA 4XPAH 5E24E 3WFEH 4Z95H 1HNFA 1L0QA 3N1QC 1J1OL 3QHFH 4EIZC 3CFEB 3FB8A 3WXWL 4I18A 3TBYA 1BP3B 2EXYD 3U7YH 2X4QB 1PEZA 1YEIH 2DWEA 2YN3A 5TH2A 5CJXA 4Z8FL 5DJDA 1D5BA 2OZ4H 2WBWB 3O3DB 4PGJA 2ADFH 3Q6GL 5F1IB 3QNYB 3SE8H 3FN9A 3IDMB 4L3EA 3CPLB 3SDDB 4XPFH 3V0WH 4PP1C 5A16B 3BEVA 4JDZA 1U8MB 1GGYA 1CDJA 1P2CA 1FYTD 1ZVSB 3S37X 2VAJA 2D03H 2N4IA 3GMOB 2FO1A 1YJDL 1GRWA 1S9WA 5DGQA 2CDGB 5IJKC 4U31A 3L3DA 2I9LB 3MO1A 1QBML 1L7IL 1M6OB 3GI8H 4HUUB 4BFBD 4N8CH 4QXGL 5GGQL 5F9AC 4DKFL 4AQOA 1OGAA 1S7QB 5J3HC 4MNQD 2W0LA 4TNWK 3PABB 3QSKB 5GQBA 1H9VA 3SKNA 5GS0D 4H26A 4KRMB 4GT7A 1JGDA 2D31B 1IQDB 3W82A 3U9PL 4L4TD 2XPGA 2DYPB 1MRFL 1UM5H 1RJLB 2E9IA 2QBWA 1NBZA 5IR1B 2NY3C 5LG1A 2EZ0C 5EIQA 1IFHH 1NCTA 3ROLA 4DGIL 2HT2D 2A6JA 2BNRD 3ARGA 4ODSH 4X5WA 1L4IA 3EOTH 3WLBB 4F37K 4NKOB 4N9GA 2WUCH 1DLFH 2Q8AL 3HS0B 4JFFB 3RTQA 1PGRB 3QIWA 3RZCC 5CEZH 3RWCB 1A6WL 3KPPA 5K9KA 2W9EH 4XP1L 5C9KA 3MOAH 1ZANH 1KEGH 1D6VH 4K9EL 2VXUH 5I1CL 5ENWB 4PJ7F 1LK3L 1CICA 2A9NL 2HFTA 5D7JA 1FVCB 5I1LB 1U8IA 3L6FA 4QGTA 1R3JA 2EXWC 3PNWA 4FQQA 1VFUA 4L8CA 1FLRH 3OB8A 4YZFE 4ZUTA 2EC8A 3U7WL 3O9WD 4FXGB 2BJMH 2VDMH 1CL7I 3DO3A 1S7RB 5F7DA 2MOVA 2C4FT 4KY1H 2IGFH 4S10A 5SV3A 3DVFA 3LN5A 2CLZB 3WJJA 5CJOL 2NY1D 1Q72H 3H8NA 1QBLL 4CGTA 4LVHC 2WWKO 4WY7L 4NN6C 3S7GA 3DYMA 5DRXB 4JHAH 4JGJA 2NR6C 2DM7A 5INDB 5L0QC 2XN9D 1B0GB 4X9GA 3VWKC 1GOFA 1OSZB 5L2KD 3OGCB 1EGJL 2F53B 5MHSE 1BJ8A 3KYKL 3NGBB 1YEGL 2P1YA 2FX9L 1NGYA 4JJ5A 3D1MC 4KK6C 3VFSB 4C54A 3VJ6B 4Z0BL 3SDYL 3KGRA 2EIBA 4OZHE 4GKZA 3JTTB 3ZKMD 2R15A 3D6GA 1YUHA 2BVQB 2B0SH 2H32B 3PWPB 4WJ5B 4K71C 3H42L 3JWDH 4K7PL 1FNGA 5J7CC 4XNZC 1HXMB 2QKIA 3W0WA 3UTSB 2BC4B 1AE6L 3A67L 3T4YB 3ARFB 4KTEL 4MJ6A 2R1WB 2XKNA 4JQIH 5A3ID 1KIRB 3QI9A 4XMKH 5FUCE 1A14L 3SDXA 4MNGB 2VTFA 1ZT7B 2VXVH 5DMKA 5D6DA 4NQDB 4N0UE 4GS7B 3RNKA 4ODTH 5GS2H 3CFKB 4B7IA 5A2FA 2EEAA 4NM8H 3C08L 1F4AA 2PYEB 3X12A 1CS6A 4HZLA 4F7MA 1JGUH 1SJXA 2E27H 1R3LB 1IGCL 5F89A 2EO1A 4W6YB 5GISH 2HMIC 1RZKC 5SWQB 1RZIB 1R5WB 3T65B 4KJWD 5E8OB 4BFIB 3GEWB 1H8NA 2GSGA 5DMJB 1AFVL 2GITB 2GAZA 4LFHD 3MV7A 4WEBL 1EEQA 4UU9A 4IOIB 1TTGA 1OTSC 3QIBD 5A2JH 3KNBA 3FOMB 2OM5A 1NCBH 3JUYA 1P7QD 2Y36H 3GUTA 4WTWA 3X3GL 1FNEB 2YPLE 3NFNA 2BOCA 3MV01 3FB6B 5BV7H 3CVHH 1FZOB 4FFZL 4PUBH 3VFTA 3WFHA 1FBIL 4Y1AE 4XCNA 1D7FA 5E4IA 4HJ0D 4Z7NE 5JHDA 1XF5A 4HQQL 3LAFA 4KK8C 5D70H 3VXRB 2FX8L 4UT6L 5CWSB 5HYJE 4J23A 1SMAA 5IF0A 3JV4B 4FZEL 4JY4B 1I9JL 3MRCA 1FSKC 4PTUB 2Q87A 2A1WL 4X6CF 5IFHH 5T3ZH 3S3PA 4ERSH 3PWVA 1AD0A 4HDIA 4HK0B 3AXLB 5DHYB 1ES0A 4JANA 2VDQL 3T1FB 4H25B 5EG6C 3MJ9A 5EIIA 1I7RB 2PKDA 1OAXL 3WEXA 4D0BB 1A7OH 4U3XA 2ADJA 3HRZB 1W72A 3L7EB 4MXVF 1NANI 3CXHK 5F1KC 3FTGB 2LU3A 3GBMH 2CK2A 4RGMC 4G6KL 3U36A 5J9PB 4DCQA 4KMTH 4QRUA 3IFLH 4N1EA 4G42B 3PGCA 5IBUG 4RA0C 2FECI 1JYVA 1RK0B 3RWHA 2D7OA 4J6RL 4NYLA 1KGCD 5DJCB 3EYFA 3EAKA 4WI7A 1MUJB 3H0TA 1L0XA 4XNUL 4OZGB 1UB5A 1J8HE 5I1HH 1MCKA 1KTDB 3MCLH 3VRLE 5C71A 3QCVL 1F4XH 1MH5A 2PN5A 1TETH 3HMXA 3OKLB 4ONOA 3WD5L 4ACPA 4WHTB 5JOPE 3NTCL 1MFDL 2QSTA 1DUZB 4P3CL 4TSBH 2XZCH 4NOFA 2I60H 4I2XB 4PJEE 2VLLB 4JZNB 5KSVA 3HLAA 4ZFOL 1UFUA 1S8DB 4RRPA 5E8NA 2QEJA 1T1WA 3FQUA 1QVOA 3BPNB 4JRYA 3UTTB 2ATKB 4YO0A 5DJ8A 4JFHD 5E2UL 1KPUB 5JIKA 4L5FH 5D71L 35C8H 2H45A 4DOHE 1RUPH 3P4MA 1P5UA 3B5TA 1I3GH 4R2GB 3ES6A 2D0HA 2NY4C 3P4NA 5DVNA 1TZGH 2V7NB 1HH6A 4OFYD 3GBLA 3MLRH 1F6LL 5ACZB 5GGRA 2Q8BH 2DYPD 4LCUB 3UJTL 5CEXA 3HPJB 4U6HA 4YK4B 3EZJB 5EORL 1IEHA 2CD0A 2R0WL 3GMQB 4NP4L 2GTZA 1SEBA 4P23D 4WFHE 4ZFGL 2C7UA 5C7XH 1IKNC 3FAXA 1HQRB 3ULVD 3IAQA 2IADB 5TQ2H 5I8CB 1IEAA 2R2BB 4JFFD 2UZIH 1FPTL 1QBAA 5FUOH 4IIQC 5FCUH 2Z31B 3TFKC 2DQGL 3LRHA 3EOBB 4QYOA 4X8JB 5EZLB 4TVPH 1MCOL 3FO9B 4Q6IB 4XVUD 3OAZK 1X4XA 4YHNA 3J7HA 4QHMB 5E94A 4YXLH 3AS0A 3LMJL 3LPWA 5E6IA 5I1KL 5FKAA 2DMCA 1ZLWK 3UPRB 1OW0C 4XHQA 4LSDA 4JN2B 2EO9A 4U0RC 1FHGA 6CGTA 4ZFZA 2XA3A 2W60A 1F3JB 1FYTA 3GMRA 3MXWH 4X98B 3BISA 5GIRA 5HD8C 2Y6SD 3IDXH 1CFQB 3ZL4H 1NEZG 3SQOL 1CGSL 1QA9B 3UYOD 2QADC 2IANE 5CP7B 4N9OB 5FUZL 3BKJL 1NMBH 1FV1A 1BGXL 1X5KA 4UT7L 4QXTA 2HT4D 3MCG1 5DQ9B 5GS2D 2ZUQB 1A0QH 3BW9A 2ZCLL 4OGXL 2F53D 1Q9LA 1JP5A 4P2OB 2G60H 2VLJA 3ARQA 4P4KB 3RAJH 2H26A 1JPTH 3BP6A 3VFNB 2OP4L 2EDLA 2ERJC 4MDJA 1YEJL 2LFGA 1G9MH 3I85A 5ICZA 4XCEB 3MRMB 4HIEA 2HKHH 4QTHA 4UV7H 3PWPD 4HUWA 1IGIH 1MJJA 5DRZA 1IT9H 4TN9A 5CJQL 3UTSD 1I8IB 3BIKA 3VRIB 4PJGF 3RNQA 4WUUA 3MV8A 2CK0H 3DRTA 1YNLL 2V17L 4PJ5A 5KS9F 4HGKC 3ARFD 1PY9A 4WDIB 3WN5B 4X7TA 3HUJA 4LQFL 3K46A 2LQRA 4ODUB 1Z9LA 4KTDH 3T8XB 5I16A 1A1NB 2O5YH 3F7VB 3N9GL 3BZEA 4ISVA 3WHE1 5FM5O 2VZTA 4HGWB 2EKJA 3ELAT 3G5XA 3AB0C 3QWQB 5ID1A 5D4QA 3MA9H 3U82B 2P8MB 5C92A 5HI3D 4AH2A 2PYED 3OX8B 2I9TA 4HIHB 5SWZA 4I3SL 3KPOB 3R06A 5SWSB 1I8MB 2YKLL 2F15A 1IC5H 3ZMRA 4PJCA 1KBGH 5JZ7D 2NY7L 4KZDL 4LVOC 2ICCA 2YPKA 3STZB 2VDRL 4W6XB 2GUOA 4RWYL 3MPCA 1QRNB 1U8HB 4LCYA 4TNVF 4YE4H 2P5WE 4YDJB 2RQ8A 4WGVB 3MJ8B 2V5YA 4XP5L 4OZHB 3O4OB 4ZS6D 4A2LA 2XN9A 4MXWH 1XF4A 3VXMB 4Y4HB 3KPSE 4NNYA 2NZ9C 3Q2CA 1YMME 3GFUA 4TSCH 1QHPA 4RAVB 3IU3A 3GNML 3VG0L 4NC2B 4HH8A 3BVNA 4I0KA 2EDRA 3QDGA 3QISA 5BOPA 2P5EA 2YRZA 3VFWA 5BRZD 5D72L 3VXRD 1QRKA 4LLYA 4LMQI 5T1LA 4TUOA 3RWFB 4S1DD 3V6ZA 1PX3A 3FZUD 4N0YH 4ZG1A 4N0UB 1IM9B 3CFBA 1X5XA 3V6FA 5I2IB 3SKMA 2DS4A 1CVRA 1FJ1A 1U8JB 3IETA 5IW3A 4LVEA 5E00B 3CZFA 4YDKL 1S5HB 4G9FE 3HZVB 5EDXA 1CDHA 5DT1H 4BQCA 2AXFA 4ENEC 2ILLA 4LHUG 3NCFB 5BS0D 3PUCA 2Z35A 4JY5L 5D6CA 3LKQA 1FG2A 1RUQL 4V1DB 2P48B 3HI6H 3S97C 1V7MH 4OQTL 1JV5B 3EUUA 3MRJB 4KHTL 2QQQA 1BVKB 4Y16A 2J88H 5DJ6B 5KAQF 2ZP0T 1HYRC 4R7NA 5DURB 1DQDH 3CK0L 3QIBA 1BBDL 4F57H 1NUDA 1BMGA 5IB4B 5C0GB 1TENA 2APTA 3ZYOA 3O6KL 3RWJB 1I9IL 1V3JA 4GQ9L 1MFBL 5HY9B 1GGBH 4EIGB 5HYJB 3MC0A 3LRSA 3CJJA 3KS0J 3MRQA 1WQVT 3I02B 3CFCL 3KXFE 2NY3B 3QG6B 4YFEA 1ULVA 4NHUB 3UTTD 3KLHC 2OS7A 3BJLA 3GBNL 5FOBA 5LCVL 2FYYB 1F58L 1CXFA 3O3AB 5EPMA 4Y8DC 4JFEE 3SO5A 4XNYH 3P0VL 5E03A 2EDBA 2OZ4A 2F5BL 3EJZD 3MFGB 1LO0L 4U1LB 5CIPB 4Z0XA 3ULUC 1IM3B 3SKJL 3C60C 4P5MA 5FYKL 4PJIE 3JSSA 5ITFA 4CN1A 3KYNB 4U1HA 43C9B 3UTZB 3I75B 4HK3N 3WFCL 3L5JA 4M7LL 2VIRA 4Z9KB 4UI2A 2C1PA 4F7EB 1AQDB 1AR2A 1G7MA 4C55A 5HXMA 3T4AB 1CD1A 4OF0A 3D0VB 4PRHE 2DBLL 3MLYL 2Z31D 4N0RA 4XC1H 1NQBA 4NO2A 4LVHB 4AMKH 3HFML 4NN6B 5KJRL 4MJ4A 1H3GA 4PJEB 1G6RH 1JGEB 5IMKB 5I71B 5L0QB 3VWKB 2R56H 1P9MA 4YEFA 1A9EA 3O3DA 4Z7WF 2AK4B 4B7LA 2XA8L 4YUEL 5CIPH 2ZNXA 5DEZA 1UYWL 3BD4A 3CPLA 3KAAA 3SDDA 4QNPF 2HKFL 4ORZC 5A16A 2CO7B 3TT1L 1FDLH 1MFAL 4JE4B 3I84A 1U8MA 5I8EB 1VGEH 3INUL 1ZVSA 2X9XA 2R2HB 1UVQA 2MKLC 1U36A 3GMOA 1T66C 1VHPA 3NACL 4CDHA 4K71B 4PRPB 4UB0H 4Z7VE 3BKCH 1P5VA 1RUAH 2CDGA 4JZOA 3BJ91 1JN6B 3QNZB 2I9LA 5JXAL 5F96H 1M6OA 3REVB 3U9UA 4HUUA 2AGJH 4MAYA 1SEQH 1QACA 2OXHA 5IQ9B 4Q9RL 5FK9B 1S7QA 3MNZB 1TQCC 5DWUL 3PABA 2NY2D 1ZLWH 1J0ZA 2IF7A 4P2OD 4P4KD 1HYSD 4JM2C 2D7QA 4PJXB 2D31A 1IQDA 3D87B 4DN4H 4MB5A 4F15C 2BSRB 4K8RD 3FT2B 2A6IB 3QO0B 3WO3B 5GRUH 1EEYB 3S35L 1QSVA 4LSPH 1K4DA 1RJLA 4JREC 5D7SL 3P2TA 4ETYA 4XGZB 3QRFM 3RUGA 3HC0A 5B39G 4YIQA 1H3VA 4A6YB 5LGHH 4RQQB 3HE7C 4CU7A 2ITCB 3K4ZA 4K94H 4AL8L 1KF9B 4OKDA 3HS0A 3LN4B 4JFFA 3SOBH 2V5TA 1QEWB 3RWCA 5HDLA 2QSCH 4KV5F 3CXHJ 3NAAH 4FHBD 5JW4M 1FZMB 3QWRA 3RU8L 1W8OA 4PRIB 4DAGL 2D3VA 4RMUA 4HUXA 1FVCA 3C6SA 5CHNA 4UILL 4WWKB 2IANB 4CVZB 3T0BA 5SWSD 2OTWB 1A7RH 4UAOC 2VSDA 4FXGA 4XI5D 4GRWE 1S7RA 4PD4K 3V4VL 1KOAA 2GJJA 5E99H 5IBUB 4KKLC 4OT1L 1RJZB 1FSKB 1FVEB 4DUXA 3NFPB 4DVRH 1IAMA 4G3YL 5DRXA 2E7CA 4MQXD 1A8JH 1T22A 4FQXC 5INDA 2GJZB 1OSZA 3VXMD 3OGCA 3TJEL 4X7CC 4YWGH 4LLVB 5BQ7B 4IEFB 2D4DA 4K3JH 3VFSA 1NCDH 5KANG 4Z7UE 3NABH 5E1AA 3G6DL 3NPZB 4UDTB 4YDIH 3A6BH 5C6TH 2ZUXA 5DJXB 1CDBA 2QLVB 3JTTA 5GRZA 4MHHG 1A02N 1YEDA 2BVQA 1GGIL 2HTKD 3MOQA 1U8LB 3ULUE 3PWPA 5C0IB 3W5MA 4WJ5A 1I7ZB 4NQEB 4U6TA 3UTSA 5HVFB 1KC5L 2BC4A 5ERWA 3WS3A 3T4YA 5CSZB 3QUMH 5ECJE 1WT5C 5FO7A 4M02A 3ARFA 1N0XH 3M07A 1IM9D 1IBGH 2R1WA 4G8GA 3IFOB 4CAGA 1LP9B 1G6VK 1BOGB 3LKSB 4MDIB 4JGMA 4X6FA 4N1CA 2G2RB 2LAGB 4MNGA 5IV2B 2CDEB 3CVHA 1ZT7A 1MCBA 2JCCE 4NQDA 2FH6A 1MY7A 4GKNB 2VMFA 1PSKL 3BESR 3CFKA 4FQHB 5TQ0L 1O0VA 4X6CB 5IM7A 2X70A 2AEWA 2YK1L 5IB3B 5JQHC 4PP1D 4PJ8C 2UYLA 3EDEA 4V1DD 1Z0MA 3KPNB 1R3LA 2Z91B 4FP8H 4XAWL 3LDBC 1KIPB 1RZIA 2AJVH 2P5WB 4XPTL 5E8OA 1L0YA 3ESUF 4BFIA 3UZEA 4LIQL 5E7BA 1IC4L 2DDQH 1JTTA 2J6EL 1YMMB 2ZCHL 4IOIA 4AQ1B 2R29H 1NCCL 3FOMA 4RCAA 4Y1AD 5C08E 4J3VA 1FNEA 4OD3L 1NFDE 5J3HD 4K7FB 2COQA 5IVNA 1BQLH 5DUPL 3IYLW 2FJFB 2FSEB 3CD4A 5HYJD 1EEZB 1GYAA 5EC2B 3TNMB 2AK1L 3KYMB 4OFPA 1TZHB 4RMVA 5AZEL 1N8ZA 2NY3D 2EZ0D 2R9HD 3ECBA 3S36X 3VXPB 4LLQB 5FCSH 2C3WA 3O6FC 5JW3H 4U0QB 4JY4A 3DYOA 5JMRA 3JWOH 1D6EB 4PTUA 1EMTL 4NBXB 4FMKA 4IIQB 3RZCD 4HK0A 5CZXD 5DHYA 4M7JL 1NAMH 1J7VR 3T1FA 2DM3A 3HG1E 4H25A 3MNVB 1HKLH 5HVGB 1OAUL 3W2DL</