2MCMA

Macromomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
112
structure length
112
Chain Sequence
APGVTVTPATGLSNGQTVTVSATGLTPGTVYHVGQCAVVEPGVIGCDATTSTDVTADAAGKITAQLKVHSSFQAVVGADGTPWGTVNCKVVSCSAGLGSDSGEGAAQAITFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROMOMYCIN
publication title Crystal structure analysis of auromomycin apoprotein (macromomycin) shows importance of protein side chains to chromophore binding selectivity.
pubmed doi rcsb
source organism Streptomyces macromomyceticus
molecule tags Apoprotein
total genus 20
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1991-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 2mcmA00
1AKPA 1ACXA 1J5HA 4JW3A 2CBOA 1J5IA 2CBTA 2G0KA 1HZKA 1J48A 1NOAA 1HZLA 1O5PA 1NCOA 2MCMA 2G0LA 2CBQA 2CBMA
chains in the Genus database with same CATH superfamily
1ZD6A 1MW0A 4HUMB 1U3YA 2UZPA 1IIIA 3FZUC 1QD0A 4NJAL 4TYUA 4MAYD 5HPOA 3Q1EA 4M3KB 4PW4A 5E8PA 5J12C 4NNYA 1T2QL 4GG8B 2F53E 3ZVVA 2FJHA 1J05A 3G6JA 1CICD 1SLUA 2FX8H 1YUHB 4M8RA 1YDPB 1VGEL 1C8QA 1JRHI 5I8EB 5L8KB 1Q1JH 1KWKA 1OAUH 3KLSA 4A7GA 1M7UA 4H20H 2VMCA 5IK3A 5AALA 3VYNA 1UKQA 5BMFH 3KPPB 2IGTA 3LXCA 4EF3A 4A7SA 1NKOA 1VFMA 2WBXA 2NY0C 1ZLSL 3DXAA 5IMOA 2CJSA 3SKOA 1OP4A 1U3HC 1NDMA 4B7IA 4BZ1H 3MV11 1SLWA 2NY4D 5BW7C 4XXWA 1QP1A 1WA0X 2AKRB 4LSPH 5F8QC 4Y1AD 2Y6SC 1OV8A 2H32A 4K07A 4NZ8A 3ZTJG 2VABA 3HG3A 2CO6A 4LRNL 2OA9A 2BY3A 4L3AA 4NSKA 4WVRA 3N44B 2EDTA 3SPGA 5FM8A 2AMGA 5DZLA 2F58L 3DOIA 3GIZL 3B5TA 4V11A 3QHTC 3S5LB 3G5VB 4MA8L 4OD2A 3CU7A 4PSRA 3P0GB 3PUUA 3KPRE 4KK9C 4XP6H 3EH1A 2DN7A 2QL1A 4JDTH 3SDDB 4L37A 2YZ8A 4MAYC 5C6TL 4H5SA 1YEDB 4QYOA 4YHIA 4X6FB 2VSDA 1EGJA 2BNQA 3K6OA 2OXHA 2SEBB 4UT6A 1QZNA 2NTFA 5K1NA 1CICC 4HWUA 1TKWA 4NQDE 4MFHA 4PRID 4N1CA 3QIBD 2DQJH 2EH8H 4FERA 1QUNB 4ODHH 3EYUH 1IGYA 5ERWA 2WO4A 4M3JA 3EO9L 5B8CA 3QIWB 2Y5EA 4MCMA 4F2MA 1CZ8H 2E7LA 2Y1AA 1KV3A 2DJMA 5BS0A 1GYVA 4WUKH 4Z3JA 2ZUQB 3AY4C 4S0TD 4BZ2L 3GDBA 4DN3H 3LZFL 1EEZB 1A1MA 3HG1E 2DAVA 3L2LA 4JLRA 5E7BA 5MHSD 2NY4C 3OJMB 4W9KC 1N8OE 4KKBD 4KQ4H 3DSFH 3I9PA 1AJ7L 1AY1H 1MCHA 3NIFB 1BXUA 2V3FA 4OAWA 5F96L 1X7SA 3QXDB 4DFIA 5F1NB 4KITB 5KYWB 2X44D 2PO6A 2YPKA 2OMWB 5I17A 3U2JA 1AR1D 1YY8A 1QWNA 1FFPB 2R2EA 4RBPK 5FDWA 1WWCA 3KHQA 3KPOA 4AK1A 2ZSVB 4Z7WB 3ARTA 3QUMH 1BF5A 5IW3A 2P5EB 43C9A 1M3JA 3CG8A 1RZFH 2Q6WA 2D8KA 3H9ZA 1SJVA 5D7IF 2CZNA 2KERA 1YNLH 3UO8B 2DMHA 5D70L 4PRHB 3C8DA 2VN4A 1D9KD 1IL1B 1T1YB 1AS8A 3DV4B 2BWQA 4OLXL 5MERA 1KC5H 3QIBC 1LO0H 4M7LH 3U4EB 4OCNC 5IROD 2B5IC 3PGCA 1XSIA 3BD5A 1UWGH 5I0VA 5AAWA 3FU6A 4JVPA 3ESVF 1KTJA 1HXMA 4POZC 4QTIL 2A5UA 4CSPA 3QDGA 1NCAL 1W80A 2BSED 5E9DE 4PJBF 3ZYOA 1E6OH 2XYCA 5LBGA 3D18A 3WEMA 1NC2D 3TV3H 4YSPA 3MCKB 5TH2A 3KS0H 1NCUA 4HXAL 5DRWA 4KKBC 2VL5A 1GGBH 3WGUB 1O5DT 1Q9WB 2EE2A 3HBPA 1N0LA 2CNZA 3C5ZB 2X4PA 2JB5H 2LLNA 4KGLA 2PP8A 1PZ3A 5E8DH 1SJXA 2ZWNA 5BUPA 3BZ4A 4U7SA 4AUUA 3OPZL 4KMTH 4R6UA 4HAKA 1RZJL 3STLA 5EN2A 1BGXH 2JB6B 1AR1C 4LLAA 2OX5B 4Y4FB 5I24A 2B4CH 5IVOA 4NENA 1YYMH 5ITFB 1RY7B 3A67H 4FG0A 2ITCB 4JRYD 1DFBH 3SE9L 1KB3A 1R24A 2X4SB 3ULSA 3ZZLA 5EZPA 5BXFB 5T3ZL 5KG9A 2EIDA 4F2FA 2PPDA 3QQ3A 1D9KC 2ARJA 3LRKA 1BX2A 1CLZL 1DSFH 1YLBB 4NQXB 5F9DC 3NIDF 1M57B 5F9OH 4Y4KA 3L3IB 4PIBA 2ZXBA 2XZQL 5IROC 1WHPA 2OW7A 4OR1A 4L3EB 3PWPD 2YGQA 1EV2E 1H3WM 3CFBA 1T4KA 3F83A 4F7CA 3CQFA 1JGUL 3HFMH 5KZCB 4EMZA 3PPSA 1P4IL 3L5HA 4FEIA 2WLIB 5HGAB 3D85D 1LE5B 4QHNB 1UENA 2ERJC 2CGRL 2NX5E 5INDB 3VM5A 4JHBA 4WSGA 2CIKA 2Q10A 4GLRH 2AJYH 4JFDE 1R4XA 3RFZC 3CHOA 3B56A 4MD5A 2YRZA 3H8NA 3MYJB 2ZICA 3ULUD 3GHEH 4AQAB 5INCB 4Z7NB 4KDVA 2B1AL 2C3VB 4AXWA 2EYSB 4ES8A 1EDQA 2ZAIA 1J9QA 4ZODA 3S5LG 3VFOB 3WFDL 4S1SH 3P4NB 3U2SB 1KYOJ 1FFQA 3GHBH 1NAKL 3BAWA 3N1GC 1UD6A 2DW5A 2G60L 3QI9B 3RWEA 4F15B 3NGBB 3VD7A 4HKJB 1AP2A 2Y7NA 1GC1C 3UIYA 1DVXA 1N18A 4XRCA 5IMKA 3GSNL 4AEFA 1EX0A 1ZDQA 3UTSA 3T3ME 4NDMB 2E27H 4P2RE 1LK2A 3PP3H 2BVQB 2VT0A 3I6KA 1GAFL 1MCNA 2B1OA 3HE7A 4IU3B 3UYRH 1JZGA 1YEFL 2FX9L 1MJ8L 4CKVX 4R26L 1CDYA 4U6TA 3ECBA 3NQKA 2VDPL 1KLUA 5CJ8A 4XBEL 3KPSE 3LD8C 2MPAH 1RK1A 4OZGF 4APQB 3NDZE 5JORA 4DNLA 3FCSB 3O6KL 3LPPA 4TVPL 3MOBH 4HWZB 2ZIDA 4LL1A 4JE0A 4UB0L 2EUZA 1NEPA 5D7IE 3FTYA 2FHFA 1JNNL 4OFQA 3EADA 1ILSA 1A0QL 3WN5C 3MRIB 3ULUC 2O5XL 5LAXB 3JV0A 1COBA 1OTSD 1S8DB 2DV6A 1ZANL 5FW7A 3GS7A 3BD4A 1SM3L 1XXFC 2W1NA 2EE9A 3Q2WA 2XWBB 3R8BB 2CPUA 3OX8B 3MLSL 5D2NE 2J21A 1F1DA 3EF4A 4K3DL 3BIKB 2BJML 2HJKA 5E2UL 3NZ8A 1W0YT 1F0LA 4DJMA 1PQZA 4GIAA 5C09E 1RD6A 1FP5A 2WCPA 2VLJD 1EHNA 3G6DH 5GS1A 4PJBE 2Q8BL 4UQBA 2Z8SA 4XMKL 1BXXA 4GRWH 3HKFA 3QQNA 2OMTB 3HS0B 5FHAL 4M7KH 2FJFA 2V17H 1KEMH 5GGUB 1KBGH 5ITBH 1NUNB 3FT9A 3B7RL 1TVBA 3B2VH 3EGXA 5GZOD 3FTWA 1XCXA 4I9WE 3WFEH 4FEMA 3IF1B 4LP5A 4DERA 4C4KO 2APVA 1EHAA 3U1PA 2J5WA 5C0AE 1S7WA 2WO3B 3BXNA 5LWYL 4X7CC 1JE6A 3ZDWA 3N44F 2XTJE 5E94B 5FKAB 4X5XB 4K3GA 1CS6A 2BY2A 3GYRA 2K7PA 2QADB 4A2DA 3F5WB 2AV7A 4FDWA 2Y07H 4XP9H 3IAGC 4L23A 1N64H 1IBGH 4YJZL 1OTSC 1ZV2A 3NIDE 3Q48A 4W9ZA 3E2HC 2ZUSA 3ETBF 1UZ8B 3U6RA 4X83A 2O1AA 2DH2A 5GGTA 1J86A 4U05A 2A9MH 4I0PA 5KSAB 4MMZC 4QIRA 2VW4A 4G1EB 1AKJD 5F7BA 4OZIA 5K1JA 1HU8A 3RB7A 4BH7B 3MV01 4NQED 3REWA 3GIVA 3W0WE 5ESAA 5HVHC 3DX6A 2VLMD 5DHMC 1KIQB 5SWSB 1RKRA 1N5AB 3MRLB 1LO2H 3ZRFC 3L4ZA 1LJMA 5I1JH 3QEHB 3T2NH 1QR4A 5E8EA 5C0IB 2XN9A 5HGDA 3Q06A 4ZMYA 3ARBD 4H8HA 4UOJA 4H0LC 1T0OA 4AM0Q 4X0KA 5F6HI 4P46A 4ZO7A 3ZBMA 4YSRA 4KMLB 3ARFD 3GO1H 3S96B 4PJ7B 1LO3L 1L9PA 1J0HA 3ZOAA 4LCCB 3APFA 3IJ7A 4LE8A 3Q13A 3W2DL 2V8LA 3NJVA 1T04A 4KAQH 1JPEA 4BA8A 2E86A 1GZPA 5BV7H 1KENH 1QSEA 3LPGA 1EJFA 4AL8C 1ETA1 4K94H 4HWNA 1RJCA 3IETB 5ANMB 3OF6A 3TBWB 4PB9H 4NNXA 1WD9A 3JWOH 4OZGE 4P4RA 4UQEA 5IW6B 4MCYB 1RUML 4JNXA 2OQJA 1G6VK 1RJZB 1IFHH 5IB5A 3B3IB 5AVVB 3P11L 3IJ9A 4QCIB 5DYOA 5SV4A 3L3JA 3MGOB 4HMEA 4LEBA 4GPVA 5JIHA 3ELAT 4O2CA 4DN3L 1BZEA 2WUCL 2Z6FA 4C83B 1DQTA 5D6DC 5JDJA 5J8OA 2OBGA 1MIEH 2TSAA 1CD9B 5FPIA 2HFGH 3DJRA 3QP3A 4E68A 3IXAA 5H2BA 4NRYB 4KQ4L 3ARYA 4ZW8A 4AITA 2PXYA 2W92A 1E2VA 1JGIA 2Y5TB 2LGNA 3ARBC 3STZB 2EVHA 4FTVB 1PNDA 1T7VA 2X88A 1PJWA 1PF3A 3ARFC 1XIWA 4DQAA 3IU3B 1CTOA 1OF2A 1FSKB 1N59B 1P69B 1P6WA 5TJWK 1KCWA 3FQXB 3AC0A 3Q0HA 1OGAE 1TZOA 2FO8A 3CFKB 4FXKA 4PJHB 4WI4A 3PUCA 3LZLA 2ZP8A 2W0KA 1RZFL 3GMLB 1F1GA 1IAOA 1UA3A 5KN5A 3BUTA 1VSCA 4ZUTB 3CV5A 5EU5A 1FNGA 3BI9X 3NN8A 4MX7B 4DPCX 3BIAX 1OP5K 2J8UA 4X9YA 1EIBA 3BEWA 4YL9A 5K9JH 1LO0L 3MUGA 2BIPA 5L2KB 4XHJD 4RAUA 5BUGA 1F4HA 4WK4B 2J2ZA 1ZJBA 2AQPA 1UWGL 1MRCH 3I75A 3ECVA 5JIIA 4EI5B 3C60D 1XDTT 3RU8H 5I18H 1NCDL 3CHPA 3TH2T 3OJDB 1VPOH 1MG2C 1S78D 1OVZA 3BFWA 1QSFA 3F12B 3KYNB 2EXSA 1X5YA 4KKPA 4WFGD 2F8OA 4ODWA 1H3XA 3QJRB 3IS1X 3RX7A 4N85A 2BFVH 3OB0H 3W11D 2ZYRA 4JQVA 2EIMB 5LGJB 4X50A 1IGFL 2F08A 2FH8A 1SUJA 1QO3B 2VSKB 4NO5A 3QYNA 1MFAL 4UTAL 5FFOA 2ARWA 4X2UA 2UYLA 5E8DL 4YSTA 6PCYA 1CLOH 1V5JA 1JGEA 1SVZA 4KMTL 2YPVH 3K6IA 5I0XA 2E9JA 1R5IB 2VDNH 2Y1ZA 4QY8B 1MAJA 1S7QA 2MTAA 2B4CL 1UURA 1YYML 3MC0A 4NT6B 1JZ2A 4ZK8A 3T6XA 1JK8B 5HI4D 1DFBL 2EP6A 1TCRB 1HOCA 4CN6A 4KKQA 3C5SA 1MSPA 1GYWA 2EDHA 4N2NA 4D3CH 3LKPB 5EWIL 1E2ZA 3L2MA 1G4MA 2W65A 4PR5A 5CUSH 3EFFB 2B39A 1S7RB 4RMBA 3E6FA 4PU2A 5E2VH 5LXGH 4PJ8D 3NIFE 4XHJC 4AYMC 3K2IA 4RWYH 2VWEC 4O51B 7FABL 3BDYL 4CU8A 3F58H 2WVSA 1NLDL 1FYTB 2VW7A 2NW3A 1SXBA 3C60C 3PFUA 3N1PC 4J4PD 4JDEA 1KB5A 4PIRF 4IOIB 2WQ8A 4BK5C 3SDXB 1S78C 3GJFB 5GRJH 1ZSHA 3EZJB 4FI8A 4AIOA 2AJYL 2F61A 2P5EE 2D3JA 2O6EA 3UJTH 2P47B 3U1QA 1ZAGA 4PJIB 2FBOJ 3W11C 1Y18A 3KEDA 1EAJA 2V7HA 2QPUA 4FLQA 4A2EA 1CBVH 1INEH 1JWMA 3U9PL 2G3NA 4XPAL 4NP9A 1H3TA 1KIPB 1Y6KR 2XTSA 4IEFB 4CVXA 1TOXA 4P5RA 5JIPA 2E7BA 4FQ1L 4N5UA 2G2RB 4MSWA 2DD8L 4KZDL 4DPAX 3FO0H 1WVZA 2OP4L 1EVUA 1DVUA 1IB5A 4S0SD 3MN8A 3DVGA 4G9FD 3TIEA 4PBVC 1OAKL 2GEEA 2YQGA 4PJAA 4CVZB 1KN4L 3NFNB 1NAMH 1DBAL 2JK5B 1MZYA 4X7SH 5GS2D 5IWLA 2ADGB 3OR7A 5HI4C 4QHUA 4I3GA 1A8JH 3D0AA 1CXKA 4Q9CA 3BKCH 1RSFA 1XXDC 4WHTA 4MKTA 1C5DB 3D25A 5C0GB 1XZ0A 5A2BA 1NBYA 3ARDA 3GZKA 5GHWH 3AUWB 1JF5A 4UI2A 4KY1L 5FS5A 3FQ1A 4XODA 5LBSA 4PJ8C 5ENWA 1RCYA 5IHZA 5GJTH 1W0WB 4N9GB 1J10A 4OJEH 2MPAL 3AWFA 3AS0A 1DANT 4J4PC 1U8MB 5I1AB 1X6NA 4ZPTA 3SJVB 2XY1A 5DQ9B 4XN1A 2EDWA 5C7XL 1TTCA 3EO1A 3LH9A 4WRLA 1ZPLA 3JZ7A 4ZNCD 1FRGH 1WZMA 5D2LA 5D1ZA 2FWSA 5CN3A 2F7RA 2GFBA 4QRTB 4JFED 1DBMH 4WO4B 2PTTA 4IU2A 4R96A 5CJ5A 3VMOA 2V5MA 3PABA 4HBQA 5HYEA 2WXOA 3BPLB 1EUUA 1NKRA 1WG3A 5I1HL 1TZGH 1OQXA 4L3EE 3RI5K 2J1ZA 2EDOA 3H7LA 4Q9RH 3U25A 5JHDA 4EIGB 1DQQB 3BFOA 1NANI 4LVOB 3MLVL 3UOAB 2LOEA 1B0IA 2H4EA 2NY1D 3KXFA 3CC5A 4XVUC 2QQNL 4NQSA 3V0WH 5IB1A 5IZ7A 2V17L 3BAJA 3CSGA 2V2XA 5ITBL 1PAMA 2JF1A 2BIQA 4HHAA 4ZUWB 5I5IA 2FIRT 4XCFH 1XT5A 3O3EA 5C0ND 3BCDA 3B2VL 4JFUA 4P48A 4RAVA 3UIZA 1UD3A 1B4TA 3R4RA 1MG3C 4XVSL 4AG4L 3N9GH 1BCIA 4M00A 3TEUA 2GY7B 4K5NA 3RNKB 4G7SB 4P2AA 1KCUL 2X6MA 3RILA 5FXCH 2OCJA 5CGBA 3SQOH 2VLKA 4JFQB 4PJ7F 1I3UA 4QYAA 1BECA 4X5RA 4NQCA 3BVUA 4LPUA 3JWDC 1QW9A 1IM3D 4OF6A 3HPJA 1M1XB 4OQTA 4F5CE 1EXUA 2BNRA 2XNAA 1IBGL 3VYOA 3K2UH 3HNTH 2Y24A 3VGFA 4XMZA 4NO0B 1QR1A 5DI8B 3LQAC 2A77H 1TJXA 4X4ME 5FM5M 1F6FB 4UTBH 3JTBA 4JHZA 2ICWI 5MI0C 4UT6L 4C56B 1L4IA 4WGVB 1AZBA 2EDDA 2IH1A 1JJUA 3UZEC 4LAJH 1FBIH 1X5XA 5DC9B 5HVFB 5HYQB 1C16B 3WY1A 5FYJL 1G1OA 4UQ3A 4DKEL 4P5MA 2CK0H 2X9WA 4JFVA 2OS7A 4FNSA 5C07D 1BLIA 1FWXA 3FN3A 4UOZA 3D85B 4HC1H 4KNUA 1XZWA 2LTQB 4XXCC 1WE5A 5JQIB 1U8PB 2PR9A 4CMHB 5HYFA 3VNZA 4YZFF 1GY1A 5I1JL 2Q7YA 3WFHB 3U2IA 3T2NL 3THMH 4PAZA 5BQ7B 1A7PH 4ORGA 5C9JB 4K0OA 4L8SA 5CD3B 4QKXB 4G6FD 4OBSA 2D7OA 3CSTA 4L5FL 1MHCB 5BJTB 3V5KA 1WQVT 3QG6B 3VQ2C 3QFJA 1B88A 3M6DA 1P5VA 3P4MA 2AQTA 5AW9B 4ZAKB 3H9SB 2C34A 2RCSH 1U8IB 1PKQA 3P2BA 4P04A 2I07A 2BOBB 4KAQL 1MCCA 1S7UA 1YEIL 1T83A 3QUZB 4ONGH 4PJHF 1A7QH 3BWUF 5HHME 1MOEA 5CSZA 4FNQA 1E6JL 1YNTA 5IMMB 6FABL 2D7MA 4G43A 1S7TB 3MSPA 3KCPB 4K94L 4NQVB 1VACA 3IWVA 5ALCH 3G08B 2CRZA 3O3DA 3K5SA 3C6SB 4PB9L 4Y19D 5C8JB 3ORJA 4R7DB 3KPNA 1MFMA 1Z0NA 1B9ZA 4XP4L 1IFHL 1KCVH 5K9QI 4BGLA 4UMGA 3QDME 2R0ZL 3B7TA 4JFZH 1LEGA 3M1OA 3LKOB 2VNCA 1PEWA 4GRLA 1JWUA 3NCMA 4X4ZA 2PWFA 3KGUA 2CO1A 4JJ5A 1YEKL 5EO0A 2WTOA 2HFGL 1G9NH 2WNGA 4AT6B 3EYQD 1C5CL 1E28B 2NXZB 5F6IC 3C5JA 3QNXA 4FJ6A 3ZYJA 4LOEA 1SQMA 3UXFA 3MXVL 3C87A 3TBTA 3WSQL 5D7JA 2V9UA 4NC1C 1TO5A 4MMZB 3K8KA 3WNNA 1OSPH 3EHBB 5E8NA 5B3SB 4MDJA 4B97A 5I9QC 1KBWA 4UYQA 1PD0A 3WTWA 4R2GB 5A43C 1YEHH 3W38A 3CBKB 1DEEB 1EXGA 4HKZA 4XPFH 5SWZB 3RVWD 3ZTCC 5KVMC 4M1DH 5B4MD 3MV7A 5SWSE 4TUKH 4ZFFB 2AJUL 1MXDA 2DM7A 5TE4L 3T4AC 3RGVA 1WIPA 2DH3A 2XKSA 3RTLA 2DLEA 1MCBA 5FGCE 2NY7H 1JMZA 3FOMB 4FGMA 1EMTH 2C1OB 3MBEA 5EBLA 1L7IH 2BXYA 2C9QA 4GMTH 1U41A 3C08L 4R5TA 4RMUA 3LEVH 3BKYL 4B9PA 2CO2A 3SB3A 4PJ7E 5EEVA 1TQTA 4QAMB 4KRPD 1KCBA 5I18L 1CK0L 3OKKA 1U33A 1LGVA 4XMWA 4RQQA 1VPOL 1L5GB 4AC2A 4IBUA 3QEGH 5CCKL 3CU1A 4WK2B 3RL1A 1JI1A 3HE6D 3SDXF 1SEQH 3U0TB 4LESA 2RACA 1Z9MA 2BFVL 2P3YA 5CJXC 3EYQC 2W94A 3D09A 1HYSD 3VFUB 2AV1B 2R2CA 2V2TB 4OLYH 4HQQH 5C92A 5T3ZD 1ZE3C 1HQRA 2R27A 1CLOL 1EZLA 4QRRA 5ANME 4XN5A 3T0EB 3UTZB 2YPVL 4FKKA 3DVFA 5A2KH 4E0RB 1IV8A 2KQNA 3ESUF 3FT2B 5D71H 2VDNL 4RDQG 1KPVA 1AKJB 4XCNA 3BGFC 4Q6KA 3VUAA 2HWZH 1GMIA 2YJLA 5G4OA 1TEYA 4PRNB 1SDYA 4Y2DA 3D50A 1MUJA 1MHEB 4GB9A 1V3LA 1MRFH 4YZFE 3RVWC 3MO1A 3PY9A 3QQDA 1MCEA 3GLDA 4LEEA 2L04A 2YD2A 1CDUA 4QTHB 4HKBB 3FRUB 5B1JC 3VXUA 5GZNA 4PJ9A 5CILH 4J23A 12E8H 5C0CB 4WDIA 5E2VL 5DS2A 3RWJB 4ZMTA 5HHQB 4RWYL 4N2EA 2WXRA 4FTVE 5I0YA 3V52L 5C0EA 1RLBA 4RFOH 3F58L 2E6PA 2CKBH 3EBIA 4WW2A 5FYKH 2DQGL 3RVVD 2E8YA 4KRPC 4R7LA 2BSRA 3DX4A 2I24N 5CBEA 1TCMA 4L9LA 3WAJA 2ODIA 1HXKA 1RZJC 5GRJL 35C8L 3L3OA 4FD0A 4M5YH 4PJHE 2HVJB 3KWXA 4B41A 3SCMB 3HE6C 4PRBA 5D7SL 3NA4A 3QH3A 4RGMB 5AAMC 3CNKA 3J27A 1HHJB 1Y07A 1NGXB 3OZKA 1AD0A 1OHQA 2DB8A 4YLBA 1HYSC 3H42L 4CA4A 4HHGA 3BGAA 4K5LA 1INEL 2MCG1 4HYTB 3LN4A 2W95A 1GZQA 1VERA 3ML8A 4BSWB 1IGMH 2PPEA 5J6GB 3N40F 2VDKH 1G9MH 4MJ5B 2NUTA 4XNAA 5L2KE 3JYCA 1L9OA 1T0NB 4HXBL 2JE8A 2DWXA 5JHAA 3VGAC 3HNSL 4BCZA 1NAML 4X7SL 3P0VL 3FPYA 3VH8A 5KVDE 1PKOA 2R1XB 2QMKA 2ZTBA 1U95A 2D3LA 4HK0A 3MDJA 1AXSA 3BKCL 2L4OA 4TVPD 3HAEH 1TTBA 2DI8A 4Y5XB 1ANUA 3BSZH 3HNVH 5GHWL 1X5HA 2R0LL 2AEIT 5DC0A 4WO0A 2I5YH 5GJTL 1AGEA 2PW2A 2XQYG 1BOGB 1I7ZA 4WEMB 3RVVC 1PDKB 3CZSA 3JWNC 5AVWB 1CE6B 1CIUA 1SFHA 2XWTA 2BPBA 5E95B 3MPCA 3B6SB 3QWRD 3GM8A 2EC8A 5ECJE 4HH9A 1AR2A 3F04A 1ACXA 4YDMA 3QCVL 4ZSOA 2GC4C 4JANB 4RDQF 4N6RB 1WC7B 4FQIL 4XPTL 4KC3B 3JT0A 4KV5F 4WFHE 1T89C 4M8UA 3AXHA 2X3BA 1N4XL 2EIEA 4P5SA 1RHHB 4WWID 3WEXB 3PJSB 3S3DB 4FXGA 1TZGL 3JBG7 4I18C 4CNIB 2C9PA 4DP2X 4A68A 3ZKMD 4Q9RL 2DLGA 1WIOA 4MA3A 1YN6B 2GJ6D 4JMXA 3VXSD 5A2JH 1FYTE 3TC9A 3Q01A 5FA4A 3QFDB 4PN6A 1UASA 4J1UA 3RVTD 1HXYA 1N12A 1U93B 4A6YB 4Z78B 2RBLA 2DQCL 4XNQB 3SDXE 2A38A 1EFXA 3BP7A 2K6YA 4Y4HA 2JLLA 3MX0A 3RJQB 3V0WL 5IBTL 2NDGA 1ND0B 4HGWA 2ZKWA 1SNRA 3QT2A 4XNZB 2GCYB 4APXB 4HG4K 5TE6L 4XCFL 1O7DE 1TTRA 4CC1A 2COVD 4TNWK 4JN1L 4NWTH 3P30L 1AACA 4HUXA 2O5ZH 1R3KB 4XVJL 2J8OA 1M56B 2AK4A 3RDTD 3ULUF 5EZLA 3Q2VA 4RGND 1MCWW 4PRIE 4HX1B 1ZHLB 5EU4B 4I13B 3UZQB 5ACZB 2Z31A 5ISZA 3BKMH 4OCYH 3B9AA 4AEHH 1JN6A 2MHAA 4HEME 4YE4L 2ZPKL 4J12A 2DM4A 2GUOA 1B0GB 1JFQH 2GT9A 1FL5B 1OB1B 1KGUA 3HJEA 3L1EA 4F33B 4F7KA 3ELQA 2VDLB 2YXFA 4DK6A 2M2DA 1QSVA 2C4FT 4ZRGA 5F93C 3HNTL 4PRPD 3T0XA 5ADPL 5GS0H 3OAZK 4L9DA 3UPRB 4AGMA 1OP3H 4B3VA 4DAGH 2A77L 1K4CB 2DMGA 3HBZA 4X0NA 4HJGA 5MHSE 3HI1A 4WFEE 1WEJH 5E4AA 2E47A 5AYQA 3V4PB 1P5UC 3ROOB 3T0VA 3WGVB 4UQIM 1AI1L 2OR9L 3IKCB 3NT0A 1UB6B 2YBGA 1B3IA 4OM1H 3ZKMC 5TGBB 2EDXA 4AQEB 2A6KA 2GABA 3GNMH 5CIPB 2QBWA 4KXCA 3SJVE 2ZSWB 4MDRA 3RVTC 2OTUA 2WC7A 3GEFA 3V79C 2L7EA 4G70B 1MIMH 1U36A 3P9LA 2X7LA 1EH9A 3IDGA 2QQKH 3D12B 3VMNA 3TEXA 3F85A 1KFAH 1YSOA 4LOVA 3Q8CA 3TT1H 3M8OH 3RDTC 3ZXAC 2ZKYA 3ATAA 4RGNC 5FK9B 2OSLA 5ETUB 3G7TA 3X17A 4BJLA 1Q94B 3Q2NA 3U9UB 3OQ3B 2BXZA 4FFZH 1QX1A 2LT9A 5HD8D 4XB3A 2FLBT 5DFVD 5SWQB 1E4XI 2JMRA 4BSVB 4WZ9A 1RZKL 5C97A 5H94B 2ROYA 3GB7A 2ZX8A 2C3WA 1CPUA 4Y5VA 1UQSB 1XQ4A 3EOAB 2VXTH 4HH8A 4UM9D 4ONGL 4NEHB 1W6WA 3C09B 4NKIL 4P49A 4LCWD 4UCFA 1RXLA 4JFHE 1SJEA 2ATKB 3P1VA 5EUKB 4BQBA 5BZWB 3BJ91 5K59F 4BQCA 3NJGA 2YD1A 3ARRA 1FZJA 3LOWA 5ALCL 3D9AH 3KDMA 4MQ7A 5AYTA 3W9EA 1DVSA 3ARZA 3C9NA 4E9XA 4PJXB 2FLMA 1RV6X 4G7RB 4TSAH 2NNXA 3K6FA 3VRIB 1UOLA 5IOPA 5ABAA 1OW0A 4JFZL 1JHTA 1ZS8B 4ONFL 4NP4H 1MHHA 1F8TH 3VXPB 4M9OA 2AXGA 3TVMA 1AAJA 1URZA 2Q7AA 4WIQA 4CBPA 1KCLA 2CUAA 3VWKB 3WEAA 2BSTB 3MV9B 1N6QH 3E0GA 4KV5E 1VENA 1WFIA 2F7IA 2GPZA 4M8QA 4YLCA 4HS6A 1XB8A 5AW5B 1HI6A 3CUPA 3CMGA 3IFLH 3K4DA 3D39A 4KI5F 4C56E 4O2EA 4HEPA 2WQVA 1CGSH 1HL9A 3DMMA 3IDXL 4WJG3 5FGRA 1BQHA 2EKJA 2I85A 3S4SA 5HD8C 5J3HD 1D2OA 1OSPL 5CGTA 5DFVC 3B2MA 1KV7A 3FW6A 5TDPB 1ZLUH 1HHGA 1YEWA 5HHOA 1YEHL 4JG0L 4ODTL 4UM8A 1L9MA 2EIBA 2JKTM 1DDTA 2WNXA 2XTLA 3N43B 4L4VA 1A6UL 4TUKL 5IFAH 4MNQD 4DGYH 1ZT1A 3LKRA 3CDZA 5F7HA 5DQJA 2XIDA 4UQAA 1UXMA 1K3IA 4TRPL 4WEBL 3VJ6A 3D0LB 3WYRA 4AQ1C 3ULUE 1FL6A 2W0LA 3PJNA 2NY7L 4BFIA 4N8PA 5CU9A 1SLXA 3TWCH 5JA9A 2CBPA 1GCYA 4GMTL 1O5PA 3LH8A 4HS8L 4L0PB 4NOFA 1CO1A 3DRQA 1C5BL 2I9TB 3APDA 4HIJB 2HXAA 5T1MB 2JKIS 1D5RA 2K70A 1JVOA 2FBJL 3S5ZA 1P1ZB 5AKVA 1KB5L 4HV8A 2IJ0C 2AKRA 5KVEE 3DBSA 1IM3B 4JR9H 4MB1A 4ZUSB 1XMEB 3MNZB 4HIXH 1HJCA 3SOBH 3WKMH 3WE6A 4AJ0A 5AB9A 2FGWH 4LBAA 1M2VA 1S9XB 1A9BB 1PFOA 1RZ8B 3KWWB 1XF3B 3W1ZA 3TNNA 4CKQA 3ES6A 4DO6A 4NCDA 3G5VA 15C8L 1FL3B 3UACA 3GXIA 7TAAA 5D71L 1WBXA 4OKDA 3OZ9H 4AZ8B 4LL9A 1JL8A 1YJDL 2RA1A 3FB7B 2EAEA 5EF2A 4ANVA 3HS9A 5J3HC 3VD0A 2WZAA 3QEUA 2HWZL 4AYID 3PWVB 7PCYA 4YWGH 5T1DH 3S3JA 4NZTL 5F3HA 4K8RC 3RIFK 1TTFA 1O9WA 4J3SA 5AYUH 3FTVA 5IESH 2F9BT 1MRFL 3PL6D 3S8GB 3DIFB 1W72B 1A3RH 1OD9A 3G04A 2J57A 1JPST 4TM9A 4U6HB 1QUNA 2Z64C 4KUZL 1LNUB 4JHVA 4L4TB 5FOBB 5MEPB 2X4TA 1FGNH 1IC4H 1QRND 1H9DA 4HWBH 3VSUA 3A6BH 1IM9D 1MY7A 4YAQA 1IGCL 1QFUH 1W8NA 1J7VR 2UZIH 5JPNB 1Z3RA 2Q3ZA 1L6ZA 3ZIYA 1XSOA 2OMZA 4PJDB 4V1DA 4MCZB 4XAKD 1A6ZA 4Y8AA 2XUWA 3GPEA 4IBYA 1QQDA 2CDEA 4FP8H 1JZIA 4UIKH 3PV6B 5MEQA 2VLJE 1JGVH 4M5YL 2VC2H 2B4CC 3INUL 1XH3B 5IV2B 1PZ5B 4IIZA 1J5IA 3QXDA 5SWZE 5K59E 5LVEA 5CXPA 2H6UA 2P1YA 3VXNB 3GSRB 4JY6A 4BHUI 4TNVF 3T4AB 1H15B 3CCHA 4H8VA 4X6EA 2Q3AA 2H1XA 4WUUB 3F6LA 2A9NH 5DZOA 3VFTB 4Y19B 2K3TA 2RIKA 5I75C 1G7MB 3A23A 1RFDL 3CPUA 2VZTA 5FYLE 4OIIH 2CR0A 1FVEB 2IOIA 3OL2A 4WV1B 5AVTB 3EYFA 4PCSA 2YEZA 4CADA 4Q0XH 1YN7B 3FONB 3JV4B 2BWDA 5EDXA 3ALPA 5EZOL 3PL6C 4Z0XA 4F8QA 5C2UB 5JLZB 3ZT6A 4KJYA 3MRJB 4K23L 3QUXB 3GUTA 3UDWC 2VLRB 2A6IB 1CCZA 5TF0A 2JJSA 4AVHA 1S9WB 2NY6C 2ZX5A 1KGCD 1QPPA 2KLTA 5KWYC 1WICA 2JELH 2FLRT 3LHAA 4KI5E 1BBJA 3DRTB 3F7PC 1BAFH 4M61A 4R4BA 2IFGA 4AMKH 1QLFA 5GSVB 3WNOA 3O8XC 4I3RL 3P9MB 1BFVH 4GW1A 3FDWA 3VFWA 3BGFB 4JFYB 3NEEA 4LP8A 5DJ6B 1MQ8A 3MNWB 5FWQA 4F37F 4Q7DA 1UADC 5I1LB 5G2NA 1CXIA 4PGDA 3VMPA 3D51A 1QTYT 4OLZH 2FT6A 4D0DB 1AO7D 4PS3A 5ESVA 1QNZH 4KI1A 3LPOA 2BP8B 1PZDA 4IHOB 4GXVH 3ARXA 1GR7A 1IGIH 3L3HA 4PJ5A 5HSFA 4FQJL 5DD6B 5IUSA 1WFNA 1U8CA 3ZK0A 2R23B 1KELL 5C0CE 1AXIB 5BVPH 2B7DT 4EDXB 1Q1PA 2X3AA 3QDHA 3BDBA 1CC3A 5FECB 1EHXA 2YPLA 3ECUA 1KJ2H 3BYYA 1LDSA 3QUYA 2KMWA 4ELMA 3ZDYF 1A1NB 4HF5H 2IANB 4NQXA 1CTNA 4XOCA 4LBEA 4KX8A 2C3HA 1E3FA 1LP9B 4HJ0D 5KSBB 1FGVL 1WFUA 1KYOK 1HDMB 2YKKA 3VNYA 4ZXBD 2R1WA 4NWTL 4N24A 4OCRH 3LKQA 1S7VA 3O2DH 3O9WB 4EZJA 1NDGA 2OK0L 5CGYD 2WLIA 1E42A 1GGIH 5TQ0L 4UT9H 3LSOA 5INDA 4LPVA 4ZTEA 1CBJA 3O3AB 5D5MB 5C7ZA 4AEHL 2F54A 2JCCA 1U8QA 2Z7YA 3WHE0 1VFAA 2X3CA 1JFQL 3VGAB 1MCIA 2Y69B 1FO0B 4FQQB 1ES0A 1TNMA 1XBDA 3BP4B 2DQUH 5FYJD 4PJCB 3TA3D 1SY6L 2OLDA 3RPIA 3ZDZB 4PJFA 4RX4A 4ZZKA 3OKEA 2Y6TE 5GS0L 4OFYD 3U2SA 4PRDA 3ARPA 3S35L 5BS0D 2H0EA 5I0DA 1WPCA 4E41B 5DHYB 4WWPA 1L9RA 1BJ1J 4J3WA 3SDCB 2XA3A 5ICYA 2HT2D 4E9YA 1FZKA 2KL6A 4OM1L 1IVLA 2OZNA 1F3DJ 4M5ZH 1R1CA 3WY2A 2LU4A 2HRLA 2EC9T 1T20B 4PJXF 1QLRA 2WTPA 1QPKA 4G8EA 4QOKB 1U8HA 5EU3A 4HGKC 2DQ6A 2RD0A 5CSBA 2VITA 3FU7A 3BW9A 4TNGA 3QQ9D 4WNJA 3KYMA 5DJDA 5IEKA 1ZHKB 4QXUL 1E2WA 1UWXK 3DDGA 4QTFA 3MV8B 4Q52A 4HJ0C 2QQKL 2RGSA 2ZWKA 4GW5A 4ZXBC 4ZJ9A 1KFAL 4MZIA 3ZGHA 1DJIA 2FHBA 1TTUA 4R4ND 4APQA 4FXLA 4YXHL 4H4NA 3TT1L 5CGYC 5D7LB 3EBHA 3R1GH 3T4YA 4R4FL 5EOTB 1J1XH 3OAYK 2WNKA 4LCYB 4LK4A 4RMVA 3X3FH 2YARA 1R17A 3FF8A 4MAUH 1XGZA 4FFZL 4J6RH 4NI3A 2VWEE 2W07B 1FDLH 2NW2A 3KPQB 2C7UA 4MJJA 2PWGA 4WGKA 4GT0A 3IMTA 3TA3C 3CX5K 4Z76A 1NOFA 1J8HA 5EO1A 3G5ZB 3PWJB 5EORH 3T65B 3VA6A 1A65A 2CBMA 2VDQH 3N43F 2VMDA 3BH8A 3FT3A 1KF9B 4BUQA 3PGDA 3IJYA 4HS3A 2NTSP 1X7TA 5DUBA 1OM3H 2EUVA 2HT2C 3PHSA 4XCEA 3UZVB 3BYTA 3TJPA 1D5XB 5CEZE 2AJ3B 3O41A 1TFPA 1F8TL 2VM3A 1KJ3H 1QKZL 3DYOA 1C1EL 3P0YH 2ZKHL 1FZOA 3QQ9C 4WF7A 5I5RA 4LEXL 1E4WH 4BEIA 5JYMA 2PO6C 3FT0A 2MNUA 2JKNA 5E24E 5CF3A 1AOZA 2GC7C 2XQ0A 4D0CB 1N6QL 2H45A 4KZEH 1OAQH 3IDNB 2N3JA 3UL4A 1GSKA 4R4NC 3UO1H 1AXTH 1OSEA 1U3ZA 1TZAA 2IDTA 1EBPA 2ICEA 3RY4A 1ZHNA 2ZXGA 1CDCA 1SVBA 4TQEL 3TASA 5E08L 2NOYA 4B0MB 4KK5D 5E94A 3O2WH 4K94C 1TYJA 2FTAA 2UXFA 1DVTA 3DO4A 4XR8C 3V4VA 3T1FB 2X4QB 2ZAHA 1RUAH 4O2FB 4W9EC 3VG0H 1BBDH 2ICWB 2C7FA 5C0RH 3QEQD 3NESA 4JREB 4CL7A 2VRKA 1SFDA 3RWGB 1Q9LB 1BD2A 1KBPA 4DGYL 1CDGA 3MCG1 5KSAA 1KEGH 2RFXA 5ICXB 3EFOA 5H35A 3UABA 2ZP0T 4UIMA 3SGEI 2GTZA 5F9WB 5J13B 4QO1A 1GIGH 4J6IA 5HYIA 3MMEB 3TWCL 3Q9QA 4ZS7H 4NM4H 2BVTA 1CFQB 3SDAA 1EEYB 4KVNH 4QKTA 1F97A 1TF4A 2VJ0A 2APWA 1TYEB 3AU1B 3QDJB 3FHQA 2I69A 4GIPD 3U0PB 5GRUH 5CJOH 4FJYA 1G7IB 3CHSA 3FO9A 1L7TH 4HSQA 3T77B 4JR9L 4YK4B 5TFSH 3TNMB 1P84J 1OGSA 4HIXL 3SOBL 1ORSB 3WKML 3GXTA 4P5KB 3I50H 3OXSA 3ZMNA 3HC4L 2FT7A 5DZAA 1UKTA 4Y16B 3IDYB 2JJWA 5EUOB 3RNQB 3W39B 1RZ7H 4F58L 3V0AC 4LSSH 4AGOA 3KGTA 4WLCA 3KW8A 1WF5A 4LXFA 4I4WB 3PDDA 4KK5C 4EI6B 5HDLA 3L4VA 4NUMA 4LLUA 4PJXE 2X89D 3OZ9L 1UFGA 3Q8AA 4ZO8A 4HIEB 4UMSA 4W70A 2HG5B 3ARED 4FE9A 4K71B 4F7EB 3HE7D 1VKXB 5T1DL 1CU4H 4Y2LA 5FLUA 1DQVA 4FMFA 2NSMA 3HRZA 4HJIA 2DYSB 4Q6IA 2J4WH 4M93B 3QQXA 3MV9E 5E6ZA 2H3NB 1I7TA 2LW3A 5DFAA 3L16A 4MCYA 3MLYH 1NCNA 5A6MA 2ALWA 1PG7H 1NGZB 1T66D 4KO5A 4WWKA 5E00A 3VXMD 2AJSH 1AQHA 3TN0A 1IC4L 4QHMA 2Q8AH 1F3JA 1A9EB 1DN0B 3SKNA 3NSYA 4UZUA 3JWNG 4EBQH 4LO9A 5D9SA 5F8RC 4WJ5B 2UZIL 2EXWC 2GJJA 3VI3F 3GBML 1K2DA 5JHLH 1CD1A 1KGXA 3CHRA 4BM7A 1UM6L 4QJ4B 4HC1A 4FP8L 1DBBL 1OALA 5E1HB 4ZDHB 1Z5HA 1XO8A 1AE6H 4P4KB 2YD8A 2VC2L 4EZKA 2VQTA 2M1KA 1Y0LA 2ZP9A 3OMAB 3P73B 2B9AA 1EJ8A 3SPVB 2D03H 4IRZA 1NIFA 3STZA 4YFEA 3GQFA 4AVKA 3BRDA 2FBRA 3H55A 2D73A 3OKOA 1A4KA 3GRBA 4U1GC 2VR6A 1LMKA 1CXHA 3ZTNH 3CFKA 2VXQA 4AQ1B 5G55A 3FO2A 2EKSB 4KKNA 5BO1H 1TTAA 3WFBH 2WWOA 3GMLA 3AREC 3VRLF 3HMXL 3HE7C 2J5LC 3T0WA 4JGJA 5JW4Q 1AZNA 2NNAB 3ZHNA 5KVFL 5F1IB 3UTQB 3WO4B 3LEYL 5FGSA 4OT1L 4NC0B 2B59A 1FH5H 1P2CA 2WKLA 5D1ZI 3QULA 2N7BA 3ILPA 5E4IA 4YDJA 1D6VL 3ZDXB 3GMOA 2AK1H 1YMMA 2OR8A 4K7PX 1GW0A 5JIDA 4IDJH 3NSXA 3DTXB 1BIIA 1LP9F 3K8MA 5KYUA 3KMDA 2CJUH 4EI5A 4E36A 1BAFL 5GGVH 2WK2A 3CFJB 1TJIH 1QYGH 4GSDH 1TZIA 2BW5A 4QJ3B 1Y7VA 3OR6B 3VTMA 1Z9SA 3K6DA 1W16A 1N8ZB 3KAAA 5I0WA 3KYNA 1V27A 3KBFA 4BFJA 4HOXA 5KJRH 2Z8VC 5DQDH 1BFVL 4X8CA 4A1RA 2GQHA 4HUCA 3NCCB 1UM5H 1L6XA 4EDWH 1TSHA 4YVNA 3TV8A 2AQQA 3I74A 2KI6A 3RB5A 5E6YA 5EH1A 1QNZL 1I1FB 4FLOA 3NUKA 4FQXA 3ETTA 4PJCF 1A25A 2YBRB 4GXVL 4H8QA 4MNQB 5D7KD 3ZDZF 3D3VA 3QWOB 4OGXL 2UWEB 4NYLA 1IGIL 1R5IA 1UUSA 3R8QA 1BWWA 4N2FA 1EHKB 4OVVA 1YMHA 3GPSA 4H7VA 3MRKB 2FVNA 2HCZX 4KJWD 2NSQA 3T3PB 3DI3B 3FXIC 4QNPE 1PY9A 1T1XB 4B6ZA 3NJMA 3MRMB 4N90D 4NN7C 4OVUA 3AAZB 5A1AA 4RSVA 2W88A 1NCTA 2YA0A 2XN9D 4PJDE 1JV2B 2XQBH 2YAFA 4KXZI 4PG2A 4DVBB 3BZEB 4WW1B 1C12B 2R83A 5EC2B 4HF5L 3D33A 2G2NA 4P46D 5FGBC 3EFFA 3MLXH 3RAJH 3TT3L 1S7RA 3HN8A 3MRFA 4IM8A 3WTVA 3NJKA 2Z35B 1HX0A 3SHSA 3OV6A 4UV4L 4H8WH 1KGIA 1BVKB 2WANA 3VFNB 2CDFB 1ADQH 3GSQB 3C6LD 3O2DL 1G7PB 1ASOA 2YQBA 1F1AA 2R39A 4QWWC 3A24A 4M4RB 2GJZB 3CXHJ 3WU1A 4U1SA 4WUUE 3S97C 5C08A 2BP0A 2D7TL 4Y19E 3KVDD 3M1BA 5I75B 4R7NA 4B9CA 1QSED 1K8DB 1ZLVK 1N3NB 3BPCB 5DJ8B 3NJFA 1NBZA 5FR3A 4WJKB 4PJIA 4XC1L 3GMQB 4MCNA 1KUMA 1N2RB 4ZMXA 1XL4A 2B0SH 4UDTA 4OI7A 4M7LT 5BRZA 5CHNA 5IKCB 5DMIH 5JQ6H 3S5YA 4M8VA 1SXCA 1CURA 2VLRE 2K78A 2PCYA 4MJIA 1AG6A 2V4LA 2KDGA 5CZXD 4IHBA 2NY6B 4XHQA 3UTTA 3VGBA 5I73B 2CQVA 3VDCA 2VZOA 4KJWC 1J5DA 2CA3A 1USZA 3NBNA 2VDOL 3TZVA 3BSHA 5HJ3A 3VI3E 4PV1C 4IBWA 1T5KA 2BHUA 5AENA 1TQBB 1Q0EA 3RQ3A 5IF0A 2F18A 5GS3A 1OGTB 3O8XB 3Q1SH 5K9QG 2I25N 1KXQA 2I26N 1RK7A 2UY6B 3HZVB 4F8LA 5B22A 4P46C 3O4LB 1K3ZA 2XZZA 1H5BA 2Z7WA 3QR0A 5HXMA 1NIEA 2OTWA 4ALAH 3CDCA 1FZMA 4N9GA 4TUUA 4ZMWA 5CSGA 1KBKA 4QRUA 32C2A 3C6LC 1SUHA 3FFCA 4YDKH 3TCTA 4O9HH 2HPTA 3U30B 5I1AA 2AJZB 5AWNH 5IIEA 1OPGL 3S88L 2V5YA 3VRLE 2XHNA 4GRMB 4JFSA 4FNLH 1CFNA 3BEVB 1P0SE 3RI5F 5I1CH 5JOPD 3DKHA 4XBGA 4WO4A 3G5YA 4I1PA 4ZMLA 4PJGA 3BMVA 1NMCC 2IANE 3I9GL 3MA7A 5HDBB 3VVVA 4NZRH 3CVHA 5CZKA 5K9KB 4EJ1C 1LP9E 5CZXC 2ESVA 4IRSD 4PQXA 1UUNA 4EUPH 2ITEA 2OM5A 2VE6A 5DJYA 3EYVB 4B53A 4I9XA 5F7EL 2J44A 4HPOH 3TBYA 3V0DA 5FO8A 1KTCA 5T3ZE 5KJ7E 5L6YH 3NCWA 3H3BC 3HJ0A 2CGZA 2HKHH 2BRQA 3S34H 2AJVH 1AZRA 5E8PB 3HZKA 5LN4A 1KJ3L 1BJ8A 3NP4A 3MLRL 4JO8A 2FJHB 1J05B 3G6JB 4YFDB 1ITBB 1JK9A 3LEXA 1XEDA 3UYOD 4Z7VA 1QBAA 3HAEA 4PJCE 1QFWI 1G1CA 4AGQA 1AD9A 1K6QH 4QRSA 2L3BA 3ZDZE 1DEDA 4M7JH 1RZKC 4PI0A 4F9PC 2J73A 4KMQA 1FV1A 1TQSA 2EDMA 4QT5A 1JPTL 4TSCH 5E4OA 3LMJH 1GPOL 3MLZL 1BQSA 3QHFH 2PTVA 5IK3B 3BDXA 4P99A 3L81A 5E5MA 3F64A 3TU6A 3TXAA 1BM3L 3WBDA 1F4AA 4YHOL 1MEXL 4E41E 5A2FA 5MP6H 3V6ZA 3DXAB 5IMOB 3P4LA 1LDPL 3SKOB 4TSBL 5KAQG 4ODVH 1DJGA 1NDMB 3C12A 2PCXA 3LKNA 4QRPD 3SKJH 5JW4R 4JBSA 3EJJX 4QOKE 3P3SA 1NGPH 3SGJC 4LCVA 3X1FA 1BBDL 1G9HA 3JWNE 3ZO9A 3K5RA 2H32B 4QI3A 5KBKA 4Z95H 2VN7A 2VABB 2XG5B 1DVFA 1PLCA 3BWZA 2CO6B 4QR7A 3ME0A 5I76B 4NSKB 3MV8E 4W6YB 3WIHL 4ETYA 4IRSC 4DFHA 2E3VA 5HYQA 1KWGA 4FHJA 1C16A 5EU6A 2QFRA 4GKSA 5IVXA 1VA9A 4OD2B 4Y9GA 3G9VA 3PLYA 1GIGL 3SGDH 2IV9A 5F72S 1BQ5A 5D7LE 2WYHA 5F44A 5KBDA 4KVNL 1FYHB 4KQ3H 1NMAH 4L37B 1MW3A 5HYJA 2LVCA 4JM4H 4O02A 4H5SB 4QYOB 4YHIB 1U8PA 5I0ZA 3Q6GH 1JS4A 3S8FB 2BNQB 4Z0BH 2CGYA 3C8KA 4JO2H 1BMZA 2NTFB 2ZUXA 2N01B 4YL4A 2CBQA 4W1TA 2K4WA 5GRUL 1TKWB 5CJOL 2OMYB 4OF5A 3MBWA 3G3LA 4FN0A 2XWDA 5CD3A 4GBXD 4W9CC 3DHPA 1ZLDA 3GMNA 1IGYB 5ERWB 5B8CB 3I50L 4TVPE 4G7VH 4ZTOH 4ZW7A 1AQ8A 1RZ7L 5BS0B 5GRZA 5AVUB 1FFOA 4U3SA 2Y1YA 1NCCH 1A1MB 3RKPA 1WRFA 1M2OA 4ODUB 4TV3A 5CKGA 2ZKMX 4JM2A 5CZRA 4OJDH 3WS6A 1I8IA 3NTCH 4PSPA 1RIUH 5D1QA 4DSYA 2VLLB 4WQOA 3KM1A 4U1IA 4DZ8A 5IMMA 3K6NA 1YQVH 3FS9A 3LNEA 3T08A 4OAWB 3PWLA 3IMSA 4AOFA 5CINL 3CXDL 3EO0A 2J4WL 2PO6B 2YPKB 1JAEA 5I17B 4HOWA 1YY8B 4HU2A 3D2UD 3MNVA 5FDWB 2V9TA 3ESMA 2APFA 5F21B 3UEZA 3KPOB 3MCLH 1XCTA 1WFTA 4BK8A 1CYGA 43C9B 5D1ZD 2DPKA 5B7MA 4LQ1A 4CC4C 4KVPA 2Q87A 1TETH 5L4FA 4DP8X 5KVDH 4YGAB 3VFSA 5JHLL 1OY3B 2D9CA 4U1HB 4WWOA 3B9KA 4FABH 5EMYA 5LCVA 1R75A 1YJDC 4M48L 5MERB 1HKLL 2X10A 5JHBA 2Z93A 1WP6A 4GBXC 4H0IA 4MMYB 4NQDA 5JHDD 5KAQF 4X4KA 4PUBL 2Y7OA 4NXKA 3W5NA 2Y22A 5BOZG 1J0YA 3ZO0A 4YQXL 5IHLB 1HXMB 3P54A 1G6RA 4WTZG 3QDGB 2UWEF 3EOTH 4B5ZA 1OCRB 3D18B 4NZUH 4OZHA 4QEGA 1I53A 4RGNE 4Z3IA 2G30A 5TH2B 1S4IA 5DRWB 3C2AL 2MQCA 1L9SA 2VL5B 1WGOA 4OU3A 3QDJE 2XWJA 1T7XA 2W0FB 1BFSA 2X4PB 3CN2A 3GI9H 3RZCA 1GH7A 1O6TA 2N7SA 3BZ4B 3E7JA 4KO7A 2R4RH 4N0YL 1SDDB 4NO2A 3STLB 3RWIA 2C1OA 4TVUA 1TQCB 4UT7H 2IAMD 3DOHA 4NENB 4H13C 2A6DA 3IKKA 4PCKA 1VCBC 3OMNB 4NQCD 2VXVH 4A2HA 1SJHA 5DMKB 5D1ZC 5TDNA 1LTXA 4PWIA 1KNOA 4GSDL 2BNRD 5B7EA 3WOVA 1L5GA 3B9DA 1R24B 3L54A 5JIQA 4LVNC 1CE1H 5KJRL 3KL5A 2WXLA 5KG9B 1F90L 4OV5A 2H2PD 3A4DA 3DX1A 2HRPH 3EJTA 3QQ3B 2WNWA 2ARJB 3ZHDA 1BX2B 1AANA 2DWSA 4LL4A 4CRPA 4IIQA 4Y4KB 1DLFH 1M7IA 2RTTA 3CFBB 4F93B 1T4KB 4F7CB 4ELKA 2WBKA 5C70A 5HBBA 1OAYH 1WD8A 2AEPH 3PWNA 1WFOA 5DZPA 3DC0A 2F53D 5IJCC 1W91A 2CIKB 4RGOL 4XNMA 1ET5A 3V6FA 5KSUB 4C47A 3S37L 4MD5B 4O4YH 3KH3A 3I6SA 4DTGH 4HCGA 4PCTA 1MI5A 1UXSB 2JKSA 2J55A 2PW1A 1HC1A 4JY5H 1XGPA 3ARSA 3MLXL 3TPKA 3US1A 1Z9PA 4GAAA 3GZPA 5AD0A 5BUAA 5HHQA 3GBNL 3P3UA 3RWEB 2IAMC 1DVYA 1ONQB 3UTPE 2R8SL 3SSGA 1PBYA 2OJEA 3HC0A 2G5RA 4XRCB 2DI7A 1UZGA 3V7AE 5IMKB 5GS0D 3U83A 2QJDA 4X8GA 3UTSB 3ZHKA 1WA2X 2K7QA 4XPHH 3BQVA 3L5XL 1Y1UA 2H2PC 1LYQA 2BM3A 3CVIH 3HZMA 3I6KB 4N0FA 5DVMA 5DC2A 2R69L 4ETQB 2VIRA 1EHLH 5D4JA 3OXRA 4QXGL 3VWJA 4MA7H 3FYIB 3GSXA 3KPRD 2B0SL 4JDVA 4FYRA 3ECBB 4PYHA 2EIKB 1V7ML 5GGSY 4BSWA 1KLUB 1O7VA 1A47A 2GHWB 4F2EA 5A6LA 4MJ5A 3Q9PA 4RH4A 4YHLH 3ZDXE 3MOAH 4P9MH 4X5PA 5JORB 3WUWA 2VN5A 5HDBF 2DTMH 4R9HA 5DHVB 3SGKC 3CK0L 2GUYA 1BFOA 4ICWA 4G8IB 3L17A 2NX5A 4I2XE 3M1CA 4YHNA 2XG4A 4JM0A 3JTSA 4L8SC 1ACYH 2YS4A 3Q1SL 2OL3H 2F7PA 3A47A 1RH8A 1I1YA 1AQKH 2PTUA 4G5AA 1I85C 2WCGA 5IG7A 2IH8A 1DYZA 2HJKB 3G6JF 4E9VA 3NZ8B 1PQZB 2VAJA 1RP8A 4B9YA 2GAZA 2B15A 5LQBL 3OHXA 4MNQE 4K9EL 2YD7A 2CHZA 3HTLX 2CD0A 4QMEA 1BAWA 2UWEE 4Z7OF 5GS1B 5JW5A 5GS0C 1PSKL 4WFFE 3TCXA 1A1OA 1BZ9A 1T83C 2FB4H 1CE6A 1UVQA 2QR0A 4G72B 3NMEA 5E6ID 2WKOA 1WT5C 3FSWA 3PAVA 4FNLL 4ENED 3NRFA 1X4YA 1RURH 3MBXH 5IB2A 4DZBA 1GC1H 2GSIA 1J18A 1QLEB 1OM9A 1TVBB 3EGXB 3TEZA 2O4EA 4Q97A 4LQFL 1R6VA 1DJWA 2VMEA 3MBED 1SN5A 2OYPA 4PP1D 4MWFA 1A6PA 3ARGD 2P5PA 1EJOH 1QBML 1R5VA 4ONHA 1WZ1H 1SPDA 1S7WB 3SYPA 3JYBA 3BXNB 4BDVB 1A7BA 4X80H 5AFAA 1ZVSA 3B2UC 3SPCA 4F20A 4MB4A 3DBXA 4KROB 3DK0A 3HG0A 3QFDA 2V9RA 3UGUA 1DQIA 2AV7B 3STBA 5L6YL 1JZ4A 2MIZA 4JRXA 2E7CA 2PF6A 3ZX1A 5CR1A 5HYSB 2I7SA 1YYCA 5BRQA 4G8GA 5D7IA 4G6JH 5B38A 3D07A 4IK7A 4XN9A 5I1KL 2B1HH 2XWRA 4MJHA 1NCHA 3U6RB 2KQMA 4Z77A 2FQDA 2KZWA 4U1KA 1AKPA 1ESOA 1ZV5A 5D7JC 4YHYC 2ORBL 2OZ4A 4I0PB 1K6QL 2AHIA 3ULUH 3LVEA 4ABVA 1SYSA 3FT4A 5I8KH 4TSCL 3LMJL 4OQ1A 4OZIB 1UJ3A 2IO5A 4HA1A 3ZL2A 4XAWL 3WKYA 3REWB 2HRGA 3GIVB 2UUDH 5ESAB 3DX6B 5E6IC 1XH2A 4ENEC 1WWWX 1EANA 3P4OA 4ODVL 2QSCH 3DSNA 4V2BA 3VFMA 3CZKA 4QHLA 5C9KA 1Z5LB 4XP1L 5E2TH 3RTQD 5KVEH 1JTOA 4P9HL 3CZLA 5E8EB 4EQ3A 5HGDB 5IJDC 1P6FA 3PAZA 2DEXX 3H0TA 4Z95L 3MBEC 4F7MA 1K8IA 1AGCA 4PP1C 1HH6A 3O4LE 4P46B 3ARGC 3BUYA 3GKWH 4JGMA 1U2YA 5C3TA 1N70A 3ROOA 4WI9A 4ZPVA 4CUCA 2FO1A 1NCBH 1U3JA 1YPZA 5GJSH 4QHKJ 4R7XA 2YSSA 2XWZA 3KLHD 2XBTA 1T04B 2LU5A 3O6FA 4KQ3L 1NGQL 3LHPH 1KJ2A 2VZVA 4GO8A 3RE0A 3VCLA 2ZXDA 1E40A 1GZPB 3Q6GL 4NX0A 5DFTA 5I6PA 5JUEL 1QSEB 3IMWA 5DJXB 4JO2L 4HLEA 4JO3H 4XX5A 4LHUB 3U7YH 4PWFA 3FOLA 4N2HA 4YNYA 1BLNA 3KYKH 1T1WA 4NNXB 2NR6A 4P4RB 3WDJA 4JFDD 2NY5L 2OQJB 5HDBE 5BRPA 3JSSA 4JEGB 5IB5B 5ETUA 4IRZL 5DYOB 4JQIH 4G7VL 5ID1A 1TO4A 3L3JB 3ULVL 3BE1H 3F7QA 5FO9A 1EBAA 2AQ3A 4EZLA 4UT9A 1JV5A 4O2CB 5T8IA 3ZR5A 5ADOH 2AW2A 2RJMA 1EERB 1JIBA 5E0QA 2GSGA 4IGBA 4GMSH 3EOAA 4YPJA 1ETJA 1RQ5A 1TEGA 3NTCL 1RIUL 3RTQC 3IXAB 2FSEA 5H2BB 3UCQA 2PXYB 1JRHH 4AIEA 5I6OA 3G6JE 4G3YH 3K0YA 2ICES 1MPAL 4KDWA 4QXWA 4WW2C 2M8XA 1I1CA 4YIQA 3D08A 1XIWB 4LDOB 4LFHD 4NN6C 1OF2B 3FSOA 4P2RD 5CM1A 4Z7OE 4L9LC 3F7YA 5AQ0A 4FXKB 2J1WA 3FQTA 5T1KD 1ID5I 2NZ1A 3MCLL 4I0KA 3UBFA 3KLHC 5ESQA 5FYLH 3B34A 3NDYE 1IAOB 5KN5B 1F58H 2ZCZA 3KPSD 3NIGF 2YD0A 5EU5B 2DQEL 5CJQH 1FNGB 1PL3A 3NN8B 1LL1A 5DF0A 2BSTA 1D7FA 4MYWB 5GGQH 2IWFA 5BQDA 1YUKB 2CLZA 2J8UB 4HIQA 3BEWB 3MUGB 2EDKA 1MJUL 1G84A 3P3RA 5C0DA 4H88L 4RAUB 1UHVA 1HCFX 2JXMA 2J2ZB 5HJBA 5IQLA 3I75B 1O6SA 5GPRA 4AL8H 3MOQA 4K5MA 4YSAA 4XN4A 2Y7QA 4DGIH 2VXSH 3QJVB 4F24A 3QCTL 1EFXD 4OF7A 4N26A 4Y4HD 5B1CA 1QSFB 2CM5A 3DHJA 4TLSA 5TDPA 4ZFZA 3SY0A 3HUJA 4MXQD 4QPEA 4JKPL 2ZCLH 3A21A 5GGRY 2R2BB 1PMYA 5JPMA 5C09D 1TR7A 4OCXH 1KTDA 3SD5A 2BNQE 5GISH 4NO5B 2AK4D 2MOGA 3GI9L 4W9DC 4XMVA 3TEWA 2UYLB 1VB9A 3KYOA 3BUPA 4MMXA 3AQZA 1PEZA 1JGEB 4ZUVA 4R0LA 4MD0A 5FYJE 2VR5A 5ISZD 3CFNA 2DRUA 1J9TA 1KJVA 2XV2A 5E1QA 3PS6A 1NFDB 5IB4A 2O5NA 2P8LA 2NY2D 1F4XH 1U3NA 4F2ME 3K81A 3BVNA 4H1LB 5BS0E 2IG2H 3ZE2B 1T0MA 4MNGA 1HOCB 1A6TA 3AQDA 3C5SB 1CE1L 4LMQI 1GJUA 4U33A 5C0AD 4MDIA 5KBNC 1QSZA 5F88A 1MFVA 2W65B 3VU1A 3MNZA 2EDLA 5EPMA 2XTJD 2Y2YA 1R19A 3E6FB 1HOEA 3UPCA 5ILTH 3MRBA 1RZ8A 4ZMZA 3A6CL 5TQ2L 1E5ZA 2DWDB 5I6LA 1JZFA 2IPTL 2EECA 1OAYL 4M43L 1FL3A 2NW3B 3R19A 4ZTPH 5I26A 4DEWA 4JDEB 4AZ8A 1KB5B 2MQGA 4PY7B 4Y4HC 1G7JA 2ZUUA 5D1XA 4M3HA 3I3DA 3U7WL 5D2NC 4FXTA 1MELA 2O93L 4MXQC 2GTWA 4UQCA 4Y0GA 1A4JA 3UAJD 5EF3A 2V7HB 3HI6H 3LKSA 4NNPH 4DF9A 3MACH 3D06A 4RMWA 1JWMB 1P9MA 5EBGA 3CH1A 3IFNH 3TO4D 4NIYE 4U6HA 5AOZA 4AENA 3WFCH 4CVXB 2PETA 9CGTA 3BOVA 4L4TA 5FOBA 4MSWB 1L0XA 1Q38A 4PRAA 3LXAA 3QYCA 1IVTA 3BC9A 3DVGB 3TIEB 4PJAB 3GK8L 2WBWB 4MA1B 5JPNA 2CK2A 1GL4B 2YAPA 2XJKA 3OR7B 4C55A 2DYRB 1N19A 2HLAB 4QHUB 3PV6A 4G71B 3M17A 2V9QA 4NGHL 4WHTB 4JO5A 1MAMH 5I16A 1RUKL 3D25B 3CVIL 1XZ0B 3OMZA 1BZDA 5JXED 4M9PA 4DCQA 3ARDB 4LSDA 2XTJC 1MJJA 4RZCA 1SHSA 1ECYA 1FNSH 1DO6A 4MA7L 5ENWB 5E56A 4TN9A 5IHZB 2DYPA 2VDMB 4YX2H 1NPUA 4A2FA 1NSNL 4JHAH 4XNBA 1H15A 3SPIA 3CN4A 4NZDA 3M88A 4O5LH 1JI2A 5CN2A 4BFGA 4YHLL 1WUZA 3MOAL 3DUSA 4ZPTB 3ZN6A 1TPXC 2VGLM 4P23A 3EO1B 2XA8L 5EB9A 4WI5A 5A2IH 4TUOA 5KTEL 3NIGE 5D2LB 5LDSA 1IKNA 5D1ZB 3NJJA 1PAZA 5GGSA 2GFBB 3UAJC 4A6YH 3MRJA 1KSRA 2PTTB 4IU2B 4R96B 3MLUL 4CU7A 1WO2A 5I19H 3TO4C 3PABB 1AHWA 1AQKL 3LRSA 3MTXA 3NFSH 1CD0A 3FBQA 1I9IH 2H0FA 1KFGA 3HW7A 3QUGA 4MD4A 3BPOC 1T03L 1UXWA 3QORA 3SBWA 3F7KA 3GMRA 4BKLA 5H37H 4X9FA 1INQA 3DMMD 4YSOA 1MF2H 1HKFA 5JHDB 1KTBA 4LVHC 2F7OA 3ZLQC 2R51A 3VQMA 5GSVA 4AKPA 1QAWA 1FFNA 1AYOA 3T8XA 4MXWH 5C0BA 3VD1A 2IDCA 5CEZH 1X5KA 4FS0A 4OZIF 2FB4L 3KXFB 4L1SA 4L4VD 3CC5B 4NQSB 1Q0YH 1W8EA 3NZHH 1EFQA 5IB1B 1S46A 1E5BA 2E5EA 2V2XB 1RP9A 1G7QA 4HHAB 4JFPA 5JXEC 5L8JB 3ZMEA 3O3EB 1BQRA 4RAVB 3WJJA 3MNDA 2WQSA 1M4KA 3V6OA 3VG9B 5LGHH 1VEPA 4QLRA 2B77A 4ODXA 1YEEH 5DD3H 5EIQA 3CFUA 1BYOA 4YR6A 1FE8H 1IC7H 3BQUA 2R23A 4F8OA 1WZ1L 2E76C 3DV6A 3GRWH 3P77A 3V4PH 2VLKB 3BIBX 4OZFA 2WLZA 3B5GA 4ADGA 1Q0XH 1T22A 1E9OA 4HUUA 3T2LA 3IEAA 3HPJB 4LEOA 5CIPH 4BSJA 1EXUB 2J6EH 2XNAB 4JPKL 5EA0H 3UTSE 2WBJA 1IAIM 1HZHL 4G6JL 5IHUL 1E7VA 4J3VA 4S1RH 5CLXA 1QR1B 3QZMA 3RWDA 4G1MA 3ZQ9A 5KSBA 4O02L 4TTGA 4CN4A 5DR5L 3OBAA 1C8PA 4F92B 2IH1B 3DMMC 2R1YA 4IJTA 4YPGA 3QHZL 3SDDD 5I8KL 2CKNA 3D4YA 4K7FA 1O9VA 1WAEA 2IOMA 4UQ3B 4X4XA 1HEJC 3O3AA 4P5MB 4EKJA 1A2YB 4NO3A 1LQBC 4NZJA 4B0MM 5D96B 1I9RL 4KTDL 5CNHA 1MHPL 3OZLA 1JZJA 4PWKA 4GSXA 4UAOB 1WCQA 2Y7SA 4ZD3H 5KVEL 5GS2H 5DEZA 2F5BL 4B9GA 3KBPA 3QIWD 4IRJA 5L9DH 5MENB 2VR3A 4ORGB 4L8SB 3VXRA 3P3TA 3OSKA 4LLYA 1UB5A 1IGTA 5C0FA 4ZFQA 1S6NA 1NWPA 3V5KB 4AUJA 2ATPA 1JUFA 1K5NA 3QFJB 3NH7H 4C8XA 1P5VB 4LPYA 2PABA 4OD1H 4FQLL 2BS9A 2R2HA 2O61A 2AMUA 4NAQA 1U2HA 1BZ7A 4FNRA 1PKQB 1KN2H 2I07B 3T6ZA 1S7UB 1P4BH 3LHPL 1ZA6B 2CNYA 5FO7A 2ZUYA 5CSZB 4OLWH 3K1DA 4GSRA 3TFKD 4KQ0A 1YNTB 3GEWB 3TF7C 4G43B 1FAIH 1CDHA 1YVLA 1VACB 2X9XA 3MREA 3SPJA 4BV1A 1WFMA 3FTGA 3JWDH 1PU0A 3O3DB 1X4ZA 4FNTA 4E42A 1MFEH 4QLWA 2P5ED 4BCYA 1I9EA 3KPNB 5DUPL 1HHIA 1OO2A 3E8VA 3SDDC 3X13B 4N0CD 3I9IA 1FIGH 3POHA 4JK0D 1H6UA 3LQAH 4JRLA 2FHCA 1LEGB 1ADQA 2UX7A 5IJKC 4X9GA 1MJ7H 3GD1C 3EUDA 4PRHD 4GRLB 1JWUB 4FMKA 4Y9BA 3RLSA 5ADOL 3O4OB 2QKIA 4JJ5B 5LKNA 4XZUA 5DK0A 5DO8A 5EO0B 4PREB 2HP4A 2SODB 3V5HA 2PP7A 3AACA 3N41F 4EEEA 2L8AA 2I60H 3QIUA 3QIWC 1TSRA 3C5JB 3QNXB 1DBKL 4GP4B 2WP3T 6TAAA 5A40E 2ISDA 2ZUQC 3TBTB 1HL5A 1CT8A 4POYA 1BV8A 1HVXA 2Z4QA 5D7JB 4DP9X 4FQCH 2FEDC 3L4CA 4H8PA 1BXVA 4HU8A 1VCAA 2Q2LA 1OT1A 2WYTA 4NJAH 5E8NB 4OZIE 4EN3A 4MDJB 5FYLL 3C5ZD 2KZ1B 2J88L 2O5YH 4HKZB 2IQ9H 1F58L 2X4UA 1FA4A 3MV7B 3TFKC 1DLHA 1VGEH 3DYMA 5CJQL 5LO7A 3G9AB 4XB8A 2A7BA 4N90E 3FQRB 3RRQA 5GGQL 4Y4FD 2H8PA 3RGVB 2VAAA 3I2CH 3IDNA 5TPWH 5KYNA 2XN9E 2N7AA 1D7CA 3BHBB 4PMFA 3OJVC 2QTEA 4AYFA 3MBEB 5EBLB 5GRXG 3VYPA 4N0CC 4A55A 3L4WA 3PGFL 5EIVA 1XD1A 3B1TA 1ZLSH 3OKKB 3CC1A 4FA7B 1WA1X 4DGIL 4RQQB 5KYYA 1SBSL 2OPCA 3TA4D 1MNNA 2JH2A 1NH6A 3IJSA 4FULA 3L4YA 5MEOA 2WV3A 2WLJA 2JJSC 5ECGA 3RL1B 4L3ED 2ZCLL 4YBHA 4LRNH 4N1EA 2OYKA 1P4LA 4OM0L 1QSEE 2P8MB 5GISL 3DWTA 2F58H 3GIZH 3DGCR 1HQRB 4QRRB 1W72H 1EUTA 1YEJL 4N28A 5LNGA 1MRDL 4MLSA 4P2OA 5JHMA 1KPVB 2QSTA 3GRGA 4XCNB 5AW6B 3PHQA 1F4XL 5GGRA 4GS7B 4EUPA 1OGPA 4FFWD 4AEEA 1PJ9A 5C6TH 3AU1A 4Y2DB 4FAAB 4C4UA 3C5ZC 1MUJB 3WIIL 4PJAF 1NGWB 4F57L 5DCCA 1KCRH 4NJ9L 1OLLA 3MO1B 3II2A 3QQDB 1R46A 2DDQH 4F9LC 2EEAA 1G7IA 3GS0A 2GVYA 3QI9D 1IC1A 3VXUB 1KZQA 5FHBH 4PJ9B 4IKLA 3BISA 2NDFA 4WDIB 4JG9A 2E74C 2HFTA 1B4JH 1UEMA 2Y23A 1XGRA 5E99H 5C0EB 3R06A 1UGNA 2LFEA 4BZ2H 3BT2L 4WW2B 3LZFH 2Q9OA 1XBRA 2BSRB 1DJSA 4M6NL 2NPLX 3LPWA 4L9LB 1U2CA 4GUOA 5EFIA 2BSCA 2FJGA 3L3OB 3S2AA 2J56A 4N2LA 1XSKA 2PNDA 3T1WA 1F4YH 3DJTA 2AFNA 4M03A 4PRBB 2E7MA 1AJ7H 3QH3B 3L7EA 2GYSA 1YRKA 1AD0B 5D2LF 1EWHA 1XCWA 3M07A 3HI6L 1UT9A 1JYNA 2CG9X 4NNPL 4APQD 3LN4B 1GZQB 3LIZA 4LLQA 2CR6A 2ZOWA 5JOPE 4JPVL 2CRMA 2NUTB 2VMFA 3A4AA 3MRDA 1MCJA 3B8SA 1U91A 2AAVA 1A9EA 3T04D 3DGGB 1E7UA 4OBRA 4FFWC 4ISVA 4LIQE 2DS4A 1ET7A 2YRBA 2DIJA 1ZE3H 5D70H 3VH8B 4MTMA 3KPLA 3BVWA 1O9ZA 1U8KB 1U95B 4HK0B 4BFKA 1RZGA 4BUHA 3ASNB 1AXSB 4CW1A 2W80C 4XVTH 4Z7IA 2H5UA 3GI8L 4F15C 4P5TA 3NGBC 2DJ4A 3EJPA 1NM4A 1GZHC 2F0CA 1VFUA 4NZFA 1D5ZA 1M9SA 3MU3A 5LN8A 1IO4C 4JHAL 1IE4A 4QTIH 2JQAA 3B43A 1DVQA 1AGEB 2PW2B 2OMUA 2RR3A 1I7ZB 4O5LL 3KEHA 2DLHA 5AOLA 4UZGA 3SE3A 1M3IA 4ZFOA 2BHFA 2FUQA 3A6OA 4YUEH 4J3UA 3GBDA 2XWTB 1JVKA 5L2JA 3LZOA 4PVLA 2J1XA 3N1MC 4HH9B 5LB1A 1MCLA 3G5XA 3OLEA 1UWYA 3FU0A 4ZSOB 4W6WB 1MAKA 2ICCA 4APQC 4Z7UB 1KXHA 1RZJH 4X98A 2JIXA 3ZRSA 4CAGA 3K3QA 5L8LB 3NFSL 1I9IL 4JPSA 1U3HA 5GSRA 4FXGB 1NMBH 2X2UA 2QADD 4X5LA 3CFJA 1NPJA 5BW7A 2X09A 3IGLA 2OZ4L 3RHWK 4MA3B 3QO1A 4J2QA 4ATTA 5FA4B 4Q6YA 5T3ZH 3QUMB 1R3LA 4J1UB 2WLNA 1HXYB 3WTUA 5CEZL 1YG9A 1CLZH 3BP7B 3MX0B 2XBZA 2CO3A 1Q9OA 1TJMA 1XH0A 3CDYA 2XZQH 1FO0H 5KSAD 3ZU8A 4P05A 4Z5RA 4AKQA 4FNPA 1I1FA 2VDLL 1R0AH 1F86A 4HUXB 1E90A 5A2CA 2RMNA 1P4IH 4U49A 4MAYA 2YKLL 5LGHL 5EZLB 3AWGA 3SDAD 2IALA 3RUGA 1YEEL 3VU2A 2APXA 5C71A 1FE8L 1IC7L 4AGPA 4AE0A 3BVDB 2Z31B 5ISZB 1JPGB 3QRGH 2FO4A 1JN6B 1CICA 3DX9A 2MHAB 3V4PL 2HVBA 3NSDA 2GUOB 4ANKA 1VEMA 3D0VA 3FUJA 2GT9B 4PJAE 1JSYA 2V3DA 3BO8B 1Q0XL 5I30H 2E7HA 4X6BA 2B1AH 2BMKA 3W3BA 4K9EC 4WW1A 2J6EL 5EC2A 3CSPA 2P80D 1S3KL 5IQNA 4I1RA 1X7QA 2B3RA 3MRGB 3UGEA 3S3SA 3JWNH 4FI7A 3SZ6A 4HG4J 2HT4D 4FMVA 4HJGB 3FO1A 1KIUA 3ZQXA 2G60H 3HI1B 3QISA 4DH2A 5HDWA 4WY7H 1YNTF 2R7EA 3WTSA 4NIKB 1PY0A 1JNJA 2QADC 4HFWA 2Y3AA 3NJIA 5I8OL 1JNLL 4NPJA 2VUYA 1FNAA 2A6KB 4Y1AA 1RIVH 1CLCA 4HETA 5F89A 2MNWA 3F62A 4D2NA 2OTUB 1K8DA 3S9DB 4L1BA 4OJAA 2A73A 2X7LB 1F2QA 3GMQA 2BIMA 1YNKL 5D2LE 3D52A 5TDOA 3QDAA 2FX9H 3TJEL 2ZE0A 1MJ8H 4PJEA 4NUPA 3B3BA 4R26H 5KSAC 3IDGB 1HESA 4LNRA 3HHMA 1NDTA 1OP3K 3CZJA 2DY2A 1A02N 5EOCH 5L9DL 3TN0D 3N2JA 4GO9A 2HX8A 4OGYL 4PS8A 3SDAC 4TVPH 2YJQA 2OSLB 3KD4A 2ZWYA 3GXFA 3BPOB 4UB0H 1NANH 2BVPA 1JNNH 3I3BA 3NH7L 2H6OA 3QIBA 4PRIA 2MPVA 2CHNA 5JHDE 1DJHA 3FZUD 1A0QH 4LVHB 4UTCA 4ANXA 4C59B 4X7TA 5M94B 1DR9A 3RBGA 2FR4A 3H2WA 3RWHA 3J7HA 1AS7A 2B16A 1ZANH 2KS0A 1RI8A 1KN2L 3GB7B 4PVNA 3HZVA 4Y5VB 3U0WL 3VGEA 3WKQA 3KXFE 3ULVD 1U92A 1SEBA 4OLWL 2CO4A 3MLSH 1SJEB 5CMAA 3WTTA 4K3DH 1KPUB 2HT4C 4U7KA 5E2UH 2F19L 2VDOB 4Y5YA 5ANHA 3NZUA 2ED9A 1FZJB 1AG0A 3QARA 3W9EB 3KDMB 4LLWA 4MQ7B 5F0LB 2XPYA 3C9NB 2H2SD 4P9HC 3TH4T 2AJZA 3VH8G 4XMKH 3K0WA 1SYVA 4WHCA 4DP4X 1FIGL 2F1EA 3FKUS 4OTXH 4CJ1A 3FQWB 1NLBL 1JHTB 3ZL1A 2F1BA 2YLKA 5FHAH 4TTDD 3V9EA 3NEXA 3BEVA 2AXGB 3V0GA 3TVMB 3HRZC 5DT1H 4G6ML 3DVNA 3RP1A 4Q6IC 4NQCE 2HZHA 3ARQA 4K3JH 4K2UH 2GSMB 4EIZC 2NT0A 5L2KD 1H6FA 2F15A 1UM4L 2BNRE 5FW6A 3I84A 1IMHC 1YHPA 5FV1L 1FI8C 3LZNA 4GT7A 4IS6B 3SYCA 4TUJA 4HS6B 3TN0C 3IVKA 4IOSD 1B6UA 2OXGA 3N91A 4EI5D 5IBUB 1HI6B 2RALA 3CUPB 3QZWA 4WI0A 5LWYH 5HI3C 5A2AA 4I5BA 3D39B 5KEZA 5AZUA 5CEXA 1D9KA 4FQCL 4O2EB 3UC0H 4HOMA 4RRPA 3NQIA 1XHHA 3DMMB 1PZAA 1BQHB 1CYWA 3S4SB 1CUOA 5DRNA 4CU6A 1JXJA 3COOA 1SOQA 2IXQA 3L2NA 1UD2A 4NFDA 5IROA 5J1SC 5K1VA 2NY5C 1MN4A 2AVGA 5K39A 2G2PA 4HGMA 1HHGB 5HHOB 4UM8B 3ULVC 2O5YL 5EHFA 2IQ9L 4L4VB 4ACPA 1A66A 3TS8A 4DKDC 1NEZA 5FAAA 1FSKC 1ZT1B 2OL3A 3CDZB 3LKRB 5DQJB 4LVEA 3I2CL 1UWEH 5TPWL 3VJ6B 4LKCA 1FL6B 1NC2A 1ZWIB 4BFIB 5KSVA 2IH9A 3BWUC 2H2SC 3RFZA 4XO4A 3FN0L 1L0YA 1NM9A 4WHYG 4LSTH 2B9BA 3DRQB 3MFFA 4GKZA 2QVKA 3QFJE 4TTDC 4YS4A 5DHEA 5J1TC 4WW2F 4WFHD 3RIAF 4EVNA 1VGKA 4HV8B 3CXFA 4LSRL 1PKQE 4DOHB 2WVVA 1JNHA 3OC8A 2CO7A 4GAJH 2ZG2A 2XG5A 4XBMA 3ZE1B 3HVDA 4JRYA 4HUVA 5I76A 1H8LA 2WOYA 2FYVA 1LMIA 4OI9A 1FYTD 3WE6B 1M2VB 4EI5C 4PGEA 5D7HA 1LO3H 4F7TA 1GSMA 4H26A 3TNNB 2IOOA 3ES6B 3NCFB 4FNUA 1DJYA 1W72L 3E8UL 3AFLA 8CGTA 1B3JA 1AZZC 5C08D 3EIFA 4KHTL 1WBXB 3L4XA 1NFIA 3W2DH 1DE4A 3F7VA 3UPAA 4NN5B 2IGFH 2RH0A 3R7QA 3K2MC 1A5FL 2LLLA 2BRRL 3QEUB 3MHZA 3TP4A 2CA4A 2VB5A 3PWPA 3C2SA 5JNYA 2FIKB 5F3HB 3LV3A 2ZWLT 1IQWH 3W57A 4WNQA 1KCRL 3DNKA 1CGWA 2OMYA 2DDQL 2X6VA 2YQ2A 3G04B 4MBOA 2NYKA 1RUMH 3L7FA 2LAAA 1A3LL 3TCLA 5FHBL 1KXVC 5FUCE 4AY0A 1Y6MR 3P11H 3MRQA 3U46A 2X4TB 2JKRM 1B4JL 5E99L 5FB8A 4POZD 4YAQB 3UJIH 3VRJA 3L6FA 5CD5D 2GITA 5AVRB 2WUCH 5IEHA 3TYFB 3QE5A 3IDMA 2OMZB 4V1DB 5HJGA 4ODUA 1A6ZB 4QHPA 1KZYA 1OE2A 1KB9J 1QQDB 2CDEB 3T3MF 4FYQA 5MEQB 2P48B 4WFED 2VLLA 1F4YL 2A2QT 4KXBA 1MCKA 2XDHA 4E5XA 1OXYA 2BERA 3QO0A 3S36L 4CN1A 3F2LA 5C0JB 3MUUA 3MV7E 4K7PY 4HAFA 3IRPX 1YC7A 4JY6B 3SJVD 4ZNEA 1KJMA 3CCHB 2FWUA 4X6EB 2YIHA 4X6DA 4IMLA 1BSIA 2QZQA 1FC1A 3PXJA 1LEKA 4LF3A 2JKXA 3RDJA 1O7DC 2Y36L 3L8QA 3EYFB 3S35X 4LSUL 2YEZB 1C7TA 4WO4D 1M71A 4X9HA 5DA4A 4CADB 3OLIA 3CPLA 4JN2A 4U1HA 2VXUH 5DK2A 5E5LA 1H0DA 5T5FH 3US9A 5I1DA 3D2TA 4Z0XB 5LUMA 2D7PA 4KJYB 3D4CA 4P3CH 4BD4A 4XO5A 2RQEA 2NXYB 4XVTL 3FMGL 3HB3B 3MLTA 1GJWA 3KHOA 5DUJA 1U8OA 5C2BL 4F27A 4MMYA 2EO1A 4YDVA 5T1LB 1CDIA 2PLTA 4K8RH 5D72H 1BBJB 4XOAA 3W56A 3M7FB 1NCDH 4M61B 3QRBA 3TONA 5I6XB 4R4BB 4W4NA 2XFGB 4QRRE 5CD5C 1QLFB 3E38A 5E2JA 2OJZH 2AXJA 1GGUA 4JFHD 3FHEA 4OUUA 4GW1B 2X6AA 3L4UA 4JGUA 4N6QA 4YUEL 3VFWB 1AZUA 4JVWA 1IGFH 5A2LH 5CLZA 2W0FA 4PGDB 5IBUG 4XE5B 1MFAH 2VLJA 4UTAH 4QF1B 5ESVB 1WISA 4BQ9A 2ENQA 1R34A 4L3CA 3KNBA 3W81A 2PYEA 1SDDA 3CN1A 5KBMA 3ML9A 3CMOH 4HEPG 2XPGA 3VXUE 3L3HB 4PJ5B 1BEYH 4A38A 2ZG3A 1BQHG 3S4SG 5FEBA 1U8CB 2AZUA 3NZSA 3EYSH 1NMBL 2UX6A 4BKSC 4LGSB 5DMKA 1D5BA 5GZOA 2IF7A 1K4DA 2YPLB 1PLAA 4BE5A 4JDZA 4WO4C 4NO0D 3QUYB 1E9PA 5EWIH 3AG2B 4ELMB 5CU5A 1E65A 2JI1A 1KBBA 3DUUA 3FUFA 3BPLC 4C56D 3MJ9L 1ZT7A 3EGSA 1TENA 4LBEB 1FO0L 5J11C 3BZ5A 7FABH 4TPRL 4UU9A 2R1WB 3BDYH 1R0AL 3E9UA 1NLDH 1OZTG 1WHOA 3AB0B 1S7VB 3LKQB 4LVOC 5D6CB 1NDGB 3IE4A 4PD4J 2FQFA 3LSOB 1E4KC 3QG7L 3QJOA 3V0HA 2NSXA 1T5XA 1WZLA 3QRGL 2F54B 2JCCB 1U8QB 5E8OB 3UMNA 1XX9C 5KSUA 1VFAB 2K3HA 4DWHA 1B2WL 5LHDA 1ES0B 3NSFA 3IGFA 1VHPA 5I30L 2YEQA 1SXZA 1PX4A 3U9PH 1UXSA 4YGVA 4XPAH 3RPIB 4PJFB 2O72A