2MCMA

Macromomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
112
structure length
112
Chain Sequence
APGVTVTPATGLSNGQTVTVSATGLTPGTVYHVGQCAVVEPGVIGCDATTSTDVTADAAGKITAQLKVHSSFQAVVGADGTPWGTVNCKVVSCSAGLGSDSGEGAAQAITFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoprotein
molecule keywords MACROMOMYCIN
publication title Crystal structure analysis of auromomycin apoprotein (macromomycin) shows importance of protein side chains to chromophore binding selectivity.
pubmed doi rcsb
source organism Streptomyces macromomyceticus
total genus 20
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1991-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 2mcmA00
1NCOA 1J48A 2CBOA 2CBMA 1O5PA 2CBQA 2CBTA 2G0KA 4JW3A 1J5IA 1ACXA 1HZKA 1HZLA 2G0LA 1NOAA 1J5HA 2MCMA 1AKPA
chains in the Genus database with same CATH superfamily
4GBXC 4TUJA 5D4IA 3OJ2C 3ALWA 4UILH 5T3ZD 3HG1D 4O02L 1EGJL 2OQJA 5KANI 5MEOB 4ESKA 5DGQA 2ZXGA 1H8SA 1SYVB 5ILTL 3EGSB 1PG7H 2L7QA 2NYZA 1GR7A 1YJDL 3SJVA 4GAYA 5ERWB 1CD1B 1QRKA 1AHWA 1FYTB 3QIBA 4LKCA 2W95A 3ZDXB 5MP6L 2WCSA 2ZXEB 1A6UL 1GJIA 4IOSA 4DN4H 2E47A 4XVOA 3DRQA 3S36H 1JGUL 2HKFH 1A7PL 2AEOA 1WE5A 3DX0A 1H15B 5MEPA 3BIKB 5C86A 2XPGB 1MQ8A 4NT6B 3VMOA 1YRKA 3VXNA 3NEXA 1LE9B 3KR3H 2AFNA 3SCMD 1C7SA 4NP4H 3ME0A 4NO0D 2NCMA 3BP4A 3MJWA 1U8JB 2X2YA 4UOJA 4F1ZA 2ALAA 1TO5A 4MMYB 4ZYKA 3QUZB 2VLKB 3PWJA 4NBYB 1U58B 3K2KA 3QIWC 3UOAB 4XBGB 1D6EB 3QUYA 3FSVA 4J6RL 1FNSL 3IBOA 4PJFF 5E8PA 2XZCL 3FO0H 1DJXA 2WLIB 4ZUUA 5BQDA 3FN3A 1R19A 3B7TA 3RJDA 1E67A 5F6HJ 2C9PA 2FCBA 4R5XA 4PJ9B 1HE7A 2VDRL 1N0LA 3ARFC 4OFYA 4G3YH 3KXFE 3U48A 1V3KA 1NBZB 5EIQA 1DBJH 4FE9A 4RWYL 3FS9A 2YA2A 1QRNA 2NTSP 5C97A 4GRWE 5KJ7E 3AXIA 1S7RA 5H35B 5G55A 3V7MA 1KGCE 4J1UB 4A7GF 4FTVA 3QW9A 4Y9FA 4ZS6C 1DSFH 3GMOA 1VACB 5FM4A 3UBFA 5HHVL 2AEPL 5KW9H 1E9QB 2X9XA 1OALA 1ES0B 4GXFA 4ZG1A 2VLRD 4O4YL 4X7FC 3IU3A 1IU1A 2L04A 1INQB 4JCLA 4ZTEA 2BOBB 3OG4B 2COVD 3RWIA 2N0KA 5CS7A 4AMKH 3ARTA 5I0ZA 3D5OF 3GO1H 1G7LA 1MCDA 2BVOA 3VFSA 1RIUH 1VERA 1UC6A 4WHTA 1CS6A 4UQIM 1PU0A 5DZOA 2HFGH 3GSNL 5A2BA 2ZX7A 3RVUD 4XGZB 1XF3A 3I6KB 4HEME 2AQ2A 2R29A 3EJRA 3OGCA 4C4BA 4XCFL 4YR6B 4G2AA 1NBYA 4L0ZA 4DSYA 4NGHH 1PZSA 4U1IB 5EIVA 2L3BA 3U4EA 3C60C 4LLMA 5FCUL 4YS4A 3TA3D 3A6BL 2DW5A 4OD2A 3SYCA 1A66A 5KS9A 4YHMH 4PV9A 2R29H 4NKMB 5GS1A 3WNIA 2RAMA 4LL9A 4Q9RL 1FZMA 4OCXL 3QDMB 5I0WA 3NCJL 3SDAD 1B2YA 1W16A 3QXTA 4L4VE 4NOFA 4YE4L 4GAGL 3DHUA 2YPVL 4KRNA 5F7MC 3I84A 1TJXA 1EUTA 4I3SH 1BOGA 2D7TH 3RE0A 4LHUB 2R0KH 2X4TB 1ECZA 1HQRA 1DO6A 5EZOH 4JFDE 1U8CB 1MOEA 2BDNH 1KJ2B 2BFGA 2GIMA 3MMEB 1Y6NR 4DVRL 1G6RB 4JQVC 5AYQA 4EKJA 3UAAA 4QCIA 3SB3A 2VXVL 2P5WE 2VRKA 5HBBA 3FO1B 3T65B 1K6QH 1L9SA 1MWOA 2DWSA 1KEMH 5MEND 1CFNA 5FYKL 2N4IA 4HZLA 3EGDA 3BPNC 2YSTA 2VO8A 4QRUA 4KROB 1GKEA 3MLZL 2VDPL 5E4AA 3EO1B 5TPWL 4EI5D 3ULVD 5E08L 2EYRB 1DQLH 1W80A 5I71C 4TQEH 3SSGA 3G5WA 4RRPA 4I77L 1OM3H 1II4E 4ADIA 4YAQA 3PLYA 3WDHA 3MXWL 2A9AA 1JK9A 1NINA 3VXSA 2OP4H 3ZY7A 1A9BA 1NC4A 5D1ZB 2EYTB 1EXUA 4CRPA 2HT3C 3CFJB 2OMBA 2QSVA 2DDQL 2GT9B 2IGTA 3AWFA 5FDWA 1PQZB 3M86A 5JDSB 3K6SA 4F5CE 1YO4A 4PJCA 3P0YL 4GP8B 1IBGL 4AI7A 2M1KA 2C3VB 1KCSH 5E2UL 4U1KA 2AJXH 4XMKL 4PJXA 1NLDL 2H2SD 3O6FC 4YXLH 5L4IA 2APSA 3SKMB 3PDGA 5IGXH 2CZNA 2EAEA 2VMFA 4PLKD 3WO3B 7FABH 3S8FB 1ZS8A 2KUTA 5C0EA 4MDJA 4JDZB 1H3PL 3JSSA 4C57C 2E7MA 2E8ZA 3PHQB 3V5KA 1MWAB 1A4KA 5CGYC 1JMZA 4LEXH 2CBQA 1I8MA 2CIKA 2PCYA 3I2CL 1YY8B 3PWPB 4H4NA 4DCQB 2R2HB 4KHTL 3DOHA 1OV8A 2UWEF 3LZLA 4MD0B 4GRMB 4PJ7E 5I0DA 1YMME 4OBSA 4OAWA 4DEPB 4F8TA 2GTWA 1SOKA 1ODAA 1OAYL 3GXPA 1OAUH 2YD1A 4M7ZC 4UMGA 3TZVA 2XC8A 4PY7A 2WBJA 2X3AA 3L4WA 5B8CB 3C5XA 4UAOB 3LRKA 1HNYA 1QBLH 4L3EA 1B6UA 4PJDA 4YPGB 1J9TA 4CILA 5MHSD 1JNHA 4OSUL 2QMKA 3QJRB 4IU2A 4OZGB 4F7PA 2XWTB 4Y16C 1F1AA 3CU1A 1BAFH 3KPSD 4NQTA 5CR1A 3EYSL 4XMZA 2ODIA 4LASL 4XT1C 4ODXA 4JFZL 5JXEA 4Z7WA 2FO8A 1NBVH 2YFNA 3GMMB 2MCPL 4DGVL 4CGTA 5JW3L 2OYPA 4WEBH 4N0UA 1AYRA 4K94L 4QTFA 4XOCA 1FVDA 1G1YA 5E9NA 1P4UA 5KZCD 1DVFA 1DL7H 2R9HC 3FB6A 4IRJC 4QHKI 3CIQA 4J2QA 1LO5A 3CDCA 1BZEA 3IS1X 1JXFA 5HI4C 2OI9C 5KTEL 3QA3B 1S78D 2QSQA 3BVUA 1J5IA 2MMXA 1Y6MR 2VDML 4GUPA 4GAYB 3MV7B 1AXSB 2TSAA 5G5DA 4ORGA 4FQCL 4PIBA 3TBSA 1UM6L 2J8HA 5GS0D 3CWGA 3FT3B 4PJ7F 1KLGA 1RZ8B 2OAAA 1G7HA 5KANG 2QMJA 1QWHA 3BDYH 3GSWA 5D2NC 5F9WB 1RLWA 3WN5C 2PABA 4OCLC 4AM0Q 2J20A 2P43B 1WFOA 2Q8BL 4UINL 3VXOA 1USZA 2VITB 2X2IA 3NSJA 4L3FA 2YWYA 1HDMA 1PYWA 2EABA 3SDXE 1FQ9C 3ME0B 5IFAH 5FM5M 1U8PA 4LSVL 1PY4A 2GFBB 2X70B 3DGGA 2BXYA 3II1A 4UOW0 3ROLA 4QAWA 4ZYKB 4N2OA 5KG9B 1DHKA 1FHGA 3WTTA 4OQTA 3GZQA 1IEBA 1KJ3H 4G7VH 1M1XB 3HI6L 2X4UA 4ZTPH 4LCIH 4DUXA 2YAPA 4TTGA 4LNRA 5A6MA 3HZKB 1S7XA 1J0ZA 4ZUUB 2NY0D 4FQLH 1HXMB 1FCCA 1N10A 2F18A 2ADYA 1HINH 3C2AL 2H2PD 4JPIB 1Y1DA 3FYEB 4G9FE 3VM5A 1AMXA 1PZBA 4OQTH 5KVGH 2W60A 5FWRA 4LLYA 5T1LD 2GTQA 1AGFB 4WFFD 2PO6A 1NAKL 3KYNB 3ZE2E 5BNXD 5IB3A 4TUOB 2MPVA 4QXUH 1M1SA 4HBCH 2LU5A 4KPHH 3BVXA 2OX5A 4Z0XB 4ZFGL 5DSCA 5A1AA 5EC1B 2LW3A 3SGJA 4HK3N 1SXBA 3MLTB 4G7SB 3RZCA 3SZ6A 1VEOA 3HI5H 1ZIBA 4JMNA 3RJOA 3UIZA 3PGFH 4OLXL 1IX2A 1ET7A 3VXRE 1IQWH 2Q76B 3DX2A 4N2CA 4UQEA 3QQ3B 5JOPE 4K7PY 1BP3B 2QQKH 4FQHA 4ODWB 3O6MH 4F92B 2A9DA 3HBGA 2E7LA 1Z9LA 5C0ND 4WHTB 5GISL 5IEHA 3ULUC 5LKNA 1BF5A 4YBQD 1MN4A 4OB5H 4N6RB 2IANB 2FX8L 1S7UA 2AXJA 4TQ8A 3HE7A 3Q2NA 4JZOA 4AQAB 4RMVA 3VFPB 3X1GA 4FXKB 3ZTJG 5EORL 5FV1L 2EDLA 2VM4A 1OB1A 2QFRA 3S34H 5I1CL 1AR1D 5CR8A 4H0GA 1G9NL 3STZB 3FUNA 3L5WA 2LFGA 4HGKC 4I5BB 4LLMB 3KH3A 4HOXA 5IKCA 3FFDA 4RGND 3CFCL 4AGPA 4KRPC 3T1WA 3L17A 3S5LB 3DUUB 3ZE2F 4Y2LA 2HPTA 2XVKA 1FZMB 2OCJA 3LVTA 15C8L 5E95B 2VCOA 1XFPA 4MJ2A 5GRVL 4WW2F 4M4PA 2VWEC 4DGUA 3UJJH 2WV3A 3TCLB 4AM0A 5IW1A 3W38A 3O2WH 4BQ9A 1RHFA 2FO1A 1RUPH 4FEIA 3DYPA 5DT1L 1XIWC 4DWHA 2UXGA 1MCOH 3BQUA 1PZUB 5IK3B 1WAAA 2AGJL 3K4DA 4MA7L 5F9DC 4CMMB 1ZTXE 1ID2A 4PJ6A 5FFOA 3TCXA 1OE2A 1KGYE 2EDEA 3IN0A 3SYAA 3EZJB 2VSCA 4XWOC 1I8IA 2X6CA 3BZEA 1XGPA 1HKFA 5CEYA 4S1QH 1BD2B 1FJ1B 4G1MA 4HD9A 5E2WL 1T5KA 5I76A 1AR2A 3NN8B 3Q8AA 4U3SB 3K4ZA 2BP0B 5LBGA 3B2UC 4F7EA 4M6ML 5A2AA 5IMMA 1T0NA 2BINA 2FECI 1F8TL 4AGMA 4JQXA 4FLQA 1JBJA 4B9JA 4BELD 2BMKA 4JMXA 3P4MB 2YAEA 5JQ6H 2Z31A 1KYOJ 4Z6AT 4GBXA 2BP5M 2P5ED 2WO3B 2OMUB 2JCWA 2R7EB 2JB6A 1AH1A 5FUOL 2PCFA 2YA0A 2UUDH 3V5DB 5LGKA 2CJUL 3BP6A 1A4CA 4J12A 4ODSH 4ZOBA 3QRBA 4Y5YB 1KCKA 2C9QA 5DD5L 4E9WA 5LUMA 5CJOL 5J9PB 3BDBA 3FFCA 1EFXB 2BK8A 5CU5A 5GRJL 3UAJC 3U46A 3DK0A 2OR9L 5FDWB 5AW3B 1QFOA 2YKLL 5KVDE 3D30A 5MERA 1KXQE 1JRHH 2QR0B 4MDRA 5CLTA 3S35X 2YOAA 4PJXB 5AB1A 2NY1D 1XR9A 3VFGL 2B59A 2R2BB 5IG7A 1D5MA 3FONB 4AEFA 4HV8B 1AO7A 3K72A 3VXPA 3DHJA 3V5KB 1CDBA 3CLEL 1A4KB 1YYML 3ZIMA 3QUKA 4Y88A 5CSBA 5GJSH 4K71C 2CLVB 5DO2D 3MV8A 2IDUA 4YLCA 2ZKHH 3QIWA 4OM0H 1PVHA 1ZHBA 1ZLEA 3NCXA 4OFIA 3T1FA 3DPBA 1LWHA 3JYCA 3MREA 4U2ZA 5HGBA 3C2SA 4ABWA 4AE1A 3OKKA 2XG4B 2BHYA 3V2AR 5L88H 4PRBA 1YEKH 2F19H 3HLAA 2ZG3A 4TSCL 3EYUH 3VCLA 3FULA 1VEPA 2BJMH 4FG6D 4Z5RA 3RWJA 4APXB 2Y07H 1G7QA 1U36A 3HUJA 2WN3A 3UTTD 5L0QC 3PWUA 1ZKAA 2CAKA 4PY7B 4ZPVB 4U49A 3KCWA 3FCSA 1WC7B 3QPXL 4PJDB 3MLYL 2X4OB 3KNBB 4XPBL 32C2A 1T1YB 1W0WB 3MA9H 1DCEA 3WTXA 3TH2T 4JS7A 3KYOA 4I3RL 1CICC 4JM2D 4J4PD 3EYVA 4MQ7A 1RZJC 2VDQL 1OPOA 4ODXB 1PKQE 2W88A 5L7XH 3MC0A 2AEQH 1MREL 3QDGA 4U33A 4YZWA 1EBAA 4HS3B 2J8UE 4XPTL 4XXDB 1G5AA 4JO3L 1U21A 3V6OE 2OMTA 1R5WB 2PR9A 2DQ6A 4OCYL 3SJVD 5LNDA 2MJWA 3EO0B 4HAFA 2E9JA 1M9SA 2P3YA 2X0UA 2QVFB 1WV7T 3QXVA 4ECNA 5J89A 2E9GA 3QIBD 4XMTA 3UEQA 3D50A 1HKLH 5IT2H 3ISRA 4IOSD 2GTZA 1I1YA 2KPNA 4J3SA 3RL1A 3TBSB 4NUGL 3H9HA 1UT2A 3GEWB 1G9MC 3GXUB 4F93B 4JVPA 5IROC 1BIIA 5DC0A 5DEGB 4DP4X 5KVEL 2AC0A 3GSWB 4PS3A 1AANA 2BVUA 3C60A 4HKBB 1A14H 4NYLB 2J1YA 3LKQB 5F72S 2QEJA 1DO5A 1YYLH 2QTEA 3QUYD 1GXEA 3X2QB 1AAJA 1JHLL 4HLJA 1FA4A 4GW5B 5CJ8A 5JDJA 3BEVA 1OSZB 4N2HA 4IKJA 4HIPA 2GY5A 4XAKE 1OK0A 1JN6A 4KITB 2BY0A 1KYAA 4OFYD 2C3HA 4UTAA 1S7XB 4S1DD 1U92B 4FI7A 3IAGC 3QG7H 5IQNA 3UPCA 4D9RE 2YOCA 1M9WA 1E43A 3FTYA 1QRND 4RZCA 5IMOA 1QHOA 2IV8A 2JJSC 3RFRA 3D0LB 3D09A 4JQVA 3BH9A 3ZR5A 1JHTB 2NR6C 1AZBA 4P5SA 5F9AC 4L8DB 2PO6B 4X0KB 4FTVD 4TLUA 3K6FA 4ZFZB 1DJZA 1Z3GL 4UTAH 1D7FA 5DYFA 3D4YA 2R39A 5JR1H 4S0TD 4BJLA 3GSXB 4ELME 2BY1A 3C9NB 4EZLA 2OX5B 3CCHB 2KZWA 3M6DA 4FXGC 4XC1L 1SLVA 4LAQL 4F2FA 1ZGLP 1EAQA 3NPZB 4P2OB 3ZIYA 2QVMA 4FI8A 1PF3A 1NL0H 1JZ2A 1IC5L 2OK0L 4JDTH 3QZBA 5DI8B 4B5EA 1QSEE 4HWEL 4HXAL 1C5DB 1GHFL 2JCCF 2XBDA 5AOLA 3DJTA 1TLKA 2CKNA 2P26A 3D2UB 4KQ3L 3WI9A 3VX0A 1KJVA 1VAHA 2CH8A 2JJUA 3ATBA 4OZFB 1UXWA 3C8HA 1SOSA 2LLLA 4WW1B 2ATPA 5E4IA 4JVWA 3KHOA 5FF6A 1VEMA 5IEHB 3MUUA 2ADIA 3MXVH 3UZQB 5IP4A 2E27H 4GIOA 4S2SA 3QP3A 3IU4L 3O6FA 4LDCA 2EINB 3HE7B 3IFNL 3MRQB 5LAXB 4JZOB 3SDCA 5FHBH 3CZFB 2R1WA 4NKOB 1TSHA 4F7TA 3AAZA 5AUMB 4BE6A 3LEYH 4P57A 5C7XL 3K8LA 3UJTH 5FKPB 1VFBA 5E8EB 4PG2C 4GI6A 2D31A 4Z7UA 3V10A 1J5CA 1DN2A 5EA0L 2OYLA 3QCTL 2AJZA 1OEZW 1RUKL 3K2IA 5G4NA 3K2UH 2DWEA 1BREA 3PNWB 1HVXA 5C0FA 3PP3H 1WA1X 3GK8L 3NIGE 5ITBH 3TPUA 1DUZA 1TQTA 1MXGA 3KPQA 4YHIB 3BZ4A 1MAKA 1D6VH 1JZGA 2D0GA 1VRSA 3BQUB 4YEFA 5I8EB 2IIJA 4ZO8A 3RDTB 3W39A 3X3FL 4BHUI 4EN2A 1JZHA 2D7NA 3AUWB 4WKXA 2XV2A 3BAXA 2EEFA 1DQVA 3BZEB 1I8IB 2Y6SC 4MCNA 1XF2A 1MUJA 1L7IH 5FUZH 5I76B 4FZEH 1GSMA 4HIJA 2QADB 3FZUC 4Y16A 5DD0H 4WJG3 1JHKL 2ID5A 4CA4A 5IMMB 1QNZL 3DVIA 3B5HA 3KL3A 4BA0A 4NBXB 4MJIE 4AV5A 1ILSA 5CD3B 4N0FB 4R96A 1E6JL 4LLUB 2CIIB 1AG0A 2B5IC 1LE5B 1WBXA 2Z31B 3ZMEA 4AQ8C 4WEUD 4RA3A 4ES9A 3ETSA 1JNLL 4OTXL 3VXSD 1NC4D 1COBA 1FLRL 1SJVA 1YA5A 4IRJA 3R06B 2H0JA 1VKXA 2EJ1A 1GOHA 1D7DA 5I73B 2HT2C 4XH2B 3CLFH 1F1GA 5ID1B 2YJLA 5C6TH 4Z95H 4UM8B 3REVA 3NSDA 3QI9C 2IAAC 4NQSB 1HOEA 1BFOA 1CG9B 1U3NA 2BC4B 5BVJA 3TESA 4N2MA 3O6KL 1PY9A 4KNQA 2B4CC 1MI5E 5D2NA 3CC5A 4YDLC 5DQ9B 5CCGE 2AZAA 3FT0A 5F0PB 1TZIB 2YQ3A 5HHQA 2OS7A 5CJXC 1P84J 4O2FA 4WAFA 1D5MB 3RA7H 2G3ZA 3PJSB 4EDWH 1Q94A 4KKLD 3D3VE 4JL1A 3F01A 3GKZA 5L6YH 2VQ4A 2CDFA 2K8MA 3OC5A 2XUWA 1R0AL 4HKJB 4X9GA 4XP4L 4U1MB 1W8OA 1KN2L 4WI6A 1IVTA 3AMKA 3FOMA 3KWWB 3WUWB 1WZ1L 2OPCA 4WWID 4BD4A 5DMYA 3EZ8A 1P1ZA 1ZHBB 4NSKA 3B9VA 3DPBB 4N4YB 1MEXH 3T1FB 1OY3B 4LCWB 4U2YA 3ZTNL 2GUOB 1QLRA 3CXDH 3TZVD 1GZHC 4PRBB 4D7BA 2WBJD 2ZTBA 3NVQA 1KYDA 1TVDA 4HUWA 5AVYB 4GAFB 4L3ED 3RWJB 3EH3B 3PABA 2ED6A 5TE4H 3ZSTA 1B6DA 3PWUB 3OC8A 2XIBA 5DTFA 2CLRB 1ONQA 1TQWA 2E75C 1X5IA 3B2VL 1A1NA 4Z77B 3CPLA 1SXCA 3FCSB 4HKZA 1DLHB 2FHFA 2WW8A 4JJ5A 4MNQB 5CUSL 4PRIE 5GJTH 4XWGH 1A5FL 4QRSA 1E7UA 3T8MA 3UTPD 4XAWL 3KJ6L 3S3DB 5JXED 3RHWF 2E7CA 5E5MA 1TTAA 3KYOB 5HGAB 4XP1H 1F02I 1QSFA 5FW8A 1AZUA 1D5RA 5BRZE 3EYVB 4ZI8A 1J0KA 4MQ7B 3SE6A 2F54B 2VLJA 4LGSB 1DVFD 1C9SA 3DJ9A 3TEXA 2CDGA 1MFAL 5E94A 4HMCA 3SOBL 4O2EB 5IQOA 4GI8A 4OGQC 2G3XA 2Y3NA 3OJVC 4YDKH 2DQCL 5F6HI 3UTSE 5JIQA 3VE0A 4WV1C 2YQ2A 2OMTB 2V17H 4OGXH 5IBLC 1IFGA 4K23L 4YVUA 4HPHA 2EUXA 4ODTL 4W4OA 3ESMA 4G6FD 5ETUA 3B43A 3RILA 5JW4M 1UZ6F 3BIBX 3JT2A 1FE8L 1SNRA 1I1YB 3A23A 3HVNA 5DEFB 3KLHC 3NJGA 2NOYA 3QC5X 1WBZA 1IEHA 4JO1H 1A1MA 1UTDA 5TE7H 4AIOA 3N44F 1PD1A 4XR8C 1YNLL 2IGLA 3SE4C 1MQKL 5AW5B 5DRWB 4EUPG 2WVSA 4PBWD 1OF0A 1F58H 3T2NL 3ULUH 4MA1B 3P3TA 3N04A 2A9NH 3GSQA 2MFNA 4MZ3A 3C8DA 4O5LL 4Y5VA 5EU5A 3U83A 1LEKA 1TZ8A 2DMHA 5I5IA 5SWZE 4F9LC 5HDQL 1KLFA 2EDYA 2EDHA 5DO8A 4MB5A 4MHHI 4DAGL 2XJLA 4I48A 4ZMXA 1FIEA 2YBRB 1T1WA 1EZSA 1HH9A 4ONFH 2Y22A 3T0EE 1IGFH 2F7IA 3MGTB 5E7FA 4ZRGA 3C5SA 3L7FB 2DQHL 3KLAA 5FGSA 1ZV2A 1OP9A 1XIWA 2CRMA 3FT2B 3LS4L 4JFQA 1KFGA 2Z65C 3FN0H 4LHQB 3DYMA 4U6YA 4NUQA 4RISL 2YPKB 2Y6TE 2ADGB 2RACA 1SDDB 3HS0C 4HK3J 1D7BA 1LP9E 1MHHB 1T66D 4M61B 4NO2B 3R19A 3RTLA 1AIZA 5EO9A 1XH0A 4L5FL 4G43B 1A4JA 1FZKB 4FLHA 4P3CH 5CZKA 4J3OG 2PWHA 4X6CB 3RZCD 4L1DA 3UX9B 4Q0XH 4CC1A 3WTYA 2AQSA 1FORL 4F33B 3L3GB 1XB6A 1MW0A 3QRLA 3RG1C 2GJ6E 3AG2B 3VFUB 1NOLA 3NGBB 5E6ZA 1INDH 1SN2A 1DVZA 4ZMLA 3AQZA 1Q9OA 3K0YA 2QJDA 4FQ2H 4L1SA 4URKA 2VDKL 5J6HA 3ZZ1A 4H2AA 5HHNB 3S0PA 4X5WB 5FW7A 5EOTA 3WKML 4H7VA 4L4JA 4ZUTB 1P2CB 4JG0H 2WJ5A 1NCCL 1AHKA 1WS8A 2A83B 1J1OH 3IWVA 1I9RL 3FQXB 5CSZB 1OAXL 2J1WA 1P69B 2ZWSA 1KB5A 2H1PL 3ZK0A 4OLZH 1X5XA 3ECVA 3TEYA 5I1JH 5FF6B 4WU7A 4KUCF 4F58H 3SY0A 5IIEB 4P8QA 5EBMA 4XCNA 3EHBD 1CL7H 1NPJA 5HHOB 3SDCB 3S88L 3ZYOA 3CN4A 4HWBL 5L2KE 3UFIA 3A67L 1OP3H 1FGVH 3TJPA 4POYA 3HMXA 3CSTA 4P57B 2W9LA 5HYJD 1KB5H 3DSFL 3MCLH 1HIML 3VWKB 3IGKA 2HA1A 1EUUA 3QQ9D 3TTSA 5AB2A 5GGVY 2XACC 4FFVC 4TULH 2Z4TA 5C0CE 2OMWB 4BH7A 2OSWA 2R15A 1UOWA 1U2CA 2BP8A 2NY3B 5EUOE 3PDOA 3HMXH 3WO4C 1CYWA 4XXWC 2YLKA 1SXSA 3N43B 3IBEA 3NAAH 2BPBA 2VUOA 3O9WB 5JORA 3H6AA 2Q3AA 2IALA 3RYMA 2XFXA 2PYFB 1WUZA 2HJKB 4I2XE 4Z7OB 5FGCB 3QDAA 3O4LB 1NCAL 1U8KB 2XICA 3B9AA 4CKQA 1T6BX 2DLHA 1RZPA 2J88L 1AD0A 4KJYB 1DDHB 5C0BE 4KNUA 4UT6L 3P0VL 1OLLA 4PLJC 5I16A 4YO0A 3U7YL 5JHAA 1XF2B 4OD1L 1MUJB 2ICCA 1HYSD 1CICA 2DEXX 1J10A 3ECUA 5JA8B 1AXIB 2Z31D 1CD0A 1P6WA 4X4XA 4YHLH 4YUEH 5C08E 5LCVH 5KYWA 2AQQA 4WWOA 4GBXD 3HE6B 4TSBH 3DTXA 4OJFL 4DW2H 1T2QH 1I1FA 1RD6A 5IVXF 4HF5L 3ARBC 3MROB 1RL1A 3RVTC 4NCC2 5HHXL 5KYYA 3HW7A 2HFEB 5D5ME 1SEBA 1CLOL 4YE0A 2LAAA 5JYMA 3FFCD 3MR9A 1VKXB 4PJHA 3ULSA 1J7VR 3UTQB 4AYSA 2EH8H 2X1XR 5DJ8A 3DVGA 2HJFA 4G6AC 2DM7A 4NPYA 3MO1A 1D5BA 1IBFA 3WFBL 3IJYA 2UXFA 3QORC 2UZYB 1MF2H 3OKLA 3EOTL 5EUOF 1FC2D 1HNGA 1TJGL 3EOYG 4KUZL 3B1TA 3REVB 3AGVA 4PJ5D 4JJHA 1B90A 4OVUA 5HHMB 2DQUL 2XV0A 5IVZA 3BCDA 2IPUG 4QOKD 5IROA 5D9SB 5EZLB 3BUYB 4U1GB 3II2A 4LCVA 3IRCA 5F1IA 1YN6B 3CC5B 1AO7D 2J1ZA 3CN2A 5FO2A 4FA7B 4JG1L 4AQOA 1QKZL 4Q56A 1Q94B 2BIIA 2P5PA 3MV8D 4XPFH 3QIWD 4G8GA 2FIRT 1MFCL 3IMRA 3ATAA 2DKMA 3ZN6A 1EAPA 2H9GB 2XN9E 3FOMB 4L3CA 2XKNB 3HAEB 1G9NC 4U6HA 3LQAL 1QW8A 4NSKB 5LXGL 1XAUA 3G7TA 1ETZA 2P7TB 2BY2A 3SD2A 2YD6A 3ARFD 4O00A 5IR1A 3JWNE 3O3DA 1F4XH 1V7NL 5TK2A 4I4WA 3AXLB 4XVSL 4LPXA 3PABB 1XCQA 5I23A 2JJSA 3U36A 2EIZB 1PZ5B 4N1HB 4GKZB 2DQGH 2HVKB 2NR6A 2Y7SA 3WIFB 1JD9A 1R3IL 1NSNH 4OJYA 4LVHC 4ZS6D 2LLGA 3SQOH 4EO5A 2PWFA 4QRSB 1ZLSL 4IKNA 3TT3L 4J3OF 2VDLB 4HIXL 4M5TA 3QDGD 1J86A 4JM0A 4FXGA 1UXLA 3M1BB 3GUTA 4G8IA 1KUMA 4XBPA 5TF1H 1H5BC 1WLHA 2Z91A 3WSQH 3MLRH 4JFVA 1RPQA 1FFNA 4BKTC 2DM3A 2QPSA 4R7XA 1B0GA 1S7WA 2YRLA 3LRHA 1GKOA 1XGTB 3JQOB 4M48H 1J8HE 1UB6B 2FBRA 4GSUA 2PCXA 5DRNA 4ZW6A 4HG4K 1CC3A 1U93A 2UY7B 3DX3A 3MLUL 3NFSH 3DROB 4J8QA 5IVOA 4QRTA 4HALA 5AVZB 2ICES 2XT1B 4RAHA 3C60D 4LSQL 1A1MB 4POUB 3MRLB 3SKNB 5ADOL 8FABB 3IMBA 3WMSA 5AVSB 2O5ZH 3U0PB 4IRSB 1NUDA 1RUML 3P73B 2GEQA 3H2PA 4P23B 4PG2A 4Y5VB 4BK8A 1EO8L 3B9EA 3OV6A 1LDPL 1IKFH 1LVEA 4WJ5B 4KFZC 3CFUA 5CCHE 3VXUA 5KN5A 3QDJB 4K3HA 3DC0A 1F13A 2UZIL 3GSVA 4Y9EA 5ECJE 5I1IL 2J8OA 3LZPA 1SN5A 1GC1L 2ALWA 1P5VA 1TDQA 2WCPA 4FNPA 4NQUA 5JIHA 3D69A 1F42A 1E90A 3ZL4L 3KLAB 1EX0A 1H3VA 5HJDA 4JFQB 1MFBH 5D2LE 2ROXA 2WQWA 2YPLA 3KM1A 4XHQA 5CHNA 4MHHG 2PW2A 3WFHB 3DXAA 4G42A 2R0WH 5C0IA 2BP3A 4GINA 5E1IA 5FECB 3EOBA 5JQIB 3ASWA 4LLDB 5EO9B 4P2RE 1BFVL 4FNLH 3O6LL 4ZUSA 4PLOB 5BS0E 1MDAA 2GSMB 3FB8A 3QQDB 1EH9A 3ZQXA 3VD2A 2OSXA 2BIPA 1CLYH 1YY9C 2E5EA 2YSSB 1EZLA 1T1XB 5EZPA 3EFOA 4Z0BL 4H40A 1CXHA 2BX5A 5GGTA 5T1MB 4MAUH 4DOHB 4AQ8A 1IGJA 3E2HB 1E4XI 3BJLA 4XCEA 5EIIG 5FYKE 2EH7H 3GMQA 5EFIA 3TN0C 1Q9OB 2VRAA 4Y4HB 2HT3D 2YQBA 1FC1A 4N8UA 2Z7YA 1BBDL 2B20A 1MJUL 4M7JL 4XO3A 5J6HB 4OI8A 3FO9A 1TEFA 3SO3B 2EC8A 3NCMA 2XKUA 1KYUA 5GGRA 3FU0A 3QCUH 3A24A 3HI1A 1FO0B 5GGTH 2NRDA 2DBLL 3O6FD 2O5YH 3D12B 3QI9A 1A21A 3KBPA 5IQLA 5BXFA 2ZQKA 5EBMB 5IMLB 5JMRA 4LSSL 3DX7A 3QCVH 4JPWL 3FTSA 1CK0L 4ZDHB 4KVCH 1A3QA 3FTUA 2XY2A 4X8JA 5CGYD 1JPST 1F4HA 3FQ2A 3SE3C 5CJXA 1PX8A 2J25A 4HFWA 4F57L 1CXLA 2JWYA 4HPYL 3LZFH 4IOFC 3U7WL 1GY2A 2GI0A 2R27A 4UQDA 4DK6A 2B4CH 1I53A 5D1XE 3BD3A 2F58H 1CYXA 3LOWA 4GXUN 5JPNC 2UYLA 3GMPA 3O0RL 1CDGA 5FFLA 4Y2DC 5I26A 5ANMB 2GCYA 3ZDYE 2J7LA 4HCFA 1Z32X 4RDBA 4HYTB 1M6UA 1S7SA 4XB3A 3OKMA 3BPCB 2MOVA 4HAGA 3F58H 1GZHA 2BCKA 2E76C 1E0OB 2AF2A 5JMOC 3WEXA 2V7HA 2F53E 2NW2A 5IFHH 3O4OC 2GB2A 3BT2H 3PE9A 4X5PA 4XVJL 5F44A 3FDWA 2E6PA 1HSBA 1IT9H 1RHHA 5EU3A 1FF5A 4X80H 4ELKA 3VFMB 1BZDA 2X6VA 1OSPL 4OCRH 1D5ZA 1UADC 2QQNL 1SMOA 1YEIH 3HB3C 4FNRA 3L08A 4Y16D 5D1ZI 4ANKA 2PTVA 1L0YA 1AD0B 3TEZA 1WZKA 2ZPKL 4KVNL 5DUJA 4YO0B 1UYWH 3THMH 3K4AA 5IHLB 4ZK8A 5H4YA 5ICUA 4D9QE 4CU7A 4RWHA 1WD9A 1AS6A 5FC9A 2R9HD 2J44A 4PRPB 2VSMB 4IRJD 2KQNA 4DVBB 1DJHA 3P4LA 1X5YA 2BVPA 3ABKB 2VJXA 4JN1H 5D7SH 5HI4D 3C12A 4L4TA 3WFEL 4A2DA 4D0DB 5I19L 1TVBA 4LXFA 2OL3L 4WV1A 4XP5H 4YHOL 8CGTA 4PJ8C 1U91A 5GQBA 3W0WA 3A5VA 1DBBL 4PJFA 3DVGB 1WWCA 2HJFB 1IGMH 2BNUA 5CIPB 5B1AB 1MPAL 2ZOKA 3PWNA 4LLQB 4HIQA 3H7BA 1NEPA 3ZDYF 1TKWA 3C09B 1FV1B 1Q8MA 1B9KA 3FQRB 4MYWB 3CSPA 2CLZB 1XGUB 2YZ8A 1P4IH 3K1KC 4UUJA 3CJJA 3BCFA 4NM8L 2A6JB 3FMGH 3LKNB 4JFUA 4RGOL 3BAYA 2VUYA 3SE4A 4QKXB 1Q9WB 2JFCA 4W81A 3US0A 4GG6F 1YEEL 5ADPL 2FJFB 4PD4K 2B1OA 5GRZA 1IILE 1DCLA 4A7GA 4GO6B 3ZT5A 1FNGA 5ESQA 2FBJH 4O58L 1F3DJ 4LT7A 4NUJA 4YZFE 3UGEA 4JN2A 4F9LA 4E5XG 4B9GA 4FQ1L 5EF0A 2F61A 5F7BA 1YMHB 4PB9L 3A47A 5GZOC 1SY6A 3MGOA 4L3CB 5JOFB 4MCYB 3O0LA 1QW9A 4O51B 3ABLB 4HWUA 2I7OA 2OYMA 1MRDL 4FADA 2XTJC 4ZXBA 3MNVA 2BSBA 2DH3A 2WUBL 2YXWA 3MRKB 1NFDF 5EOQH 4DTGH 4XMXA 5A2IH 1JV2A 3MJ8B 5JHLA 3G6JE 1YNKH 1DJIA 3HS0A 2WNXA 3HMWL 4NWTL 3RQ3A 4F7CA 1ZHNA 1OE1A 1SY6H 3ZBMA 5HYSA 1CDCA 3LEXB 4FHJA 2BIOA 2AQPA 2EYSB 4M7KH 2ZUYA 1QSFD 2XQBH 3L81A 2DD8L 2CG9X 1HZLA 1H6TA 2VLJD 6PAZA 4YXHL 1WRFA 5B1CA 1I7UA 4JPSA 3PWVB 1QA9B 3V8OA 3HR6A 5GS3A 4I1NB 2AJ3B 5I15L 4N22A 4QHNA 4H8WC 4JKMA 3BH4A 4N8CH 2GBVA 4WFHE 5FYKU 3PQYA 2Q3XA 4NQDA 2AXGB 1SFDA 3D85B 4YZFF 1OD7A 2LT9A 5LGJB 1JXKA 4W9ZA 3ULUD 4I0PB 1X5MA 2G30A 1AXTH 3GZOA 4GH7B 3ZRFC 1NAMB 3WELA 2XWBB 2WXMA 3K3QA 4YSEA 4GRWH 5DRNB 4NKDA 4OZIF 4L18A 4P9HC 2DQIH 3V6OC 1BAGA 3B8YA 2H1LM 4QRTB 4LOVA 5HY9A 3U1SL 2E86A 3BD4A 5K5YA 1X5HA 4PGBA 1TUPA 4G6KL 3G6JF 5CWSB 2WTOA 4NAQA 4XC3L 1SM3H 4KRPD 3SDYL 2DL2A 3ESVF 5TDOB 1CFSA 2X4RA 5T3ZL 2KMWA 1Q0XH 5JPMB 4ODHH 4NKIH 4YDIL 5CZRA 2YC1B 4HEMA 4WUUE 1U8NA 1W72L 4JFWA 1QOKA 4LPVA 1M2VB 4GS7B 2K9UA 2WP3T 2OTWB 4NERA 1EVTC 3RTQC 1GS8A 2CBMA 5F7UA 3TWYA 4NQCE 1C08A 2IGFL 1RULL 4GT0A 1XIWD 2R2EA 4K2UL 4MXWH 4R97C 4GEIA 1N5AA 3P30L 1IE5A 1YEFH 1YQVL 2EADA 4XXWA 2AABL 5HPMB 1LO2L 2YEZB 3VI4E 1AE6H 3KW8A 1F0LA 2NZ9C 3HA0A 4D2NA 1JPEA 1JUFB 4XWOD 2BNQB 2I5YH 3I74A 3SE9L 3CMOH 4ZOCA 2UVFA 5CHNB 2MCMA 1QLEL 1BQRA 2PW2B 3DXAB 3L4XA 3U0WH 4HJJH 5F0LB 3X14B 2MEJB 3B2UD 5B3SB 3LDBB 4LBEB 4B7IA 3BESR 4F8QA 4JK0D 3HIZA 4ZUSB 1IC4H 3FB8B 1IM9A 4JFDA 1J87A 2D3JA 2ZWKA 4C83B 2UXTA 3QXDA 4AIZB 1HHKA 1SBBA 2GI7A 3G5ZA 2BRRL 4U1LA 1OT2A 4BZ2L 2P5WA 2MQ0A 1CGUA 3T8XA 3PHOA 3OBAA 1IGJB 4G8AC 1IGIH 5EFIB 3GMQB 2UUDK 3P2DA 3Q43A 2UWEA 1VF5C 3GI9H 3L6FB 1KCVH 1SF3A 5GGRB 5AW0B 3QORA 4X5XB 4LHJB 4MNHA 3HI1B 4LEEA 5ESVB 2IPKB 4XX5A 2F1BA 1T0PB 2WXIA 1MFDL 4ANXA 1KPUA 3VI4F 5EV7A 1KN4L 2E3VA 3V8CA 3S2AA 4XTRC 3FQWB 4PMFA 1Z2KA 2PXYB 1IAKA 4YBLC 3EBIA 4PVBA 2JKWA 2XU9A 3WS3A 2DWDA 3UYOD 5LGHL 4F5CA 3QXUA 1RMFH 1XF4B 3QUXA 1KGUA 4XCYA 5J11C 2PMZA 1HS6A 3ZMNA 5EC2A 4ES8A 1MELA 3OHMB 3ZDXE 1QVOB 4GMSH 3VXQA 2WLMA 4OFVA 3NYKA 3KPMA 4LHUG 1Q72H 1UUSA 3VSQA 2YMOA 5IY5B 2UYLB 2C4FT 3GMPB 4HOZA 3WTSA 4WIQA 3NBNA 3MA7A 2HH0H 5GHWL 3H7LA 3OKMB 3VDCA 3UDWC 4F37K 2BCKB 3EYFA 3LKPA 2V7HB 1UASA 2VR7A 3F6JA 3BKCL 3IEAA 4FKHA 4UBDC 4DESA 5CCKL 1AZNA 4AWJC 5F7NC 3WJLC 4RX4A 5E8NA 5PCYA 4ELKB 2H3NB 5EU3B 4KX7A 3IRPX 1J0HA 4JGMA 2NY2C 1CICD 2PYEA 4PJ7A 4A38A 4L1BA 5AVTB 4DK3A 1BM3H 4WCYH 1BV8A 5AKTA 4OFPA 3W2DH 3IJEA 2NNRA 3NIDB 3VXME 3VMPA 3RKPA 1DVUA 4MYPA 2XWRA 3QUML 5IB5A 2W80C 1X9UA 3P9WB 4UIKH 1N59A 3MNWB 2CBTA 4R90H 5GSVB 3U30C 1H5BA 2XA8L 1JIBA 3CSYA 4XODA 1ZA6A 2A2QT 5ALCH 1MLCB 2OMVA 3WY1A 3D06A 5JW5A 1I3RB 1TVBB 3ZDXF 3BGAA 4PGDB 3OF6A 5AW9B 5KVFL 3WXVL 1U91B 2VQTA 3MACH 5EU7E 3WAKA 4KJWC 2CU9A 1ET8A 4L48A 2BNUB 3LHPH 2OJEB 2Y3AA 3TNMB 5IROD 2G60L 2EE0A 4PM1A 2PN5A 3L4VA 1MHPH 3P9MA 5K33A 3CZUB 3ULVL 4NRZA 2WZPD 1BZ8A 3T0VA 3NK3A 1A6WL 3LJ3A 4UUJB 3VGEA 4X6FA 4X6BA 1LK3H 4PW4A 1CXIA 2H26A 2DRUA 4MD5A 2V37A 1GGIH 3E6FA 4G8GD 4F8OA 1F2QA 1G7MB 1S5IL 2QQLL 4M6AA 4AYGA 3BO8A 3HLKA 3LKOB 3NCFB 4OY9A 2V9RA 4ODUB 4XN5A 1RIHL 2RH0A 4OGZA 5E5UB 3H42L 2C7FA 3HN5A 3MRPB 3TBWB 4YHKL 4JN2B 3FT1A 2IBZY 3EOAA 1DJWA 1FFQA 4GSDH 2CNZA 4Q9QL 1IGTB 2KL6A 3K46A 3MGOB 1I3UA 3BKML 3P3YA 2CUHA 3DJRA 4JFFA 4MVBC 1OVZA 2MOQA 4X7EC 4ZXBB 4H2CA 3ML9A 4FULA 2Q2LA 3SPHA 3RX5A 3BPLB 4UQAA 1MLBA 2G9HA 2NR6D 5FYJD 2A7BA 4N8VB 1JERA 5DMIL 4RAUB 4WGWB 3DIVA 4F7CB 1LK2A 4YSPA 4WFEE 5FYJU 3QUGA 4E42A 3MRCA 2D03L 3VI3B 4EVNB 3CDGB 4M3JA 4UDTB 1F4WH 4DT2A 2J5LC 2YD5A 1M6OB 3L4TA 1HH6A 2IAMC 4AGQA 4KHXL 3BAEH 4NI3A 2J6WA 2OTUB 1I7UB 3EIFA 4G9FA 1NCOA 2ATKA 1NFIA 3H0TB 3KXFB 4UT7L 2A1WL 5C9JA 4NRXA 3IJ9A 4KTGA 3L5XL 4L23A 4WVRA 3D05A 3VFNA 5HDBE 3CFDA 3MCG1 2ZKWA 4I87A 4PYGA 4DP0X 1GSKA 4LARL 4GRWB 1MH5B 3BGFC 4Z3IA 1NMAH 3TN0A 3UC0L 2HMIC 1NQBA 3EYOA 4JY6A 4M8VA 3SQBA 3NJFA 4PREB 2ICWA 3SD5A 4TV3A 5DHEA 2CHWA 3CBJB 4CADB 3ECWA 4AY0A 5DD3L 1ITCA 3CVHL 3MUJA 1A25A 3RY5A 4NKDB 1XGQA 2AI0H 3VXRA 3MRDA 3DJSA 3RBSA 2KQMA 3L45A 4LEOB 1IFRA 3RNQB 3C8KB 2TRYA 1BLIA 3K80A 4K7PX 1NLBH 2EXWC 5DWUL 1QTSA 5CJBA 1I1AC 1CJYA 5FHAL 5C3TA 1TJIH 3VXUD 1E8YA 4FN0A 3R8BB 1XH2A 3K2MC 4JFXA 4LP8A 1IVLA 1QI5A 3ZU8A 2ENJA 2ZYIA 4NZDA 3WFDH 4F2MB 3EGXB 3ILPA 1U8NB 4AYFA 3NZHH 3DVNB 1DBKH 2Z93B 5JPNA 4YSAA 4MAYB 3PP3K 1ANUA 2JKTM 1H6FA 1KTDA 4Y2DA 2CWRA 4XP6H 1UWGL 4R7VA 4KKCC 5GS0L 3ECBA 4OLUH 3QXAB 1ZAGA 2YPLD 3ZHNA 1BJMA 4U6XB 1I3VA 3UMNA 4LVOC 1BLNB 3MFFA 1TOXA 3TWCH 2JK5A 4PQXA 3QQ4A 1ZPLA 4IJTA 2Y6SD 3N9GL 1DFBH 3TBVB 4L4VB 1VGEL 2M8XA 4KK8C 3T0EC 5BVPH 4IIQC 1U6AH 5JIIA 4POZC 1J1XH 3FZUD 3U1QA 3U6RA 1XEUA 5TDNB 1V55B 3DOSA 3QVAA 4UM9A 5A7EA 4CC0A 5FO8B 1NOAA 4OF3A 5E4EC 2H4EA 2IPTH 2H6PA 3EJUA 3ABMB 2Y5QA 1UACH 2CO6B 3WDJA 3MLPA 3OXRA 4NDMA 1G1CA 1X3DA 2F74A 3JWOL 4K5NA 1JPSL 2V2XB 5IHWA 3IJSB 4RNRA 1A0QH 3GB7B 3QYCA 4I3GA 2WWMC 4BM7A 3F7QA 3I85A 4OKVA 1IEAB 3L1EA 3CXFA 2AAVA 4CMHC 4ETYA 2HT2D 1UB5A 4MJ6A 2WOYA 5EEVA 1ZTXH 1LEIA 2DL9A 1F4YL 5T1DL 3GPEA 2ZNXA 1MW1A 4M6OL 3QI9D 1JPFB 4PY8I 1KEGH 4JREB 5IEKB 1QYGL 3CNKA 3OX8A 4R4BB 5I1GH 3QORB 2H8PB 3GBNL 2AV1B 4LSUH 4MNHB 4PS8A 5J12B 1XO8A 3F7YA 3LH9A 4QXTA 3MUZ1 1KPUB 3S5LG 4I13B 2YD8A 1SN0A 2DLFH 3NJMA 4RMTA 3FH8A 3DARA 7PAZA 1MJ8H 3SGDH 3INUL 2DWDB 1SHMA 3N40F 4GAJH 4PTUB 4UWQB 2QELA 3V6FA 3OTTA 2FGZA 1SDAB 4BSJA 1KXQA 2ZWZA 3MV7E 3QUXB 4MB1A 4XCYB 4ELDA 2H45A 1XCTB 1HEHC 2J2ZB 4RGMB 4DPBX 2H32B 5J06A 2FTAA 3VXQB 4PN6A 1OW0C 1JVLA 3E3QE 5D8JH 4LQ1A 2ENPA 3RPIB 2R0ZL 1Y18B 2ZKYA 1GYWA 1LD9B 3OMNB 3A6OA 2VYRE 3CX5K 3ZT7A 3LH2L 5KVDH 3UBXI 2NY4C 3G08A 4DP7X 1MW2A 4FQJL 3I9GH 4NC2B 2KI6A 3GBEA 1FIGL 5C0AB 5T5NG 2IDSA 1AQDA 4OZGF 4GRLC 3GGWA 1RU9L 2JE8A 2IQAA 4ZFOA 4GG8B 3MLWH 4NCC1 1E27A 2FJGA 2HRHA 1F1DA 4M56A 1YMMB 3L5HA 3LIUA 3JTSB 3PGCA 5D55A 4LVHB 2YO3A 4KZDL 3BPOB 2WTRA 2X89D 3FPXA 4KMTH 4MJ4A 3U9UB 1HL4A 3IJEB 3R1GH 1F18A 3QEHA 1Z9SB 3HFML 4MA3B 1BVNT 1UQSA 2XXMB 3KD4A 4L4TD 3TVMC 5IBLD 2WYZA 3MU3A 1RURH 3W0WD 3TS8A 3FUFA 4EXKA 1A6AB 3ZTJH 4QRAA 3LV3A 2EKSB 2QV2A 2BHUA 4J6IA 3BP5B 2RJMA 3DKHA 3OWEA 4IK7A 4OIIH 5LJYH 3KLHD 3L3OC 2AK1L 2J8UA 2HFFB 2MIZA 2R56L 3MOAL 3SODB 4OCMC 4Q7DA 4H5SB 2D0FA 5F3HA 4D3CL 4K3EL 2B16A 2E7DA 3V6OA 1B4JL 4GNKB 2ZUTA 3IM1A 2ZXAA 4OJEH 3W9DA 3L1OH 1TQBB 5FA3B 3D18A 2JB5H 4X6FB 4X6BB 5MI0B 3LQMA 2YHGA 1AGBA 5C7ZA 3QJOA 3MRGB 1OAQL 2XG5A 2GJZA 4ZMAT 1JZ4A 1Z5LB 5EHFA 3QEGH 2VISB 3MTXA 4J3OC 4P9HH 5HGDA 4OCWL 5B7FA 2WYTA 1MRCL 1XSKA 3IDXH 4EZJA 2VL4A 4LSDA 2NY5H 1IARB 2IANE 5AVXB 1Z5YD 5BQ7A 3G04A 5DJ6B 3K8KA 3RTQA 3QNFA 4G6JL 1J18A 4P4KC 5JIMA 3EDEA 3O11A 5SWQB 1P5UA 2UZXB 3FB5B 4JFEA 4JANB 2FT8A 1TQVA 4RAVB 3NACH 3SDXB 4M43H 2D4FA 2DQTL 4HISA 4MKTA 4A7TA 3AMLA 4JRXA 3C6LC 5FM8A 4AQZA 3S3JA 1A3LH 1CLZL 3GC3A 3IETA 1RERA 4NN7C 4PUBH 3BWSA 4CSSA 3GSOB 3GXFA 5KSBB 3HHSA 3BGMA 3I50H 2F5BH 4IS6A 2BIHA 3L9YA 3UJIL 2AKRB 4AL8L 5CEXA 4I85A 3DURA 4ZMYA 1QPXA 1JD7A 4XVTL 3BW9B 3L7EB 2NNCA 5I75B 4H1LB 3FOLB 4EIZC 1JDCA 4KZEH 4B97A 1NFIB 1HZHL 3PQYD 3FQYA 5IB2B 4NQDD 3KMDA 2KKQA 1CFMA 1I4FB 1QTYT 2C9VA 1AZZC 2G5BB 4F8PA 1BD2E 1GPOH 2RFXB 2GUYA 4FABH 3VFWA 1T04B 4JFTA 4TRPH 4MWFA 3BHBA 4UILL 2VZUA 3TN0B 3EBHA 4A2HA 2ITFA 3ZZSA 4LRNL 5C0DB 3FCTA 3FH7A 4JY6B 1VHPA 2H5UA 4FS0A 1NCNA 1OM9A 1R3JB 2ICWB 1UXMA 5CLWA 4TLKA 3JTTA 5L9DH 1OGTB 1QSEA 2WVVA 3CHXA 3RPKA 4OLYH 2WGXA 1YC7A 4XPAH 4CJ0A 3O2VH 4JCWA 3HC4H 2Q86A 3MJ6A 4NS0A 4OQ1A 4D7PA 1OP3K 4LK4A 1M7IA 4KZCA 3S36L 5HI5C 3ALPA 2HKFL 4GUCA 1ADWA 4WUKH 4FFVD 2APFA 1WF5A 2VZTA 2AK4B 3PUUA 2Z92A 4LVNC 2PUQT 3KR3L 4NQEE 1RPKA 4R2GB 2YWZA 2XWXA 1BEYL 1Z66A 4NP4L 3J7HA 4CKVX 3RIKA 5ESAA 3UTZA 35C8L 1RCYA 4MKMA 4HUVA 4K7PH 1LWJA 3T4AC 3V0HA 1ZLVH 4AVKA 5K1NA 3UDWA 3FO0L 4L05A 2B9AA 3MFFB 4ICWA 1GGBL 3HZVA 1Q38A 4U7MA 4WGVB 4N6QA 5T5NF 4K8RH 3WJLA 3ZGIA 4PLJD 4LOFA 4WEEA 1ETA1 1IM9D 1Z0MA 2X41A 4JFDD 4G3YL 3UABA 3RFZC 1JPGA 4PIRF 1DBJL 3KGUA 1B9ZA 5IHZA 5F97E 1Q0YL 3KCPA 1S5HB 4YHYC 3QZWB 2P5WD 4MXVF 3BSHA 1JZDC 4AUUA 5E8DH 4Z9KB 3FHAA 5IQ9A 5DEZA 3PJLA 1TPXC 3RVTD 3H9SE 1OZUA 3HFFA 1UVQA 4OV5A 3NJHA 4DGIH 2GBAA 1IM3B 2QLVB 1T21A 2E4FA 3C5ZB 4GKNB 4OZFG 5KW9L 1F11A 5GIRA 3DX6A 1I9IH 2VN3A 4UYPA 4G6AD 4X5QA 3B5GA 3JBG7 3OL2A 4EJ1C 5PAZA 3GM8A 3QORD 3MRIA 1MCEA 2DS4A 1E28A 5IBTH 2R83A 1EQWA 4AMKL 1QR4A 4PJXF 1GRWA 3BP7B 4P99A 4Z8FL 3MKGA 3GO1L 4JGUA 1RIUL 1WHOA 2WNKA 25C8L 3RWGA 4R26L 4KRMB 5D7JC 2EKJA 4OZHB 1CQYA 1FZOB 3V4LA 4DO4A 4NC0B 3WL9A 3LYRA 1KTLA 4UV4L 3BE1H 3KPPB 5E6UB 3WS6C 1KGWA 2BZDA 5DJCA 5IQ7H 1OSEA 2ZCZA 4UTBA 4KQ4H 3JUYA 3VB9A 2WIIB 3QNZB 4LLWB 4UQ2B 2ZOTA 3TJHC 4NGHL 4HUXA 5B7EA 3DRTA 1U2HA 3NDYE 1OOAA 4A7QA 4Y4FB 2P47B 2WLJA 3L4CA 2V8MA 2XTSA 5JHDE 2R29L 2ZOLA 2LTQB 5AZUA 4F7MA 4UTBH 2ZD0A 4ABUA 5CU9A 3GLDA 4F20A 3I3EA 4YFDB 3D3VA 5AZ2H 1B2WH 3OKEB 2HX9A 2WTPA 2MRYA 1NKRA 4PU2A 3VD9A 4PD4J 3QK0A 3ROOA 3N50A 3NPSC 4PJDF 4RX4D 3NSFA 4I3SL 2D7TL 5D1XC 3VQ2C 4NRYA 1YPZE 3CFKA 3RWDA 2Q87A 2PYED 5EZOL 3PRZA 2BDNL 1YN7A 2IQAB 2IDQA 3EJYC 5E6IB 3X1NA 2YXFA 1BX2B 3MOBH 4XOBA 3BFQG 5CEZE 5K69A 4YSSA 4M9PA 3STLB 1HHGA 3UBXG 3PGCB 5FO7A 4JLRB 3H55A 2VRQA 2WTRB 2IAMA 1CLVA 3LPOA 3EG9A 2ZWLT 2XV3A 5I6XC 2JJWA 2WQVA 1T0OA 2WINB 2HX8A 3DHMA 2EACA 4PRIA 1UQSB 1DQLL 2NLJA 1USQA 3Q6FB 3DSNA 4KBPA 1WJ3A 3OF6D 5F89A 1ICTA 4HGMA 4LL4A 2Q3ZA 3KS0H 1A7BA 1OM3L 1DANU 1UM5H 5BRZA 4P2AA 3LV3B 3WNJA 3NRPA 1C12A 1X5GA 4M29A 4LKXA 3FTGB 3GBDA 1PKQB 2ZJSL 3LPWA 2WYIA 4Z7NE 1AACA 4PRAB 1PEZA 5DFWH 2J8UB 3IXAA 1PAMA 2ZXDA 5FKAB 5HDOA 3UTSA 3LSOA 4XNMA 4XBEH 1BYPA 1F6AB 1ODUA 2WP3O 4U0RC 1KCSL 3JV5A 2AJXL 2HVJB 5J1AA 1I1AA 1NC2A 4YXLL 1T20A 3KPOB 2VXTH 4FCAA 2DLTA 1OTUC 3WUWG 2GJZB 3ABZA 5IOPA 4KV5E 1DBAH 1H0DB 1QFWM 1E9PA 4PHZA 4WI0B 2OMZA 3P9LA 4Y89A 2V2WA 4AH2B 5DUPH 4LEXL 3RUGB 3MNZB 3G04B 3RTQB 2Q8AH 4JFFD 4YFEA 2CKBB 3WY3A 1CF1A 4HJUA 4K73A 1N7MH 4OUUA 1P5UB 1QAWA 4QRPE 4JGJA 1BJ1J 5SWZA 5F96H 3KPRE 4WFGE 4ZJ9A 5ACLA 5DYOA 2BVQB 1J5OL 4MRBA 4WTZG 2APTA 5C3LD 4UT9A 5SX4I 4DZBB 4HCGA 1BWMA 1T5WB 2Y0SA 1OAUL 4P5MA 3T0EA 4IIQA 3AFLA 5DVPA 2K4AA 2EIJB 1T5XB 1YY9D 3FUHA 4MAZA 3U0TB 2YZ1A 1QBLL 2HPOA 4MFHA 1NDTA 3LH8A 4G9FD 2D9CA 1G9EA 5CEXB 1HYRC 4KI5E 3DURB 3BVVA 1TZHB 3P4OB 3X12B 3NP3A 5DHDA 4K0OA 3ARRA 4ORZC 1MG3C 4QXGH 1TJHH 1XMWA 1BAFL 4UT9H 5KSAC 3GI8L 4FJYA 4WI3A 4M93C 3SQRA 5BUAA 2Y7MA 1FFPA 3TN0D 4AUYA 1NBVL 4DIXA 4M8QA 3E9TA 4WEBL 4H20H 5DURD 1FG2B 3NFPA 3OB0H 1FFOA 4KV5F 5B1BB 1KB3A 4CVUA 4ELMB 4XB7A 1DL7L 2AQTA 3SBRA 1TTUA 4U05A 1NWOA 3ZQ9A 2NUPB 2GJ6A 2V5YA 3VXRD 1NGYA 4MD4A 3T6VA 2FAUA 5JOPD 1EDYA 5B38B 1KGIA 1XF5A 4R4FH 3QAZB 1EDHA 1QI3A 3GXMA 1GGCL 4G9DB 2YBGA 4NJAL 4B9CA 5C6WH 3WY4A 2J57A 4EN3A 3PCYA 3WE6A 2BS8A 3AVEA 3BDYL 3I6SA 4R84A 4IOFD 1AI1L 3NJVA 5I1EH 1AGCA 4XMWA 5HHPA 3IGLA 3QEQA 2F68X 2ZZUT 1XHHA 3P3UA 4OM1H 1FN4A 3RL2A 5JXAL 4Y2DD 3P2TA 4Y5XC 3D87B 1K4DA 4DF9A 5IVXA 5IFAL 5L2KA 1A3RH 5ESAB 4YDJA 3H4FA 1E7VA 3BEWA 4G7VL 1S2EA 2C9RA 2X0WA 4ANUA 1BGXH 3DYOA 1ZHKB 1MCWW 4LCIL 4RFEA 4WHDA 4ZTPL 3MNDA 3HB3D 5EMYA 1NDGA 5DMKA 5C0CA 4FQLL 3KZ8A 4GUOA 5B22A 5K9OA 2O26U 4GRLA 3HHMA 1T22A 1HINL 4UM9D 1UA7A 3ESOA 4WKZB 5EUOA 4XRCA 2BIQA 1CL7I 4NFDA 4RESB 3NIGB 4OQTL 1PLCA 2YXMA 5KVGL 1SUJA 1RJLA 1CU4H 1KPRB 1RKRA 1M05B 4LCWE 4WEMB 1ZGLM 3N91A 4LCYB 4E9VA 4ONGH 3KCPB 2OCFD 2GSIA 4QXUL 4I2XA 3HG0A 4HBCL 4MQTB 2HRPH 1A6ZA 5D7IE 3VFTA 2I25N 4KPHL 2ITCA 4EUPA 3O8XB 1JP5A 1EEUA 2LGNA 1HWWA 3T08A 1FNEA 3HN3A 3PHAA 2P24A 5DJAB 5BO1H 5DRXA 4ZNEA 3KYMA 2VUKA 4MNQE 4KKRA 4H8UA 4RFNB 3DPDA 4PJ8D 1KBKA 1S9VB 3HI5L 3VTAA 3UYRH 5LXVA 4M02A 3PGFL 4Z7QB 2FSEA 5HI3D 1IQWL 1EDQA 4JRYB 4YL4A 4EUPH 4HKXB 4MJIB 3OAUH 2WY3B 2F54E 3D0AA 1G84A 2QQKL 2VN6A 3L3OA 4K7FA 3O6ML 1Q1PA 2DI8A 5F7LB 1T0MA 4QF1B 1OQOA 5SWSE 3T6WA 2EDWA 5TQ2H 4W9KC 2X4QA 4OB5L 2O5XH 2OMYA 1BHGA 3FSOA 1MAMH 5DGRA 4F37F 2NXYC 1X7QA 3VG0H 2ZYSA 4AEHL 4J23A 5KBLA 5E5RB 4NC1C 2XQYG 2WLHA 5GXBB 3S34L 3S8WA 4HUXB 4L29A 4GW1A 3SKOB 2DJ4A 2D7PA 3ETBF 5GZOD 1U4EA 2XBTA 3MRFA 2QFPA 1VZHA 1DZ0A 1MI5B 1PAZA 3O81A 2XTJD 4XNUH 1WPCA 4P4KA 4Z76B 4EOWH 3GFUA 5KVMC 1YC8A 3V0IA 1CGSL 1S8DB 1JFQH 1WFMA 4J3OH 4DETA 4DPCX 1ZHLA 3UJJL 3FHEA 3ROOB 4K3DH 3NZSA 5CXPA 1RUPL 1HXYA 4Y4KB 2G9KA 2GPZA 3C6LA 4HIHA 1MCOL 3BSGA 1YJDH 2XN9A 4NRYB 1UZ8B 1VJSA 2WJ7A 2WLZA 2XX0A 1E50A 4URTB 1QFWI 3WLWC 3F6LA 4ZX3A 2DH2A 1T7XA 4IIZA 1T7VA 5LG6A 4S1QL 3EDJA 4KDWA 5KOMC 1JGUH 2HUEA 2X6AA 2GSGB 2LU4A 1XX9C 2CJSA 3QUZC 4PBVC 4UQ3A 2PNDA 4IJ3B 1GA2A 3OKNB 5G4OA 3G5YA 3KWVA 3MV9E 4HK0A 2HP4A 1HWHB 2CSPA 3GLAA 3JWNH 4X9FA 5I1DA 2ZYHA 1KT2B 4JAMB 4XCCH 4ZX5A 2VXSH 3S37X 4PJ9C 4BSWB 5BRZB 2A6IA 1HI6A 4H88H 3AG4B 1U8QB 4QO1B 3IFPB 4L8SB 4E68A 4LKXB 2NDFA 4LF3B 2CXGA 3MFGB 2JIXB 3RWHA 3L3IA 4FQPA 3TP4A 2Y1ZA 1AG6A 1LQBC 2ZUXA 4AXWB 1JRHL 1FI8C 1Y07A 4FFTA 5EU7C 2K1MA 1ECYA 1WWWX 5J1AB 2GK0A 4FTDA 2IXQA 1KACB 3U79A 3AM8A 2GVYA 3HAEG 3H53A 3RTQD 1JZFA 4WZ9A 3C75A 4JPVH 4A6YA 4BHUA 1E9PB 4N24A 3F8UB 3S3CB 3LKRB 4JFED 2F8VA 2ZOOA 3OZ9H 4Q4EA 5GJSL 5IW3A 1O9WA 3U6XS 1UT9A 5HHOE 1DUYB 4JFHE 2ZKHL 1NGWB 2MKWA 4OM0L 2NZ9D 3MRBA 4G5ZL 1UXSB 4HUUA 4JRXD 3T4AA 5IB4B 1FL6A 4EIBA 3UGUA 5A2FA 2PPCA 1CUOA 1I1RA 2ITDB 2ORBH 3RNKB 4A6YH 5L88L 1U8LB 4M5SA 2K0RA 2F19L 3ZE0E 2YD3A 2BJML 4JE4B 4FYSA 3B9KB 2E74C 2Y2WA 4GY4A 4YSDA 4X6CF 4WSGA 1R5VA 4P5MB 4HZ1A 3TIDB 2VLME 4JW3A 4FMVA 1RV6X 3VTMA 4XN1A 1V7MH 3D6GA 2DKUA 1LP9B 3L3JA 2DPKA 2Z8VC 4WY7L 1L9MA 4JR9L 3WJJC 2H7WA 3HJ0A 5F9OH 3TL5A 4P2RA 1XDTT 3RGVB 5BS0A 1FFPB 3X1EA 3WY2A 1B0IA 3DETC 3BSZA 3F7LA 5F1NB 2AEQL 3UO8B 5L7XL 2Q7YA 3GXIA 3L3DA 2XWDA 1B3IA 4PV8B 3CFEB 3OAYH 4JZNB 2BSDA 4PRNA 2I07A 3IGAA 4K5PA 2V2TB 1QSED 2P8PA 4LLAA 3WFZA 5D7LB 2V9TA 3BSZH 5IT2L 5D7JA 4LU5L 4FMKA 4XTRD 2ADJB 5TE6H 5FPIA 5EF3A 3KEDA 2Z4QB 5GRYA 4DP9X 1TU2B 1FNLA 1ESOA 4X4ME 3HHRB 5EWIH 3W1ZA 1KTBA 4G80A 4PJBB 2V5MA 3OSKA 3WS6A 3GXDA 1KG0A 3IJHB 4KROC 3VWJB 1NMCB 4EN3B 1R9FA 1OCOB 4R4NC 3FUEA 4MLIA 4QTIH 2R0LH 1A6VL 1J05A 1U8OA 5IMKA 1E42A 5F7AA 1EPFA 1KGJA 1W0YT 3ARSA 2BWQA 1ZWIB 1A14L 4C59B 1AGCB 3QZLA 4N5UA 5HHPB 5DFAA 5DRZA 3Q3GB 1FN4B 1YYLL 2FB4H 5HHME 3TFKC 3ZW3A 5LN4A 1S9YA 3N43F 1K4DB 1JTPA 3R0NA 1RAMA 5D1ZC 3P11H 3ARDC 1EK3A 4Z7OF 2Y7NA 3RPBA 1BZQK 2BOCB 4YDJB 5B4MD 4UBDD 3I3BA 4JGNA 1U95B 3GF8A 2C8NA 2HVBA 1MSPA 3PGDA 2YAHA 5ANHA 1O7DE 5D1XA 2NY2D 5DJYB 5HYQA 1A9EB 3QG7L 1RZKC 2DDQH 3M45A 5C0CB 1HILB 5K9OB 1XB8A 5C70A 2L7UA 4XZUA 1IBGH 1P4BH 4JFPB 4AV0A 2ZKXA 4YH6A 4Y9BA 2PP7A 2TRHA 3OGOE 4IBYA 2ZWNA 2OXGA 2LQRA 3CVIL 1ASOA 1S7VB 4ZQKB 2F53A 2DY2A 1WICA 2NQDA 4P59H 1URZA 3GM0A 4FFYA 4UTAL 1UH4A 3NCEB 5D96B 1BECA 1HESA 4P5KA 4YX2L 1K8IA 2CMRH 4JFOA 3QG6B 5GGVH 3U4KA 1G6VK 4FQQA 5C0BB 1TCRA 1KBGH 1GYAA 2LVEA 1CDHA 5GGUB 3VRIA 1BM7A 4DEPC 4YNYA 2W0LA 4FFYH 2DQDH 4JDTL 4KJWD 4ZTOH 1KDIA 1N3NB 4JY4B 1MCRA 3O3BB 5C08B 3H9ZA 3AROA 3GMNB 4X98A 1GS6X 5B8CC 4Q97A 1NCGA 1CVSC 4BH8A 1ROWA 1NFDA 2JQMA 3QULB 3L3OB 3V4PA 3QPKA 4K7FB 5F8RC 1DQJB 1T0MB 5D5MB 1IV8A 1ED3B 1MHEB 2GAZA 3MXVL 4N2LA 1UD2A 2E27L 2WWNA 1DSWA 4BSVB 2OMYB 4HJSA 4NO5A 5BV7B 2B39A 5BOPA 1HHHB 1HHJA 5L8LB 1ZA3B 4JDEA 5FHBL 4R7DA 4HETA 3H3BC 3V4PH 4LP4A 1R47A 1ORSB 3LEYL 1N5YH 4O02B 3EYSH 4U3CA 2WZAA 4GW1B 3T0XA 3UJTL 1JAEA 4LPYA 3W9EB 4DP6X 5DC9B 5AW7B 5I1LB 3GJEA 2CRIA 4ZO7A 5JW3H 2YGNA 3D3VD 3J2PA 3CXHK 1SYSA 4MVBD 3T4YB 3K2UL 2G4GA 3KDPB 1L0QA 5EIIA 2HTLC 4ZMQA 1I9EA 5ITBL 3VFRA 1IZKA 1NGXA 1L6XA 5E00B 2DIEA 5AD0A 1AP2B 4ZO6A 3ILQC 1WFIA 1D6VL 1R1CA 4PJEB 2XN9B 3OLDA 5F9WC 3QDJE 1PS3A 3B5TA 3U2JA 2KZBA 1XQ4A 2WSPA 2IAMD 4LFHG 4BCXA 3B7SA 3HJEA 3N06B 3ARXA 3G6JA 4B27A 1MKFA 2BM3A 3N3EA 4JVUA 4QJ3B 4QYOB 4TQHA 1F3RB 5FUZL 2H0EA 2O4EA 4FZEL 4PRID 5DD0L 1PZAA 3P77A 4AV4A 4AITA 5KSAA 4UOQA 3PWLB 4H8PA 4NO3A 3TA4D 5A3IC 4N87A 1MIMH 5BRZD 2HMID 4P06A 4LSVH 4HK0B 4D0CA 4Z1PA 4FQXC 1H8NA 3L95A 1N6UA 5E9DA 5JW4Q 2A73A 2GW5A 3FUDA 5TGBA 4P2QA 3HS9A 4L0PB 5EPMA 4ATTA 3QISA 4ODBD 3UTSD 3FTZA 4I7ZC 2MKLC 2ATAA 4UYQA 4U1HA 1YZZA 3CLFL 2CE6A 2Q6WA 2WWKT 4NBZB 2IO5A 2EXWD 5AVQB 5C6TL 4Z95L 1I1AD 1NC2D 2UY6A 4M1CC 5HSFA 4YHNA 1EERB 5MHSE 2DMKA 1JF1B 3IPBA 5LVEA 2EVGA 2IG2H 5GGRY 4MMZB 2F5AH 2QDWA 1NAKH 5F7DA 3AWEA 1J8HB 4LIQE 4ZW7A 3FO2A 1J0IA 1EEQA 3KPSE 1I31A 1QPKA 3S37H 2FR4B 3A4EA 1YEDB 4EI0A 3RIFF 3BKJH 4UMSA 5A16B 4B9PA 3Q1SH 1VFOA 3Q5OA 3RA7L 4EDWL 2ZP9A 1BQUA 3OPZH 4ZFGH 3TYGH 2JELH 2WXQA 3P0GB 1RFDH 4A6YB 1CI5A 4Y5XA 1CFVH 5AAWC 3HKFA 4KKCD 5L6YL 1T2XA 2A74B 3G5XA 5KYNA 3DTUB 3BLPX 4BXVA 4ETQB 2A6KA 5SWZD 3GSNB 3GT6A 4PGJA 3S35L 1Y0LA 1ZT1A 5DZ9A 1FL6B 1MEXL 4WUUA 4U7SA 1OAZH 4KK8D 3T0ED 4MLSA 5FO9A 4AIEA 4KUCD 4POZD 4WDIB 4I18B 4KXDA 1RI8A 4AYMC 5LDSA 4RIRA 3NESA 4FXKC 5TE4L 1J0YA 3PS6A 4FYRA 5ANME 4NIYE 4NWUH 3VI4A 1C16A 5GJTL 3L13A 4HIEB 2ZAIA 5D2LB 5MEQA 1XB3A 5EORH 2H1XA 5I5JA 1KXVC 3H8NA 1PIGA 3HG5A 1P9MC 2WWMD 2FK9A 5CJQH 2E46A 3L3JB 4XP1L 3HCVA 3Q48A 1SJHA 2F7RA 3F5WA 2XN1A 1CDYA 1RK1A 4TMPA 2CNYA 3KDMA 4P2RB 4WO4C 3ESPA 1B4TA 2XIDA 4E5XA 2EVIA 4QHMB 2GJ6D 3ZRCC 1J8KA 4IEFA 3OWRA 4Q9BA 4LLVA 4YDKL 2X4PA 3VXTB 1RUAH 3IPEA 4MSWA 2EDBA 4OGXL 2V17L 5KBMA 2I07B 4GJTB 1BQHB 4KDTC 2P8PB 5ICXA 3V9FA 2OBGA 4PRPE 3S3SA 4WWKB 2J6EA 3IDJB 4BE5A 3OKOB 4X4YA 3RWFA 3VD1A 3VH8B 5A6IA 1PG7X 2VDPB 4JKKA 2FYYA 2B2XH 2TAAA 2BNRB 2CCVA 3GIVB 4JO1L 1K4CA 5I66A 1KG0B 3ILDA 2EDOA 5TE7L 3QEQD 1PLBA 3MRHA 5DZAA 1AGEA 1J05B 3FTVA 1QP1A 1U3HB 1UGNA 4TL4A 3N42B 2J6EH 3HPLB 1F58L 1IB5A 1OF2A 5L2KD 3LN9A 4TUKH 5I6NA 1QSVA 4PMEA 1L7TL 3ULUL 5EBWB 2A9NL 2N3JA 4BFJA 2ZSVB 4XHJC 4LMQE 5CILH 5DHYB 5GRWA 1BBJB 4Y5YC 2NY4D 1WWAX 3GSRA 4D0BB 4R6UA 5IHHA 2ED7A 4HEPG 1IQDB 5ERWA 4ONFL 5C0CD 1CD1A 2Y5TB 1IGFL 2ZG2A 4A2FA 1FYTA 4GRLD 4OGYH 5AKVA 2CJUH 2WAQA 1T4KB 3JV4B 4DERA 3FCUB 1U8HB 4YHZL 1QHPA 2P4AB 1OANA 3FN0L 4M7LH 1EEZB 2ZP8A 5CJOH 5D1XB 4X83A 3DIDA 5J6GB 3HNTH 5DJZB 5TH2B 4XNQB 1H15A 3R4DA 3BIKA 4JG5A 1TYEB 5CBAB 3TT1H 1LE9A 3H56A 2C7UB 2KZ1B 4E2OA 1U8JA 1FFRA 4P3CL 1IC0A 5TK4A 4RGNE 4E9LA 2FX7H 3IDMB 2C1PB 3QUZA 4MMYA 1A7RH 4P5KB 3TVMD 2VLKA 2XN2A 1U58A 5AWNH 1K8IB 2X87A 4Q0XL 4N5EC 1D6EA 4Q58C 1FVEB 4XBGA 2X2JA 3UROR 4Z7VB 3KM2A 1L3NA 1G7PB 4U1NB 1M3JA 2WLIA 2MCAA 1KZQA 1CWVA 4HPOH 4BV1A 1INDL 1AQKL 2GJRA 4FQ2L 2VLLA 3LQZA 2CA4A 3FQTB 1W91A 1NBZA 4JG0L 1SDYA 1J1OL 2CRZA 3CIAA 1N4XH 4BGLA 3N85H 4DGYH 3P69A 4OLEA 2HRGA 4HUMB 4OT1H 2XA3A 4AX3A 4CVWA 4OLZL 1QFUH 3A22A 3UZVA 5I1JL 2XTLA 4F58L 4J1UA 3BUBA 4CDHA 1LXMA 5TDPB 4J3OD 4PRHB 2ICEB 2RQEA 1XD1A 5AW4B 1MCPH 2Z8RA 1E9QA 2Y69B 3L8QA 2VR3A 3BVNB 1FGVL 5E1AA 4BYHA 1ES0A 3BWUF 4BWWA 3D0VA 1AFVH 4P4KD 1KB5L 1INQA 2FD6H 3MCLL 5T3XH 2X88A 5E23A 3TGXA 2BOBA 1FL5B 4FYTA 4HDIA 7TAAA 3GJEB 2P5EE 2EICA 4TULL 3V0JA 2VDMB 2Z7WA 4JO3H 2YARA 2LVCA 4RMWA 1QLFA 5DXWA 3VGAB 1VCBC 3C6LD 4FRWA 1Z9MA 1NIBA 4E9SA 1G5GA 3HMXL 4GLRI 4HH8A 3EW3B 3I6KA 1S7QB 3G6AB 3KPNA 4TXVB 3NAAL 2IBZX 1OLZA 1QG3A 4I0CC 4YR6A 3SPVB 1IGYB 4W9HC 4Y7OC 5D6CB 5EDXA 3PV6B 1BXAA 1KY7A 1WAEA 3T8VA 4U1IA 1YEGH 5JNYB 2G2NA 5TTRA 1G87A 4NUGH 3VSTA 4WU5B 3ES6B 1S6NA 3V7AG 2VT0A 4GP4B 4JBSA 4NKMA 4RZKA 1NEUA 3QDMA 4XBMA 1G7IB 4YUEL 3WJJA 3ZXAC 4AQ1B 4YHLL 2LABA 3V0WL 2PF6A 2BCMA 5F3FA 1RZQA 4TSBL 1E4XH 5DDHA 4ZS7H 1DR9A 4DW2L 1T2QL 4ZQTA 4LHUA 1OSYA 2X4TA 3TO2B 2VZ1A 4ZSOE 1A6PA 1U8CA 2FH6A 2A73B 4TVUA 4UB0H 1KJ2A 2FEEI 5E1HB 2BRQA 3MMEA 1GGTA 3MRJB 2EH8L 1G6RA 2EXYC 4FNSA 4JO2H 5CJ5A 2FLBT 3FBKA 3QJXA 1KV3A 2YS4A 3BC9A 1M56B 1KJMB 2PO6C 3FO1A 4U1HB 3T65A 5DQJB 5FB8B 2HTKC 2CR0A 1MF2L 4Y7MA 1AIFB 1V3MA 3IDNB 2UY6B 1FL3B 3QC6X 5HI5D 3FU7A 2QZQA 3FUKA 1KJ2H 1KCUH 3NSXA 3QS3A 3OD3A 2ZT9C 3EO1A 1L9RA 5DD1H 2EYRA 1G6RH 2AJYL 1GJUA 1UUNA 5DD6B 4P2OC 4PP2A 5INDB 1Z3GH 3FO2B 5L4JA 1AZCA 3NJXA 1AYOA 5FLVA 2GITB 4HZAA 3BZ5A 4PGCB 5JIKA 4XPFL 2GIXA 4LAQH 5GGQH 3T2PA 4PR5A 3PPSA 1CFQB 4AJWA 2NXZB 3FRPA 2DYPD 2EYTA 5I18L 4BUQA 3ARDA 3CFJA 2HN7B 4N8VG 2GT9A 3T6QC 2E7LC 4HHAB 5JDSA 1PQZA 1O7SA 4HWEH 2D9QB 3AABA 4OF6A 1ZLVK 3WNLA 3CSGA 5IJKA 2C3VA 2FO4B 2ZYRA 3BFOA 1BG9A 3HZMB 3GS4A 3HE7C 3SKMA 3CPUA 3NFNB 4NQCB 3HVDA 1TQCB 3X17A 3AW5A 5CMAB 3TH4T 2EZ0C 4JDZA 3VG9B 5HYFA 2K8QA 2ICWI 4JM4H 3Q8FA 2DQGL 3VW3H 3PHQA 2J3SA 1MWAA 3IFNH 1NSNL 3NIFB 3WV0A 4DKFL 5DZNA 4ICXA 4OCSL 3KAAA 4W9JC 1YY8A 1XF1A 5BS0D 1RZKH 1FAKT 4NQVA 2GYSA 2K7QA 1ADQA 2R2HA 3IB4A 5I6PA 2JI3A 1TVHA 1K9TA 5I6KA 3F5WB 4JX0A 4MD0A 5EA0H 3KDMB 3FPYA 4GRMA 2DLGA 2Y24A 4N3TA 5FYJL 1ACXA 2H3KA 3W56A 2DEWX 4BKLB 1RZGB 2WPGA 3BQUC 2ADFH 2WHVA 2XPZA 3MLRL 3WSQL 3RDTC 3NIDE 4WTQA 1ADQH 2APWA 2X6MA 1BXUA 2YK1H 4L9DA 5D7JD 5B8CA 3NJNA 2YD4A 2AERT 3CFQA 4YPGA 4M48L 2KH2B 3GSUB 1VB9A 3EFDH 3V7AE 4LPUA 1MCLA 3NFSL 4OZGA 4ZUWA 3UAEA 1UWXK 1WITA 2E59A 2QADC 3NCWA 4X4YB 4PJIB 1DJSA 3PNRB 5JUEH 1E9OB 4HHGA 3BX7C 3TJHD 2VQ1B 4IMLA 4LVEA 3CZEA 4NNYB 5FA4A 5I66B 2Y4SA 3GMMA 5EBGA 3BKYH 2O5ZL 4GW4B 1LO3L 5D70H 1JHKH 1MY5A 1N2RB 1OF2B 1QNZH 1JZ5A 3X3GH 3U7AA 2CA3A 3KWUA 4N0YH 4X9BA 3ORJA 1IKFL 1E6JH 1K3IA 3DJZA 5C0JB 5J57B 1R17A 2QHRH 3MAWA 5I73C 3QA3A 2IQ9L 3GSRB 1JNLH 5IJVA 3MJ7B 3RHWK 2EE6A 2K6ZA 4U1SB 5D1XD 4IRZA 3MV7A 1AXSA 5KUKA 1IRAY 2G0KA 2X2UA 1K2DA 4EQ3A 3FT3A 1MXDA 3T0WA 5FIEA 4DEWA 1RZ8A 3EJYD 3MV11 1E8WA 1MFBL 1U9KA 3NIDF 1BPLB 2F53D 3WEMA 5D71H 4JZJA 2VITA 2HYMA 3IPFA 1VDGA 2CK2A 3NEOA 4IRZH 4JUSA 3SGDI 4OLWH 5KS9E 5HVHB 4FNLL 4W9EC 4N2FA 1EBPA 2GFBA 3DX8B 1ZVYA 2X70A 4N2EA 1CLYL 3ZKNC 4EPSA 4JHAH 1RSYA 5KG9A 4X99B 3BVWA 2P44B 1M1XA 3MUGB 3L9EA 1L9PA 2RCSL 1TITA 4DP5X 1DJYA 5F9JB 5EDSA 2WD0A 4LAJH 3VI3E 3WBDA 3HZKA 4MAUL 5HP5A 2EQDA 2ZCKH 4FQXA 4G71B 1HXMA 2FATH 3VXMB 4G11A 4FL4B 4N90D 2WXLA 1VGKB 5FYLE 1THCA 4Z7AA 4JPIA 5ABDE 2VLLB 3LQZB 5DU7A 3TO4B 2YJQA 1OTSC 4BQ8A 3KGSA 4HA1A 1AGFA 3A0OA 3KYNA 5C0RH 1SEQH 1Z6JT 3QCUL 4TUOA 1IBYA 2K45A 5GGTL 2QDVA 3OLGA 1W0VB 2F1EA 2O5YL 3HBZA 3BRDA 2VDQB 4WW2B 3B2VH 4UU9B 3UZVB 1OTUD 3LPFA 4Z0XA 3PUCA 2FQFA 5CUSH 5D7HA 2EVFA 4V33A 3QCVL 2C5DC 5A6LA 5EC1A 4HT1H 4XAWH 3MLTA 1SXNA 4WTWA 3N1QC 3MLXH 2XNAA 5E1AB 1WFJA 4C8XA 3D0VB 1EIBA 3JV6B 3WXWH 3T04D 5GRUH 1F45A 3RWEB 3LZFL 2Q76A 5AAWA 1OP4A 1MDTA 5C07B 3QQ3A 1I7ZB 4HDIB 4ODWA 4RMSA 4RMBA 4XPGH 3HTLX 2B4CL 3PIQB 1CLCA 2X9ZA 2F58L 5E9AA 3RVVC 4KJPC 5BPPA 4I1RA 1UZGA 4AVHA 1QLFB 3BAJA 4PJCE 1NCIA 1IE4A 1FP5A 4N6RA 2IANA 3VI3F 3F58L 1D3CA 3KPNB 4YL9A 3HZYA 4AQAA 3VFPA 4F2ME 5IFHL 3US1A 2QV4A 4FXKA 3F00A 3BT2L 1WD8A 4NNXB 1RP8A 3ZLQC 5GS2H 5ISZB 1IT9L 1IAIM 1KFAH 2Q5BA 1FE8H 1JMXA 4X80L 2Y23A 3O41A 3STZA 5J8OA 4OCRL 5CM1A 4I5BA 4OFKA 4MA1C 3ZTDC 1K8DA 2NYKA 4A2MA 1LWRA 1QUNA 5KSAD 3S5LA 3EYQC 3DUUA 2H6OA 3PXHA 4PS4H 1KXVA 4GRWF 1PFOA 1P9MA 4S1SH 1UYWL 3WIHA 3THML 3V0EA 3B7UX 4WO4A 5E56A 5E9DD 3MRNB 4L8CA 2EILB 5DDHB 5EUKB 3TCLA 4JRWA 1W8NA 4P2QD 1WO2A 2EDFA 3Q6GL 3MBWA 2B0SH 3OB0K 4MASA 4KXCA 3SYOA 1KCWA 3VGGA 4G6MH 5IK3A 4JN1L 5D7SL 4WFHD 4CMMA 5D72H 2OSYA 3WIHH 3L4UA 2KT6A 4KDTA 2W0PA 2Y5EA 4L3EE 3QFJB 3B1UA 5HDBB 1YEHH 1VIWA 1IGML 4OLVL 1HCYA 1BD2A 1FJ1A 4RISH 2NY7L 2IADB 3NN8A 4U3SA 1J88A 5AL0A 1J9QA 3W11C 4Z78B 2BP0A 4AGOA 3MKKA 4QXWA 3FU7B 1P4IL 4DN3H 2X5PA 3FMGL 1OL0A 5ABAA 4OV6F 3P4MA 4CVXA 3QO0B 4PP2B 3DECA 3NGBC 1NCJA 4WWNA 4XX1E 1OP5H 3ZKQD 2OMUA 2FE0A 2R7EA 1X44A 2FBJL 4WLCA 3TBTB 4BA8A 2FWUA 3V5DA 3ZKMC 4PR5B 1XR8B 1SLUA 4WUUD 3FRPB 1DQML 4Y5YA 4Q6IB 5J9PA 2FX9L 1EFXA 1T03H 2CDEB 2X1QA 3ARDB 3JWDC 4QRBA 1R24A 3RU8H 2HSIA 3L3HA 4JHVA 4NQEA 1JF5A 2QR0A 2R4SH 3IFOB 3BUIA 3KVQA 3OR7B 5EOQL 1LDSA 1WCQA 2IH3A 5AOMA 4A39A 3Q8EA 1WIOA 1YNKL 3SDCC 2VXQA 4FKKA 2R2BA 2QSCL 4H1LG 1DVSA 4CVZB 3FONA 4NCDA 1SY6L 3EH5B 2R59A 3MJ9A 2YEQA 1I1CA 4AENB 4HV8A 3WDIA 1FHNA 3VWKC 3TJEL 4B6ZA 1LHZA 4M7KL 2XQBL 4P46B 4AZUA 5K9KB 5C09B 3QWOB 1O9ZA 4X8XA 3T5WA 2CLVA 5JHLL 1GYVA 1VESA 5C0AE