2MCMA

Macromomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
112
structure length
112
Chain Sequence
APGVTVTPATGLSNGQTVTVSATGLTPGTVYHVGQCAVVEPGVIGCDATTSTDVTADAAGKITAQLKVHSSFQAVVGADGTPWGTVNCKVVSCSAGLGSDSGEGAAQAITFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of auromomycin apoprotein (macromomycin) shows importance of protein side chains to chromophore binding selectivity.
pubmed doi rcsb
source organism Streptomyces macromomyceticus
molecule tags Apoprotein
molecule keywords MACROMOMYCIN
total genus 20
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1991-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 2mcmA00
4JW3A 1J5IA 1J48A 1NCOA 1AKPA 2CBTA 2CBQA 1O5PA 1J5HA 2G0KA 1HZLA 2G0LA 1ACXA 1HZKA 2MCMA 2CBMA 1NOAA 2CBOA
chains in the Genus database with same CATH superfamily
5DRWB 1A7QH 1HXMB 4OLYL 1OL0A 3AXLA 5C0BA 4AIXA 1E5UI 3M17A 3I6KA 4C83B 5TDNA 4HFUL 3ME0A 5E5LA 5KYXB 3GXUB 4I1NB 3ARFC 3VH8A 1S7RB 4JPKH 3FFCE 5I6PA 3G5XA 4HCRL 4YHPB 5GGTL 1J5HA 3L3DB 1TQCB 5FWRA 1TTAA 3H85A 4YFLI 2X4OB 3FCTA 1S78D 1Z32X 3EJCA 3ISRA 4W70A 5ISZE 4PWGA 4MS8C 3RWDA 4ZFZB 4KBPA 1OLZA 2IPKA 2WKLA 3MRGA 1WF5A 1MFNA 3WY4A 4NC2B 4NP4H 3BAXA 3QFJD 4XHQA 4XO4A 5EO1A 1TJHH 5AVYB 1M6UA 1FA4A 1NCJA 3BIBX 3FSOA 4AYSA 1JZ3A 4OZGA 3VB8A 5JOFA 3WO3B 1CDCA 1CU4H 2YUWA 4PRPE 5JA9A 1PKOA 2XACC 3LN5A 3G08A 2K6ZA 1UM6H 1Z9MA 3TCXA 4QDGA 1JHTB 4XWOD 1T1YB 4ZAKD 3SE8L 4FTDA 1MH5A 3TEZA 1CMOA 1T0NA 1ZT1B 4C54A 3LIZH 1UXSB 4BWWA 1NSNL 2H2PD 2UZYB 3ASWA 3CQPA 3QJVB 5KSUB 4XMXA 1XF5A 4KUZH 4Q0XH 4Z3GA 2GBTA 3MCYA 1O7VA 5I0WA 3R19A 4IMKC 3BGFC 5IW3A 3B83A 5ESQA 4LCCC 1I31A 1QACA 3CFUA 3OR7A 2P8MA 3RVUD 2AQ2A 2IDTA 4XCYA 4HYTB 4DPAX 1WTGT 2R4SH 3LYRA 3O3UN 1J48A 4HQQL 4PCKA 1JPST 2VMEA 5IVXA 1M05B 2R1YA 4WO0A 4AYFA 3UMNA 1BSIA 1CTMA 2P24A 4ZPTA 1T6BX 1FFOB 3JTTB 5DHVB 2GIXA 2X4PB 4XMTA 5JHLA 3A23A 1J0YA 2E4TA 5K59E 2JH2A 2I9TB 5IVXF 5IJDC 4FTVB 5FUZH 3V0DA 1RAMA 4MJIE 4I4WA 3N6YA 4RBPH 1L7IH 5GSRA 1RHHA 5J6HA 1S7WB 1CTNA 4EN3C 3GB7B 5L7XH 4IU2A 3ZHNA 3K4DA 4AW7A 3X1EA 3MLRL 2PP7A 5BOPA 5KSBE 2YC1A 1TOXA 5FK9B 4N4YB 2YD4A 5F6IC 3MLWH 4PY7A 4MRBA 1CK0L 3RWDB 1K4CA 4LSVH 4FFVD 3UTSB 1IZKA 2LABA 1TU2A 4N0UA 3VXTA 4M6NH 4JM2F 3V4VL 4OB5L 4RIRB 4D9RE 1ZXQA 2PYEE 2F7QA 3KYMB 2ZCKL 3L7EB 1G5GA 1XH3B 4FFVC 1EEZB 1XGPB 4ZUTB 1RUMH 1SY6A 2ZXAA 3WIIH 4LOUD 2XG5B 4NQCA 5I17A 1O7DE 2VW7A 2UXGA 1YJDH 3VQLA 2HT3C 2P80D 3CUPB 2JKIS 1AGCA 4WJ5A 5AZEH 3T2LA 2WLLA 5F1KC 5DYFA 4UT7H 2F8XC 1L0PA 1YAIA 1BV8A 4DPRA 3O11B 4XCNA 3D33A 5LN8A 4QXUL 1YO4A 1WCBB 4UV7H 5E9DD 1FO0L 4CADA 5FUCC 2R69H 3VI4E 4KC3B 4WTZA 1GA2A 4DZBB 1JHKH 4I3SH 2C3XA 3WNLA 5DMGC 1QLRA 5DGQA 4H26A 4HWBH 4CNIA 3BGMB 2WHVA 5DJ6B 3UJIL 5I1HH 3QW9A 1U8CB 1XSIA 1VLXA 3ECWA 3HE6C 2R2HB 1JYXA 3MUGA 2KQNA 3WLWC 4K2UH 2CRMA 5ADOL 1R3JB 3HNSH 3M7OA 1QW9A 2VKXA 3FKUS 3S36H 5MENA 3U0PA 1J7VR 2KZWA 4H2AA 1C1EH 4L05A 3ZYJA 1QHPA 3BGMA 3WEXB 4X80H 1IKFH 2XWTB 3WTVA 4ZMZA 3F7YB 4ZFGH 2CGYA 5H37G 3BMWA 4HBCH 4C57C 1RULL 4DH2A 1PG7W 1T21A 2JQZA 3PABB 4XPGH 5J6HB 3EHBC 4NKIL 3ES6A 5E94A 5K39B 3VMOA 2X2IA 5EEUA 3PIQA 4L1SA 4Q56A 3AXLB 5C0BB 1TFPA 1A0QH 2ICEC 3IDGB 3WE6A 4C83A 4DP9X 5KSAC 4Y4HD 1LNUA 1PZSA 4BFGA 3TA3B 1G7JA 3LPGA 1BJ8A 3DX9A 4PJAE 1T1WA 5DQJA 4GRLD 5FDWB 3QDJD 2R0ZH 1H9DA 2J8UA 5JPMC 4I2XE 5E94B 1TQBB 5K39A 3SQOL 5L2KA 2XHNA 2VMJA 1YEEL 3PXLA 3DUSB 5GS0D 1ZLSH 4DEWA 1V3JA 1L3WA 4N2BA 1ZTXE 2C1OA 3CLFH 4HJIA 1AXTL 4WWKD 3QJZA 5D93B 4JZJC 1EEQA 2ZYHA 1UOVA 5ECGA 4D0DA 4NP9A 3BPNC 3P0VL 3T4AA 3VGHA 3QORB 4HXAH 3PG2A 3EGDB 1XD1A 5CR1A 2XY2A 4L37B 3TGXA 5I1DA 1KWKA 4O51A 2XQYK 2WXKA 4AYID 3OXSB 4UTBA 3UBGA 5J3HD 3IAGC 1BJ1H 5GHWL 1A6WH 1T5XB 2JKRM 2YAQA 4XH2A 4DP4X 3NIGB 3BD3A 4MD4A 3BWZA 3DRQA 4I7ZC 4NRZA 1KELL 2PCFB 3KJ6H 4FQQA 2HLFC 3FHEA 4LK4A 5AENA 7PCYA 1CXIA 4MQTB 4B9YA 4UDTA 1N18A 4M62L 5DTFA 5AG8A 2R2HA 2YS4A 1JV5A 4JREC 2FLMA 1BXAA 4TSBH 5LVEA 2R4RL 1FPTH 5TE7H 3VWKD 4M7ZC 4LBEB 2MNJB 1H8OA 3BISA 3IMUA 1V7ML 2E0PA 3PWUA 5DS8A 3DTUB 3F7RA 4U1IA 2D7PA 1IC5L 2J5LC 5IB4A 4XP4H 5BCAA 3GUTB 3QISA 4YOKA 4EVNA 4YE4H 1D9KD 1DFBH 1TJGL 2EH8H 1UC6A 3ZDXF 3MC0A 3JTTA 1TEGA 1X5KA 2X4QA 3CFNA 1OPGH 4LVOB 1P4LA 1TITA 2ARJB 1KPVA 1AO7D 4MB5A 1J10A 5ANHA 4BFFA 2WLIB 2CO6A 2ZCHH 3QUZC 4BEIA 3WN6A 4YBQD 1HE8A 2GJ6B 3DX1A 3BESR 2YLHA 1TYEB 3DETD 4RGOH 3HNVH 2R2BA 3CVIL 3FQUA 4ACPA 1RLBA 2XTJB 5ES4B 1ANUA 4JO4H 1IMHC 1SNRA 4FQ1L 4FQCL 1ZGLM 2QKIC 4WUUD 3GLAA 2V6HA 3QQ9C 4DEPB 5MHSE 3C75A 4OZGB 3MRIB 2A9NH 5LWYH 1P7QA 4OJCA 2ZICA 1DZBA 2WLKA 1OTSC 3D9AH 2XVGA 2IADB 3EFDH 3KE0A 4XE5B 2XZCH 2YFNA 2W5PA 4PV1C 1KB5H 4PRDA 3UTZA 4Z7OE 2BVQB 2FQEA 5LBSL 5IB3B 5J56B 3OHXC 3SKMB 3CZSA 3GHEL 1XBRA 4N8VG 5A7BA 4B3EA 3KPLA 2PXYB 3MBEB 1CFMA 4HFWB 4L9DA 3V6OC 3DV4B 1KIQA 2ADFH 3IJHB 3QHZL 3WHXB 1A9EB 3ARTA 2CWRA 3WYRA 2BNRE 2EXWC 4ZX3A 4ZOBA 3H4FA 3DOHA 5D9SB 4K5LA 3HUJA 2N1TE 1FZKB 5DJDB 5HHXH 1NJ9A 4EUPB 1I8LC 2NY6C 3SYQA 1FNAA 1NGZA 5GRYA 1F2QA 2FK9A 2PPCA 2VSCA 1N19A 1EJ8A 1LILA 1QFWI 4MA1B 4EXPX 5I19H 5J9PA 1Z0NA 1SXCA 3AS3A 4OJYA 1J8HA 1I3RB 3CVHL 3PP3H 1W80A 3QG7L 5DJYB 3TL5A 3HG5A 1THCA 1ASOA 3O4OC 3WD5H 5B1KA 3B2XA 4KDTC 1MSPA 1S78C 4TSAL 3ZN6A 4TQ8A 5IB4B 3PNWB 4DQAA 2PTUA 4J3XA 3L6FA 4DEPC 4YNYA 4GW4B 1MN4A 1ZTMA 1WRFA 5C09E 2IMMA 3B8SA 5F1OB 1IAKA 3DROB 4PTUB 3TH3T 1CG9B 3V4PL 2MHAB 2FGWL 3A3YB 4M43H 4U0RB 3VXRE 1NBYB 1MAKA 1LD9A 4LPTA 4LZKA 1SXAA 2FJHB 4NHUB 4F27A 2OR8A 2WBWB 1WZ1L 3CZLA 1SXSA 3BQUB 4GW4A 4OJFL 2B39A 5D72L 5TQ0L 3DIDA 4G6JL 4PJGF 1FG9C 2ISDA 3FPXA 2Y0SA 2YPLE 2G75A 4APQD 4L5FH 1AR1C 3PWPB 3MAWA 4FL4B 3BC9A 4MLIA 4OCWL 4BXSV 5B1BB 2IDSA 4KKNA 3DUUA 5DT1L 4LNRB 3HHRB 3LEYL 4HQQH 3FB7B 2DD8H 4WKXA 1X3DA 5EN2A 2ESVB 3X13A 1R46A 4CVZB 3IFOA 4JN2A 3AU1B 2ZOTA 5BRZD 2HLFD 5B7EA 4JS7A 3U1QA 2H9GA 4R26H 1F6AA 1J9CT 4HLEA 4LGRB 1E7UA 3MV7E 1UZ6E 2EO7A 5DHVH 1B2YA 5SWQA 4LLVB 2YZ1A 3MBXH 3QJHB 4KFMA 4RMSA 3MV9E 2ITEA 4ODUB 4PGDB 1INDL 4DZBA 2R29L 3VWJA 1G5AA 4OM0L 1JCKA 4Y1AB 5L7XL 4HGWA 2AQTA 3MJWA 3Q2CA 2RCSH 4LOFA 3GSNA 4MJ5A 3DA0A 4X4YB 5EOCJ 3ZUCA 2CKNA 3F7LA 3PF2A 4N9GB 3DTXB 1QRNE 2AMUA 3MO1A 1RU9H 1T7WA 2A6IB 5ISZB 2FYYA 1IL1A 2VERA 3B43A 3N9GL 4LCCA 5LKNA 1GMEA 4FQQB 2D0FA 4OB5H 4OFVA 1TCMA 2XXMB 2C4FT 3U7AA 3WEXA 5DFVD 2P42B 1OEZW 1TFHA 2J88L 2WBKA 4G8IB 2Z7UA 3GIVB 4GSDH 3KBFA 3GMOA 1RSFA 3GMPB 3MOAH 4ZMOA 3BSZH 4WGWB 5LAXA 2OLDA 3MRCA 4YHPA 4B27A 1ZAGA 1R3LA 2NY2D 4JHVA 3GSXA 4AGNA 3ALPA 5J1AB 4XWGH 1MJ7H 3C6LB 3ZGIA 1I3GH 2W65A 1J0ZA 2FYVA 1BVNT 5D7IF 4QR7A 1NEZG 3FT4A 4L8SC 4KDTA 4S1RL 1W0VB 3KYOA 2WKGA 5FYKU 1RK7A 3Q2VA 3HB3B 4E9LA 4MA7L 4MDRA 4F5CA 1N3NA 2AJUH 4N8CL 3F01A 1JHKL 1KMGA 3O6FC 1NMCB 4E36A 3CHRA 4OT1H 3O3DB 3U4EB 4YSSA 5I1KH 4JFHD 1Z7JA 3VG9B 2MNWA 1I9EA 1KGIA 3NQKA 3MGTB 4K7PX 3WSQH 1YC7A 1FQ9C 4PGEA 1GIGL 1FGVH 3JSSA 3SB3A 4PI2A 2FCBA 4UIMA 4L4VD 3ILDA 1J11A 4N24A 3GKWH 3AU1A 4PU2A 1LQSR 4S0TD 1QUNA 4KJQD 3GD1C 4YEFA 4CVXB 1FDLL 4I2XA 2RACA 3FBKA 4W81A 5AKSA 3MRNA 4HC1A 4XVTL 4PGBB 4PRBA 4D0BB 3SJVA 5A2LH 2V2WA 2R0WL 2APVA 4AUJA 3BH4A 5GGSA 3HVDA 3QG6B 3VTMA 2F5BH 4BXVA 3TIEA 1OAUL 2XTLA 3VXSE 4ZZFA 1GYAA 1G9NC 4QNPF 2PCFA 2ZUVA 3GRWA 5EPMB 3DLQR 3BRFA 2BRRH 4N1CA 4A66A 1FV1B 3IXTB 5SWZD 3PY9A 5E8OA 4UQ2B 5DJXA 3C6LC 3NZHL 3CCHB 4P23D 1XF4B 4FNLH 4S0HA 5F93C 4A7UA 3BDYL 1TSHA 4XVJL 4FHKA 4MYPA 4PFEA 5C0AB 2VXVL 1G7HB 3O45B 4U33A 3QDJE 4JAMB 5C71A 3D4ZA 2E7LC 4QGYA 4DAGH 3I50L 2E7LA 2B4CL 4L8DB 2IMNA 5IBUB 2Q8BL 4FNQA 1AAJA 3BPNB 4CN1A 2FH8A 5C0NC 3FUIA 1D6EB 1WA0X 1AI1L 1KJ3H 4I3SL 2Z9TA 4KNTA 4EI6A 1GS8A 1EO8L 2CO6B 35C8L 3CHOA 3N1GC 2F7RA 3A4EA 5E1IA 2VXQA 3QJSB 2QFPA 2P5ED 3H54A 3BVUA 4HMCA 2Z34A 1WBYB 3D9AL 3BWSA 4PJ6A 1F58H 4C4KO 3QNXA 2PF6A 1MZZA 1VF5C 3UTSA 1ZE3C 4FHJA 1QTYT 3MV8D 7CGTA 3LKNB 4G1EA 1A6UL 4X6CA 4L0ZA 2OMNA 3L3GB 3GBNH 3N5AA 2VLLB 3F62A 3GHEH 5JO5B 4NKDB 1E5BA 4LE8A 1UWFA 3ETTA 3KR3H 4Z1PA 1DBAL 2BCMA 1KB5A 1XWVA 5D1ZA 4LARL 3W11D 3QHZH 3QNXB 3A4DA 3CMGA 3WFHA 3TP4A 4WZ9A 1P84J 1E8WA 3GPEA 3OGOE 5IVXE 4DKEL 4P59H 3Q2NA 4ANVA 5J13B 2ZUQB 4UTCA 2NY3D 5BZWA 3NIFB 5C07B 3UBXB 4E41D 2BSCA 4KRPB 2ZSWB 3E1F1 4KUCF 1DFBL 3WTUA 3FQWA 3KXFB 4RFOL 3BLKA 4XP1H 5DEFA 3ABZA 3WD5L 3HVNA 4NZ8A 5F9JB 4I48B 1HL4A 1L7TH 4HIXH 2B1AH 3LRGA 3TJPA 5K5YA 4HUWA 1ZSHA 5B3JF 2ENQA 3L4XA 3RL1A 2OSLA 1MJJA 5CD3B 1ET5A 1R1CA 4J23A 2O61B 2ZSWA 2WQUA 3HS0B 3NN8A 4XX1E 1IE4A 2DMGA 1ZT4A 3G6DL 4WI3A 3FU5A 4F7EA 4L18A 2J56A 5D2NC 3QUYD 2DQDH 3BN3B 3NFPA 3P73B 4G71B 2XJLA 1K9TA 4P2OC 1ILSA 3FB5A 2XJKA 1ZA3B 1H8NA 3SE4A 4Z7WE 4ELMB 3IMWA 2W0LA 2JK5A 4ZW7A 3LS5L 1VJSA 3DROA 3IF1A 4PTUA 2V7NB 2XNAA 3LRMA 2HMID 4NRXB 4NBXB 5IBLC 3U30C 1DJYA 1L6XA 1T04A 4CL7A 4UM8B 3VQ2C 5ITBL 4S0SD 3CBJB 5IFJA 1A4AA 2VUOA 2FLBT 3FFCA 4Y2DB 4U1LA 1BD2E 3KPSB 5EC2A 4LARH 1TZAA 1DO6A 2EE6A 3NRPA 5AW0B 3ZHKA 1I1CA 3D18B 4RDBA 2ID5A 2VLJD 3P1VA 1PNDA 4DFIA 4U1JB 2IAAC 1UT9A 4U1KB 2BLFA 2NDGA 4BKLA 3NABL 1RU9L 2BNQD 4WLCA 1CGSH 2A83A 4GKOA 5D1ZD 3C8DA 4KKPA 1NCIA 4GS7C 1O0VA 4NQDA 3KYOB 1SYVA 1E4HA 4Z7WA 2J72A 4YHNB 5HDOA 1P9MC 2GUOA 2J88H 4LL4A 5AZ2L 1QUPA 3QO1A 4GKSA 3VNYA 2NUTA 2YAFA 4JO1L 5D7HA 4NO3A 4PMEA 3D2TA 4H1LG 4K7FB 4NCDA 3HE6D 4X9IA 3CHSA 6TAAA 4OFYD 1UACL 4LCWD 4MYWB 2QSVA 2ZF8A 1KCLA 2XI9A 4XNBA 2IFGA 1YEDB 3QHTC 4LLVA 1UOLA 4KI1A 5EU6E 1M9SA 4QRQA 1U9KA 3KGRA 5IP4A 3AMKA 4JM4H 2KQMA 2LVCA 3HPLB 3VWJB 3WS3A 1KTDA 3KPPA 1YYMH 4M43L 2VERN 3MLSL 3RGVC 1F86A 2DJUA 1IGCH 3ULAB 3ESOA 1OP4A 4YPGA 3ARDB 4JRYB 1A4KB 4WVRA 5FGSA 1JTOA 4HPHA 3OAYK 2JCCA 2I07A 3GKWL 1I7TA 4JFQB 4LSUH 1U8QA 4P2RA 2QGEA 7FABH 4E41A 1JFQH 3U2SA 4AMKH 3S8WA 3GGWA 4N68A 1V10A 3EYVB 1ZANH 1HSAA 2WM0A 4AEHL 2HH0L 3ECVA 3QPXL 5C0AA 1NDTA 3QZWG 4EN3A 1S7SA 4AUYA 2ATPB 4Q6YA 5AOZA 2DW5A 1XMEB 3KPTA 4OCSH 5E9DA 5HGAB 2B1OA 3SPHA 2B3IA 3VRJB 1BZ8A 2YD8A 5J3HC 4TXVB 2QSTA 5SX5H 4HMEA 2AXFA 1K5NA 4A2MA 1CO1A 4HKBA 2QT6A 3BEVB 1GW0A 3PAUA 4XPHL 3I3EA 1A7NL 4KJPD 4E5XA 2ADGA 2FR4A 2FATH 4DGIH 3MUUA 2VXTL 3M1BA 3V9FA 3AWGA 1PNCA 1A7RL 2DQJL 2WIIB 3LNFA 2GUOB 4QY8B 5E6YA 4DUXA 2K9FB 1QUNB 2GBAA 4RGND 3MNVB 4RQQB 3CXFA 1MPAL 3KWUA 2CKBB 4AIZA 1PLBA 2GSGB 4HCGA 4GXVL 4FKEA 4JFPA 4PGCA 5DLLA 5AYTA 1UM5H 4GKNA 3OAYH 1AD0A 4OGXL 1MIEL 4WI4A 4PLJC 5CP7B 4WUKH 2XQ0A 2FHBA 2VJ0A 4Q9BA 1OPGL 4D0DB 5IQ9A 2YN3A 5KSUA 4XAKD 5D9SA 3ILPB 3BAWA 4U6HA 5FFOA 3ENEA 1RURL 2VZUA 5EZLA 4P9HL 5D96B 1I3GL 4PJIB 3F05A 3K6IA 1LO2L 3SJVE 5I2IB 4C4KT 2VDQB 3QDHA 4JO4L 2WXFA 2A73B 3STLA 4WK0B 5AWNL 4IBUA 1S7VA 4BQ6A 4I1PA 1S9XA 4PJCB 5EC1A 4NRZB 3S37X 3UTTD 4OCSL 5FCUH 5IOKA 3FSAA 1FZOB 3QZWB 3HC4H 3SGEH 3X14A 1OTSD 2UVFA 4A1RA 4ODHL 2X2YA 3F6JA 1NOLA 1V27A 3HJEA 4UOQA 1YHPA 4FTVA 1M7XA 5EU5B 1OTTD 5E9DB 2F08A 4DGIL 3NIDB 5I6OA 1NDMB 2OULB 3HPJA 3IDMB 4Q58C 3OQRA 4P3WA 4TNWF 4Z78A 4D7PA 5T1LD 2YPKA 1XL6A 3P4NA 3CZGA 3OKEB 4XPTL 4M1GL 5FKPB 1J9TA 3CFJA 3J07A 3THML 2EQDA 3Q0HA 4P48A 4EAEA 4I9WE 5F1NB 3NMEA 2XFGB 2R83A 4CKVX 3X1FA 4CUCA 1PYWA 3UZVA 3AROA 3QJFA 3NP4A 3FN9A 1HAWA 2F7IA 2FO8A 4PJ7E 4UQCA 3N44F 1BA9A 1JYWA 4NHCL 3WKQA 1PZ3A 43C9A 4XHJD 3V5KA 4ABQA 4YGVB 5HDWA 3OJ2C 1INEH 1BHGA 4G80B 2E9BA 4GSUA 3SDAB 3BKYL 4GXUN 1TXKA 4K71B 4WI7A 4Y5YB 4ZQKA 2WMPB 3T77A 5C2BL 4OAWA 3BPLB 4L4VA 4YPJA 2Q8BH 5EOQL 5B8CC 2H8PA 3FB8B 3ARPA 2JKNA 3FRPA 4NO3B 5A2JH 2I26N 4V1DA 3V7AG 1U3HA 2FX7L 3FU8A 1E9OA 3OKNB 5T3XL 3MJ9L 1DQLL 4PJBE 3WOVA 2CMRL 2BIMA 2F9BT 2APSA 1OAYL 4EI5C 1R5IA 2J6WA 1Z9PA 4HEPG 1OAKL 1CD1A 2ENJA 2G60H 2OSLB 4BFIB 5CD3A 3BUYB 4M29A 5D5MA 3ULUC 2QV2A 4H2CA 2ZXEB 1CC3A 1HHHA 3EJSA 1H5BB 4DO5A 1A9EA 2XDHA 5DWUL 1F6LL 3CDYA 4AVKA 1I82A 2W1NA 2B59B 2DBLH 1PIGA 5EC1B 3EDJA 3VXME 2YJLA 2GK2A 1A4KA 1CR9H 1FUNA 5FYJH 1QBAA 3DECA 1I3RA 1J8HB 2G3NA 3HN8A 4UT9H 5DHYA 4BGDA 2CHNA 1T04B 1MNNA 3S5LB 1CGYA 3CMOH 3P4LA 4RNRB 4AJYV 2C7UA 2ED7A 2WWMD 4FQ2H 5KVDH 4JM4L 3CDZB 4JEGB 2EDNA 1F97A 4JDEB 1MCKA 2QQNL 4MA3A 1XF3B 4P3CL 3VRIA 5I1AB 5KN5B 2NOYA 4KQ0A 5D71H 5GZND 4JQVC 1F56A 2QZQA 2Y7OA 3O4LA 4ZMXA 1CICD 1JGDB 1L0YA 5FKPA 3BRDA 2VR5A 1GL4B 3PS6A 3S88H 1KBKA 1G0DA 1CFQB 3TPUB 2Y5EA 3QWOA 5DR5L 3T3PB 2ZKMX 3ZL1A 2VW4A 2IAMD 2YWZA 4KROD 5JHLL 5C0JB 4MJJA 4KZEH 5MENE 3OMZA 4K71C 3IDNA 1I1AA 1I9IH 5CN1A 4ZX4A 3VJ6A 3QUZB 4GSDL 4MHHG 5C0EB 2R0KL 1X9UA 4R7NA 4FXGC 1PD6A 1HNGA 4NQXA 5CIPH 3T08A 1NANI 4YSQA 5KW9H 5T1LA 4JCMA 4L1DA 1E42A 1HZHH 5C08E 5EUOA 3LNDA 4KY1H 3LRLA 3GI9H 1BD2B 4JKNA 3TNNA 1HE7A 3HG0A 3L9EA 1JVKA 4C56A 4QEGA 1RUAL 3DRQB 2DS4A 3FUEA 1WEJL 4PJCE 2E6PA 2FJSA 2IDQA 3QARA 5DUJA 4YX2H 5JZ7C 1IC0A 5DJ2B 3VXNB 1B6DA 4XOCA 1U8QB 4FG4A 4JHWL 4P2RB 4K94H 3CN4A 5KUMA 4PJGA 2I25N 1T0MA 1OGAA 4FTVE 5CBEA 4F7MA 1HTYA 2BW4A 3AG4B 1NCCL 2QGCA 2B5IC 1U92A 5IM7A 4GAFB 4HUVB 4PAZA 2YK1L 1ZLUK 2IBBA 4UTAH 5GSVA 4EOWH 3TBTA 3QAZC 3OAUH 1AGDA 5DWPA 1E50A 1E65A 2YQ3A 5G2NA 3HG4A 2WKOA 5I8EA 3TT3H 3MLWL 4L3ED 5IJVB 2P48B 4OIBA 2H26A 4AVJA 3WNKA 5K69A 3VFVB 5DJCA 3RTQC 3G6DH 5EBGA 5JPNB 3VX1A 5HYJD 1NSNH 1N5AA 1OT4A 5D55A 4JNXA 4AJWA 1UYWL 2Q6WB 4YH6A 3T65B 4HKBB 5BPPA 5K9KB 3NZHH 2OXGA 3GSQA 4ZFOL 5JHDE 4NBZB 5HI5C 2WIIA 4QY8A 1Y0LA 3GHBH 1R5VA 1IFHL 1RIUH 1BEYL 2Q76B 2LLGA 2WINA 2IAND 5DJCB 2V3DA 2FWOB 2OAAA 5CAYB 1KGJA 2R4SL 1NUGA 3DSNA 1UZ6F 5FB8A 3NIFE 5C07E 3GLZA 3G9AB 4LSQH 4QRRB 3T65A 4BKTC 4ZMWA 1D5ZB 1U4FA 4TUKH 3IJYA 1X6LA 2FIKA 4RFNB 5LDUA 1G43A 2I5YL 4QCIB 2WWNA 1NCDH 2IAMC 1JGUH 2VDRH 2XBZA 3C5SB 4P3DA 1MLCB 3WGUB 2Q76A 4GUOA 1EA9C 1J1PL 5IEKA 4Y0GA 5J12C 2BW5A 5E2TL 3TJHD 1QFWL 3B5HA 3RX7A 2NQDA 1LJMA 3LKQB 2ZNWA 5B7MA 4MXVF 2VW6A 4GQ9L 1AOHA 1Z3GL 4LL1A 2AI0L 3F8UB 5I9QC 1UADC 4ODWA 4X0NA 1M53A 3RDTC 4QRSA 5B4MC 5IJBC 5CHNB 3ZX1A 1G1OA 4RWYH 3ILQD 1NEZB 1DQDH 3PWPD 2NYZA 5F7FA 2YBGA 1WA2X 4ALAH 1RCYA 2JI3A 1O9VA 2A7BA 4NM4H 2O30A 2XNAB 3EYQC 1Q1JH 1X9RA 2JXMA 3KEHA 4H8WL 1KTRL 3RU8L 3GJFK 1KN4L 1VZIA 2IBGA 4YO0B 1OW0C 2YMOA 3L13A 4OGAC 4ZFOA 4XNDA 5KBLA 3N2JA 3NJMA 3CFDA 2EUWA 2WUBH 1MFUA 1VKXB 2XXFA 4MDJA 1MG2C 1QWNA 1A2YA 4J8QA 4M8VA 1HWWA 4ZUUA 1N0LB 3N1QC 4IRJD 4KKRA 5KZCB 3TN0D 1EERB 3FOMA 5J06A 2QR0A 2DB8A 5I75B 4FQXD 5DD3L 4W9EC 4KXCA 3DX0A 2XKSA 3K71B 2BZCA 3LNIA 3GSWA 1QFOA 2ZKXA 3QUKB 1U8MB 2Q6WA 3K2IA 4EMZA 1NAML 5HYQB 4JFOA 2Z35A 4DTGL 1NPNA 4WI2A 3PDDA 4TNVF 4P9MH 5MEQB 1R5VB 3QR2A 4UMGA 2OJEA 4A7VA 5C0FB 2P5PA 1IM3A 4YGVA 2W91A 2X44D 2VZTA 2F2HA 2LFEA 4MNQD 4G1MA 3KPMB 1L9TA 1MNUH 1D5MA 4FC3E 4LSSH 4QXTB 2OMZA 2VSKB 4FI7A 4Y5YA 4ZQKB 3VH8G 1ZIAA 3M45A 1YEDA 1HEHC 2VAJA 1OAXH 1QYGL 4G8AC 5C08A 3QZLA 1E8ZA 4FHBD 2H9GB 5LNEA 3RURA 3U79A 3QUXD 3VFRB 1F6AB 2NY2B 1MHHA 5ABDE 1U58A 2AEPH 4WO4A 2WXHA 3G5XB 5JNYB 3WY3A 1RZ7L 3UCRA 5I8OH 3PJLA 4IBZA 3BW9A 3UTQB 4JG1H 4JJ5A 4JFWA 1S3KL 3PJSA 4M62H 3U4KA 4IQHA 5D93C 2XWJB 5HHOA 5HHQB 1J5IA 3BUYA 1YPZE 2FEDC 3KCPA 1OP5K 3ROLB 2I27N 1RUQL 3U9UA 3MTRA 3O0LA 2EKJA 3QI9C 2HWZH 5MP6H 1M71A 2J8UF 4BQ8A 4Z7QF 2XVKA 5L9DL 4CSPA 1P1ZA 2HKFL 5KG9A 2WNKA 3ULUD 1ETA1 1T20A 4G9DA 3TVMC 4I8DA 3HS0A 3NN8B 3FFDB 4X7DC 3GSRA 3LKSA 2FYYB 1UWEH 3WUWG 4YAQA 2EXTA 1E7VA 2ICWB 3HI6L 1ORSA 2EDOA 2WVUA 4UOW1 4WW1B 1ASQA 3WV0A 5I16B 3DGGA 1JK9A 1M71B 1S3RA 2EDKA 5AZUA 1AXTH 1OGAB 4F7MB 3LEYH 5HYSG 2MQGA 1M6OB 1RZKL 4GRWE 4K15A 4OKDA 4ADJA 5E8DH 4JKKA 4FQ1H 2Z31D 3UPRB 5E00B 3PP4L 3PAVA 3WTXA 2DLEA 4TLKA 4TVPD 4BDVA 7TAAA 1YA5A 1Q0XL 4XTRD 3ALWA 3IMBA 4OJDH 5EUKB 2VN6A 2CBTA 3VFUA 1YNLH 1CXKA 1Q94B 3CFIC 1CL7H 1RK0B 1TLKA 4PRHD 4IRZH 4RQQA 5CLXA 3FO9A 4UOZA 5C0AD 3WNJA 1PJWA 1TZGH 1TQWA 1F1AA 2J6EH 1WBXA 3MGTA 4QJ3B 4JY5L 4DIXA 3NCCB 3REWB 3UROR 1Y0LB 4L3CB 5KVFH 1NM9A 1A8JH 1P0SE 4Y2NA 2GAZB 1CLYL 3VXMD 1M2VA 3GJEA 2VMCA 4XBPA 3X3FL 5IQ9B 3QQNA 2XTJC 4H7VA 3PWPE 5AVXB 3RJOA 4MAZA 2R7EA 3NK4A 4ELKA 2I24N 4LQFH 3NCJH 3ECBB 2CLRB 4EQ3A 1BVLB 1BVNP 4O02L 4M8QA 1TJMA 4MCNA 4F37F 3H42H 4M7LL 3MV8B 4PJAF 5I19L 1E5ZA 2KDYA 3B3IB 1ZPLA 3ESPA 4LHUB 1AFVH 1FV1A 4GOSA 2BS8A 1KLGA 1BOGB 4LOUC 5HYSB 5KBDA 4XGZA 3FUHA 3AM8A 4XOAA 1K6QH 4PJGB 3EKCA 1VEMA 2Z6FA 4D3CL 2F58L 3BCFA 1SDAB 3II1A 1C08B 4UQEA 4H8VA 2JLLA 1LE5A 2R39A 3ZDXB 3ULUL 3BAKA 3QE5A 5CSBA 4XMUA 5C07D 4FFYA 4HK3J 3S4SB 1U8NA 1FVEA 5ALCL 1BLIA 1YCSA 1KCRL 3W5MA 3MR9B 1U91A 1OAYH 3EYFA 1SLXA 1RIUL 3DXAD 1QFWH 1P9MA 1LK2B 4A6YA 5CEXA 1AZVA 4H4NA 3I02B 1A3RH 1IBHA 5KJRH 3HR5B 4TNGA 4FXKA 2HA1A 2EC9T 1E9PA 2N7AA 1PZ2A 3X11A 4NNXA 4IKLA 4QKXB 2BNRB 5E00A 4NQDD 1FAKT 3P0YH 5T3ZE 4YHYB 3CXDL 3RWIA 2WQ8A 5I30L 4X7FC 5D2LF 3EH5B 4NJ9H 1YMME 2ADFL 2H7WA 1H0DA 2J21A 5IB5A 2DF3A 3MLZH 5LLIC 4WO4D 5CJXC 5C9KA 9CGTA 3I9IA 4E5XB 5CU9A 2L7UA 3CSYA 4Q6KA 3P3UA 2OTUB 3ZKQD 4YIQB 1ZMYA 1MF2H 4Q89A 3WU1A 3DX3A 4K94L 4FS0A 4L9LC 4PJ9D 1UCBH 4APXA 4FCHA 4HIPA 2BWDA 2ZWLT 4X6BA 3OMNB 4UQIM 2AV1B 4P2OA 1MLCA 1HH6A 4M1DL 2NRDA 5L4IA 4HZLB 5C2UB 32C2A 5D2NA 1I8KA 4NQED 5H35B 2F68X 3MCKB 1F3JB 3SPVA 4WU7B 5DQ9B 4EIUA 4F80A 2X28A 2BVPA 4G8EA 4EOWL 4QHLB 1LK3L 4FE9A 1E90A 1FZJA 2RMNA 4M8QB 2DMCA 4XZ4A 3E3QE 4FJZA 2XLLA 5E8EB 3IXAA 4XXWC 4DTGH 5IMLB 5D1XE 3V4PH 5CFAA 2D2CC 3KPNB 3VYPA 4JQIH 2VNCA 2QBWA 4NQEE 2VM9A 5I73C 2BNQB 3ZZQA 1DBJH 4APQC 2DQFB 3P9LA 3FN0H 4PW4A 3IJSA 4OD3L 2MQ0A 4MJHA 4OFYA 3MBWA 3REVB 1D5XB 3VX0A 2E8ZA 3S3JA 1E6JH 2VXSL 5E1QA 4M9OA 2LE9A 1TNMA 5DK3A 2X6AA 1EAQA 4MXVE 1Y6MR 3Q6GL 5I5IA 3CVHA 3D3VD 2JI1A 5ESAA 2XQYA 2UZIL 2G2RA 1E3XA 1WIOA 2VM4A 3RWFB 4AGLA 1NA8A 4KO5A 2ZX7A 2FWSA 4EIZC 4NGHL 5T3ZD 1KPUB 3O4LB 5E2WL 5JIPA 3JV6B 3MLTA 1MJUH 1T66C 3LY6A 1NM4A 4N2CA 2ZX5A 3BFWA 5BS0A 4UDUB 2AJSL 2J2ZA 4AQ1C 4ACTA 5JHBA 3HAEA 1SUHA 1TEFA 3CX5K 4RSVA 1C5DA 3WY2A 1QR1B 4H1LB 1H0DB 4XPAH 2KMWA 2DMHA 5CFHA 1P5UC 1DVQA 4LLQA 4IIQA 3AY2A 1B9KA 5BOZG 2JIXD 4QYOA 1K8IB 5D1QC 4FG2A 1PYWB 3ZL4L 1WK0A 4WJG3 3HE7D 4R5TA 4ZTPL 5I8KH 3UAJD 1YNTF 2WO2B 4HWBA 1Z9LA 3W5NA 1A1OB 3C5ZB 2YGNA 2GHWB 4L29B 2WQWA 3ET9F 3ZKMD 4ZW8A 4YDNA 3L3IA 3QIBB 3BD4A 3GMMB 1GHFL 1X5MA 4TTDD 3O3EA 1FYTE 2VQ1B 1EGJH 1H19A 2YSSB 1T22B 3CVHH 1KXTA 2LU3A 5AVUB 2LU5A 4Z7QE 1EHLH 1EAOA 2W9DL 2YPLA 4KAQH 1CXLA 4NRYB 3Q5YA 4PJ8D 1JE6A 3ZR6A 3T2NL 3BZ5A 1DHKA 2V7HB 4IRJC 4GO6B 5FGBA 2DQFA 3P9LB 2I9LB 5I17B 2ZUYA 4RRPG 4RLDA 4NQVA 4PJ7A 1A9VA 2VQ1A 4FNTA 3VD1A 3OMIB 4W9DC 3OQ3B 5BOJA 3H9SD 5CEZL 2FD6L 2JB6A 4P4KB 5ABZA 4K8RC 1V3KA 4U4IA 1VCAA 2VE6B 4U3SA 1QNIA 4JRXB 4Y7OC 4PRDB 4KMTH 4E42B 3EYQD 1KLUB 1K8DA 3F2LA 3V79C 2O5ZH 3MA9L 4WI6A 1P7HL 1JK9B 3VFNB 1BZ7B 3U7WL 3TX4A 5C70A 2AK4D 1CWVA 3RNQA 3GK8L 4M93B 3WN5A 4OZHE 3UO8B 4WKZB 3KWTA 1HIMH 2WCSA 1HILA 3RBSA 3HR6A 3E0GA 4XE0A 4IRSD 1G87A 4KITB 1NGPL 4JVUA 1E28B 5D70H 2QSCL 2OYPA 4OCXH 3GI8H 3ZPDA 3ZXAC 2MPAH 2Y5QA 1ERNA 1IILE 2J2ZB 4FXKB 5I71C 4GH7B 4GKZB 3LVTA 1S8DB 4HCRH 4XCYB 1E5AA 4OZFG 3O9WC 4XMKL 2XCMC 1KB3A 1L9RA 1YY9C 3ZE2F 3JT2A 3FU6A 2BINA 4U7KA 2VCOA 2NXZD 1V05A 3HA0A 5L9DH 4G6AD 4YNYB 1E6OH 4PJBF 2DEXX 2C9AA 2QPEB 4PGJA 5DFWH 1DVFD 3DVGA 1A1OA 3HI6H 4M7KL 4M7JL 5F21B 5CGYC 2C8NA 1IGTB 1NAMH 2PP9A 4KX8A 5SWZA 5EZJB 3W39A 4IBSA 5GISH 1GTNA 4ETQA 3B2MA 3MV8A 2DYPD 4UAOC 4Y4FD 4HUUB 2G5UA 5D6CA 2FD6H 4D0CA 4U6HB 3GS7A 1HU8A 4FLHA 4XXDB 3UGXA 3SPVB 4QMEA 3H2PA 4O4YH 4Y5XB 4J6RL 2F53D 1QA9B 1WWAX 1KLGB 2EYTB 1ETZB 4HPYL 2CCLA 4MMYB 4XNXH 5BVPH 1FRGL 5IGXL 1N6VA 4YDIL 3LRSA 4OIFA 5HVGB 2DPKA 1UD3A 1TQSA 2G3ZA 1HN1A 4ZFOB 3HUJE 2WZ5A 4HP5A 4N0YH 4Z76A 3D2UB 3QIUD 5E6IC 3B5TA 3C60C 4XN9A 3GBMH 1RJYB 3ULVF 3U2IA 2XRAH 4KVNH 2Q3AA 3RWJA 1IEBA 4YHKL 3NJLA 4XCCH 1JTTA 4M7ZB 2VO8A 3EGSA 4ZYKB 4RZCB 4ZG1A 1JBJA 4O2EA 2QTEA 1CDJA 1XO8A 4P2QA 3NGBB 4Y8AA 4FQLH 1SEQL 1Y7VA 4O9HH 2QKIB 5CN2A 3X3FH 3NPSC 3GXPA 1X5JA 4JHBA 3RKDD 2D03L 1LO0L 2ZKWA 3O81A 1FC2D 1NL0H 3TZVD 2OPCA 1Z6JT 2BX5A 2WZ6A 1IEAB 4WI0B 5KSVA 1JV5B 3S36X 2QL1A 2WTPA 4JKWA 3AS1A 2F74B 4JPSA 4Z78B 2EUXA 1D7BA 2DTML 5C0CD 4Z0BH 1I1AD 4TNEA 3VD4A 5DURB 1D5IL 5E4IA 3A22A 3O6FD 3IVKB 5TTRA 1NGXB 5KVDE 1JI1A 1NC2D 2DQCH 2F1BA 1DJHA 4OW6A 4A2FA 1JZ8A 5DJ8B 4FXGA 5HD8C 1MUJA 1FH5H 5HJGA 5AAWC 3H8NA 5CZXD 1J8HD 3ARBA 4OFIA 1RZFH 2R27A 1HH6B 1D5BB 1XR8A 1Q9LB 4AYGA 1NDGA 1JZIA 4JG0H 5GJSH 3KH3A 2I7SA 3SSGA 3KPRD 2IDUA 3L5XL 3Q48A 1CL7L 5FIEA 1A3RL 2FBRA 1P5VA 3KBHE 3F65A 1QPKA 4I3RH 5KJRL 1EMTH 2BS71 2H2SD 3HMXH 4KRPC 1TZGL 2MNUA 5FLUA 3ECUA 1T4KA 2B4CH 3AT8A 3EO1B 5GGVY 1I7UA 4LCVA 5DC2A 2CDEB 3FTUA 1LL1A 1LTXA 4KJYA 1R17A 2PCPA 2VC2H 4IOFC 1PD1A 3WFBH 2K70A 3RUGE 5DUPH 4AEHH 2DQIL 4I5BA 4HFUH 4ZPVB 1JERA 5ICYB 4IHBA 2ZG1A 4Q6IA 4ABUA 3V6FA 4LQFL 3RGBA 3HG1A 3STZA 3MNWB 3RKPA 1KXQA 1U2YA 1WJ3A 2X38A 4JKLA 5KVGL 1HJCA 4KRLB 1DBBL 3HNSL 5GGSB 3HMWL 3M1CA 4BFRA 1ROCA 4FLOA 1HVXA 4IHOA 1TQCC 3ZDZE 4LF3A 4WWNA 2HG5A 2R59A 5JYLA 1ZVYA 3BKYH 3SCMA 4NBYB 3B9KC 3Q2WA 4G6FB 4K3DL 3SO3C 3VFUB 3DX8A 3DK0A 1WAAA 2IWKA 2P8MB 4NNYB 3F7QA 4LSDA 4EI5D 3FOLB 5FW8A 5JQHC 4NSKA 2LLNA 1RL1A 2BERA 1RUQH 5CN3A 5D6DC 3CBRA 3QDGB 3A6CL 3IJEB 3FTSA 1WDAA 1KGYE 4HZAA 4DO6A 4XMVA 2X5PA 4RMVA 5G4NA 1RVFH 4DCQB 3I9GH 4MJIA 1GAFL 1VIWA 4OSUL 4DGVH 2PKDA 1YNTB 1UJTA 2ZYSA 4JFUA 1EIBA 3HZYA 3JWOH 4NKOB 5A16B 1BVZA 4OZIB 5IF0A 3DV6B 5BVJA 3QUZA 3MHZA 4DN4H 3HJ0A 4Z3FA 2DM7A 1RH8A 1GS6X 4XO9A 4JFFB 2X87A 1X5GA 3RX9A 5I66B 2ADYA 4I4WB 5JXED 3SY0B 3L7FB 3OR6A 4ORZC 4KUZL 3BP4B 3QRLA 2ZOLA 1NFKA 3PU7A 3TBWB 4PJ5B 2APFA 2AXHA 2M1KA 3QXAA 4N0UE 5C86A 2O5NA 1P6FA 4AC4A 3QNFA 4AQ1A 5IMKB 3H1ZA 2DWTA 4KJYB 4HUUA 3PJSB 2NY4D 2ZJSH 4R7VA 4MNGA 3O2VL 4JZNB 4U6YB 1L7IL 2IPUG 3BIKA 3W0WA 4N1EA 1UFGA 4IIQC 3RVTD 5GZOD 1RZIA 8FABA 1FIGL 3WS6A 1DANU 1HSBA 3D50A 1LK2A 4PRNB 3ZT6A 4K3DH 1RULH 4MZIA 5DF0A 3VI4A 2EACA 3VI3B 2Y6TE 3WLBA 1KXHA 3LB6D 2UYLB 1EUTA 2COQA 4X6FA 1R3KA 2OKMA 1HWHB 3D2UA 1EXGA 2DWEB 3VA6A 1OF2B 4U1SA 5CZRA 1AG6A 1QG3A 2GK0A 1WWCA 1QVOB 1SZNA 4MAYA 5I0ZA 1ASPA 4HUWB 4PGZA 3U30B 3VU1A 1O6VA 2HX8A 4OSUH 4PRPB 1YVLA 1CLZH 2YQGA 1UKQA 3DV4A 3O3BB 5AW9B 1AG0A 4F9PA 1LP9F 3VXRD 2WQAA 1AKJA 2A9MH 3HBZA 1N26A 1CURA 1BZ9A 2ZKYA 3M86A 5AB2A 1D9KA 5I24A 3EIFA 4Q14A 2IH1A 1R24A 1BVKB 5FPIA 1JGLL 1RP9A 1RZJH 3HN3A 3MRDB 3PDOA 1G84A 3RB5A 4X6BB 5I5MA 4I0PC 3U0PB 3LZRA 2JF1A 3DSFH 3CD4A 3LZFH 2NQ3A 3B2UD 4GI9A 3LHPL 4XP5H 2A9NL 1HEJC 3IAQA 1FO0B 1MCNA 1NL0L 1A6ZA 4OLUL 3SPJA 3VFMB 4OFPA 5K1VA 4E0RA 3KPNA 3WNOA 3IPFA 3UXFA 4Z7WF 5SV4A 1WLHA 4OQTA 3B9AA 2EO1A 3AGWA 3PABA 2D3NA 1NIDA 4RIRA 3V4UL 3LKQA 2DTMH 3VGGA 3MA7A 5LAPA 2DRUA 4L8CB 3NEEA 4ZMVA 1GGIL 4KTDL 2XG5A 4NQCB 1KIUB 3VFMA 4M02A 5EN3A 2DQCL 1FN4A 5JPNC 4IEFA 1ZJAA 4OCYH 3FAWA 4KUCD 3PQYB 5DMJB 2G75B 4NN5C 4PS8A 4XVUD 4JPWH 2NY2C 3V6ZB 3DBSA 3PYCA 4NN6C 1AS8A 2EEXA 2IV9A 1DQJB 5GXBB 2NTFA 1Z2KA 1YY8B 3FQTB 4FQHA 3RE0A 3EYSH 1EJOL 4E9TA 1A9BB 2CNZA 2WVSA 4PBWD 2Y7QB 2HFEA 2ZCLH 2XN9B 4R7XA 2VN5A 3ZTEA 3P0GB 1U8OA 3F6IA 2KERA 3PLYA 1QWUA 5F0MB 2R9HC 1R33A 2GT9A 4KV5E 5HDBE 4M3JA 2I5YH 3KL3A 4DEUA 1FSKC 1JSYA 4H88H 3UAFA 3QUXA 1DLHA 1LM8V 25C8H 3FSVA 4X9HA 1PZAA 1Q9KB 2Z92B 4I0PD 5LWYL 1E27A 2NR6A 1I9IL 4JFXA 3VA2C 5AAPA 4JKPL 1PTZA 4IBLT 3B6SA 3WEBA 1A6PA 4LRIA 2MMXA 2V2TB 3LH2H 1QSVA 2X4PA 5EIQA 2LAGB 1X9LA 1H3PL 2DQEH 5ANME 2CO3A 4WF7A 4K55A 3GINA 3FTVA 2OZ4H 3O0RH 3QUMB 3SKJL 3VD5A 4BQBA 1U36A 1NGPH 3LOWA 5D70L 1YYLH 5JA8B 3MRLB 2B1HH 2KPWA 2IPTL 1H15A 3MV7A 3K8KA 1PCSA 5SX5K 2Z31B 4R26L 3NUKA 4XMKH 5IF0B 3AC0A 1FPTL 5TE7L 5B39G 4YK4C 3MRQB 4L4TB 3U36A 1CVSC 2PWEA 5KVDL 1CD9B 1T4KB 3EO1A 1OCWH 3GJFH 2P3YA 4N25A 3GXDA 2EE9A 1DO5A 3LMJH 5F89B 4KH9A 1D7CA 4ENEC 3QG7H 4PRHB 2EXSA 1T0NB 1ZT1A 2Y1YA 3V0HA 1JWMB 3KNBB 2VE6A 1KPRB 1HCZA 4KQ3H 2VRAA 4JRWA 1FFRA 4TSCH 3BAEH 4KI5D 2CLVB 3ZMNA 4X4XA 3EO0B 3MRQA 3NSFA 3N85H 2AK4E 3ZE1E 4JB9L 4YDVB 2MEJB 5BXFB 2R0LL 5DVKA 5I1EL 1P69B 4PLKC 4POYA 1W72H 5EO1B 3PGFL 4LF3B 5IQLA 4WTWA 2XFXA 3CXHJ 2YXFA 4PJFB 4KKAC 1FP5A 3V0WH 3RTLA 2PXYA 1OANA 3GMLA 2VDLH 4LHQB 3Q44A 4PRIB 5DTFB 5IFAH 1DJZA 3B56A 4WWPA 1EHLL 3VYOA 2BFGA 5C0GA 2OCCB 4KK5C 1C7TA 1NH6A 3ZBMA 4FFZA 3IGKA 2G0LA 2OM5A 3T2NH 3MI6A 1QTSA 5MI0C 3MVSA 2W81C 4KKLD 3HMXL 2Z31C 1JNHA 4NWUH 5CINH 3LD8B 3AABA 1N12A 4AM0Q 1SJEA 2BHUA 2IH3B 5KSAB 4KQ4H 4JHAH 1XEUA 5TF1H 5D2LA 3ASOB 4N8CH 1W8OA 5SWZE 4YC2B 1OB1A 1DQLH 3KM1A 3QC6X 2VN3A 2VZ1A 5L2KD 1XGQB 1BP3B 4UBDD 2VXQH 3QUHA 1CD8A 5KVEH 3C2SA 4ONGH 5JW4M 4D9QD 3UC0H 2CGRL 4PB0L 3DPBA 3F04A 4GMSL 4JHUA 4LSPH 4U1KA 1WPCA 4KI5F 5I6KA 4B9ZA 2BNRD 3TN0C 2P5EA 5TPWH 3DO7A 4EJ1C 1DJWA 2QQQA 3D25A 5EU6D 1WFMA 4YHNA 4OV5B 3DX9B 2XXCB 2HLAA 3ZE1B 4JFED 4LDLB 15C8H 4MCZA 5C3LD 5EWIL 4N87A 4NN5B 4KJWC 1KCBA 2BCKA 1VDGA 2GTZA 3GZPA 4QKTA 1TO5A 3MRBA 2VYRE 5LGJB 5AKRA 4GW5A 2FNBA 2F7PA 1AQHA 1JVOA 3QUML 1RXLA 2AW2A 3QFDB 1INQA 4LLMB 3BSZL 3SBPA 5GRVK 1Q0XH 4OZGF 4QOKB 4RMBA 3FUMA 1CDYA 3ESNA 1NAKH 1BAGA 1VPOL 4G6ML 3ARGB 4CVZA 2X0WA 1KCKA 3QXTA 1I8MA 4G70B 1LHZA 3SKNA 2XFXB 4OZHF 1GW6A 2W60B 5AOJA 1F1GA 3OXSA 4HGMA 4M03A 2LW3A 3N0AA 2OMYB 1N8ZA 5TF1L 3TN0A 1DSWA 3MRHA 4F1SA 2PTTA 4NO0D 2ERJB 2IH1B 3EBGA 3ATBA 5ENWA 3K2MC 5PAZA 3PPSA 3BP7B 1D9KB 5KTEH 1N5YL 1YN6A 1I75A 3MXVH 2Y36H 1AXIB 3EJRA 2QQLL 4RAVA 3SJVD 4QWWC 3TYGL 2G4GA 3SODB 4D2NA 3IGAA 2ENSA 2WQXA 1XBDA 1FNSL 2BC4B 3BZFB 3UP6A 1IVLA 4F2MA 5JHMA 5CKGA 5HDBF 1QLRB 5LCVA 1QPXA 5IHUH 1H8LA 2OMXA 2GJ6D 4XCFH 1TVHB 3TA3A 1UB5A 2HRLA 2K4AA 3KWWA 4B0MM 2WWKT 4JG1L 4ZZKA 2IF7A 4QIRA 5B39B 4OCYL 3DX7A 3QO0A 3QEGH 2R4RH 1YUHA 5JUEL 3O4LD 3K0WA 2OP4L 2AXWA 4JGMA 1WH0A 4WUUB 4Z7UB 3QUMA 2X05A 3NOIA 2YGQA 1RUPH 3HBPA 3S3DB 3WKNA 1W15A 1CTOA 5F1IB 4GRLC 4PHZA 5LBGA 3SD2A 4Q9CA 2AEOA 3D0LB 3K3QA 4X4ME 2R23B 4ZT1A 4MWFB 4ETYA 5KYXA 1YPZF 4ODSH 4OJEH 5FA3B 3NSYA 1LEGB 3EYUH 5FHAL 3GBEA 4HIXL 4PJEA 3ARBD 2IXQA 1X7SA 4JFPB 4PGCB 4AQAB 5DEZA 2JIXB 2YGOA 3Q1SH 5IB1A 4H13C 4X4MA 2V17H 3IYLW 3KW7A 3IMTA 2ATKA 2DJSA 3TEXA 2LVEA 4F8PA 4ODTL 3RVVC 2BO0A 4NJ9L 2GSMB 1GJIA 4MASA 5H4ZA 1F3DJ 4JKPH 3AY4A 5HHMB 2OXHA 3AQYA 3WIFA 2BVOB 1DEEB 5EEZA 5BXFA 3KLDA 1JZ6A 4HWZA 4Q52A 1JPSL 4MCMA 5HVHC 1H3XA 3E9TA 4KK6C 4L9LB 4YDKL 2ADIB 5CZKA 5IMMB 1DN0A 2G5RA 1AQDB 3EJPA 3CHQA 4NB7A 3BSGA 3MJ7B 5TDOB 1FNHA 3HI1B 5L88L 4PJ8B 5T1KD 4Y9GA 1LO3H 3OTTA 1C1EL 3VDBA 2YAEA 4NO2A 2YEVB 1F90L 1KIRA 2CPCA 2GBVA 2V9TA 4Y19D 5DC0A 4K3JL 4DCQA 4DP0X 4OVUA 4PG2A 4PJAB 3WI9A 4ZFGL 2CIIA 3QPQD 3HG1D 4QF1A 5KJ7E 1X7TA 2YQ2A 3AITA 4U31A 2ICWJ 4DKEH 3V9CA 4FFYL 4P4KD 5D7IE 4OD2B 4ZUSA 5I1EH 2EDYA 2UZXA 3S48A 5DUBA 1LYQA 1JZDC 4OTXL 3WG7B 4F3FA 4NZFA 4HOZA 2JCCB 4WSJA 4ZOEA 1A0QL 4Y19A 4X5XB 3AG1B 2FHFA 3LXAA 1XAKA 1TQTA 1G9ML 2BDNH 2EC9U 2NY5H 4POZD 3SE9L 2CJUL 4MZ3A 5BUGA 2D7QA 1BQHG 1ZHBA 3D4GA 4QLRA 5TDNB 2C34A 1OVZA 1FL5A 3QO0B 4N0CD 2ITCB 2YPKB 2ZWZA 3CK0L 4GRWF 4QHMB 5E6IA 1XCXA 3BDYH 2UVEA 1OQXA 3N85L 3RAJL 3T0EB 1WBYA 4GY4A 1MKFA 1OKEA 5IQ7H 5L0QC 3PHSA 3QQ3A 3QB7C 4PGEB 1YDPA 1UVQB 1PD0A 5AOMA 3L9YA 1C9SA 3DPBB 1HL9A 3VE0A 1NEPA 4S1QH 4XC3H 5D96C 2NCMA 5C0CA 2AV7B 1FVCA 2BSSB 1DBKL 5H2BA 1U33A 3UDWA 1OGTA 1EPFA 1SHMA 3PP4H 1DVFA 3RUGF 4QXGL 2VDPB 4HLZG 5DK2A 4C4BA 5E4EC 4OFQA 5DC4B 5IFAL 1I7UB 3EO0A 5E8PB 3VI3A 1IEHA 3L81A 1G7QA 5FYLD 1X7QB 2VRQA 2LT9A 4N2HA 4J3OH 1TT6A 4V1DB 5CSZB 3T6XA 4TULL 4KKCC 1I3VA 1ZWIA 2BMKB 4XCEA 5IKCA 2GK0B 3MFGB 3FTXA 1QHOA 4JFDB 4JY5H 4L37A 4ZD3H 4NZUH 3V6OA 3AREA 3HFML 4XP9L 2F61A 3QQDA 5KANG 5CNHA 5D4IA 2WB7A 4XMPH 2PYEB 3BXNB 3WN5C 4DKFL 4XC1H 5LNDA 4XI5D 1IB5A 2W60A 2F53B 2F19H 2FT6A 1AOZA 5CGBA 4AYFB 1MRFL 3TT1H 4UZSA 5IT2L 1HCFX 1RSYA 2B3RA 4K8RH 3FTGB 4GEIA 4LKXA 3TA3C 1HL5A 1KT2A 1ETB1 3TV8A 1OB1B 1B0RA 4UTBH 1S9WB 3E6HB 2RFXB 3HCVB 2F53E 4LO9A 3RGVB 1LMKA 1A7OH 5E5MA 2UZXB 3N50A 2HFGL 3PWUB 2C7UB 4BFEA 2RTTA 3FRUA 3NFPB 3BT2H 4TSCL 1ECZA 1U8LA 1ZRUA 2C3WA 2EDTA 5FGBC 4HWUA 4QRPE 5GGQH 1ZLWK 2VGLM 3HB3D 3CLWA 3I2CH 2NNAA 4OF3A 3AZUA 4RBPK 5B1JC 3T5WA 3N9GH 1I7ZB 3FOMB 1NKOA 1F02I 2IBZX 1IX2A 2ICCA 3PP3K 4NKOA 1MDAA 4P5RA 1G6RB 3LIUA 5A16A 3FB7A 3MYZA 3IGUA 4KMTL 3P3SA 5KS9E 4EDWH 5HYQA 4PWFA 4OUUB 1HL8A 1NEUA 1YNKH 3SDCA 4OUOA 3MV7D 4UNIA 4NN6B 4JMXA 3RX8A 1P4UA 2YRBA 3JT0A 4I0KA 4K2UL 4BKLB 1FVCB 2BSSA 5JW4N 5JYMA 3J27A 1A7BA 4HC1H 2VDLB 2YD2A 3O0RL 5GS2D 2EYTA 4BH7B 1SN2A 2OTWB 4AQZA 2GSIB 4CA4A 2CK0H 2HRHA 3D5OF 4QTIH 4HG4J 3DXAE 5TDPA 3OVUB 3BH8A 4GP8B 1L0QA 2WCGA 3FT3B 4X8GA 1BIHA 4AQAA 3UAJC 3SKNB 5ITFA 5DHXB 4AGPA 4F33A 4UQBA 3O11A 4FZEH 4WFED 4AQOA 1LDSA 4LLDB 5EF1A 3ESVF 3LEVL 4JM2B 3RJDA 1AGEB 5DA4A 4GFTB 2EUVA 5FF6B 4UQ3B 1IBGL 1ZLWH 1MELA 1G7PB 4KK9D 3QEQD 3K6NA 4JDZB 3O2DA 5TE4L 2IWFA 1T0PB 2MCMA 5F1SA 3L45A 2GJZA 1A5FH 1NJ9B 2KPNA 5T3XD 1YC8A 5F7MC 3KPRE 1ZA3A 1X9QA 4G3YH 1U8JA 2WXIA 3D09A 4R0LA 4J3VA 1C7SA 3FUFA 1QEWA 2BIHA 3OKKB 4N2OA 2WP3T 3NJIA 1LEIA 4F8OA 1QLFA 3U0WH 1AY1L 1WAPA 4XXCC 1GXEA 3K0YA 4OZFA 4G5ZH 3VW3L 5E7FA 2B2XL 5FCSH 2WLNA 2FSEA 2HSIA 3OGCB 1EZLA 1UB5B 1GSMA 5F88A 2GI0A 3VGFA 4YDKH 5BO1L 3ERXA 4MX7B 3BKCH 4HBQA 4WW2B 4G5AA 5FGCE 5ACZB 1BECA 2N0KA 2P8PA 4OZ4B 3LHAA 3FT0A 3MLXL 1TJXA 4MXQD 4HKZA 4K3JH 2PXYC 4WHTA 4GXFA 2YOAA 2XBDA 4X5WA 4KK8C 2WPGA 4MSWB 3L3GA 2Z8VC 1GOHA 4YLBA 4YHML 1AH1A 5ANMA 2ICEA 5I6MA 2YD7A 3Q3GA 1ZDQA 1VFMA 1UTDA 3WJJA 5HYJE 4OTXH 1DJSA 5HHOE 2XA8H 3QNZB 3NRQA 3RB7A 5D5MF 3T8MA 2BOLA 5C3TA 1MH5B 2E9GA 4BZ1H 1UXMA 2LV4A 5LQBH 1X4XA 3V8CA 5C0IA 4NUPA 5TE4H 4P2QE 2YA2A 1UOKA 1D5IH 4HETA 5IHUL 4MMZB 1MCIA 3WE1A 4AGMA 2BZ7A 4XNQA 4LLDA 5FYKD 2O26U 3VXRA 2EDBA 2QDVA 1YY8A 4OJAA 2CAKA 3QUYB 3O45A 3NIGF 1UEMA 5HJBA 4U1NB 2OP4H 1XGYL 3AG3B 4FZ8L 4BK8A 5FS5A 3CU7A 1DSFH 1FHGA 1Z1WA 4P0DA 3KLSA 5F96H 5FXCH 3LQAH 2NY4B 2XWBB 1MQKL 1WISA 3SGJA 2ZCHL 3DGDA 4B41A 5AUMA 1E8YA 1PFCA 2RD0A 4LAJH 4U2ZA 5D8JH 5HJDA 1B4RA 2XPZA 1G94A 3EBAA 4QRUB 5I0DA 1MCBA 1CDUA 5M94B 2OMVB 4FABH 1O6TA 3HI5L 3KPSD 5L6YH 1G9MC 1YEEH 2WVVA 4W4NA 3GSUA 4IM8A 3VGBA 1LWJA 3V0FA 4F8QA 1DBKH 4XP9H 1P4LB 1IAIM 5H37A 5A3ID 1TSRA 5EOTB 1ZTXH 4M5TA 4KZEL 5MEND 3FRUB 3QH3A 1IIIA 2VQ4A 4I77L 4O2CA 1HJBC 1QZ1A 4TV3A 2DQTH 3KPSA 3OKLA 4KXZI 4F2FA 1EZUA 1W16A 3FQRA 4LCWA 5DMKB 2Y06H 4Y2DC 5DSCB 2CXGA 4TULH 5EDSA 4DZ8B 4NO5A 3TT1L 5IT2H 1GZPA 2UWEE 4UNTA 2R0KH 2X41A 4UTAA 1L5GA 4RVBA 3HC4L 5JPNA 4X5WB 4OZIF 2A6JA 1T4WA 2AMGA 3AAZA 3CFJB 1D5MB 5GPRA 2EVJA 3LN4A 4AIZB 1VESA 4NENB 1E67A 3KJ6L 4E68A 4LLMA 4BUGA 3PPEA 4TVUA 5FYLL 2R2EB 5LGHH 4YXHH 3UZVB 3NTCL 3IT8D 4HK0A 3CDGA 3ZMEA 3BIKB 5FFLA 1OAUH 1GZPB 4LEXH 3N04A 1AC6A 3CMOL 1MRFH 3QDJA 2H3NB 2X6UA 1B4JL 1IGFH 1J1OL 4NJAH 2FO4B 1KIPA 1S7XA 3SQBA 4QRRA 3LPFA 1VHPA 2VR8A 2UX7A 3MCKA 4OAWB 3TIDB 3BMVA 5C09D 2LTQB 1G9MH 3SE9H 4EDWL 4XTRC 3ESUF 4A37A 4Q9RH 2TAAA 3JVFC 4DK6A 3KLLA 3S2AA 2QQKL 3VFOA 5FHBH 3BP7A 3UACA 4PG9A 5K9OB 3VXPA 3FUDA 4YSAA 1ZHLA 4FMKA 4ZFQA 4DFHA 1NBVL 5L2KE 1HH9A 1CGTA 4M1CC 2XT1B 4K7PY 4YBHA 1KCWA 4QXGH 4X8XA 4NZDA 1EGJL 1NQBA 3MOBH 2BSRB 4NWTH 1SY6L 1HHKB 1O5DT 2A4ZA 4UANA 3DJ9A 3O9WA 1YEIL 4PJFE 4R0LC 1NCOA 2QSQA 5CM1A 2NX5A 4K5OA 3HBGA 3FQNA 1KB5L 2IANE 1BXUA 3CDZA 4KVNL 1KBGL 2UY6B 5DWUH 4WFFE 4RMUA 4QGTA 3LNHA 4OGYL 1T7XA 2D7MA 4HCFA 5C97A 5K93A 3NPZB 1CT8A 1P7KA 2YO3A 4F8TA 1JXGA 1E3FA 3KYAA 3US0A 1UOWA 2NUPB 4TS6A 4X83A 3NJHA 3HN5A 5B38G 4Z7UE 4IU2B 5DLML 4K7FA 1TVBA 2MCPL 4IK7A 2VZ3A 4JHWH 3EG9B 3NDZE 3UYPA 8PAZA 3HKFA 5DHEA 3D25B 2WV3A 4O00A 2EILB 3M1BB 3RI5F 5CJOH 2ZKHH 4FQJL 3D06A 1ZHKB 3CN0A 3DIFB 3QQXA 3C2AL 2YAHA 4W93A 3B2VH 4WV1A 2BS9A 4GPVA 4Y5XC 2OXHB 3U48A 2AC0A 1XQ4A 4WEBL 2APXA 2GC4C 2OX5A 1BVLA 2W9EH 4PWEA 1PX4A 1DQJA 4M8UA 4YJZL 4OLEA 1OK0A 5IMMA 2CD0A 3SO5A 2DM2A 1MFAH 2XZQL 4R7NB 3QEGL 2B9AA 5JUEH 1U8HB 5C0EA 4HUNB 1EZVY 5CF3A 4GUCA 2I07B 2I7OA 1EGJA 1OY3B 1H3UA 2AVGA 2GJZB 4TNFA 4XCNB 3T2QA 1RZ8A 4PBVC 1E6OL 3BW9B 5E6RB 2WZPA 3WELA 3C5XA 4H8HA 4ONHA 1QO3A 4S1SL 1RERA 4E5XG 2WLZA 3N91A 4JFYB 3FHAA 3DDFA 3M1OA 3KLHC 1N8ZB 3RWHB 1UH3A 1MW1A 2EC8A 4XOBA 4YZWA 2OSYA 5DUBB 3TF4A 4F3FB 1E4XL 2YMTA 1V3LA 3NCFB 2AQQA 4ENED 3R0MA 5MERB 3U6RA 2Y7NA 5EDXA 2XKUA 3QCVL 4WV1C 2QLVB 2DD8L 1WZKA 5K9QG 4KTYA 2OW7A 3RWHA 1YAZA 4W68A 2OYLA 1DVYA 2G5BA 3DMMB 1BFOA 2DMBA 4F7PB 2P8PB 4OZFH 4RFEA 5CLYA 1DVUA 2FVNA 3FT4B 3CLEH 1IGJB 2VABA 2W65B 2CHDA 1E28A 1MWOA 4FL4C 4UYQA 4JBSA 1AR1B 2H2SC 1HC1A 3NH7L 2ARJQ 3SOTA 5H2BB 5IESH 2V3EA 3TM6A 4NO0A 2NUPA 4M6OH 1E4XI 4F58L 3OLDA 5I1GH 2V5YA 4PCSA 4ZFZA 4RFEB 5ID1A 5HGAA 3IWUA 1WBZA 1LP9B 3F7VA 4WY7L 1XSJA 3AWFA 3QNZA 4XAWH 3FNKA 2R1WB 5E6UB 1QQDA 1HDMA 1DP0A 1DSYA 32C2B 5D2NB 4PJEB 3MRNB 3RLSA 3NA9H 5L2KB 1NMBL 1TMCB 1WBXB 3ARZA 3FB6A 4PV8B 1SBSH 4OI9A 4OGZA 3PXHA 4Z7NB 5KYWB 3INUH 4WFEE 3IB4A 5D6CB 4NXKA 3L4ZA 4NZRH 2BNQA 2ZOKA 1DVZA 4KY2A 1SMDA 2IV8A 3KPOB 5E95B 3AMLA 4NX0A 1OOWA 4GKNB 5EEXA 5HYIA 4IDLA 1U8PA 1ZANL 2VLRA 3MLXH 3LQMA 2FX9L 3F00A 3UTSD 2D3VA 5CZVH 1WAAF 4ZK8A 4XN1A 2C9XA 3NTCH 1J87A 4MMXB 5TDOA 4W9KC 1MJ8L 3MJ9H 1DL7L 5EU5A 3ZSSA 2E74C 1ZSDB 4JQIA 2FNWA 4JGJA 4OCMC 3RTQA 4NJAL 5C6TH 4UDTB 1FVDB 1D6EA 4OLUH 3GSUB 3VGDA 4AENA 4ZFFB 1ED3A 2NSMA 3UABA 2VLRB 3UIYA 5BW7A 4RZCA 1WP6A 2YKLH 3EGXA 4TRPL 3LKPB 1WTLA 5E2UL 1CE6B 3S0PA 3QIWB 4GRWB 2FJHA 4NHUA 5FV2A 1A4BA 3F85A 1A5FL 4WFGD 3QRBA 2HFFA 3NJVA 5HYFA 5MHSD 1NZRA 3AAZB 3D30A 1J1OH 1IGFL 4UM8A 3RWCB 1MCWW 1PSKH 2E6JA 4NNXB 4X6CB 4TL5A 4FNRA 4M3HA 3ULVC 5TGBA 2E27H 4OIAA 1WZAA 1GYUA 2NR6C 3WFHB 2CU9A 4ODBD 4X99B 3NEOA 4KRNA 5IHZB 2DQGL 3O4OB 4LAQH 3MGOB 5DJ8A 3UP1A 4AY0A 2K3HA 4BYHA 1VEPA 2Y1VA 2QQKH 1LE9B 1AO7E 2WXRA 5IQOA 1H9VA 4U1HA 4KKZA 2OJZH 3GMMA 1CDBA 3IRZA 1OGSA 3HRZB 1Z5LB 2B9BA 4OM1L 1BD2D 1OPOA 4H1LH 4XB8A 4HIHB 1JRHH 3TURA 4QNPE 4ODWB 1KYUA 4WDIB 2NT0A 4P9ML 4EE2A 5I18L 2Q5BA 1SF3A 3SDDC 5K9OA 3U4BL 4LMQI 2O61A 2X6CA 3VFOB 3NABH 4JPIA 5FYLE 4Z3HA 1MAJA 3CFCL 1RZQA 2XWJA 4NYLA 5IQMA 1ZHNB 5IVNA 3CC5A 4H26B 1E2VA 4H5SA 2MKLC 1S7VB 5F7AA 2BM3A 4HIIA 3U9UB 2XKNB 1GYCA 4HF5H 5E8NB 3IBEA 2XWDA 3TJEH 4UAOB 3SDYH 2DKMA 2WJ7A 1RZ7H 5I8OL 4OV6F 4HS3A 1ACYL 3QRGH 5HYJB 2UXTA 4N85A 5CCKH 1WEJH 1X4YA 2EIBA 3IE4A 3PQYE 1E30A 1IBFA 5HHMD 5E5MB 4U3CA 5J1TC 4FAAB 2H1PH 3FQNB 1QYGH 4AH2B 4LIQL 1E4KA 3TPUA 3WKPA 3CNKA 1QKZH 5F71A 2VDMH 4NQDE 3UH8A 2D7OA 2NY6B 5HYJA 4I0PA 5T1KB 4N2NA 1CGXA 3WFDL 3N1FC 1HESA 2KLRA 1NBZB 2D31B 3TCLA 5IVZB 3QDMA 3KPMA 3ARYA 4X7CC 3SDDB 4HXBH 3QA3B 1Z5YD 3DIFA 4LQ1A 3JXAA 3VUAA 1MCWM 4V2BA 4HUXA 3S35L 4PWKA 3I75A 1C5BL 2AJYL 1HQRA 1XIWC 4PLOB 1AZUA 4TQPA 4Y7MA 3FO9B 3F12A 1U3NA 3ABLB 3ZRFC 3HS8A 4L4JA 2D8KA 1R5WA 3I9AA 3CX5J 3ARGC 3O6LL 1CS6A 1CE1H 4OZIA 3N0PB 5C8JB 2AERT 4NUJA 5EIIA 3FT9A 3P4OB 2ESVA 3X13B 2P5EE 1QI3A 2P45B 1YNLL 1WD8A 2OR9L 3MJ8B 3P4MB 4IBVA 2R56H 3WIFB 1S5HB 4JDTH 2X4UB 2A6DB 2OMUA 2X4NA 5D7JC 5F9DC 2ROXA 1P5UA 3F7KA 2L3BA 3L5WA 5FO7B 2XWXA 1CD1B 3GYRA 2OL3B 3WXVH 1DN0B 3K2UL 5CIPB 4M6ML 4XH2B 4WO4C 1O6SA 2AJUL 2ZWKA 4J3OC 3TCTA 4YBQC 5AVWB 4D9LH 2EDEA 4UT9L 1G7PA 3B4NA 3QJQB 3HC3L 2Y2YA 2GTQA 5ACMA 1B2WL 4XMWA 4RA0C 1RJLA 3BZEA 3LS4L 2BVTA 4U1MA 3S3SA 1PX3A 5D7LD 2ZUWA 2GJRA 1EHNA 4HT1H 3VXOB 3UAJA 5C7XH 1JGIA 1NCAH 3GGWB 3TO4D 5GS0C 4LPVA 2NY0D 5A2CA 4V1DD 3ZHFA 1QLEH 5T3ZH 1UGKA 1OHQA 2ZP8A 1QEWB 4H0IA 5KVFE 3KLAA 4FG6D 4P5KB 3D39A 3ELQA 4ZOCA 1T89C 1XGRB 1EAPA 3UZEC 3MV11 4F2ME 5IZ7A 5C0CE 2QVKA 2APBA 4NUMA 1X5ZA 2QJDA 1JHLL 3MR9A 2MWCA 1YLBB 4EDXB 5INDA 1HT6A 4CJ1A 1ZLUH 1MVYA 2ZSVA 3L48A 4TVPE 4KNUA 3O8XD 2RH0A 1T7VA 2NX5D 4MNQB 4YC2C 4PJ5E 3WJLA 4NQSB 3K71A 1NCBL 4HUCA 4G6KL 3NSCA 3RRQA 3UC2A 4LT7A 2D73A 2C4XA 1YDPB 5ID1B 3CHXA 3EAKA 2ZPKL 4LVHB 5D6DA 4OQ1A 4GYBA 1PKQE 4XBPB 4ERSL 1XF2A 4CBPA 1NPJA 1V7NL 3FHQA 1LO2H 3CSYB 3O2DH 1Q9LA 1NDGB 5AKVA 1HZHL 1DLFH 3EZJB 4KHTL 5CILL 1C8PA 1URLA 4LP4A 4APXB 3HLAB 2XIIA 1Q72H 1N68A 1RIVL 3TYFA 1JYVA 4KMQA 1G7IA 1MHHB 4XCEB 5E2WH 5IKCB 4P5TD 4TLSA 4U1HB 4MXWL 3VVVA 4YSEA 5GS2H 1CGSL 3UTQA 1KDJA 2D7TL 2PCXA 5T5FL 2BY2A 1KFAH 4L8CA 4AC2A 1OAXL 3IXAB 3OJDA 5IMLA 5EUOB 4UOJA 1FZJB 3HC0A 3NBNA 3GLEA 4JFDE 5DMYA 2COVD 3PGDA 3TIEB 1G7IB 2DQGH 2EIMB 4LAQL 2WXLA 2BY3A 2VLME 2AEPL 3RL2B 2ROYA 5HHPA 4FP8H 1YSOA 2K1MA 1RV6X 2WYZA 3AREC 3IDIA 5AD0A 2L0DA 3C08L 3F5WB 5J13C 2AVFA 2AK4A 1HI6A 1ZT7B 3O41B 4Z0XB 4GI6A 3SN6N 2P47B 2P52A 5D4JA 3H7LA 5HHVL 1D5XA 1SM3H 4N90E 3EJYD 4WY7H 2X09A 3UEZA 4OM1H 3WMSA 3FQTA 4FQHB 5CHNA 1WITA 1L6PA 2YXWA 3BLBA 3MRPA 2Q7YB 2CG9X 2X9YA 4ZMPA 1F3DH 2Z35B 4NQUA 4DT2A 2WSKA 4CKQA 4F7KA 4JZOA 3SOBL 3V0VB 3L3OC 3PWLB 4AJ0A 4TLTA 2IDFA 2NNAB 1NAKL 5A40E 4H8WC 3EF4A 3LXBA 2BHYA 5FEBA 4PWHA 4EN3D 4NZRL 3CDCA 4DP2X 1MHCA 5K9JH 3CX2A 1RJCA 7FABL 2BVYA 4Y4KD 2Z4QB 3SGJC 3P3YA 1RK0A 2HTKC 3NJFA 1O9WA 5DUPL 1K5WA 4R4BB 2WXOA 3CXHK 1NBZA 2D31A 3TCLB 43CAA 4GFXA 5CMAB 3IM1A 2PPFA 1SVBA 3NACL 3D69B 5F2FA 1ND0A 2C9PA 4GP5B 2R1XB 4Y16D 1JPSH 2WWKO 2G2NA 1HEZB 3GJEB 4R2GB 5EBWB 1KJ2H 4A39A 3BHBB 3TYFB 3ZY7A 2C9SA 3TBWA 1K2DB 1BG1A 1DQDL 1GJUA 4YL4A 4ADIA 4DNLA 4ANWA 3PHOB 2J25A 1JTPA 1F90H 3N40P 6FABH 1ACYH 1I8IA 4PREA 4YHOH 5IUSA 5BJTB 1CCZA 2E7HA 1GMIA 2Z8SA 1KTLA 1R3HA 3MLUL 4FQLL 3BP5A 2YUXA 3DIVA 4FFYH 1NKRA 3FQXB 3RWEA 5F6IB 3SO3B 3MKKA 1F18A 4ZS7H 4Y9FA 5H4YA 4KTEH 5EHFA 4BJLA 1AQKL 1IAIL 1NMBH 1P5UB 3L5WB 1YZZA 5JHAA 4W9CC 1QATA 2BFVL 3VXPB 3MLYL 4A2LA 2BDNL 3Q8BA 5EEWA 1NUFA 1GHFH 4D8PA 1DUYB 3EYUL 5KJ4A 4F7CA 3O8XA 5D72H 5TQ0H 5ICZA 1QFPA 4HXBL 4AXWA 5M7QA 1EBAA 1K8DB 3EO9L 4L4VE 4ECNA 2IGFL 2NR6D 4YUEL 1OTUD 1VEOA 2ZXWB 5F7YC 3S34H 4P57B 12E8H 3PWLA 3QFJA 3S35X 1UD5A 2IDCA 2IGLA 3IK2A 3P2DA 3X3GH 4E9VA 2K8MA 1QEXA 4O02B 3GI9L 3HS0C 4B60A 5LHDA 1U2HA 5I1LB 1X5XA 1DL7H 4Y9BA 5I8EB 5IJVA 2CMRH 3MOQA 2ORBH 3AB0B 5IVOA 2HRGA 1PDKA 2A1WL 4P23B 4P99A 3EUUA 5FECA 3CC1A 1JWSB 2P24B 3VSTA 5C0FA 3S6CA 3UERA 1OF0A 2RHEA 3L4WA 2Y6SD 1PY4A 3L3KB 43CAB 2GI7A 2VIRA 2L7QA 4NAJA 2OA9A 5C09A 1IJNA 1FE8H 2GG1A 4UIMB 3QCVH 3QXDB 4IK6A 1XIWD 4I87A 1E4JA 1TZIA 5E5RB 2FWOA 3QWRA 4N5EC 1P4BL 3PWNA 4AT6A 4HZLA 5GQBA 4NQXB 5EZOL 3ZR5A 4MLSA 3Q6FB 5EO0A 2KZ1B 5KTEL 2QGBA 4LLWA 3VI4F 1KYFA 5BV7C 1UT2A 4K9EL 2X4UA 4LOVA 5I74B 5FA4B 4XN4A 2WBJD 3MZGB 3ULSA 3GM0A 2A9CA 1A1MB 2NYKA 2CBQA 5HHOD 4PJDB 3UBFA 1K4CB 2OFQA 5FO9B 3FZUC 3DBXA 3G5ZA 4KKBC 5EPMA 2Z0BA 3JTSA 1U8NB 1MIML 5J7CC 4DW2H 4QHKJ 1CQKA 4OCXL 5I1JL 2CE6A 2MPAL 5F9AC 1YMMB 1F00I 2DJMA 3UG5A 4AENB 1LK3H 1FH5L 4G43A 5DD6B 4Y88A 5KANI 1ETZA 3FN3A 4NKIH 3RNQB 1F2XK 3GTNA 1OM3L 3ARGA 2O6PA 3B3IA 1PX8A 2JLPA 4MNGE 1BQHB 1GOFA 1XH2A 3G7TA 4PY8J 2VMFA 3BO8A 3G6JF 3WY1A 3C60B 3EBHA 1WCBA 3KXFD 3P9WB 2IQ9H 1IBYA 2DL9A 1YEKL 2VXSH 3RY6A 1OT1A 3NZUA 2RJMA 3FULA 3QP3A 1YEHL 2Y3NA 3OKLB 3GLDA 4OR1A 1AXSB 4M61A 1U0QA 3KCWA 4HWEH 4JZOB 4YSTA 4BCZA 4AYDC 4DOHB 2FDBP 3MTXA 1G7LA 4AEIH 4FERA 3VXQB 3OPZH 2XV2A 2F54B 2XPYA 1D5ZA 1UASA 1GZQA 3BEVA 4JRYE 2NLJA 5HHXL 2MOVA 2Z4QA 1IU1A 2QQNH 1VZGA 4FQIL 3MRDA 3V52L 3ZZ1A 4M7LH 2AJXH 3QZNA 3LQAL 4N8VA 1NCAL 1U3HB 3TH4T 1OOAA 2X6VA 2IAMA 3PUCA 2WOBA 5E4EB 2FO4A 3E2HC 2CKBA 3QCTL 1CXEA 3CZJA 1C5CH 4XP6L 4LPWA 4YDJB 5HY9A 2F54A 4Y2DD 3OXRB 3TLRA 1JRHI 1NFAA 5KYYA 4LLWB 2NXZC 5D7KD 3ETBF 3W9EA 1JPEA 5GRUH 2H32B 4EIBA 1J5CA 4ZNEA 4AQEB 2VLJB 5F9JA 2Q2EB 4A7TA 4IS6B 5EUOF 2BXZA 5ILTL 4URKA 1FNEA 5KEZA 4H20H 4ZW3A 3PGDB 4YE0A 5BMFL 3ILPA 1GC1C 3O8XC 5H8DA 4H8QA 4ZDHA 1CXHA 3T3ME 4JY4A 1LO4H 4HK3N 4N90D 3FW6A 1TCRA 2X9ZA 2AK4B 3O41A 4JLRA 4Z0XA 5MI0B 2Y06L 2ATKB 1G1YA 3ZT7A 3ATEA 4A38A 3U1SL 5HJ3A 3U0TA 1T80A 2NXYD 3HE6B 3IMSA 1AMXA 4G8FA 5DZJA 4PRHE 3Q9QA 4C56E 5CU5A 5MEPB 2BSEA 5E99H 3V6FB 4X6EB 3HNVL 1QTPA 4E9XA 3PWJA 3UAEA 6FABL 4X98B 4CGUB 3VGEA 1CYWA 2GC7C 2IPTH 2WW8A 3X12A 4HULB 4PY8I 1UH4A 4J5VA 4JCLA 2VLKD 3CHPA 1HILB 1TZOA 1J1PH 2FRGP 2QR0B 2HFEB 2ZX9A 2Z4TA 3VWJD 2ZUSA 3F58L 1NC2A 1A6VH 1A4CA 1NIEA 2ZWSA 1V8HA 1IV8A 4JFTA 3SBRA 2NXZB 3LEVH 4YVNA 3U7WH 2CKBH 2CIIB 1JF1B 4AYBA 2BY1A 4NS0A 4DK3A 4CSZA 4RFOH 5FYKH 3B3BA 4KQ3L 3GNML 1DQQA 4N2MA 1OSPL 1HX0A 3TFKC 3VWJC 2AANA 4AIOA 2HKAA 4QRPA 3P4OA 3K5SA 3VACA 2Q10A 3WO4C 3ZKMC 3QRGL 1N7ML 1KBBA 4W4OC 5HHVH 3SE8H 1U58B 4HMDA 3VFGL 2DDQL 2P5WD 3PGFH 2X70B 3VFRA 3EYOA 2DAVA 5A2BA 5G5DA 3DTDA 3HE7C 2NX5E 3AY4C 2YAMA 2FGZA 4LEEA 2A6KB 1YYCA 4DOHE 5HSFA 1MZYA 2CHZA 3TNNB 1CLZL 4JFFA 4NWTL 5GS1B 3OG4B 5ETUA 3UX9B 5JLZA 2CSPA 2P26A 2ZXCA 2EO9A 5C6PB 1GVIA 4BHUI 5AYUH 4ZXBA 2ICWI 4U6XA 4NFBA 4J3OG 5DHMC 3T4YA 4MHHI 5DC9B 2F7OA 2P8LB 2LGNA 3DKHA 1NPUA 2CUIA 3GUFA 4DN4L 4MA7H 3DURB 1RIVH 5KYNA 3EJUA 3SKOA 5JLZB 3N1MC 3NCMA 3TWCL 1OP3K 1NGWA 2ORBL 3OJVC 4HW6A 5HHNA 4Q2ZA 2A1WH 3WKMH 3WNIA 5JXEC 1BFTA 1IEBB 3CTTA 3A5VA 3OKDA 4N3TA 1IBDA 4PR5B 5DJ0B 3A6BH 4NQCE 5I75C 4K9EH 1TJIL 1PJ9A 1YG9A 3ZTCC 2E86A 4DGYL 2JB6B 3AXIA 4RWHA 2GTWB 5L8JB 4PJBA 2BPBA 5AALA 1R3KB 4QHNB 3O6FB 1U8CA 3LAFA 1DANT 5C0DB 1MEXL 4HG4K 3U4AA 1MRCL 3D85B 4UDUA 3WTTA 3ZW3A 5J89A 1KC5L 1MHEB 1K6QL 3O3AB 1A02N 2RGSA 3BE1L 3C8KB 1CLOL 4K3EH 5B8CB 2F58H 4XNZB 1B0RB 3PDGA 5EH1A 4HOXA 3SPIA 2QZ5A 3OC5A 5DA0B 4F57H 3S3PA 1B3JA 3L3KA 4FZ8H 3UTTB 4QT5B 3A24A 1QX1A 4DKDC 1AQKH 1IAIH 1JL8A 3H42L 1TZIB 3L6FB 4LDEB 1BYNA 3SOBH 1GZHA 1ZS2A 2VLRD 3DYPA 3MLSH 4M5SA 1WT5A 4LB8A 4XNAA 3TO4C 1S9VB 5AZEL 2VMDA 4AG4H 2TRHA 5ICXA 3EOTL 2ZOLB 1EJFA 2NW2A 5FHBL 1FO0A 5A6LA 2X7LB 5E1GA 4J3TA 5FO8B 4N86A 1G7JB 3FONA 4HJTA 5LXVA 1JFQL 1W0WA 5GRVL 1RIHL 2H5UA 3HC0B