2MCMA

Macromomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
112
structure length
112
Chain Sequence
b'APGVTVTPATGLSNGQTVTVSATGLTPGTVYHVGQCAVVEPGVIGCDATTSTDVTADAAGKITAQLKVHSSFQAVVGADGTPWGTVNCKVVSCSAGLGSDSGEGAAQAITFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROMOMYCIN
molecule tags Apoprotein
source organism Streptomyces macromomyceticus
publication title Crystal structure analysis of auromomycin apoprotein (macromomycin) shows importance of protein side chains to chromophore binding selectivity.
pubmed doi rcsb
total genus 20
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1991-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 2mcmA00
1NOAA 2CBMA 1J5HA 1J48A 2G0LA 1O5PA 1HZLA 1NCOA 2CBTA 2MCMA 1HZKA 1ACXA 2CBQA 4JW3A 1AKPA 1J5IA 2CBOA 2G0KA
chains in the Genus database with same CATH superfamily
1IBFA 4E0RB 1DQMH 2ITFA 3CBKB 5KBNC 4M8UA 1UZGA 2MNJB 3A24A 5CU5A 1N6UA 1SLXA 3VXRE 3CWGA 5E6SB 2VL5B 1PBYA 1KYDA 5ANMB 2BFVL 4JL2A 4JHZA 5HPMA 1QLFA 2Q7AA 5TDOA 2C9XA 1DQLH 1RK1A 5EFIA 4QTIH 5AOIA 3M8OH 2C9SA 5DZLA 1Z0MA 4FQXB 4KO9A 4FQHA 2ZXGA 2XICA 3U6RA 4C57C 1NKRA 1HC1A 2D7QA 4PRPD 3CAFA 3PREA 1S5IL 1IC5H 2DYSB 3ARGA 1IC4H 2YJLA 4A66A 2I9LA 3M46A 2AJVH 1QLRA 2EDLA 3SGKC 1QUPA 1ZPUA 3B2VH 3RIFK 5F9WB 2E7CA 2B0SL 1SY6A 4EEEA 4UT6L 3M7OA 4XHQA 3N06B 1NCDH 2MOVA 3OG6B 3V6OA 5EIIG 5AEAA 1FGNH 3PGCB 4R7NB 2ICEB 3ZZQA 4ZUUB 5JDJA 1I8MA 3T08A 3BFQG 1YY9D 1A3QA 1KPRA 4N2NA 3QRGH 4ALAH 4ZQTA 3E1ZA 4Z7WE 5IIEA 1ORSB 3ECBA 4LBAA 1ZWIA 3DX6B 3QG6B 5D6CB 5EU6D 3H9HA 4A1RA 1XGPB 4KK6D 1I1RA 3I3DA 2GSGA 4OV6F 4F24A 4RMWA 4MSWB 3VFUA 3T2NH 1QNIA 3KM1A 4L3CB 5J12C 1S9XB 1DN0A 4S1SL 5EBWA 3WOVA 4AKPA 5EEZA 2EJ1A 1WH0A 4K94L 2KBGA 1HAUA 1VB9A 1FUNA 1QBAA 3QC6X 2FIKA 2PETA 1NGPH 3VRJB 1R3LA 5E8DH 1SDYA 1E8YA 3HN5A 2NNCA 3CDGB 1P9MC 4PP2B 3N40P 5C0DA 3IU3B 4HU2A 5BV7C 5C2BL 1VEPA 4HIXL 2VSMB 2OMVB 4JHAH 3CVHL 5GS0D 3EOBA 3GI8L 3ARUA 4LSQH 2NXYC 5IVXB 5DZVA 1DLFL 3BVUA 2UXTA 1WC7B 4PJHA 4N0UE 5IJBC 5K9KA 3BT2H 2IDQA 1TKWB 2F6AA 1VZGA 4JRLA 5JOPE 2VDML 1HOEA 4AH2A 3BPNC 3BH8A 4R4NC 4PY7A 3G6AA 3KL3A 3FTXA 3RWFA 5BV7B 2Z35A 4FFTA 3L6FB 1CDJA 3FBQA 3FH8A 3BMVA 3MLZH 3BW9A 3QDGD 2RA1A 3EZJB 4U49A 4EN3C 2EVFA 5FOBA 4JFXB 1FO0L 1RZ8A 1YDPA 4GBXB 3ML9A 3VW3H 4OTXH 5E7FA 4V2CB 4OLXL 3ZTJH 2GUYA 4MMXB 3S37L 3K6SA 4I18A 5I9QC 1ACYL 4Y4HC 2AK1L 1NDMA 2FX9L 3FCTB 1RULL 1GS6X 3H1ZA 1TPXB 2F5AL 3D3VE 1J0KA 1A9EA 1XH1A 2VN4A 3NDYE 3P73B 2XIDA 3CFDB 4NT6A 2YBRB 4OIBA 1KPRB 4WI7A 5TF0A 5LNEA 5C6TH 4A7TA 4G8GE 2C26A 4GBXC 2JCCF 2R0WL 5JIKA 4EKJA 3TH2T 2VXUH 3GSRA 4B7IA 1NFDE 4LASL 3ZX1A 1VF5C 5JHLH 5B1BB 2BSED 2V2XB 5H37H 1M2VA 1HL4A 5ESVB 3CG8A 2Y36L 4DNLA 4QCIB 2ZX8A 1Q94A 3NIFE 3BUDA 3IAPA 2R2EB 2LABA 4KI5D 1EO8H 3EDDA 3LS5L 4L8CB 3QZOA 4AUUA 3AUVA 4LLQA 35C8H 5FYKD 5GS3A 1C08A 4GW5B 2Y23A 1ES0A 3SQBA 1K8DB 1MCKA 3GKWL 2JKXA 2V9TA 5EUOF 1MCQA 3ARFC 2R69L 1AZNA 4MCMA 3DOIA 4U05A 2I7SA 3OV6A 4LCUA 2WCPA 3NACL 1JXGA 5IR1A 3MBXL 4W6YB 3F85A 3I9PA 3CXDH 4R5VA 3D2UA 3C6LC 1GYWA 1F3DJ 1SJHA 4NQEA 1QSZA 4HLEA 2ICWA 3MLRH 3BIBX 3U2SA 2PABA 3MCKB 1CU4L 1VFBA 3AREC 4HUXA 4U2ZA 2QKIA 3NCBB 5J11B 3SKNA 1KELH 3O3AA 3FQNB 5A6LA 4KO7A 4MSWA 1MCLA 1DJWA 1DQQB 5BS0D 3RWIB 1L4IA 5GSVA 1EZVY 4FMVA 5CJQL 1MVYA 1XSOA 1IGCL 1ORSA 3C8HA 1BLNB 3MI6A 4B9KC 2LAGB 3FFOA 1V55B 1S7UA 2WYZA 3T0EE 2I60H 5IHUL 3DX9A 3TN0B 3QIWD 4G6JL 1E4KA 5HI4D 1FL5B 1HFUA 2PYFA 4NCC1 4PJ5B 1ZANL 1LEKA 2XQBH 4PEEA 2D0FA 4HK3J 5D2LB 2LLNA 1K4CA 3ULAB 2WKGA 4M6ML 4H5SA 4HEPG 3BKCL 4UU9A 2VDNL 4IRJD 5JHMA 1MCEA 4X8JB 2XWBA 1YMHB 5TD4A 2FD6H 3ARED 4NN6B 1B4JL 4POYA 1GGBL 1YUHB 3BO8B 5B1JA 4UOZA 4FAAB 1BAGA 2BWQA 1CS6A 2BWDA 4L1DA 5DGQA 3AU0A 3MRCA 2FWUA 4S1DC 2DWYA 4HJIA 2XLLA 4F7EB 4PJIF 2OMTA 1A6AB 4UNTA 5EMYA 2PW2A 5FUZH 1L5GB 1Q9KB 1D5XB 3PIQA 3A22A 5BS0E 1I1AC 1PNDA 2DAVA 4V1DD 1BPLB 2ZAGA 2EE2A 1SN5A 5LCVH 1GCYA 2FQGA 3UEQA 3UZEA 3VH8A 2I9TB 3TS8A 2C7UA 5DU7A 5FWRA 1QNZH 2YHGA 3D0LA 4FZ8H 4PW4A 3MA7A 5DJ6A 3ARGD 3ZHNA 1DVXA 3AWEA 4BWTA 8FABB 1OGAD 2ESVD 3NZUA 5FEBA 4XNAA 2VL5A 1CYGA 2G4EA 4G9FE 4BFNA 5A2BA 1KTDA 4Z7NB 5I66A 1L3WA 4GI6A 1D6VH 4K8RC 4RMQA 4BE6A 5J12B 4XWGL 4E0RA 5AVSB 4M62L 3CFEB 3O11B 3FNKA 4HWUA 2X40A 1NGYB 1Z9SA 1T89A 2CIKB 2X7LB 5TQ2L 5DEFB 4ZTPH 1OWRM 3RA7H 1KJVA 2YPLE 4OZGB 5HHOA 3LV3A 3L7EA 1CFSA 4R96A 3MREB 5B22A 3VWJD 2ZCZA 2VO8A 2H0FA 3MCLH 4J3UA 3P4NA 3IDJB 5KW9L 1AO7E 1JD7A 1ZDQA 4LOVA 1I8KB 3MJ6A 1XF2A 2C3VA 5C0AE 1XGYH 1RZ7H 2R83A 3FQWA 4POUB 4R4FH 2BSCA 1E5CA 1PYWB 4D0BB 5MP6H 4EIGB 3Q5OA 5JHDA 2YD3A 5AAWA 3X12B 4Y9GA 4HOWA 4NQXA 3D85D 4LLDA 4AUYA 3DDGA 4N1CA 1MJ8H 1CFNB 3OMAB 4M6NL 1CDHA 4TVPL 5EOCJ 4BE5A 5IBTH 1SQMA 1DE4A 5E5UB 4NZRH 3RBGA 3BT2L 1YNTA 5FPIA 1WZMA 3AAZA 4WW2B 5I16B 2IFFH 4QHKJ 4EQ2A 5IVZA 4JDEB 1OAXL 3ULVD 4EN3B 2CLVB 2R59A 3DV4A 3OF6A 3L7FA 2OMYA 4FNRA 4ZXBD 3LKSA 4GSUA 3VG0L 3VWJC 4PJFB 4GRLC 3RVWC 4JRYA 1TO5A 3VFVA 1NFDA 2M26A 1ID5I 3VQLA 4TVUA 3IBEA 3AWFA 5DRXA 1KDIA 1LYQA 1DDHA 4J3OH 1TVBA 4K5LA 4RQQB 4Y0GA 2WXLA 2D4DA 2XKSA 3JVGA 2EDTA 4PJ7F 3M86A 1FG9C 2VE6B 2HJFB 4H0LC 1Y1DA 4RAVA 4YSAA 5DK2A 1N5YH 4TRPH 2GHWB 1LK3H 2VDOH 1FG2A 4KTDL 1ZVHA 5E6ZA 5DMYA 4LP5A 3S96B 3GZPA 1E6OH 2X4SA 3V4VL 4PJIA 2EIKB 3E0GA 1KLFA 1QFUL 4JO5A 5D7LD 5J13B 1ZLEA 1BVOA 4AYID 1HH9A 5F1IB 1UFGA 3CFCL 4OBSA 3UTTA 3BKML 1T80A 3PAYA 2BOBB 2OMZB 2R9HD 2ZWZA 3AT9A 5EC2B 4JDTH 2LGNA 4CU7A 1YEFH 1J0IA 2WGXA 1K2DB 2DIEA 1SUJA 3ROLB 4F37K 4HS6B 1J9SA 3HUJF 1QMUA 3GIZH 4PYGA 2WV3A 4TOYL 1E67A 1N70A 4QJ5B 3C5JA 4IRSC 1IAMA 3HNVL 1DBKH 5K5YA 1R3KB 4GKZB 1I9RL 4MRBA 2BIMA 3SE9L 5F7HA 4K5MA 3BAXA 1KBGH 3EF4A 4F7TB 4HJJL 3SKOA 4HXAL 3GNML 1C7TA 4MJIB 4CU8A 3VFRB 4X2UA 1OP9A 4JUTA 2WLJA 5F9OH 2K0RA 1VKXB 2P5WB 2CJTA 1INEH 1AD9A 2FDBP 1ASPA 3MFFA 5CZKA 2Z31A 4KDTC 5DFVD 3VFNA 2ODIA 2YGNA 1YAIA 2B4CC 2QV2A 3NIFB 2PO6C 2ZOWA 3QBTB 1A5FL 3O6LH 3SPJA 4G7SB 4NRYA 4CNIB 3CC5A 1PZUB 1IE5A 3TWCL 4X5XB 2NUPB 4PRPE 4MJ6A 3M6DA 5CO1A 1MN4A 1E4KC 1MJ8L 1RY7B 3WTXA 1OAZH 5D96B 2OZ4H 1VACB 3RVUD 3SDXE 1EO7A 3A23A 2SEBA 3FT2A 2AK4E 2NNAA 2L7EA 2IPUK 5TPWL 3BDXA 1J5DA 4UTBL 1PY0A 4IRJA 4YSEA 1FIGL 1EPFA 1PDKB 4L2LA 4BQ6A 3V6FB 3UEZA 2X53A 3KLKA 1LL1A 4UT9H 3GRWA 2WB1A 2L0DA 3RAJH 2VDPB 1RIVL 3ULUL 1IQWL 5GRUL 4NRZA 4J8RA 3SOBL 5FV2A 1JK9A 1IC5L 1PKQB 3HB3B 3S37X 5CD3B 1FH5H 3QDJD 3LRHA 3BOVA 1PQZB 4TMPA 3DRQB 4JL1A 1G0XA 1BSIA 2CDEA 1CD1B 3OAWA 3FUDA 4YHLL 4N5UA 5I8KH 3P4LA 4IRJB 1KIRB 4BFRA 3G7TA 4KUCF 1VERA 4R7DB 3TJHD 4B9ZA 3CD4A 1UWXK 4R4ND 5HY9A 1ET8A 4GP8B 1IGML 4IEFA 3V9CA 5I8EB 1A66A 3DUHA 5CJXA 1OSPH 4Y2DD 4NQED 4B60A 5DLLA 2XZCH 4YSSA 2E27H 3WFZA 2APXA 4OZIF 1I3RB 3CLWA 5HP5A 4GAGL 2PR9A 3QRGL 4ALAL 4S1DD 1IM3A 3BJ91 4AE0A 1HS6A 4HWEL 9CGTA 3ABGA 4YHML 3KPRB 1XMEB 4JFPB 5DHVH 3G5XA 5D7KD 2H0EA 2I85A 2VKWA 3EJRA 4XBEL 3RIFF 2KZWA 2WLNA 4M8RA 2BY0A 4FQLH 2JB6A 4WU5A 3BQUA 5CBAA 3QPXH 1JNJA 2Z35B 1OGPA 1NIAA 4R26L 4BQBA 5CKGA 3D2UD 1IC4L 2NY2B 4GYBA 4HIHA 5EBMA 5LGKA 4ISVB 5MENE 2AJVL 3G6JA 1RPUA 2X4QB 1NC4B 3HRZB 4YHIB 5EU6E 1FSKB 5CGMA 4YSUA 3E38A 2EH7L 2X1PA 3ZMNA 4YBHA 1L7TL 1HHKA 3M17B 1SJXA 1LDPH 4XN5A 1P84K 1A25A 2YAFA 2V3FA 3OB0H 3VWJB 3ESMA 4FHBD 1BF8A 2FHFA 4Q9RH 3P30L 3FT4B 4ZFOL 2Y07L 1CLYL 1QSED 4KKQA 4XCCH 5ID0B 2DQEL 5ICXB 5KBDA 1FJ1B 1RKRA 2BINA 2HKAA 3VFSB 1AXTH 2RALA 3IS0X 4LVEA 4N8VG 1J0YA 3I6SA 4FTVB 1X7QB 4P2OD 3C09C 4WIQA 5ERWA 4GY4A 3DJRA 4BIKA 3BE1L 1KENH 4IHOB 4NKQB 2HA1A 3CGTA 4D0CA 3MV8B 2ZXAA 5JW3L 3Q06A 4MA7H 1HOCB 1AI1L 5KSBB 4FZEH 3LV3B 4M8QA 2W59A 4F8NA 3OZ9L 5B3JF 5I1JH 5I5RA 3GMPA 3B2MA 2Z93A 1I1YB 3DGCR 3MLXL 2BNQD 4NP4H 4LCCC 4TNEA 5M7QA 2XWEA 3O0RH 1U6AL 1XWVA 4FZEL 3C09B 2X4OA 1JERA 4FHJA 4WGKA 5T3ZL 4EZKA 5JIQA 4ZZKA 1DUYA 3O0RL 2WLMA 3ZL2A 3IKKA 4PY7B 1P4LA 2VMDA 2BNQE 2Z0UA 1GGIL 3CFCH 5MEQB 3WJLA 4XOAA 1FZOA 4Q2ZB 1TQCB 1WBYB 3OJVC 3F58L 3GBMH 4IBLT 1E30A 3VH8B 2KKQA 1JGLH 2I9TA 1YEFL 5D5MF 5GGTH 3OSKA 3VI3F 1N9PA 1UB5B 4U1IA 5DVNA 1X44A 3NJMA 3N1QC 4NRZB 1SQ2N 1KJ2H 3WG7B 4WHTA 4KQ0A 5JMOC 2Y7QB 5KVGE 1A4KB 4LLDB 1BZDA 4UM8B 1UB5A 4U1IB 3WO4B 4Q6KA 3MV7E 2HG5A 5JYLA 2GT9A 4AL8C 1XTMA 5I1IL 1PLBA 4AW4A 1OT4A 1A7RH 3WTSA 5IOPA 2N7AA 2P80A 2OSYA 4AM0A 4TSBL 1WLHA 1J5OH 1BVKA 1KJMA 4HJSA 2C34A 3D8MA 1PEWA 4G71B 1MFEH 3U82B 1PJWA 4FHKA 3ULUE 3CHOA 5B8CA 2OBGA 3LNDA 4XP5H 4B97A 3AB0C 5EC1A 4HH9A 2E6QA 1IE4A 1PD1A 2QHRH 1HNYA 4WEUD 1B4LA 3GZOA 2DIAA 3HPJA 5ACLA 2ZTBA 2GJRA 3UL4A 3HN3A 4NQDD 3NESA 4Y9CA 3KYKH 5SWZD 4ELMF 3O3AB 3RI5F 4HK3N 4P9MH 4W9KC 5D2NC 4DO5A 4Q6IA 1ZK5A 3U25A 1NEUA 2CBPA 3DECA 1B4TA 1EHLH 1MFCH 1X5IA 1ACCA 5FKPB 3X11B 3BPOB 5IW6A 1QSEE 1FIEA 1ZK9A 1F2XK 2AJYH 3H55A 3FO0H 4QRQA 1P4IH 4WKZB 3KNBA 2B59B 2BIQA 2IDSA 2RBLA 2WO3B 5EU3B 5K9QI 5DF0A 2FO1A 1SPDA 2O61A 4X42A 4J12A 3RIAF 2WLLA 4MJ4A 3CBRA 1IL1B 1XFPA 2Y2YA 1J0ZA 1CI3M 2DQFB 3UABA 2ICWJ 1GPOL 4ZMLA 3UTZB 2PYED 2B9BA 5F70A 3UJJH 3D18B 3PFUA 1YJDH 4X8JA 5FGSA 3TBSA 4Z7NE 1UASA 5TE4H 1D7BA 2QR0B 3GXIA 4YXKH 3VD5A 1A7BA 5L7XL 1U4EA 4M3KB 3EYFB 4TL5A 4XAWL 4Q9QH 3HE6A 4F9PA 2P80D 3S48A 3X3FL 4JHBA 3IT8D 2DQIH 1MFDH 4X5XA 4PJ9B 4P2QE 5SX5H 1GIGH 1LEIA 4LSVH 2DH3A 3RVWD 4GRLD 3HI6L 2WQAA 3IJSA 4PGDA 3HJ0A 2QVFB 1UWEH 5CLZA 2PP8A 3O2WH 3SDCD 1S9VA 1T7YA 3V79C 4FN0A 5KSAA 3POCA 3RUGA 5AVZB 1N2RA 3OX8B 4HWEH 3GMPB 3WUWA 4XMZA 9PCYA 5GGVL 2IAND 2VSCA 5EO0A 2PYEA 3ILQC 3VQ1C 4HCGA 1ZV2A 2DWEB 3PGDB 4R0LC 5I17B 3WNLA 1JSYA 1KJ2A 4PJ8D 1BXAA 1ZVYA 5AG9A 5BNXD 1AXSB 2AANA 3JV4A 5IMMA 2VXQH 4NUJB 3ZTEA 1CGSH 3MAWA 4I4WA 3QI9D 5FCUH 5HHPA 3B1TA 1FQ9C 5E2WH 2H1PL 4LAQH 1GJIA 5I0WA 2W60A 1AGCB 1EO8L 1F11B 2ESVB 1TZAA 3LS5H 4AV0A 2J1YA 1OSZB 2WNKA 4JDZB 4J39A 1RUQH 4D7PA 4PRHD 4R7VA 3DMMA 1CLYH 4KKAC 2N56A 3OKMB 4BFIA 3MV9B 3GO1H 2G2NA 1AAJA 1T03L 3GSXA 1QYGL 4JFFB 5JW4Q 4YHPB 3D52A 5CF3A 5JHDB 3RWGA 3TCTA 4Z7QB 2CPCA 1N4XL 4ZQKB 1JE6A 2NY1B 3H2PA 4PJEA 3PWJB 1I8KA 4WEMB 3OPUA 4UCFA 4WU7B 5I0DA 4QJ3B 4J1UA 1HHGB 1O0VA 4MJHA 1G84A 2J8OA 4PVNA 4QLRA 4LCCB 3P4OB 4TF4A 2P52A 5K9OA 4JNXA 5FLUA 4PJBA 2YS4A 5LBSL 2Z7ZA 3HHRB 3P3UA 3V7MA 1TEGA 3P9MB 2YMOA 3KBEA 3PNWA 2XQYG 4PB9H 3QEQA 3LHAA 1PSKL 7CGTA 2QEJA 4PLJD 4AC2A 1ZLWH 1AHMA 1LE9B 1YEWA 2NY6D 4LHJB 2D7MA 2VAAB 1A9BA 4LSRH 3VFTB 3T65B 5LAXA 5T3ZE 4HUCA 2NMSA 5C0JA 3IDIA 3TV8A 2BNQB 1A3RL 4NQTA 4OF8A 3ZT5A 1AG6A 3RX7A 4I3RL 3HS0B 3B1UA 1FL3B 2A77H 3MV8D 3LN9A 3IDUA 3UDWC 3BJLA 5AD0B 1P9MA 5CZXC 1A9VA 1D5ZA 4HIIB 3EYQD 1ZCRA 4FYSA 3DX8B 4MDJA 2AJXL 5DUMH 3VYNA 4HS8H 3AY4C 5F89B 5LBSA 1U8IA 1T0PB 3O2DH 1UA6H 3TBWB 2GJZA 4FG4A 4RFOH 5FKAB 4HK0B 3EGSA 4KRNA 2P8MB 3DURB 4MNHB 4U1MB 1XF5A 2UY7A 3QPQC 3PP4L 4QMEA 3DGGB 7PAZA 1WGVA 5FM5M 1DVYA 5CXPA 3Q2CA 4FYQA 3L4XA 5HVGB 2ZUTA 3KPQB 1KCLA 5J6GA 4TV3A 3U36B 5T33L 1CCZA 4QHLB 4OZIB 3HG1E 2NNAB 1MFUA 3VW3L 2IBGA 3QNFA 4OD3H 1AS8A 3K0YA 3BDYL 4XB8A 1KG0B 1T1ZB 1HAWA 2J8UB 3PAVA 1KB5A 4QRTA 4DTGL 4LOFA 4QIRA 5GRWA 1ZE3H 3QO1B 3ULSA 4YPGA 4F7MA 2VLME 4J3BA 3ARFA 3PXJA 4L9LB 4HS3A 1S4IA 2R29A 4HAGA 1E9PA 4KITB 3ESNA 4MNGA 3TEWA 2Z31B 2QGBA 5F44A 2HJFA 3FT1A 2BOCA 1GY1A 3E6HB 4PJGB 4AENA 5JOFB 3QR1A 4MNQE 3CPLB 3L4TA 4RX4D 3SY0B 3H42H 2JF1A 4AOFA 4HMCA 4PWHA 1F6AA 3E7JA 3EO1B 4GEIA 1CYWA 4OF5A 4LNVA 1CGYA 5B4MD 1H6FA 1RK0B 3VE0B 1G5GA 4L9LC 4DN3L 2VZ3A 2X3BA 4XVUC 5E1HB 3THMH 1IAII 3H42L 3EJJX 3PWVB 4YHNA 3N85L 4MMZB 5HGDA 2I25N 4ZUWB 3N04A 4OAWA 5DZPA 5F7NC 5GRUH 1N0XH 2B14A 2O5NA 4WNQA 3HAEG 2IFFL 2AV1B 1GPOH 1XH3A 2Z65C 4HWBA 3TC9A 2HXAA 3UYOD 4K3DL 3O41A 5CLTA 2ZUWA 1OPGH 4MXWL 5TQ0L 1RZJC 5DEGB 5GS2H 3L45A 4NO0A 2D7PA 2HSIA 1AD0A 1JHTA 1LWHA 3ARXA 2QKIC 1E4XH 4IOFC 2EO1A 3QXAA 3OJ2C 3OLEA 3QZLA 3TGXA 3MSPA 2IV8A 2P5ED 4YVNA 1URIA 3O6LL 1E4XL 2HT4D 3A47A 3LN4B 4AK1A 1JZ4A 3CHQA 1D5BA 2B1AH 3Q3GB 3DNKA 3UTSD 3VWKB 3FU9A 4F15B 1JTPA 5DJZB 1YPZF 1EWHA 3OHXA 1WZ1H 4GT0A 4PJAF 4G6AC 2X4TB 2W1NA 2CZNA 3N42B 5CLXA 3WLWD 2EILB 3F12B 4NM8L 1TEFA 1UZ6E 2BY3A 3TO4D 3ULUC 1T7VA 3N9GH 5I0ZA 4AZ8A 4JZOB 4XZUA 5JPMA 1UQSB 2RR3A 2EUZA 2C9AA 3RDTD 3OB8A 2COVD 1USZA 3L4ZA 4PJ7B 1CFMA 4URTB 3TIDB 3Q2WA 4JMXA 5B38B 3H54A 4JRYB 4AYBA 4ZQKA 4JCMA 5IFHH 3EUDA 1QZNA 2V5RA 4NN7B 1UA7A 3GRWL 1RFDH 4NO3A 4XP1L 4Z7VA 1PG7X 1VZHA 3TVMD 3BP5A 4ZNEA 1HWGB 2VDQH 1FORL 2E8ZA 1D6EA 5IJKC 4AGMA 4N8VB 3WMSA 1F1DA 1QTSA 3BVXA 3R1GH 3PV6B 4M5YH 4WO4C 1VADA 3I3BA 3VD2A 4WW1B 4IU3B 1A0QH 5EIQA 3LMJL 3LKRA 3ARZA 3KPPB 3NFNA 4OV5B 2DQDH 3K1KC 4TUKL 3VXNB 4Z7UF 3P2TA 5IBTL 3BP5B 3I9IA 4XPGL 3BFWA 3L3HA 1J8KA 1E5UI 1F56A 2YAQA 2CO6A 4RSYA 5C0BB 1I1FA 1YY8B 1AZRA 2BNRD 1Q9OB 1R47A 3EUUA 3BX7C 1S3KH 2XACC 4F7PA 3W9EB 3KLQA 2BIPA 2J3SA 4EO5A 3QI9C 2QGDA 4NC1C 4N0FA 4WO4B 4HUWA 3US1A 2CALA 1TR7A 3ME0A 4P5TD 1M1XA 4PG2C 2XTJB 2GC7C 4L48A 2ZP9A 1HINH 4MMXA 3B43A 1FWXA 3U79A 3RX8A 5JOFA 3GMQA 4FQLL 1AI1H 5IVOA 4JPIB 3UBXA 1V3JA 4JFXA 4MTMA 1L0QA 2CHWA 4HS3B 4X9GA 4HUVA 4K07A 4XCFL 3B3BA 1XGZA 4AMWA 2GCYA 1XVSA 2X0WA 2WYTA 4ZT1A 1NCNA 4YE4H 3KPOA 2WUCL 3DKHA 3SBPA 2R8SL 2UUDH 5DJ6B 2QGCA 3W37A 2BK8A 2ZNWA 3WMPA 5BRZB 5E6IC 2VZUA 5L88H 2V5TA 2JB5L 4G8FA 3SGEI 5FYLL 4K4KA 1G0YR 1D9KD 2CAKA 4WFEE 2VWEE 4HV8A 1H6EA 5JW5A 3G5VB 4XN2A 5L88L 3U46B 1NGXB 1T1XA 5GHWL 4HD5A 4UQDA 1W72A 1E4WL 4G8GA 4FULA 5EZIL 2QTVA 4Z7VB 3IMTA 4WHDA 1QUNA 3S5YA 5KANI 2NY7H 3L5IA 5E70A 4GNKB 4CN6A 4MMZA 3BAEL 2OMWB 4YEEA 1Y0LB 3MJ8A 2CMRL 2BNRE 2P5EB 3A21A 4L3CA 1OAQH 1MCWM 3W1ZA 1RP8A 3HVNA 3HG1B 2WO4A 5I1JL 4FNTA 1VEMA 3D09A 3WJMA 2QZ5A 2IQ9L 1ETJA 4KKZA 2R51A 5HI5D 2A9DA 1THCA 4YSDA 3RY4A 4AQAB 4QXTA 1OAQL 2FJGB 4LL9A 5JZ7C 2WJ5A 3K6FA 3JV0A 4JO4L 4RNRB 3FTUA 1NBVL 1RVFL 2GAZA 5BW7C 2FR4A 3ZJAA 4N2LA 1PAMA 4NDMA 4XWGH 2ZXDA 1UCTA 3O3DA 2XWXA 5C07A 2XETA 2WTRB 3EGXA 4YHMH 4TQHA 1NPJA 1QFUH 1DQQA 1MHPL 1QHPA 1OP4A 2H2PD 5C07D 4MASA 2WWOA 3GINA 2J6EH 3GMNA 1P5VA 5I6XB 2ZICA 2IIJA 1FNHA 2C9RA 4ZZFA 1YY9C 4K2UL 5DMGC 4HOXA 4HPHA 4FX5A 4LIQE 1MFCL 4GG8A 1OP3K 4WFGD 1XSKA 3E9TA 1UJ3A 1NCGA 3ETSA 4JFHD 4X6EB 1E5AA 3WHXA 2X1XR 2YSSB 5BUGA 1C12A 4U1JB 1CN4A 2BSDA 3PV7A 4KRPC 4K3EH 4M7KH 4KGJA 4ATTA 3VD3A 4P3CL 4GXVH 3NAAL 2VDPL 2GJ6D 4G3YL 4UT9L 4GG8B 1AKPA 4OZFA 4KNTA 5KJRH 3II1A 3WDJA 1JN6B 1Z9OA 4FTVD 4YHNB 4A7UA 4JCWA 4JHAL 1R6VA 4EDXA 4GRWF 1HSAA 5FUCC 1S6NA 1YECH 3BEVB 2FWLB 5HGAB 4ZG1A 4OD1L 2J88L 4IOIA 3LHPL 1KCSH 2X5PA 4TLTA 1L9MA 3EXJA 4YMPA 2EAEA 5IEKA 1Z1WA 1MFDL 1ZLVH 3MRHB 1MWAA 3S8GB 2HCZX 2OL3H 1QKZH 3OXRA 1KXHA 1YQVH 4MA7L 5I18H 1KJ2B 1FNEA 4HLZG 1A2YB 3FB7A 4UTBA 5IB1B 5IV2B 1HL5A 5D1ZI 2KH2B 2Z93B 3CQFA 4H13C 1K4DB 1S9YB 1OTSC 3BGFB 4PS4L 1WF5A 2BCKB 3V8CA 1WFUA 4JREB 4N2EA 1C5BL 3CHRA 5GZNA 1NFIA 2D7TL 2VZ1A 1BJ1H 1KG0A 1T1ZA 5GJSL 3ZDYF 5K9JL 1S7VB 2OR9L 4N2DA 2OAAA 3FFCE 3HC4H 3N1FC 4PCYA 4U6YB 5FX3A 4KTDH 4OM1H 3MTRA 4PRBB 3MRNB 3HS8A 3MRHA 3SJVD 3VFGL 3TA3C 1JGDB 2ICEA 2N7BA 2P47B 4X0NA 4D9RE 2YQBA 3KEHA 4L2YA 1P7KA 5DO2C 1JPGA 3CMGA 3P9WB 4PJEB 3VMOA 4JFSA 5F1NA 2WVSA 3QDMD 1HNGA 1IGJA 2FGWH 4QT5A 1G6VK 2RAMA 2PYEE 4GO8A 4Y19A 2UWEE 4YR6A 5FFOA 1BQHA 4N24A 4NYLA 2NQDA 3IMWA 3WJJC 2YEQA 3GB7A 3KBFA 3RUGE 1SLUA 1V3LA 2L4OA 2IANE 3BVNA 2H0PA 2WLLB 3CVIL 5F7MC 1BZOA 4K7FB 4OFDA 1QFHA 1CDGA 2G0LA 3MXVL 3QQXA 1GGCH 4JY5L 4JO2L 4AC4A 4FKEA 1P7HL 2G2RA 2BSTB 2CR0A 1EFXB 4XCCL 1SN2A 2HMIC 4G7YL 1CT8A 1WRFA 5JPMB 2LW3A 4CSZA 5HPOA 2ZX5A 1PU0A 3DO4A 3WFBL 1NBZA 3S5LA 2R0KH 1BIIB 5INDA 2W92A 1UH4A 3W57A 5L4JA 3DUUA 2MQCA 1G4RA 2HUHA 4NQDB 1DVSA 5CWSA 1D5BB 3Q3GA 3VWKA 2W9EL 1U8KA 4XNMB 5IMLA 3DX6A 3TP4A 1I8LA 3O3DB 3QIUC 4HSCX 1PGRB 4HUWB 2PPDA 2VDKL 4JO1H 1LE5B 4Y2LA 3FB7B 4HWZB 5IB1A 1A8ZA 4PY8J 2IV9A 2BJML 3NGBB 2KPNA 2E9BA 4NBZB 1AVAA 1TU2A 1AO7B 2ISDA 1NICA 3QUYA 5B21A 5I82A 3Q2NA 3VFWA 1DO5A 2FJFB 4U33A 3AADB 3BLBA 4OT1L 3BEWB 1ZMYA 4OJEH 3RTQC 3ZVVA 4K8RH 4IU3A 4XVTH 3QIUB 2H1LM 2B20A 3S88H 4OUOA 3PS6A 3QARA 1NCTA 3MJ7B 1L3NA 1WUZA 2CBMA 3HPLA 4NHUA 2W0FB 5I6KA 2Z6FA 1N8ZA 3E2HC 3U1SL 3LZFL 5SWZE 4Z18A 3FH5A 1E4WH 3DOSA 3DA0A 5EZIH 1FPTL 1OSZA 2EIDA 3H9SA 3ZDYB 1CGVA 1GSKA 1KGJA 1DSWA 4PG9A 4P05A 4OF6A 1OHZA 5ECJE 3TFBA 1MFAL 5C0CE 1R1CA 3RTQB 3OWRA 3P3SA 4FQQA 3DIFB 3HC2A 4CSSA 3S37H 5D1QE 4D0DB 4DZ8A 4PGBB 4M7JL 4MD5A 5KJ4A 4R2GC 43CAA 3WU1A 2B15A 2DMKA 1Q0EA 2BSEA 3OMZA 1JZDC 3PGDA 2VLJB 5ABAA 4NOFA 3SYPA 3ARBC 2GHZA 1UWEL 2W65A 5EOCH 1Q38A 5H4YA 3SDDA 1OSPL 3MGOB 1TZ8A 3CQPA 3SYQA 3VFNB 1EZVX 1LO0L 1SEQH 3AXHA 3K8LA 2IOOA 4LASH 5JHLL 3MLTA 1T0NB 3BESR 5IKCA 4IIQC 4BH8B 5FO9B 1GGIH 3MZGB 4PTTB 2FZ3A 4JPKH 1U8PB 1V3MA 2CBOA 2A1WH 4S1RL 1NCIA 3MRIB 5G5DA 3T4YB 3HE6B 2XFGB 1U33A 1A7QH 2ZXCA 5FCUL 3LVEA 4EAEA 3UACA 5A43C 3MJ8B 2AQRA 1DLHB 2R1WB 4JM4H 2JK5B 3F01A 4Z78B 1AGBB 3VRLE 3NFPA 4JQIA 5AAPA 5B3JE 4DIXA 4OCYH 5EWIH 1X7TA 3LKNA 3MJ9H 1NPNA 3SDDD 3QYMA 3PCYA 4Y4KB 4ZNCD 4R4FL 1MWOA 1CFTA 2AJYL 4UM9D 3UP6A 3QNXB 3QUXD 4NLHA 1KACB 3ASOB 3V6FA 1PFOA 1IGFH 3KPMA 3L3GA 1PG7L 4XNUL 3ZKSD 3QDGA 3IETB 1MG3C 4JPSA 5C8JA 1OKEA 4MQTB 1JNLL 4XP6H 2CRZA 2PLTA 5TQ0H 1W80A 2F08A 4F8PA 2CKBA 1A7PH 4ECNA 2CO3A 2Q2LA 4FD0A 1U8LB 3AGVA 3EZ8A 3QZPA 3BGFC 3EO0A 5FO7B 4KJQD 5LGJB 4B9YA 2X9ZA 4NPKA 5E9AA 4FXTA 2WXHA 5DR5H 5AAWC 3FO2B 1CB4A 3Q1SL 4WTWA 2PNDA 1UD2A 2HVBA 5JDSB 3X3FH 1G87A 3ZLQC 5KBKA 1RUPL 3WENA 3IDXH 1IQDA 3GFUA 2AZUA 1DQJB 1P7QA 2BW4A 3ATBA 1JXJA 1KB9K 1Q0XH 4KTEH 2BH0A 2X89A 4OT1H 2DM2A 2YARA 1SEBB 4J2QA 2ED9A 3D0VA 1IBBA 2JKJA 3I9GH 2BDNL 3PAUA 1YEDB 3MLVH 3ENEA 3D69A 4JGUA 3BIKA 3GS0A 4UT9A 5KVFH 4F2MA 2Z34A 1H5BB 5KEZA 2WQRA 4O02B 3SQOH 3JZYA 5EDSA 5LGHH 2Z9TA 1QR4A 4NLAA 2HFFA 4QHPA 1OCZB 2ED7A 2P8MA 5DS8A 2PN5A 1RJCA 4UILH 2B4CH 4DOHE 4GI9A 3TJPA 5T1KA 5ISZE 1FORH 2Y3AA 4P9HC 5JLZA 5LWYL 1D9KC 4TUUA 5L8JB 1A0QL 3HKFA 4LEXH 3O8XB 2Y22A 3TO2B 1BZ7A 3EDKA 1OALA 3NIDF 1JZ2A 5E24E 3VA2C 2QSTA 5FR3A 1MNNA 1L9OA 3NPSB 5E23A 3QISA 3L3KB 1PD0A 4GRWB 5KVGH 4S0SD 3TBBA 4PJGF 4NUQA 3B9EA 4MDIB 4BV1A 2XVGA 4FEMA 5TE7H 1I7RA 3FSWA 3TIDA 2JV6A 4DN4H 3WFBH 1VFAA 1JMXA 1DBKL 5I71B 5EO0B 2DN7A 2VR9A 4NM8H 2XN2A 2F54B 2QQLL 2KZ1B 2BP0A 3H9SE 2GABA 1R3JA 1RH8A 1QSFB 2BVPA 1KF9B 4LESA 4LLUB 4KNSA 5C6PB 3LRLA 1ED3A 5DFTA 4PMFA 1RHHA 4M43H 2A6JA 2F15A 4P23A 2ADJB 5DJDA 2QDWA 5I73B 5IUCA 1C5CH 3RGVA 1M7IB 2XKUA 2WZ6A 5HHME 1JFQH 4G7VH 4XO4A 3HFFA 1OY3B 1ZD6A 3VFRA 4YHOH 5GZND 2CIIB 3T2QA 2P24B 5FOJA 1UXWB 3GSXB 4R4BB 1JWUB 1SYVA 2MH4A 1DZBA 5E95B 1HXYB 4NO0B 3TZVA 4JFEA 4R0LA 1KCBA 1PQZA 3FONB 3C6LA 4NWTL 2X4UB 5DJXA 4N90D 2AV1A 2XZZA 5DMIH 4OM0H 4AV5A 3ZTJG 3IBOA 1AH1A 3G9AB 4OIFA 3VD1A 5F97E 3PL6A 1BQRA 3V10A 1UD3A 1DLHA 1IQWH 4IIZA 3P0VH 2CBQA 3FONA 4LP4A 4NGHL 5D7JA 4PG2A 5DHEA 3RGVD 1CZ8H 3T1FA 4ZFZA 3VH8G 4EQ3A 2GEQA 1BYOA 4KH9A 3BAEH 3KWXA 4MCYB 5H37A 1VLXA 4Z8FH 2XQYA 4FTVE 1IGTB 4BH8A 1AG0A 5HVFB 3RTQD 1E9OB 4I2XA 1JGEA 2ERJB 5IJVA 3C5XA 1MEXL 5EOCL 4PVBA 4D3CH 5FAAA 5F71A 1FLRH 5DSCB 4MD0A 5CUSL 5KSUB 4PPTA 2ZWLT 3H7LA 1IGMH 1ILUA 1XF1A 4DEWA 1UEMA 3GSNA 5SWZA 3B6SA 4WY7H 1L9RA 4NPJA 2DKUA 1O7SA 1BXVA 2AVGA 2Y2TA 5PCYA 1QEXA 4QTIL 1ZT7B 2E27L 1NCBL 2YFNA 4FQXC 3RPBA 2R0ZL 4JFDD 3S36X 4JRYD 3RFRA 5ADPL 4YDLC 4BWUA 4UILL 1EZSA 1FLTX 2Z7WA 4ZAKC 2Q76A 4JFUA 2EDHA 4TPRH 3IETA 4FXLA 4OZIA 3EDEA 3CVHB 4RMVA 5D7KE 3MRPA 4W9EC 4HGWB 4B0MB 1E3FA 1WFOA 4K2UH 1A6VH 1SJEB 3LS4H 4X9BA 4XZ4A 3MJ9L 4NKDB 4IJTA 4J3OC 4R26H 1JHKL 3SQBB 3DUSB 4QXUL 1BYNA 3FMGL 3NSFA 1HL8A 1BQUA 1UCBH 4A7GA 1XF5B 2XA3A 2PWHA 5KZCB 5CEYB 1A4AA 1DJYA 1WAAA 1XL6A 3SPGA 1XX9C 3P0GB 2RFXA 5IROD 3QIBB 4Y4KD 2CG9X 4NKDA 1CBVH 1NANI 1UCBL 4TQPA 3GMMA 3BRFA 1CIUA 4FFZH 4OSUH 2MHAB 4XMKH 4BDVA 5A16A 2NW3B 1KWGA 4JKLA 4WFHE 2I32A 1CQYA 1AKJA 1AGFB 1HH9B 3NABH 2R56L 2AI0L 2BZ7A 5DA0B 3L3OA 4NNYA 1L6XA 4X4XA 2QPDB 3BPOC 4RCAA 5MEPB 2YA0A 1A1NB 3O3BB 2XBTA 2OW7A 2VUOA 4RMUA 2VYRE 2HLEB 4KRLB 2KQMA 3GHBH 4A38A 1CLOL 5CD5C 2PWFA 2R0LL 1DVFB 3DHJA 3QHFH 1MFBL 3NQIA 3R4RA 3HG5A 3GBNL 1A6UL 3DXAA 4D9QD 3WUWB 3EOTH 1ED3B 4OCXH 1JZ7A 1JZIA 4XPAL 1OOAA 4PJFF 2YAMA 4X83A 3MLVL 3TT3L 3NSXA 3FF7A 4NNPL 2Y0SA 1Q9LB 3D30A 1CVRA 1E7VA 5KUMA 1Y6NR 5GQBA 3L4UA 2CNYA 1E2ZA 1P6AB 2GFBA 2IWEA 2Z64C 4N2MA 4NP4L 1R33A 3RWFB 4CADA 4X6FB 1H3UA 4HZ1A 1TMQA 2DPKA 2OSLB 4IJ3C 2XVBA 5FW7A 3FCGA 2K8QA 3L3KA 4Y88A 4H88L 4ACPA 3S0PA 1CJYA 2V17H 2EE0A 2O30A 3ZPDA 1X6NA 4JG5A 4AGLA 3PY9A 3MRGB 4G43A 5DURD 5T5FA 3VX0A 3FT3A 3L4VA 3FFCA 2FATH 1YEJH 1KYFA 4OZHE 1IL1A 1DJXA 3DTUB 5CCJA 2NR6A 2YJQA 4JFEB 3X13A 1R3LB 2WK2A 4A6YB 5SWSB 2WLZA 1TU2B 1I31A 4GAFB 1N26A 2XZCL 3MRNA 1T04A 1S7QA 2ZSWB 1MCOL 2KDGA 1UM5H 1MKFA 4G9FD 4JQIL 1OP5K 1HIMH 1KNOB 1MCCA 1KWKA 4XMUA 4UANA 1RZGB 1FRGH 1WGOA 3B56A 4R2GD 3KDMA 5ADPH 4BSVB 3H9HB 5LDSA 4ZO9A 1HL9A 4UQAA 3ARQA 4N0CD 3HZYB 1S7UB 3K2UH 3RUGB 5E1AB 3L4YA 1EERB 1OEZW 4K3JH 3LSOA 3WLBA 2F54A 1A4JB 3WS3A 1T04B 5JDSA 3NTCL 4ZFGL 3QQ3B 1N3NA 5EPMB 3L9YA 5JIHA 5J9PA 3D33A 1JNNL 2X4PA 2BNUA 4PP1D 5TK2A 3TTYA 2K6YA 3MX0A 3IKCA 4AM0B 3LXUX 4CW1B 4XNQA 5C0CA 1RZQA 2FVNA 3IDGA 4PI2A 3EYFA 3ZBMA 1JN6A 5F96L 1ZT4A 3QDJA 3IGAB 4X7FC 5KOMC 4XPHH 3D34A 5KZCD 4N5ED 4KXZI 3UTZA 2PW2B 1KY6A 4NXSA 5K69A 2VDPH 1U3JA 2YWZA 5DMJB 2X4QA 3K7UA 1SJEA 3D6GA 2EH8H 2F7OA 2ERJC 4OCMC 3TNMA 1KUMA 3ECVA 3GXUB 1R19A 4CUCA 2C4XA 2AQ2A 1YNTF 1U2YA 2LU5A 2X70A 2WNXA 3T5WA 2GBVA 5EN3A 4E42A 2NY1D 2H41A 4FL4B 5D2LA 4KVCL 2JIXD 1FGVL 3LQAH 2CHXA 3DXAB 4MVBD 3SCMC 5HXMA 3TVMA 4EZMA 1MI5B 4WUKL 1FCCA 2GYSA 1RHHB 4R8WH 3D39D 2BP5M 5CIPA 1W0WB 2BY2A 4A7QA 2J5LC 3P73A 4FQPA 1S9WA 5DXWA 2Z92A 5IB2A 2ZOLB 7FABL 1JGEB 1P1ZA 2DDQL 5CWSB 5EF2A 1AFVL 2DQUH 4OZFH 3UAFA 2TRHA 3L9EA 4W9DC 5D6DC 4HBQA 1UB6B 4GSXA 2WBXA 5FGRA 2E75C 5FM4A 4GBXA 3AU1A 4KI5E 1U8LA 5E6IA 3MA7B 4M5ZL 3ATFA 3OLDA 5I15H 5DD3L 2F8VA 1GW6A 1FO0A 2J5LB 3MOBH 5TDPB 3SO3C 5IB4B 4AYSA 1KULA 3KYAA 4RA0C 4M93C 1ID2A 1Z7JA 1S78D 2HRPL 4DP8X 4LVOC 2Y7NA 4OJAA 1BECA 5I1KL 1J88A 5KVEE 4G6KH 5FYJU 1OD9A 1UM5L 4M1GH 4Y4KA 5LDUA 4BXSV 4IBSA 1NUDA 1JV5A 1J7VR 1OAUL 1P6WA 2J44A 3FFDB 4PJ8C 5CMAB 1U92A 3SJVB 3ZSSA 4URKA 3O81A 5IF0B 2R1WA 2AJSH 2WXJA 4N2FA 3UO8B 1KJ3H 1KCUL 3DHUA 1A6TA 3DYMA 4ZAKD 4PP2A 5C0DB 1KB5H 2YGQA 4L4VB 3WNIA 2BIOA 1HHHA 1N0LA 5FGCE 3WAKA 3RDJA 1LO0H 1SEQL 5KG9A 5BOZG 2JJVA 4U6HA 2CJSA 3HLKA 3A6OA 5EU6A 4RAVB 4P4KD 1UXMA 5CFHA 1S9XA 2FR4B 2A73B 3KR3H 4JB9L 1UKQA 3WFCH 4XR8C 4B3VA 1YNLL 1QZ1A 1V7MH 1TLKA 4AQAA 3TYGH 5B1CA 4I77H 1NINA 3N1MC 3SDDB 4G1MA 4WJG3 2Q87A 1KIUB 4WV1B 1S8DB 1HI6A 2NXZB 4NM4H 4AL8L 4Q9CA 5EUKB 5AVVB 4TSCL 2A2QT 1U21A 5GGVY 1NEZA 2WXFA 1QLEH 1MVUB 2XNAB 5I9QB 2NZ9D 1OIOA 3LQZB 2F5AH 4XE5B 2M8XA 3NN8B 2AZAA 4NM4L 4AL8H 5I1LA 1K9TA 1TPXC 1WWWX 4LSRL 1I9IL 5I6XC 1BFVH 5B39B 1XCQB 2WUCH 2EYRB 4H40A 3HI5L 3UBHA 1UZ8B 3PQYE 3KJ6L 5BJTA 4IS6B 3C6SA 1IKNC 1WITA 3BVVA 3ELAT 4DH2A 1JNLH 3ZDXF 2UXVA 3L4CA 5HYSA 3DOSB 3RZCC 4LLWA 3LNHA 3DO7B 1AR2A 4W9FC 3E6FB 4GEJA 3QJHB 4JFQB 2GUOB 5HD8C 1NMBL 4L29A 1YECL 3PL6D 5GS1B 3KZ8A 4PBDA 4RA3A 2UVEA 3ZIYA 5B38A 3GHPA 3D3VA 5GIRA 4Z9KB 3EJPA 3UTOA 2OP4H 5CILL 2FO4A 2DYRB 3UP1A 4F2ME 3G08B 1AO7A 3FUNA 1JGDA 3QIWB 3HZMB 2WLIA 5AW9B 1KOAA 2QLYA 4QOKD 3S2AA 4MZIA 4OFYA 1ROCA 3VXRD 3L5JA 5B1JC 3BN9C 3MFGB 2VQUA 4BCXA 5BCAA 3JQOB 3UTPD 2ZIDA 3BUIA 1EBPA 1RK7A 2A74A 3QFDA 2FSDA 3AREB 1NCWH 3TESA 3QFJB 2BP8B 4R7LA 3STLA 2G3ZA 3WE1A 3X1NA 2E4FA 3QXDB 4KZ0A 3DPBB 4U3SA 4LKXB 4YSCA 5I1CL 2Y6SC 5JO5B 3L5HA 2BNRA 4FQQB 5LNGA 1VGKA 2DEYX 1V3KA 4EF3A 2V3EA 4KX9A 1XGQB 4PRPB 6PCYA 2ZUQB 3T3ME 3RVUC 1KCKA 3VXOB 1Q9KA 3KM2A 4G5ZH 3VJ6A 1JP5A 3CU7A 5JXAL 1OGAA 1TKWA 3VWKC 4QTHA 1ZANH 4N8VA 4PJHF 1D6EB 4GFTB 4YHYC 2P8LA 5ECGA 2DQJL 1JS4A 1LNUB 3WIIL 3B3IA 4K8RL 4W4OA 1RIVH 3AABA 4PGZA 5IB3A 5D1XA 3ULUH 2P5WE 4MD4B 4QT5B 4X8GA 1RXLA 1N6QH 1MDTA 4G11A 4X8XA 2V2WB 1VENA 1W8NA 5I1AB 1F6AB 2H7WA 3EO1A 4HKBA 1K8IA 4LCYB 4NUMA 4FQXA 3ARGC 2BHZA 4QXGL 3B9VA 1QRNE 2SEBB 2BSSB 3FT2B 1RIHH 3VGBA 4PRBA 4F1SA 2N4IA 4P07A 2GC4C 4LRNH 5A6IA 1EHKB 1TQWA 3KXFB 1ECYA 3F05A 3UTTE 2YN5A 1JPTL 3LRMA 3WFHA 4EIBA 4JN2B 3D50A 4ACTA 2IPKA 3L48A 4G1EB 3IDMB 1O6TA 4NZJA 4XMTA 3ZQXA 3ECWA 3VI4E 5CD5D 4IBYA 3PWPD 4MD0B 3QUZC 2EICA 3KMDA 4WY7L 2ZT9C 4RNRA 2VE6A 4GS7B 1SGKA 2BSSA 2EXWD 5FHAL 2MPVA 3QCVH 5IEHB 1CMOA 4D8PB 4IKKA 4FA8A 1LD9B 3C5ZA 4I0PD 1ET5A 1X3DA 4ZX4A 2OMTB 2FD6L 4FJ6A 3FT0A 3NDZE 4XVJH 3RIKA 3ZK0A 5HDRA 1U0QA 4GUPA 4J6RH 1FH5L 4KDTA 4A2HA 2D31A 3CHSA 4PM1A 1G7IA 1U91B 1LO3H 1N8ZB 4GS7C 3VXQB 2G9HA 3WIAA 3NPZB 3ULUD 1LGVA 5INCB 3S36H 3US9A 2JIXA 1NGXA 1T1XB 3U46A 1I8LC 3QIUA 4PSRA 4UT7H 3LKRB 3NFNB 3RWCA 1AIFB 4RISH 4AY0A 3DX3A 3VJ6B 5DZ9A 3FQTB 3GSQB 5HTSA 4YHZL 4L1HA 4LLAA 4M6NH 4TVPH 5KVFE 1NM9A 2G5UA 3NIFF 3B5HA 1G9NC 4CL7A 2AABH 3VYOA 4DTGH 4PTTA 2VR5A 2OCFD 2GTWA 1PG7H 2ITCB 2J72A 4UQ3A 3K5SA 4YE0A 5TF1H 4XXDA 3LH2H 4ODXA 2VC2L 4LPUA 3RPKA 3T1WA 3KPSB 1X4XA 5T1LA 4NN5B 2HKFL 2JCCE 5DFWH 2ARJQ 4PS8A 3GKZA 3VYPA 1A6WH 3MGOA 2W0PA 3HR5B 4HCIA 2GEEA 4GRLB 1T7XA 2G60L 1KBBA 1XBRA 1NIFA 5DC0A 4I77L 4NCC2 3NA9L 3OMNB 1A2YA 1XMWA 1DQIA 3G04B 1FI8C 3MODH 4LDCA 1NIDA 2ORBH 1SYSB 4HU8A 2XI9A 2NXZD 4A7SA 3HHMA 1I1CA 4C56E 4Y2DB 5EU4A 1J86A 5EEUA 1JXFA 3K3QA 1EQWA 1NGPL 3GSUA 4KOCA 5DD5L 4CMMB 2OQJB 3BZFA 5J3HC 5TGBA 2M83A 3QCUL 2NYZA 1CXKA 3LZNA 3WGVB 4DPBX 1BQHB 3SYOA 5JQHC 2EDRA 1UM4L 1YNTB 3AQZA 3K4AA 4JVUA 3UPCA 4PCSA 2J12B 3ZUNC 3GGWB 3NCXA 5GPRA 5IUSA 1HE8A 5E1IA 4JREC 1SOKA 3BQUC 3M45A 2X6UA 4P46C 1U8CA 3GSRB 1RU9L 2ZKHH 2XDHA 1Z3GH 4A67A 3DVNB 4XBGA 3SPHA 4XPBH 4C56A 3BD3A 5GS0L 3SHSA 1TQVA 5E4AA 3EYUL 4NHCL 4KX7A 5D1XD 4F2MB 4I3SH 1ZVNA 3RFZA 4NQCE 3VXSB 4I1RA 4KTYA 3C60D 4QRUB 2Z4TA 4ONFH 4Y16B 2WXQA 1M56B 2J1WA 3W0WE 3QUYD 1BOGA 3T8MA 3TN0A 3VNYA 2JKWA 4MVBC 3A6CL 1OAJA 4I3GA 5GGVH 4GG6E 4PWJA 3VVVA 5L0QB 1BAWA 1FNGB 2EXYD 2JKIS 1EXGA 4OH2A 2O6CA 5K9OB 5C9JA 3MUHL 3V0JA 3L3JB 2HPOA 3QORB 3C5ZC 2R29L 3WFHB 1ZHNB 5EO9A 2QVMA 4ZJ9A 1BD2D 1BDYA 1BBJA 3L81A 1T6WA 5E2UL 4AEHL 4EBQH 4LAQL 3AXLB 5IW3A 2C7UB 2G75A 1J1OL 2VISB 3LMJH 3QZWG 3RWJA 3WL9A 2DQTL 3JYBA 3HB3D 3EHBC 1TZGH 3S3PA 3VXUB 3JWNG 2QQNL 4HHGA 5DRZA 1JHKH 5EG6C 3WS6C 4F57L 1SXCA 4RFEA 2MIZA 3L3IA 5DFAA 3CLFL 5HI3D 5D4QA 4BSJA 4R90L 2WB7A 4L9DA 4OCYL 5EWIL 4MB4A 4MB3A 5INCA 2YWYA 1ZLDA 3W0WB 1KTKE 5DQ9A 2YAOA 2JH2A 1TTUA 4BFGA 2WMPA 4FQHB 3CX5J 2EABA 1HZHL 5FHBH 2LR4A 4GKNB 4TQIA 4DKTA 1PZAA 2NT1A 3QYCA 1DO6A 2EXYC 3ZKXB 5IW6B 2EH8L 4Y9FA 2OMUA 1U4FA 4QHUB 4YNYA 5F7FA 4TQ8A 2LLGA 3TBWA 1MLCA 4LL4A 1ODUA 1E40A 4U1LA 2XV6B 2DLGA 3V0GA 1HI6B 5C0AA 3GI9L 3ZL4H 5BMFL 5J6HB 1MFVA 1G7QA 4ZO8A 5FXCH 4KH2A 5CP3H 5SWSE 4E5XA 5D9SB 5KSAB 2WWKT 2IPTL 2KUTA 5B7FA 1U3HB 3O6FC 2NY6C 3NMEA 2EXTA 5EA0L 3DI3B 3RX5A 2G5RA 4NO5B 4E41A 4WUUB 2HJKA 2NY4D 2Y69B 4KMTL 4R7NA 3VI3B 4ZUVA 3SDCC 1A3RH 1ONQB 3G5ZA 3TT3H 3ME0B 3ZXAC 5D96C 4IHBA 3L5XL 4QRTB 2KLRA 4B6ZA 2FLMA 3Q2LA 1WO2A 43CAB 2ENYA 3D5OF 3Q0HA 3LEVH 3Q6FA 2WZPA 4PRAB 1MOEA 5IMOB 5JPMC 2XV0A 2G3XA 2G9KA 3WELA 5EZLA 3WJLC 1PLGL 2ZWYA 2G2RB 5AYUH 4X0KB 1BZEA 3K6DA 4JN1L 5DD3H 2A6IB 3NT0A 2PR4L 1IM9B 2XJLA 1OTSD 3WEXA 2QADC 2Q86B 1SDAB 3DGGA 1ZS2A 3PP4H 3LKPA 4X5PA 1AHWB 1R5IA 1AE6L 1C08B 5JUEH 1F8TL 3UTSB 4JDVB 1M3IA 1KTCA 2OQJA 4NN5C 4GLRH 1E4XI 1CD9B 5HD8D 1BMGA 3KPOB 3B7UX 4MBOA 5I8OH 2W60B 4XC1H 3CFMA 1M05B 2XWRA 4JFWA 1NBVH 1RVFH 2WW8A 4O2FA 2PPCA 4JFHE 1UADC 4QRRB 4ZOBA 1FHGA 1H3WM 4QF1B 2WQVA 5I8OL 5TE7L 5DQJB 1FNGA 4KXAA 4I18C 1QATA 4WI5A 2PWEA 3OKOA 2WQ8A 5F6IB 3ARDD 4B53A 1KTBA 2RQEA 4XBPB 4MNGB 3PDOB 1OCOB 2FUTA 4HZLA 5I1EH 1MJ7L 2NUTA 4H26B 4LSSH 1HH6B 3BE1H 4G9DB 2EO9A 1BEYL 1AZVA 1NCHA 3BN9D 2WYIA 1U8OB 3LZPA 3O6ML 2WTPA 5SWSD 2XBDA 1R17A 4PB9L 5D6CA 5BRZE 5LKNA 2AXGA 4YSPA 5E9DA 5BOPA 4TPRL 2WBJA 5IQ9B 3IPBA 5I6NA 1A6UH 1Q9OA 2PW1B 3QG7L 2Z8WC 2J6WA 4HF5L 4N87A 4U7SA 3WIHH 4M48H 1BJMA 5L6YL 1HHGA 4NQEE 3QXTA 3Q8CA 5F96H 2F74B 4YSRA 4WHTB 5C0BD 1LO2L 1OB1A 1XR9A 3RYMA 3WN6A 3QCUH 1LDPL 1IJ9A 3KS0H 3CFJA 2K45A 1AIFA 2QR0A 3B2PA 4N2KA 1Z9NA 1RD6A 4I1PA 3NCJL 5K9QG 3BSHA 2GJ6A 5IESL 1WZAA 5E4EB 3IWUA 2P5PA 1ZLSH 4FFZL 3EOBB 4OSUL 2YPVL 1E28A 1EAPA 3GI9H 4AIZB 2O6PA 3GSUB 3P69A 1GGUA 1R0AH 4WI2A 4OGQC 2HG0A 2CKNA 4I9WD 3IU3A 1T20A 3KHOA 5CP7A 4Z7UB 4U6VL 2Q1EA 1EJOL 2Y6TE 2Y7SA 3WUWG 3L13A 2ID5A 1CZ8L 3HCVA 3QAQA 4Q58C 4LF3B 2XWCA 3N44F 2JJTA 2FQDA 3HVDA 3GEWB 4JM2A 1E27A 1H15B 5C97A 2DJ4A 3V0VB 1MFBH 2C4FT 5I5IA 3F7PC 4GG6F 3KWWB 4TLSA 4Y89A 2WXGA 4X6CF 3HE7C 3RP1A 1QR1B 3WLWC 3EYOA 2EIBA 2F5BH 2CLZA 3FU3A 1JF1A 3O9WD 1YHPA 1IFHL 1U42A 2P8PA 5D7IE 3FQXB 3L16A 1S9YA 3I75B 1UACL 3N91A 2G0KA 4LDEB 4OZ4A 4KJWC 3VXSA 3MRMB 1JZGA 2IGFH 3CZGA 2FECL 2ZOKB 3CHXA 5E9DD 3WKPA 4D7BA 3V2AR 4ODVH 2GSIA 2VOTA 4K7PY 3C5SB 4I85A 2XVKA 4F92B 3MLSH 4AQ1B 3QHZL 2VW6A 2NW3A 3IJ7A 2V17L 3WJMB 2FWOB 5C0RL 3FQTA 5EN2A 2W9DH 4E42B 3S34H 2J73A 4M7LL 2QMJA 1JVOA 2WBKA 2QQKL 4Z3FA 5B4MC 4P5KA 3LIZH 1IU1A 1MF2L 4WO0A 2A9ML 4HHAA 2OK0H 3UTQB 2KHAA 2IMMA 2J71A 4OIIL 5IVXF 3RWDB 1PIFA 3HBZA 4DGYH 2NW2A 2WAHA 4JGMA 3LKPB 4L23A 5E1GA 1NGWA 2X0VA 1TXKA 5CS7A 5LBVA 4EVNB 3OM3B 1P7BA 1CXFA 3K71A 1NLBL 1P6FA 1X5YA 4UAOC 3GBLA 1MHCA 3QNYA 5AW8B 3IWVA 4MZ3A 5FK9A 3BSZL 1FN4B 2A6DA 5E5MA 4BZ2H 2ALWA 2LHAA 3K81A 2F54D 2OCJA 4FEIA 1T1YB 2ROXA 5IK3B 2MCPL 4KZEH 1PTZA 3N43F 1MG2C 1S7TA 3HB3C 3L95B 4DCQB 4LHUA 4JPWL 4PJXF 2Z3FA 5LAXB 4C58B 1BX2A 1UXLA 4FNQA 3E3QC 1IT9L 1ZA6B 2P7TA 1KCVH 3D85A 2AKRA 3OJDA 4F7KA 1VIWA 2IGLA 2B1HL 4DAGH 1KB3A 2GKIA 4GMTL 3GDCA 2GBTA 1UJ3C 3ZHKA 4AZUA 2RTTA 1DQML 2R1XB 1F58L 1JYXA 2VDLB 4OB5L 5I8EA 3VO0A 5FGBA 5SX4I 2F1BA 3N3EA 5D2NB 5AZ2H 1WA2X 4AMKH 5B8CB 2I5YL 1H9DA 1OTUD 1W91A 3I85A 3P4OA 4YOKA 1RP9A 4JY6A 4PHXA 2QADB 4FFZA 4TTGA 3FB6A 4HWBL 5A16B 5BO1H 1D5IH 1T7ZA 1AJ7L 2V9QA 5F7DA 3PDDA 2C7FA 5E7BA 4AEEA 4W4OC 2OXGA 5I71C 4PU2A 1SDDB 3B8YA 4Y4FB 3PJSB 2ZSWA 4OI9A 1FIGH 1GYCA 2WLHA 3DROA 2J55A 3EJUA 1AJ7H 3TBVA 1S3RA 3EJYC 5I0XA 2WXKA 2WMPB 1X5XA 5ELIA 5I2IA 3QJHA 1U58B 4FERA 2X4UA 2X12A 2CKBL 4JGJA 4OR1A 3TVMC 2PCYA 1KPUA 2DD8L 4LXFA 4QY8B 5EUOB 1QFWI 1HXKA 1GZPA 1YA5A 2EC9U 3EH2A 1AGDA 4MAYC 4QKTA 4HIIA 3I6LE 3OSVA 5F0LB 2C9PA 5AOZA 1XB8A 2NYKA 4AEFA 3D48R 2W88A 1XIWB 4ODUB 4F15C 1FGNL 3SCMA 4ONGL 5ETUA 5AZEH 3RGVB 3FZUD 1UVQA 3S96A 1PZ3A 4ZNEE 3U9PL 2YD2A 4PIRF 1A9BB 1ZHNA 5EO9B 2YRZA 2GCYB 5EOTB 2MCG1 1KIQA 2YQ2A 3O2WL 3QWOA 2XZQL 2EDFA 4CVWA 3VFPB 4NIYE 4XMXA 3KCPB 2GSMB 4PLJC 4RFNC 1PS3A 4JPKL 1GH7A 2YRLA 4OVUA 1ZSDA 2I27N 5KW9H 1JJUA 5F7EH 4ERSL 2CO7A 1HQRB 3ZKNC 3SDAC 1QW9A 3T3MB 3WFCL 1I53A 2B7DT 7PCYA 4AYFB 2XUWA 1YMMB 4ERSH 2YKKA 3IJ8A 3QDAA 4IK6A 1G1KA 4C83A 1ITCA 2MCMA 1MXGA 1QRNA 1MWAH 1S7XA 3OBAA 2OTUB 4FG2A 1JHLH 4FG0A 1ZHKB 1WUNT 3DVIA 2UY7B 1W16A 3NRPA 3FUJA 1CTMA 2VDLL 3HG0A 4OU3A 5JXAH 1WAEA 2JCCA 4A7GF 2KLSA 4WW2A 2P8LB 5I16A 1I9IH 1MSPA 1OAZL 4B95C 1OAXH 4I87A 3QEHB 1U36A 2R2BA 3BSZA 1K5NA 3IJYB 3LB6D 2Z7YA 2LU4A 2X42A 5MI0B 3BPLC 2DMGA 2DWXA 1CFQA 3TURA 1KY7A 2BFGA 3PRZA 2XN9A 2JLPA 1QVOB 3D4ZA 1RI8A 3LHPH 3ZE1F 3BZFB 2VN7A 1CK0H 4YDLB 3NJVA 1IAIH 3SDAD 4FYRA 4IMKA 5HHNA 5F3BA 2WSKA 3RHWF 1O75A 4OLYL 1P0SE 2CO2A 2CGZA 4OZFG 5E8OB 2NTFB 5GGUA 1U8JB 4KXZH 4ANXA 2BHUA 4NKIH 1Q0XL 4KTEL 5ITFB 1B2WH 1MZYA 2V7NA 2Y9RT 3SBWC 2B8OT 1JCKA 3V0WH 2V2TB 1HZKA 3ZSTA 3KPRD 4JAMA 3JTSB 4Y8AA 5DJYB 2XU9A 3GSOA 5E8PB 5AB1A 1I3GL 2VR6A 1CXEA 2RQ8A 5SWZB 4DGIH 3U4EA 5GRJL 1HOCA 4LIQH 3RJDA 1JVLA 3T0DA 2ZKMX 4AG4L 1WAPA 1FZJB 1AD9B 2AS5M 1PX4A 3LZLA 1BFOB 2VXVH 2AXFA 3SE4A 1H19A 3L08A 2VERN 2EDQA 4BZYA 2OKMA 1OLLA 1Q1PA 5FA4B 2DLFL 3BPNB 2B16A 4L29B 4GP4B 3PFQA 3OKMA 5TE6H 2X3AA 2P4AB 1IIKA 5JLZB 5GS0C 2NY3C 2VXSL 1HQ4B 1SVCP 1U2CA 4JG0L 3UZQB 1I8UA 4G7RB 4BFKA 2OJZH 2ZYIA 2DLFH 3MOBL 1KIPB 1AMXA 3AQXA 5I2IB 5IBUG 2HX7A 4MAYA 3T3MF 1T5XB 4ONHA 1YVLA 3CN2A 1G94A 4H25A 2NY5H 1KJ2L 5A6MA 2MSPA 1ADWA 4QLWA 4HK0A 4ZD3H 3WIIH 1FZKB 2HLFD 2XIBA 2C9QA 3BIKB 3ZDWA 2YPLA 2JKRM 4E9TA 3T6VA 1KEMH 2W95A 1LEKB 3CVHA 4OLWL 4G72B 3CZLA 1FAKT 1QASA 4KY1H 1CFSB 1GA2A 4J3SA 2AV7A 1JRHH 1RJYB 1AQDA 3ALXA 5HHOD 3UCQA 4WSKA 1F90H 4AENB 5A2FA 1INDL 3C9NA 3ARDA 4BXVA 4ES9A 5KTEL 2ZD0A 2F61A 1AR1B 4A04A 1T3FB 5CCKL 2HT2C 3PXLA 3HZYA 2KMWA 4Q56A 4G8GD 1GC1C 4V1DA 3V4VA 2E7BA 4XCNA 4ZS7L 3ABKB 1O5PA 3CCHB 1LWJA 3MV8A 3FO1B 3BHBB 3JT2A 5CZVH 2P5WA 2X2YA 3NVQA 1ZVSB 1FNLA 4XPFL 3T2OA 3ULVE 4I0CC 4YH6A 4G5ZL 4UMSA 4YSOA 4Z23A 3U7AA 2KC0A 3K71B 1H8SA 2VDRB 4NUPA 3VXPA 4FG6C 1TYRA 2G5BB 1U95A 1XB6A 3BZ5A 2HJLA 4ZAKA 3RU8L 3FO0L 1J87A 3LKSB 4NQSA 3FQ2A 2WM0A 1WIPA 1DBJL 2E86A 5F7YC 1U8NA 4WO4D 1HWWA 5CM1A 5D1XB 1AOZA 3GMRB 2ZCHL 4OLVH 4J8RB 1OT2A 4YHYB 2OFQA 2GBUA 4Z7WA 1GMEA 4Y4FA 3EOAA 3MXWH 1BIHA 4HCRH 1LJMA 1H3GA 3AU1B 4NJ9H 4K5NA 5B3NA 4P2RD 5CINL 1YJDL 2HLAB 5ILTL 1EVTC 2YUVA 3UO1H 4DP0X 3ZR5A 3ZMEA 1AOHA 2CIIA 3KHQA 3Q9PA 4PGJA 3LZOA 5E9DE 1MH5B 8CGTA 4JG1H 4WJKB 2HFGH 5I1LB 2MPAH 1KLGA 3RZWA 1JNHA 4PJIB 3SKJH 1HYSC 3WNMA 4YQXH 1IC0A 2ADGA 1MCOH 2IANA 3V4PA 5A2LH 4L8BB 1MIML 1MI5D 1ZA6A 2P7TB 4UBDC 4XBEH 1THAA 5ENWA 3VGFA 1XR8B 3SPVA 3FUMA 5JTWA 1HILB 3I50L 3LEVL 4L3AA 4MQ7B 4YQXL 2F8OA 4JMNA 3GK8L 4IHOA 1PLGH 4APQC 1E4HA 1WIUA 3CFKB 4A2MA 4CDGC 1MH5A 4UZSA 1Z9PA 4OFQA 2ZJSL 2JKTM 1SBSL 5KG9B 3TNMB 3G6AB 5KBMA 4XRCB 4EVNA 1BQLL 4LPWA 1A4BA 4K5OA 1O9WA 5JPNA 3NCYP 2BRQA 2H47C 5HDBB 3F7KA 3LEXB 2ORBL 4PJAA 4LSUH 2QPSA 3WV0A 4UB0L 4CVZA 3FF8A 2RFXB 4L3FA 5EO1A 4P2QA 5D1QA 3SBWA 3D18A 5ACMA 5HHQB 2YPKA 4XVTL 3S88L 3E6FA 4Z0BH 4J7RA 4MWFB 4KY1L 4FJZA 1Q1JH 1QSFD 5TDNA 4FP8L 1T03H 3UXFA 1GVIA 2F74A 2FJFA 3UJIH 1W72L 1SFDA 4X6FA 1S3KL 1ZHLA 3WI9A 4YDJB 3HUJA 3LDBC 3P77B 2A6KB 3N0PB 2HFEA 1NWPA 4PLOB 2P42B 4JZJB 2OI9B 3G5XB 5CNHA 1ZLVK 2PXYD 2IH8A 3O6MH 3QUGA 2WZAA 2K4WA 4KUZL 2L04A 3B5TA 2G60H 4XN1A 1ZTXH 1I1YA 2IH3B 4L4TE 3WNOA 3P4NB 2CXGA 5JNYA 5F1SA 1SXSA 3O4LB 1GCFA 1BF5A 5K59E 1WG3A 3IE9A 2HYMA 3EJZD 4APXA 1T0NA 4GO6B 3N6YA 4R7XA 2Y06H 1TLMA 3WSQH 1NAMB 3W2DH 5BVJA 4NPYA 1RJYA 4ZO7A 2VMEA 4NUGL 3SE3C 5DRWB 4OUUB 3HI1B 3ZIMA 3EBIA 3EH4B 4HPYH 4L1LA 3P3TA 3UPRB 2EEBA 1T4KA 5C2BH 3ML8A 3QPKA 3APMA 5CP7B 1ZLWK 2NOYA 1OOWA 2CR3A 2WZPD 1IILE 1WFJA 2OA9A 3NIGE 4WK0B 3OZKA 1T1YA 3LNIA 4PGBA 1DLFH 1Z5LB 3HRPA 1H9VA 3S35X 3QQDA 3I02A 1MNUH 3CFUA 3FFCB 4EI0A 3WIFB 1QFPA 4U1KA 3EBHA 2CRMA 4YWGH 3S34L 2CLRA 4S1SH 3FFDA 5CMAA 4WUUD 1ZDSA 4L0ZA 5EEYA 3EJSA 4J6RL 4MA3A 2I9LB 3BP4A 5I6MA 1GW0A 1K8DA 4GQ9L 4PGCB 2H6PB 2OMXA 1JK8A 4IOSA 3H53A 1A7RL 2PCXA 5AW1B 3PABA 3TBYB 5KVGL 4KVNH 3QC5X 5IFAH 2VRAA 5CEZD 1JXKA 3BQUB 4KV5E 5CBAB 4EI5B 3QQDB 3ARSA 4XNXH 4QJ4B 2FJHB 4F5CA 2HRLA 4ORGA 3SDXA 5G5DB 4JFPA 2VIRB 3BVTA 5I24A 2F58H 1U8QB 4JY6B 5IBLD 4TUJB 4XNXL 1DUYB 1EDHA 5FCSH 1DL7H 2DB8A 2NUTB 3QH3B 1JXDA 3MDJA 4S2SA 5EOQL 2AXJA 1RIUL 4KPHL 3QFJD 4GJTB 2VN6A 5JR1H 4H8VA 5G2NA 1E2VA 4M1DL 2NQ3A 2VXUL 5HDQH 4AV4A 1G9HA 1KN2L 4JKKA 2BS8A 2IADA 1J48A 4NKMA 2YD4A 2AQSA 3DUUB 3IU4H 4Y5YB 2OR8A 2QQKH 4AM0Q 1RJLA 4K94H 2WP3T 1MLCB 4BRJA 3SQRA 4UTBH 1RULH 3VDCA 1VJSA 4L8SC 4P5RA 1D5IL 3C5JB 4BEIA 5IHZB 4G8GB 3VFSA 3MJ9A 4A6YL 1DQLL 4K3EL 4FKKA 3QULB 1AIZA 3VXMD 1EGJH 2WGNB 4UTAL 3T8XA 2VR3A 3EYVB 5FHBL 4JK0D 4JN1H 4PD4J 2GITB 1Q0YH 1E9QB 1M7DA 3WY3A 1DR9A 3BQVA 3GLDA 4E9LA 1EGJL 3MJ7A 2VDMH 2BLFA 3QSKB 2DJMA 4L3EE 3Q43A 3RY6A 3PG2A 4C83B 4XNQB 1T7WA 3GC3A 3HFMH 1FVDB 1CICA 4FI6A 2MEJB 4V33A 4CC1A 4ABWA 4ZUVB 2FECI 2WZ0A 3MREA 2GSIB 4KKBC 1BJ8A 3O4OC 1WBXB 5ICZB 4ZMYA 2HT4C 1ETZB 4G6JH 4BD4A 1D6VL 4LRIA 2BDNH 3HS9A 2DLEA 4N0UA 3V6BR 1KCRH 1KTLA 1F3JA 1TQTA 4APXB 2HVKB 2HRGA 2BVEA 4HALA 1G6RH 1M1XB 4N2IA 1NOFA 3K0WA 5F7EL 1JPSH 1XIWD 1VFAB 5ES4B 5DD0L 3LCYA 2H8PA 5EB9A 5F21B 4LDOB 2AERT 2ZUSA 4DGWC 1BEXA 1YEHL 5A40E 1K3ZA 1N59A 1X7QA 1VCBC 3DMMC 5EHFA 4FXKC 1DEEA 4U1NB 5JPNC 4F2FA 4TLUA 5K33A 1CQKA 3CIQA 1EZUA 4Y19D 4ZXBB 1F3RB 3LQAC 4KI5C 4IIQA 2VDLH 1JBJA 4XN9A 5AQ0A 4EDXB 3JZ7A 1NWOA 5DHVB 1CL7I 2QQNH 4L4JA 4JHWL 2J56A 2PWGA 2ZE0A 4DK6A 4M6MH 4WWKD 2UZXA 3UJIL 2R2EA 4YFLF 3U4BL 5D72H 2ZCLH 3FU0A 4LQFH 5E5LA 3GJFK 4XN7A 1GGBH 2C8NA 4FRWA 4PWKA 3QDMA 3BUYA 3ZN6A 2HKHL 3RBSA 3P0VL 1N0XL 3IDJA 2HLFC 2P1YA 5D1QD 1HHJB 2V5MA 3II3A 5FDWB 2BVYA 5D7LB 2FL5A 3IYLW 5I73C 4JGNA 4NWUL 4P5TC 5B7EA 2DL9A 3DYPA 4GAJL 4Q14A 1AZUA 4XO5A 1J1XL 1DCLA 2FWSA 4F8OA 2AVFA 2Y25A 4B41A 2PPEA 1DDHB 3FOLB 2XWTA 4HPYL 2DJSA 3OZLA 3QAZB 5DHYA 4U31A 4JJOA 4FFVD 1CO1A 4IU2B 4QRSB 3Q6GL 4DVBA 5MERA 1TUPA 1CPUA 3FB8B 3PGCA 3PWPE 2V4LA 3INUH 1NC2B 4LSTL 4XP4L 3T6ZA 2FT8A 1EEZB 1UG9A 5F9DC 1Q72H 4EUPG 1RZPA 3L3GB 5GGTL 3TA3A 2YPLB 1G7MA 3LEYH 5HJDA 1OF2A 4PRDB 4OI8A 1TVHB 1FDLH 2OYKA 4A37A 15C8L 1B9KA 2GIYA 5I75B 4NQDE 2NLJA 4JKWA 4I0KA 1L6ZA 2MQ0A 2UUDK 5CJXC 5EZPA 5KYXB 2ETWA 4GQ9H 3FN9A 2HFFB 1RZIB 2O5XH 4XVJL 1Z6JT 2OP4L 5ADOL 5T8IA 5T33H 1QEWA 4JM4L 4KXCA 4PWGA 1OF2B 4PRDA 3K46A 1NGQH 3RL1B 2YSSA 1LWRA 1QBLH 3OKYA 4DGYL 4ZUSA 4M4RB 4GRMB 5C09D 3IVKA 1RERA 1UD4A 3CSTA 2V7HA 3TZVB 1MEXH 4N8PA 2VISA 3RWJB 4X4MA 3WCYA 1NEPA 5GZOA 4TSBH 4H1LA 1VACA 1UYWH 3WEOA 3ZE2B 3MNVA 3D12B 2JI2A 3HAEB 2YRPA 3GSVA 4HC1H 4JX0A 4MJ6B 4Q6YA 4P0DA 2H26A 4Z5RB 1NUFA 4KZEL 1JF1B 3CXHJ 4I1NB 1OTTD 2IO5A 3K4ZA 3SE4C 3WEBA 4AXWA 4DERA 1HEHC 3B2UD 3BH4A 4GW1A 3H3KA 3RL2B 2E0PA 3VXUE 1T3FA 2OW6A 2R15A 3MFFB 4P23C 3ISYA 1G1OA 1TTCA 4EOWL 4QNPE 1BEYH 3BFOA 2XV3A 3D0LB 1AQDB 3EO9L 4O2CA 3LXAA 4P59L 4XPAH 5AW2B 1J8SA 3SGJA 4QHKI 3QNYB 4UZGA 2FT7A 2APTA 2O6EA 2VJ0A 4WI0A 3K6NA 4NZUL 4Z7UA 3CH1A 3QXVA 1ZGLP 3NSYA 5C0FA 4BHUI 2IDUA 3BVNB 2AEPH 3RE0A 2W91A 4U3HA 4PJGE 2HWZL 1YUHA 2R4RL 2XA8L 3BO8A 5EBGA 4RGNC 4LRIC 5HGDB 1AZCA 4MGXA 3TONA 1SM3H 1ZE3C 1H5BC 4CRPA 4AYDC 1CFBA 2ZUXA 5C0FB 4IMLA 2NSMA 4G3YH 1BBDL 1QW8A 5BVPH 3DJSA 3H4HA 5A3ID 2NDFA 3B7RL 1D9KA 5D8JL 2O6FA 4ETYA 3U6RB 4JY4B 1GC1L 3Q9QA 1BG9A 1JWUA 1SYVB 3HBQA 4M7ZC 5JW4M 4NC2B 5JHLA 1FL3A 2B1OA 3RIAK 2VSDA 3FOMA 3DJTA 1PL3A 1CDCA 5F0MB 4ADJA 1DANT 3I6KB 1BLNA 3BP7A 2YXWA 4XO8A 3F2LA 3M07A 4XGZA 3WMQA 3HMXA 2NZIA 3AMLA 3R06A 2IAAC 3ZE1B 2YK1L 3FQRB 1RAMA 2WXNA 5DEFA 4KZDH 3RB7A 2DLHA 5CR8A 4LIQL 3L1OL 3LRKA 4KROC 4KC3B 5C7ZA 3S3JA 4OLZL 5D7JC 3T9WA 3I6GB 3J8F7 1EFXA 4WHCA 4QRRA 3P2DA 5B8CC 2FO4B 3H3PH 2G2PA 4MRCA 3W39A 3V0DA 4DZBB 4J5VA 1TITA 1WVZA 4NO0D 1NFAA 3J27A 5LGHL 32C2B 4G8IB 4DO4A 4XODA 5HGHB 4YEFA 3T71A 2AJUH 4I89A 3MROB 1KPVB 2ATKB 2PCPB 1JHTB 2FK9A 1M6OB 1M7DB 1RUQL 4M7LH 5FYKU 5C8JB 2ZOTA 2QFPA 3MA9H 3UC0L 3L8QA 4GG6A 1V54B 2YQ3A 3QWRA 2MOQA 5ITBL 3VM5A 2ZXEB 3CLEL 3SDAA 1EAOA 4JM2F 3ZE0F 3NEXA 1RUAL 4KQ3L 4H20H 2IQAA 3IFLH 5F7UA 1EEZA 5D7LE 1MCSA 3DIVA 3RVTD 1IBGH 4PUBH 2JELH 3V4PH 3X3GH 4ZD3L 3H0TB 5G55A 4NO3B 5J57B 3AGWA 3NQKA 2FEJA 4R90H 3RVXD 2Z1KA 3TCXA 1RK1B 1T21A 3W56A 1ADQA 3JWDL 4H5SB 4H7VA 3MRRA 1HCZA 1KXVC 4P4KC 4Y5YA 4Z95L 3ZQ9A 2WXIA 2ZG1A 5DUPL 5EEXA 2R0KL 1INDH 3FN3A 3L5WA 5I8KL 1QRND 3G5YA 1J8RA 4MJ2A 5IKCB 3W5MA 3ZHFA 3BZ4B 3PDOA 3FB5B 1ETZA 3MACH 5IB5A 1BZ9B 4XNYH 4WWKC 4XXCA 5FF6A 3HUJE 3IJEB 3KE0A 1RURH 3BW9B 4H44C 3CN0A 4MHHG 1OQXA 4HX1A 2XYBA 4QHMA 2LAAA 3B83A 5D2LE 3DTXA 2XY1A 3FSZA 4ZS6C 3CZKA 4JPQA 3VQ2C 2ZAHA 4GBXD 3VG9B 3EKCA 4B9IA 4FFWD 4JZNB 1XIWA 3ZGHA 2VCOA 5HVWA 5M94B 3FCUB 3LEYL 1BZQK 2ZPKH 2FX7L 4WSJA 4U3CA 2OR9H 2AEWA 4LLWB 3B2XA 4I8DA 4TUOA 4XAKD 3KBHE 4Y4HD 3CMOL 4ABVA 1EEYB 2NY7L 4IIQB 1DUZA 1KBKA 1PX3A 4KI1A 3D39A 1YEKL 3EYUH 3B3IB 1IAIL 5IB3B 4I3SL 4EUPB 5C0IB 5H4ZA 1J0HA 4FQJL 4MS8C 2FBRA 3G6DL 4OCSH 3UTQA 5DC2A 3KPLB 4EI6B 3PWVA 3T6QC 5IMOA 4JZNA 1OGAB 1MVUA 3FCSB 5I17A 1PPIA 1ZEAL 5AAMA 4BK5C 1UYWL 1NFIB 3D05A 1I7UB 5C7XL 1ERNA 1FVEA 3NCMA 3QXWA 4I48B 5CSZA 4AWJC 3NIDB 2EP6A 4NZ8A 3OB0K 5HYFA 3M88A 4DUXA 1OGTA 3MXVH 5JORB 2XOTA 4FA7B 4GAYA 1IVLA 1W0YT 4HWZA 4LCIL 1OCWH 1QX1A 3BKJH 4DGIL 1CDBA 4G6FD 1EHNA 2YOAA 5IROA 1LO4L 3C60B 3IMSA 3V0HA 3U0PA 1WCBB 2VAAA 3QH3A 4S2SB 3FL7A 3OD3A 2DKMA 3MLPA 2VH5L 2QHRL 3I74A 1WV7T 4MLIA 3S97C 5M95B 4YBLC 1MJUH 5DYFA 3IAGC 1HHHB 4QRUA 4MB5A 1EFQA 5D1ZA 3KXFA 1TSHA 3RKDD 2VH5H 2APSA 3EYQC 5DTFA 4RVBA 4ILDA 4PBXA 1GYUA 1SXAA 4KK9D 4F5CE 2ALAA 2YD8A 4JFED 3Q1EA 4H2CA 4RIRB 3B9AA 4M00A 1J05A 4G6KL 4N2GA 3B9KC 5EV7A 5KN5A 3BUYB 2BOLA 5K59F 1ET7A 1IAOB 3D3VB 3WTVA 3DBXA 5I0YA 1YYMH 5FECB 4LSPH 2NY3B 3K8KA 1JZJA 4XVSH 1WD9A 3CDZB 2BVTA 1MCPL 1C8QA 3FJTA 3FRPG 4Z7VF 4OF0A 4U2YA 1XXFC 4LSPL 1YN6B 4PV9B 4XMKL 5E1QA 5FUOH 4XNUH 2QL1A 1IGJB 1FYTB 3EG9B 2HVJA 5T3XL 4FC3E 5C92A 2EVGA 2OXHB 1YEJL 4HFUH 2BMKB 1J1PH 3RKDC 4N6RA 3MKGA 5AVQB 1E50A 5EA0H 1DEEB 3JXAA 3KJ4B 4U1NA 3VSUA 3I6GA 1GTFA 1M9WA 3H7BA 1FAIL 2YC1A 2CCWA 2RMNA 4EXKA 4BRVA 3APCA 3KGSA 4N0CC 4K9EC 1JZ5A 2YD0A 2Y4SA 3G5YB 1TENA 5BZWB 2R7EB 3TVMB 4F3FB 1EDYA 3PQYB 5ISZB 5A2IH 2VDNB 4AJVA 1KTLB 1KGCD 3BP7B 4N0FB 4FLQA 4HSQA 2HT3D 1RZ8B 3HE6D 4PV8A 3MUGA 4IJ3B 2JE8A 3G6JF 4L5FE 4HJ0D 4Q74A 3ABMB 4P5MA 4Y4FD 3TL5A 4UTAH 4D9QE 3AM8A 4KTGA 3TFKC 2XXCB 4OKVA 3MNZA 5D7IF 4K8RD 5A7BA 3GXMA 1C1EH 3QJFB 1MJJA 3V6OE 3B4NA 5CJOL 4R5XA 3VWJA 1NBYA 1UWGH 2FRGP 2UY6A 5GJTH 4RFNB 1X9UA 1FFTB 1AHWA 2UZPA 1R5IB 1NCDL 3ESVF 2B2XH 3D39B 4HKJA 4CILA 2XXFA 2OK0L 5LNDA 2WYHA 4XCYA 5F1NB 3T3PB 1P4LB 2FX8L 4TUOB 1NMAL 1CE6B 2WWKO 1XF3B 2A7BA 2Z7UA 5C0BE