2MCMA

Macromomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
112
structure length
112
Chain Sequence
APGVTVTPATGLSNGQTVTVSATGLTPGTVYHVGQCAVVEPGVIGCDATTSTDVTADAAGKITAQLKVHSSFQAVVGADGTPWGTVNCKVVSCSAGLGSDSGEGAAQAITFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROMOMYCIN
publication title Crystal structure analysis of auromomycin apoprotein (macromomycin) shows importance of protein side chains to chromophore binding selectivity.
pubmed doi rcsb
source organism Streptomyces macromomyceticus
molecule tags Apoprotein
total genus 20
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 1991-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00960 Neocarzinostat Neocarzinostatin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.230 Mainly Beta Sandwich Immunoglobulin-like Neocarzinostatin-like 2mcmA00
1NCOA 1HZKA 2G0LA 2CBOA 1J5IA 2CBTA 2CBQA 2G0KA 1J48A 1J5HA 1ACXA 1NOAA 2CBMA 1O5PA 2MCMA 4JW3A 1AKPA 1HZLA
chains in the Genus database with same CATH superfamily
1N3NB 1PFOA 2F54B 3ISWA 3WXVH 3WEOA 2PPFA 2FAUA 3V0AC 3LS5H 4LCIL 1MJUH 1Z3RA 2IWGA 2XV0A 3HS8A 3L3IB 2J73A 4WKZA 3SDAC 8FABA 3MV9D 4K7FB 3VFUA 5E1HB 2DWYA 2CO6A 4FP8H 1Y6MR 3FQUB 1BZQK 4R0LA 3L48A 3I75A 1I85A 5F1KC 3WNJA 3UO1H 1E4HA 5EH1A 3ARGA 5C0BB 3ATBA 4YFLI 3VXTB 4WHDA 2HUHA 4B5ZA 4G7VL 3HW7A 4OIFA 4FQLH 4AZ8B 3GSUA 4PP1C 3DV6B 3PGFL 3ECVA 3L9RA 3GIVA 4LPWA 4OQ1A 3D0LB 5FV2A 1Q9LB 3QNXB 5IVXA 3T2PA 1HJCA 2FIRT 4DO5A 3AXLB 3GSNL 2CQVA 4R4FL 3QT2A 3QFJE 1KT2B 2VN7A 2P5PA 3LH2L 4J3UA 1ADWA 1KN4H 5EIVA 1TQVA 3VWJA 5HGBA 1ZHKA 3N06B 5FB8A 4Q6IC 4JFFA 5ID0A 1CVSC 4MQXD 1A1OB 2NY4B 2CNYA 4YGAB 2WXLA 3F58L 1Z66A 4GMSL 1G9EA 2YXVA 2XI9A 5GZOD 5B39G 4N2GA 4XCYA 3VRJB 3RUGB 3UP1A 2YAOA 3TJHD 3AU0A 2X9ZA 2AQ2A 2N0MA 1FGNL 4TNWK 4RDBA 5ESVA 4TTDC 1CDGA 4UB0L 4ZW8A 5IJVB 3UADA 1FZJA 1FCGA 2DQCH 4HH9A 2E6PA 1B0IA 4J3WA 1PL3A 1QPXA 2V37A 4B9ZA 1S3KL 4Q14A 4Z7WF 1U92A 4RFOH 1S9VB 4G7YH 4KTYA 4RX4A 1VESA 1CXIA 4JZOB 4MS6A 4PY7A 4XB8A 3SDXA 1J0IA 3KWWA 5JIKA 4YAQB 4P23A 2H47C 2K6YA 3Q9QA 1AHWA 1UXWB 2BOBB 4N3TA 1DVFC 3CFCH 5E6ZA 5TGBA 1ZMYA 5TDOA 2Q76B 4WHTA 4GP8B 4MQSB 3TBSA 1FNEB 4XMTA 5LGJA 5KW9H 1EFXB 2ITFA 1VAHA 3PWJB 4UANA 3SQBB 3V9EA 3NCJL 2KZKA 4HU2A 4LFHG 4PAZA 2ZJSL 2K6ZA 1M7UA 3AT8A 4FFZH 4HJUA 5LBVA 3PWUB 5DVNA 3BWAA 5HHXH 3VFRA 4RSYA 1XFPA 1U8OB 4OQTL 1GYWA 2FJHA 2H0FA 5CEXB 3QJHA 2RJMA 5I2IB 2G0KA 2N56A 4KVCL 3A6BL 2APWA 2YBRA 1K85A 5E9DB 1KFAH 2FBRA 1DJYA 1XF4A 3RTQC 3VVWA 3GZOA 4I2XA 2OFQA 3ARZA 2AS5M 2GJ6D 4JREB 3QAZB 2YAHA 4JBSA 5FDYA 4DCQB 2C5DC 5EC2B 3GDBA 2EIMB 3N9GL 4FYQA 4P5MB 4L1SA 2PTTB 5DJXA 4E41A 1OLLA 3PY9A 4WFGD 5JZ7C 5B4MD 4TQEH 4EE2A 1Q9KB 3CLEH 4HFWA 1OSPH 2IAMA 5KYWA 1E9QA 1UATA 2D4DA 1FZKA 1JZDC 2P8MA 3TEXA 3MRNA 4K15A 3SDDB 3VXOA 4BHUI 1ET5A 3GPEA 4JUTA 1R24A 4N0CC 4NNXA 4CMHC 5LDSA 2VDPL 2RFXA 4H1LB 1YNLL 5F9OL 1C08A 3PREA 5T5FA 4PRIE 4MD0B 3TF4A 3D85A 1OGAE 1VFBA 3DARA 4JQVA 2XXGA 4M5YH 4NZFA 3G5ZB 4XOEA 3P4LA 1HEJC 4JN1L 5DURB 1BWMA 1BZEA 5D4IA 1YEJH 3GF8A 3CFTA 1JMXA 2YKLL 4B9IA 2EVIA 2OR7A 4M48H 2WXNA 5L2JB 4JN2A 5IY5B 1HESA 2FEDD 2VM3A 2C7UB 5CZKA 3HMXH 1C5CL 1YAIA 4GO6B 1QG3A 1EAPA 2YQ3A 5CJOH 4J3TA 3WE1A 4AV0A 3JZYA 1C16A 3KVDD 1XGYH 2HKHH 3KYNA 5EUKB 3ETBF 3RWJA 4ZW7A 2WXGA 3ZHLA 1MCSA 3KPTA 2XN9E 1CFVL 1FF5A 1G87A 5H94A 3PAZA 3VQ1C 3PHOA 2EZ0D 1HEZB 1T5KA 3SCMC 2F74A 3A5VA 4FFWC 4WEUD 2CA3A 3W82A 4NQXB 4NQSA 1G9MC 1ZTXH 1D7CA 4OLUH 4Q6YA 3V0WH 3CUPB 3CN1A 1KPUB 3SQOL 2IV9A 3NACL 1QTYT 4TRPL 5AWNH 3R4RA 4Y4HB 1A7BA 4JZJC 4FTDA 1Q72H 3O2DL 3HG4A 4QYAA 1FAIH 5BS0A 3W39A 5IG7B 4EXPX 4NNYA 3MNWA 3W5NA 2DLFL 1D5BB 2WLZA 3EDEA 2AEWA 2FE0A 2VDOB 4P2RD 3TNMB 3US0A 2BRQA 1C1EL 3RIKA 5KBLA 2YPKA 3PAVA 1SBSL 2J7LA 4PJDB 2J6EA 3X12B 2VXSL 1J5OL 5BOPA 4X8JB 1VACA 1AZCA 1ZT7A 5D5MA 1FORH 4G70B 4ZS7L 3S3BB 2X6VA 5J0BA 2YD8A 1G9ML 3T2QA 4DF9A 4P48A 1H8NA 1U8QB 1PF3A 5EN3A 3HA0A 2BWDA 2R0KL 1ML0A 4MNQA 2A99A 4JY6A 1YDPB 5HVWA 2W1NA 2BY1A 4ILDA 1T7WA 3L4YA 4P2QD 4YDJA 4ZUUA 3V0GA 2O26U 1R0AH 2OXGB 4ZQKB 1RH8A 2A9NH 3KPMB 4TOYL 3DGDA 5T1DH 3REVA 2VQ4A 3ARPA 4JPWL 4U0RB 3ZHDA 4ZUWB 4M56A 1QSFA 1D5RA 3I84A 4IHOB 1H3PL 2D03H 1OGSA 3HG0A 4HXAH 1JL8A 3P9MA 3TFBA 4EPSA 4D0CB 3MJ9H 2NUTA 2K8MA 2ZG1A 1DVFA 1ZJAA 2OXHB 4P59L 4TLSA 2EUVA 5JORB 4Z3FA 3EXJA 1O7DC 3OKNB 2NQ3A 1F1AA 3VFTA 3U0PA 2GJPA 4JKNA 2JQMA 2PCPA 2E47A 4JR9H 4GRWB 1A22B 2WBKA 4QIRA 3ZR6A 2H3NB 5HGAA 1N2RA 5FOJA 1BQHA 2WNWA 2BHUA 1FP5A 4GQPH 2F53A 4LPCA 5AZEH 2YD2A 1TNMA 3RZCC 5BV7L 4ERSH 3LKPA 3WTXA 1VGKB 2OMYA 1MJ7L 3GJFH 3VXSE 1G6RB 1DJIA 2R2CA 2BP8A 3JXAA 2ATPB 4GJTB 2VL5B 4QRPD 4JDVB 1QASA 4JM2D 2ADJB 2Y7QA 3FB6B 5D1XC 1CL7L 4ONFL 2ZWSA 4KH2A 4NCDA 5GZNC 1SZNA 3KYKH 4PWHA 1RQ5A 4YNYA 1KB5L 3WLWC 1IFHL 2PCXA 1ZLUH 1ZPLA 4QOKD 2GBVA 2CM6A 1WA0X 3EJRA 1CICC 4IBTA 5I30H 5BRZB 2BOCA 3BAKA 2JXMB 1KWGA 4JFSA 3VGGA 4XP1H 4LESA 4XNMA 4O2FA 2HG5B 4JFZL 3WO4C 3HRZC 3RL2B 4AL8C 1CLVA 3DDGA 4OZGF 5C0JA 3GIZH 3QUZB 3F65A 3HLKA 3OMIB 3LY6A 1U8PA 1GY2A 2VR3A 2N7SA 4N2LA 5IBLD 3DUUB 2ZIDA 1B4LA 3JTTB 3RKPA 4AQAB 5CEZL 2QPFA 2UUDH 1N6QL 4LASH 1JWUB 1ES0B 1MHEB 2DLGA 4H20L 1FYTB 2XG4B 4LDCA 4PJBB 1XGRA 1PJWA 3IGAB 4JO3H 5EZJB 1VENA 2SODB 3D48R 4XPBH 4ZX6A 2I27N 4LGPB 4MD4B 1JDCA 4QEGA 4YSOA 2WXQA 4F33A 3Q6FB 4V1DD 3WIAA 4XMLL 3QG6A 1R1CA 1ADQL 4DGIL 3SHSA 4L8CB 4MRCA 1J1PH 5CN1A 1RZPA 3K3QA 1VRSA 2B77A 2PPDA 4BYHA 3MBED 3HG1D 1WWWX 4OGAD 4AMXA 1EZVY 1U8CB 3QIUB 1A3RL 1XR9B 1HFUA 5D7SH 3SCMA 3BQUA 1WC7A 5BOJA 4OZGE 3KJ6H 4OGQC 4XBPA 3U6XA 1PMYA 4RRPM 1SJHB 4PS4H 1H9VA 3RGHA 3NFPB 1HU8A 3EH4B 4HAFA 2BO0A 3MOQA 4ANWA 3GMRA 1F4XL 1NCWL 4XWOD 5IHHA 4U1IA 2F9BT 3H8NA 3QCVH 5HVHC 3L6FB 2NXYD 5HDBF 5K93A 3MREB 3HNSL 4LCWE 4HWEL 1L0XA 1F45A 1JGEA 2H1XA 4PBDA 1YN7A 1ZHLB 4N8CL 1IGJA 4S0TD 5DMGD 3ZDXF 1R9FA 4Y2LA 2Y1AA 4K7PL 1MQ8A 3D25A 3BVUA 1YRKA 5SWSD 3D3VE 4NRYA 4PBWD 3OR6A 3QJFA 3L5JA 4R6UA 4AXWB 4BZ2L 4AUUA 3IB4A 2VDLL 4PS3A 1TYEB 5JW5A 4QHMA 5DWUL 5GIRA 4HMCA 3WFEH 5DZOA 3QQDB 4J8RB 4PR5A 2UYLA 3BW9B 3Q01A 2B7DT 3CWGA 1ZA3A 3ATEA 4JS7A 3N1MC 4XTRD 5EO1B 4L37B 1KIPB 2R0LL 1E6OL 3PV6A 3U4EA 2K3HA 1FVCA 3GI9L 3KPLB 4HK0B 4I18A 4UMSA 4DP2X 2H41A 3LZRA 4HHAA 2AXWA 4OH2A 3TF7C 1G6VK 2BVPA 2FQDA 3RX8A 5HDBE 4LCUA 4BDVB 3GSWB 4OB5H 2VDQH 2RA1A 4NYLB 3IGFA 4MAZA 4O51A 3ZDXE 4D9RE 4NFCA 3TWCL 1L5GB 1LEIA 1KCUL 1JFHA 3EGXA 2G75B 2C3HA 3IDXH 1RZJL 1MRCL 4B95C 1TOXA 1JHLL 2JI2A 3L9EA 1P7BA 4BSJA 4MA3A 1RK0A 3QDME 4YSDA 3FQTB 3BPLB 4FA8A 3WJMB 1XB8A 3RB5A 1CBJA 1IBZA 2XKSA 1IKNC 3O0RL 4WK4B 2VIRA 2ZX6A 1U3ZA 4PJHF 5DUBA 3W38A 4M6OL 1F11B 4PBVC 3UYRL 3UG4A 3TZVB 3ZU8A 1HWHB 2WXPA 4O2CA 4JCMA 2BVYA 1EMTH 5JHAA 3EXLA 4GSDL 1MWAL 3CMOH 4HSCX 1AH1A 5BMFH 1AGCA 4MJJA 1OAXL 4N0UA 5D7KD 4EZLA 2ZWNA 2QV4A 4RAVB 2AJ3B 2HFGH 4WW2B 3TCTA 2W0KA 1UYWH 3ULSB 1G7QA 2ZXCA 3T6QC 3CFIC 3VDCA 4JG1L 2GCYB 4FFYH 5D55A 3U30C 2VDRB 3FUJA 4PRHD 3T0ED 3EJCA 4NSKA 4JHUA 3EYVB 3L1OL 3ME0A 1QQDA 3SE8H 1CD1B 2BNRE 4P8QA 1U3JA 2ADFL 4ENED 5IIEB 2AJUH 5I1LB 2ICEC 2ICWA 2X4UA 5I6KA 4OV5A 1EZLA 3MLZL 3RDJA 3IDNB 5GRZA 2Z8WC 2KYIA 4MXWH 1XWVA 5LWYL 3V4VL 4E5XG 2X1QA 4ADGA 4KK9D 3W0WB 4JFDD 3V5HB 3PXJA 3Q0HA 2DZEA 2GSMB 4PJHE 2DQUH 3TGXA 2ITDB 4H0IA 3HI6H 1CFSA 5KUKA 3KPRA 3FUKA 1AIFA 5GGRB 5I5IA 5AYTA 3TBVB 2HJFB 2QHRL 4ONHA 2CKBB 2VDNH 1F90L 1VB9A 2WLIA 2V3DA 4HJ0D 4HS3B 4MNGA 2DYPB 3CX5J 4PG9B 3OAWA 5IVXF 1JF1A 2HN7B 3H85A 4LOEA 4J6IA 3GI8H 1Z9OA 3IMBA 3GJEB 4NO0B 3CSGA 4AM0A 3TJEL 5EIIA 2DDQL 3L5WA 4KX8A 5D4JA 2JLLA 4DNLA 4MLIA 5FR3A 4FA7B 2KHAA 2WLKA 5MEOA 5BRQA 3U82B 15C8H 2G5BB 4EKJA 2N7BA 2OTUA 3B9KD 3GHBH 2HT4D 5BUAA 1A6UH 3NCYP 2APFA 1CDYA 4KQ3H 2DMBA 3OZKA 4X8XA 2R56H 2I9TB 5F2FA 1BBDH 3GPSA 2EE0A 2J2ZA 4EUPA 1IC1A 5CCGE 2FX8L 4UV4L 1SF5A 5JW3L 4ZT1A 3LQAH 1UENA 5T1MB 3FUIA 2HT2C 1WFNA 2A6JB 2EKJA 3HE7B 1HHHA 1RSYA 4UM8B 5DJAB 3EO1B 2XWXA 1GZQA 3O8XD 1CWVA 2LTQC 3FT9A 1P4IL 5C0AD 4E2OA 2DH2A 5ITBL 4NX0A 1U36A 1XGZA 4YDLB 5KVDE 5IVXE 2WV3A 4JFOB 1ETZB 4PJ9C 4UAOB 3EYQD 1PS3A 4OIIH 4TPRH 1C5BL 1D9KC 1MJUL 2QTVA 3D4GA 3JT0A 3LS5L 5AW8B 4DQAA 5CSZA 5GGTH 1IC5H 2G4GA 2NCEA 4QXUL 3EBIA 4J27A 4WWKC 4JFFE 5AKRA 5I9QC 2XPGA 3UO1L 4CU7A 5IROC 2IADB 4PJ5D 2G5UA 1XSOA 2VISA 2F5BH 5DRWA 1N70A 5SX4H 1RJYB 2SEBB 1U41A 3V0EA 3FO2A 2XQYK 1X6LA 2R0ZH 3KLQA 1MHHB 3QRGL 4HS6B 3DWTA 1IEBB 3OHXC 3M45A 4FQLL 1P69B 3JV4A 5T5NG 3HS0B 3B34A 5DQDL 3FOLB 2A74C 1ZLDA 3OAUL 4UQCA 5IQNA 2F8IA 2IBZY 2ZD0A 4L4TD 1L0QA 5BQ7B 1U3HB 4H8HA 3KPSA 5CJ8A 3UC2A 1L0PA 4GW1A 4Q0XH 3KH4A 1KN4L 1BIHA 1G4RA 2VWEC 3DPBB 3S3DB 4PP2B 3SBWA 3DX8B 1RZ7H 25C8H 3ESMA 2FGWH 1KCLA 1KTDB 2PTVA 1QLFB 4QLRA 2G0LA 3QIBC 3LKRA 1LVEA 3VFSB 1MI5A 2YEVB 1XGUA 4XCEB 1PIGA 2Q10A 2VZ3A 4Z0XA 2DQTL 1GA2A 1A3LH 1IJ9A 1T5XA 3OJ2C 1SRDA 4IGBB 4JFEE 5IESH 5D1ZD 4W6YB 5F1IB 4X7SL 3MA9H 4ZAKD 3S36X 1MH5A 2DQCL 2Y23A 1QLRA 2ZSWB 3BWUC 4OD2A 3RDTC 4CGTA 2EXYD 3U7WL 4EN3C 5MEQB 1BV8A 3QULA 5E4IA 4LRIC 3ARSA 4F7MB 3LXBA 3BGMB 1FO0H 3IETB 2A6DB 3GDCA 4RFOL 1WHPA 4G7YL 3LIUA 1CGUA 4GY4A 2O30A 1PVHA 5BVJB 4AEIH 2VMDA 1JPEA 2F54D 1R19A 2FWLB 3HPLA 3G6JF 4ZMYA 1THCA 3KGSA 5MERA 3HZKA 5I76A 3CFCL 3DUHA 3FQWA 4R96B 1CFTB 4HT1H 2FZ3B 5IFJA 3MRKB 5D7IA 1AS7A 1H5BC 3UBXG 2QMJA 5E5UB 5KW9L 2IWKA 3DJ9A 3QJXA 4DFHA 4E41E 3O3EA 2CLRA 4XI5D 4L4VA 4QO1A 4G9DA 3C60C 4FG6C 5LAXB 3VYPA 3QUMH 4TL4A 5HTSA 1FWXA 4FFZL 4NKDB 3DVGA 4G7QB 4KY2A 1V3LA 5DHVA 3TTYA 5HHXL 4AJWA 2J8HA 4NZJA 1KXQA 1Q1PA 2Y5QA 4JFUA 2F7RA 3CZFA 2J1YA 1TEFA 1E4XL 1UVQA 4LVEA 1SGKA 3FB5B 1KFAL 1XGTB 4U1NA 2BSRA 1KG0A 2DQGL 3II3A 4ZPTA 4ALAH 3MNDA 1HHIA 1FNHA 3BKJH 1AQDB 3MRLB 3MBXH 3NCMA 1WD9A 2NY4D 3G6JE 4Z7WB 1PEWA 1DEDA 3NESA 4DZBA 4CADB 5A2KH 1NIAA 1JPGA 1K4DA 1NOAA 2X5PA 1CFQA 1DZ0A 5DJYA 3FU7B 1FIGH 2ZX7A 3RL1A 3QWOA 2ZCHH 3F00A 3ULUH 1CXHA 4JPVL 5SV4A 5D1QC 3KLDA 1F18A 2NPLX 4ODTH 3RNQB 3B9VA 4MMZB 4IOIA 4ZOCA 4KKBC 1ZLSH 1ASQA 3VO0A 1L6PA 5F6IB 3NCYS 5D5MF 5HY9B 5E5MB 3U7YH 3ZKND 4MCNA 4B7IA 5CJQH 1I4FA 5L4IA 5I8OH 4FZ8L 2OCFD 5ANME 2NY5C 3EJYC 4L3ED 3QJSB 4J3OD 5CLYA 1DP0A 1UEMA 2QV2A 5TPWH 5IOKA 4I5BA 4NP4H 1Z9MA 2DB8A 4PRIB 1OB1A 3GKZA 3ILQD 4ZXBC 1Y0LB 1YEJL 3U2SA 2YAMA 3KL3A 4Y5YB 1T2JA 2XG5A 3KXFA 2BDNH 1FHNA 1OGAB 1IGIH 5HHOA 5IP4A 3ALXA 2YAEA 1J88A 3HAEG 4M48L 5CKGA 4X9IA 4TQPA 4P5KA 4JLRA 1M4KA 4Q89A 1SMDA 4HULB 1Q9OB 1XGQA 3HMXL 4QYOB 4RGNC 5H2BA 5I1IH 4XMKH 4XP5L 1D9KA 5DJ2A 4Z3JA 4U0QB 3N40F 3DO3A 4PSRA 5CJOL 4YZFF 4X7TB 2FHCA 5A7EA 3NSCA 3B9EA 1XGYL 2HKHL 1U4FA 4OM0H 3RIAK 3MUY1 4KI5F 3QUYB 3HN3A 2AV1A 1UKQA 2C9XA 4NUPA 4DT2A 4KKZA 1OD7A 4QJ3B 1Z5YD 5AL0A 4M7KH 1OIOA 3B7YA 5D5ME 2Q3AA 3TA3A 3AMKA 2XIIA 4ZMXA 2G2PA 3OHXA 3BD5A 4Z78B 1ZTXL 5DD3H 3P9LB 3NGBC 3V0WL 3NJMA 5AWNL 1D5MA 4X8GA 4FXKC 5FWQA 3EFDH 3H54A 3H3BC 3QA3A 3UAFA 5HXMA 1INQB 4JFPB 1EPFA 3D50A 1Q72L 1FAIL 1PY4A 4BH7B 3DX1A 1E8WA 2CKNA 5IQMA 5IMKA 4IIQC 3T08A 1S9YB 4JL2A 1QSFE 5J6HA 4F3FB 1LILA 1WT5A 4QXTA 4FMFA 4PMFA 2YD3A 5E1AA 5DS8A 5GRXG 4AOFA 4YZFE 3CDZB 1LDSA 1FORL 3TV3L 1IM3B 2P8PB 3BSZA 1BQUA 1JV2B 2B1AH 3GMOA 4KI5E 4LNVA 4APXB 4CDGC 3B3IB 3ZRSA 4XPTH 1BPLB 2Q86A 4KOBA 1S5IH 4YH6A 5GGUA 1R0AL 4G82A 4BFEA 2A9NL 3F12A 2F53E 3FHQA 5FGBA 2J1ZA 3NP4A 3RAJL 4OD1H 4ADIA 2W80C 2GUYA 3OR7B 4YXLH 5L2KA 2D03L 4HXAL 2V7NB 2XX1A 2AJXH 4WKXA 2DQJL 4N2FA 5J3HC 4PJ6A 4ZFZB 5C0FB 2F1AA 2R7EB 2B0SH 1W9XA 3OSKA 3WJJC 4FRWA 3CZNA 4JFTA 3S4SA 1F02I 2HJLB 3FU9A 3BPNB 5IB5A 4KRPD 3QIWC 1Q0EA 4OFIA 5B7MA 1I1AB 2YXFA 3CHSA 5I18H 2FBOJ 2DKSA 5JXEC 4OF3A 4Z7NF 3J7HA 5C09A 4G42A 4ERSL 1ZVSA 3BDXA 2O5ZH 3QO0B 5EEVA 3JT2A 1R3LA 3T1FB 4KUCF 3X3FH 2R4SH 5DJCB 3ZKXC 1TZHA 1M7IA 3MNZA 5DZNA 1RIUH 3QAQA 2W94A 2GKIA 1KTKE 2ITCB 4HK3J 3VFVA 1P5UB 3AAZA 3VXSB 1WO2A 2H6PA 3FB8A 4G1MA 5J1AB 1IGTB 2PPAA 1WAAA 3KYKL 2M8XA 4GBXA 4WW1B 1FGVH 5JUEH 4M7JH 3BJ91 3D12B 5T3XE 4LOVA 2XKNB 1EAQA 5K9KB 2WZPD 4LVHC 2D9CA 4C83B 5I30L 3ECBA 1R3JB 3AW5A 4JFXB 4OZ4B 4YVUA 4AGMA 4TUJA 3S96B 5FF6A 2OQJA 4ZMZA 1J11A 4EDXB 1RLBA 5D7LA 4ONGH 4NCC2 4PCKA 3ZPDA 1QACA 1OTTC 3P3TA 2VABA 3GIZL 3AGWA 2Y0SA 3N85H 4Z7NE 5F7EH 4Q9QL 2DWDA 4R7DB 1KXTA 3RPIA 4DGYH 3BLBA 2GK2A 2ZNWA 4RNRB 4BBWA 2HXAA 1XZWA 4F2MA 4LASL 3PABA 5F71A 4KGJA 2PCFA 1TPXB 3BIBX 2CO1A 1EEZA 3VFGL 4JO3L 4ODBD 3WEXB 4FKHA 5KSAB 2FLBT 4XPBL 1T0OA 5F1OB 5T1LA 1RK7A 4RFNB 4GMTH 3W9EB 1CZ8H 5A2JH 3D52A 3Q3GA 5DJ0A 4HIIB 1IKFL 1DDHB 1O7VA 3DHPA 3OKKB 2J21A 1I7RB 1BG1A 1HDMB 4JPQA 2HSIA 2JB5H 3G08B 4HSAC 1J1PL 1U8HA 2NW3A 1P5VA 4HJIA 1JZ8A 3FPYA 3HS9A 4GW5A 4L8SC 1JUFB 4JKWA 3DUSA 5D7SL 3VD2A 1FG2B 3FL7A 2OR8A 3GLDA 3MO1A 3KJ6L 2VGLM 4OFVA 4PS4L 1NBYA 3QRFM 3FNKA 3UTSA 2VRAA 5B22A 1CF1A 1R3IH 1AO7D 1KACB 1E3XA 2VSMB 4FXKA 4OZGB 2JB6B 4RWYL 3QCVL 5LCVH 2WBJC 3ULVD 4P4RA 1XF3B 3VW3L 4FQHB 4FQXC 5GS1A 5HHME 4G6FB 2BS71 3WKMH 4WFHE 4WNQB 5BRZD 2UXVA 5AOJA 2YO3A 1YEIL 3FT3B 4M8VA 4PGBA 2FYYA 4AVKA 4B41A 5I5JA 4R2GB 1EXHA 4LCWB 3MTXA 2C4FT 4HJJL 4ABVA 4YUEL 1OTSC 1B2WL 2DEYX 4BXVA 3QEQE 1CYGA 2NR6C 1F5WA 3UBHA 2XOTA 4B6ZA 1MXDA 1X5KA 5IMMA 3LPPA 2UZIH 4L8BB 3D3VB 1PD6A 4TLUA 1BZDA 3WFEL 5F96L 2HZHA 4M7ZB 5FCUH 2ZUQB 2OMUB 3RKDD 1DBBH 2C1OA 3QH3B 1BZ8A 3IDJB 1JWMA 3KCWA 3B7TA 5CF3A 3ARDB 3LXAA 4AK2A 3FYIB 1RUMH 4Q52A 4QF1B 2E75C 3BPOB 5SX4I 5C6WH 2A4EA 4G9FB 4ZFOB 4G6AC 5JQIB 2XJLA 5D71L 2Z8SA 1U95A 5GRJH 2WOYA 1NINA 3UMTA 2WSPA 3VGAC 4KXAA 2VYRE 3LZLA 1Z6JT 5D6CB 1J9TA 5DQJA 4OB5L 3B2UC 5D1XE 1FV1B 4QWWC 3PWPE 2VMCA 2EKSB 4OM1H 2NX5E 4LEBA 2CIIA 5C0IB 5HDBB 4IKNA 2FYVA 3WEBA 2HJKA 2NY1B 5B1JC 1M9WA 2GBTA 3IDXL 3RWHB 1HKFA 1TVDA 5CJ5A 3MGOA 2HA1A 4YK4C 2HTKD 3IT8D 1SLUA 3QIWA 4OZFB 3EBAA 3ZDXB 3SN6N 4W4OA 1QHPA 2VQUA 4LARH 1MJJB 2WWMD 1A2YA 3NJJA 3CSTA 4Y7MA 1CFBA 2UZXB 5IHUH 3DVNA 5GSVA 2JI3A 4XNZB 1KNOB 1EMTL 1I7ZB 4QRSA 4LSRH 4U1JA 4HUNB 3FCBA 3CMOL 5JHDA 1FYHB 3MGAA 4OGXH 5AYQA 3IFOA 1JZFA 2GBUA 1W0YT 3DRQA 3RA7L 1XF5B 2V7HB 2HFGL 5IW3A 4WWOA 1UYWL 4NC2B 2WWKT 2IWFA 2IEPA 3IJYA 5FYJU 3ZO0A 4JE0A 4MNGE 4PYGA 5J56B 3CMGA 3DX6B 2IBGA 5HPMB 4LRNH 3L3JA 1ZGLB 4UQ2A 4Y89A 1IAKA 1G1CA 2AJUL 4JJHA 4O2EB 3L4TA 4HBCH 3FCTA 4F5CA 1O6SB 1AGEA 3TX4A 1DE4A 3ROOA 1ID5I 1X5GA 4MKTA 4AITA 1UD3A 4MXWL 3RX5A 4OLWH 3C9NB 2BNRB 4MLSA 4ZUSA 1JFQH 2IANB 5IFHH 1ZOXA 1ZPUA 3IRPX 2FQEA 2YUXA 3HI6L 4IRSC 1NDTA 1HE8A 2MIZA 3FTYA 5SX5K 4U31A 3TYFA 3MCG1 3G7TA 2VDNL 3RFZC 1U4EA 4QRQB 3IAQA 4PJHB 4XO8A 3P40A 3T4AC 3WUWB 3G9AB 5FO8B 1Z32X 1S7SA 3ASOB 4FTVA 3GI8L 4MA8H 1NDMB 2BCMA 4OZHA 2AJSH 1AKJA 3CU1A 5F1SA 4WU5A 5F0JB 3IMWA 4F9PC 5IB4B 3MOBL 1YCSA 5D7JD 2Y7NA 5FUCC 3P69A 1OCOB 5TE7H 15C8L 1AGBA 3OKEB 5E8OB 3GHBL 4CVZB 1LJMA 2BWIA 1T22B 1A6UL 3TXAA 4KQ3L 1NMCC 5GZOC 2R56L 1MG2C 1CE6A 3CFKB 3Q13A 1AG0A 1BBDL 1Q4NX 2GABA 4WSJA 4X6EA 3TJHC 1UD4A 4WKZB 1BJMA 3TVMA 8FABB 3I6KB 3VFUB 4XOCA 1MY7A 2CO6B 2QKIC 4R0LB 4OKDA 3LDBB 3WCYA 5LG6A 2VZUA 4WSGA 2Q8BH 4NHCH 3FUFA 3CSYA 3HIZA 5G4NA 1TF4A 5AKTA 3ZN6A 4FQXA 4Q9RH 1WCBA 2VERN 2WUBH 4XH2A 1GCYA 4OIIL 4YSSA 1JZJA 1WSST 2HPOA 2QLYA 5ELIA 2C9QA 2PYED 2WWOA 2GUOA 2DEWX 2W9EH 1IC5L 3L9RB 3VGBA 4F1SA 1OZUA 5IVXB 2CCLA 3BRGC 5D7IF 3FN9A 5LNDA 2CJTA 2W92A 2NR6A 1RAMA 3EZJB 4E36A 3E0GA 3N50A 3L2MA 3VWJB 5E0QA 5HGBB 1QR1A 2BFVH 1T4WA 3RVXC 4JFFB 5ID0B 4XP6H 4B5EA 3B3BA 4XPFH 4IOFD 1MCHA 2BSEA 5ECJE 1Y1DA 2WLNA 3VWKB 4P2CG 3LKOA 2DYPD 4JKPH 1CK0H 3BH9A 1OP4A 1G7IA 4XCYB 3O4LA 3BT0A 4P0DA 3JWOH 5ESVB 2ZOKA 4I1RA 5KS9F 1XH0A 2P42B 4Q0XL 3US1A 4X7FC 3PG2A 4JQIH 2APSA 1RZ7L 25C8L 2BY0A 2DIJA 1RZ8A 1MLBB 2FGWL 3GZPA 4ZSOE 4GYBA 2V9RA 3IPEA 4I48B 1A4JA 1U92B 3IRZA 2X4OA 1TUPA 4XPAH 1A3LL 3F5WB 3IDYB 5B1JA 1IGCH 4J3OG 1RL1A 3OVUB 4M5ZH 3VXUD 5B4MC 5IESL 2ENQA 5CBEA 1E4WH 3UAJD 3TFKC 4BE6A 3SDXB 1E9OA 5D7IE 3MA9L 1XH3A 2WBXA 5DF0A 4KRNA 1UB6A 4CMMA 1XF2A 3MV8E 5BQDA 4FI7A 1AHWB 2Q7NA 2MHAA 4OCSH 4L4VE 3HE7D 5KVEE 5CZRA 4ODUA 3M07A 5MHSD 5TDOB 1YHPA 1YMMA 4WHTB 4IMLA 4ORZC 4OLVH 1FO0L 5GS0H 4ZBJA 1I75A 2HH0L 4AEIL 1E3FA 1KB3A 3ZTJH 1AXTH 3MLYH 2X28A 5JO5A 1EXGA 1R4XA 3L1FA 4BGLA 3V6OA 5KS9E 3FFCA 4PJ8C 3BWAB 4OFQA 4RFEA 1INEL 4XGZA 5IEKA 1D3CA 1VZHA 3VFRB 4M7LT 2FJHB 4HT1L 3LRHA 3QJQB 5BCAA 3QJHB 4DZ8A 1UGNA 2ZICA 2YBRB 2FO1A 3D06A 1XF4B 4I2XB 1FFNA 2JCCA 1OZTG 5DHDA 5JIQA 3LPGA 5D4HA 1PZSA 4LE8A 3QUML 3EBHA 1IIIA 2CBQA 3NFNA 4XPHH 2CUMA 4E41B 2WP3T 3BESR 1BOYA 3LPOA 2L04A 3SYOA 3PFQA 1WQVT 4HFWB 2IAMB 1E9QB 5KAQG 1V3MA 2XZZA 3O11A 5F3FA 1FZKB 3TN0A 1SQ2N 2P8MB 3MRNB 2EZ0C 4HKXB 3VXOB 2X4RA 4TSBH 4WU7A 3QK0A 5IOPA 2BZDA 3MRRA 4AMWA 3BKJL 1R24B 2FK9A 5DZJA 5DD6B 3BYTA 3MBXL 1XMEB 2LE9A 2RFXB 4H1LG 4K71C 2W07A 4NZTH 3VXQB 1C08B 3ALWA 3BDBA 1WGVA 5F88A 1FIEA 3TPUA 4AQ1A 3HN8A 1KN2H 2N1TE 4AKQA 2D9QB 3D85B 3MLUH 3K80A 3KXFE 4IGBD 5HHOE 1VFBB 4TM9A 1UQSA 1FIGL 3D9AH 2ZCHL 3ULUL 1LK3H 4WVRA 2QHLA 4MHHI 1KUMA 2ZT9C 1MWOA 4L1LA 3SZKC 1GGBH 2WSDA 4OJEH 1ZLSL 1CGXA 3SOBH 3EW3B 3FRPG 4EMZA 2EC9T 3FCSA 3U7YL 4YSQA 4R5XA 3U1PA 5CJQL 5BZDB 4ATTA 4LOFA 5I8OL 1EAJA 4DN4H 3SDAB 1DJZA 5TPWL 3SPHA 1EAPB 1WP6A 4G8FB 4JFYA 3BWUF 3V6FA 4PIRF 5C0EA 1C16B 2KLRA 4FFTA 4X6BB 3B4NA 3KYNB 2E9GA 1HX0A 2BDNL 1IGIL 4ZFFA 5H94B 3V6ZA 2OYPA 5JQHC 4YGVB 3G6DL 3PHOB 4P2OD 2YLKA 3KYMA 4IU2A 2F74B 2O1AA 2C9AA 2FO8A 4L8DA 5I1IL 5IB2A 2BW5A 2X4TA 4XMKL 4NQSB 3P77A 3IMUA 1BQRA 1EO7A 2VXQH 4M93C 2KLTA 4NUQA 1JVKA 5DHXB 2D0HA 1F2XK 3BPCA 4M00A 5I71C 1VEPA 3QFDB 5KVFH 3IXTA 4XN4A 1FFQA 2OKMA 2V2WA 2Y5TA 2FLMA 4GAFB 5TDPA 2NTFA 1PGRB 2R69L 3W39B 5BS0B 4NNYB 3MNWB 1H15A 4LDEB 3RIFF 1S6NA 1ORSB 2YPKB 3QSKB 2G9KA 5EO9A 5DD3L 3WS6A 3FRUA 1PTZA 3FTZA 2I9LA 4IBQA 2OP4H 5I19H 1VACB 1ZT7B 4BJLA 1UHVA 5D5MB 3QRLA 5FYKU 3EFDL 3T04D 4UNIA 3IMVA 2P7TA 2DM7A 2HKFH 4AMKH 2TSAA 3IU4L 1JGDA 5E4AA 1SLWA 2HLAA 4JY6B 5ID1A 2FBJH 2VE6A 4JM2C 4CVWA 4ZUUB 4ZYKA 4YDJB 1KBPA 2QVMA 4FXGA 5L2KE 1FUNA 2XFXA 3BP4A 1NUGA 4KK5D 4ZFGH 4G5AA 4KJPC 3W5MA 4N2HA 3REVB 3R18A 4DETA 4QKXB 3G3LA 1WE5A 3TO2A 2JJTC 3ARXA 2APXA 4NDMA 1QSFB 4FXTA 4WV1C 4LF3A 2ALAA 1YJDH 3DBSA 4WTQA 1FH5H 2IDCA 4MJIE 1HSAB 3DXAD 3P9MB 2VJ8A 4XPTL 2NUTB 3DX9B 3H6AA 4D8PA 3ILPB 4QRAA 1DVFB 2VT0A 4KWUA 2Q2EB 3MXWH 2BVEA 4WZ9A 1S5IL 1BA9A 3UEZA 2D3LA 4FJ6A 1DLHA 4YPGB 2IV8A 2KERA 1J1XH 3VFTB 7TAAA 2GEQA 3U0PB 3FT4B 1NEUA 5IK3A 3RE0A 2PCPB 3IRCA 3EGSA 4OD1L 3I02A 4YXLL 2NXZD 5JMRA 1N2RB 2AJXL 1BQHB 4BUGA 2HPTA 1CDHA 4GI6A 5IBLC 2P52A 2F53B 4LKXA 2FX7H 4G8IA 5FECA 2JJWA 4FCAA 2B0SL 5C08E 2AQPA 2EIZA 3LKPB 4M1GH 4RSVA 2OMYB 5I24A 4GW4A 4RAUA 3NG5A 2OI9C 2XA8H 1PY9A 3J07A 4HW6A 5A2BA 4IBWA 1E5CA 4XBGA 3MV7E 1QFWH 4HJ1A 1NFIA 1WAPA 2Y7QB 3QYNA 1EEYA 2YN3A 4LIQH 3FTWA 3FU5A 1NMBH 1P2CA 1QRKA 2X4SA 4W9JC 3AXHA 4L1BA 2XTJD 5D1QE 3S9DB 3FQRA 5ECGA 4F9LA 1DANT 4YNYB 1ESOA 3MBEC 3MPCA 2RQEA 4X0NA 4OGAC 4PS8A 4XN1A 5D7LE 3O2VH 2YQGA 2WUCH 4P46C 4QTIL 3L1GA 4LSTH 2R4SL 4WRLA 3X3FL 3ET9F 2OMTA 4XCNA 2BOCB 4DESA 3DMMD 5FO9A 4CMHB 4XNMB 4O2FB 4N2KA 4ZUVA 3AB0B 5A3ID 3R0NA 4KXZH 5AB2A 1WZMA 2XUWA 4XWOC 5C0JB 3DIFA 1FGVL 4M7JL 3VX1A 1R46A 1OSZA 2OV0A 3UGXA 3T71A 4HKZB 5FK9B 1NAMH 1U8PB 4LCYA 1K6QH 2NXYC 3SGKA 4P2RA 5F9DC 4UIMB 2OZ4H 3KG5A 4RGNE 2XIBA 4YHYB 1GTNA 1KXVC 5IVZA 1BVZA 2KDYA 2WKOA 4K3JH 5HYSB 4ONGL 1G6RH 1XGRB 3QISA 4NQVA 1XDTT 1ACCA 1XL6A 3VM7A 3IU3B 3NFSH 4M1CC 4FNTA 4F33B 2Y36H 3N85L 4F37K 5F7EL 3QG6B 4DGYL 5I0VA 4NP9A 5H37G 1ZLWH 4NBYB 3D05A 4N87A 2Y25A 4P2QA 4Z7NB 4CA4A 1IARB 2B1HH 5FXCH 3L5HA 5DJ6A 1ZIBA 4XTRC 5T3ZE 4UQ3A 3SCMB 1WC7B 3OGCA 2GT9A 2UWEA 3Q06A 4GMTL 4NN6C 1LO4L 3GMPA 5F93C 3PQYD 4DUXA 2ZP8A 1I1YA 3GMRB 3X13A 5DMIL 2L0DA 3RX7A 2KC0A 3A4FA 1G0YR 2Z92A 1I1AD 4U1IB 1EGJL 2YEZA 2X6MA 2WVVB 4P9MH 2AZUA 4PFEA 2K7QA 3MTRA 4NWTH 3QUXA 1WCQA 4S2SA 1QFHA 3ZL1A 1JGEB 1F3DJ 2F61A 3G5YA 1YN7B 3LXCA 1IGJB 1W15A 2PXYA 3WD5H 3FAWA 1R47A 1XCQA 1R3IL 4NLHA 4TSAL 4HPHA 2X2JA 1Y18A 2CE6A 1AG6A 4HEPA 3HZVB 3UDWC 5KBPA 4K9JA 1L9SA 4NRYB 3TIEB 1FFOA 3K2MC 3QJFB 1CIDA 3NZ8A 3P4MA 3UXFA 3EH5B 1K3IA 1JP5A 5JW5B 4QHMB 2ZF8A 4JM2A 5GIRB 5TE6L 1FNGA 1EHAA 5GS2H 4JQXC 5AB0A 4PR5B 2XRAH 2UYLB 3RTLA 5EN2A 1ZA3B 1VZIA 2FJUB 3VFPA 1LQBC 1P84J 2WTPA 4O4YL 3U4EB 2AW2A 1FVCB 4I18B 1NFDA 3BWSA 3TO4A 4QOKA 1BYOA 3CVDA 2UZIL 4MJ5A 4N0FB 4ENEC 1IB5A 2P80D 4P3CH 1MJ8H 2I25N 4Q9BA 2VOTA 2WXFA 5FCUL 1A6ZB 1BM3H 1DBBL 2DLIA 3QEQB 5I17B 1FG9C 5GPRA 1B9KA 5E70A 1LEIB 2FJFA 3EGXB 1SDDA 4NBXB 1RUML 4LMQI 2CBPA 1U8IA 3NEOA 3GGWA 4KK9C 3CIAA 3TL5A 4H0HB 1D7FA 1WFOA 3EJQA 1J1OH 4MA3B 4N2NA 5INCA 4MBRA 4PPTA 1J0ZA 3A3YB 1KPRA 2VIRB 1TKWA 2N0KA 2HX7A 4J3SA 5DUBB 4HJ0C 4OM1L 5CIPA 3NIFF 3BFWA 4YHNA 4O2CB 4OZHF 2XETA 32C2A 5D1XB 4V1DA 4C4KO 3PWPB 3CAFA 2RAMA 4HS8H 2WAHA 2NX5B 1JPFB 2R8SH 2E3VA 4LARL 4MASA 2P47B 1G7QB 1ONQA 2VITA 2X3AA 2R27A 3K6IA 1XBRA 1N0LA 3MBEA 2WXHA 3B9KC 4JHVA 1WBYA 5ICUA 4UT7H 5IHUL 1JTPA 2HT4C 4NSKB 3KWTA 1A7NH 5I73C 1DBMH 3ME0B 1ED3B 1IZJA 1U30A 4LSRL 2GJJA 3H0TA 2X89D 1QR4A 4OGXL 4PWEA 3PGCA 4WTZA 3KNBB 2ICWB 1RP8A 5CNHA 3WO4B 4OV5B 3UG3A 3HRZB 1YO4A 1T0PB 2X0VA 1TZGH 4A68A 2YAPA 5J9PA 3HNVH 4R3SB 3UTPD 3BO8B 4BHUA 3EOTL 2IQ9H 2QPEB 3O8XC 4UWQB 5BO1L 5EU6D 5DZPA 1CFSB 3KPRB 1EBAA 2QVFB 2DMHA 1AIFB 3KCPA 4FTVE 2F58H 4OTXH 5AAWA 3EYQC 5FEBA 4F1ZA 4ONHB 4OZHE 1ZA6A 1KB5A 3JBG7 4HBCL 4MNGB 5I8KH 2QSCH 5AUMA 4NM4H 3QI9C 5HVFB 5C7XL 1JF1B 3EF4A 5HGDB 4OLWL 3ZDYB 4JK0D 4C58B 5SWSA 1E43A 5I5MA 1JFQL 3DLQR 4DVRH 1V27A 5E5RB 5FO2A 4BCYA 5LHDA 5EIIB 3L5WB 4A6YA 4G9FD 2UXGA 5KTEH 4FNLH 4Y19A 1OANA 5DZAA 1DR9A 1M2VA 2B1OA 2D73A 4W4NA 5MEOB 1ANUA 1MNUH 1EVTC 4CC0A 2E7CA 4U1HA 1HZHH 3V4UH 5I15L 1R6VA 1MCWW 1OP9A 5E7BA 4JRXD 1MIMH 5LBSH 2J2ZB 3ARBD 3D08A 3CZSA 4MA8L 5F7YC 4EUPB 2AJSL 2NY1D 3REWA 2D8KA 2DQDH 4WI6A 5JMOC 3P30H 4MZRA 4RMRA 4UT9H 3F01A 3NSYA 2YPVA 1KOAA 4M8QA 3UP6A 3MX0A 1NAKH 1HHHB 2F7IA 4ZO7A 5TE7L 2Q7YB 5HVHB 1MPAL 4HGMA 2APTA 2XBTA 3DI2B 4QRUB 1CLYL 3WTWA 3BHBA 3S35H 3RNKA 3S37L 2XVBA 2Q8AH 4Z77B 1DO6A 3ESPA 4PB0H 5K1VA 1OAQL 5LAPA 5C71A 5D1ZC 2DIBA 2DJUA 4MZ2A 5E1GA 4N8VG 2CKBH 5CSZB 3C6SA 4HXBL 4ZAKC 4QHKI 2Q8BL 4NQED 4LBEA 2EXYC 3RVVD 4UOJA 4NHCL 2AERT 1TZIB 2VISB 5DRWB 3FO2B 1TO5A 4J28A 5EBWB 3FO1B 3LKQB 5DK2A 5AVQB 1CLOH 5I8CB 3O4LE 4KQ4H 3GHEH 2P5ED 3JV4B 5K39A 3KW7A 3O9WD 4MB4A 1XSKA 2JFCA 4PV1C 1X5MA 4U1MB 4N2DA 4GG8B 3T6WA 4Y2DD 1CG9A 4Q56A 2W9EL 2AK1H 3CSBA 3DHMA 4ODSH 3IM1A 3L2NA 4A2FA 4MB5A 2EE3A 2IAND 3T0EA 4GW1B 2JCCF 3T8XA 3VXPB 1Q9WA 4XI5C 3NA4A 4XP6L 1I3UA 4IKLA 2PUQT 4GIPD 4A2EA 4XPFL 3LKRB 5T3XL 3H2WA 1MI5B 4JKPL 4XMUA 1CK0L 4LSQL 1OCCB 4Z0XB 3L17A 1T5XB 4IS6A 3JWOL 3IKCA 3N1GC 4JFDA 4HAGA 2MQ0A 1YMME 2FATL 2ZKYA 3E38A 2GHZA 1AZVA 1MH5B 1J5DA 4OD2B 4B50A 4ABUA 4IKJA 4DKTA 1XIWD 4LSUL 1HHKA 2J4WH 1KCWA 4W70A 4M7LL 2O61A 2NY4C 1MUJB 2D0GA 2ZUUA 1WIUA 3FFCE 3O4OC 2XXMB 3VI3A 2EIEA 4XPAL 3OKDA 4BFRA 4BK4A 1IGCL 3CZKA 4M5ZL 4YMPA 3FQXA 4ZSOB 3HPLB 3C08H 1E4WL 2YARA 1KJMA 1WPCA 5MERB 1HXMA 3HZKB 1M3IA 3E9TA 2JCCE 3H55A 3FQWB 1ORQA 3ZSTA 2HG0A 4OCSL 5EU5A 3DURA 2BOLA 3KWVA 5CP7A 2EH8H 3U30B 1VFAA 5IB3A 5IFJB 5D7IB 1ACYH 4OLVL 3MV9E 5GS0L 3ARGD 3MV8B 3ZKNC 3O3EB 2CLRB 1HKLL 2IDUA 4LDOB 4L4VB 4QO1B 4G9DB 1AXTL 1HNFA 1JD9A 1ZE3C 2GSIA 4J3OC 3KLLA 3VYOA 3DVGB 1JSYA 4TN9A 1RZGA 2A0LD 2WTOA 4K07A 4LLWA 3GXFA 1X5FA 4Y0GA 3ILQC 1GHFH 4Z1PA 1A9EA 3CZFB 2VKWA 2DN7A 4PG2C 1UVQB 2Z8VC 3O8XA 5B3JF 5C0AA 1BZ7B 1JNNL 4DKFH 1OF2A 3ECUA 4U1NB 2BSRB 2YN5A 1KG0B 4ZPTB 3VWJD 1HHIB 1JERA 2KL6A 4MQ7A 2MNWA 2WO4A 5DFAA 5FKAA 2A9ML 5AOKA 12E8H 1MFEH 1E42A 4W6WB 3SKNA 3VE0A 2F7PA 4FC3E 3S8WA 2WSKA 4J3XA 3IN0A 2CR0A 4DIXA 1IBBA 4BKTC 1CFQB 1HWWA 1OF0A 5DJYB 3RL1B 2ED9A 3QWOB 1I53A 1QFWI 2ITEA 4Y4KA 4KNSA 2CG9X 1WV7T 4KDTC 4TSBL 1PEZA 1XR8A 3CXDH 4HJGB 2Q2LA 4MSWB 1SXNA 4FJZA 4IOIB 4CW1A 1OHQA 3AS3A 4NZTL 1M7DA 3SDYH 2VCOA 1I4FB 4OR1A 1KN2L 4WJG3 4HJEA 4RX4D 3GLZA 3MLUL 1N5YH 2FB4H 1NM4A 3D9AL 4I5BB 5B3JE 1KC5H 2JV6A 2BMKB 1C12A 1IAII 3EYSL 4P23D 1F4HA 3ZDZF 5IWLC 2NY0D 1LK3L 1UB5B 3SDDC 3U2SB 5T5NF 5SX5H 2XG5B 3KXFB 5HHOB 2HFEA 4N8UA 2LTQB 3GRWA 4KXZI 3SOBL 4Z7VA 4P5KB 1KYDA 2AGJH 5CWSA 1NCJA 5H2BB 4WJKB 1D9KB 2K9UA 4DN4L 4YLQT 5CLZA 4ZAKA 3EAKA 5EUOF 1RVFH 4UNTA 4WWKB 1NQBA 3EFFA 4XODA 3KWUA 2AV1B 3SD2A 5CFHA 5LBGA 5I0ZA 2VXVH 2AJVH 2QL1A 2JI1A 3GUTA 3OHXB 2GTZA 1N59A 5IGXH 2HVBA 3LNEA 2VXQL 2A74B 1Z3GH 3P02A 5GRUH 1D5MB 2V8LA 4N20A 3X2QB 5KVFL 3DHJA 3ZDZE 1X7TA 2GJ6E 4JO4H 1NGZA 3V5KA 3QQXA 5IVOA 5B3SB 3KH3A 2IAMD 4Y1SA 2RR3A 5F9JA 3SGEH 5IMKB 1MCEA 1BQKA 1OE3A 4WFGE 1AE6H 3K2UH 3FUEA 1D5XA 3UGUA 3K2IA 2QELA 3QIBB 4QXTB 5L4FA 5I19L 4EEEA 5DS8B 2VLRD 2QQKH 5DVPA 2QMKA 3GS4A 5AOMA 3IWUA 3COOA 5EUOE 4ZO9A 3NT0A 4Y4HC 1CD9B 1GGTA 1GS8A 2HKFL 3MU3A 4WI9A 3GMOB 4AMKL 2NZ9D 4XXWA 5C2BH 4H2CA 4JHWL 3EH3B 3HI5H 3MZTA 1C7SA 1H3XA 2Q86B 2FBJL 5AVTB 1K5WA 4UAHA 1JZEA 4FAAB 1NC2A 1WEJL 1J8SA 4XN2A 5GGUB 4ZFGL 4BUHA 4HUCA 1T1YB 3F12B 2X7LB 3HOGA 4OD3H 3AU1A 1VZGA 1E65A 4BQ9A 5L2KB 1MN4A 2H45A 5DFTA 4RESB 2PP9A 1LM8V 3KPQA 4KZ0A 4L2YA 4PD4K 5H35A 5JXAH 3HCVB 3HFMH 3I9GH 2F19H 3IJEB 2YUWA 3MXWL 1U9KA 4WHYH 1TTAA 4X4YA 2QVIA 2VDKB 3ZL4H 1H5BB 1OB0A 1J1XL 5CCHE 4ZO8A 2CMRH 2VDOL 2F08A 1P1ZB 5GJTH 3S4SB 5JIIA 2IPUK 1F8TL 1XH2A 2Y69B 3II1A 5IFAH 5IB5B 2BSTA 2VJXA 5H4YA 3RWCA 4TNVF 2FX7L 5ESAB 3T0VA 4GQRA 3QXWA 4G42B 4NIYE 4M1GL 5C09B 3X14A 1ZVSB 3T3MF 2ZYRA 1ZEAH 3LIZL 1DFBH 3P0YH 5BS0D 2XA8L 2BERA 3E9UA 3FPXA 1TZHB 2UWEF 3MNZB 1I9IH 5E00A 1H6FA 1QFWL 3E1ZA 3PGDB 5C08B 1BZ9A 3VFVB 2ARJQ 3AAZB 1VLXA 1E2ZA 2X1XR 1UG9A 4GSRA 2H6PB 1ZS8B 3FB8B 4LIQL 1NMBL 4DQOH 3NZHH 4NUGL 1PNCA 4P2RE 4LEOB 3U1SH 4OZIA 4YFLF 4GBXB 3FAXA 3NJNA 1A1MA 1T2QH 2WYZA 4JUSA 3TYGL 4GRLD 3MOAL 1CN4A 3GSOA 2NOYA 4UU9A 1Q8MA 3EHBD 1BM7A 1PDKA 1YG9A 4LSTL 2DWTA 1OAKH 5J1SC 4QJ5B 1J8KA 3BN9C 2DQIL 2GITA 4MNQD 1NIEA 2Y3NA 3PAUA 2CXGA 3OV6A 3OKMA 5F0LB 5D7LB 1IAOA 5PCYA 4WUUA 1QZNA 1A47A 2ED7A 3DVIA 3ZTCC 2VABB 3PDDA 1CC3A 1E0OB 4HWBH 1H6EA 4I0PA 4P2QE 4TUUA 3CBJB 2DWDB 3T3ME 1K6QL 1TTGA 1XO8A 4JM2F 4XBEH 3S48A 4AY0A 2OZ4L 5IWLA 1R5VA 2UWEE 3O6FD 5DEJA 1BG9A 4F2MB 1G7JB 3PABB 5AKVA 4O58H 2C4XA 4X4ZA 2PCFB 3VSQA 3WIIH 3NH7H 4K3JL 4BK8A 4AGQA 1EEZB 2Q3XA 1G6RL 4OI9A 3W3BA 4NAMA 1SJEB 3TWYA 2I69A 3I2CH 5T1LB 3NFSL 5F3BA 2LVEA 2J88L 2EICA 3BKYH 2Y36L 4RGNB 3Q3GB 1WFUA 4UM9A 5DJ0B 1FNLA 1TXKA 3DOHA 3NSXA 3F8UB 1JRHH 1MFVA 4ZI8A 2X4QA 2JJSC 1MFAH 1U8HB 2BNQA 1P5VB 2NW3B 3K7UA 4GW5B 1BAWA 3RKDC 3VTAA 3ZHNA 4A2HA 4URKA 5ICZA 3CXHJ 2BH0A 4I1NB 3M86A 3M46A 3MO1B 4HCIA 1FC2D 1NBYB 3UTSB 2W59A 4IM8A 4XC1H 5EU4A 2JH2A 1FVDA 5EDSA 4FXKB 3HJ0A 4O02A 3L8QA 4QRPE 1N64H 3NZUA 3S98A 2ZOWA 5JIPA 4OFDA 1GOFA 4HUVA 4A7GF 5FUOH 4P9ML 4P4RB 2AMUA 5F7KC 1A6TB 2VN5A 4IIQB 4NWTL 5GS1B 4BZ1H 3MAWA 4DP5X 3ZRCC 3H9HA 2Z34A 3B5HA 2FYYB 4PGBB 3WD5L 4BWUA 4QOKE 2QJDA 4E9LA 2VJ0A 1VHPA 1ZHNA 1QW9A 3L3DA 1ZXKA 2CK2A 3MLTA 3VD3A 1OE2A 2R29A 2WWMC 4PRDA 1HILB 4URTB 1QNZH 4C57C 1QRNA 2KH2B 4HJSA 4KKCD 2DKUA 4HEME 3N41F 5IMMB 1O5DT 3OMZA 1UTDA 4KTDL 1IUZA 1LGVA 5AEAA 1L3WA 3APFA 1ID2A 2G4EA 2XRAL 1YYLH 5I5RA 1E28A 4ODVH 3TJPA 2AABL 2C1OB 3H4HA 3PLYA 1A9BA 2WZ0A 4PLJD 1UZ8A 3QUKA 5HI5D 1JWMB 5A6IA 5IVNA 2K1MA 2YK1L 2J25A 3EIFA 3SE4A 3SKOB 4LHJB 1U95B 4NKIH 2ZXWB 4U49A 4WEBL 2WM0A 3H4FA 4P3CL 5DQJB 4KX7A 4V1DE 4MS8C 1BM3L 1B4RA 4BCXA 3LJ3A 3LAFA 1NWPA 1XMWA 1TETH 2CIIB 4M4PA 3C6LA 2HJKB 4D7PA 4HIHA 3UJJH 4QT5A 3U36A 3BQUD 1ACXA 3HZMA 3PIQB 1OAJA 3PNWA 3HG1E 1IV8A 4LL4A 5DGQA 2YJLA 4OZFG 1KENH 1J1OL 3QIWB 4OU3A 2XWDA 3V5DB 3WDJA 1H8LA 1UM6H 1IL1A 1Q0XH 3C5ZA 2QSTA 5C3LD 1A2YB 5AB1A 4FQIH 3DX7A 2WMPA 1UM4H 1A6WL 3LQMA 3KE0A 1KBWA 4Z7UF 4POZD 5GSVB 3FUDA 3CVHH 1QKZH 4K23H 5EF2A 4WO4A 2AV7A 3ZKXB 3QEGH 3MJ9A 4KROD 4H5SA 3T77A 1AGFA 4ZW3A 4QRSB 2R2EA 4X6CF 4AYSA 3IFOB 1DO5A 4HS8L 1LP9A 5FO7A 4OBRA 1SEQH 3DRQB 3MLRH 2YHGA 2EXTA 3Q5OA 3QDJD 5E6IA 2R8SL 4J4PD 1B0WA 1PY0A 1IQDB 1QMUA 3BPLC 5D7JC 5TF1H 1AD0A 1CT8A 1JZHA 3OF6A 4P9HC 3IJYB 1QHOA 4UT7L 5DYOA 4LVHB 4PJ7F 1A7NL 3IF1A 4CU8A 3DYOA 5DXWA 3CHXA 2ZCLH 3L3JB 4UQ2B 3I6LD 5SWSE 3HC0A 1IAKB 2H3KA 2X38A 4U3XA 3FCTB 1AGEB 1TZGL 1DE4B 4Y1AD 3ROOB 1AO7A 1OT2A 3HNVL 2MCMA 2I60H 4P2YA 1YECL 3FFDA 1ZT4A 3CDFA 2RD0A 2A6KA 4FD0A 3FTXA 3GWJA 4WW2C 4Y5VA 4ZUSB 5KVGE 2OSWA 4KY1L 2IQ9L 4YE0A 3UAAA 1I8UA 1VJSA 2OL3B 3OQ3B 2GAZB 5B1KA 4Z7UE 2NNFA 5TFSH 4OZFH 3DDFA 4FG2A 3MXVH 3RJDA 4OTXL 2F58L 3DSFH 3TYFB 1WK0A 5CGBA 5DYFA 4ELMF 5ADOH 4NB7A 3AG4B 4X6CE 4CJ1A 2EYRA 5CZVH 5I8KL 2QSCL 4NM4L 5I16A 2CHDA 3WUWG 2XC8A 3NIFB 1S7SB 4FTVB 4OZHB 4DVRL 1AKJB 4GKSA 2DI7A 1U8MB 3K0YA 3W11D 4CJ0A 2OX5A 4ACTA 3DOSA 5KTEL 4FNLL 3TH4T 1M05A 4A67A 3ZSSA 4PJ7E 4YHZH 1MNUL 1AGBB 3JSSA 3GTVA 1OAZH 4G6KH 4L8SB 4IOFC 3UBFA 2BK8A 1HZHL 4JE4B 2VDRL 5DVLA 3V4UL 3O3BB 4H25A 1CE6B 5GSRB 1V10A 1B9ZA 4X6EB 5LBSL 1YC7A 1KB9J 1A4KA 1MCWM 4LLUA 5CINH 5E94A 3DPDA 5IHLB 1GGUA 1C7TA 1L7TH 1BHGA 4HKJA 2DQDL 2BHYA 3P30L 4GT0A 1FFTB 4UT9L 2COVD 2WO3B 1UJ3C 7PCYA 2HWZH 4C8XA 4WJ5A 1NAKL 2KMWA 1U3NA 1S7RA 4I9XA 5FGCE 4ELME 2WBJB 4G6MH 4JEGB 2NNXA 5D7KE 3CSYB 3ZDWA 4U6VH 3VI3F 4MMXA 3S35L 1EIBA 3LB6D 3GLAA 4FQXB 4AEFA 2DLEA 4PB0L 5IKCB 2E4TA 1C5DA 4OUUA 4XH2B 3STLA 2YD5A 3P2TA 3UAJC 4PRHE 4M29A 3T0EE 5L88H 2DW5A 2W8CA 3IS1X 4NM8H 3R8BB 1Z9LA 1DQLL 4JAMA 5CGYD 1W72B 1EXUA 2WNXA 3WEMA 3HE7C 3U0WH 4TVPH 3SBQA 3K8KA 5T1KD 4E9SA 1QR1B 2FEJA 4KQ4L 3GHEL 3KPRD 4YDLC 4WI7A 2Y6SD 4JFDE 4FE9A 4KKRA 1OVZA 3MVSA 4N28A 2NY2B 1LWHA 4IW4C 2AK1L 1UWFA 3JV5A 4XRCA 1KTBA 4ODSL 3BH9B 4G83A 3ARTA 1OCRB 2BIHA 2DS4A 3O4LB 2NUPA 2GFBB 4ISVA 1TENA 2DH3A 2WK2A 2NSXA 2ZOKB 1A5FH 4ABQA 1U91A 4PTTA 5IM7B 3H3PL 5AVXB 4RDQF 4S0HA 4U1SA 4G80A 1S5HB 3VI3E 4NJ9L 2WXOA 3WTSA 2ED8A 2YZ1A 3R8QA 2VSCA 4U7SA 4Z5RA 4H4NA 4X4ME 3RWFA 1BYNA 3HS0C 1A4JB 4XVTH 3MHZA 1BLNA 1VCBC 1X5ZA 2X4OB 4DEWA 4M9PA 4NKMA 3FH7A 2RBLA 2VUOA 4NRZA 1Q0YH 4YK4B 4DERA 4Z76A 5CBEB 4NZRH 1E9OB 5F3HA 1XH3B 4FEMA 1XF2B 2ZX8A 1KIQA 3CFDA 3DV4A 4XPGH 3BCFA 1T80A 5KVDH 1P1VA 2PYFB 4ODUB 5IZ7A 4A7TA 2J4WL 2K4WA 4PSPA 1YMMB 3JYBA 5DU7A 1QTSA 4JVUA 2KKQA 4PJEA 5CXPA 4AKOA 1MHPH 3QQ3A 4KO7A 1JCVA 1RIHH 1PZ3A 5JO5B 3C08L 5E2WH 4IGBC 4P99A 5C0AE 1J8HD 3FFCB 3SE6A 4FULA 1QNIA 1QFOA 3D2UA 4RFEB 4XGZB 3VFOB 2DAVA 5D7JA 5IEKB 4MJ4A 2H8PA 4IEFA 4R7LA 3C5JA 4DZ8B 3ZMRA 2IGFH 1ACYL 5AZ2H 1MHCA 2IFFH 4AIXA 4UTBA 3KBHE 1FFNB 3MRGA 2JCCB 3MROA 4NQTA 4GS7C 2TRYA 4X7DC 4PJ5E 1WLHA 4OLEA 2FEEL 3MV9B 4IU3A 3NFNB 1CDIA 2ZPKH 1BD2A 2J8UA 4G8AC 1GHFL 1JK8A 5KJRH 4HCRL 3QW9A 4Z23A 4QKTA 4BK5A 3CN4A 4YSAA 5MP6H 3TN0B 1CQKA 3KPSD 4DKFL 2VLMD 4P2OC 2OYLA 2X4RB 3MRRB 2ZONA 2EVGA 4L4TE 2CO7A 4FFYA 3T4AB 1MFEL 2PYEA 2FHFA 2W07B 4AYFA 3TPUB 1EJOH 5F88B 3BJLA 3CSPA 3B7RL 4ENZA 1JNJA 1MI5D 4AGLA 4RMVA 2VW6A 1HSBB 3WKNA 3RY6A 4K8RH 3MA7A 5AW9B 2W65A 2Y4SA 5AALA 4YLCA 1GGIH 4ODHH 4KU1A 2ED6A 5SV3A 2DTSA 3PXLA 1G0XA 5AYUH 1GYAA 5KANI 2IFGA 4N26A 1ICTA 3N04A 3VXRD 4LU5L 3RWEA 3SDYL 5KJ4A 3QO1A 5E2VH 3LQZA 1A8ZA 2EDEA 4FI8A 4W9DC 1N5YL 2FB4L 2AVGA 3N2JA 2EH7H 4JFYB 2CHXA 1O6VA 3QNYA 3VUAA 3V6FB 1KC5L 3P3YA 4XVUD 1QA9A 4QCIB 5HHPA 2F54E 4JCLA 4KK5C 4F15C 2ZXEB 1LHZA 4ZFFB 3I6GA 1DUYA 1VERA 2BFGA 4PJFA 3O6MH 2QGDA 5D7HA 2IBBA 2AGJL 4QRTA 2Z7UA 3KYMB 3VMPA 2FIKA 4IU2B 4F57H 3VXUA 2XN1A 4L8DB 5IB2B 2OYKA 3WFBH 3UAJA 2EE2A 3H1ZA 3BPCB 1S46A 2PF6A 3NIDF 1RVFL 1CDBA 5T5FH 3HPJB 2EUZA 2TAAA 3IXTB 3LKSA 2Y5TB 2XVLA 1TQWA 1MAML 5TDPB 3D4YA 5EEXA 4Y5YC 1H15B 2ICCA 2VXVL 4BKLB 1JNLH 2AJVL 4UCFA 3RVUD 1RPUA 1H0DA 3ETSA 5IGXL 5EO9B 4J3OF 3D4CA 2NXZC 1JRHI 3FRUB 2B4CC 2I9LB 3KAAA 5DC9B 2M83A 3EG9A 4OAWB 4HIXH 1MCOH 3MRFA 4LXFA 4U2YA 4WFFD 5D4QA 4ZMNA 4XNUL 5J5EA 3CPUA 1D5ZB 4HUXA 4JO4L 4EI5A 5CM1A 5F0MB 5JLZA 5GGTA 5DUPH 5HJBA 3F7PC 3GSNH 2HLAB 1F0LA 1FJ1A 5ID1B 1T7VA 2H2SD 2VE6B 4P3WA 3TS8A 1AE6L 3ZDZB 3K2UL 2GJ6B 4ZYKB 7CGTA 4FXGB 4MA1C 4YOKA 2XFXB 3D33A 4QAWA 1TZ8A 2EIBA 2QQKL 2DEXX 2XTJC 3NIDE 4NDMB 5LO7A 4JVWA 4CC1A 1E7UA 4LF3B 2YWZA 3MUGB 4EXKA 3BZEA 1HH9A 4JGJA 5C2BL 3BVNB 1L7IH 3V8CA 4Q97A 3HI5L 3GB7A 5EUOB 5SWQA 3L7FB 4L3EE 2O93L 1DLHB 3ABGA 2L7EA 1UZ6F 3C6EA 2G3XA 3L3OA 5A3IC 2OK0L 3G9VA 5ICYA 3LVEA 4UUJA 5FW8A 4JZNA 4OD3L 3BUBA 3OKLA 5IK3B 3ZIYA 3WS3A 3EGSB 5KBNC 2PLTA 3I02B 3CC5B 3K6SA 2G3NA 1BQHG 1WITA 4HLZH 5JXAL 2JMRA 2J6EH 3X17A 4AT6A 3N5AA 3HFML 2F19L 4FQ2L 4LKXB 5KUMA 5EORL 3FU3A 3UCQA 3UPAA 4G8IB 5FECB 5IMLB 3HB3D 2VZOA 2EIZB 3T8MA 1UACH 3GJFK 4ZX4A 5JA9A 4JO5A 4RAUB 3ZL4L 4GXFA 2V3FA 3EDJA 4ZS6D 2CMRL 5GJTL 4AV4A 4OJFL 3TA3D 1ILSA 1NFIB 3AG1B 1FL3A 2R1YA 4H8QA 1DUZA 3SDCD 1EEYB 5GGVY 1P2CB 1F3JA 3RI5K 1FO0A 1NOLA 2NDFA 2X4SB 2YD0A 1CO1A 1O9ZA 1N10A 2ZKWA 4BGDA 3OB0K 3KM2A 3FQRB 4TULH 4NN5C 1HS6A 4M3JA 4UDUA 1KCVH 1ZEAL 4J3VA 3P0YL 1WYJA 1V8HA 1ZLUK 1UZ6E 5IJCC 5EA0H 1I9IL 4XCNB 3UBXB 3ZX1A 4P5TA 5FO9B 3ZQXA 2C1PA 2YBGA 1AVAA 4OJCA 4ZUVB 2CBTA 3NZHL 1UM5H 3K0WA 3DIFB 1ZS2A 1I1AC 3NCBB 2XWZA 4XP4H 5DD0H 1N9PA 1OSZB 2ZWYA 3LVTA 3CD4A 3DTUB 3QUMA 4LCYB 2VZ1A 2GY5A 1OAKL 4P2RB 4DKAA 3AY4A 2P24A 4JRWA 1D6VH 4FMVA 1WUNT 3QG7H 4YSCA 4F91B 3E8UH 3MLSL 2ADYA 4P05A 4YXKL 3MYJA 5DFVD 1I8AA 2BWQA 1AS6A 4D94A 5B1BB 2Y7MA 3CN3A 2NQCA 1ASOA 2VC2B 4HWBL 2ZCKH 4IDLA 1WA1X 3RWGA 1PCXA 2AXHA 2VZVA 2ZYSA 4W9ZA 2J1XA 3EO9L 4XBEL 1CFNB 4AYDC 2AQQA 3LN9A 3MQIA 2NYZA 4P2QB 1I3RA 1JXDA 2J57A 4O58L 4KJQD 3WIIL 2PETA 3GFUA 3N1PC 5ANHA 1IEAB 4PU2A 4WNJA 5AOIA 3T3MB 2WLLB 1ZD6A 1KTCA 3IJ8A 4UQ3B 4YBQD 5D93C 3I2CL 5EC1A 1KIRA 3OGCB 2UWEB 4MGXA 3BKYL 1A4CA 1QFWM 4GG6A 1A3ZA 2Z8RA 4DOHE 1GJUA 5EPMA 4CRPA 3DXAA 4NWUH 3LEXB 3CGTA 1I1YB 3X13B 5CLTA 4QPEA 1MFAL 2Z92B 4ZW6A 4F7PA 4QXVA 2YEZB 1TR7A 5C09D 2ZAGA 2K7PA 2D3NA 4MDRA 1TPXC 1DL7H 3QZNA 4MD5A 4S2SB 5FYJD 4WK2B 2JSFA 3EJPA 2ID5A 4PW3A 4RFNC 5CMAA 3A67H 1HWGB 5T3XH 1CLZH 3ORJA 1K3ZA 1XCQB 3BH8A 4N5UA 3RYMA 2CO3A 5EFIA 3MRJA 2ODIA 1Y18B 4TRPH 5CILH 2JF1A 4GBXD 4B9JA 1FFOB 3UTOA 2PPEA 3GRGA 5FUOL 3O2DH 3WHE1 1NC4A 3VAEA 4PJDE 5DVMA 1EA9C 5F7FA 4UYQA 1SOXA 4JM2B 4XCCH 4BZ1L 1FNGB 5J13C 4Y5XA 4GRWF 1RCYA 2R1WA 2BIOA 2YMTA 3W9DA 1LP9F 3WNOA 4QRFA 5EN2B 1Z5LA 4RISH 2GIYA 1E5YA 4ANXA 2FR4B 4NEHB 3CCHB 3NRQA 3GYRA 3QWNA 3EYOA 4PYHA 1QFPA 2MEJB 5BW7A 3FYEB 3GBLA 1G9MH 4JCWA 1DTUA 4QOKB 3UO8B 1W2KT 3LRGA 4MJ5B 3DMMA 2HLFD 4APQA 5E4EB 3WJLA 4JRFA 1YYLL 3CFEA 1KBGH 4ODVL 2ICWJ 4ZZKA 1NMAL 1UH2A 2VAAA 3BIKA 5FA3B 2JQZA 4BQBA 1SDDB 2M1KA 2Q3ZA 3ULVF 1U8IB 3LRLA 3GGWB 5T1LD 4NQCA 4RMSA 2XNAB 2G2NA 1U58B 2A6IB 3GTNA 5J06A 3EDDA 5EF1A 4QXWA 5K59F 1KPRB 1JPTL 1TKWB 3VFNB 1YY8A 3ILEA 5ES4B 3CDGA 4GRWE 4P59H 2NNRA 3EUUA 1LP9E 2ZUQC 1TETL 1F56A 4S1RH 4YHNB 4LCCA 3PF2A 5M94B 3UJJL 1BFOA 4W9IC 5FV1L 3VXMA 5IREA 1RURL 3ARDC 3L4CA 4V1DB 1EDHA 1KENL 1BWWA 3UTSD 4Z6AT 4M5SA 1WRFA 4LGRB 1U8LB 1UM6L 1Q0XL 4NJAL 3DBXA 1ONQB 4MBOA 2VITB 4I1PA 2K70A 4NAJA 2MCAA 4FQIL 1N0LB 1UM4L 3MBEB 3HG1B 1MZYA 1WBYB 3TBYB 5KBKA 1MJ7H 1QKZL 3PU7A 4K23L 1BYPA 1AO7E 4AKPA 4LLYA 1PG7L 5GGVH 2RQ8A 3WNNA 3N41B 1S7UB 3ARBC 3H0TB 4L2LA 1T1WA 2NY1C 3PGCB 3ULVE 3K5SA 2VMJA 3MRCA 3PQYA 1SEQL 1CL7H 3ARWA 3MLRL 4ONFH 4OLZH 3Q5TA 5J9PB 4UZSA 1IGMH 1P4UA 2XU9A 4KMLB 4MQTB 1YQVL 5TF1L 5BRZE 5K59E 3VSVA 1H3GA 5DD5L 2HX9A 5B7EA 1KLGA 2ZSVA 4ZFOL 3TESA 5F6HJ 4HA1A 3HI1A 1SY6H 1OKEA 5HDLA 2DJMA 4XNZC 4KZEH 1B3JA 1ZA6B 4OCMC 2IGTA 5AUMB 5HJ3A 1JN6B 1ZV5A 4FLSA 2CJUH 1T1XA 2I60L 2KT6A 5LJYH 2BSDA 1T03L 1MZZA 1RHHB 5AVWB 5SWSB 2LABA 1PX3A 1QSEA 1ZRUA 3WDHA 4CN1A 3RVVC 4DO6A 1PZ5A 2ICES 1I8LC 2VW7A 3NP3A 4KKPA 1B0RA 1NCOA 2KDGA 5EIIG 4A6YB 5TFSL 4P04A 3VMNA 4Y19B 1GXEA 3MXVL 5E8DL 5ADOL 2BX5A 3DSFL 4QNPF 2MOGA 4QGTA 1N6QH 1OE1A 3BAJA 5I1HL 5CZVL 1GMIA 4NCC1 4U1HB 1PG7W 4Y2DC 5JPNC 1C8PA 5F72S 1HOCA 1R3HA 3LN5A 4F7KA 3D69A 4RCAA 2WANA 4EUPG 1X5HA 3Q2NA 4NN6B 2ZG3A 4X6CB 2ZOOA 3REWB 4OIBA 4X50A 2X4NA 2HRHA 2X6UA 4XMLH 1FBIH 3OJDB 3T2NH 4AL8H 4YHZL 4HHWA 4UQBA 1SYVB 3MX0B 5ETUA 1JI1A 2WVTA 4U1LA 4G6KL 2F7QA 3QFGA 1XZ0A 5TK4A 1BLIA 3RNKB 4PJ7B 5AW1B 3APDA 1A3RH 4KFMA 2CUIA 4OKVB 4NGHH 1J12A 1G7LA 1L7TL 5DMKA 4WFED 2AAAA 5JHDD 4DVBA 4I3SH 5I0WA 2B9AA 1ET7A 1F42A 5M7QA 3CQQA 4ZOEA 1NCWH 2XWJA 1QI3A 1NEZA 4LBEB 4KRLB 4G6ML 4QNPE 3HFFA 2ZUXA 3EDFA 1BX2A 4KO9A 4U6VL 1W16A 5DK2B 2D7NA 3SSGA 4AIZA 2L7JA 3T9WA 2BCKA 5K39B 5FGCB 4MAYA 5L88L 1XXDC 1BFTA 4JHZA 2Z7YA 5KYYA 4K7PH 5I1CH 3T6XA 3NJHA 1EANA 4EUPH 3U0WL 3LDBC 1W0VA 1I85C 4PRHB 4TVPL 3T0EB 4CNIA 3ARGC 1SHSA 3T8XB 4EIGB 3QQ4A 4L1DA 4DPRA 4ANUA 5DWUH 2VR5A 5LCVA 2W60B 4ZNCD 2XPZA 3K8LA 4I0CC 4R9HA 2J8UF 2A0LC 3I9AA 4PHXA 4DEUA 3BZ4A 4IS6B 3SKUD 1Y6NR 5DMYA 3HHSA 3IKCB 4JFDB 2VO5A 1USQA 1A5FL 2P43B 3RURA 1AKJD 1IAMA 1CURA 1HQRA 3GXIA 5AL8A 1GGYA 1BVLB 1SOKA 3MUJA 1DVQA 1EDYA 1GYUA 2B16A 1MFUA 2YC1A 4GAYA 5D6DC 3TBCA 3VWJC 1NM9A 5TK2A 1GJIA 4HGWA 4Q58C 4XVTL 1JZ6A 5FLVA 3VI3B 2UZYA 3FW6A 3VXNA 3OKDB 4AH2A 4KDVA 4U1KA 1Q0YL 3FQXB 4KI1A 4NZRL 1KJMB 4ZO6A 2QTEA 5LKNA 3W2DH 4UT6H 3TVMD 2X53A 3SOTA 1HXMB 1VDGA 2OMNA 3ATAA 3NA9H 1ZSHA 4D7BA 4UTAH 1ORQB 4XPGL 5KVDL 3LXUX 4KO6A 5EU5B 1KBVA 3DURB 4NO3A 5CP7B 1VFAB 3F2LA 3LSOA 4M6OH 5F1NA 2AP2A 5I73B 1CD0A 2J8UE 5EBLA 1DQIA 4CDHA 3OB8A 5CUSH 1RIHL 3QORA 5E2WL 2GSIB 4FQ1H 5CKAA 1AC6A 4CBPA 5JW4R 1EHXA 4HPOH 2P9RA 1OAXH 3MUHL 2R2HA 5LXGH 2ATAA 2BPBA 4LLWB 4P23C 3F6LA 4CKQA 2NY0C 1AHWC 4F93B 3UIYA 1T3FB 3CBRA 3O8XB 1PLGH 2WB7A 4PJFF 4IYKA 5C0AB 2PYEE 2IFFL 4JG1H 2Q0ZX 5FYKD 4HFUL 2PWDA 3IDIA 3T0DA 3ROLA 4AWJC 4MQ7B 4Z7OB 3VVVA 4UOZA 3MJ7A 3BC9A 5E0FA 4J12A 3SKNB 3VE0B 2BSED 1I7UA 2ZPKL 1FA4A 1XCTA 3R06A 1E5ZA 4HWNA 4XMVA 2E6JA 2VSDA 4ADJA 5KJRL 4NQEA 1OTUD 1WWCA 4PJ5B 5CGTA 2PO6D 5MP6L 3S88L 2FTAA 1RZIA 3A4DA 4Y4KB 3RPBA 2BP3A 3SKMB 1XR8B 4AM0Q 1T6VN 3ASWA 3RHWF 4DP4X 5A7BA 3ZQ9A 4WLCA 1ASPA 3CFBA 3O9WA 2QHRH 1JHKL 4KJYA 4PJXA 5TQ2L 5JPNA 1M7DB 2ZXGA 4FA6A 1EJOL 4KHTH 3CFUA 2QZ5A 1TTUA 5ENWA 4ETQA 4K8RL 5KVEH 4UQDA 4KZCA 1QWHA 2IAMC 1SJXA 4PJFE 1GGIL 5FUZL 1C12B 4ODHL 4YHOH 4ELKA 3VXUE 3WAJA 1DJHA 2WYTA 3VD4A 5DHMC 5AYUL 2HFEB 2BSSA 1PZAA 3L3HA 4NPKA 2X12A 1YMMD 4Z7VB 2DYRB 5E2VL 5CWSB 1X5YA 5JYMA 3HC2A 3W81A 4UINH 5MHSE 2JIXA 4AQZA 4HPYL 3OTTA 1JZ2A 1RP9A 2EH7L 2NZIA 2FX8H 4NNPH 3E3QE 4JQVC 4R26H 4ZAKB 5HDRA 4BM7A 5L8LB 3FQYA 1YLBB 2EE9A 4BA0A 1M53A 4FGMA 2VW4A 3WU1A 1WD8A 4PIBA 3IGKA 3EFFB 1XIWA 2A38A 1CBVH 1DQVA 3NN8B 1S78D 1A25A 3O6ML 2F1BA 3PDOA 2QPDB 5ITBH 1PZUB 4F57L 3GUTB 1E90A 3ZZLA 3MFGB 4TNVK 2GTZB 1N59B 4I77L 8PAZA 3WFBL 1ZIAA 3WXWL 3JWNC 1C5BH 2WW8A 4R90L 1OPOA 1RFDH 1KJVA 5DO2D 5T5FL 1JF6A 4QXUH 4XMPH 1NGZB 2QR0A 3V5KB 2Y7SA 1Z9PA 5IQLA 5I75B 1SXSA 4PJGA 1S7TA 3HZ3A 1JNLL 3DTDA 5F9JB 4NT6B 4JM4L 3TN0D 1RIVL 5DS1A 1BVNT 3QRGH 1K8DA 1CFMA 1TZOA 2GW5A 1S9WA 2IG2H 1MCOL 4HIXL 5DQDH 1EHLH 3OAUH 4N90D 5AW0B 1VSCA 5EBMA 3E1F1 4K0OA 2IWEA 2X70A 4OW6A 2ADGB 3APMA 5G5DA 3QPQD 5DUPL 3ERXA 3VX0A 1P4LA 3Q2VA 2WJ5A 5FYLD 1UXLA 2WVSA 3P2BA 5E23A 5D6DA 5AAPA 5L7XH 5DQ9B 2LV4A 2NW2A 3T6VA 5KSBA 2AFNA 2CPCA 2C26A 2BLFA 4IBZA 1SM3H 2P44B 1NH6A 1B3IA 4NO2A 2YD7A 5F89A 1XSIA 2H9GA 4Q2ZA 2IDSA 3CTTA 3O4OB 3SEPA 3TT1H 4WY7L 2H32A 4P57A 2OA9A 2WGNB 3CFJA 4HUUA 1T4KA 1LQSR 2DQTH 2JKWA 3VDBA 3BCDA 2IH3A 3DA0A 3HC4H 1RULH 3EHBC 1HIMH 2E7BA 5H35B 5A16A 3KPQB 1L7IL 2PW2A 5ILTH 3BSGA 4X7SH 5I6MA 4BSWB 2FSDA 2EAEA 1QWNA 3NIDB 2NRDA 4JG5A 1WFMA 4X4YB 1YSOA 3GMLA 5D72L 4G72B 3U7WH 3L45A 1ACZA 2ESVA 3C8DA 4BFGA 1LL1A 4XP9H 2BS8A 4K7FA 3TH3T 3S4SG 3ARFA 4JQIA 2EDKA 2F8XC 5JOFA 5JIMA 4L3EB 4QRRD 3UL4A 1I8KA 4U2ZA 2CAKA 4HGKC 2BSTB 2J6EL 5CZXD 3RWCB 5L4MA 2D7OA 2Y07H 5C0BA 1QTPA 3O6FC 1NANI 2VM4A 5I6LA 3GBDA 3X14B 1UACL 3BSZH 5EOCH 4AQEA 4AZ8A 4KI5C 2CGZA 4RA0C 4GG6F 3ZMEA 2X3CA 4L29B 1TLKA 3QNZB 3F64A 3QNXA 3Q2LA 4DP8X 5DLLA 3FQ1A 1CGSH 3Q44A 3S35X 2DJ4A 4EKXA 2ETWA 3VGHA 2R0WL 1E5BA 5J12B 4TULL 4ZMAT 4YHLH 2O5YL 3GSOB 4OCWL 1KCVL 1KGIA 1RJCA 5DS2A 1PDKB 1U2HA 1E4XH 3O3DA 5IMOA 5EA0L 1BVKA 2GITB 4Z7WE 1RY7B 2DQGH 4LQFH 1FFPA 1T0MA 2WTRA 3OLGA 3QXDB 4C4KT 5JW4Q 2BNUA 4NN7C 1IAOB 2VDKH 1HVXA 4YXHH 1UM5L 1RKRA 3EFOA 5CLWA 4XP4L 4FL4B 3BEVA 5DD0L 4HK3N 3RU8L 1A02N 3LCYA 4ZOAA 4JDTL 1OAUL 3F7VA 2VR7A 3BMWA 3L08A 1BIIA 1S9VA 1D6VL 1FI8C 3QG7L 4JPVH 4GG6E 1VA9A 3E8UL 4RLDA 1CL7I 1AQKH 5F7UA 4ANVA 3DXAE 2IH8A 3PHSA 4B96A 1NKOA 2DY2A 3MRHB 2AANA 2VLRA 3AB0C 1HNGA 1SOQA 3AT9A 1LO2L 1UURA 4FLOA 4OFYD 5JIHA 5F3BB 2ZCKL 3KLAA 1N4XH 4M61A 1NBVH 4MXQD 4FZ8H 3O3AA 4QR7A 1PPIA 3I50H 3KL0A 2X4QB 1CB4A 2WLJA 2BNQB 2GI7A 2VR8A 1AJ7H 3LOWA 5I1GH 3WKYA 6PCYA 1J48A 4L1TA 3Q1SH 4Z7QF 3CHQA 3PHQA 4YHYC 3NCXA 4QTFA 4AE1A 5J6SA 4PLJC 5HI5C 3TNNA 3FRPB 2GB2A 2F7OA 4K4KA 4PVBA 1A66A 4OUOA 3HMWH 1HEHC 4XP5H 5CEXA 5EU4B 4NWUL 5I2IA 4BXSV 1FVDB 2HLEB 4N3UA 1HH6B 1JS4A 4F2EA 4O02B 5E9DA 4QGYA 1NGWA 1YEGH 4DOHB 2NY5H 4DUVA 1V3JA 1J7VR 1NCHA 4PM1A 3SODB 4PTUA 4PJIF 2CUHA 1DL7L 3LKNA 2XTJE 2PTTA 2J43A 2XA3A 2BC4A 3BQUC 3EJZC 3H9HB 3VU2A 4WI5A 3SYAA 3A67L 4MYPA 2H7WA 1S9XA 1CLZL 1MDAA 1TMQA 1WDAA 3NVQA 4GKZB 4HF5H 4HZAA 4JJ5B 4KRPB 3L3DB 1ZHNB 3MLTB 1NCNA 2F6AA 5DO8A 4LP4A 1KGWA 5CILL 1HNYA 1HCVA 4PRDB 2YA1A 5BZWB 3MACH 1QRNB 4K73A 3VB9A 4TNWF 4POZC 3O45A 1QBMH 4Z7QE 2Z7ZA 4KROC 4XCCL 3B56A 2HVJA 2I5YL 1M2OA 4R97B 5IJDC 1E28B 4RISL 3TFKD 3TURA 1OV8A 1A9BB 1UZ8B 4JO1H 4PRAA 4G1EA 5B1AB 3TV3H 3F7YB 4GRLA 1MVYA 2UY6A 5I1EH 3LNHA 1OP3K 3ESUF 2PWGA 4KRMB 4KTEH 4PJIE 4MCZA 5T3ZH 3LD8C 1J0KA 1MCFA 4ZQTA 5L8JB 2YWYA 5ITFA 3SPIA 1UD2A 1TJHH 4PMEA