3STLA

Kcsa potassium channel mutant y82c with cadmium bound
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2011-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3stlA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3stlA02
4WUUA 2QQLH 1JMZA 1UZ6E 2NY6B 1HHIA 3QEUB 4LVEA 4WFFD 3SOBH 2CKNA 3FT2A 3UBXB 3O9WB 2AV7B 2FJFB 2WWMC 1S7UA 4HCRL 3X3FH 2DIAA 3TT3H 1S7UB 4R8WH 2G5BB 1G0DA 1HKLH 3WO3B 2DLEA 5L8KB 1CIUA 5EPMB 2NZIA 3O6LL 3X14B 4NOBA 4XPHL 3BN9C 4PJHA 4YDVB 1JZ4A 4HT1L 3GBML 2FBJL 5HYJE 2XZAH 1J8HB 1XGRA 3OAZK 3H9SB 3VFPA 2HLAA 2Q76A 4QRTA 4RGOL 1J8HD 3A0OA 5BQ7B 3LB6C 4QY8B 5C0JA 1KSRA 4Y4HD 3MJGX 5IVXB 5CJQL 4I5BA 1IGTB 5I1DB 4ONGH 4NM8L 3EDJA 2VSCA 5E1AA 1J1XL 2F5BL 1NCWH 4KK6C 5E2TH 4P23D 4HK0B 2GKIA 5D7LD 5T1MB 4OZIF 3MGAA 2HWZH 1LILA 5CJBA 1QHPA 3DX9B 15C8H 1P5UA 5KVMC 3NH7H 3IDYB 1P7QB 4MCYB 4LF3B 3CDFA 5DJZB 3OJDB 4IDJH 1HYSC 3AXLA 3OMZA 2OL3L 2F5AL 5DJ2B 2EYTB 4Y5YA 5I30H 5D7KE 3SO3C 3L3JB 3SGJC 4P2RD 4YPGB 2VDNH 1Z9SA 4FP8L 4M1DH 4QRPB 4QHMA 3D25B 1ITBB 2WLYA 2R4RH 4ZFOA 2H41A 4AL8H 1NEZA 3JUYA 1Q94A 4CU6A 5IK3B 5KW9H 1JRHH 4PP1D 3WDHA 1YNTB 3IFLH 4LU5H 4D9QD 4AZ8A 4WJ5A 5I18L 4LASL 2J8UF 4U7KA 4QT5B 1MVUA 3P9MB 3NIDE 3DTXB 2Q20A 5TPWH 3RVWC 3EJZD 4KY1L 4XP5L 4J6RH 4PTUA 5BV7C 1F4XH 2CJUL 3HG1D 1BBJA 2DQCL 2O5YL 2YPLA 5F6HI 1YYML 2R56L 3RVTC 1G7HB 4PRID 5HY9A 3KPMA 1BD2B 1CD1A 3GBNL 4PUBL 4XVSL 2A74B 2FH8A 3QXDB 4YHKL 1XAUA 3FQWA 3W2DL 2OTWB 2A9NL 1DVFA 4OJFH 3RWGB 1Y0LA 3HNVH 5I6XC 1ERNA 5E94A 3EYUL 3PWJB 4FG6C 5IROC 1QFWH 1N8ZA 4HHAB 3V79C 2HJFA 1RUAH 1NKRA 2OR8A 2R9HD 5E8NB 1WLHA 1ZGLA 3RU8H 3WFBH 2X9YA 1PEZA 2PXYB 1XGPB 2EE9A 2CIIB 4QTHA 3SDDC 3PL6B 1ZLUH 5D1XD 4XP9H 4OQ1A 1TJGH 2WM0A 1ZMYA 3U4EB 3PQYD 3HCVA 2XN9D 3LRHA 1D5XA 3G5XB 2ESVD 3MJ9H 1I9RH 1I8KA 4BSWA 4PRIA 5C8JA 2W91A 4ZTPH 1KIQA 1OTSC 3N50A 4YPJA 5GRUL 2VQUA 3EJYC 5A40E 5HYEA 2NY0D 4ZFFB 1DQLH 3FB5B 3MLYH 2Y06L 1A6VL 5ACMA 1JHKL 1OAUH 3QFDB 4P2RB 3HNSL 4WU7A 2C3WA 3S88L 3O6KL 1S7RB 4LKXA 3OQ3B 3FOMB 2VE6A 2V2TA 4S1DD 1L7TH 1YQVH 3WN5A 2YHGA 2DQEH 3QI9C 5B3JE 4JQXA 5DJAA 1EX0A 2P5WB 3NCJL 1BFSA 4KJYA 4R4FH 2XN9A 5ICYB 5JOFA 2D31B 4P59L 2VABB 1S5IH 4C59B 1WSST 3VJ6A 2YD1A 2VC2H 4LSSH 1AY1H 2P5WA 4L4VB 4Z7UF 1BQHA 1NEZB 5DMIL 3U46B 4ZFOB 1CD8A 2V5YA 1YMMB 1TVHA 3BRGC 3QA3A 4NRZA 3MGTA 3RAJL 1NGYB 1KLUB 1IMHC 5IHZB 3T0EA 4ZD3L 5IM7B 4LGRB 4WU7B 3HPLA 5GSRB 3BKCL 1CS6A 5EWIH 3LD8B 2NMSA 1HKLL 2M26A 4ZS6C 4Y5VB 4NWUL 1CDGA 1KT2B 2NY3B 4ODXB 5B22A 1GOHA 4MNHA 1D5BB 1ND0A 3HNSH 4JM2C 2QHLA 3GIVA 5DJYA 5EZLA 3B2UD 4JPVH 1G6RH 3WKML 1R3IH 3QUYA 4PREA 4C56D 3ULUD 5I1CL 3QXAA 3GI9L 4O00A 1IGIH 2EYRB 3UZQA 4F33A 1T1XA 1EGJL 1VFAA 4MDJB 5J06A 5EU6D 4FFYH 4D0CA 1KLUA 3CSPA 2AJVL 4GLRI 12E8H 1Z6JT 1KJVA 5C0EA 1Z9LA 3LV3A 4S1SL 4POUB 3RWFA 3VFTA 2X7LA 2EXWD 4JRYB 4ZOCA 4QTIH 2I5YH 5D1ZB 2JB6A 5HVHC 3U0TB 3W11D 1OT2A 3QXAB 3OB8A 2N56A 4O58H 4Z7WA 3PWJA 3UCRA 4J3TA 3MRPA 4JO1H 4OKDA 2A6DB 5CCKH 1EGJA 5I75C 2AQ2A 5C92A 2JK5A 4L4TB 5DRZB 3VXUA 1CFQA 2OR7A 4O51A 1B0GA 1KT2A 3KXFD 1PG7W 4IDJL 1N6VA 2MKWA 1J0JA 3WD5H 2ADJA 3QXUA 4WEMB 5JORB 3K4AA 3QPXH 3VFVA 1I3UA 4MXQD 3GHBL 3ULVL 5DO2D 3T0EB 1T22B 3QG6B 4TTDD 4YLQT 4POZC 3TA3B 2CIKA 1MCQA 4NNPH 2VDQL 1AJ7L 4TOYH 3NFPB 4LOUD 3V6ZB 3OJ2C 4ONGL 5GHWL 5SX5K 4EUPB 4YDLC 3RI5F 4HWBL 3VI4F 2QKIB 2WP3T 1ROWA 5JMRA 3QXWA 2XKUA 4GKSA 3D85A 3TBSB 1Z0NA 3TVMC 4XNQA 3S36X 4EXPX 3TV3H 5LGKA 3MUZ1 3GSWA 1TDQA 4LASH 3R8QA 4KDVA 3U7YH 4JN2B 3G6JB 5F7NC 1G7IB 5CAYB 4XVTH 3I3EA 4Y16C 3V4UL 2ADFH 5HYIA 4JPIB 4NO2A 3DMMA 4J6RL 1KBGH 1BEYH 4M48L 4ODWB 4FNLH 3IDJA 3QSKB 5TE4H 2EEDA 2VZ1A 3C87A 5EU7C 5E8NA 2Y07H 3OKLA 3TBYB 4J1UA 2FBJH 3BWAB 4IOIA 1V7ML 4DN4L 4MDIB 4C56E 1QD0A 1DQTA 4WU5A 5GS0D 1HILB 1IZKA 1QLEL 4HPYH 1JPGB 1R5VA 3IU3A 4Z7WF 2K7QA 3E8UH 4IRZL 1T0NB 1IGJB 3MRGA 1U8IB 3QPQD 4TVPE 1KJ2A 3O4LE 3SY0B 4U6HB 4XPAH 4NP4H 4UIKL 3PHOB 2GITA 2XNAA 2OJZL 3BIAX 3FCTA 3G5XA 2P5EB 5FO8A 3MV7D 5ITFA 1ZS8B 3OAUH 2QSCH 4OCLC 4YDLB 5J1SC 3VRJA 5C6PB 1NDMA 5FXCH 3EFDL 4IJ3C 1N0LA 1OT1A 2R69H 1U3HA 3RWIB 5H37G 2H6PB 3MV01 2VDOL 2AJZA 4YXLL 4KHTH 5EUOB 3MLXH 4O2FA 4XP9L 3DVFA 2ATKA 4W6WB 2BNRB 4F8QA 5F3BA 3DPBA 2P8MB 5GGRY 1FNAA 5C07B 3QWRA 4HPOH 4X0KB 3HS0B 4Y16B 1MJJB 4BKLB 3H9YA 5L2KA 4S11A 3D5OF 2P8PB 2VN4A 4ZSOA 1E4XH 1BD2D 5F7YC 3ZDXF 5BW7A 5SWQB 1A7OL 5GGQL 3MRMB 3OAYH 3MROB 3QWOB 5DJDB 4YR6B 1BBJB 3ZTNL 3C6SA 4PJ7A 2W9DH 3ABZA 5KVFL 2MFNA 1ED3B 4H0HB 3QFJD 4JY4A 5M95B 3ARBA 4UDTA 3PDOA 1MCWW 1V3KA 4N8CH 5C86A 4DVBA 4PGDB 1PSKL 1JWMA 3QJHA 4R26H 1HI6B 1XIWC 3UTTE 5D1ZD 4JFDA 3MJ7B 1YEDA 3O6FA 4KH2A 1XFPA 2DL2A 3QUXC 3G04A 5TPWL 4N8PA 5CLTA 2AEPH 1SYSB 2ADGB 3CU7A 4NO5A 2CR6A 3CJJA 1WWAX 2R56H 1M6OA 3SJVA 3HC3L 4ZUSA 3C5ZD 1CK0L 1N4XH 4PJBF 3U30B 3KPOA 3O3DA 5E5MB 2F74A 4PP2B 4HCRA 5JPMB 4FXLA 4NZTL 2XI9A 1QA9B 3D6GA 3BDYH 3OKKA 43CAA 4K9EL 2WW8A 5TF1L 5BZDB 1XGYH 3VGBA 3GMOB 1NBVH 2FL5B 4IOFC 1WBZB 5INCB 4NQVA 4NQDA 2WBJC 2BJMH 4MJ6B 3S3JA 1G9NH 3FQXA 4NUGH 1ZEAL 3TFKD 4PJ8B 5E99L 1F6LL 5FYLH 1N64L 1VCAA 5IB1A 5KSBF 4P9HL 4OF0A 1ORQA 2WWKO 5E5UB 2BOCB 3HG1E 4KI5C 5E8DH 1TTFA 1KN4L 1E6JH 1KLGB 1KC5L 3BIBX 4DVRL 1TTUA 3GK8H 3WDJA 2HKHL 3TO2A 1FE8L 5FDYA 1FFQA 2OZ4L 4MSWB 4OM0L 4MJIE 4IHOA 4N9GA 1GVIA 2UVEA 4OZGA 4UAOC 2EKJA 5I66B 4LHUG 4Q6IB 1MFEL 4XRCB 4RFNB 2R0KH 4WWKB 5D9SA 4BSJA 1C5DA 3KPNA 3FO9A 3D9AL 1RULH 1OOAA 2CDGA 3RA7L 3BKJH 4XNMB 1EUUA 5KN5A 1NBYB 1BFOA 1FYTE 5KG9B 1MREH 2YA1A 5GGUA 2A9ML 4KV5E 1RUMH 5DJXB 1LO4L 2LU4A 1IAKA 1XGTB 3KPLB 4FTVE 3FOLA 3O2DL 4FQLL 3VGFA 3FB6B 5E99H 1QNZL 1KJMB 1AXSB 2DQJL 4LCUB 5D7SL 3RI5K 4F8TA 3VG9B 3KHOA 5E00A 3ARDD 3DROB 3GZKA 3VXMD 4YBQD 3TYFA 2V2WB 2FO4A 3HS0A 3T77B 4LARL 2B1AH 5DRWA 5T5NG 4OM0H 2R2HB 4U1JA 2UVFA 4NQCB 3CFJA 4MXWL 2FLBT 3D2UB 2NX5D 3DGCR 3WNKA 4PJDF 4BELD 2XPGB 4HBCH 4DZBA 4UINL 1H8SA 4OV6F 1QKZH 2XV6B 4NKOB 2VXQL 4M6AA 2R23B 5KSUB 4HIXL 4OZGE 1IFHL 1NANI 3RWEA 3GM0A 4JPVL 4Y19D 3HAEA 2Y07L 2VXVH 2XT1B 3WN5C 4AQ1B 1A4JB 3ZT6A 4AEIH 5HXMA 2ATPA 5CEZE 1F3DH 1NC4A 4AH2A 4JFOA 4NRXA 5D71H 5EBMA 3VFWB 5IG7A 5MENE 2X4NA 2Q87A 1DQML 2HA1A 3VFGL 4I77H 4PJIA 3P4MB 4APQC 1LO4H 4ZPTB 1DDHA 3WXWL 4LNVA 3IU3B 3UTSD 3MODH 5SX5H 4NQTA 3C60C 3QYCA 4ZMAT 4L3EE 4MDIA 5FOJA 1P53A 3ARFB 3TH4T 3ZL4L 4KI5E 1RMFH 4JFPB 4R3SB 4GRWH 3GO1L 4B5EA 3WNPA 3Q48A 3MRKA 5GIRB 4G8EA 1ACZA 1T7XA 3QCUL 1QEWA 2OI9B 3H7BA 4EI5C 5E2VL 5I74B 3G6JA 3TT3L 4ENED 2X09A 2NXZB 1S8DB 2R0ZH 1AXTH 3WFDL 5C09A 3JV6A 3B8SA 4K7PL 4JM2F 1QSFE 4P46C 5JPNA 3NABL 4LLQA 4J8RA 4OCRH 4KXZI 3QUXA 1NCAH 3PIQA 4RWYL 3MGOB 1F90L 3Q6GL 5EIQA 3NMEA 4MXVE 2IG2L 3CIQA 4RWHA 3FQUB 1IQDA 1HINH 5DHVH 3DYPA 3ULUH 5LG1A 3SDXE 2VZVA 2PYFA 2XZCL 4FQIL 1P7KB 1MHCA 1A1MB 4TUKL 4QHUA 1CLYH 2BMKA 4DZ8A 4JZNB 4KAQH 1MQKH 4KRPB 5EIIB 3HE6A 1JE6A 2VL5B 2ZCLL 1DTUA 4EN3D 4ONFH 4MX7A 2QV2A 2GYSA 2CRIA 2UZIH 4NUJA 3ARFC 5IVXF 3MRJA 4PB0L 2XN9E 3MBXL 4OBRA 5DHYA 4PS4H 2FX7H 4M48H 4FNLL 2OI9C 4EI5B 5DYOB 3WUZA 6CGTA 1ZLUK 2IPKB 5F89A 3V5KA 1F4YH 4M62L 5IVZB 2NLJA 3H2WA 1KLFA 3QDGA 3VFTB 5HDBF 3D2UA 5F7KC 1OTUD 4GRLC 1T20A 4KK8D 4UQ3A 4X6EB 2VMFA 3HAEG 4QRRD 4XZUA 3BQUD 2W9DL 3D39E 1WAAE 4Y5XA 2HFEB 1WZ1L 2C1OA 4XPAL 3DO3A 3BZDA 4P49A 4WRLA 4P5KB 1BHGA 1FDLH 2X4RB 1RZ8B 2EE6A 5IBTH 3O9WC 3AROA 4Y2DB 4N0RA 3E3QE 1GIGH 1A6WL 3KXFA 4OGAC 2VIRB 3KPSE 2D7TL 4NQEA 3UYOD 2B4CL 3A67H 4KKLC 2ZCKH 4KROC 4UMGA 5GGUB 4JCMA 3A6CL 3ARGD 2YD8A 3WE6A 5D6DA 1G7JB 3BXNA 2UUDK 3QDGD 2NY4C 4XNMA 1GCFA 1TZHB 2NYYD 4KKCC 1RZ8A 1UVQA 2XWTB 4Q9RL 2R1WB 3MLVH 5C0ND 4GRMA 3ZYZA 2GSGB 3ZDXE 1B2WL 4OQTH 3ZKNC 4L4VA 3O4OB 1U36A 3KG5A 3RHWF 3AGVA 1PYWB 4X7EC 3CVHL 4P2QE 1TETH 4B50A 4L4JA 3W2DH 3S36L 3MRRA 1H5BA 5LWYL 5EU6B 1QEWB 3BN3B 4GBXC 3TN0D 1JN6A 4GG6B 3C5ZA 3DVIA 3VI3E 2QJDA 4RMSA 3G5VA 2RR3A 2FEEL 3JWDC 4UBDC 3RP1A 4EEEA 5CBAB 3MA7B 1MWAB 3ULUE 4JO2H 5KSAB 5H2BA 4GKNA 1PX3A 4HIHB 4X7CC 4JRXE 5C71A 5IMMB 5DT1H 3MLRL 3QDMB 1U9KA 2H3NA 1A64A 1S9XB 3GSVB 3LMJH 4NUJB 3TBVB 2RIKA 3QDAA 4O5LH 3TZVB 3PXJA 3DYMA 4X6CB 1D9KA 3KYKH 4ZTOL 4PY8J 4N1HB 2BY1A 4PRPB 4KROB 4X7SH 2C3XA 5IQ7H 4FZ8H 1A1OB 5DSCA 1I4FB 2A1WL 2XYCA 1CDJA 4OD3L 1IKFL 3IKKA 4KU1A 2B1AL 3BD4A 4ZUUB 2DLHA 1A6PA 3IFPB 3ZKMC 3C8KA 3KYMA 4QXUH 1NAKH 3EO9L 5FUCE 1LK3H 35C8H 4PJ7F 3HR6A 1J05A 4HIJB 2R2HA 5DWUL 1IT9H 2P45B 1C8PA 5IJKC 3KR3L 5CIPH 1F4WH 1NGXB 2Z31A 3UTTA 5BZWA 5FGBA 4NHCL 3P0YL 5JTWA 3IFLL 1FJ1A 1R5IB 2BSTA 5L9DH 1CVRA 4KFZC 1N0XL 2AKRB 3G08A 5L88L 3MUJA 5C0CD 1TFHA 4MNQE 5HGHA 5E94B 1G9MH 3QEQB 1BIIA 3WHE0 4BQBA 5C0AB 3T65A 3RX8A 4FQHA 4KJWD 1XH3A 1GGUA 2K1MA 5T1DH 2FH6A 5EZOL 5SV3A 3L95B 5DT1L 5HYSG 1E6OL 4GAJL 1BD2A 3CX5J 3OKNA 1G7HA 1QSEA 3HZKA 4M61B 4WUUE 5TDPA 4NYLB 2ZUSA 2Y72A 1KB9J 1PW3A 3GRWH 5I73C 1JF1B 4ODHH 1Z9OA 2V2XA 1XF3A 4W6YB 3CK0H 5D7IB 1DUZA 1W0VA 2NNAA 5IOPB 3MPCA 3UYRL 5CIPB 3BP7B 1K4DA 2NQCA 2R4SH 4HWEH 4PJEA 5FV2A 1YPZE 2AJYL 5IF0B 2ARJQ 2W0FB 3VGHA 4AEIL 3PJSB 3O81A 1QVOB 1FL5B 3MLPA 3MRFA 4DGYL 1UZ6F 3FN0H 2LTQB 3DI3B 2PW2A 1GL4B 4X98A 1YECH 3I3DA 1IGIL 2GSIA 2YD2A 3F12A 4UB0L 3R06B 5E6IA 2CKBB 2HLFD 1SJEA 2NY1C 2ZKHH 3OXSB 1VGKA 2GJ6A 5IB1B 3HG1A 4K3GA 3LOWA 5J9PB 4QKXB 4U0QB 4ZNCD 1FFPB 5HHNB 4GKOA 4YHYB 2FZ3A 3AXLB 1C7TA 4CVWA 4ONFL 3IS1X 4G6JL 5JW4M 4ZUVB 1VGEL 2OMBA 1ACYH 4M8QA 5IFJB 1JGDA 5FHAH 3SO3B 1QR1B 1CT8A 4KKBD 1QA9A 1JVKA 2AERT 4NSKA 1H8OA 4HIXH 3IYLW 3SDDD 4K2UH 1UT9A 1FRGL 3U9UB 3RZCD 3GHBH 2DMKA 2ITCA 1SJVA 3L9RA 4MCZA 1GGBL 4NKQB 3P4NB 2EDFA 5GSVB 1T21A 4UDUB 3MNZB 1G7LB 2W92A 5J3HC 3N1MC 5BQ7A 1RHHA 2AK1H 3GEWB 3OHXA 4TRPH 3MOAH 5F9AC 5T1KA 3CC5B 1CGSH 1FN4B 2LE9A 4Z0BL 4JKKA 2W0FA 2CUMA 2YUXA 4YDIH 3O11B 1JGEA 1CZ8H 2ERJB 2R1YB 4XWOC 1BOGB 4XMPH 2W9LA 4YDJA 5K9KB 1R3JA 3MCLH 3DNKA 2NXYD 3BZEA 4KQ4H 4H26B 4KRPD 4XH2B 3ARBB 3HI5H 1TCRB 3MREB 4OLXL 1I7ZA 5C08E 1UJ3C 2HTLC 4K7PH 4KJQD 2NY0B 1LEKA 4PRDA 3OGCB 3H3PL 4XTRD 5INDB 2WIIA 4WO4B 1N6UA 2NPLX 4XH2A 1ZLVK 2VDNL 4JM2B 3ESVF 4JFFB 1LP9F 1NCAL 5GS0L 1F6AA 4AIZB 5I6XB 3CFKB 5ETUB 2VXUH 4F7PA 1BAFH 4X9GA 2PYED 5D1ZA 4IOFD 3CVHB 3ZLQC 4CBPA 1JBJA 4M6NL 5DRXA 5C0AD 1E4KA 3V6FA 1L0QA 3B5HA 1CLCA 3LQZB 5DFTA 4KRNA 1B6DA 4KTEH 2K3TA 1CQYA 4IIQA 3U9UA 5JW4R 3INUL 4NRYB 2ZCLH 3OL2A 3QQ3A 3P4LA 4Z9KB 3MRHB 3WIHL 1I9JH 3CSBA 3ILPA 2VZTA 1K5NA 1AR1C 3RWCB 4FQXA 3MJ7A 43C9A 4Z7UA 3E6HB 4L9LB 1WCQA 2EO1A 3IVKA 1JZ5A 2COQA 3SEPA 5CEXB 1JPGA 1R5VB 5IBUG 5IB4B 1MI5D 4M6OL 4FQQB 3T09A 3UC0L 4NM4H 1DSFL 4J1UB 3B6SA 3HFMH 5GRYA 1B90A 4MQXC 1IEAB 4FN0A 1JHLH 3BPNB 4YH6A 4CW1B 5IVOA 3BISA 2CKBA 1I8IB 4KKAD 3W5MA 2AQ1A 1MWAA 4L29A 4PJ5B 3GNMH 5EOCL 1XF1A 5ICZA 1GZPB 2HT3D 4OUOA 5CEZD 3KWWA 1D6VH 4Y16A 5ADPH 3L3KB 4JG1H 5BCAA 3MFFA 5L8JB 1QLRA 1OPGH 3N1GC 4BFEA 4GMTH 2EXYC 1OVZA 4Z8FL 4P9HC 2AEIT 1K4DB 1CLOH 3ZMRA 1W0YT 1MFAL 5LGJA 2ED9A 2VXSL 5B38B 1O0VA 1BZ9B 2X2YA 4IM8A 1EAPB 2CKBL 2OJEB 3S8WA 4N8VB 1M7DB 5T1DL 4K3HA 5IR1B 5TF0A 1A3RL 5BVJB 4KK9D 1NDMB 1T04A 5TE4L 2Y1VA 2MNUA 3HMXH 5FO8B 3ROOB 4MYWB 3RZWA 2IH3B 1GGCH 3G5YB 4U2YA 2DM3A 2FNBA 3MLSH 1S3KL 3CFBB 4NNYA 1WFUA 4WUKH 4I4WB 1PQZB 2QADC 4ZFFA 3S97C 3AAZA 3MYZA 3RGVC 2ZUVA 3QUKA 1QFUH 4GQPH 4WDIB 4F7MB 2J7LA 3G08B 1T03H 3S3SA 3MLZL 3TM6A 1KCSL 3OR6B 4Y0GA 3LN5A 3HZMA 4GT7A 1MCCA 4IJ3B 4JO2L 3LPGA 1BLNA 5JXED 4Y5XB 1KCKA 3FFCE 1P2CB 1QLFA 4DUWA 2P5WD 4ELME 1X4XA 3TNMA 1LDPL 3D3VD 3NIGE 3EOAB 2X70B 4GAJH 1KC5H 1MCEA 4JGUA 5FFLA 2GUOA 3IFPA 3UYPA 4OBSA 3VGGA 4OIIL 5IW6A 4GW1B 4HPOL 2EYRA 4WHYH 3WL9B 3H7LA 2DQGH 2HT3C 4KROD 5IFAH 4V2CB 4X4YA 4P3DB 1MJUL 3TPUB 3EYVB 3BMWA 4BH7A 4XNUL 2FSEB 3W9DA 3V52H 3BH8A 1RFDH 1NPUA 2EDJA 1CE1L 3JV4B 5CP7A 2QADD 1ORSB 3VFMA 1S78C 2CRZA 35C8L 4DEPC 3GHEL 1X5ZA 4DKEH 1T5WB 5KVFH 4L8BA 4OD1H 1C5CL 4JRWA 4ZNEA 1S9WB 1S5IL 2UY7A 3BKJL 4TTDC 5EBLA 3TIEB 1OAQH 4M3JA 4V1DD 5J13C 2KZWA 2O5XH 2QSTA 5CP7B 3LHPL 5GXBB 5KVEH 4ZDHA 3RL1B 4O51B 4UB0H 5CUSH 3ZE2F 3BT2H 5F7FA 1E27B 2UV3A 4GBXA 3VJ6B 1OTUC 1Z5LA 2ZNWA 3CVIL 5E8PA 3GK8L 3UTQA 3CFCL 3VXSD 3MNWB 3I50L 5I71C 1KB9K 3JV5A 4BK5A 5FM8A 2XN9B 4NKIL 3CAFA 2HMIC 2OX5A 2DD8H 2N1KA 3W81A 2X70A 2FHCA 4QHNB 2FX9H 2LU3A 4GOSA 5GRJH 2HMID 1G7JA 1I7RA 4JFED 1TCMA 4LSUL 1NAMH 4LLYB 1QFWM 3IS0X 3DX7A 2PTTB 4Y5YB 4RZCA 5AUMB 3ARFA 4DJMA 4JKMA 1EEUA 3PWLA 1FP5A 1EJ6A 4PJGE 2Y36L 4G8GA 3VE0A 3HE6C 4H1LB 1NBZB 3VXRE 1P7QA 3TPUA 4LEOA 1SJHA 5FB8A 4M7LT 2IAMB 4EN3A 3NCEB 3QCTH 3HPLB 5GSRA 3OF6A 3ROOA 2JTDA 4F58L 2G75A 4CJ0A 1U92B 5JUEH 2H2SC 4D9LL 1P84J 1FL6B 3TWCL 4TVPH 1P69B 3MLXL 5DLML 1E4XI 2XPGA 5J8OA 3N1FC 5F7EL 4XCFL 3GMLA 1ZOXA 3K46A 4HS8H 3V5KB 3WNLA 5IEKB 2HJFB 3PGDA 3RX5A 4LRNL 2ZSWA 1ITCA 3MNWA 5ICYA 2VERN 2YPVH 1WC7B 1QFOA 5FHAL 1EIBA 4RSVA 5LCVH 4Z78B 4HIEB 3UDWA 1EEZA 4IDLA 4WFGD 1F11B 2AJ3A 2YUWA 3NCYS 4EKXA 3UPCA 3VRIA 1IM3A 5GHWH 4YXHH 2NY3D 2B39A 5D1QB 4JR9H 2VXUL 3OKEA 3KPMB 5A2IH 5IVNA 1MCHA 1HK6A 1DSFH 5D93C 3QEQE 4DN3H 1G9EA 3BUYB 1CFTB 5DHVB 5DEFA 3I6KA 1AR2A 1QBMH 4P5MB 5DJXA 2IAMC 2FSEA 4YIQA 1ZA6A 1W72L 4QT5A 4QOKB 4O9HL 2RGSA 2DYPD 2ZPKL 4WW2F 3U2SA 3L5IA 2MHAB 2BY3A 4HX1B 3IXTA 1KFAL 4DGIH 3NGBC 4L5FH 3AREA 1MRFL 4ORGA 4F3FA 4XCYA 1PKQB 3MUGB 3R1GH 1CLOL 3JWOH 3NVQA 2Y4SA 3CD4A 4WIQA 1MLCA 3ESUF 2PO6B 4LGSB 3ECBA 4DGVL 3TT1H 3O3UN 2GTWA 3PGFL 2H1PL 4FOMA 4XMKH 2B2XH 2EDWA 2P48B 3UTZA 4KWUA 3HZMB 4YHIB 2JIXA 2P42B 3BZ4A 4LDLB 5KSVA 1SHMA 2IG2H 4JFXB 2IMMA 3E6FA 1ZT7B 2WBJB 4R96A 2VSDA 3ZDYF 5CP3H 1JGLH 4NQSA 5CEXA 4LF3A 5DJZA 2R2EB 4H8WL 3JBG7 2VDOH 4PJIB 2V6HA 1H3TA 5C0DA 1N3NA 1YN6B 1D6VL 4AENA 5HYJB 5L6YH 4NRXB 4JZJA 1QSVA 5FCUL 5I1GH 1OF2B 1RD6A 3MXVL 4OF3A 5B21A 1RUQL 1MHPH 3QDMD 4YHMH 5BZDA 4OI8A 4E0RA 6FABL 5IR1A 2YBRB 1F3JB 3JWOC 2FLRT 1I8LC 3AB0C 3IDXL 3F7YA 3L5WB 4PP2A 4GUPB 3ARQA 1F58H 2GCYA 3DGGB 4LLMB 4QY8A 5CSZB 1KTDB 3GMMA 4Q6IC 5TH2A 4GKZB 2AEQH 5K9OB 3O8XC 4KVCH 2XXCB 1VADA 1WT5A 1SEBB 1G1CA 2YKLH 1PZUB 3AS0A 4LLVB 4ZUTA 1YMME 4JPKL 4Z7VF 5KVGH 4EBQL 4KZDL 2D7OA 1IQWL 3MO1B 5T1LA 1EFXD 4RDQG 2X89D 3ARVA 4OTXL 3REVB 3GMQB 2J8UB 1SEQL 5D70H 4QWWC 3UP1A 1U8LA 4YHNB 4XBGB 3QXTA 3VG0L 4IMKC 4MD4A 5JOPD 1FBIH 5CKGA 5L6YL 1DVFD 5GJSL 2JJTC 3T3PE 3VXNA 3UTSB 1CK0H 3KVQA 1N4XL 1JGEB 2CDGB 2PNDA 2CK0H 2E9IA 5FCSH 1FE8H 2H26B 4ZUTB 1YMMD 4RRPA 5T1KB 3PNWA 4M1GH 4MVBD 4NBZB 5I8OH 5D6CB 4P23C 5BV7L 1RY7B 5EBWB 4KK6D 5I19H 4GAGH 3QUXD 3BKML 4MJID 2I24N 3LEYL 1P9MC 2M8XA 2BY2A 3X17A 3MV8D 3BOVA 4HUKB 4X6CF 4PLJD 3QISA 2VDRL 4NIKB 5BXFB 2EIZB 3H9SA 1PEWA 4TTGA 3VRJB 5GGVY 3T0WA 4KJPC 3GKWH 5E0QA 5FKAA 3FCTB 4JZJB 4D3CH 4PJHB 5GZNC 1NEUA 2MQ3A 4APQB 3TBTA 4APQD 2VITA 1AQKH 3DXAA 2G5BA 4G6FB 4NQDB 5KZCB 1ZT7A 2WBJA 2QBWA 3QFJA 3A6BH 4NFCA 4U1HB 1RMFL 5LAXB 3KYKL 3TIDA 1A7PH 2PW1B 3R06A 4I8DA 1U8LB 4ELMF 4HUUA 1TNMA 1RQ5A 3S37L 3BGMA 1YEFH 2VLRB 3MQIA 1E6OH 4U1LA 4CVXA 2F74B 4BQCA 4LBEB 4GW4B 1CG9B 4D0BB 2VLJE 4I9WE 1P9MA 2KPNA 2KQMA 5DR5H 4AQOA 2NTFA 2GJZA 1EJOL 2HLFC 4ERSL 1H3GA 3U9PH 1AHWA 4DOHB 5JHDB 3O3AA 3MXWH 1AXIB 4UOW0 2WUCH 5KVDL 5GSVA 5BS0B 4FXGB 2FHFA 2BOBB 1NAMB 5DQJB 3UTTD 3GMMB 3ULVD 4K71C 2R4SL 4OCYL 4EUPA 5JW4Q 3C6LA 4KKCD 1WIPA 2ZUUA 2EE2A 1CT8B 4FFYL 2H2PD 4D3CL 1X7QB 3PDDA 4L8SC 5AYQA 1AFVL 3BAEH 3ZE2E 1HNFA 2ICCA 1DFBH 2BXZA 3O9WD 5KSAD 2AAVA 4QCIB 2G60H 4CGTA 1C7SA 2QQLL 5L2KB 3CLFL 2R2EA 3EDKA 3VWKD 5I1IL 4Z78A 1L6ZA 2A6DA 2OQJA 4YDKH 2PYEA 1A21A 3BKYL 5C0CE 2H9GA 1CR9L 5HHOE 1YY9D 1ZHNB 1FGVH 5CSZA 3ROLA 1JFQL 2VOTA 4DGVH 1F3DJ 2XG5A 2VWEE 3SN6N 1KENL 5BRZB 2FIRT 1NQBA 1WVZA 1WEJH 2PO6A 2DKSA 4FMKA 3PJSA 5E03A 2JF1A 1AD9B 1MF2H 5IW1A 1GJIA 1ZS8A 3UPRA 1CFVH 1FDLL 1U2HA 2XRAL 3OB0K 4HKXB 5ANMB 1EPFA 2AK1L 4KHXL 5LXGL 4L3EA 2ZUYA 1HSBA 3C8DA 1JTPA 4C56B 5BMFH 3KLDA 4H25A 1CFSB 1QSEB 3HZKB 2P7TB 3ARRA 2CPCA 3ZE0E 3FJTA 1MY5A 1KTRL 2BNQA 1DFBL 5EB9A 1J0IA 1UQSA 4Z7QF 4F7EB 4PBWD 5F1OB 2KKQA 2JE8A 4G5ZL 1W72B 4JPIA 1K9TA 4X6CE 3KAAA 2Y25A 5A2FA 3L5JA 2QQNL 3NBNA 5I1AA 2DM4A 2J6EA 4RFEA 4LQFH 3IDNB 4X4XA 3QIWA 1MEXL 2DI9A 4U1NA 3NZ8A 2VZUA 3ULUL 1UWXK 3O4OC 3BP5A 3S98A 4HIEA 4F9PC 2MJWA 2Z31D 3NPSB 4XAKE 3ZYOA 4WV1A 1ZLSH 3UTTB 1NGXA 2Z31B 3E8UL 4MNGB 2R1WA 4MD0B 4X6EA 2YA2A 4I0KA 2D03H 4GBXB 4TNVK 1KB5A 3DMMD 5D2LB 3LQMA 1ZA6B 3VFSB 4KTYA 2IJ0C 3MXVH 4ZG1A 5D2NA 2GTZA 1UB6A 1FIEA 4P5MA 4AIOA 4LCWD 5GRWA 4PB0H 5E7FA 4V1DE 4ETQA 3SQBA 1RZGB 1UACL 1AGBB 5DJCB 4K94L 5ICXB 2VLRD 5E08L 4EXKA 2IQAB 4PG9A 3FRPG 2UWEF 3QJFB 1P4BH 3QXVA 4ZAKB 1UZ8A 4OF8A 5ELIA 2ADIB 1I9JL 3QG7L 3EYVA 2P44B 1WQVT 3NZHH 4YHZL 5AAWA 1P7QD 2EKSB 3NH7L 4DZ8B 5HPOA 4JFYB 3IDIB 5F1NA 1HQ4B 3W0WB 5J6GA 2IADA 1UB6B 5J6HA 2GUOB 4ZXBB 1CICC 4I13B 3U4EA 1JN6B 2V5TA 3KS0J 4QRUA 4GG6A 4JHAL 4L3CA 4QHNA 1G7QB 1I1AC 1S7SA 3RKPA 5DFVC 4G80A 5HGBB 1UYWH 4ZSOE 1Q1JH 2FATH 5EFIA 3SDXB 4I48B 5D7LA 1BMGA 3RIAF 2R0ZL 1SBSH 1U8NA 1N0XH 1UFUA 3D39B 4Q9QL 1F00I 5EUOF 4H20H 1U8MA 3FN3A 3GI8H 5TGBA 1JIBA 1UKTA 4OLUL 1CU4H 3OGOE 1D5MB 4MD5B 4J3XA 2AABH 4HG4K 5LQBL 4F7CB 1DANT 1D5BA 2ZJSL 1JGVH 3G5ZA 1D9KD 2GFBA 1RK0B 5C3LD 2W38A 3FQNA 3VXTB 3BH9B 5CILL 1LEIA 3BFOA 5EZJB 2NY0C 3VXTA 5JQ6H 2IALA 4JM4L 2PYFB 2DBLL 4YFEA 4AM0B 3HUJA 1TETL 2DN7A 4HS3B 1JTTA 3G5ZB 3L3HA 1Z3GL 1CLYL 3BKMH 4NO0D 1NUDA 2HVJA 4PJFE 5K59E 1D5MA 3JV4A 3RVXD 3NFNB 5DVOA 3O4LA 4F80A 4WWID 2CGRL 4G6AD 2E27H 2ATPB 2QTEA 3M17B 5GZOD 1FO0H 1AGEB 3GB7B 4QRRB 3D39D 3IKCB 3DVNB 1I1AB 3O6KH 1QLRB 3EYUH 3M8OH 2JJSA 5I1EH 5KW9L 2R29L 4ZXBA 5C07E 1LE5A 4GRWF 1SBSL 3AMLA 4U1JB 5CSBA 2Y9RT 3L3DA 4TNWK 3ARDB 5ILTH 3FOMA 1I8IA 2NY1B 3I02A 3OXRB 3WSQL 4BUHA 1E28A 1J7VR 1FNSL 2A83A 4NC2B 3ALPA 1ADQL 3EYOA 2CMRH 2VAAA 1XCQA 4JKPH 3S35H 4LLAA 3QCVH 4YHYC 2F8XC 4WDIA 4F7MA 2P24A 3VFUB 1AGDA 1Q0XH 5H37H 3O2VL 4H88H 2NY3C 2X44D 1C1EL 4LFHG 5J1TC 4GAGL 4ELKA 2KH2B 5MP6H 3RTQA 5HBBA 4WUKL 4JGMA 1HKFA 5DGRA 5B3NA 1UB5B 4PJBE 3C6LB 2BNQD 4LNRB 2X42A 1QFWL 5IQ9A 2F54A 2J1KA 5BVJA 3MGOA 3DX8B 5DQJA 3FO2A 3RY5A 4G6KL 3K81A 4FQJL 3LQZA 3IFOA 1C5CH 5FECA 3FHQA 5I8CB 2OR9H 1JNHB 1AKJD 1RZJH 2K7PA 4PGEB 4U1NB 1XGRB 1J8HA 3EDFA 5HVHB 1P1ZB 2ERJC 2GJ6D 4NT6A 1FCGA 1ZWIA 3MFFB 4S1QL 5I66A 4N0YL 1F8TL 4N5ED 3FQTB 2D7QA 4NHUB 1BQLL 4QF1B 1KJMA 4U1LB 4CVXB 4XBPB 3VXME 3O6FC 1U8KA 3ARBC 1AGCA 4LLUA 2RFXA 2QR0A 2J88H 4LPWA 4LCIL 1B4JL 2BVPA 3RNQB 4FXKA 4N0UB 4HMDA 2AV7A 4ERSH 2BVUA 4ALAL 4PTUB 1BECA 3B6SB 3MLSL 1C1EH 4R7DA 3K8LA 4GQ9L 4X99A 3QEHB 4N90E 2ZP0T 2VDPL 3QNYA 3P9MA 4WI8A 4X4ZA 1R3JB 2QQKL 1GAFL 2BXYA 1KUMA 3U83A 3OKMA 2W1NA 4K3EH 3GMOA 5SWSB 2EDYA 2W0KA 1FN4A 3L3KA 2EDHA 1K6QL 1AGFA 4YE4H 2ICES 4DZBB 5IUSA 1OSPH 5CEZL 1CGVA 3F6LA 4MB3A 3MODL 1HHKB 4I18A 5DJ6A 3SBWA 5CGYC 1CE6A 4M1CC 1MAML 3Q1SL 2BK8A 2OLDA 2IEPA 1CLZH 1Q9KA 4TNVF 1FH5L 3PV7A 1NCNA 1YEDB 3O6FB 1KPUA 5KJRH 5C1MB 2E6JA 2ZOLA 3MRNB 3UTSA 5L88H 1AXTL 1G0YR 1QRNB 1VESA 1ZHBA 2AJUL 1I1YA 2LVCA 4Z0XA 4XC3L 3QHFL 5T1MA 5J9PA 3FZUD 5INDA 4NN7B 3EJYD 2FB4L 3HG1B 2QQQA 5CGYD 5GS0C 4WHCA 3ILPB 4XMLL 3BE1L 3MBEC 3BRDA 4GRWE 4UUJA 5CD3A 4JB9H 3P73B 2DQTH 4ZUSB 5SWZE 4WHDA 2BVYA 5T3ZL 3KLHD 4M9PA 1KIUA 1U3JA 1MJJA 2E9BA 4RGNE 2OTUA 3G04B 3L1OL 4LP5A 4ZS7L 4K7FA 1JP5A 4ONHA 1NFDF 5F9OH 1MCBA 5SWSA 4DK6A 4UNTA 3U7WH 4FQXD 4U3CA 1F6AB 4AIZA 4MSWA 2I25N 4PJGA 4UOJA 5L8LB 3TC9A 1DUZB 4QNPE 4CAGA 1BWWA 2DKUA 3H0TB 3WO4C 2ZZUT 1JNNH 2OK0H 5JQ6L 4ZNEE 5T1LD 3M07A 1RVFH 3DXAB 2H1PH 1U8HB 1RZFH 4UTAH 4U0RB 5AYUL 4R90L 3KPRD 1JYXA 4OJFL 4XBPA 2QADB 5D1QD 3TA3C 4PBXA 1P84K 3ZT5A 3FONA 2Q7YB 1OL0A 3MOQA 2RAMA 3INUH 4MA7H 3BDBA 3GSNA 1R3LB 4RIRB 2C1PB 4IOIB 3MMEA 4PGEA 3FL7A 4YHIA 4PJ9D 5SWZB 4Z7WE 3SQOH 3F8UB 1CCZA 4Q74A 3RDTA 1KJ3H 4MQTB 2DYPA 2VKXA 3QQNA 4U05A 5F3HA 5I17B 3BHBA 15C8L 4S1RH 1D6EA 5FYLD 1J5OL 2ZUWA 3ECBB 2I07A 4YK4C 2IGFL 4M7JL 3GRWA 3IXAA 4WW2C 2GT9B 3F7QA 3NTCL 4POYA 5CZKA 4XCCL 5HI4C 5E56A 2EH7H 3MMEB 1M71B 1MFDL 3MLYL 4JFDB 2EIBA 1INEL 5CJQH 4BQ8A 5FAAA 3H9HB 5CIPA 4OZFG 3Q2CA 4XTRC 2ORBL 2BSED 1P6FA 2R4RL 3G6DH 4D2NA 1GGTA 1ED3A 1QLEH 4HPYL 1WFOA 4HH8A 4JRXB 4LAQH 1F6FB 1I1FB 3MRMA 5CLWA 1EUTA 5I1GL 4LFHD 1WCBB 5JORA 4OZHA 1CL7I 2VWEC 4WFHE 4Y2OA 5J12C 1KCVH 1JCKA 1B0GB 1XZ0B 1XH3B 5EG6C 5LGHL 5HHOB 4U1MA 5I71B 4YXLH 2C4XA 4X0KA 2CLZB 5IHUL 1MRFH 5HDLA 5DMIH 3CZJA 1MAJA 2PO6C 4O5LL 2CK0L 1CGUA 2ED7A 4K55A 2ILLA 4XHJC 5JXEC 5BS0E 4OCWH 1KJVB 1JF1A 1HH9B 1PZ5B 5FDWB 2A1WH 4DAGH 5JHDE 1MFEH 4HS3A 4XC1L 4OGAD 1T03L 3GSUB 3LKNA 3ARGB 1T83C 4JLRB 2QHRH 5KANG 4RAVA 3AM8C 4JDVB 4FZEH 1WV7T 3BEVB 1JPTH 5J56B 3VXUD 4OGYL 1K8DB 1U8IA 1WAAF 4LEOB 2JK5B 4NWTL 5AAMA 2Z8RA 2CD0A 4YGVB 2V5MA 4GAFB 4Y19E 3MOBL 4GBXD 3TN0C 4QXGH 4MXQC 3GSVA 1S9XA 2B0SH 4G43B 4D9LH 1VEPA 5I1LA 3DX7B 5DVLA 4RISL 1YEKH 4LHJB 2MTPA 1AKJB 1WBYA 5C0CB 4P57B 1CGWA 4QTIL 1FNEA 5JQHC 1OQOA 1YMMA 5C2BH 2DWDB 3MRDA 1U8PB 5DUMH 5SX4H 2DDQH 1F5WA 1JHKH 1OAUL 2APFA 4PRAB 4MJ5A 4HC1L 3WCYA 4KUCF 4LSUH 4PJFF 3SE9H 3QDGE 5DA0B 3DV6B 4WWKD 5ESVA 5HGDA 1DUYB 1DLHB 1E27A 2QSQA 5DJAB 2P1YA 4WI2A 1UM5L 2W9EL 5F1IA 4EDXA 3QJFA 4MQXD 5EBLB 2XG4A 1RJYB 4X8XA 5MI0B 3ULUC 2FYYA 4Y7MA 2YSSB 3T2NL 5GRUH 3VXUE 2WZPD 2X40A 2C26A 4LSSL 5IB5B 1TQCB 2V17L 4WW1A 3NCMA 4N5EC 3TN0B 2I5YL 5E2UL 4TUJB 4HF5L 5E9DB 3VFSA 1TQBB 3W9EA 3RHWK 3NN8A 1IARB 1H5BB 5GGVH 5I74C 1A2YA 1ZWIB 2A9NH 1AE6L 3EBAA 4I0CC 4XCFH 2XZQH 1IAOA 5IW6B 3PF2A 4KV5F 4HH9A 4BM7A 3CLFH 3QIWB 1IM9D 5GS1B 2A73B 4WNQB 1FNEB 1S7TB 5JXAH 2Q7NA 4K3DL 2IBZY 4GQ9H 1W72A 1F2XK 1XGPA 1XIWA 3QHZH 1OP5K 1UB5A 3GJFB 4P3WA 1HQ4A 2AP2A 5F1NB 2VIRA 3CLEL 3QUYB 4JN1H 4H8WH 4Q9CA 3BN9D 1ES0B 1X5XA 5GQBA 3N1PC 3D0VB 3T0BA 3FRUB 3TO4C 1U8JA 2WBWB 3OKOA 2DI8A 3KJ6H 2ICWJ 1JK8B 3O2DA 1CGSL 2I27N 3VDCA 1A6VH 4RZCB 5AUMA 3S3PA 1QYGL 5IFHH 3F5WB 4Z5RB 2NY5C 2RHEA 5DURD 3DO7B 1FH5H 1I7TB 3RTQD 4ZFZB 1Q9OA 4HJ0D 1JF6A 5E8OA 3ULUF 1EAPA 1Y6KR 5I1CH 4ISVB 3WD5L 3MSPA 4EI5D 1MCOH 1T66C 3MBXH 3QIWC 4Z7OE 4PGBB 3UTQB 5E2VH 3QIBB 3M17A 1A9BA 1UA6L 5D5MF 1MSPA 4OLVH 1YEIH 3HI1B 1IQWH 3WN5B 2IQ9L 3NFNA 2J3SA 1MCWM 2VL5A 1KPVA 3DRQA 1JPFB 4CL7A 4P4KC 1AXSA 4LCUA 1OGAA 4Y4FA 1MAKA 2VL4A 2D7MA 2HH0H 4M3KB 4QXWA 1HE7A 3SQOL 3V4PH 1FVEA 4I77L 1EZVX 4KGLA 32C2A 4KDTA 3THML 5JZ7C 4RNRA 3EOYG 2P5ED 4AEHL 3QDJE 4J4PD 3LS4H 1QO3A 3S34L 3UMTA 4P2OB 5IGXH 3FZUC 2VDLL 2AXGA 2HWZL 4ZPTA 4HGKC 1A6TB 2FGZA 3GSOA 5GRXG 3CUPB 2C9AA 4A2MA 4KK5D 1TPXB 4FQXB 5C0BE 1JWSB 1BIHA 5A3ID 4M5YH 3D39A 4UTBL 4NM8H 3UJTH 3PWNA 2I9TB 3HCVB 2OK0L 2NTFB 4GMSL 4P23B 1U6AH 5KTEL 1CICD 3DETC 1BJ8A 4PS4L 4GO6B 4OI7A 3ARPA 1XGYL 4QRUB 4M43H 4K9EH 3RDTB 1NBVL 3SDCB 4JZOB 4WTZA 4CADB 1FFOA 1R3LA 4U4BA 2CXGA 1X6LA 4F7PB 3WXVL 1MCDA 1HINL 3FQRB 4EN3C 3C60A 5EUKA 2YN3A 4X6BB 1QRKA 3SKMA 5JOPE 3JWDH 5ECJE 1IGYA 1NH6A 1QACA 2AEPL 1CN4A 3FQXB 3TZVC 3FT4B 3OGCA 4ODUA 4U1IA 1LO3H 4Z7UE 5HDQL 4PJCE 1OP5H 1LD9B 2D0HA 4Z7VB 4PLJC 1AGBA 4I3SH 3GSRA 1WZLA 1XGTA 3KPLA 4XX1G 4ZO8A 4DN3L 1I3GH 1DQDL 4BYHA 1M7DA 4WI9A 3DMMC 4NPYA 1J1OL 5L7XL 1FSKC 2OSLA 5KVGL 1JPSL 3O6FD 2R1YA 3VFPB 4I0PA 1RJZA 2BOBA 2H8PB 4HUVA 5B4MD 4KMTH 2VZ3A 1BFVL 4ZO9A 3O3BA 3ARZA 3O3AB 2HFFA 4JFEA 3LAFA 2VDML 2GJJA 3PV6B 4AT6B 2HFFB 1NLBH 1RULL 5IKCB 3ZHDA 2FJHB 3CX2A 3GJFH 1U91A 2VLJA 2ZUTA 5GGRA 4H1LH 1NAKL 3L9RB 4MCZB 4C58B 4LCCC 3LB6D 4G7VH 1PG7L 1HI6A 5SWSD 3KYOA 1FYTB 4BSVA 5ADOL 4RBPH 2XWBA 5D72L 7FABH 4MD4B 5I9QB 1IEAA 2X1XR 2AABL 2LAAA 3ZDZF 4ODSH 1KBGL 2BVEA 5JDJA 1UACH 1F45A 1Y18A 4P3CH 4TPRH 4P9MH 1NMCC 1UC6A 5L2JA 4OCNC 1CFSA 3EYSL 4HUMB 3IU4L 4ZO6A 1NMBH 4HDIA 2UUDH 2R1XA 2LVEA 3A67L 2Q86A 5ISZA 3FO9B 1IL1B 5A16B 4FHBD 1FLRH 5D5ME 1K5NB 4LSRL 4KZEH 2O5ZL 4YHLH 2GAZA 4I18C 3WIFB 5JLZB 4JJHA 3QQ3B 4R2GC 4PJAF 5DJ6B 3WFCL 1RFDL 5DQDL 1NCCL 1FL3B 2LTQC 2PW2B 1FL3A 2J5LB 1MLBB 2DQUL 3GJFK 3L5WA 5C6TH 2D9CA 3P11H 4FQLH 2XQBL 1B3JA 1U3HB 3RWIA 2GEEA 3MRFB 2R29H 1OY3B 4P23A 5DUPH 4YBQC 4WO4D 5KANI 3CZFB 2PYEB 3DSNA 4EDWL 4O2EB 4JN1L 5T33L 3J8F7 5KSAC 1LHZA 3U0PA 3OZ9H 1JWSA 4FA8A 5JR1L 3BP6B 1GXEA 5IROA 5AG8A 25C8H 4JQIH 3VXNB 3S9DB 5ALBL 3CFEA 4G8IB 2YD5A 3UZVB 5ENWA 3PDOB 1ZLWH 1F8TH 1FO0B 3OR7A 5DRNB 4G9DB 5HHQA 4JY6A 1MNUL 1RHFA 1OARL 1HHIB 3QEUA 2WWKT 1QTYT 2E7CA 4YR6A 1YC8A 3ZDZE 3P30L 1P6AB 3U6RB 1CR9H 1IKFH 5IWLC 3MO1A 3CCHB 1BIIB 1Q38A 3N9GL 1ZGLP 3NCYP 1S7VA 4LPXA 1MIML 4J7RA 4OZFA 3SDDB 4FQ1L 1RHHB 3PL6C 1JNHA 2F54D 2CK2A 3SE4A 4ZODA 2BVQB 5HSFA 3SDAD 1EXUA 3DX8A 4NBYB 5EA0H 1TZIA 3UO1H 1JWMB 3QJHB 2EDKA 4QOKA 4M5ZH 2ZUQB 1A6UH 3MV7E 3BGMB 4KAQL 3B43A 4KHXH 5LXGH 4XXCA 2X4TB 5DO2C 4FFWC 1T1ZA 3TA3A 3K4ZA 3TLRA 1VFOA 2PW1A 4TNWF 1KN2L 5IFJA 1OP9A 3ZO0A 1FFRA 2AGJH 5D7JB 4IRJB 2KZ1B 1ADQH 4U1HA 1OGAB 2VTFA 3KPRA 2VNCA 4GW5A 4X7DC 3FT4A 1UGNA 4ODUB 4U1IB 5D7KD 1D9KB 1YN6A 2CO7B 1IILE 4H88L 4NO0A 1YY8B 3SKMB 4NQSB 1A9BB 2APTA 4U6YA 2FIKB 4K3DH 1F4YL 2Y5TB 4FTVA 5H2BB 3QHZL 3QI9B 3H9ZA 3BZ4B 3C08H 3TBYA 4ONOA 5MERB 4U1GC 5A2LH 3E1F1 1BVKA 1DZBA 4PV9B 4NO2B 3B9KC 1N5AB 5DK2B 3LV3B 1KEGH 3D0LB 1Q1JL 2HH0L 1PFCA 4GRLA 3VA2C 3C2SA 2BSSB 3VXSE 4AMKL 5MEOB 5IF0A 3UAJD 5EU6E 3DARA 5C9JB 1V8HA 2BNUB 2ZUQC 5IBTL 5KZCD 4PJXE 2VQTA 4GRMB 1UM4H 1FNGA 3SY0A 4X80L 3TV3L 3V8OA 1SJHB 3D69B 5TQ0L 4AIXA 1Q0YH 1ND0B 1V7NL 5I2IA 4TULL 3WIIL 5D7JC 1TTGA 3VE0B 3TFKC 4LMQE 1EBPA 3LD8C 5SV4A 4XBGA 3GJFA 4PJBA 5IM7A 1WBXA 4PRHA 1BBDH 1I3GL 1FV1B 2GFBB 1DQMH 3QQ9C 1NKOA 4PGCB 4F7CA 4GG8A 4M43L 2AV1B 4MD5A 4RA3A 4X9HA 3W39B 2CGRH 4G7YH 1LE9B 4UU9A 1OD9A 3C5ZC 4NZJA 2E8YA 1VEOA 3HE7D 2X4SA 3EYQD 2C4FT 2RBLA 3CXHK 2HFTA 4HUXB 5E8EB 5C0GA 2DQTL 4XNQB 1WC7A 3B9KB 2VABA 2DJUA 4GAYA 2CRYA 1B6UA 2BDNH 1S7SB 3WS6A 4MS8C 4QGTA 4Y4HB 4TRPL 5DD6B 1L7IL 3NFSH 4W68A 4WFED 5FHBH 4EVNA 2YWYA 1FGNL 2HN7B 5DDHB 1OAKL 4YXKL 2HJKB 4YDIL 4L1DA 1KEMH 3DRTA 4WFHD 2IADB 2HTKC 4E0RB 4M7KL 4L4TE 5EC2B 1YNLL 2MMXA 3ARYA 4OV5B 5AWNL 4Y19A 5GGTH 3LRGA 3EYSH 3BPLB 4LEXL 3DBXB 3GKZA 2ADJB 4PLKC 3EO0A 3OAZH 1FG9C 3NTCH 3TBVA 1UZ8B 1MCNA 4JHAH 2FEDC 2NY7L 3SCMC 2YPKA 3TZVD 2XTJC 3JZ7A 4NN7C 5IMMA 3BGAA 3RUGE 5BMFL 3LS5L 4C55A 1YEHL 4KRMB 4QHUB 1I8KB 5C8JB 1MCPH 4LLDA 3G6AB 3JXAA 2YMXL 4JZOA 2EC9T 1G84A 1KG0B 1RURL 1NGQL 4MJ5B 1H3XA 1OAYL 3ZL4H 2DTSA 1OM3L 2OL3A 4OF6A 1AQDB 1JGVL 1ZA3A 4QTHB 5FK9B 4YEEA 3ZTJH 1NGPL 3CSYA 4XX1E 3L5XL 4Y4KB 1R3HB 2X4SB 1KCVL 1RZKH 2VLLB 3NZ8B 4JCLA 4X7SL 2CO6B 3PL6D 1B88A 3S37X 4ZFOL 3W5NA 5H35A 3NN8B 1NFDA 4RAUA 4HSQA 4F7EA 4XVUD 2IH1B 5JW5A 4X6DE 4R3SA 1CD0A 5AWNH 5IB5A 3LH2H 1Q72L 2VE6B 2F53B 1KYOJ 1P5VA 1J86A 2ORBH 5EU7E 1XF4A 4MWFB 3SCMB 5IHZA 4HQQH 3UC0H 1NCCH 3CK0L 1PBYA 3VFMB 1NLBL 5J13B 3P3YA 3FN9A 2OBGA 2J8UE 5EH1A 2X4QB 4Y16D 5L9DL 3QHTC 2WV3A 3PQYE 4MZ2A 4TSBL 4X4YB 3QUMH 3QIBA 5IESH 5I30L 1C16B 4KJPD 4NZTH 2ZSWB 4D9QE 3D48R 4GW1A 1CTNA 2LABA 4YFLF 5KOVC 3AMKA 4HFWA 5EZOH 5SX4I 4JGJA 3DYOA 4P3CL 5C0AE 4NFBA 4G6MH 5ICZB 5TDOB 1SY6A 3PWPD 2FECI 5IW3A 1F3RB 5HGGS 2RCSL 5B39B 2IANE 3EYFB 3LKPA 4PR5B 3SKNA 2VUOA 1XIWD 1RZJC 4HC1A 1T2QH 3ALWA 3RVTD 4AK1A 4HFUL 4Z77B 5E00B 5K9QG 4FMFA 1LK3L 1FQ9C 3F58H 4HXBH 1MH5B 3BW9A 4YFDB 3WFCH 1MIMH 3O0RH 1OP3K 3RVWD 5F9DC 3RNKB 1S7QB 3RL2B 1KB5H 4ESKA 2FB4H 4PJCB 1S9YA 2YD6A 4TUOA 4Z7UB 3PWLB 4PYHA 4HQQL 4K07A 1SYVA 4RAVB 2QQKH 1P7KA 4J3VA 1WICA 2XZAL 3V6OC 1FC2D 3MBEB 1LO2H 1T6VN 1A0QL 3FQUA 1I7RB 2J4WH 4NRYA 2M1KA 1GPOH 3D3VA 3VFNB 1EXUB 1HZHL 3RWHA 2XA8L 4I3GA 4Y5XC 5BJTA 3L7FA 2FGWH 2FR4B 5I17A 5F3HB 3MOAL 1BZ9A 1UWGL 2YD7A 4NO3B 5F72S 2PXYD 5E2WH 5C70A 1N8ZB 5JUEL 5JIHA 3RWJA 5IEHA 1YNTA 1OWWA 4KQ4L 4OZGB 1DVFB 3RWGA 4X5XB 3OSKA 1AO7B 4XAKD 3RVUC 2G60L 1I9EA 1Q94B 3KR3H 2VLRA 4XBEH 4DOHE 2DQJH 4PLNC 5IJVB 2Z91A 5B3JF 5ID1A 4E41B 3TPKA 3V2AR 5D1QC 2FECL 4ZS6D 1LNUA 1YEGL 4JHBA 5DF0A 1I7ZB 4KDTC 4HXBL 2FEEI 4JFQA 4DFHA 3VXQB 3DHJA 3T3MF 4Z0XB 3BE1H 1UXWB 3EO1A 4CN1A 3VD9A 4XWOD 3WJLA 2G9HA 3VWKA 1M1SA 2GK2A 4TQEH 3T2NH 5DJ8B 1QP1A 4MCYA 4Z6AT 3CLEH 5F6IB 5GISH 4AEFA 4JE4B 1NGWB 2A6JA 4NKOA 4ZFGL 3CH8A 1YEEH 3CFCH 3NPZB 2I07B 3D18A 3X3FL 3T1WA 4G6JH 5HJ3A 2ZPKH 2ED8A 1DEDA 4KKBC 3WIFA 4KY1H 3EHBC 4PJEE 2L0DA 5JO5A 3I84A 3TVMA 2D7PA 4X83A 2YRLA 4LKCA 4XPHH 4PD4J 3ZTJG 1IL1A 3TJHD 4G8GD 2H26A 4XMLH 4XBEL 1BWMA 3QDME 4X7TB 2JJTA 4G7YL 3B4NA 4M4PA 1INDH 3OKYA 3V4UH 2G9HB 3VWKB 5IIEA 1F90H 2UY6A 4R97C 2B2XL 3MV7A 1Q9LA 1A7RL 4KK9C 5EOTA 1C5BH 4Q2ZB 3SGDI 3QH3B 1U3HD 1M7IB 5E6IB 4MB4A 3UBXA 5HI3D 3QCTL 4YO0B 1NUGA 2Z4QB 1WWBX 3HLAA 5J12B 4JO3L 4ZSOB 5IFHL 1JRHL 1H0DA 4X98B 1YUHB 1NDGA 4LLWB 1JTOA 1YNLH 4WVRA 1A7BA 4D0DA 4XHJD 1IRAY 5HI5D 3V0WL 4O9HH 2DL9A 2CH8A 5F3BB 2E7LC 1DQJA 3P9LB 4NZDA 4LLWA 1I3RB 2VLKE 3AREC 5FGSA 5EUOA 3AU1B 4L5FL 4C83B 4MB5A 5D7IA 5ITBL 2V2XB 4XVJL 4P5TC 3ULVF 2CQVA 2GY5A 4K7PX 1M05B 1GGCL 4CW1A 1LD9A 1QOKA 3O9WA 4JM2D 1FPTL 3QULA 2GITB 1HYSD 2AXFB 4YC2B 4GRWB 1X3DA 4H5SA 1S7QA 4LSQH 3RWDB 4QF1A 1E4XL 2DQFA 2UYLA 3EJZC 4X6BA 4ZUVA 5FV1L 3MJ9A 2MQ0A 1SMAA 4N1CA 5FO9A 4Z77A 1P1ZA 3PWVB 4NT6B 5E6IC 1MFAH 5EULV 5KSVB 5IGXL 1Q9KB 2B5IC 3ZDYE 2DAVA 5E24E 4HMEA 3OXSA 1TMCB 2EZ0C 1CDHA 1T3FB 3SBWC 1DL7L 2NXZC 1KFAH 4UAOB 3LIZH 1X5JA 1VDGA 1G7IA 1NGZA 4XCNB 3V8CA 2X9XA 4WWKC 5I0DA 4Z95H 4F2MA 4LNRA 5KBNC 5DMYA 4X9FA 1PAMA 3AREB 2I60L 3DSFH 3GDBA 5IFAL 3RTQB 3D85B 4XPBH 3TBSA 4M03A 1IAIM 3GSOB 1PVHA 4MMZC 5J4MA 1A6TA 1DN0B 1U41A 1U95A 4PRPA 5I1KH 4QEGA 1XR8A 3ZKQD 4RMTA 3VA6A 1UCTA 3GHEH 3V6ZA 1EBAA 4YUEL 3CSGA 4HLJA 1MI5B 4JY5L 1CFTA 5DHVA 2NW2B 5DZNA 1P4IL 1WF5A 4UBDD 1M05A 1GC1C 4LSQL 4YZFE 3VH8B 1PG7H 2XKSA 4P2OC 2QR0B 4NJ9H 5D1QA 3S34H 1CXHA 3ZKSD 2BP3A 1EEZB 3EFFB 3RIAK 3AB0B 3UXFA 3IDGA 1A3RH 4NBXB 5AEAA 1RI8A 4QRRE 4Z7NE 3DVNA 4WI7A 3Q5OA 1IC7L 5D7IE 3MACH 3O45B 2BC4A 4UILL 3SE4C 5DEGA 1QBAA 5TQ2L 4NO3A 1D7FA 3K3QA 5EFIB 3SDXA 4F37F 5CEYA 5IMOB 2EDXA 2V7NB 5KSBB 2DMBA 4OGYH 3RWHB 5BJTB 2H6PA 4G3YL 1W2KT 1FAKT 3LMJL 3SDAA 4OLYH 3RRQA 4HWUA 1FIGH 2PN5A 3BSZL 4WY7L 3OBAA 2MCPL 5AZEH 4Q2ZA 4FABL 4NQEB 5GPRA 2E7MA 1F4WL 2FWOB 5EO9B 1L9MA 1U8JB 2W07A 3QDJA 1JGDB 1RK0A 4M6ML 1LP9E 3MRIA 3B3IB 2XQBH 5C0IA 3PWUB 4L8SB 2DIBA 2Q6WA 1A6ZB 3UBXG 5BOZG 2SEBA 4JY5H 5F9JB 5LJYH 2Z35A 5FEBA 1VFMA 3NCCB 5F88B 1HEZB 4G8FB 3ZYIA 5F97E 5HVFB 3O2WL 1T1YA 5EU5A 3TBWA 3TNNA 4LKCB 1DBJL 2NY4B 3T0AA 4KMQA 3DMMB 1NGYA 5D1XB 5KSAA 3VD3A 4OI9A 4JEGB 5E1HB 3F12B 2CR3A 1MIEH 2H32H 2HJKA 4M93B 3OX8B 3CDGA 4LCWB 3QNZA 3FT3A 3ISWA 4HH9B 4JO1L 5TJWK 1F97A 4CJ1A 3QO1B 3MRRB 1BEYL 3BUTA 4RAHA 3IDIA 1QVOA 2BFVH 2VDMH 4MA8H 2YS4A 4QYOB 5E8PB 1J87A 5E8EA 1RZ7H 4K3JH 3LKQA 4DUVA 5IVXE 1BJMA 4OLYL 1CI5A 2MPAH 4EOWH 1E0OB 2XTJE 5F21B 1LE9A 4A6YA 4OZ4B 1IAIH 3H42H 3Q6FA 5AZ2L 4LKXB 4G9FB 3S4SG 1AJ7H 3VGDA 1R24B 3IJYB 5GGVL 3FAXA 4FXKB 5CSGA 2VXVL 4M61A 5TDPB 5HYSB 3B2UC 2F53A 2IALB 1BZ7A 4PRHD 5D7JD 1FVDA 5IJVA 3C5SB 4KUZH 4K8RL 2EO9A 4QRSA 3W9DB 1HOCA 1ZTXH 4MGXA 3QDHA 1QSED 3FQTA 5HGDB 3TJEL 5FF6A 4JHWH 5CP3A 4S2SA 3DJ9A 4LLQB 5AG9A 4HKXA 3DHMA 1F2QA 2VLLA 4I0PD 4OCMC 2OXGA 3P40A 5MHSD 5I8CA 3NPSC 5C09B 2NX5E 3RWFB 4MNQA 1X6NA 4LPUA 2BSSA 3QCUH 3HE7C 3ZKMD 1WIUA 2HKHH 3H7BB 4QRPD 4L8DB 1JZ3A 2NW3A 1N5AA 1BLNB 2YC1B 3QDGB 4F57L 1I8MA 3B9AA 5HI5C 3ROLB 1CBVL 5I1LB 1NBQA 2WINA 4HK3J 1JZ2A 3H3BC 3LN5B 3VXRA 4U6VH 4OCYH 4XP4L 2J2ZA 3HTLX 2Y5TA 2BSRB 5DD1L 2DTMH 1YDPA 2AK4B 1ZGLM 3O6LH 3EAKA 4U3XA 3MRJB 1HSBB 4Y5VA 1KN2H 1AGDB 1FLTX 3TZVA 1XGUB 3ULSA 5ANMA 1FRGH 3L1OH 4ZS7H 1UM6H 3C2AL 4PRIE 3LKNB 4RFOL 3GSUA 5IW1B 3SOBL 2DLIA 1X7QA 2Y36H 3GSNL 2HAZA 4PV8B 1F58L 1PY4A 3OJVC 2V7HB 1JZ7A 4X5WA 5IBLD 3RJQB 5C0FA 3WEXB 1ODAA 2R2CA 5I16B 3VH8G 5JHLH 3LKRB 3V95A 5LGJB 5E2UH 4CRPA 5B8CC 1UG9A 1PY9A 1IKNA 4MNGA 4OGXL 4UTAL 3HE7B 3V4PL 1AGEA 2FO4B 1BAFL 1MHEA 4ZUWB 3CNKA 4F9PA 3JV6B 1C5BL 5CBEB 1JPST 3MCG1 5CMAA 1O7VA 3GGWA 2XWTA 2OP4L 3N85L 4L29B 2VDKL 5HPMB 4YQXL 5CZVH 3EDEA 1QHOA 1NFIB 1I1FA 4RA0C 1T1WA 3UJIH 1CXIA 5I9QC 2R69L 4AM0A 4IMLA 4OKVA 4N8CL 4K9EC 3EOBA 2BNQB 3CFIC 3BVNA 4N68A 1RUKL 1J0YA 3K8KA 4IRSB 4PJXB 5CGTA 1DBAH 1MJ8L 1J0ZA 5DJ2A 1KEML 5ENWB 1ZT1A 3GMNA 2XWJA 4YXKH 1HHJB 5KG9A 1IAII 3P4MA 4KC3B 2DJ4A 1J1OH 4M1GL 2HFGH 4APQA 5F7UA 4LSRH 4KZEL 1M71A 3K4DA 1DE4B 2A2QT 4JJ5A 4P2YA 5I0ZA 1KGCE 1TITA 4LSTH 1JMXA 3GJEB 4UIMB 5TE6L 3CSYB 2KQNA 3HAEB 1INQA 4KK8C 2PETA 1N6QL 3EUUA 1K4CA 1WWWX 5EO1B 1OB1A 5I15L 4M1CD 5ISZE 5CJ5A 3D0LA 1IKNC 4Q9RH 4WI4A 1BVKB 1I1AD 4PV9A 2Q76B 4CMHC 3ILQD 5DRWB 5ADOH 3EYQC 3WFBL 1Q9WA 4PJGF 1HIMH 2FX8L 4RQQB 2UWEB 3RZCB 1MJ7L 2YUVA 1OM3H 1MCKA 2HYMA 1DBKL 4DKFL 4NQEE 3TT1L 1HDMA 2F58L 4OFYA 1OPGL 3PP3K 3HPJA 3B9DA 3ELAT 2ARJA 2X4UA 2VISB 4M7KH 2IWGA 4P9ML 4XP6L 4Q0XL 5DJ0A 5BO1H 5HHPA 1EFXA 3QFJE 1SBBA 4MMXC 2FEDD 3A6BL 1CF8H 1RUPL 1JI1A 4PRDB 5HY9B 1A6ZA 3U4BL 1MHHA 1XEDA 1IC4H 4RMUA 1IAKB 2L7UA 2Y5EA 4JKPL 3S35L 1GRWA 4HJJH 3LS5H 4E41D 1FC1A 3FB7B 3KPOB 3O3DB 5E5MA 5I18H 3BIKB 1FIGL 5F7DA 4R7NB 4HAFA 4YHOL 1JL8A 2VKWA 5BOPA 1VB9A 5DMKA 4WEBH 4D8PB 2FJHA 5GGSA 4JFDE 3B9KA 4MS8D 5IT2H 5T3ZE 2XY1A 1XCTA 4GLRH 5DUPL 1ZLWK 3FMGH 3IDNA 1S7VB 1S8DA 1RJZB 2H8PA 2YZ8A 3C9NA 1T4KA 4J3SA 2MPAL 4EOWL 2ICWI 4HIIA 1TJHL 4TSBH 1EZVY 5DD0H 1IT9L 2HKFH 2G5RA 2VLME 3R4DA 4JDZB 4KUCD 2VYRE 1KELL 1EHAA 3BAEL 1RZJL 5BV7B 5HHQB 4JY6B 3TCLA 4N1EA 1HXYB 4PJ7B 1DP0A 3VDAA 2D0FA 4Z7NF 4NKDA 3C6SB 2XQYG 2PUQT 3I6LE 2P49B 3CFEB 4G8IA 4NGHH 4Y5VC 4WUUD 4BQ9A 3E0GA 1OAXL 1P4LA 2XTJB 4OTXH 1JGLL 3DX9A 1A7NH 1Y6NR 1T2QL 4LLVA 4WFGE 2BRRH 2D3VA 4NOFA 1RJCA 4AYFA 4HD9A 3S5LG 2ZG2A 3DURB 1UCBH 3T2PA 4X6FB 5KSUA 1UM5H 2W9EH 3V0AC 3F7RA 4M00A 2A9MH 3QUML 4HKZB 1FAIL 1QQDA 4F2MB 2ENSA 2YBRA 1A0QH 5CWSA 2J12B 1CTOA 4P4RB 5JLZA 3BKCH 2DQDL 3L3GA 3OJMB 5CD5C 5ITFB 4ORGB 3ARDC 4F3FB 5T3XH 4HF5H 5I75B 3EOTH 2A6KB 4YE4L 4A6YL 5GZOC 4JAMA 5T3XE 3U2SB 2Q86B 5FO9B 1P4LB 2MCG1 1L7TL 4G9FE 4PGDA 3MJ8B 4YIQB 4N0UA 4RMRA 4PRPD 4UT7H 3H6JA 3HB3D 2PR4L 2R0LH 2DB8A 4IS6A 5D5MB 3Q1SH 3FRPA 4JY4B 2CUIA 4HT1H 2JIXB 2RFXB 1OAXH 1QFWI 4NDMA 4IMLB 4OKVB 3MRLA 5FA4B 4HWZB 3RY4A 3RGVB 1AI1L 4NHUA 5C08D 5C09E 4ZOEA 1N64H 3KYOB 1YEGH 5KN5B 3QEQA 4F57H 2G2RA 5D96B 1MLCB 2EDLA 4FXGA 4U6TA 4Y8DC 1JV5A 3ULVC 4BKLA 3H42L 5AZ2H 1FJ1B 2A6IA 2BSTB 4F15B 5FUOL 1EFQA 3F62A 3L3GB 1E4KC 4G6KH 2D03L 2NY2C 1TVBA 1GAFH 2MHAA 2GJ6E 3DUUB 2E7HA 4G42B 2E7LA 4PYGA 3JTTB 1OAKH 1CG9A 4D0BA 3BQUC 3LKRA 1J9CT 4LPTA 5E8OB 4HGMA 5FA4A 3U9PL 5TQ0H 3NFPA 3QUZD 4ZUUA 3HLAB 3B5TA 2WBKA 3KPRE 4O2CB 3P77B 1G6RL 4J4PC 2LV4A 3QG6A 2OL3H 1FO0A 3OR7B 3CXDH 3QH3A 1DBAL 4Q7DA 2D7TH 2BOCA 3GI9H 3RA7H 5FYJD 1DBML 3KPSD 1ZANL 4U0RC 1KJ2B 4JAMB 5FB8B 1CFQB 2ARJB 2EDQA 2X4UB 3QRGL 5FKAB 3VFRB 4HWBA 5GZND 3E6FB 25C8L 4JQIL 4L4VD 4FFVD 1I9IL 1ZLVH 1L6XA 1FFOB 3SDCA 2JELL 3OKLB 5CBAA 5BS0D 4LLYA 4Z7OF 1LE5B 1YPZB 5F1KC 3IFNL 4FQIH 2BVOA 1T66D 3T2QA 4Q97A 4QHLB 2E3VA 2EZ0D 3D18B 3NFSL 1K4CB 1A02N 4PRBB 4JO4H 3UAJC 2VZOA 5DTFB 4RCAA 5IV2B 2ARWA 3GSWB 4Y4KC 1DR9A 4BZ2H 4TSAH 2A0LC 5LQBH 5D1ZC 2O26U 3QWQB 4FFZH 1XF5A 3GI8L 1B0RB 5CHNB 3BYTA 5A16A 1DLFH 4P46D 5GGSB 2V9QA 4W4NA 4JVPA 1A6WH 2X89A 3IETB 1OW0A 4HDIB 2HVKB 2C3HA 4P2OA 3TO4D 1NCDH 5DK0A 4RGOH 1RUPH 4JM4H 1DQQB 3Q5TA 1UH4A 4NKDB 3NCFB 32C2B 4XMKL 4GG6F 2EH7L 3TESA 5ESQB 4PRPE 1JNJA 1T5WA 5AD0B 4X6DA 4MAYB 4XC3H 3MROA 5DJDA 1NFIA 4OQTL 3DECA 5T1LB 2JJUA 3J7HA 4UQ2B 4OCXL 1L7IH 4P5TA 2WK2A 4XNXH 3BO8B 3IDMA 3LZFL 2Y7QB 1BQHB 4Z18A 3S36H 1HIML 2FX8H 3CFDA 5IKCA 1SEBA 3MC0A 3LEXB 4NJAL 5CZVL 5JIPA 1J8HE 2WUBL 4KQ3L 4OLZL 3C8HA 4EZMA 2DICA 2DM7A 1GC1H 4OUUB 3QO1A 3FMGL 2F5AH 2ZNXA 1RZKL 5L0QC 4NQXB 2D0GA 5BRZE 2FJGB 3GMPA 1EDQA 1BFTA 2Z93A 4N0FB 3VI4E 2NLJB 1KJ3L 3GMRB 3ZTNH 1DQLL 4PV8A 2NTSP 4U7SA 5DHYB 4WCYH 2HRPL 3L5HA 1VACA 2CXKA 5ITBH 5L7XH 1JK8A 3QPQC 5HYQA 1J1XH 1SYVB 5F9WB 5F88A 3WJLC 3GBLA 2EDRA 2VR4A 3E2HB 4XPGH 2IBGA 1IGYB 3LKSB 1S7WB 5EC1B 5E2JA 5HHME 1KB5L 1S78D 1T0NA 2IAND 4KMTL 4X80H 4P5TD 4F37K 3VXPA 5AYUH 3RVVC 3CFBA 3FO0L 4MAYC 5TDNB 1NFKA 4HCRH 3SDYL 3PWPE 3KPQA 1IM9B 1ETZA 1Z0MA 3VXRB 1HWGB 5D2NB 1R5WA 2X1QA 3LKOA 1LO5B 1J88A 3EOAA 4KVCL 2PTUA 1NMAH 2GTWB 4DW2H 1E4WL 4HV8B 2A73A 1MWAL 5MEQA 1FZMB 3I2CH 3O41B 2WUBH 1P2CA 3GBNH 4PUBH 2R9HC 3PWPA 4XVSH 1PSKH 3MX0A 2UZXB 4YK4B 3V5DA 4HBQA 2XICA 2JB5H 1OD7A 4PY7B 1EMTH 5IHLB 4C57C 2CLZA 3PXHA 3WLBA 1J1PH 1KIPB 4HJ0C 1HSAB 1BPVA 1A22B 4HXAL 1FLRL 1ZT1B 2AJXL 3GMNB 4LAJH 1INEH 1IEHA 3SKUD 2C4FU 2ZCHL 1A3LH 5IMLB 3BZFA 1HQRB 3E2HC 4PPTA 3TH3T 2YSSA 4G3YH 2NW2A 3EGSA 2E6QA 3F7VA 1K3ZA 3HZVB 4NQDE 5IP4A 3NACL 5C0RL 1PDKA 4FTVD 4HWNA 4EDXB 3TYGH 3QIUA 1BF8A 2R0KL 2EICA 1GGBH 3W11C 4G9FD 4UZGA 5H35B 2ZCKL 4QWWD 3S96A 3DV6A 4JKWA 5ESVB 5SWSE 5JMOC 3K2UL 5EN2B 4LCWE 3PGDB 3U4AA 1DL7H 5IJKA 2B20A 5TF1H 4NN5B 1AHWC 2DOCA 1U8PA 4XMPL 2EYSB 5IB2A 1V3JA 4I3RH 3KPTA 5D8JH 4HV8A 4IIQB 5C0CA 5ADPL 1KXVC 3RTQC 4QRPA 5DRXB 3U82B 5IMKB 3B9VA 3CXDL 4F33B 1MIEL 4G43A 4HHAA 2EYTA 2ENYA 5EO0A 4S2SB 1KJ2L 4R0LB 3FRUA 2MQCA 3QUYC 4R4FL 2NCMA 3CX5K 1YMHA 3VWJA 1K2DA 4G8GB 4PJEF 1M7XA 4L4TD 43C9B 3OF6D 4NNXB 1UWGH 1KCRH 1KNOA 4GJTB 1MPAH 1T0MB 1JUFB 4Y19B 3TP4A 1UXSB 4PJIE 3TYGL 3DXAD 3I6LD 1JZ6A 1IBGH 4LVHC 1PLGL 1AD0B 1OHQA 1R6VA 2DQHH 4JDTL 4H26A 1BQLH 1DBJH 4EIGB 2DJSA 4LPCA 1KTLB 1I3RA 4O4YL 4AY0A 4YDJB 1QZ1A 3FAWA 2AGJL 3T8XA 1AHWB 4F58H 4XVTL 4WWKA 5I1IH 1ZTXL 1A2YB 3PQYB 1G6RA 4IIQC 4U1MB 4HUXA 5C09D 1QSFD 3KWWB 3VW3H 4NQCE 2NR6D 2NZ9D 4M7ZB 4P5TB 4MAUH 1H0DB 5ALCL 4PJ5A 4PIRF 1OAZH 3W39A 2AV1A 1NUFA 3P73A 5M7QA 4HBCL 3TIEA 5M94B 4R0LC 4MA3A 1R0AH 1EH9A 2JELH 4P4KB 5L2KD 3IJYA 1ORQB 4NSKB 3FTGA 5D6DC 1T80A 1CQKA 1WZKA 4A6YB 4MA7L 4YHPB 3TGXA 3ARWA 2R0WL 1CBVH 3QCVL 5DQ9A 5CINH 4CKVX 2ZOLB 3MRNA 4FS0A 3K0WA 1EO8L 4Y1AA 3S5LB 4Y88A 2D4FA 4XWGH 3RWCA 3LCYA 3GRWL 1H3VA 3IJHB 1VGKB 2GJ6B 1IJ9A 3TJEH 3ARUA 3O8XA 4PRAA 1CE6B 3PHQB 4M93C 5I8EA 4QRPE 3NA9H 5KVEL 3I9GH 5EBWA 2OTPA 4UV4L 4GRLB 3SJVB 2W0PA 5DUBB 5D71L 5DA4A 3B5GA 3WUWB 5EORH 2I60H 1T3FA 4XVJH 1YPZA 2Q8BL 3RDTC 3RVVD 1CICA 3FFCA 5CJOL 4K71B 3VD5A 2F53E 1RZ7L 4K3JL 4FTVB 1JZ8A 3OKMB 3G6DL 5CEZH 2E5EA 5DD3H 3JVGA 4NM4L 3VFRA 1TXKA 4OGXH 2B8OT 5C3TA 2OTWA 4JFFA 4XVUC 5T3ZH 3B3IA 3MRIB 5C0IB 2H32A 5C08B 4NJAH 1UEYA 2ZSVB 3UPAA 2AJSH 4P4KA 4CVUA 1FNHA 1LNUB 1YZZA 4LPYA 3V6OE 2O93L 1TCRA 3MREA 2GHWB 3DIFB 4HULB 4N8VA 1NMAL 4LQ1A 4HG4J 3WHXB 5GS3A 1VPOL 3VFOA 1XR8B 4RBPK 2EDTA 1R3IL 1TZIB 3AFLA 1AIFA 2JJVA 4K2UL 4KI5F 1I8LA 1ZHLB 1GOFA 1YUHA 2RQ8A 1S9VB 3L7FB 4DAGL 5DK3A 2FR4A 2AJZB 2HG5A 4OAWA 2Q8AH 5ERWA 1OSPL 3SGEI 2EECA 3O6ML 3IF1A 4FABH 4LCYA 2Z8WC 4QO1A 2IQ9H 2D4DA 5FIEA 4PLKD 1JUFA 1OWRM 4NDMB 3QG7H 1YEJH 2P5EA 3C6LD 3CH1A 3PABB 1QR1A 4PTTB 3NZHL 4YHZH 1IGCL 5CCKL 4KVNH 3S7GA 4DW2L 1K2DB 4NZUL 1GC1L 4EBQH 1QRNA 3ES6A 1ZHBB 1HHHB 3ES6B 2P5EE 1T5XA 4PGZA 2YXFA 2AXFA 2PCPA 2VAAB 3BEWA 3KXFE 5B39G 3WIHA 4HK0A 4TPRL 5B39A 1LQSR 4XPBL 1QSFB 1LO3L 3KLAB 2VC2L 5BZWB 3HRZA 5HI4D 2EDBA 2DDQL 1WAAA 4R2GB 5CWSB 4XC1H 3A6CH 5DUML 2KDGA 3S6CA 3G5VB 4JB9L 4HC1H 3AU1A 5CZXC 3WFEH 4QRQA 4C83A 1ZE3C 3C8KB 2WIMA 4OIAA 3U0WL 1SY6L 1HYRC 1FL5A 4PRNA 3BSZH 3DURA 3GSNB 5DSCB 3X3GH 4WGWB 1NC2B 2Q8AL 4YHOH 1MUJA 1QBLH 3O6MH 1NDGB 4PB9L 2B0SL 4H5SB 3M8OL 4JM2A 4X99B 4NC1E 4U3HA 3GFUA 1AP2A 3DUSA 5MENB 3MCKA 3HR5B 2V17H 3JTSB 4KI1A 1XT5A 3MLVL 4C4KT 1LDPH 1G9ML 4JVUA 2VH5L 3SDXF 1IM3B 2DMCA 3CVIH 1U8KB 4NC0B 5FUZH 2H32B 5C08A 1V3LA 2DS4A 4PJAA 3QEQD 4BSVB 5K9KA 1IC4L 4HIIB 3OTTA 4QXTB 4UNUA 1S9KC 4X7TA 4B53A 1DCLA 4KDWA 3STBA 5FYKE 2DWEB 3QEGL 3U7AA 1IC1A 3M1BB 3EHBD 3RIFK 3HC0B 1CICB 4PJHF 1AO7E 1CYGA 2QL1A 5DFVD 1X5FA 1OARH 4ODHL 4HGWB 3RDTD 1BFVH 3S4SB 3MLRH 4G80B 5HGBA 2BHYA 5KSBE 3MZTA 5ALCH 5C0RH 5KS9B 5C0NC 4ELMB 2G75B 4ZTOH 1R0AL 3GIZH 4ZXBD 4CMMB 2IFGA 3HI6H 3IJHA 1MJ7H 1A47A 1KNOB 5ANME 1NGWA 2A38A 1VEMA 4JFZL 4HAGA 4GXUM 4BH8B 4IRJC 4Z7VA 1ZT4B 3B2VL 1F02I 1TNNA 5CJ8A 5HD8C 3G9VA 3LKSA 5EC1A 1YQVL 4S1QH 2ADIA 1D9KC 4V1DA 3RBSA 3F6IA 5HHXL 2VISA 4I3RL 3SE3C 4PJ8D 1GGIH 4OM1L 4XWGL 4XNYH 3SDAC 3ZYJA 4QNPF 5JO5B 3ARBD 3ARDA 5JDSA 3L3DB 1TVHB 2NY1D 4I18B 2C3VB 4IBLT 2ESVE 3WBDA 2Z93B 1GYAA 1XGQA 1MNUH 8FABB 2YK1H 5MHSE 2NXYB 5B8CB 1AGFB 5EORL 1AR1D 1N2RB 2VDPH 2NR6C 2Z31C 4DQOL 4OLVL 4EQ3A 3WNOA 5JPNB 2VLKB 3GB7A 1PYWA 1ULVA 3C08L 3PWNB 1RJLA 4XPTL 5F7MC 2JCCF 2NNAB 5IOPA 5I19L 5CS7A 1ZSDB 4YQXH 4DGYH 5BVPL 5KAQG 5I1AB 3BPCB 3QQ9D 5F8RC 1R3KB 3QAZC 5JW3H 3WE6B 1WEJL 4X6DB 5FM5M 1V5JA 5LKNA 3K7UA 2BVPB 1A1NA 1UJ3B 5D7IF 4ZAKC 1RUQH 5EZJA 2HT2C 3V52L 1S9YB 4TUOB 1AGCB 4WO4C 5DK0B 5I73B 4EI6B 4ZYKB 5HHXH 2C3GA 3L7EA 1LK2A 1HSAA 4ODVH 3GGWB 4PD4K 5EO0B 1PX4A 1NC4B 4AH2B 5ESAA 4PY7A 5BW7C 3DX6B 4DCQB 5DHXB 4DKAA 5A2JH 5B4MC 1R3HA 1DBMH 3ZT7A 1EHLH 1AO7D 4Y1AE 2NXYC 5JHDD 4GXUN 1XR9A 3BT2L 3OG6B 3LQAL 4GSDH 4ETYA 4JPKH 1J8KA 2P46B 2F54B 2OL3B 5T5FL 4YX2H