3STLA

Kcsa potassium channel mutant y82c with cadmium bound
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2011-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3stlA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3stlA02
3LCYA 2V7NB 4KRNA 2OQJB 4UOJA 2JCCF 3EKCA 1UADC 1A7RH 4R4ND 3K4DA 4EXKA 3WIFA 3RDTD 2MTPA 5IJVB 1LDPH 5TE6H 1I1AB 3V7AE 2R2EA 3W82A 2D7OA 1VPOL 1TJHL 1CICA 3BESR 1I1FA 2IQ9H 4IRJC 5T3XL 3UMTA 1R3KA 4I18B 1IEBA 3OXSA 5GGSA 1ZANL 5F3BA 3C5ZD 5L7XH 5I1AB 1ZLVK 1KCRH 1SEBA 1CZ8H 3MLRH 4CU7A 3T2NL 3GSUB 1NGYA 5LBSH 2B0SH 2AK4A 4Y89A 2NY7H 3ARZA 5IJKC 5MERA 2EDWA 3RKPA 1WC7A 4P4RB 3LIZH 3X11B 5D6DA 2JB5H 1VSCA 1MCHA 2CKBH 4POZD 3ZHDA 1PKQB 5CJXA 1UXWB 2X1XR 2VZUA 5FHAH 1MCEA 3F7VB 1TMCB 2AJVH 1MHPH 4LMQE 4JR9L 4LIQL 1MFAL 1DFBL 4ZXBB 4BSJA 5C0IA 3MR9B 3WHE0 2EIZA 3VXSB 1IC4L 5H35B 5E56A 3PGCA 2VXUL 1AO7A 2RCSL 1SY6A 4YUEH 3VA6A 4XAWH 5IWLC 1MRFH 1CVRA 3MACH 4OUUA 3FFCB 4JQXC 3STZB 4YNYA 3IETB 2O61B 2YD5A 5GGVL 1XR8B 3KPLB 4OZHF 4PV9B 5TDNB 4XPFH 1HI6A 3V2AR 3SDDB 3QDJE 5GSRA 5E99H 1IGCL 4TOYL 1AE6L 2DMCA 3SBWA 3GM8A 5F7EH 1N3NB 3NIDE 2PXYB 3Q2CA 1BOGA 4LVHB 3RWJA 2HVKB 4R3SA 5K9OA 4I0KA 5TPWH 3VCLA 2CO7B 3QPXH 4NRYB 4G6JH 4M5YL 5I8OL 3KXFA 4M93C 4ZS7L 3MV8B 3GDBA 2ICWA 4P3DB 5L6YL 4X80L 5EO0A 1H8OA 2X09A 3CSYA 4P9HC 2QSTA 1LP9E 3VFOA 1AKJB 3W39B 3B2UD 2ZCHH 3C8HA 4PJFF 2GY5A 4XB8A 3S3SA 1CD8A 4K3HA 1JWUB 1P5VA 1Z9MA 3TPUB 2DWEB 3C09B 3L3GB 4X4ME 1S9WB 4X7DC 2CRZA 4AJ0A 2F58L 4PPTA 4GBXA 1F4YH 4F33A 4LCWA 5C0CD 2BNUA 2EDNA 3FO9B 3B9KC 3WEXB 4PJBE 4PJCE 2DIBA 4U6YA 3AREB 4ALAH 3QA3A 3QI9C 5DRXA 4F57L 1ZT4B 3NIFE 4HFWA 3HR5B 1TJGH 2UZYB 5GS2D 3BGMA 1T1XB 4N0FA 2Z91A 1CDHA 3T4AA 2KH2B 2D03L 3O8XB 4NJ9L 1JHLH 1IGYA 1BQHA 1YY9D 3UBXG 3L7EB 1XF2B 1U3HB 4X6EB 3SKMB 4LCWD 5C0CA 4N8VG 1VFAB 2F74A 4IJ3C 5D7LD 1YA5A 1VB9A 3I6KA 4JRYE 1R5VB 4ODHL 3IJSB 4PGJA 3BX7C 5IMMB 2EXWD 3WO4B 4YQXL 1JYWA 3ULUF 1CXLA 5EBMB 1LDSA 4QNPE 3KYNB 1WZ1L 3MO1A 4OD1L 1FNHA 1ZA3A 3H0TA 5JXED 3VGAC 5FYKU 2IBZX 5TF1L 3L5WA 4NRZB 3RPIB 3RL2A 5CD5C 5I1JH 1U8KB 5B22A 1LEGB 2NXYB 3QUKA 3GMRA 1UM5H 4PJIB 4ZNCD 2X7LB 1HE7A 5HYEA 4LVNC 5CEZD 2DI7A 4NQEE 5DEFB 1MWAL 2A83A 4JRYB 1WIPA 3PQYE 3HC0B 5J89A 4TSBL 1AR2A 2FEEL 2E3VA 2V9RA 4NWTL 4X7SL 2D7NA 1JHKH 5I1DB 4P2OA 3NTCH 3H7LA 2AJYL 3LQZA 1B6DA 2Z93B 4JFZL 5J13C 1BEYL 2WINA 1UFUA 1CBVL 4N8PA 3BW9A 1ADQA 3ZSTA 3E8UL 3QUYA 5F9DC 1JIBA 4LF3B 3HZYB 4RGNC 3BGAA 1AO7D 4G6KL 3PGDA 1Q9KA 3K8LA 1D5XA 4JFZH 4N8CL 4Y1AA 2FWOA 3U6RA 2X42A 2HTLD 4MXQD 3R1GH 2HFGH 1NC4A 1FBIH 3LKOA 5J6HB 3DGGA 2ZUTA 3MV7E 3QUXA 3BOVA 5HI5D 3CFJB 3QO1B 1I9RH 5ESAB 2O5XH 2DI9A 5CUSH 4DGYH 2FIKA 3O6KL 4PJBA 4WU5A 5I6XC 5I30L 4O9HL 4Q2ZA 4IHOA 3FRUA 2D31B 4XNQA 5F9WC 1QP1A 1T83C 4MNGE 1RY7B 3TVMC 2DKSA 5DR5L 3VFGL 3B8YA 4OD2B 3WN5C 1NBYB 4F3FB 1T1ZB 3MV8E 2IH3A 1JZ5A 5TE4H 3GI9H 1K8DA 4LLUA 3QCUH 4ELMA 2FHFA 1MRDL 2FD6H 2OYPA 3UTTB 4UTAH 3MJ9H 3FO1A 4Y19E 5LGHH 4OI7A 3OKOA 3QWRA 1JHTA 4NHCH 1QSZA 4QXWA 1TXKA 1YY8A 3C5ZA 4XPHH 3X13B 2FEEI 4XGZA 1V3MA 3RVWC 5SWSD 3OKYA 5CJQL 4EUPA 3BAEH 2ADIA 1VDGA 2R4RL 3BO8A 3RNKB 4L3EA 3UO1H 3PHOA 5T3ZH 3QCVH 4LEOA 4L8SB 4LKCB 3PP4H 4JZNA 3SO3B 4NWUH 5H37H 3SE4C 1IM9A 1A47A 3QEHB 3CFEA 4F8QA 2BOBB 3WD5L 5CBEA 1CL7I 1N26A 3NZ8B 3TT3L 4YBHA 3G9VA 1YQVH 2BNQB 2UWEB 5ANMA 4TRPL 1OGAA 3BN9D 1HOCB 1ZLSL 3NZHL 4LDEB 4ZNEE 1JF1B 5EO9A 1S7VB 5GIRB 3GI8L 4E5XB 3WS3B 3RI5K 1O5DT 3L3KB 4JPVH 1Q1JL 2AAVA 4J1UB 4XCNB 5ESQA 2DL9A 4TULH 4AH2B 3OKDB 3CLEH 4GW4A 3GSNL 2ZUVA 1I3GH 4RISL 3V5KB 1FH5H 4OZIE 1I7TB 3MLZH 4N1HB 5B21A 1KXVC 3OB0H 3RAJH 3KG5A 1NAML 3CD4A 4PD4J 4HEME 4APQB 1I7RA 1NMAL 4N5EC 1FO0A 1WQVT 1LEKA 1MFEH 5KS9F 3D39E 4EI6B 4YAQA 3SDCD 5TFSL 1JGLH 2IPKB 1C16A 2QADD 1KCVH 5F7MC 4KJWD 5D9SA 1FGVL 4ZQKA 1S5IH 1FZJB 4D0CB 3DXAA 2F54A 2QQKL 4WV1B 4MS8D 5IT2H 9CGTA 5C08B 1N7ML 5CSZA 1BLNB 1QSEA 5HGAB 3TBTA 3WDHA 1X7QB 2YPLB 2ZUYA 4E42B 1BIIB 2CDFB 5JXEA 1JNLH 2ZJSH 5KS9A 2JIXB 2LV4A 4ZUWA 1PQZA 2ZPKL 1RJLA 1HSAB 3JUZA 1IE5A 3RWFB 3ARBA 4MAYB 1ZLVH 1S8DB 2FH6A 4UIKH 2EC9U 5KJRH 2WWMD 4OQ1A 3C6LD 3U1SL 5J12B 3QQ3B 1I3UA 3T3ME 4LBEA 1AGBB 2FO4B 4R9HA 2FGZA 3WIHL 1UQSB 5I0ZA 5E00A 3FOLB 2BC4B 4PJIF 4Y4KB 3FFCE 5D5MA 3FQUA 3MX0A 5I1KH 4RRPA 5C07B 3V95A 5I17B 2HT2C 5IMKB 1ROWA 5BVPL 4U6VH 2WIIA 3S37L 3OB0K 5EC2B 3AS3A 2HRLA 2OSLA 3V9FA 4C56B 4JFFB 1CLYH 3T0VA 3UJTL 3VXSE 3OBAA 3BEVB 5F71A 3O2DA 1RZJC 5IFJA 2CDGB 1OAXL 5F6IB 2F58H 1FVDA 2LE9A 3O6FB 5FXCH 1U3HD 2HLAB 1A7OH 1QEWA 5D7JD 3S3PA 2B4CC 3VWKC 4LPXA 4LPWA 5DQJA 1H8NA 4AG4L 5T3ZL 1TZIA 5FKAB 4IMLA 2FYYB 1NAMA 1NC2B 1KB5L 2Q76B 1BQLH 3CNKA 3QIBA 5K9JL 4Z7VA 2PKDA 4NQDA 4UV7H 1SBBA 3EYSH 1PDKA 1UENA 4YBQC 5IIEA 1J5OH 1QVOB 2ARWA 12E8H 1T20B 3KAAA 5EU7C 4GG6E 3SKNA 3H8NA 5DMGC 1OF2A 1IAOB 1MH5A 4ZO8A 1XT5A 4IM8A 4OLYL 1A64A 4FXKB 4D9LH 5DXWA 4DFHA 4S2SB 4OZGB 3JWOH 3SN6N 3QEQA 1EXUA 1C12B 1QG3A 1N4XH 4M6NH 4YZFF 4DKFL 1K4CB 4BZ2L 1CFTB 1WSST 3C9NB 5A1AA 4FXGB 2NTFB 2BVPA 4IIQB 4K9EH 4XVJL 3QDME 1QFWL 3MRLB 2XTLA 2GITA 1FL6A 3TESA 5D1QD 4YHLL 1MJJA 43CAA 3OHXB 3C09C 3X3FL 4APQD 1JBJA 1TCRA 1OB1A 4JY6B 2CXKA 2YXMA 4LVEA 3D18B 3RU8H 4PJ9A 3HZKA 1EHXA 2HN7A 1YN7A 5ERWB 5CHNA 3HKFA 1HQRA 2N4IA 4JJHA 5T1KA 1EHAA 1OSZA 4U1LB 1W72H 4HBQA 2LU7A 1YPZB 2Y5EA 2B8OT 3U4BH 4ODVL 3GHEH 3NIGE 5J11B 3L7FA 1P6FA 2DYPA 3BD4A 5IW1A 1CF8L 1G0XA 2YUVA 3MRDA 1FNLA 2VITB 5JDSB 4PRHE 4DJMA 3QPQD 5FECA 4JDVB 3VXPB 5L9DL 4BFBD 4FQJL 3MRQA 4OV5A 4E41A 1OT1A 6CGTA 4QRPB 5F7EL 3EYVB 2P8LB 2XWBA 3L1OH 2HFFB 5GJSH 1FYTE 5DC0A 1V7MH 1KBGL 1FYTD 4EUPH 4DUWA 4ZXBC 3QZWG 2OR9H 3QWQB 3FL7A 5DS8B 1WCBA 4QO1A 4Y5XC 5CEZL 5KAQG 5T3XD 5J3HD 1NFDE 5I19L 1SHMA 1NMBL 1NBZB 1ZHBB 2W9EH 3BDBA 3RY6C 3UTZB 3VFTA 4L4TB 1S3KL 2Q8BH 4HD9A 1RV6X 4MD0A 2J8UE 2NY2D 1U3JA 3KJ6H 4JFED 1R0AL 4M61A 1T80A 5GS1A 1BQLL 3DVNA 4I48B 1T0MA 2ESVB 4FN0A 5EZIL 4BQCA 4MD4B 1E4KA 2ATKB 4Z95L 1CGWA 1EIBA 2WW8A 1OP9A 4R6UA 1S7RA 5DTFB 1L9NA 3V4PL 3VRLE 4PYHA 1QRKA 1FLRL 2I60L 3G5ZA 4OCSL 5ITFA 4NC1E 3VWJD 4OFPA 1G7LA 1R5WB 2YMXL 2NR6C 5I9QB 3BKYH 4QXGL 3L95A 1RZIA 4HLJA 5EIQA 2XZCL 4OLYH 1KLGA 3G6JE 3SY0A 3EYSL 1UWGH 4OBRA 2IALA 3D2UB 2XV6B 5DK3A 3DTXA 4WNQA 1DJSA 2A6IA 1TTUA 3HUJF 5B4MD 1UXSA 2ZOLA 3IJYA 4MHHG 4ONOA 3QXDB 4J3UA 1F2QA 1T0NA 5JNYA 4X98B 5E8OB 3TO4B 3SGKC 5HHNB 3O2DL 3QP3A 1MOEA 3RVVD 1NCBH 4FQIL 5I1LB 2Q86A 5D7KE 1RJZA 1YMMB 4GRLB 3RGVA 5BQ7A 3QDGB 5GJTL 3PWUA 3RTQD 3GJEB 4DN3H 4ZFOA 2DQFA 4R2GD 1NUDA 1U8PA 5ALBL 2FBOJ 3MRRA 3F6IA 3S88H 3WLBA 1GHFL 1CD0A 1OTTC 3LKQB 4ODXB 1KELL 3SE8H 1U58A 3GSVA 5TFSH 4ZUSB 3GK8L 1I4FB 1S5IL 2ITDA 2VYRE 5JQHC 4XBPA 4WUUE 5D7IA 2CXGA 4OQTA 3O3EA 3KPSD 4YDKL 3HI5L 1LK3L 5D2NB 2GT9A 4P46D 3HFML 3BZEA 4P59L 2R2EB 4BYHA 3FTGB 3FT4A 5FUOH 3VFVA 4JM2C 1EJ6A 5JIKA 3RJQB 1A2YB 2ZJSL 1DQDH 1O7SA 2IAND 5E8EB 3WHXB 4O5LH 4PGCA 1I7ZB 1JNHA 4Y5YC 4FABL 3P4OB 1OTTD 3PV6B 2VZ1A 5IBUB 1G7PA 2UYLB 5IVXA 3RVTC 1UACL 4DOHB 5IT2L 1V3KA 1AC6A 2C7UB 4U49A 1P7HL 3BZDA 3PG2A 4BKLB 4U1HB 1NGYB 1FJ1A 4RNRB 1A6UL 1JYVA 4N0UB 2WSKA 1QRNB 2AEWA 2DJSA 4NUJA 2XPGA 3IDXL 3H7BA 2AV1A 5DC4B 3X11A 3UTSD 2LABA 1NCNA 3UTSE 1RZJH 1KPVA 4HFUL 2IAMD 1MI5D 1XGUB 1WBYB 1A1OB 3TV3H 4Z7QF 1NUNB 4P2CG 2X89D 2FGWL 4MB4A 5CEYA 3T1WA 5DUPL 3SE3C 2XNAB 1ORQB 2YA1A 3CX5K 3ARQA 3MR9A 4X9HA 3C8KB 4WV1C 1MPAL 5IWLA 3QI9D 3BMVA 2HJLB 4PJHB 3L3IA 3MBEB 3IKCA 1X5JA 3FQXB 3S5LA 2V7HB 3GSOB 2WWKT 3T65B 2P5EB 4Z95H 2HJKA 4PV8B 4AEHH 4OFYA 1QLRA 4OCXL 2DLFL 4F2MA 1NCAL 5F3HB 1HI6B 1YDPA 4GKSA 4ODTH 4OD3L 4RGNB 5C6WH 5SX4I 4MB3A 1N3NA 4Y5XA 2AGJH 5IP4A 3VDAA 3QZWA 1BOGB 1Z2KA 1BREA 4PGZA 4NN6B 4UTBH 3S35L 5CFHA 3RUGA 1SY6H 4LSPL 4QXUH 5EN2B 1CR9H 2PTTA 2BP3A 2XZQH 4YIQA 1KB5B 3SDAA 1KTLA 3HCVB 1BFOB 3DV6B 1YEJH 4P3DA 5GGTL 2JTDA 5EO0B 2AKRA 3MQIA 3KPSB 4I5BA 5CBAA 1GVIA 4MNQD 4NRXB 4DGVL 1OPGH 4N68A 1P84J 2XT1B 3QUZB 2FSEB 2MPAH 2JF1A 1A02N 4R2GB 1GC1L 2F53B 3DX9A 4G6MH 1SYSB 4TTDC 1A6PA 3TPUA 3GSRA 1KELH 3Q6GH 1MLCB 1S9WA 4L4VD 4LCIH 5C09E 4PRNA 3SO3C 3IVKA 2LVEA 3IU3B 3NABH 3CPLA 3ZE0E 2ADFL 3MOBH 4P3WA 4EDWL 5DD6A 1D3CA 2P8PB 5E2TH 1CDBA 3RWIB 4KKAC 1OWRM 3V4VL 2FECI 3QA3B 4LL9A 3T2OA 5KVMC 2XACC 1N2RB 1T2XA 2VMFA 2FB4H 2DTML 1OD7A 4WI8A 2D0GA 1TNMA 1YPZE 1AJ7L 5EBLB 1BQHB 2DBJA 5E03A 3RP1A 1LE5B 4UNVA 5ISZE 4R4BB 5LXGH 4WI9A 4POZC 2P43B 4HDIA 3GHEL 1GGYA 3LS4L 3U7WL 2VLRA 4LAJH 1G9MH 1ONQA 3N9GL 5HD8C 2PW1B 1IL1B 2OP4H 3QNYA 5IGXL 2ZSWA 4K7PX 1EA9C 4JFOA 4Q6IA 1JV5A 3HRZB 5SWZB 3ARFA 1D5IL 2BK8A 3CFBB 5KN5A 1H3GA 3AM8C 5EU3A 1ETZA 2AABH 4P5MB 4NRZA 4XCYB 2ICEB 2XA8H 5GRJL 4L4VE 3ABZA 4ZFFB 4XZUA 1KJ3H 2YXFA 3QDMB 4PRID 4PRAA 4L3ED 3SBWC 1S7QB 1NKOA 1WT5A 3CK0L 4XRCA 5FA3A 5GS2H 3NPSC 5KANG 3ZDYF 4DCQA 1IKNA 2NY4C 2J5LC 1E4XH 1JPST 1WZKA 3MRMA 3UJJL 5JHDB 4AZ8A 3CSGA 5BZWB 3IAGC 4HWZB 3HMXH 3QJFB 1L9MA 1T2QL 4OCWL 4JFXA 5DMGD 3MBED 2IFFH 4I77H 1NDGB 3G5YB 4H88H 5L2KB 3IFLH 5MI0B 4OLZL 2DDQL 2EYRB 2V5MA 4JRXE 5F7NC 1Q0YH 3LQAH 1NCAH 5GS0H 3QDAA 3KJ6L 4AT6A 3P0VH 4OCRH 2VLKB 5ADPH 4GW1A 1IEAB 4HSQA 1YYLL 2DKMA 3B83A 5D7JC 3GRWA 3S7GA 3U6RB 1XMWA 3KVQA 3IAQA 4GAGL 5DLMH 3A6CL 1W72B 3DGGB 5C09A 2EDHA 4XTRD 1JI1A 1ZOXA 3S35H 1U41A 3GSXB 3NMEA 4U1IA 1NC4D 5J1SC 1KPUA 4ZPTA 2BNQE 2C3VA 1TVBA 3ALXA 4OLUH 3VH8B 4LPCA 3GMLB 4YX2H 1NLBL 1U9KA 5DFTA 4FMKA 3LKSA 5JIPA 2VR9A 5B39G 2BY0A 5BCAA 3LRGA 5EBWB 3IFNH 3PXJA 1H15B 2YRLA 1T1ZA 5AUMA 2VLLB 1KENL 2IH3B 3B9AA 3MV9D 2GJZB 3VWJA 5FDYA 4KROD 3ROLA 4ELMB 1A21A 4D2NA 1JGUH 1KEMH 3NA9L 2EXYD 3OKOB 3K2UL 4Y4FB 3KDMA 5IFHL 3EYQD 1JHTB 2DD8L 4HXAL 5A43C 4ERSL 1ACYH 3UXFA 5KSBB 4GMSH 4JHAH 3EO0B 4MAUL 4MGXA 1B88A 1JZ6A 3V7MA 2VISB 1YEKH 1F45A 1GZPA 2QQNH 2IWGA 4NKIH 1ZGLB 5EU6D 5D2LB 2APXA 1TTFA 2H2SC 2VLJD 3FRPG 1L7IL 4LEOB 1ZT1B 4LLQA 3L9RB 1DFBH 4ONHA 3QHFH 4XNUL 5L2KE 5FUOL 1UM6L 3SDAC 5MHSD 2R4SH 3JWOC 4I18C 4PLJC 4OLEA 4MQ7A 3VG9B 4F7EA 5T33L 3VRLF 4MX7B 4L3CA 3T0ED 5GHWH 2ZUUA 2IC2A 3S6CA 7FABL 4EDXB 3TJHD 1A6WL 4NQEA 5J9PB 5HYQB 4GXVH 1CVSC 5AD0A 3SPVA 3ARRA 2B7DT 4DQOL 4E5XA 4FQJH 2Z31A 1CDYA 3F7PC 5D8JL 5SWQA 1EO8H 3BFOA 3BPCB 5B8CB 2DWDA 4WO4D 2AXFA 4ZPVA 2PXYC 1MAJA 2NZ9D 2K9UA 1MFBH 4PJAF 43C9B 4YXLH 1UVQB 2QHRH 5KW9H 1KEGH 3MLUL 3W2DH 5EU7E 4PB9L 1BJ1H 4M7JL 1QSFA 5FM4A 4YBQD 4GS7B 3HZMA 4RMSA 4HCRA 1D9KB 1E28B 1F3JA 3HUJE 3UJTH 4A6YL 3LPWA 4FNLH 3I6GA 2DM2A 2EKSA 3EGSB 1INQB 4D0CA 3FB7A 4NM4H 4G6FD 4PD4K 3PWVA 1RZFL 5D1XA 1IZJA 4PJAA 1X7QA 2IPUG 2XIDA 3G6DL 4UNTA 4PRIB 4ZUVB 3OJDB 3LQAL 1T1YB 4I3SH 5DQ9B 1FP5A 4OF0A 4LRNH 4C55A 1V5JA 1BD2E 4MNGA 4WRLA 1FFPB 4PUBL 4P2RD 4U6XB 4N1EA 5HGHA 1IM3B 4QLRA 4OIIL 4OLVL 5C1MB 4ONFH 4R90L 2EH7H 3G08A 3EOTL 3IXAB 2A73A 4XHJC 1NBQA 1I9RL 3CU7A 3C6LC 5DURD 1PEWA 5JOEA 4H25A 3WS6C 3TVMD 4PJXB 1WZMA 5IBLD 2ZOKB 4FZEL 4LOUC 4FQHB 4IRSB 2WIIB 4YGVB 2YK1L 5J1TC 3VG9C 3BI9X 3LN9A 1MFNA 1QBML 2R56L 3EOAA 5ACMA 3UJIH 3ULSB 5IQ7H 3O6FA 3RZCD 3FQRA 3S88L 1VADA 5JOPD 4JG1L 3QO0A 1WK0A 3GIZH 1VEPA 5D7JA 3BH8B 4U3CA 3MRCB 5C0BD 4Y16C 3BDYH 2E6JA 4GRWH 4G3YL 4Y5VB 4KVCH 2R15A 2P49B 1WISA 4NFCA 3HI5H 4HLZH 5DVOA 4UAOB 4PJXE 4GG6F 3WLWD 2PNDA 1CIDA 5AG8A 4ETQA 3OJVC 4X7SH 4L9LB 3SKNB 1U3YA 1FFNA 1LO0H 2ZSVB 4DGIH 5GGRA 3HNTL 4MJIE 4G9DB 4WFFD 5E5MB 3PQYB 4OT1L 1R6VA 5D70L 5DK2B 4PB0L 1C12A 1KJVB 4R7DA 4TQEL 4TNWF 3T04D 2B5IB 3ETBF 5I76A 3RAJL 4AIZB 3RWDA 5D70H 1OAUL 1AR1C 1QLEH 3O11A 4RDQF 1KJMB 1VERA 3IDIA 5E9DE 4JFFE 1HYSC 3ULUH 2H32A 1CDJA 3WUWB 1WFNA 25C8H 4WDIA 2APFA 2BFVL 5HDBF 3TO2B 4IRSD 1UJ3C 2Y6SD 3GMNB 1GPOH 2VOTA 2G9HA 2GEEA 4M62H 5EBGA 2OZ4L 4Y16B 1KUMA 2OCFD 2CO6B 5CHNB 3TNMA 1UWEH 3FB6B 3QCTL 2X1QA 3QG6B 1XGPA 3ARGB 5CILH 5C0DB 5CP3H 3K0WA 1BBDH 3P11L 4WCYH 1A6AB 5J0BA 1J8HB 4LHJB 4HBCL 5BMFH 4QEGA 1EO7A 1NFIB 4V2BA 3QXWA 2FCBA 3BGFB 5I1EH 2C3XA 2DQHH 1Z0MA 1DVFD 1GIGH 4MJID 3VE0B 1U8JB 2FX8H 1J1OL 1RD6A 1XF4B 2D7TH 4YDIH 3DX6B 3MCKA 4QRRE 2HAZA 4PGDB 3LEXA 4XWOD 4ODTL 3QUMA 1SJXA 5HDLA 4FQQA 2A6KA 3E3QE 4O4YH 3CAFA 4OV5B 1JCKA 2A77H 5DJZB 4XVTL 5JPMB 5L9DH 1CFBA 3K74B 3ZMRA 1DE4B 4N8CH 3B2UC 4JFQA 2HFFA 3GI9L 1FC1A 3CSBA 4QRUA 1RZ7L 4RFOL 1CLYL 3V5DA 5JO5B 5E1AA 3EAKA 1WCBB 2ESVD 3MGOB 4L4JA 4NN5B 4PJGB 5I71C 5F9OH 3VFPA 1VFOA 4UIMB 3BJ91 3N85H 2HTLC 4LU5L 2VDPH 1RZ8A 1HHIA 2X9WA 2B4CH 3F58L 4M6MH 4UOW0 2VR4A 4Y88A 3SDXB 4MD0B 4RGMC 2HJFA 1H3PH 3VFUA 4H1LG 3UYRL 1FL5A 3L5JA 4NQDE 2J7LA 4UILL 2HKHL 4HJGB 3KPNA 1MJ7L 3O6ML 1A7PH 1EGJL 2EDOA 4EBQH 5DTFA 1K4DB 2OI9C 4JE4B 3LS5H 4KVNH 2W0LA 1F6LL 3CJJA 2AJ3A 5C0CE 3KNBA 1DBBL 4CMMA 5I71B 2FR4B 4Z5RB 5IESL 1N5YH 2EECA 4D9QE 4DUVA 4M5ZH 4Q97A 2MNUA 2WQ8A 2VDNL 3PL6A 4BZ2H 1X5LA 4GG8A 3HAEB 2IALB 3D2UA 4NYLA 4YO0B 4HS6A 2XXMB 4X6CA 4R2GC 3DTXB 1C1EH 2A6IB 2W9LA 3SDYH 4XPBH 3PP3H 3FO2A 2X4QA 3P73B 1BVKB 1SBSH 3DI3B 3S9DB 1T0NB 3I02B 4NM8H 3X17A 4NP4L 1MHHB 3VRIB 4NGHH 1RK1B 1DQJA 1UH3A 3ZE0F 5JW4Q 4HMCA 4PFEA 1MY7A 3CCHB 1KIRB 4XNMA 4NP4H 4XNXH 5J1AA 4OFDA 5DA0B 1QHOA 5DVMA 2VLKE 3BDXA 4Y4HB 1MFEL 5E70A 4LIQH 3BHBB 1J1XH 2EH8L 2CK0H 5KVEL 3FMGL 4GT7A 4RGOL 1FGVH 5IG7B 2VLRE 3EYUL 5C0AA 3DNKA 4TTGA 5C0RH 4ZUSA 3THML 5IB2A 2C1PA 2VDRH 3MRNA 2EE9A 3GBML 1UA6H 3WJLA 3I6LD 4R4NC 4QGYA 5HPOA 4KZEH 4TSAL 3I2CL 1F42A 2XWJB 5J6GA 3X14A 4WW1B 1T5WB 4KTDL 4P4KD 5E8NB 1RJCA 2XKNA 3H2WA 2NMSA 2EIDA 3BKYL 4DVRH 4JKPL 3P0YH 5JXAL 2I07A 1RZFH 2I9TB 1MRDH 1UJ3A 1CDIA 1RZKC 5E2VL 2X44D 4AENB 1LE9B 5L6YH 4DEPC 2ATPB 4HKZB 4JZJA 4ZS7H 4NUJB 5FIEA 5FYKD 3D69A 5E8PA 5F7LB 4ZXBD 2CD0A 2IFFL 1AQKH 1WF5A 1R0AH 3B5TA 4I2XB 4OGAD 2GK0A 2VO5A 5DJ8B 3C60B 4Y19D 4OTXH 3B3IB 3EYFB 4R4FL 3GSWA 2FJHA 3DV4B 4PG2A 1JPFA 5GZOC 4UT7H 1UZ6E 2XNAA 1G7JA 3MV9E 4DKAA 3MUHL 3HE7A 3HPJA 3O4OC 2Y06L 3I9GL 1K3ZA 1XAUA 3VXTA 4HC1A 5KSUB 4ZUUB 1MVUA 1E27A 4XX1G 4HHAB 2QQNL 4RSVA 2QR0A 4UNUA 3FQXA 3QXAB 3S5LB 5FYKL 2OK0L 4MLIA 1HNGA 1WTGT 1DL7L 1J10A 4XC1H 5IQ9B 4LPVA 1ORSA 5KVDL 1D5ZA 2F53E 4R26L 3HS0A 1NJ9B 1I8LC 4R0LA 2Y1VA 2HFEB 3BIKA 1T83A 2R2CA 2R4SL 4PTUA 3HNTH 5TGBB 5IESH 2B5IC 2AK4E 1BJ1J 3QEGL 4LPTA 3QUML 1BBJB 1ZT7B 1YNLH 1D5BB 1Z9SA 1FL3B 3KYMB 2GK2A 2EC8A 4F58H 1J7VR 4ERSH 2EEBA 4YIQB 4IRZL 4WI5A 4GJTB 3E6HB 5SWZD 3HCVA 2DM4A 2QEJA 1MJUL 3UYPA 5HI4D 3PDGA 3QWOA 4KMTL 1CZ8L 3CDGB 2XTJD 3QFDA 3RWEA 5I1JL 1KT2A 4KFZC 2D7PA 5BVJB 4BA8A 2R1WA 3ESVF 5EO1A 2W9DH 2B0SL 4NN5C 3DX9B 1R5IA 1GC1H 3LQAC 4RZCB 1UWXK 1OLLA 4H1LH 4MCYA 1VKXA 4X4ZA 5D7IE 1N5AA 1JJUA 4L5FH 1UYWL 3KLHC 3LKNA 5I16A 2ZG3A 5F97E 1U0QA 4JO3H 3D9AL 3NIDF 1IAKB 4X5WB 4K7PL 1OW0C 3MBXL 2WK2A 3IYLW 3ECBB 2EDYA 3ULVE 3MYZA 1EVUA 5H94A 5IVXE 1U8OA 1N2RA 1RUQL 4KKLD 4XP9H 5LCVL 3QNXB 3ARWA 4HK3J 3DX7B 1XCTB 3G6JF 3N1PC 1DANT 3DYMA 3VWKD 2HVJA 1RK0A 3MMEB 4KUCD 4X6BB 1EK3A 4AMKH 3Q48A 4TVPE 4MDIA 4HDIB 3BEWB 1EEZB 1SQ2N 2VLRB 4JAMB 4X8JA 2VZ3A 2P24B 1WITA 2ZSWB 1XGYL 1JV5B 4ZG1A 2OR7A 4OLVH 4OZIB 1JMXA 1FSKC 3CFBA 2AEPH 3V5HA 3U4EB 3QIWA 1EHLH 1NH6A 1EVTC 4YFDB 5DUPH 3IF1A 3W0WB 1IGJB 4XCYA 1NUFA 3HE6B 2ENSA 4X9BA 4ZFFA 1XH3B 2PYEB 5FGBC 3MLVH 1FN4B 2SEBA 3KPRD 3TJEH 5ETUA 4CDGC 4FQCH 4LLMA 5BZDA 4QF1B 4GRMA 2H26A 5GGVY 4AEEA 3FRPA 4NZTL 4QOKE 5E6ID 2VDQL 4NBXB 1AGFB 3K1DA 1FNFA 3U36A 1P9MC 2BVQA 2UUDH 4N0RA 2HKFL 2Z35B 1A1NB 3MRKB 4YXKH 3BMWA 4XBEH 1G7MA 3WHE1 3TYFA 8FABA 3LOWA 1A0QL 4O02L 4KHXL 4KJWC 5ICYB 4LASH 2YEZB 3RGHA 1H0DA 4LVNB 5D96B 3PGFL 4OLXH 4PG9A 4N5ED 3REVB 3QEUB 4R96A 2DTMH 4FZEH 3F5WA 4F9PC 4Z7OF 1DUYA 2R0WL 3MV01 2ED7A 4PRPE 4JFDD 3GSXA 3IU4H 5FV1L 2NXZB 1KCLA 1TIUA 5DJ2A 1H5BA 3U2SB 4XCFL 1R3JB 1XIWD 4PJDB 5T1MB 2G60H 4FRWA 4JQVC 4X6FB 2DIAA 4OZFB 3FN0L 5E6YA 4K2UL 5DD0L 3P30H 4RCAA 3NCMA 1FNGA 3LN4A 3RWGB 4JRYD 4PBXA 4XCEB 2WBJD 4Z78B 2CDEB 4J12A 4Z8FH 1YEEL 5FYJL 1Q9OA 4PY8I 3CUPA 1M1SA 1F02I 1A6TA 5HPMB 1P7KA 5ELIA 4IDJL 5H37G 1GZPB 4HZLB 3T0DA 3EJJX 2J88L 1FG2B 4FA8A 1EJOL 1D5MA 1JHLL 4U1MB 5D1ZB 1CI5A 4Y4FC 1MHPL 2BERA 4PRHA 4QKXB 2AV7A 5DHXB 2VL5B 3L9RA 3V52H 5D2LE 4ONHB 1FIGL 1W0WA 1UKQA 4JDTL 3VGHA 1BVLA 4E41E 5D7LB 1RUPH 3V0VA 4JFDE 2ZKHH 5JORB 4Q9CA 5I8OH 1WZ1H 4L8CB 1FZKA 2Z8VC 4P4KB 3DLQR 1INEH 3P0YL 4NQEB 3SKJL 1P69B 3LEVL 4NKDB 5E8DL 2P7TA 5KOVC 4PRPD 1INEL 3WKNA 1S7TB 4PS4L 4G42B 3H3PH 3RI5F 5KSAD 4LLYA 4ZAKB 2NXYD 2OJZH 3DMMA 1B0RA 2ID5A 5I1HH 5MEPA 2MCPH 3S34H 4OLUL 4QCIB 3I75B 3MYJB 2NY6C 2OL3L 43C9A 4BZYA 3CGTA 1MLBA 4FOMA 4XMKL 5E7BA 5DHYB 4Q0XL 4G80A 1A7QH 3HUJB 4BSWB 4V1DE 4HKJA 5HBBA 4NQCD 4M62L 2MOVA 4HAFA 4Z7UB 1HHHA 1ZE3C 4EQ2A 5T3XE 3KPRB 3PWNB 3VGFA 2EDRA 5ADPL 3IDJB 1RFDL 4GAYA 3SJVB 3I6GB 2Q7YB 4S1QH 2VAAA 4PG2C 3R1GL 1KLUB 2I5YH 2YSSA 1A22B 1IKFL 4P57B 2VE6A 3KPRE 5F1KC 1AY1L 3U9UB 2ARJA 3MCLL 4HS8L 1QFOA 2RQ8A 4OIBA 3RL1A 4NFDA 2YA0A 3ARYA 3K2MC 2NX5D 2XY1A 5DQ9A 4KXZH 4NQTA 3P4NA 3HHRB 2WBJC 1KV3A 2Y23A 4G9FE 5GJTH 4KKCC 5MEQB 2EO9A 3OGCB 1FFPA 4C54A 3CH1A 4I8DA 4QHNA 4D9QD 1KN4L 4R7NB 1YECH 5KANI 3H3KA 2WUBH 3C6LA 1GRWA 4XH2A 3UTQA 5T3XH 3A67L 1S9YB 5F89B 1XIWC 4QHKI 2PR4H 3IXAA 3RY6A 3QRGH 4OM1H 1F8TH 3ILPA 3VA2C 3W9EB 1Y0LB 3ULVF 4OLWL 4GMSL 2X2YA 5FK9B 1QSED 5IGXH 3GKWH 3RU8L 5B39B 5I75C 4MNHA 5CZKA 4HH9A 2V2WB 3QNZA 5D7IF 3U46A 1F11A 3MV8D 4JREC 1OPGL 2VDOL 2VSDA 4YR6A 3QO0B 2ICCA 1QFWH 4YQXH 3K3QA 2BNRD 1JGUL 3A0OA 4S10A 2BHYA 5E94B 4NO0A 1SJHA 4X9FA 4NO5A 3ARDB 3REWB 3HG1E 1E6OH 3DVIA 2F5BL 3SDDD 3DECA 3Q6FB 2VZOA 5KVGH 2H9GA 4NZRH 4J3TA 1FFOA 3G5VA 4LARH 5ANME 5JW3H 3BKMH 2QL1A 3PWPA 3H9YA 4CBPA 4P9HL 1K5NA 4QTIH 5BXFA 3LD8B 4I1NB 1YYMH 4BH8B 1HQ4B 4PJFA 4FQLL 2IQAA 2CLZB 3RVUC 3BKML 4Q6YA 2WUCH 2ORBH 4G43A 1Q9WB 3QIUB 4I3SL 3WKMH 3RFZC 1DANU 1T6WA 1AFVL 1HHJA 2E27L 1IVLA 1FZOB 2YN5A 2PYFB 1HKLH 3RWDB 1KIPB 4X6DF 1PY9A 4OM0H 4ZAKC 4ZSOB 4PRPB 5EULV 1A7NL 1GSMA 1MCCA 2A9MH 1U92A 3HNSL 5A16A 2ZUWA 3DBXA 4RBPK 4X4MA 4Z7NE 3UJJH 4HEPG 3P9MB 3CLFL 1BFVL 1KG0A 1PD6A 4A6YH 5ECJE 1UZ8A 3WFBH 3P4MA 1WEJH 4X80H 1BJ8A 4MA1B 1HDMA 5HHQB 4N8VB 4UUJB 4K71C 4Q58C 5MEOA 1D6VH 3KPPA 5DJ6B 3VFMA 3BPOC 3MLUH 1XGRA 2X40A 1HHGA 1G6VK 1I1CA 3D2UD 3GSNB 2PO6A 3L3HA 1OAYH 4HIXL 1RURH 2GTZB 3HAEH 4V1DD 4XHQA 3FQNA 5F7HA 3LH2H 4QRPD 3GJFB 5C0JA 3TIEB 3MCLH 2FJFA 2W38A 4XAKD 32C2B 4R97B 1CICB 3SCMD 1QHPA 2JJSA 4PGDA 1P4IH 4WI7A 3CU1A 1YEFH 5M95B 3QIUC 4FQQB 3V6ZA 2YRPA 4UT9H 4UQ3B 4Z7UE 2F5AH 1G0YR 5I1AA 5JPMA 1GGCH 2XTJC 1XF3B 2WUBL 3OKEB 5FB8B 1DE4A 3O8XD 5CZVH 3R8QA 3STBA 2GW5A 5DUML 2UWEE 3BH9B 5C8JA 4TUOA 3QUXD 2CIKA 1Q0XL 1QNZH 5IUSA 4NCC1 1EO5A 2JK5B 5DZLA 3ARXA 5T3ZE 4NKQB 1I3RB 4LLWB 1EAPA 2R2BB 3LSOB 1RAMA 3V4VH 2X4TA 4ONFL 4R90H 4DQOH 2DBLL 3UPRB 3GIVA 1FCGA 4PJFE 1PZ5B 1Q9LB 2XWTA 2XTJE 4LSRL 3C5ZC 1ES0A 1ZMYA 5LBSL 3MLSH 1ZHKB 5DRNB 1TITA 1C5BH 2R8SH 3S97C 3PGCB 2XN9B 4ZOEA 4H0HB 1AO7B 5IB3A 1MAMH 3UTTD 2IQ9L 2W91A 5GZOD 5C70A 1NLDL 4YHPB 1DVFA 4JANA 1OAZH 3SDDA 4NZRL 4OZHE 4PTTA 3KYKL 1P2CB 3T1FB 1TPXB 4QRSA 1MI5B 1H9VA 3RTQB 3CFDA 4YJZL 3M8OH 5E9DA 4CNIA 1M6OB 3DWTA 3UBXB 4NRYA 2L7UA 3VXMA 4QHLB 4G9FB 4KRLB 2EZ0D 3MV8A 2C4FT 3H3PL 4YXLL 5KW9L 4L8BB 3OZ9H 4Y5YA 4NHUA 3BP5A 4ZAKD 5TQ0H 3T3PF 3AVEA 3TBYA 2XOTA 4HH8A 4S0SD 2ZCLL 2YHGA 4G8FA 5D8JH 2FGWH 5F7DB 2OMBA 1UWXH 3ILQC 4JDZA 5F21B 4UV4L 1S9VA 3CMOH 4EVNB 1G9NH 4HZAA 4GBXB 5D2NE 2DIJA 1A14H 4K94L 4UDTA 4P2QB 4F33B 4A2MA 4I3RH 4HKBA 4V1DB 5GRJH 4XB7A 2VC2H 4M1DL 3ULVD 3O45A 3AREA 4WHDA 2YUZA 5DRXB 2IBZY 4HFWB 4HK0B 5GGSY 4D3CH 3UCRA 1ODAA 2CH8A 3OX8B 4GW5A 5IB1A 5IK3A 4NKMA 4HS8H 2MCG1 5JDJA 1JI2A 5J6GB 4YXKL 4CU6A 1CU4L 3IDYC 4DKEH 1U95A 3L7EA 1T5WA 1XF2A 4HGMA 3B2VH 2BJML 3TVMB 5C0CB 1S78D 4H20L 3TA3D 2X9YA 1XGQB 4JZJC 3HR6A 2F5AL 1UM4L 3TBSA 1R5VA 2Q8AL 1UJ3B 2R9HC 3BKJH 5IMMA 4HWEL 4KUZL 4QYOB 1K2DA 5CMAA 1L7TH 1RIVL 1D9KC 3GNML 1J0JA 4Y4HD 2UV3A 3KYNA 3FHAA 3ZKSD 3DJ9A 3QUMH 4N0YH 5I1CH 3OKNB 3O8XC 4PJ7A 4NC2B 2OTWB 1YEIL 5EZOL 1V3JA 1E4JA 1HILB 4RX4A 1CG9B 3OPZL 1QYGH 4PJEB 4L4TD 1MF2H 4I2XA 3GFUA 5HHXH 1U8KA 5IW6A 3QUKB 2PTVA 3GMRB 5HHOA 2Y7QA 1Z3GH 1FRGL 3TM6A 2X4NB 4IRJB 2CMRH 4NNYA 1CLCA 4KKCD 4LASL 3NA9H 4LSUH 4WU7B 4L3EE 2G75B 4GAJH 2H45A 3WNKA 4RIRB 4GH7B 2FJGB 3VXTB 4CMHC 1DEDA 4WEUD 3I3DA 5EC1A 5IMLB 4U1KB 1QBMH 2JB6B 4PRBA 1F4AA 3T4YB 1I8LA 4R0LC 3TA3A 3MZGB 2DQEH 4WJ5A 1K6QH 4L4VB 3LRSB 1EEYB 4LF3A 3MREB 4GXUM 4NJ9H 1K85A 3V52L 2OJEB 2HFEA 5E2WH 4HBCH 4J3VA 4TVPD 5HHMD 1OP5H 3ZKQD 5TH2A 4F7TA 1AHWA 5SWZE 4M1GL 2OQJA 1A6VL 2E9BA 4LVHC 5FO7B 4DN4L 5E08H 2OXGA 4OD1H 1JTPA 2GSGB 3AAZB 4MA8H 2NY6D 4WU5B 1WBZA 2XY2A 1QSFD 1DBML 1HKLL 3UDWA 5TQ0L 4JO1L 1EBAA 1J1XL 2EH8H 1CDCA 4S1SL 2GY7B 5KSAC 3QFDB 1IEBB 1S7XA 1PYWB 3HRPA 4CJ0A 1T66D 3LEYL 1KCUL 1NUGA 3H42L 5CD3B 5EOCJ 5GJSL 1IAMA 3B5GA 5CCKL 5EZIH 1G7QB 1OAUH 3SE9H 2OP4L 4A6YA 1F90L 3I3BA 1X5YA 2NYYC 3IFOB 4O9HH 3WFCL 5I73B 4QWWC 2AK4B 2ZKHL 2UZIL 2QSQA 3S37H 2BVEA 2BY1A 4I4WA 5FF6B 4I9WE 4PJAE 1IAKA 4X5WA 1HXMB 2CKBA 2OL3B 3BO8B 3EOBB 4WTZG 3NFNA 4L8SA 1TCMA 4Y4FD 1RVFL 3HMWH 1PKQE 5LJYH 3DX7A 2HRPH 4AG4H 2HFGL 2Z31C 2Z92B 3U0TA 1A7OL 2H6PB 2CLVB 2EIZB 1TETH 2JKXA 4X6BA 2BSED 1FLTX 3IDXH 3BKJL 5ISZD 3IDGA 1IT9H 2M26A 3BEWA 5AEAA 4DKEL 4I3GA 4X8JB 5GIRA 4ODWA 3WS3A 3FFCA 1DLHB 5D5ME 2NY6B 4YNYB 5IQ7L 4PGEA 3Q3GA 4J1UA 3DRTB 4ODSL 4EXPX 5FYLD 1KNOB 1U8LB 4UMGA 4B7IA 3ALWA 3UPCA 4TNWK 4YH6A 5CEXA 4WI4A 4POYA 1KPRA 3MOBL 5K9OB 4C83B 3EOTH 3O4LE 3KXFB 4XMKH 5ETUB 1R3IL 5DUBA 1T22A 4PJCA 4PJEE 4GXUN 4X7CC 3WLWC 4MA3B 3OXRA 5GGUA 4NN6C 4FTVB 1NMCC 3HNVL 1G6RH 4JHBA 3J7HA 4KQ3H 4Y16D 1OLZA 2BVQB 3P4LA 3FO0L 2ADGA 3PWJA 2HT4C 5LGJA 5TDPB 4LCCC 1A1NA 3MRKA 3G04B 1OHQA 3QUZD 2DWEA 3OB8A 3P9LB 2X1PA 5ICYA 2YPLA 2YEZA 3EYOA 1X3DA 2XZQL 2X70A 2I24N 3S4SG 1C5CH 3KR3L 3QQ4B 4KPHL 5D4QA 1SM3H 1TNNA 5F7YC 4XMPH 4M6NL 4OFVA 3MRHB 1BD2D 3WEXA 2VXQL 4M1GH 4U6YB 1IC1A 3TN0C 4IMKA 3FQTA 3H9ZA 4QRQB 4MAYA 2WBJB 2IANE 4M8VA 4NQCB 1ZT4A 2D2OA 4WHCA 5AWNL 3JVGA 5CJOL 3VXOB 1AGBA 3IS0X 2XQYG 3HZVA 5FM5O 3R8BB 2MKWA 1NFDB 4YHIA 5DJYA 2XXCB 1URLA 3OF6A 4J23A 3ELAT 5BV7L 2F19H 5C07A 2F74B 5J13B 1WCQA 5EU6B 5EZLB 1WBXB 4MLSA 3TF7C 3I6KB 5E6IB 4PY8J 4GBXC 1Q9OB 3PIQA 4IDLA 5MP6H 3UX9B 1A6TB 5EBMA 2NY5H 4NKOB 1IC5L 2GFBB 5I2IA 4XNXL 1AI1L 5TPWL 3ZZ1A 3HC3H 3MLYH 4HZLA 4X4YA 35C8H 5FKAA 2V5SA 4LSSL 1NC2A 2JJTA 2VXUH 4HW6A 4PRHB 4NNPH 1IC4H 2QBWA 3EO9H 2X7LA 3ARDC 2J1KA 4XBGA 4LKXB 3KJ4B 1RUAH 4NC1C 5IVZB 4FXLA 1J0HA 5HSFA 3RHWK 4XXDA 1UB6B 5DURB 1J1OH 5DVNA 4GRWE 3S96B 1BZ9A 3AROA 3BUYA 1DBKH 3VGEA 4JG0H 2VDMH 2OLDA 3WNNA 3B9VA 5HHVH 3ULUD 1VGEL 4U1GB 3T2QA 2AJYH 2Z93A 1MEXH 1A9BB 4JY4B 1XEDA 4OB5L 3K1KC 1E4KC 5L2KD 1MQ8A 4J3OC 2XN9E 1JYXA 4K3DH 3QT2A 4JQXA 2WIMA 3IDNB 1D5XB 4Y1AB 1B0RB 4G7VL 4J8RA 4UT6H 1W8NA 2KQMA 4HKXA 4Y4HC 43CAB 1NC4B 4P23D 4QCIA 5CP3A 1N6UA 5C9JA 3T0EC 3OKKA 1QFWI 3LS5L 4KVNL 1OB1B 4WI2A 4HG4J 2VAJA 1RZ7H 5HVGB 4G8GA 1CN4A 1JWMB 3SDAD 3HZKB 1M7IA 1DQQB 4Z7UA 5FYJD 3BISA 3QDGD 1WJ3A 4Z7VF 4NC0B 2DB8A 4XNYL 1NGZB 4F3FA 1NBYA 5C2UB 1QQDB 2DD8H 1YC8A 2YMXH 2CK2A 1SJVA 4J4PC 4LNRA 3P3YA 3A6BL 2P5WD 3PP4L 3WXWL 3UYRH 4TN9A 3KR3H 5CKGA 1OCWL 4YHML 2Q6WA 4Q9QL 1J8HE 4FS0A 1H3TA 5KSVB 3TT3H 3GBLA 3LDBC 5EORH 3BJLA 1TJHH 1ADQL 4J6RH 4TPRH 4Z7WF 4DUXA 1P53A 3B8SA 4UOW1 3HI1A 5JTWA 4ZD3H 4M8QB 3ARUA 3B9KA 3VD7A 4DN4H 1HYRC 3PHOB 4ZODA 1F4XL 4U1NA 5DRZA 2C5DC 2NY1B 2P8LA 4HUMB 3UO1L 3D48R 5IFAH 5JW4R 1X6LA 4P5TB 4TPRL 3QEHA 5ADOL 4EI5B 4ZFGH 2BOBA 4CVZA 2VN4A 1L6ZA 1LILA 5DQDL 1Q38A 1PVHA 3L3OA 4KY1L 1F4XH 3ILPB 1AGDB 4AIOA 1I1AD 3R06A 1QSFE 4U3HA 5I0DA 5L0QB 2EZ0C 5MP6L 1WLHA 2Y5TB 2R0LH 4N9GB 3HMXL 5DSCB 1KACB 4PLOB 3BZ4B 1FCCA 3AXLB 3I2CH 3IDMB 4H88L 4QRTB 4Z7WA 4PLNC 3U46B 4LEXL 5CZXD 5KSAA 3T77A 3GJFH 2RFXA 1OQXA 1QBLH 2P5WE 4GQ9L 4X7EC 4Y19B 4RMWA 1JNNL 4L8DB 1EFXD 1HZHL 4JDTH 1T1WB 4J7RA 2PCPB 3L3JB 4I0PD 1I7TA 2FHBA 3T0BA 4MJ5A 5FYLH 2DAVA 3KLHD 1GPOL 4FQXA 2P5WB 1NANI 4MJ6A 4L5FL 1AE6H 4JFHD 2R2HA 1IZKA 2NY4D 1HXYA 4K7PH 4YHZH 3LMJL 4W68A 5ENWA 3OR7A 5HJ3B 5BXFB 3VGBA 4YAQB 1HQ4A 2WWKO 2AQ2A 4PJFB 5EU5A 4HK3N 2GHWB 2IPKA 3U30B 1DDHA 1XZ0A 5MI0C 4G43B 3IXTA 5ID1A 2NNAB 1IBGL 3A6OA 4WV1A 5HI4C 5BVPH 3DO7A 4PBWD 5HYJA 3W81A 3QXDA 1BLNA 1QSEB 4LRIC 5DMKA 3ZHKA 5E8OA 4OAWA 3TO4A 1BIIA 4OKDA 1K3IA 4JZOB 4N0YL 5I1CL 2EDEA 2G2RA 1C7TA 4ZUWB 1RUMH 4G9FD 5FGSA 3O41B 3C8DA 5ITBH 4XP1L 3QUXC 4ZS6C 3RWFA 2QQLL 5A2LH 1CFVH 4ZFOB 3N1QC 4WIQA 3AY4A 5BRZD 5C0BB 5ITBL 1HDMB 4LBEB 5HHQA 3MJ8B 1SMAA 5K9QI 2DQJL 4MQTB 4JQIH 3KPMA 2YRZA 1TJIL 2EDQA 2VUOA 5D7SH 3CSPA 4ZMAT 4KKAD 2WLZA 4FFWD 4M6AA 4UILH 4LRNL 5DVKA 1MIML 2GTZA 1DN0A 1LD9A 5EC2A 2ZWLT 1RULL 2OSLB 5ISZA 3GIZL 2FLRT 2P8MA 1Q94A 1CYGA 2CDGA 2EEDA 4MJIA 4UT7L 1EAJA 2EE6A 3MOAL 4P2RB 2GQHA 3CFIC 4R8WH 4PGCB 1I8IA 4GLRH 4HIJB 1EFQA 4MDJA 3PV6A 2X4SA 1G7PB 2UYLA 5IVXB 5DQJB 1U91B 4HF5H 1CR9L 3JWOL 3VW3L 3RIAF 3DI2B 1L0YA 4XC3H 4NQDB 4M7KH 5GZNC 1FJ1B 3Q5TA 4I0PB 3ZTNH 1BZ7B 4K7FB 3TIDB 1QRNA 3ALPA 2JK5A 4JPKL 4XMPL 3SE4A 5JOFB 1DP0A 2FZ3A 3NN8A 4MXVE 3V4UH 2CIIB 4CVWA 5IEKB 1FQ9C 5KSBF 4FXKA 3O4LB 3TZVC 4KH2A 1LO5B 2GJ6E 3ROOA 4HCRL 4JPKH 4QHKJ 4OZGA 4RAHA 4PJXF 2X4TB 3UPRA 1AH1A 1A1OA 4J4PA 1TTGA 4ISVA 1QOKA 1PZ5A 3H42H 2QQQA 3O6LL 3ES6B 4UQ2A 1TVHB 1CFTA 1FZMA 4TVSa 3EBAA 2NTFA 4FXGA 3IKKA 1A9EB 4JRXA 3AB0C 4XWOC 4YDJB 4F7CB 3MRLA 3TWCH 1J88A 5I1IL 1FIGH 3GBMH 4U7KA 1MUJA 1IMHC 1BMGA 1RU9L 4GRLD 3OR6B 3DO3A 1TCRB 2Y36H 5J56B 4Z76A 3AM8A 2V7HA 1N8ZB 3GSOA 3SDDC 5KVFH 4CKVX 1BFTA 2NXZD 4G8GD 4NDMB 5T1LA 5ERWA 2DYPD 2RCSH 2HJKB 4PV8A 3MV7A 2PYEE 1HQRB 1HWGB 2YWYA 3BP6B 1JUFA 5K33A 1UYWH 1MFDL 3IJHB 1B4JH 1NAKH 1P4BL 2AXGB 2D7MA 3SDXF 2MQCA 1VHPA 3UTOA 2IADB 1IGCH 2Y6SC 3UBXA 1IQDA 1MEXL 1ZSDB 3RJDA 4YC2C 5EOCH 5BJTB 3VXMB 1MSPA 2WZPD 3PABA 1KB5A 3V0WH 3LAFA 4C4KT 1MHCB 4JN1H 3DV6A 4JB9L 4JCLA 1CFNB 2Q87A 2VDML 3IFPB 5C9KA 1RUML 1AR1D 2VQ1A 1OP3K 1Q0XH 4X7TB 1H3PL 1NGPH 3TBYB 3RVTD 3DRQA 2R0KL 3IRZA 4W6XB 4U7MA 1KCSL 2FX9H 5IVOA 3RBGA 3DVGA 4ODUB 4RA0C 2ZUQB 5INDB 4WEMB 4BM7A 3ARBC 5FKPA 1OAQH 1OSPH 5F6HJ 2AQ1A 3CZJA 2DQDH 4M7ZC 3IFNL 2GI7A 2VQUA 4G3YH 4OLXL 5IBTL 3LKRB 4IS6B 3IU3A 5CIPH 1FNSL 3EDKA 5F70A 1TQCC 1NFDF 3ZT7A 1IT9L 5B3JE 5IB5B 5IFHH 4KGJA 3SQOH 1F4WH 2FBJH 3QAZC 3D3VA 3UTZA 4NO3A 2VDQH 5J57B 4AEHL 1CE1L 5DJAB 3AU1A 1EUTA 3HLAA 3O3DA 1DN2A 2YC1B 2DICA 1UWGL 5BV7B 3OF6D 4GFTB 3WSQH 3BPNB 4KUCF 3TBVA 1LDPL 1S7RB 5TE6L 4D0DA 1TQBB 1YQVL 1YEJL 1HHKB 2QKIB 1IL1A 3QNYB 4QYOA 1MCBA 4Q6IB 4LOUD 1AP2A 2VKXA 3ARFB 4ZFGL 4ZNEA 3OKNA 3N0PB 4PJ7B 4XC3L 2M1KA 4NUGL 4G7YL 3VXRB 3MUGA 5EU3B 4ALAL 1HILA 4QXGH 1RZGB 4XHJD 5HHPA 1FO0L 3RA7H 4ZD3L 3ULVH 4ZFZA 5SX4H 3BSZH 1VCAA 4U6TA 4YHOH 2BSTA 4XZUB 4QHMA 3B9DA 4WNQB 5IW6B 3FOMA 5DK0B 1CLOH 3PNWB 4ZSOE 1IGIL 5EOQL 4IRJA 1KXQE 4NNYB 1LK2A 4DFIA 3D0VA 4P23A 3DX8A 5TE7H 3MRMB 1P7QD 4X98A 4U2ZA 4UU9A 2VLJB 3D0LB 3S36L 1GIGL 4XCCL 3QJFA 5TF0A 3SGDI 2MJWA 1NDGA 5IF0B 4OLZH 1RJZB 4RQQA 5L2KA 3PWUB 1AXTH 3M1BA 4FP8L 2C3WA 3TA3B 4KJQD 4NT6B 3QCTH 5EA0H 1U93A 3VFNB 4M7JH 4KK5C 4AT6B 1MHEA 2NY5C 4NBZB 3UEZA 3SKOB 4DZBB 4HUVB 3WLBB 2DQEL 3MREA 1IC7L 1T89A 1PG7L 4WUKL 2FDBP 3P11H 5IB4A 4MD5B 4ODXA 2AJZA 2F54D 4JCMA 3VFSA 1G7HA 5JR1L 1BFSA 3BWAA 3PV7A 5ICZA 5C0EB 3GGWB 3HTLX 4F7TB 1UWEL 3AS0A 3J8F7 3TZVA 5C09B 2PW2B 4POUB 4Z0XA 5D2NA 1JK8A 2BOCB 1MCLA 1KFAL 3BZEB 1WBZB 2N1KA 1D5IH 3CVHA 4XPGL 3QFJE 5K59F 3LKSB 1JNHB 4OJFH 4LLVA 4PJ5B 2IF7A 4PB9H 4N9OB 2Q1EA 2E9JA 3O0RL 5AUMB 4K3EH 1R24A 4QTHA 3QPXL 3QPQC 3TV3L 5HY9A 2ZUQC 3FQWB 4GRWB 1VFMA 1NCCL 4BKLA 5TQ2H 1G9EA 3TP4A 1OARH 4Y4FA 1U3ZA 4MMXC 5F1NB 1OAYL 4JREB 1W8OA 1SYVA 3NFPA 1UC6A 2VISA 3BKCH 4OGXL 2AV1B 1DR9A 5DYOA 1HXMA 2HH0L 1FVEB 4QHUA 2CSPA 3KS0H 2H2PC 1WBYA 5HVWA 4EKXA 4Y4KD 1T7XA 3TN0B 2H2SD 1YJDH 4WW2B 3EO9L 5CWSB 1YUHB 3P0GB 3QUYC 4LK4A 1NEZA 1Z9LA 1BD2A 2MKLC 1AY1H 3FAXA 2GSIB 2H6PA 4OD3H 3MA9H 3WE6B 4F7EB 2D9CA 3LV3B 2W60B 2I9LA 4MX7A 3WFEH 5T1DL 5EPMB 4APQC 5EH1A 2CR6A 4PJHA 4WFHE 3MBEA 1QO3A 1C5DA 1CFQA 15C8L 4ELKA 2EO1A 3T0WA 5HYFA 3DIFB 3GK8H 2D03H 5E95B 1KSRA 5ADOH 3Q3GB 1TJGL 1AD0B 5GQBA 3DRTA 4OFIA 4F2MB 1BQUA 3NCBB 4DTGH 1YPZF 5MENB 1U8LA 3P9WB 4JM4L 5CEXB 5HDBE 1ZA6A 4HUWA 4NNXB 1F3DJ 4OGYL 3T2NH 1KPRB 1J0ZA 2DRUA 4JO3L 1HEZA 1N6QL 1YEIH 1T7YA 1KCUH 2OM5A 4K55A 4M3JA 4ZOAA 1N59A 3O6LH 1T22B 5DC9B 4JQVA 1KTLB 3QDGE 4DOHE 3TYGH 1KIUA 5T5NG 3WL9A 4F8TA 2AKRB 1JPTH 1E28A 3KWWB 2JCCA 1C7SA 1HN1A 4OZIF 5E2UL 4KKLC 2E7HA 4LSRH 2F53A 4XNYH 1G6RL 5LXGL 4KQ4H 3BP4B 2VLJE 5C0GA 5LGJB 4Z7QE 4H26A 3G04A 1HH6A 4PJ8A 1U3HC 1C5BL 5D1XB 1MLCA 3GMMB 5JW5B 1LK3H 4PP2B 5T33H 3FT2B 4FABH 3F12B 4YPGA 5E4EC 3PHQA 2HT2D 4MNGB 2P8PA 2YA2A 1TVDA 1GGBH 1AGCB 4M3KB 2PXYD 4NFBA 2HWZH 3MNZB 4WO4C 4HJJL 4NO0D 3S8WA 3VWKB 1X5FA 2K1MA 3NBNA 3W0WD 5FM5M 1LO3H 3B6SA 5MHSE 1J0IA 5FOJA 1YEGH 3CC5A 5D6CA 3BVNA 1NFDA 4W6WB 4H20H 5IROA 3T0EE 4JM2A 2X4UB 1DBJH 3JTSA 3AMLA 3U0PA 1SEQH 4ODSH 4FQHA 4IRSA 3DYOA 4YGVA 3C6SB 5DGQA 4OCYH 5KTEH 1MELA 5ALCL 4CRPA 3BQUA 3U7WH 5LG1A 4JPIA 1KJ2A 2V2XB 1JPGA 1FV1B 5D7JB 4P5MA 5BS0E 1GOHA 2VDPL 1U8QB 2WBWB 1IQWL 4FQCL 5GRUL 5J7CC 5E1HB 2BVOA 1DEEA 5F93C 1Y6MR 4GQPH 5DEZA 5AZEL 5GGRY 4CN6A 2UZIH 3BPNC 5I18L 3OMZA 5C08D 1CE6B 4LDLB 5ABDE 5BV7C 4ETQB 5IVZA 4Z77B 2ZUSA 12E8L 4YHYB 5JHDA 3EYQC 1S7SA 1RJYB 4L9LA 3O6MH 2EXYC 4C4KO 4XXDB 4JKLA 2HKHH 3S96A 4KROC 2V2TA 3CDYA 2G5RA 4PR5B 1DZBA 1MFCH 4AQ1B 5ACZA 2NCMA 3WXVH 3HMWL 5E5MA 1TPXC 5CJQH 2EYRA 4HWUA 3MSPA 5DK2A 3SGJA 5JIHA 3E0GA 1HINH 5GXBB 2COQA 3VXMD 2GAZA 1NQBA 4HPYL 4YX2L 4DW2H 1AIFB 2VLKA 4HAGA 4DK3A 5AWNH 4J3WA 3IDIB 3MNVB 3V4UL 4X6DB 5HGGS 3FB8B 3BSZL 1W72A 5DQDH 4WFHD 5J8OA 4FFYH 1I75A 3EHBD 4GAGH 5DLML 3K7UA 1KJ2L 5AG9A 1EJOH 2P42B 4K2UH 5D7KD 2DJUA 2H3NB 1Y18A 2C3VB 1B0GB 4Z0BL 4ZTOL 2IG2H 4U31A 1T4KA 5F7UA 1JNJA 4HWBA 1G6RB 4KHTL 5EOTA 3BT2L 5LWYH 4OZ4B 2KZ1B 2DQHL 2GJZA 5D7SL 3SHSA 3VWJB 3VXUB 3DETC 1FE8H 1Z0NA 2DQTL 3MBEC 2RIKA 3ME0A 4PJ7F 4LDOB 2GTWA 5HVFB 4HXBL 4OZGE 5KSBA 3DXAE 4WGVB 3MCKB 3VXRD 1P5UA 3LEXB 1LO2H 5D1XD 3RX7A 4KI1A 4PB0H 4MXWH 1ZGLA 2G5BB 5F3BB 4GUPA 3H9SE 5F96L 2L0DA 5EORL 2ICWI 4HGKC 3TO4D 5FO8B 4CAGA 2O5XL 5CUSL 2ITCB 5DRZB 2QHRL 3OAUH 5HYJD 1PG7H 3DURA 4WUKH 4JFQB 3ULUL 4CVZB 3TEUA 5F44A 1W72L 3O3AB 4K9EC 2EEAA 1WC7B 4MQ7B 4OJFL 1II4E 3V0WL 3MGOA 4PJGA 3RGVD 3VFPB 2Y5TA 4PJCF 5C6TH 4NZUH 5IHUL 4K3EL 4M48L 4NQVA 2IMMA 1KFAH 2XYCA 5ALCH 1HHIB 1NKRA 3F7VA 2Z31B 1AXSA 4RGND 3IDMA 1Z6JT 1NGQH 2B1HH 4EN3A 3SDXA 1LGVA 1C08A 4HS3A 1REIA 4J2XA 3HC4L 1A5FL 5I6XB 2OBGA 2C1OA 3MRIA 3VXSA 4D0BA 3K8KA 4JM2D 1T1WA 4M1CD 1BGXL 3W11D 4JGUA 1IRAY 1ULVA 1LP9F 5FUCE 4I3RL 2OTUA 4KUZH 3ZDZE 3IGAA 2UVFA 3T0EA 3S36X 2AJ3B 4XP6L 3STZA 3QHZL 1J5OL 3CMOL 3X12B 1FNEB 1P4IL 1VGKA 4OCMC 1ZGLP 2VLMD 3ZE2F 4PV9A 5TDNA 5ENWB 4UINH 1FLRH 2I60H 4CUCA 1AQDA 5CAYB 4UTBL 1CU4H 4XNZC 1T03L 4RAVB 3JZ7A 2VABB 3MODH 5JUEH 1DDHB 1XZ0B 4WWID 3DROB 5DRWB 4LCYB 4HPYH 2D3VA 2NNAA 3RWJB 5HVHC 4O2FB 2CQVA 1A3LL 4NIKB 1AD9A 2VWEC 5HYJB 4PJ8D 5KAQF 3QIWC 2HFTA 5CKAA 3R4DA 1IGMH 2ICWB 1GCFA 4XPTH 3RVVC 2G2RB 4NUGH 5HYIA 4TRPH 4U6HA 3MLWL 3ZTNL 5CJXC 1OOAA 1PAMA 5GGTH 2OR8A 3U9PH 3NIGF 4LHQB 3MV9A 3UZVB 3RA7L 4HIHB 2X10A 2O5ZH 1BWWA 2Z0BA 3BE1H 3H9SA 1E6OL 2GJ6B 3FAWA 3KPMB 3VI4E 3L5XL 1T3FB 4BZ1L 1JPTL 2YD7A 1T21A 4H25B 1IEHA 1YN6A 3ZT5A 3ESUF 4HUXB 2NR6D 5IBTH 4PJXA 3M17A 2ZOKA 3VWJC 2EIEA 4NN7C 4CMHB 1TQCB 1DN0B 1LD9B 3WO3B 1BM3L 2I27N 3HR5A 3QB7C 4U33A 5ISZB 5DD5L 5FHBH 4PJGE 2EDDA 5IEHB 4PIRF 5SWSE 2NW2B 1EFXB 3BGMB 5BO1H 2ED8A 3EOAB 2LTQB 3HNVH 4N0FB 2Z91B 3FQRB 4TQEH 1U8HA 4KQ3L 4PJIE 1CBVH 4FFVC 1EMTH 1T7VA 3VGGA 3ZKXB 2XKNB 4PJHF 1VFAA 4Z7WE 1A6WH 4IRZH 4XPFL 4HT1L 4CN4A 5GHWL 1P1ZB 4TUJB 4KZDL 5EUOF 4I0PA 4M6OH 4PJ9D 4IOIA 1HYSD 3D69B 2FZ3B 4Y2DC 1FFNB 2X4RA 4KXZI 3SDCB 5IEKA 3U7YL 4X6CF 1FG9C 5GGRB 4HX1B 2IGFH 3RL2B 3UYOD 5A40E 1I3GL 4OB5H 2GK0B 4S1DD 4JFDB 1KJVA 1CK0L 3GSWB 5JHLH 1H3UA 3F65A 4WTWA 1RMFL 3ES6A 4UQ2B 5IHUH 5C6TL 1LEIB 2OR9L 2A83B 1CFVL 4JRXB 4JN2B 2EE3A 1D6EB 1VACB 3BKCL 1V7ML 1W0YT 1NMAH 1OP3H 5IJKA 1MUJB 1INDL 3MRPB 3RVXD 3UC0H 5I1DA 5K9QG 4NWTH 2NY1C 3OAZH 3LQZB 3MRGB 1E27B 3QFJA 1LO4L 4Z76B 2D0HA 4D8PA 5LAXB 4QT5B 1AI1H 2G9HB 3AB0B 5C0FB 2VIRB 2W0FB 1I7UA 5IQ9A 1RIUL 1HZHH 1KIQA 2AXJA 4JVWA 1CXEA 5EA0L 3MV7B 1PSKH 4NQDD 1HIMH 3QG6A 2FWOB 4XWGL 2YPVL 2CGRL 3OKMA 3RZCC 4PTUB 1JPSL 3RTQC 5B38B 3C5JB 5I8CA 2X5PA 4EOWL 5HGBA 5ESAA 3IS1X 5I8EA 5JPNA 2AJUL 1T04A 3DHMA 1M7XA 2IADA 3NCCB 4Y8DC 1J0YA 2BNQD 4G6AC 1GGUA 1RVFH 4LHUA 4JEGB 3FRUB 3HE6D 4P5KB 1NBVH 4L29B 4OIAA 3UZEA 2QSVA 5HTSA 5ID0B 1CFNA 5FYLE 3U9PL 3IFPA 1WIUA 4LAQL 3CDGA 2D7TL 3U7AA 4JM4H 1NLBH 2AVGA 4XPTL 4MJ4A 4LLUB 1P7QA 4G7YH 4DZ8A 4ODUA 5E7FA 4F15C 4RFNB 5INDA 4GKZA 3FO1B 2E9IA 4WY7L 3U4AA 4OZFH 2XICA 1NCDH 5T1LD 3O2VH 4AK1A 4LSTL 3C5ZB 1SM3L 1GC1C 4YWGL 2WV3A 5GRVK 3EDDA 2M8XA 4OGXH 5L88H 3LN5A 4NN7B 4YDVB 3RNKA 2VH5H 3EW3B 5JZ7D 5H94B 2IBGA 1J8KA 3U79A 4DKDC 2NY2C 1IM9B 3E2HC 2BFVH 3K80A 2ORBL 3CFEB 1N5YL 3H9SD 2HJFB 3HG1D 4OFYD 3VFUB 1SBSL 2F54E 2NX5A 4IOFD 1CCZA 1OVZA 3OAYK 5FCSH 1RK0B 3O6FC 1P6AB 1YJDC 3NPZB 1RPQA 2UWEA 1MCRA 1RHFA 2C4FU 1HOCA 4KDVA 1K4DA 4D0DB 5K9KA 4Q9QH 3C60C 5ESVB 2ZCKH 1Y6NR 5IW3A 4TVPL 4WEBH 3L3KA 4AL8L 2NZ9C 3QFJD 4Z5RA 3JXAA 2XA8L 1UKTA 3QIWB 1XR8A 3KPLA 4EZMA 4RWYH 2AABL 5GSRB 1RZGA 3MLXL 4IIQC 1MWAH 4OF8A 25C8L 4U7SA 3VD9A 4QHMB 1HH9A 2PYEA 3FOMB 5DK0A 2P48B 2ZG1A 4OCYL 5FO9B 5KTEL 3SQBA 2PF6A 5F8QC 3OJ2C 3SGEH 3UTSA 1WGOA 1LK2B 5C07D 3TJHC 5BZDB 3D0VB 4P23B 2GUOB 1F90H 4GRMB 1DQJB 5KZCB 1BEYH 3BD3A 3DMMD 3CCHA 1UGNA 3ARGD 4HJ0C 3CSYB 1KTDA 1ND0B 5C71A 1AKJA 2APBA 1E4WH 4YC2B 2NTSP 2JIXD 2JELH 5JOPE 4MS8C 2Z35A 4WO4B 3PL6C 1JWUA 2VB5A 3MROA 3UC0L 3DPBA 6FABL 3U4BL 3SKOA 2VXVL 3FB5B 4MA1C 3EO1A 1DLFL 2P4AB 5IB4B 5BRZA 4PG9B 4Y2DA 4NNPL 3FO9A 3BWAB 4C56D 3ZDXE 2V9TA 1RJLB 1ZWIB 2C1PB 1JWSA 5H2BB 1TZGH 1DUYB 4KRPC 2HKFH 2PUQT 5D1QC 4LPYA 1S9XA 2CLRA 3I50L 4PUBH 5DJ2B 2J8UF 3ARFC 1B4JL 1NAKL 2DM3A 3C5SA 2OTPA 4JFEB 2JE8A 5HHOE 1HSBA 2ARJQ 1J87A 5E8NA 4U0RC 4JPVL 1NBVL 3TJEL 1A1MA 2JJUA 4Z78A 3NIFF 4GKOA 2AGJL 3WXWH 4C56A 3VFGH 5M94B 4XTRC 3BE1L 1QLFB 3GKZA 1F4WL 3QCVL 3VFWA 1FIEA 1ZA3B 1SYVB 3H0TB 3BXNA 2HT3C 2VUYA 3F7RA 2R29H 4FQXD 1ZS8B 2FX7L 5C3TA 3WD5H 1XIWA 4IMLB 4L1HA 1A4KA 4MA7H 4MQXC 5DJDB 3WN5A 3G5XB 5FYJU 1NDMB 3SKUD 2VL5A 1EUUA 3GMPA 5K9JH 5CWSA 4U0RB 4UZGA 1W0WB 1CXIA 3S37X 3DYPA 1G7JB 4JFPA 3V0VB 1KGCE 4L8CA 3LV3A 5D72L 2DF3A 3QG7H 5KSUA 2DI8A 4S2SA 4P2OB 1BPVA 1MVUB 1WWCA 4MSWA 3TT1H 1UACH 1A7RL 1GZQB 3T0XA 1C5DB 1LO0L 4Y1AE 5GISL 2ZP0T 3SEPA 3QDJD 5T5FH 1B2WH 5EUKB 4M6OL 4MQSB 4CVXA 3C9NA 4G42A 4KJPC 3CFKA 2O5YH 1U2HA 5E99L 2E8ZA 3PGDB 4OKVB 1C5CL 2WWMC 3M07A 3P30L 5IV2A 5MEPB 4GAFB 2P1YA 2KDGA 2V17H 3LKOB 3TCLA 3EFDH 3CFJA 3O6KH 3QO1A 4KZDH 1ZLWK 1BQHG 1FPTH 5F88B 4G80B 5HD8D 3S98A 3NCYS 2HG5A 2Z4QB 2I26N 4JLRB 4PJBB 4IHOB 2DN7A 4NZJA 1FH5L 3EZ8A 3WCYA 1HHHB 4MXQC 1CGVA 2ZPKH 2EICA 2YUXA 1WWBX 3RZWA 4OD2A 3KWWA 3NAAH 3HC3L 3IDJA 3MLYL 2YOCA 4N0UE 2DQUH 3K81A 5EO1B 2EYSB 3PDOA 5EUOB 4PRDA 3VXQA 1TETL 4KHTH 4LGRB 4P57A 4QOKB 5EFIB 1LP9B 5IW1B 1JHKL 3MRDB 1KCVL 1YY8B 3WV0A 1LNUB 4KZEL 3FHQA 4YPGB 1S7UA 2J6EH 1CICC 4FQ1L 4EUPB 4YHZL 2YZ1A 3GEWB 4YFLI 3CH1B 2P47B 2XZCH 1ZHNB 4E41B 4NWUL 4TTDD 1V8HA 2RBLA 4LKCA 2IBBA 2W59A 3TH3T 4OCXH 1XF1A 4O4YL 3QH3B 3MRBA 4P99A 1A3LH 3RNQB 2YS4A 2YKLH 5EIVA 1JE6A 5DS8A 4URTB 5JXEC 3NCFB 1PLGH 2BNQA 4FMFA 4LFHG 3BN9C 5ANMB 4HC1H 4KV5E 1OGAB 5FK9A 1EEZA 5D1ZC 5DZNA 3JV4A 3SOBL 4JAMA 2YK1H 2EXWC 4GKNA 1NBZA 1TZHA 4MNHB 2P24A 4RGNE 1EBPA 4YGAB 3N85L 4JPIB 4L4TA 4OZIA 2BSRB 4D9LL 2MFNA 4YR6B 4MA7L 1NSNL 1FO0H 2X4OB 3U4EA 2O5ZL 3OKDA 1FV1A 1YY9C 3T09A 1T0MB 2VXSL 3IF1B 4N0CC 1K6QL 4OCLC 4MD4A 4U3XA 1A3RL 3INUL 1GAFH 5KVGL 3MA9L 2DQJH 2YD6A 1DBAH 4QOKD 2H9GB 4P9ML 5ITFB 2ERJC 3F62A 4Z77A 3B9KD 1I7RB 2MMXA 4G8EA 3GRWH 1IILE 7CGTA 2DQCH 2DLTA 1Y6KR 1RULH 1I8KB 5GSVB 3ZE1F 1FZJA 2UUDK 3QDHA 5DO2C 3DXAB 3LPGA 5KS9E 4CJ1A 3D39B 5C08A 3DUUA 4WWKA 2IAMC 1I9IH 1TLKA 2VZVA 4OV6F 5HGAA 1WFOA 4ZO9A 4XT1C 3MFFA 1KIPA 4PP1D 1F8TL 2DLEA 4KK9C 5KS9B 5EU4A 3DBXB 2OXHA 5FA4A 3L1OL 2OI9B 4R96B 2LVCA 2VL4A 3RGVB 5BQ7B 3QDGA 3ARBB 1QPPA 3RWCA 5I75B 5AZ2H 1H3WM 2JCCE 5D96C 2W9DL 4PJDA 5T1MA 3NAAL 4X6FA 4KI5D 4JM2F 3C2SA 2MHAA 4FFZL 3DUSB 1ZLWH 5DJ6A 3AS2A 5E00B 3VFMB 5EZJB 4Y4KA 1T4KB 2A74B 1CF8H 3FQUB 1UM5L 4Z18A 1QBLL 4GQ9H 1G6RA 3JWDL 1D7FA 1I4FA 2HRPL 3MGAA 3GSNA 2ITDB 2PO6B 3L3HB 4P46C 4XCEA 1MRFL 3MACL 4AM0A 2CDEA 3MXVL 2N7AA 4X9GA 1IQWH 5CGYC 2YD4A 5HHVL 3TIEA 4M43L 2GTWB 5HPMA 4CW1B 5IHBA 3E6FB 1JGLL 4GMTH 32C2A 4C59B 1CD1A 1A2YA 1ITBB 3DARA 4WI3A 3MLVL 2AERT 2HLAA 1QEWB 3FZUC 3WKML 4XP4H 1TZIB 2WUCL 3ZO0A 3PJSA 1XF3A 4YUEL 4Z7VB 4OM0L 3PDDA 1Z5LA 3DURB 4LGSB 1OT2A 2EH7L 2A77L 4N0UA 1QVOA 1RHHB 3O3AA 4GRWF 1NC2D 4UI2A 1UT9A 1U8IB 1X6NA 5DJXB 3G6DH 3V4PH 1FZKB 4LLWA 2A1WL 1KPVB 1EAPB 4M6ML 1N4XL 1WUNT 4HPOL 5DD3L 4NQVB 4DGVH 2P7TB 5B4MC 3GM0A 4ZTPH 5SX5K 3KLDA 1U8MA 2VXSH 4G5ZH 1UH2A 3X3GL 4AEIL 4NQXB 4D9RE 3INUH 2NY4B 2GITB 4U6VL 2C1OB 3MRIB 4KRPD 2BXYA 1VPOH 4H0IA 4M4PA 3U82B 1MJJB 1UH4A 4PJEF 1MWAB 3GMOA 2HJLA 3I75A 4OF6A 5JHDE 4L8SC 4EQ3A 4OF7A 5DHVH 3MJ6A 4XVSL 2XI9A 5C09D 1U36A 3RDTC 3IKCB 4BFIA 2OTUB 1YEHH 1W0VB 5F9JB 1JRHH 1MNUH 4LVOC 3WXVL 4F57H 1V7NH 4PJ9B 3VXSD 1YNTB 3MLPA 4DAGL 3BAEL 4KK6D 4KWUA 1KYOK 1DVFB 4JANB 1QFUL 1HINL 1G0DA 3VI3E 5F3HA 4DVBB 3PWNA 3SQOL 4LSQL 4GKSB 1F4YL 3WIHA 1QKZL 5TDOB 1HWHB 4PJDE 4IDJH 1YPZA 5DRWA 1MJ8L 2R0ZH 3JUYA 5ICXB 4LQ1A 1M6OA 4NJAH 5J3HC 1G7IB 3GKWL 3L7FB 2AJUH 5HDOA 4JHZA 1L4IA 2RB8A 3IDUA 2ARJB 4WFGE 5HDQL 4YBLB 4P5TC 1CGTA 1MCFA 4DGIL 1OAZL 1IGML 3QWRD 2DBLH 3L3DA 1X44A 1JF5A 5DD0H 1Z3GL 4U6HB 1MY5A 1A6UH 4WWKD 4GXVL 1MFAH 2GCYA 2V17L 2FSEA 4YFLF 5HYSB 3HFMH 4G8FB 3MV9B 1A4JB 1B6UA 4GLRI 2C26A 1BX2B 2WM0A 5IM7A 3EYVA 1KN4H 3UTQB 4JDZB 5E6ZA 2E7LC 4K3GA 4ESKA 1MQKH 4Z8FL 3WS6A 3Q6GL 3MJ7A 2VZSA 5CIPB 4F9LA 3LIZL 4UDTB 2PN5A 4DWHA 1UEMA 2NY3B 4HUXA 1NGQL 2B1HL 1B90A 3RWIA 3O45B 1IAII 1P84K 2BHUA 3N1GC 2AEQH 3TYGL 4HH9B 2NW2A 4XCCH 4F37F 4MHHI 1UCBL 2HA1A 5KVFL 4M61B 2ERJB 1A7QL 2AJVL 5CINH 4RWYL 5EBLA 5ILTH 5GS1B 4B41A 5HHOD 3M8OL 5CSBA 4MAYC 3TVMA 5E94A 5FFLA 1UB5A 1IGFL 3SJVD 5JR1H 1PZUB 2VSCA 2BVTA 3OGOE 4QRRA 3AC0A 4OQTH 2W0PA 4RFEA 1P1ZA 4TUJA 4FG6C 3HRZA 5L2JA 4WW2F 1OY3B 4IOIB 5EUOE 1Q8MA 4O2EB 5IHZA 1K5NB 2OTWA 3DGCR 2OJZL 1ETZB 1P4LA 3WMSA 4XVTH 2CLZA 3CZFA 1R3LB 4PJEA 2E8YA 4HX1A 1IGTA 2AEPL 4ZDHA 1UG9A 1F4HA 4RAUA 3S4SA 4B0MM 1HHJB 4IRJD 2MPAL 4ORGB 4XPHL 3HE6C 5L0QC 3GZKA 1LEIA 5LGHL 1YMHB 3WFZA 2DM7A 4FG6D 1F58L 4JPWL 4WU7A 1JF6A 4B50A 4HWZA 1D6EA 1VACA 4WI6A 5I1LA 4XVSH 4HIEA 1IJ9A 4JGMA 1YMMA 4M4RA 4GRLA 5IMLA 3P9MA 4NZDA 4L9DA 1KG0B 5J11C 2J8UA 3QFJB 1T5XA 1JYNA 1AGEB 1TJIH 3FN9A 1GJIA 4MYWB 2P45B 3VW3H 2CJUL 2EDJA 5FV2A 3VI4F 4ZYKB 2LTQC 3HI6H 1IEAA 1YMMD 1CD9B 4LVOB 5F7WC 4C56E 3GSVB 4JFHE 4XXCC 4BSVB 1FORL 5B38A 1QRNE 3FO0H 1YJDL 3C5JA 1FAIL 1OCWH 1JTOA 4Y5VC 4PGBB 5I8EB 2J4WL 3O3EB 3FN0H 5CZVL 2OMNA 2GSGA 2GT9B 3AAZA 1KPUB 5C0JB 4NM8L 3MUZ1 2FJFB 4L29A 5D2LF 3WIIL 1BZQK 3IU4L 5E8EA 3WHXA 3P4OA 2XA3A 4KJYA 4S1DC 4KI5C 2X89A 1PYWA 4OT1H 3V6ZB 5JW3L 1H15A 5L8LB 4UQ3A 1MJUH 1O0VA 3MGTA 4WWKC 5EIIB 3WBDA 1PGRB 4X99B 1FRGH 3MLXH 4OUOA 5E4IA 4A6YB 1KBGH 3ZE2E 4TUOB 2XG4A 3IFOA 3SGEI 3EO0A 2XPGB 4CU8A 3HMXA 1ZVHA 2BVYA 3GHBL 5DT1L 4DN3L 4I4WB 5FF6A 1I3RA 4DEPB 5D2LA 4M03A 2R2BA 3LSOA 4U1SA 5DJCB 2OL3A 4JFEE 2R69H 3GHBH 1XF5B 4WFEE 3NFNB 3FFDB 4LLQB 3T8XB 4FP8H 5CEZE 2XWTB 4GOSA 2QADC 3F7YB 3TBWA 3WUZA 1JL8A 1BFVH 1WZLA 3SDCC 1H8SA 3NTCL 3U0TB 3U48A 2FRGP 2IEPA 4U1JB 1UM6H 1CFSB 1DQLL 4WHTA 3EFFA 3W5NA 4LMQI 3IDGB 2XN9A 2NY0B 3MV7D 2VRAA 1DBMH 3PHSA 5AD0B 1CGSH 1ED3A 3SPVB 4JY5H 4LPUA 5DMIH 2V5YA 2R0KH 1OGTA 3T65A 4Q7DA 4PGEB 2AS5M 1AO7E 2BY3A 1QLRB 3BPCA 4BK4A 2DWDB 1YDPB 2A9ML 3JVGC 4BH7A 3WJLC 3EIFA 1G9NL 3LEYH 1MCDA 2RAMA 1P2CA 1PLGL 1OTUC 5F7KC 2HP4A 4UBDC 2VDLH 5FYKE 1UVQA 3RTQA 4ENEC 1V05A 4DVRL 5FGCB 5FO9A 4KMQA 5IHLB 3RUGB 4Q74A 1KTKE 3UTSB 5EN2A 1CXHA 1IARB 2YBRA 1QSFB 1RFDH 3VRJA 4FQIH 1NCBL 1BFOA 2GUOA 2AK4D 4AMKL 2IAMB 2R23A 4MA3A 3OXRB 1NSNH 4Y5YB 2ZCHL 4HMDA 1F3JB 4NRXA 3BP5B 3TH4T 3UTPE 2P44B 3R0NA 3AS1A 1NGXA 3BPLB 5I1KL 2VJXA 4LSTH 2DLIA 2XG5A 1S3KH 2ADGB 1MCJA 5TDPA 2CGRH 1SYSA 5F7DA 2BNRE 4ZUTB 3GSRB 3WSQL 3HAEG 3QBTB 3ZL4L 3P9LA 1OAKH 1BHGA 5DDHA 5AAMA 1S9VB 1N0XL 4UV7L 3TNNA 1CICD 4TUKH 6FABH 3RVWD 4PRIA 4LNVA 4Y2DB 2Z8WC 3JV0A 4HUUB 4Q9BA 4YBLC 3MRHA 5AZEH 4HC1L 5GS0L 1EZVX 2PO6C 1JWSB 5H2BA 4M1CC 2PYED 2BY2A 3MLTA 3A6BH 4LCCB 4HK0A 2CLRB 4XMLH 3VXOA 5JLZA 5KG9B 2YPVH 3OX8A 4GW5B 3G08B 1T03H 4JFEA 4NKMB