3STLA

Kcsa potassium channel mutant y82c with cadmium bound
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2011-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3stlA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3stlA02
5EZIL 3IFOA 5MI0B 1L0QA 1RUAL 5AWNL 1KJVB 2AXFA 4HGWA 1DBKH 5A1AA 5AUMA 3S37X 2V9RA 1W8NA 3WIFA 4NQDD 1CXIA 1KUMA 2YD1A 4U7MA 5ELIA 3O8XD 1FE8H 2ERJB 3FAXA 1CFSB 2FH8A 1FZJB 3FB5A 4XC3H 2ILLA 3SCMA 2E7BA 2FLBT 3MRCB 4HXAH 1EO8H 4J6RH 3UZEA 1WWCA 1CDYA 3RWIA 1UKTA 5IESH 3N1MC 5HDLA 3UJTH 5IOPB 3FB6B 4CAGA 4MX7B 3ULUF 4GMSL 3WDHA 1RUAH 5AWNH 3QXUA 1J10A 2EC8A 2YD2A 5DK2B 4PJXF 3MRHA 5DQJA 5DD0L 3WS3B 4PP1D 5JHDB 1CTNA 3F7QA 4CDGC 3WNOA 3LD8C 5EBMB 4PJGA 5IHBA 3TBTB 5I1EH 5LGHH 4Z7UB 1BQLL 1CD8A 1UXWB 4GMSH 4P2OC 4ONHA 3RZCB 2VDRL 4D9QD 4OZ4B 5JQ6L 4K7PY 3RU8H 4JDZB 4OLVL 1R5IA 1A21A 1DVFC 3WNLA 2XXMB 4MVBC 2QADD 1YEJL 4NQEB 4AJ0A 5CIPH 3T4YB 1ZA6A 3KYOB 4PJDF 3PDDA 4TSCL 5D2LA 3QT2A 1S9XB 2NY4B 4XHJD 3STLB 3OAZH 2Z35B 4GG8A 2BSED 2DQIH 1BQLH 3P0GB 5BS0E 1AGEB 4KV5E 5ESAB 5DEFB 2VDRH 3UBXA 1F6FB 2DKUA 5IJVA 1AGBB 3N50A 4NO2A 5JQ6H 1S5HA 3PDOA 1SQ2N 2HG5A 4OLVH 3SDCC 1A47A 2RCSH 3DVGA 4HS8L 2UUDH 4LVNC 2FYYA 3TF7C 1LNUA 1KNOB 3P30L 2KDGA 4LPVA 1R3LA 1T1WA 2DMCA 1JTPA 4IJ3C 4I18B 1JCKA 4ENED 2ZOKA 3T0VA 4M7ZC 3S34L 2P5EB 4TSCH 5DHVB 4ZFFA 5D72H 3I02B 5JR1H 2HLAB 5FYLL 2EIZA 4HWNA 4GXUN 2WINB 4OIIH 2JB6A 1IE5A 5KVMC 4I2XE 4C56D 4J3SA 3ARRA 3WNNA 1ADQA 4PRDB 1Q9OA 2Y36L 4HS8H 1C16B 3OAUL 3OG4B 2J2ZA 4D9RD 3VMOA 3TH3T 1QYGH 1QLEL 3I50H 2RBLA 1OGAD 5IIEA 1CFBA 3ME0A 3S96B 4RAVB 4Y4HA 5FO7B 1H0DB 4FXGB 3FQUB 1TZGL 4I0PC 4L4VE 4PRHD 1MLCA 4M1GL 5DJ0B 4DK3A 4ZSOA 1CE6A 5T1KA 4KKBD 1TCRA 2GSIA 2XV6B 3LY6A 2DJSA 3BYYA 2J6EL 3UYOD 4GG6E 1FRGL 1BM3H 2BNRD 2XWBB 4UIMB 1S7RB 1I1FA 4X6FA 2BHYA 3C6LB 4QOKB 3BDBA 1PAMA 1YN6A 3OAUH 4PJ5B 1BREA 3PL6A 3X11A 1QNZH 2UWEA 3WFEL 3WIHA 5F9WC 1AGCA 3VGEA 1II4E 2XXCB 1TZGH 5JTWA 2R56H 2ZNWA 4M1GH 3VG0L 4AENB 1VB9A 5DMJB 3BP7A 4XMLL 4XCYB 3OL2A 4CVWA 3FTGB 4KKCC 2JF1A 4CNIA 3L3OB 1P4LA 5FA3B 3QR2A 3T77A 1FRGH 3X3FL 4EDWL 1MCNA 1JPTL 3WE6A 5AG9A 1PYWB 4I4WB 5F89B 4ACPA 5GSRB 2VL5A 1CDGA 2EDOA 3WFEH 5CGYD 3EO1A 3E1F1 4G6ML 4M5YL 5CJBA 4LRIA 5J6HB 3OKKA 1VADA 4JPWH 4PJ7A 3UC0L 1ZVYA 5EFIB 1SBBA 1G6RA 4RISL 1IGYB 2FX8L 5C08E 1BHGA 1KB9K 4QT5B 5EZOL 5C0CE 3A6BL 4QHKI 5KVGL 3X3FH 2CDEB 5D9SA 1JNNL 2X44D 3MLTB 4EDWH 1JPTH 2QQNL 5KS9A 1Q0XL 3KPSD 2BVEA 1JHLH 4KK8C 4ODXA 3BH9A 2RGSA 1D9KC 3L3HB 4LDOB 3GRWA 2FB4H 3QNZB 1NCTA 4M5YH 4G6MH 1HXMA 5INDA 4LLMA 4U3XA 4AEHL 5TE6H 4XI5C 2YEZB 4WI5A 3UC0H 2X1QA 1EBAA 3REWA 5I66A 4RISH 4R0LA 4OCYL 3QIUD 5EZOH 3RUGB 1DR9A 3H8NA 5HYQA 3KR3L 3T0ED 3A6BH 5KVGH 1LE9B 4WUKH 1WFUA 1JNNH 5DJYB 5I19H 1Q0XH 4K8RC 4MQ7A 3JWDC 2ITDA 3M8OL 1KULA 4NDMB 1V3LA 1VKXA 4WTWA 2QLVB 1HHHB 1DQMH 5D7KD 4HMCA 5BZWA 4NWTH 5DSCB 3SEPA 3D0LA 4PUBL 3TO4A 3CFEA 4AEHH 1CYGA 1UJTA 5IKCB 1HH9A 1MHHA 4KPHL 5I16A 3UTSB 4OCYH 5E8DL 3TPUB 3VRLE 4DAGL 3GSVB 2PXYD 1J05B 4KV5F 2NXZC 2CLRA 4JM2F 4BFIB 1Q94A 1KJ2L 5ADOL 5I18L 3DETD 4NKOA 1OP9A 4GRLB 4HD9A 3M8OH 1IQDB 2C9AA 4XNQA 4U1KB 5GHWL 2CLZB 1BJ1H 1A6TA 1TLKA 4HWEH 3VFOB 4N8CL 4L3EB 4PUBH 2A83A 3GMOA 1FNFA 3LKOA 4YH6A 3PP3K 4CGTA 4KPHH 1QA9B 5E8DH 2PCPB 4BUHA 4ETQB 4LPCA 1IC5L 4P9HL 3HCVB 1UYWL 5HI3D 4E41D 4I5BB 1KJ2H 5ADOH 3CSGA 5I18H 5DYOB 4LCIL 2P24B 3VFWA 1W2KT 4CW1A 2DJUA 4QRUB 1SJHA 1UM5L 5GHWH 3U82B 4NSKB 2Q3AA 3VWJD 2VXVL 4D9QE 1MF2H 2E6QA 2W65B 3H42H 2AEPL 3FQWB 4HT1H 4EBQL 4LHQB 4IBLT 3DBXB 4OV6F 3VJ6B 3F12B 1IC5H 4P9HH 3V8OA 1UYWH 2R0ZL 5EU6A 2NMSA 2MWCA 4M62L 3IAPA 2FHBA 5DQ9A 3QUZC 3MRLA 4HMDA 4GG6F 4Y2DC 2NY2B 4X4ME 1FHGA 2YS4A 4ZUTB 5HYSB 2AV7A 3P4LA 3SJVD 4BSWB 2C3HA 1XH3A 1UM5H 5EOCJ 4UINL 2VXVH 3P9MA 1G7QB 4YFDB 2IPKA 2Z92A 4TUJA 2AEPH 3BKML 4NQXA 3W2DH 3REVA 3V4VL 4HFWB 3ARTA 3C5SA 3RNQA 4MGXA 3MCLL 1XR8A 2CIIA 1FFOA 3PNWB 2R0ZH 5L7XH 5I1LB 2Z31B 5E8OA 5FUCE 1Z0MA 2FECI 1S9WA 3DV6A 2D31A 4BA8A 5DUBB 3TBWA 3BP6A 4C56E 5TGBB 3U9UB 1S7UA 4PY8J 3EYOA 5L2KB 1H5BA 1HQRB 3RAJL 3VGAC 2WIIB 5J8OA 4NUJB 1XGUA 1B2WL 3OKEB 1EAJA 4IIQA 4P4KC 4D9RE 5A2IH 4NC1E 4GW5A 3MRFB 4JPIA 4HUMB 2R2BB 4ALAL 4LCUB 1U95A 3BIKB 4PRHE 5E7BA 3BD5A 1HIML 3T3PE 3EYQD 3NCEB 3FO2B 5HI5D 4U1IB 5BRZB 3U79A 3RVXC 2X4OB 5CILL 43CAB 1J9CT 2LTQC 3RAJH 4OI7A 2BNRE 3PE9A 3CUPA 3TV3H 4F15C 3PWUB 2X4SA 1TVBA 5DMKA 1RU9L 1XEDA 2WMPA 5FECB 3JXAA 1AO7B 3VA6A 1G7HB 3FRPA 4ALAH 5ESQB 3NPSC 5L8KB 4G9FA 1AC0A 2PETA 1LVEA 3D3VD 3HI6L 4JM4L 1X9QA 1A6ZA 2EE2A 2OCFD 4ODVL 2BOBA 2FECL 3RWFB 3V5DB 4FQPA 3AS3A 1KN4H 1AKJA 5CILH 5TE7L 3OKYA 5IW1A 5ESVB 3D25A 3ZHKA 1ZSDA 2P49B 3HUJB 1EJ6A 4PG9A 4KY1H 1FO0L 4FXLA 2L4OA 2NY3B 4F7PB 3CLFL 3VRLF 3B5HA 3SDDD 3PIQA 1M05A 2BNQD 4NQCA 5HHVL 4CMHB 2E9BA 1NFIA 3H9SA 4JM4H 2VXQL 5HHOB 5J11B 3RDTC 4DW2L 1XFPA 4ODVH 1WC7A 4I0CC 1RIVL 2BY1A 5DMGC 2NTFB 5TE7H 4X6BB 2YUWA 2C1PB 2B20A 1NAKL 1KV3A 3KPSE 4WWKB 2F8XC 3SE3C 4OD2A 1FO0H 1ZWIA 4JFFA 2HJKA 2R9HD 3CLFH 4JVPA 4QLRA 2GJ6B 4NBXB 3PGDB 5MEQB 5C09B 5HHVH 4LLYB 1JVKA 2F53A 2VXQH 4YXLL 3GFUA 5CZXD 4DW2H 4NBZB 4LSSL 4QTHA 4PGCB 1PSKL 1RIVH 1D6VL 3PGFL 5LBSL 1HI6A 4K9EC 1Y6MR 3T0EE 3T08A 4MCYB 5CMAA 2W0PA 4HV8B 2ATPB 1VFBB 1OT2A 2B1HH 1ED3A 5JW5B 3VE0A 4F33A 2E9IA 3MMEB 3RL2A 5GGRA 1X5XA 5L2JA 3NZHL 3BQUC 5D7KE 3RZWA 4YC2C 1R5WB 2CJUH 3G5XB 3L3DA 5IMMB 1U8LA 2KUTA 3R4DA 2PW2B 2XNAA 4Q6IC 5D1XD 3RTQA 3L7EA 4YXLH 2F15A 4FS0A 4L3EE 1LMKA 3B2VL 4WRLA 3ES6B 2ZPKH 4XXCA 3EAKA 5AAMA 3SKOB 1PSKH 2OTUA 1QVOB 2BC4A 4JREC 3D39A 1X5YA 5HGAB 3U0PA 5IV2B 5IWLC 4PJEA 3M17B 2QQLL 3SGKA 4XWGL 5ICZA 4KJPD 1P1ZA 4Y19D 4HIJA 1T4KB 1CN4A 4OLUH 3NZHH 2XY2A 1Z5LA 4R4BA 4XCFH 5SWZA 1A2YA 2VITB 3IU3B 1K8DB 1A0QL 4PBXA 3BUYA 5FM4A 1GGYA 3ARBC 4GW1B 3B2VH 3ARQA 3NCYP 2VR9A 3MBEB 4Y1AA 2J88L 4RGMB 2WV3A 4E41E 3BO8A 2KPNA 4MJ6B 3HMXL 2F74B 2QQLH 1I7RB 2AXGA 1X5IA 4LK4A 4UMGA 3QEQB 3OB8A 4NUGL 5FB8B 4FQJH 1IGFH 1L4IA 4Y16C 3QULA 5EO1B 2D7NA 4FOMA 4K2UH 4P9ML 2AK4B 4YWGH 2DQGL 1A0QH 1YEDB 3GBLA 2DQHL 3G9VA 5GGVH 1P9MC 3G08A 1IQWL 3W5NA 1UA6L 2BY0A 3MO1B 4GBXA 1W0WB 2CLVA 2P45B 3T3PF 2BSTA 4N68A 3VFTB 3PWPA 3RVVC 3SDYL 2EICA 3A6OA 3HMXH 1AH1A 4GJTB 5GIRB 1AQDA 8CGTA 2CUIA 2BMKA 2VL4A 5F3BA 3SJVE 5HDQL 4WI7A 1A9BB 4LPYA 4MA7L 1XF2A 4MD0B 1A1NB 2AJUL 5EBLA 2HT3C 4O4YL 4PJ8C 2IAMD 3NCFB 2DQGH 5EU5A 3VWKD 1YY8A 3WLBB 4KDTA 1U42A 3BEVA 2XKSA 1HDMA 2V2WA 3QQ3B 1IQWH 1IAKA 4WEMB 2BVOB 2GCYA 5EUKB 2YBRA 3KPRD 1HCVA 1JPGB 4APQA 3SDYH 5L88H 3PABB 1CVRA 1HKLH 3P0VL 1U3ZA 4FZEL 2I27N 5IJKA 4OCXH 5HDQH 2JIXD 3HZKB 4NYLB 1A7OL 4MA7H 4HLZH 4XCNB 2AJUH 5J1TC 1OAZL 1MHEB 5M7QA 3WKML 1BWMA 2QJDA 2IFFH 2Y4SA 4H1LG 4PB9L 4PLKC 4UQ2B 5E6IB 5D7LB 3ROOB 1KYOJ 2JTDA 3QUMA 1DJSA 1LEGA 3TCLA 8FABA 1VFUA 3FN9A 1EA9C 3WJJC 1PQZA 3ESVF 1JE6A 1MFBL 5H2BB 4XPBL 3QZWB 2YA0A 3P0VH 4YHPA 4FZEH 5ID1B 7FABL 2F54B 1EFXD 3GK8L 1A7OH 2H2PD 4MAYC 4BFEA 5IR1A 1OAZH 4XBGB 3CU7A 3WKMH 5FKPA 2XZQL 4PB9H 1DTUA 5FDWA 3ARGA 3BP4B 1NC2A 3VI4E 4FQXA 4Z5RA 4YAQA 1NEZA 5EC2B 3H3BC 5IB4B 1H3PL 5E08L 4XPBH 2VB5A 1KTLB 1AIFB 4M03A 2IF7A 4JZOB 5KZCB 4EUPA 2IGFL 4KU1A 1KGCE 3GK8H 4AT6A 5FV2A 4NZTL 3S3PA 5DVLA 4NIKB 5HHOE 1GC1L 4M00A 4P2RD 5F7DA 1NGZB 2A73A 1E4KA 3JSSA 2XZQH 3ZT6A 1CS6A 1MCOL 1JNJA 2G9HB 5AZ2L 1LHZA 5I75B 1FNAA 3DPBA 1Z3GL 4ZS7H 4ZAKC 4IRZL 3G5VA 1L0XA 1XCQA 2AV1A 1H3PH 2YD4A 4M6NH 2AJVL 2BNQE 5HDBE 5B4MC 1BBDL 4KC3B 1OTUD 2IGFH 1K2DB 3RY6C 4PBWD 5IW6B 3EO0B 4NZTH 5F70A 1CXHA 1VEPA 3OKLB 1GC1H 5GS0C 3LD8B 3HRZB 1O7SA 4PJAB 3BAEL 3JTTB 1JNHB 1MCOH 3MCKB 4WEBL 1PEZA 5AZ2H 2Q86A 3S4SG 1Z3GH 2BSSA 2ARJA 1F97A 3MJ8B 4P2OB 2X4PA 4LGSB 1T20B 2HH0L 4LQ1A 4P5TA 1JF6A 1U41A 2AJVH 1BBDH 2VE6B 3PXJA 2BVPA 4ELMB 2V9QA 1Q9KA 3QBTB 1KJMB 1ZKAA 5C08A 5C3TA 1AY1L 2IALB 3VH8B 2BHUA 3TN0C 1KYOK 2I5YL 3DVIA 2EE6A 5D1QD 4XBPA 4P49A 5I9QC 1Y18A 5DI8A 3ULSA 3V8CA 2R0KL 3GJFB 4CRPA 3H3PL 1JL8A 4WEBH 4CKVX 2XTJB 4NFCA 3CDFA 3W9DB 1MHCA 1ZHLA 5TDNA 3OTTA 1XGPA 2YN3A 5ILTL 1WFNA 1VPOL 1KJVA 4LVNB 4EQ3A 5ICYB 1AY1H 3NN8B 4IJ3B 4A6YB 4QY8B 5CD5C 5C9JB 1G7MB 5HHMD 4M7ZB 1CFSA 3MRGB 4QRSB 3VFNB 5F9DC 3H3PH 1FZJA 2H32H 3MRCA 4CU8A 3VXRB 4Y19E 2VLKB 4V1DB 3TP4A 1QEWB 3FB6A 5IOPA 3U0WH 1FCCA 4MX7A 2IWGA 1UH3A 1B90A 4A2LA 3WNMA 3UX9B 3L9RB 5DK2A 2P4AB 4JR9L 4PJFE 2NLJB 3VFGL 5I0ZA 4QEGA 3WS3A 5JHDA 4I0PB 3RGVC 4WHTB 3QA3B 1XIWB 3MODL 5EBMA 3TBTA 1RZIB 4Z7UA 2M1KA 3DWTA 3QDAA 1UXWA 3FB7B 3RZCA 3RRQA 2RIKA 3PHSA 3WNKA 1PW3A 2E3VA 4CBPA 4ODTL 5JPNB 1OSPL 4OZ4A 5T5FH 4WIQA 4JGJA 4JDZA 1JTTA 3EO9L 5EDXA 5F9WB 4P3DB 4L1HA 4NQEA 4M43L 3T4YA 2KQMA 2A6JB 3KYOA 3MODH 4EJ1C 1HHGB 1S9XA 3HHRB 4PV9B 3STLA 3U1SL 3VI4F 5DVMA 2Z35A 4U49A 4J3TA 2VISB 3QIBD 4EN3C 1CR9L 1AGEA 2AJZB 3SO5A 3FFCB 5ESAA 5DEFA 5JOFB 4MQXD 1YEKL 4OCWL 1AGBA 1DQDH 5HI4D 1SEQL 4OM0H 1U2CA 1I85A 2OJEB 1UXSB 5ICXB 5CJOH 1D9KD 3QPQC 4ZS6D 1N5YH 1V3JA 2CMRH 1KNOA 3EJYC 1X5KA 4M3KB 5IFJB 4I18A 5DRXB 2P5EA 3OBAA 5DHVA 3DLQR 3I02A 4IRSC 2YA1A 2HLAA 3TIDB 3U1SH 1YMMD 2WINA 3JWOL 1CR9H 3T4AB 5AAWA 2F54E 2ORBL 3HPLB 1X4YA 4HIXH 5HDBF 1K5NB 4PRAB 1BD2B 4OCWH 5HJ3B 1SEQH 3MPCA 2VDQL 4PRDA 1FORL 3ZL4L 2R2HB 1MFEL 4LAJH 1C16A 4P46C 1LO4L 3S96A 1MRFL 4RAVA 4HCRA 1QTYT 3O4LE 4HC1A 5FO7A 1H0DA 4FXGA 4QWWD 1OTSD 1PG7L 3FQUA 5DJ0A 3U6RB 3JWOH 4U05A 5DT1L 3VGBA 2WBKA 2ICWB 2ORBH 3G6JE 4AMKL 5DK3A 2AJYL 1PFCA 2XWBA 2VDQH 1OB1B 4UIMA 5CUSH 1S7RA 1IAOB 1MFEH 5IVNA 3DJ9A 3RNKB 2P48B 1SMOA 3C6LA 4QOKA 5E2VL 4PJ5A 1CD1B 5FGCB 1LO4H 1OW0C 1O0VA 2OQJB 5FV1L 1MRFH 2NY5C 2IAND 4MD4B 5D6DA 3LSOB 4CVXB 2NXZB 2DWEB 5DT1H 1G7IB 3PWNB 4AENA 4JY5L 4P2RE 4XCYA 3FTGA 1CICC 4AMKH 5DHYB 2AJYH 3L3OA 4IEFB 5FA3A 4TOYH 3B83A 3UZVB 5GRUL 5LGJB 4Z7OE 4YDKL 3HG1B 1PYWA 4I4WA 5F89A 5HD8D 3QJFB 5E2VH 1MCJA 5GSRA 3DYOA 3BKYH 3GZKA 5LG1A 4FQ2L 5T3ZE 4YPGB 5J6HA 1ADQL 1GRWA 4L5FL 4UT6L 5EFIA 2XY1A 2X4UB 1IGYA 3GJEB 3VXUB 4KHXL 5BOPA 3OHXB 4QT5A 4EI5C 1KCRL 4IOSD 4QHMB 2C3WA 5GRUH 4YDLC 2CDEA 3MLTA 4YHOL 4YDKH 3NAAH 5SX5H 4J4PC 3KPTA 1LDPL 5CZVL 3L3HA 4PJFF 3JV6B 2V2TB 1UADC 2YC1B 1QFWM 3QNZA 3ZKMD 4KZDL 1ADQH 1JJUA 1G9ML 1X5AA 3QDGB 2YUZA 2YEZA 4HBQA 4L5FH 4UT6H 2BVUA 3ARDC 4ZTPL 1TVHB 3QUZB 4YX2H 4KHXH 4Y2DB 3RUGA 1KCRH 4R90L 1WSST 2F19H 5JPMB 1LE9A 5FA4B 3WIHL 3MJ7B 4OCRL 5DJYA 4YHOH 3LRHA 1B3JA 5DJCA 2IPTL 4UT9L 4X9HA 4P99A 1LDPH 5CZVH 4NDMA 4NO5B 4KJYB 3LB6C 2W0KA 2VABB 3VXMD 1D6EB 3VXRE 1HHHA 3TZVD 4OZHE 5DSCA 1EUTA 4KZDH 2I07B 1EGJL 3LPFA 1G9MH 5IKCA 4Y4FB 2VUOA 5DR5L 1G1YA 3UTSA 4ZTPH 3TPUA 5I71C 3GSVA 3UMTA 1I3UA 1J05A 4LARL 4BFIA 2WBJC 5HYJB 4KKLD 4WDIB 4NQDB 4RFOL 4GRLA 2IPTH 2HP4A 4UT9H 1OTTC 1X5JA 4KHTL 4O2CB 1L6XA 1IQDA 4ZOBA 5FYLD 1JZ8A 4U1KA 4AEIH 5JIIA 2CLZA 2NTSP 3VGAB 3MCG1 4FFZL 3MRJB 3SGEH 3VFOA 4L3EA 5IMLB 3SKJH 4P4KB 5BQ7B 4G3YL 1EGJH 4RGOL 4TVSa 5DR5H 4LASH 1QA9A 5C0JB 5L8LB 2KH2B 2PCPA 4ETQA 3B8SA 4LARH 2Q8BL 1UZ8B 1T2QH 3HCVA 4PY8I 3GRWL 4I5BA 4NO3B 4AM0B 5DYOA 4NCDA 4RFOH 1FVCA 43C9B 1Q9LB 2P24A 4N5ED 1WIUA 4KHTH 3O3DB 5E95B 2E6PA 1BECA 4FFVC 3IETB 4RMQA 3E6HB 4QRUA 3PQYE 5HPOA 4NSKA 4FFZH 4K3EL 4LEXL 3HI5L 2W65A 3SGJA 4F15B 1DQQB 3FQWA 2RAMA 3LV3B 5FUZL 1BAFL 5CEZE 3NFNB 4YHYB 3VJ6A 3NPSB 3F12A 2Q8BH 4IDJH 4HF5L 3G6JF 4L9DA 4MXQD 5EOCL 3RA7L 1FFRA 3GRWH 1EHLL 1AHWC 4JRXD 4ZUTA 5HYSA 4BSWA 3GSUB 2WUCH 4N0UE 1ORQB 3WNPA 5EC1B 1ZAGA 2A9MH 5CLWA 1G7QA 3D85D 3JWNC 5C3LD 3WCYA 4GFTB 4PRIB 1TNNA 3BDYL 3SE9H 4NWUL 4U0RC 4HFWA 1CFNB 3TBSB 4HF5H 4MNHB 3PNWA 5EOCH 3RA7H 4NHCH 4OGAD 1RZFL 3RDTB 1EHLH 5I1LA 2Z31A 4QGYA 4G6JH 4Z7OF 2GQHA 2UZYB 2B5IC 2EC9U 3V2AR 1T7XA 5DUBA 1U3HC 5TGBA 3U9UA 1VERA 5L2KA 1HQRA 2CKNA 1KOAA 3MYZA 2WIIA 4NUJA 6FABH 3OKEA 1KPVB 3BDYH 4NN6C 4NWUH 2I24N 3FHQA 4J8RB 4JQIL 4RDQG 3VXQB 2YPLB 3MRFA 2DN7A 4OIBA 2R2BA 4Y4KB 4LCUA 1ND0B 1J0JA 1IJ9A 3BIKA 4JZJC 3RQ3A 4QRRD 2VR4A 3F6LA 4HKBB 2XG5A 3FO2A 3PXHA 4NKIL 4U1IA 2H45A 4Q2ZB 5BRZA 3LPWA 1ZS8B 2X4OA 1OGAB 2CKBH 43CAA 2IBGA 4JKKA 3U0TB 5I8CB 3ILPB 4ZUSB 3QP3A 4WCYL 3TNNB 3IDIB 3BQUB 4YC2B 3PWUA 4JQIH 1WTGT 2JJTA 5FECA 2ADFL 3HG1E 1AO7A 1PBYA 1G7HA 3BPOC 1QSFB 1F4WL 5ESQA 4NO0D 3NBNA 2V5YA 4JREB 3MBXL 4EDXB 3TJEH 4B41A 3MV9B 5E2WL 5DHXB 4NKIH 3RWFA 3V5DA 4PTTB 2EDFA 4PTUB 3ARED 2CXGA 4OZHF 1BIHA 1EEZB 5ESVA 1HYSD 2DQJH 4POUB 2ESVB 3HUJA 1PZ5B 2XG4A 4U4BA 3OJDB 3DRTB 4F7PA 3V95A 2E6JA 2YPKB 4L9LC 5ALCL 4YJZL 4KJWD 4WFHD 2HYMA 3GB7B 4XRCB 4ZOEA 3ARBB 5DO2C 1F4WH 4D3CL 4OFYD 3U7WL 5F1OB 4JHZA 5KTEL 5HHOA 3MBXH 3UTTB 2V5TA 5IMKB 2BK8A 5E2WH 3FQNB 2NTFA 3ECBB 4X6BA 1WCBB 2C1PA 1J8HB 4C83B 3C8HA 4MCZB 1GYAA 2GJZB 1TVDA 3ZKND 1NAMB 5ALCH 4BSVB 2GJ6A 3T0WA 3PGDA 4LCYB 5DQDL 4PLNC 5C09A 5MEQA 2H2SC 4JFHD 2JJUA 2CK0L 4CN4A 4LLYA 3FT3B 5KTEH 4XP6L 3LZFL 4HJJL 4NBYB 4WUUD 5GRWA 3ULUH 4PGCA 1SY6A 1NGWB 3ARFC 3MRKB 4MCYA 4BQ8A 5F7UA 4HV8A 2YXFA 2ATPA 1VFBA 3KLSA 4HMEA 5JW5A 5D2NC 1IGJB 3VXPB 3VD7A 5HYJE 1GIGH 1ZLWK 1HINL 3ULVL 2L0DA 2Z8VC 4PJ8B 3ZSTA 3MMEA 4TPRL 1A7PL 4S1RL 1R5WA 3G5XA 1QUNA 5DQDH 5IMMA 1MAKA 1OVZA 2EDTA 2CK0H 2PW2A 1CFTB 2IG2L 1A7RL 4X7EC 4XP6H 2CPCA 1JZ2A 3ES6A 5CS7A 4IS6B 1MCDA 5E03A 2FATL 3SKOA 1QVOA 1G0DA 5F8QC 4HEPG 4OZGE 4YGVB 3RWGB 3CPLB 3PL6C 5HGAA 5IV2A 2J5LC 2JCCB 1AR1D 2XQYK 3ELAT 3M17A 4X9FA 4RMRA 4HJGB 4NKDB 1HINH 3ULVH 5FYLE 2PXYB 5DD5L 1T4KA 5ACZB 4PV8B 4W68A 5HDOA 5ISZD 3BE1L 2GYSA 3WUWB 4TPRH 3J8F7 4KRPC 4DVRH 3BJLA 1CLZL 1XF1A 2VITA 4QRTB 3GSRB 3O45B 3I84A 3IU3A 1K8DA 2IG2H 2R29L 5I1IL 1A7RH 1UWXK 4MYWB 4GW1A 5C0EB 5CAYB 2FATH 2Q87A 3MBEA 2E27L 4L4TD 5CJXA 4MJ6A 4U2YA 1G84A 3CC5B 2F74A 1I7RA 4MAYB 3QEQA 5FB8A 3VMPA 4JO4H 4WI2A 5DD5H 3I6LD 3BE1H 5EO1A 5GXBB 1TQBC 2AK4A 1WZKA 3MUY1 1NBQA 5I1IH 2AQ2A 1YEDA 3VFUB 2FBOJ 4NZJA 4IRJD 4HKZB 1X5ZA 3MO1A 1BZQK 1KEML 1N3NB 1W0WA 2E27H 3VWJB 3VFTA 2A9NL 4PRIE 2J8UB 4TN9A 4ZNEE 5D7JC 5GIRA 1ACYL 4JRXE 3KLDA 2YD9A 5KOVC 1A9BA 2APBA 4B50A 2DQTL 1CZ8H 1A1NA 4MD0A 2G5RA 1NJ9B 4ZXBC 4F57L 1H3WM 1S7WB 3WV0A 4ZAKB 3QUXD 4BK5A 3SDAC 1KCKA 3WLBA 3ZDZF 1NCCL 1HWGB 4XZUB 3QQ3A 3QI9D 4MDJB 1KEMH 2BVOA 5EUKA 4JG0L 1JPGA 4XP5L 1RSFA 2D7OA 1NQBA 3MRDB 4D0DB 2Q76B 3C6SB 1DQJB 3Q3GB 4W4NA 3HZKA 4NYLA 2DQTH 4XCNA 3OSKA 4F57H 2DLHA 1MHEA 3HC4L 2ZP0T 5C86A 4UQ2A 4UOW1 5E6IA 1I4FB 4XNZB 1NCCH 1XT5A 5D7LA 3ROOA 3DHJA 3BX7C 3PWJB 4DWHA 5BZDB 1L9NA 3LOWA 5DEZA 4XP5H 3OX8A 2VLRB 3QZWA 1YNKL 5JXAL 1IAII 2BXYA 3TN0B 4QRRE 2F54A 1QSFE 3UAJC 5I9QB 1NFDB 4XPTL 1N4XL 4EIZC 1U8KB 3B6SB 5DGQA 4XBGA 5FHBL 1WZLA 3HC4H 2UV3A 4HWUA 4OGYL 5I0DA 4Z95L 2J8OA 3BP4A 3PP4L 3KJ4C 4AK1A 5T1DL 4KK5C 2ESVE 3WIIH 5EC2A 1BF8A 4IOFD 4YBLC 5IB4A 3UPCA 3VDBA 1KTLA 1AIFA 1XF3B 1YNKH 4JZOA 1NEUA 5JXAH 5GRXG 4R4ND 1XCTB 5DFVD 2NY1D 3WJLA 4G5ZL 4UDTB 1UB5B 3S5LB 1N4XH 3UTTE 5FHBH 1NGZA 3RVWD 3D3VB 1DZBA 3MV01 4OGYH 2ENYA 2G9HA 4NQVA 3CJJA 1BVLB 3PP4H 2JB5L 4U6YB 1GGUA 4HZLB 5LJYH 4MXWH 4WFHE 2EXWD 4C4KO 3MRNB 1UG9A 4BQCA 4OZGF 4ZQKB 4O58L 1K2DA 1MCEA 2AABH 2OBGA 1RUKH 2EECA 4G5ZH 1IAIL 5IW6A 3EO0A 3QUML 4KQ4H 5ANMB 3OKLA 2J1KA 3RGVB 1ZLVK 1INDL 3JV4B 5MEND 5T1LB 4JRYB 3HRZA 1DLHB 4PJAA 3B2UC 3JTTA 1JNHA 3MCKA 3SE4C 3MNWB 2FIKB 5K59E 3F62A 4GXVL 4JO3H 1KTKE 3MJ8A 4ODBD 4P2OA 3ETBF 1T20A 4JFHE 1T7ZA 3QUYC 4POZD 1D5ZB 4ELMA 1HEZB 1E28B 4H0GA 1H5BC 1KJMA 1J7VR 3F6IA 4WUUE 2IALA 3VH8A 3QUMH 2EDWA 3TH2T 3L3IB 3U9PL 1INDH 2GFBB 3DMMC 4HG4K 1MIML 4N8VG 2IBZY 4I1NB 3AB0B 4EN3B 1RPQA 5GRZA 3W9DA 2ATKB 4GXVH 3I6KB 2Q3ZA 4RGND 3EOTL 2EKJA 1C08B 1CK0L 4R26L 2NY6C 1IKNA 4KVNL 4QCIB 3W9EB 2ARJQ 1HXYB 5ICYA 4U6VL 3EZ8A 3NN8A 5DD3L 3MC0A 4QY8A 4A6YA 5C9JA 1G7MA 3U9PH 1NGPL 4RX4A 4IRSB 5GGTL 2R23B 1JPSL 1MIMH 3IGAB 2WQRA 3MRGA 4QRSA 5DD1L 3VFNA 1YJDL 4G43B 1IGTB 3VXRA 3EOTH 2VLKA 1CK0H 4R26H 2EYSB 4V1DA 1QEWA 3O2VL 4KVNH 3LRSB 4KGJA 4Q97A 3MA7B 4P46B 3L9RA 5DD3H 1NCAH 2WAHA 3D2UB 5F1NB 5SV3A 3S3SA 2GY5A 4JZNB 3EIFA 3HE7D 4KK6C 3MJGX 2NLJA 2IADB 3L3JA 1NGPH 3ZDXF 5GGTH 1JPSH 1CDHA 4I0PA 2X09A 1YJDH 4WHTA 2Q8AL 4PGJA 3QA3A 1XIWA 2P44B 1ZEAH 1RZIA 5IG7B 3I6LE 5ID0B 1N5AB 3O2VH 1CGWA 1MWAB 4U6HB 3FB7A 2XN9B 4N9OB 5JPNA 3V0VB 1OP3H 3IDNB 3IKCB 1RFDH 1EVUA 4P3DA 1I75A 5E2TL 5AD0B 5DMYA 1S9YB 5HGGS 2A6JA 2Q8AH 5A16B 1FAIL 4MAUL 3STBA 5IB3B 2FRGP 1HHGA 4K07A 1CICB 4PV9A 1CTOA 2ICCA 3QUKB 2VISA 3A6CL 2AJZA 2GKIA 3PHOB 3TWCH 3FFCA 4X8XA 3H7LA 5JOFA 2NZ9C 4WVRA 2K9UA 1I1YB 4X7TB 1NL0L 3ARVA 2OJEA 1UXSA 3FN0L 4J4PD 5ICXA 3RP1A 2K1MA 1BWWA 4I3RL 1CDIA 5IFJA 5E2TH 1MY5A 4M6AA 4JCLA 5I1GH 5DRXA 1T22B 3BGAA 4MS8C 4XC1H 3MUGB 1FAIH 1SYVB 4MAUH 4JKWA 4DZBB 4YEFA 1LQSR 3TIDA 2WUBL 4U1SA 4EI5B 1JP5A 3MX0A 1W0YT 3T4AA 3A6CH 3L5HA 4POYA 4YDLB 1RJZB 3HPLA 3O6KL 3CFJB 1NFDE 1T2XA 1K5NA 2RQ8A 3C5ZD 1HHJB 4PRAA 1BD2A 4F2MB 5HJ3A 1CQKA 5D1ZC 4RWYL 5DJ8B 1NL0H 2R2HA 3FN0H 4WTZA 3DVFA 4JY6B 4I3RH 1MVFA 4UTBL 3D6GA 5GRVK 3U36B 1HNGA 4MNGB 2ZUSA 4RDQF 2ZUVA 3RVUC 4GQ9L 3ARDB 4HH8A 1QQDB 1QBAA 2WUBH 1NUFA 3MLXL 4PB0L 2ICWA 2A1WL 3O6KH 1JYNA 3W81A 5DD6B 5GSVB 1OB1A 4RWYH 4M7JH 1IAOA 2NR6D 1OTTD 3F58L 3RNKA 3RX7A 5GGUB 1CD1A 5EA0H 4OLZH 4UTBH 1K6QL 2OQJA 4WU7B 4GQ9H 4YIQB 3RI5F 4MD4A 1TMCB 5I71B 1CIDA 3FO1B 5F9AC 1O7VA 4F37K 2B2XL 3LSOA 2AI0L 2DWEA 1G7IA 3PWNA 3MLXH 4PB0H 4YBQD 2P8MB 4TVPL 3UJIL 1S9KC 2A1WH 4LSRL 3OR6B 1BZ9B 5DHYA 3WFDL 2OR8A 1AQKL 5ANME 5EORL 1MCWM 1DE4B 2HWZL 5K93A 2GI7A 1BJMA 1XF4B 5LAXB 3L1OH 1O5DT 3VGFA 1GVIA 3HG1A 3F58H 2M8XA 3QJFA 3V0WL 4MD5B 4FFVD 3FB8B 3EJJX 1K6QH 5B38B 1RZKC 4J3XA 3QXAB 3QB7C 4OUOA 4YPGA 2QHRH 3TA3D 2B2XH 2X4UA 4KDTC 5J89A 4TVPH 3UJIH 3GJEA 3VXUA 4LSRH 3OHXA 5MENE 1S78D 1YEIL 4QHMA 4BH7B 5EORH 4TSAL 4ZPTB 4APQC 2DYPB 3DXAD 3GMPB 3QDMB 5DHVH 4HC1L 5IJKC 1FP5A 1FLTX 1TETH 1WFOA 2QL1A 4WWID 3V0WH 2ZG1A 1ZLSH 4HW6A 1DEEB 3JV6A 3BHBB 2V2TA 4TTDC 4RMTA 2YC1A 4K3DL 2DLIA 5CSZB 3SKMB 4OFPA 3CXDL 3UTQB 5GZNC 3VFPB 3QDGA 1EZVX 2O5ZL 4YR6B 1LK3H 4CN6A 2ICWJ 3T2PA 2H8PB 1TVHA 5F7KC 3QUZA 4Y2DA 1AHWB 1YEIH 5K9QI 5JPMA 1KT2B 5FA4A 4JKPL 3MJ7A 1I9JL 3FFDB 4K94H 3QCVL 4HC1H 4HKJB 3HFML 3F7VB 4PJCE 3TM6A 5E5RB 4NO5A 4KJYA 2VABA 1YN7B 1D6EA 3ZO0A 3UBXG 1F3RB 1IVLA 3B9KC 5FOBB 3CXDH 2DDQL 2I07A 4U0RB 4JJ5B 2O5ZH 4Y4FA 1N6VA 3SCMD 1MRCL 5IEKB 1QRNB 3BPNC 4CMMB 3LPGA 5HYJA 2B5IB 5C9KA 4N1HB 4JKPH 5AUMB 4WDIA 1I9JH 1HH6B 3Q6GL 4NQDA 3QCVH 3HFMH 2YKLL 1U3HB 4O2CA 1EBPA 2F8VA 2APWA 5K9OB 5BCAA 5I15L 4LSTL 3MRJA 3VCLB 5IMLA 2DDQH 3LDBC 1E4KC 4P4KA 3W11C 2MCPL 5BQ7A 3IVKB 1TJIL 1I9RL 2XN9E 3P2TA 1MFAL 4H8WH 3EHBC 1MRCH 4MB4A 5HVWA 1ERNA 5C0JA 4BKLB 3BKJL 4ZFOL 2CH8A 1UZ8A 4JZJB 5E1HB 4NO3A 3BT2H 4AM0A 3SBWC 2LE9A 3BESR 2JLLA 3Q6GH 43C9A 1Q9LA 3FQTB 1T5WB 4YK4C 5GQBA 5E94B 4ZDHB 3O3DA 4WW1B 3IETA 1E6OL 3E6HA 1QR1B 2NXYB 3NTCL 1P7QB 4HXBL 2DTML 2PO6C 1OCWL 5EIIB 1DQQA 1ZANL 1J1PL 1I9RH 1MFAH 4ZODA 3LV3A 4Y5VB 3NFNA 5BV7B 5DZLA 3BKJH 1P4IL 1T0MB 5FYKE 2W92A 2V17H 2WWMC 4YO0B 2DS4A 4PJIB 4L8DB 1NLDL 5DO2D 4R2GC 2OI9C 5CINL 1FYHB 5F88B 3F7RA 1RZ7L 3GSUA 3JUYA 1ORQA 4ISVB 5EC1A 3NTCH 1FC2D 2AEWA 1MCLA 4F7TB 2EDEA 3HNTL 4HXBH 2DTMH 3SOBL 1R24B 4YHKL 5D2LB 1ZANH 1J1PH 4RQQB 2G2RA 1FL6B 2FDBP 2IPUK 4L9LB 4PRIA 3C60C 4ZNEA 1JIBA 1FZMB 1CFNA 1E27B 5F6IC 3TBSA 1P4IH 5J9PB 1KF9B 1CGVA 4MNHA 1CLYL 3OB0H 3RDTA 3Q2CA 1NLDH 5IBUG 5MI0C 1RUPL 2H26B 4MNGE 5KSBB 1RZJL 5KSAC 3V7AG 1RZ7H 4ERSL 1M71B 1L0YA 4KRLB 4YDIH 2ZOKB 1KXVC 3SOBH 4N9GB 4YHKH 3SE3A 4OM1L 1P5VA 4FZ8L 4Y4HD 3B9VA 1KPVA 1GOHA 2A74B 4J8RA 3HS0B 3VXQA 2W9EL 2YPLA 1H15B 1ZV5A 5I1AB 1CLYH 3HNSL 5T1KD 3L5IA 4Y4KA 4KKAD 1OAKH 1ND0A 1QFPA 2HTLC 1EIBA 1RUPH 4GAFB 1S7VB 3D5OF 3ARFB 1OLLA 1RZJH 5JW3L 2OX5A 3BOVA 5KVFL 4HKBA 1BGXH 5L0QC 4Q2ZA 2VN7A 1ZS8A 1CDCA 1L7IL 1OGAA 3UPAA 5D2NB 5GS1C 3MUHL 1CG9B 5CJ5A 5I8CA 4F8TA 4OM1H 3ILPA 2P8LB 4ZUSA 3TNNA 4FZ8H 3IDIA 4F58L 1ZLWH 3BQUA 3KWWB 2APVA 4JRWA 2W9EH 2ADGB 3HNSH 2QSVA 5CP3A 1QSFA 1X4XA 4G7VL 1P4BL 5CHNB 1R3KB 4EDXA 5JW3H 5KVFH 3MV9A 4PJCF 5IWLA 2J5LB 1GGTA 1U9KA 4PTUA 4LOUC 4UBDC 5D7IF 2IANB 1K3IA 1EEZA 2OXGA 2VIRB 3RVTC 3LAFA 4DUWA 1Z9MA 3LKPB 1HSAB 3SPVB 1PZ5A 2O5XL 4G9DB 4ZFGL 1JWSB 1NBYB 3DRTA 3OJDA 1JMXA 2YPKA 3GB7A 4XRCA 3ARBA 5TF0A 3UYRL 4XMKL 3WE6B 4PD4K 1P4BH 3P11L 1UACL 1UWXH 4LCWB 5GISH 5IMKA 1YECL 2W9DL 5TQ0L 3FQNA 1BIIB 2AKRB 5F9OH 1RZGB 4L4JA 2QBWA 2HFFB 3ECBA 3WSQL 4BQBA 1WCBA 5IBUB 3ALXA 1J0IA 1J8HA 2XKNB 3DXAE 4I18C 4C83A 2EO1A 4OCNC 2WK2A 4FQCL 4MCZA 1WF5A 4ZFGH 2GJZA 4NRZB 4HPYL 5GZOC 5KVEL 1TQBB 1WZMA 1NAMA 5J57B 3O2WL 4HHAB 4BSVA 1UT9A 4LCYA 3D69B 1YC8A 3UYRH 3ZE2E 1P9MA 4LDEB 3P11H 1RUML 1P53A 3CDCA 3FT3A 4JN2B 2EH7H 2VDLL 4N0CC 2W9DH 4JQXC 1TCMA 3C8KB 1RMFL 2WANA 5TQ0H 5D7JB 4FA8A 1NGWA 2GTWB 4TRPL 3EYSH 2KL6A 1WAAF 3OF6A 3WSQH 1QRNE 4LLMB 2HT2D 1IGIL 1TZIB 2DI8A 2WWKT 1IGJA 1VEMA 3VXPA 4FQCH 3GIVB 3TO4D 1A5FH 4ZXBB 3EJZC 4PJ8A 2X42A 5C6WH 4HPYH 1DN0B 3O2WH 4TULL 3MLWL 4GAGL 3SDAB 4YBHA 4KK9D 1CFTA 1RUMH 5CSBA 1I3RB 3IFNH 2VDLH 4GLRI 3RY4A 2PR4L 4RMWA 4FQHB 1KJ3L 4XWOD 4IS6A 5I2IB 5H37H 4Y7MA 2R2EB 4HFUL 4TRPH 3C6LC 4UAOB 2R15A 1B6DA 4YGVA 4NP4L 3RWGA 3CPLA 5MHSD 2JCCA 1E0OB 1IGIH 2FHFA 1OARH 1AGFB 1BEYL 4HJGA 4NKDA 4P5KB 1JUFB 1UM4L 1BP3B 1YYMH 2PXYA 3B8YA 5D6DC 2I60L 5ACZA 4TULH 3WUWA 2R4RH 3LKRB 1QACA 4LRNH 4QRTA 2CIKB 3GSRA 3O45A 3QPXH 1MCCA 4AIXA 4HDIA 3WJJA 2PR4H 1KJ3H 5E6ZA 5C0EA 2M26A 1NLBL 4PJGE 4C57C 4NP4H 1JK8B 5ADPL 4PGBB 4JKLA 4RMVA 3CC5A 1FJ1B 1BEYH 1QOKA 4MAYA 4TNWK 3SHSA 3BUTA 3KPMB 1GH7A 3WHXB 1UM4H 4M6ML 5CD3B 1SY6L 2I60H 2AXHA 2A6KB 3IB4A 3KJ4B 4MJIB 1LEIB 3H7BB 4HAFA 3FQXB 5EU6D 3VFUA 4YBLB 2QKIB 4MB3A 4YHZL 4I0KA 5D2LE 3TBVB 4HKZA 4WEUD 1N3NA 3FO9B 3IDGB 3VWJA 2EDJA 3MLRL 2J8UA 1ZA3B 2KQNA 4MJ2A 1ZVSB 3O3EB 4JAMB 4QXUL 4U3CA 1Q0YL 4M6MH 2HN7B 5KJRL 1SY6H 4P3CH 3TIEB 1NJ9A 4KI5C 3V4UL 5L6YL 4BFGA 1S7WA 4ZAKA 4LPTA 1HSBB 5FUOL 5GGQL 3LEVL 4BZ1L 3BYTA 4YHZH 5J1SC 4XZUA 4ODSH 5IVXB 4KJQC 4GLRH 1LK2B 4MDJA 1IEBB 3RX8A 1KIQB 2FX7L 3MLRH 3RY6A 3MRDA 4D0DA 3GI9L 2Q76A 3C6SA 1TJHL 1DQJA 3Q3GA 4QXUH 1Q0YH 3NOIA 3F65A 5KJRH 3LQZB 3BRFA 3V4UH 2YN5A 2HT4C 4F7MB 3HTLX 1I4FA 4WFGD 4NM8L 4GRLC 3PWJA 3QUYB 1EMTH 4KUCD 1S7UB 3EZJB 1Z9LA 2VLRA 1UH4A 1I1AD 3GI9H 5F71A 3TN0A 3GSQB 4XNYL 1H8OA 1FBIH 1A6VH 4X4XB 3DMMB 1NFDA 4IHOB 5DZNA 1U8KA 3B6SA 1JN6B 2VR5A 3BKCL 2HFEB 2HVKB 4ZO7A 2UWEE 1NGXA 3ZE2F 4HJ0C 3U4BL 1ORSB 2NY6B 1IEHA 1PG7W 1NMBL 4G9FD 4UU9B 3WEXB 2EEDA 3QFJB 1EJOL 2AVGA 3ULVD 2FJFB 4JPVH 3BH8B 4JQVA 5CEYB 1XF3A 1AKJD 1XCTA 4ZUVB 5JA9A 4XNYH 1F8TL 1IM3B 1DUYB 3QDJB 3B9DA 2D0GA 1J5OL 4UDTA 1IAIM 1UB5A 3S5LA 3ZT7A 2FEEI 4LCWE 4Z7NE 1BJ8A 3VD4A 3N9GL 2N7AA 3D0VB 2JJSA 3D3VA 1KCLA 1GAFH 4LLUB 4MLSA 2X1XR 3U4BH 1BVLA 1F2QA 1NMBH 1WTLA 3RWJB 2PYEB 4U6YA 4PJ7E 4X9BA 2IFGA 2N4IA 4HZLA 4OI9A 3V7AE 3R8BB 3MRNA 2VSDA 4CL7A 1MCSA 1WVZA 4ZQKA 1HZHL 1PY4A 1NANI 5A2FA 2VLJB 5C0BB 2F5BL 4NHUB 5ANMA 1RQ5A 5ITBL 2CRYA 5DVKA 5TE4H 3RGVA 3N9GH 4NQCB 2PTUA 4JFFD 3JV4A 4PJ9C 3K4AA 5T1LA 4JRYA 1DLHA 3QEUB 3MNWA 2VZOA 1RJLB 2FIKA 1WC7B 5ERWB 5C07B 4XTRC 2EXYC 5D6CB 5A43C 4X5WB 1T89C 2F53D 2YHGA 3CMGA 4PJGF 1MCWW 2YRLA 3P73B 5EO9B 4GKOA 2BHZA 1HZHH 2ZSWB 1D5ZA 4E0RB 1HEZA 2BVYA 1E28A 1DBJL 1SJEB 1DUZB 2CO6B 3LQAL 3EDDA 2PNDA 4CADB 5ITBH 4LLQB 1AFVL 3L3IA 1QHOA 2E7LA 2GFBA 4LVEA 3TVMC 2FCBA 2FEEL 3ZYJA 1P7HL 5EU7E 4WO4C 4LAQL 4MS8D 4EN3A 2ATKA 3LKSB 3I6KA 4GMTL 3RTQD 1WISA 5D2LF 1C08A 1CE1L 1D5MB 1CLOH 3KS0J 4FQIL 3D39D 4QCIA 1YNLH 5TDPB 3W9EA 1BVZA 1DBJH 1HXYA 1ZHKB 3WN5C 4JDVB 3IAQA 1JYXA 1BPVA 4ONFL 1UH2A 3C8DA 3OJVC 4M48H 1A7QL 1LEKB 3WDIA 3I75B 5LXGL 4IRSA 2R23A 3IGAA 5EPMB 1XMWA 3MFGB 4MWFB 1Z6JT 4HGMA 2ED7A 1F4YH 4LAQH 5SWZD 4G43A 1IGTA 4FNLH 4UTAL 4GMTH 3MZGB 1CWVA 1CE1H 2EYSA 4QRPB 4YZFE 3B9EA 5FGBC 1MRDL 5D1ZB 1OP5H 2DM2A 3LRSA 3MA7A 4HUNB 4P46A 2G75A 4HUWB 1WCQA 3D2UA 4KUZL 2OL3H 4ONFH 5F1NA 4S1SL 5T3ZL 1DBAH 2IADA 1A7QH 3MLZL 4R96B 3I9GH 3SKUD 3AAZB 1R3IL 4CMHC 2GK0B 4V2CB 5IFAL 5H94B 4UTAH 3O9WC 1PY9A 1F3DJ 2W60B 5IG7A 5ID0A 5J06A 1N5AA 3H9YA 3OKMB 1MWAA 4U6HA 4BELD 1MRDH 4GBXD 2XN9A 2VKWA 3PWPD 3EFDH 5EIQA 3K2MC 5EU6E 3V0VA 3IDNA 2R69H 2R1YB 3T2NL 1OW0A 3IKCA 1EXUB 1NEZG 3V4PL 5T3ZH 3RHWK 5E8PB 3MLZH 3RWHB 1CT8B 1V7NL 1S9YA 4H1LH 1U8JB 1YUHB 2UWEF 4IRJB 4EUPG 5A16A 5IB3A 1CFQB 5IFAH 1CICA 2Y9RT 1KTDB 3QRGH 4P23B 3QUKA 3LH2L 5HTSA 5C0ND 4A6YL 3VDAA 5JOPD 3PHOA 3FZUC 3HMWL 3LKNB 3IFPB 3GJFH 1WQVT 2VZUA 5DC4B 1AGDB 4DKAA 1I1YA 4X7TA 2EC9T 2NW2B 5BS0D 3V4PH 1GZQB 4GKZA 7CGTA 2HTKC 3GBMH 1F02I 1S8DB 2EDXA 1T22A 1CGUA 4RA3A 3MUGA 4DZBA 3E3QC 4IMKA 1EEUA 1B0RB 2YBRB 4S0SD 4EI5A 2A6IB 3LH2H 4PJ7F 2R2CA 4APQB 2NY0D 1RJZA 3CFJA 3HMWH 5F7YC 4X98B 5KVDL 1HHJA 5TF1L 4UDUB 4F2MA 3INUL 3OZ9H 4WW2C 3E6FB 3MUJA 4WFGE 4HPOH 3RKDD 5DJ8A 5KS9F 3QCTL 5HGHB 4JY6A 5IMOB 4MNGA 2I9LB 2VSCA 3ARDA 4DN4L 4X7SL 3K0WA 1QQDA 3ARGD 3CVIL 1NC2D 4NN5C 2BRRL 4FQXD 2VDML 2UYLB 4EIGB 4XBEL 5KVDH 3NIFE 3QEGL 5DD6A 3INUH 5D7SH 5GSVA 1IC7H 3MSPA 5DTFB 1K4CB 3QCTH 2ICWI 3ULVE 2DIBA 3B9KB 5GGUA 1GL4B 1LP9B 1P69B 4WU7A 2PYEE 2WP3O 3BEWB 3O3AB 2H3NB 4YIQA 12E8H 5CEZL 1KCVL 1KB5B 5IW3A 3HR6A 3FO1A 4FG6C 4X5LA 4NM4L 1U58B 3EHBD 5JW4M 5LQBL 5DVOA 3CVIH 4M3JA 4RCAA 4XAKD 5DC9B 2P8MA 2LV4A 3OR6A 1IGCL 5C0BE 1BZ9A 4XBEH 1FYTB 1DE4A 3QEGH 3U7AA 5LAXA 1XF4A 3EUUA 4NQCE 4JPKL 5C0IB 3R0NA 1MEXL 3H9SE 1VHPA 4WI4A 2UY6A 4B5EA 4PLJD 4MD5A 3MOBL 1FPTL 3LDBB 3FB8A 3HC0B 2G60L 5B38A 4Z18A 1P6FA 1KBGH 5C07E 2YOCA 5B39B 1H3XA 3QXAA 3A67L 4WENB 2HLFC 5CEZH 1KCVH 3IXTB 2DM4A 5FEBA 4FFWC 4PJBB 4NM4H 1ZK9A 1LO2L 5F96L 5JORB 1FLRL 4YZFF 1JWMB 3CX5J 1IGCH 4BH7A 4YK4B 4P5TD 4ZPTA 2DYPA 3N1GC 2EDKA 1PEWA 3GMPA 3QDMA 1MEXH 1KIRB 2F53E 1FIEA 4IDLA 1KENH 5C08D 3EOBB 2PO6B 1DEEA 3MOBH 3BHBA 2G60H 5C0CD 1TXKA 1NKRA 4K8RL 2FIRT 5CSZA 3SKMA 3JWDL 1KELL 3UTQA 4OKDA 3VFPA 2VDNL 3RIAK 4GRMB 1T7WA 2A77L 4YR6A 5JZ7C 2FNBA 4LQFL 3KPLB 1LO2H 1TFHA 2H8PA 2QQKH 2E7CA 2OI9B 1I7UB 2JJVA 3RWCB 5T5NG 4JFQB 1KT2A 2GIYA 3FFDA 4HKJA 3BPCB 4WV1C 3UO1H 3F7VA 2VOTA 1YN7A 1OPGL 4K8RH 5L9DL 3D39E 3JWDH 5FOBA 4LHJB 1CBVL 2YUVA 3C60B 5IQ9B 4JJ5A 2VDNH 5F6IB 1ULVA 2A77H 4PJEE 1TZHB 4LQFH 1XZ0A 5A3ID 5IEKA 1Q1JL 3HZMB 1QRNA 4CMMA 3F8UB 5KG9B 3QHTC 2E8ZA 1AXTL 4LCCC 3QIWB 5KSAB 3L3KB 1Y6KR 5SWZE 1HH6A 1INQB 1U3HA 5K9OA 4UNUA 3GM0A 4MNQB 3WJLC 1DLFH 5D71L 1OD7A 4WFFD 4Y1AE 3VCLA 3G9AB 2EYRB 4E9LA 1C1EL 4H0HB 5DJ2B 5JHDD 3IVKA 4WFED 1MH5A 4C58B 3QQ4B 5I75C 4X6EB 4BKLA 3LN9A 1EEQA 5EZIH 1ZT1B 4P2QB 2A2QT 5FXCH 3UXFA 1NUGA 1HYRC 2HJLB 4JZJA 4JHAL 3DHMA 2J7LA 2X41A 3CFBA 4OLYL 3RZCD 2APFA 3P3YA 4YLQT 3FQTA 1T5WA 5L0QB 5J12C 5E94A 4ZDHA 1IZKA 4WW1A 4P57B 5GS1B 4KUCF 3SQOL 5D71H 1QR1A 1MQKL 1P7QA 4WI9A 3PWPE 3CX5K 3K1DA 1C1EH 5EIIA 4NQED 4MA1B 4ODUB 4Y5VA 3G04B 3K81A 2NW3B 3N1QC 3KYAA 4LKCA 5T33L 2NY4D 3GBNL 1GGCL 1T0MA 2C3VB 1BX2B 2ZJSL 4PG2C 3P4MB 4S0TD 4JHAH 4LHUB 4WNQB 4YO0A 4PJIA 3UTOA 3NIFF 4L8DA 4OLYH 5JOEA 5F88A 5DD0H 4CVUA 5E9DB 1D5BB 3ULVF 4UNVA 5JOPE 3NCMA 4ISVA 1MQKH 3NA9L 4ZO8A 2EE3A 4F7TA 5D93C 4TVPD 4M8VA 3TH4T 2NYYD 1R24A 2VUYA 1H3GA 3I2CL 2XTJC 4RQQA 4YHIB 4LLWB 1FL6A 4L9LA 2P5ED 5J0BA 5T33H 1IL1B 4M1DL 1FZMA 4UV7L 1E27A 1GGCH 1F4HA 5J9PA 4M9PA 2D7TL 4ORZC 5JO5B 2ZJSH 4U33A 1JI2A 4GAJL 1IKNC 5F97E 1H8NA 1YY9C 2H26A 5KSBA 1KB9J 1M71A 1YEJH 4RMUA 2IQ9L 3BWAB 3LHPL 3LKQB 3ZE0E 4OAWB 4N9GA 1B4JL 1DCLA 3I2CH 3V6FB 3GHBL 2A74A 1X7QB 4G7YL 4M1DH 4UV7H 3HS0A 3R06B 1H15A 3QDHA 2IBBA 5I1AA 4GAJH 5K9QG 2J12B 5LWYL 1ZVHA 4FQLL 3L5WB 1DANU 1S7VA 2AJXL 3ARFA 5IP4A 3KLAB 4XVUC 3DX9B 3HC3L 3P30H 2IQ9H 5CP7B 4JANB 4QOKD 5D2NA 3GM8A 3S34H 1CG9A 2P8LA 5FYLH 2CO7B 1XIWC 4S2SB 4G7YH 3KWWA 1PGRB 2CR6A 4YE4L 2ADGA 5FKAB 4ETYA 2VERN 5LWYH 4L8BB 2Y36H 5TH2B 3NFSL 3NA4A 4W6XB 5CHNA 2H32B 1R3KA 2AJXH 1H3VA 4XAKE 3HC3H 2MMXA 4PJBE 1QLEH 3X14B 1MJJB 2IANA 1K3ZA 2NQCA 2FLRT 2PW1B 3EOYG 2DD8L 2VIRA 4G6AC 5IK3B 4E42B 3LKPA 1HSAA 3SPVA 4Z7VB 1Q72L 4K23L 4PJEF 1MIEL 4G9DA 3AMKA 1JWSA 1NBYA 2A0LC 2VXUL 4G80B 2J6EH 3RFZC 1M4KA 3GMQB 2VKXA 3NFSH 3BZFB 4OD3L 4LCWA 2DRUA 1QFWI 2C1OB 3KPPB 4UILL 1FFQA 1BIIA 2ZCHL 2AKRA 1RZGA 1QRKA 2DL2A 3S36L 2V6HA 2HFFA 2DM3A 4JM2C 3MXVL 3VGHA 4H88L 4C55A 2DD8H 2XKNA 3BN9D 2H6PB 4XVJL 3VG0H 1Q72H 4K23H 5E56A 1MIEH 2YZ1A 4K9EL 4XMLH 3O6FC 4NRZA 2B1AL 2VXUH 3KHOA 4HHAA 4MQSB 4YXHL 3D69A 1ZGLM 4R9HA 3BI9X 5CZKA 4JN2A 1IRAY 4OD3H 5EO0B 1OOAA 3C8KA 4UILH 3UTPD 5C70A 5D7JA 4DOHE 1WT5C 2GTWA 3S36H 3KHQA 3MXVH 4H88H 3L95B 4XVJH 1TZIA 5HYSG 3DIFB 3IAGC 2X9WA 3GIVA 3U7YL 5A2KH 4ZXBA 5BXFA 4K9EH 2FX8H 1IC4L 1MVUB 1WLHA 4UV4L 3GSOB 2B1AH 1DN0A 2VYRE 3R1GL 1CDJA 4KMTL 4YXHH 3SDAA 3UTSD 2QQNH 5DJCB 1TITA 1IFHL 1I3RA 2HVJB 4Z0BL 5JXED 1CXLA 4GRWB 4FQHA 5I2IA 4GRLD 1W8OA 3D87B 2R2EA 4HUXA 1QFWL 3WXWL 3T3ME 4C54A 3MJ6A 5CP3H 3ZYOA 1I8LC 3BXNB 3HE6C 2VMFA 4KAQL 1AGFA 4ZD3L 1U8QB 4L3ED 3U7YH 2AJ3B 4P5KA 1JUFA 1IC4H 4QO1A 4UV4H 5B22A 2XQBL 3TEUA 3KR3H 3R1GH 5DRWB 4OZIB 1F42A 4WFFE 4AIZB 4JO2L 3LKRA 2FEDD 1RVFL 2CIKA 5JHDE 1JZ4A 4JFEB 1IFHH 2OTPA 4WFEE 2ICEB 3O3UN 3DURB 1QBLL 3MV8B 3WXWH 1QFWH 1NAML 4Z7UE 1JK8A 4PGBA 3VRIB 3ZE0F 4JB9L 4OI8A 3NVQA 4KAQH 1FJ1A 3CDYA 1FFPB 5KAQG 3KPMA 3WHXA 4DAGH 2Y6SC 5CD3A 2VNCA 1UQSB 1F45A 3LIZL 2A6KA 5EIVA 1X4ZA 4JO2H 5FM8A 5E9DE 3L7FB 1RVFH 1U3JA 4MJIA 1FVCB 3H7BA 1LEIA 4NQEE 1G9NC 3FQXA 5I1HL 1KC5L 1LO3L 1SJXA 2QKIA 2J4WL 2NY2D 4TUOB 3TBVA 3DRQB 5H37G 3FO9A 1UWEL 3IDGA 1QBLH 1NAMH 4P0DA 4N8CH 3IS1X 1ZA3A 2YWYA 4FQQB 2MKLC 4JB9H 3ALPA 1JWUB 5DFWH 3HB3D 1H8SA 3H9ZA 2BOCB 1ZVSA 3AY4A 1UC6A 3O3EA 4FTVB 3MREB 4JAMA 4I48B 2HN7A 3O2DA 3KG5A 1A1OB 4YNYB 3LIZH 3TIEA 2AW2A 4TVPE 2OYPA 2VN4A 5D5MB 4LCIH 2OLDA 1JRHI 1HSBA 4OF5A 5I1HH 4M7KL 1KC5H 1LO3H 3ZHLA 2Z31D 4WI3A 2BJML 2J4WH 1IGML 2P5EE 4XGZB 5IVXA 2EXYD 1LK2A 1IBGL 3RWDB 1IEBA 1UWEH 1KIQA 4PJBF 4LF3B 2RHEA 4D94A 5JIKA 4K7PL 1S7QB 5L2KD 4EBQH 4Y4FC 4PJ9B 1YEGL 3LQZA 3KLHD 4KROC 3SE4A 4M62H 3VXOB 5E5MB 4F7MA 3C87A 4M7KH 2BJMH 1IGMH 4OF6A 4UINH 3QUYA 4PGEB 4NCC2 1PJ9A 3O8XC 1V8HA 3DO3A 4LSQL 4AEEA 3BKMH 4O00A 4K7PH 3VFMB 1TJGL 3GSQA 3NCBB 3V4VH 4X4XA 3T0DA 2E7HA 1WITA 3DMMA 1MNUL 3MCLH 4YDVB 3TVMB 1UENA 4RBPH 1YEGH 4Z7WB 4IHOA 4QOKE 1JN6A 5I17B 4M1CD 4WO4B 4PJ5E 3ET9F 3CAFA 2HFEA 2HVKA 3FOLB 4M5ZL 2R8SL 1AO7D 1CGSL 3EFFB 3CMOL 5LVEA 5DEGB 1ORSA 1G9EA 1YEFL 5J56B 1JRHL 4UU9A 3WEXA 3QFJA 4CDHA 1Z0NA 5DA0B 5I73C 2FJFA 3CFCL 5ETUB 4OCSL 4Z7VE 3BH8A 2ADJB 4PP1C 5CEYA 3WN5B 3MV7B 5EH1A 5KN5B 1B2WH 4KGLA 4ZUVA 1TJGH 4JFXB 1IM3A 1DUYA 3QDJA 5GJSL 1KIPB 2D0HA 1MNUH 3OAZK 1F90L 1MJ8L 1YA5A 1VEOA 2X5PA 2NY3D 4YHYC 3D0VA 1RULL 4LLUA 4M5ZH 4OJFL 4BQ6A 1CGSH 4YFEA 5JLZB 1KGCD 1YEFH 3ARUA 1JRHH 1HIMH 3RWJA 5GS0L 1OY3B 4DZ8B 2PYEA 4DKEL 5EUOB 5HHOD 2UUDK 4FN0A 4OCSH 1ZGLB 2W9LA 3EW3B 2QADC 3T3MF 3KXFB 5F7HA 3ILQD 4DEPC 1NCWL 3C09B 3U4EB 4ZTOL 2VLJA 5GJSH 2C4XA 1RU9H 4X5XB 5C0BA 3S36X 4NHUA 4WWKD 1F90H 1MJ8H 5F3HB 5DURB 4LP4A 4JN1L 2YR3A 1CD9B 3GSNB 1RULH 3O9WB 2LABA 4OJFH 3HI6H 5HYEA 2GJ6D 3QEUA 5C09D 1UB6B 2FO1A 1RJLA 3P0YL 3DARA 5ERWA 3M07A 5GS0H 5C07A 5D6CA 4HIHB 2DICA 4X5WA 4DKEH 3S35L 3S7GA 3P73A 5EO9A 3PGCB 4Z7UF 3BGMB 5C0DB 1NCWH 1YNTB 4MZ2A 2ZSWA 5HYFA 3RUGE 4E0RA 3NMEA 2W0LA 1SJEA 1DUZA 3UTPE 3T2OA 4MMZC 1FCGA 2DLTA 4CADA 3MNVB 4K94C 4LLQA 4GRWE 4MQTB 2VXTL 5EU3B 2OMBA 2EDRA 4ZOAA 1DN2A 2F58L 3MQIA 4KDVA 4Y4KC 5T5NF 4NZUL 4U31A 3QJHB 4S10A 3LKSA 3S35H 3V5HB 3CK0L 4PGDB 1D5MA 4UNTA 5JHLL 3UTSE 3W39B 4NC1C 1NAKH 2P5WB 1BOYA 1KACB 3DX7B 1ZT7B 3MRPB 1CDUA 5TDPA 1C5CL 1ZHKA 4JDVA 5HPMB 2GJJA 3GMMB 1R6VA 1U93B 4KKBC 1LEKA 2VXTH 5C92A 3I75A 3ZTNL 3UDWC 3EYUL 4MB5A 4TQEL 5EPMA 2E9JA 1AJ7L 3KS0H 4MWFA 2F58H 1I7ZB 4OKVB 4LSSH 4NZUH 4X99B 5DJAB 4JFDB 1QSVA 1DL7L 1D6VH 1JPST 3PGFH 5LBSH 3CK0H 4QRPA 5JHLH 3W0WB 1SM3L 4WW2B 4L3CB 5D1ZA 3MBED 5GJTL 4X4YB 4KQ3L 1C5CH 1R0AL 1EV2E 3PJSB 4HUWA 3G6DL 1T1XB 1VACB 3T2QA 1KEGL 1N64L 3AU1B 3EYUH 2CKBB 3QZWG 3TESA 5JQHC 3DECA 2EYTB 4R96A 2EIDA 4MXVE 3AAZA 2GK0A 1RHHB 5H94A 4NN5B 1DL7H 4G6FB 4FG6D 1JGLL 3QQ9D 4I3GA 5F9JB 2KKQA 2W60A 5F44A 1SM3H 3OKMA 3T1FB 1NGQL 5GJTH 4TNVK 5CGYC 4XWGH 4KQ3H 1R0AH 4NNYB 4OTXL 2R1YA 3U46B 1EXUA 3G6DH 4PJHB 1F3DH 4TUKL 4X6DB 1KPUB 5E4EC 4KWUA 5E8PA 1KEGH 2HMID 3RWHA 1CT8A 1GGBL 2UZIL 4FMFA 4JCMA 1U8JA 1YUHA 4IRJA 3AM8C 1CFQA 2VTFA 4JHWL 2W1NA 1KTDA 2J88H 4P23A 2D7QA 1SMAA 4Z7VF 1R5VB 1NGQH 3LKNA 3IFPA 1YEEL 2R4SL 4I77L 3NPZB 4NUGH 1AGDA 3W5MA 3T0XA 2NW2A 5FK9B 4QRQB 1Q38A 4TUKH 1QSEB 1GZQA 4GKSB 5TJWK 5EOQL 4P9MH 5M94B 3UTZB 3PG2A 1GGBH 2UZIH 3O3BB 4K7PX 4M61B 3T0EC 1S8DA 4NT6B 2LAGB 2DQHH 5A2JH 5L2KE 3DGGB 1RI8A 1UA6H 3TFKD 5JZ7D 3GI8L 1B0RA 2MQCA 3HAEB 5E6ID 3TYFB 2A6IA 5ALBL 4B53A 5DGRA 5D7LD 4M02A 2Y72A 3VI3E 1JHTB 4MJ5B 4X98A 5C0AB 1YEEH 2R4SH 1GHFL 4UDUA 3E6FA 1T1YB 3KNBB 3QHZL 1S7XB 4G8EB 5A40E 5FGRA 4ZUWB 5HGHA 2DKSA 2F54D 5IMOA 3WHE1 4O4YH 5B8CC 2PXYC 5EOQH 1MWAL 4DQOL 5BRZE 1X5FA 2I9LA 3FN3A 3CVHB 4PJXB 3DETC 3VXSB 5IGXL 3RPIB 1YZZA 2Q7YB 1CGXA 3MV7E 3VH8G 3GI8H 5ALBH 4KTEL 5IB2B 3LCYA 3VA2C 3OX8B 2NY5L 2UYLA 1I1AB 2B0SL 3FONB 4WV1B 4MDIB 1AO7E 1GHFH 2X4NB 3RUGF 3O4LD 5KOMC 5KZCD 5DTFA 5B21A 5D4QA 1K4CA 2WW8A 3MV11 3BZEB 3B9KA 1LP9A 4M4PA 1MWAH 3K4ZA 2VLMD 1TTUA 3BEWA 3O3AA 2H3NA 2W59A 3QXTA 2QSCL 1KB5A 1MFCL 3PWLB 5IGXH 2EDQA 2ZWLT 4OZFB 1U58A 5FYKL 4KTEH 3HUJE 4LCCB 1MFBH 2NY5H 4PJDB 3VWJC 1REIA 4YHML 2MOVA 1FYTA 4XHQA 3OGOE 2ZUYA 2JELL 7FABH 5DC0A 2VDPL 5C0IA 3IDYC 1FGNL 1J12A 3HC0A 3LN4B 5B39A 1BF2A 4NQVB 4PGZA 2AQ3A 4PRPB 2OTWB 2QSCH 2D03L 1T83C 4FQ1L 4RIRB 1MFCH 3IXTA 4TSBL 4PJBA 4CJ1A 5FYKH 4X7CC 5JORA 4TYUA 5E08H 1WUNT 1JWMA 3PDGA 3SBWA 2X2YA 4P2OD 5T3ZD 1A02N 4YHMH 5J12B 1FZKB 3U2SB 2JELH 2GJ6E 3QNXB 1CXKA 5C09E 4XNUL 3WFCL 1VENA 3S35X 1F11B 1FGNH 1KIRA 4GAYB 2DMBA 1DVFD 3EOBA 2PO6A 4YFLF 4MVBD 5IUSA 4U1NB 2VRAA 2Y07L 1FC1A 4C4KT 2E8YA 3NGBC 2D03H 3WMSA 4FQ1H 4TSBH 4GRMA 5CFHA 5EU4A 3SGDI 4IRZH 2XTJD 3KPLA 5HBBA 4XNZC 2FO4B 1T03L 1A7NL 1VSCA 5CEXB 2ID5A 3QQNA 2X4RB 1OT1A 1I7UA 3RWCA 4JFQA 4XNUH 1P5UA 3WFCH 3MZTA 3BPCA 5HHPB 3SDCD 5HHNB 5D93B 1M7XA 3HPJB 3CU1A 3WS6C 2FWOB 2Y07H 3BAEH 3FT4B 4JY4B 2YD5A 1YQ2A 3C60A 1A3LL 2LU4A 2Y06L 5IQ9A 4RX4D 5EZLB 1TZHA 2EIEA 3HZMA 4U1MB 1HCFX 2HH0H 3EYQC 5HI5C 1T03H 1A7NH 32C2B 1BQHB 4U3HA 2P7TB 3VXRD 1A6WL 5KG9A 2YXMA 2VLKD 1FFNB 4V1DD 5GGSB 5FYJL 4JQVC 5KSAA 3QIWA 3L3KA 3MLYL 5J6GA 1INQA 3GO1L 3TT3L 3CXHK 3QRFM 2I5YH 2DWDB 4MNQA 4LLAA 4WGVB 3S3JA 2R0KH 1GOFA 1OGTB 3BVNB 4IM8A 3FHAA 3UJJL 2EYRA 3K4DA 2O26U 1A3LH 2JJSC 2Q1EA 5DJ2A 2O93L 1GPOL 2XTLA 4I0PD 3O41B 5C1MB 4WTZG 3HZVB 3QEQE 3QQ4A 5ILTH 5JA8B 4X6EA 1QBBA 1VPOH 3QO1B 2XRAL 1MELA 1ZT1A 4LL9A 3NACL 4P2QA 2HJLA 2BCKB 4G8GB 1IKFL 3VI3F 1XR9B 4QGTA 4X6DE 1FH5L 1X3DA 2C5DC 3MLYH 4DGIL 3ARSA 2AK4E 3GO1H 3TT3H 2PTTB 1URLA 4P57A 4WHYG 5GS1A 3L3JB 5KAQF 3SDDC 3EKCA 3FJTA 5MEPB 3UJJH 3BD3A 1JYWA 3V6OA 1GPOH 2IPUG 1NBVL 4ODUA 3G04A 2NW3A 5AZEL 3SGDH 1IZJA 3PQYD 1T21B 1P2CB 3LEYL 3NACH 4KKCD 2C3VA 1BX2A 3P4MA 2NX5B 4WNQA 3AS0A 4LHUA 1FH5H 1UVQB 3FFCD 5CEZD 4KVCL 4JR9H 5E9DA 5F7MC 3VFGH 1D5BA 1YQVL 4LKXB 4YHNB 2D2OA 4DJMA 2E7LC 3BP5B 2VLLB 1G0YR 4DTGL 1EPFA 1NBVH 5CZXC 4YHIA 4LLWA 3AB0C 5AZEH 4HZAA 1IL1A 3HUJF 3IJSB 3FO0L 5F1IB 3LEYH 4HIEB 5JO5A 4ODTH 1IM9B 5SV4A 1OSPH 1HK6A 1GZPB 1MCFA 1BD2D 3OKOB 4KK8D 5BS0B 1WV7T 2XZCL 1CL7I 1JHKL 3VXSE 4JM2B 1E4XI 3EO9H 3AXLB 3UBXI 5D7LE 1JGUL 3KDMB 4M43H 3BWAA 1DDHB 3DO7B 3LKQA 4OAWA 4ESKA 3NIGE 4U1LB 4DTGH 3O6FB 5D1XC 5J1AB 4XI5D 4QHNB 5E24E 4U1SB 1HHKB 3V6FA 2DB8A 1X7QA 4XB8A 3VG9B 3V6ZB 3FO0H 3R06A 3T65B 2QTEA 1YEKH 5BVPL 5CBAB 5HXMA 5CWSB 4JQXA 1MI5B 3VRJB 5I8OL 3IDXL 4K8RD 3L5WA 3OXRB 2EEAA 4KJPC 1XGYL 3KLAA 2XZCH 1JHKH 3AUVA 1Y0LB 1U8HB 5LGKA 2BRQA 3DX9A 2H1PL 4I2XB 1JGUH 3K80A 5CP7A 4JANA 3MRQB 4QYOB 4CUCA 3MLVL 4S2SA 2XI9A 1S7SB 3PHQB 2VDOL 4JLRB 2FZ3B 5DJ6B 2NXZD 2VLME 4GSDL 4KH2A 5IVZB 3DSNA 3GUTB 1OAYL 1A7BA 5IHUL 5FKAA 1NSNL 2JJWA 4L4VB 4L8BA 5TH2A 1FORH 4M9OA 3ZL4H 2H32A 2H1PH 5F93C 3HG1D 5T3XE 1CL7L 4GG6B 3HE6B 1KFAL 1E4XL 4NJ9L 3X14A 1MJJA 2R1XA 2PW1A 3MLVH 2H41A 4O2EB 5IK3A 1PG7H 3U83A 4E42A 1E6JL 4Z7VA 5F72S 4B0MM 1X6NA 3DROB 3SE8L 3K7UA 3PV6B 4GSDH 4G80A 1OAYH 5IHUH 5FYKU 1NSNH 3GMQA 4OGXL 4UUJB 1NC4B 3BZFA 4KDWA 4PJAE 4BH8B 1EAPB 4Y88A 2C1OA 3KPPA 3TO2B 4Q9CA 2JK5B 1W72B 1CL7H 3K8LA 1E4XH 1J11A 4NJ9H 1IARB 1C5DB 4PREB 1DEDA 2B8OT 2H6PA 3PP3H 4LIQL 3VWKC 1E6JH 3TC9A 4ELME 4JY5H 2ZCKL 1G7LB 3ISWA 3QDGD 4IMKC 4U7KA 3SE8H 1YEHL 1ZTXL 3QHFL 3QUZD 4X6DF 3AC0A 4XPGL 4Y2DD 5SWSB 3BSZL 3BIAX 5EO0A 2V7HB 2XTJE 1DBKL 1JF1B 2FH6A 1U3YA 5DXWA 4FQ2H 4UOW0 5F7FA 3CSPA 4EXKA 4F9LA 3L95A 5CGTA 1Z9OA 4LIQH 3DIFA 1UFUA 1F5WA 3B5GA 2YSSB 2ZCKH 3RWEB 4R97B 1EO8L 1MVUA 2X05A 3GSOA 4Y4FD 1NMCC 5IESL 1YEHH 3UJTL 4DK6A 3QHFH 4XPGH 1FIGL 3BSZH 3E2HC 5HYJD 3WO3B 1FDLL 2HVJA 3IDUA 5FF6B 4OFIA 4OV5B 1XGTA 3MRIB 4ODHL 2EIBA 2H2PC 3GSWB 2I25N 2VLKE 4OF7A 1FNHA 4V1DE 4FFYL 5H35B 3BXNA 3GMNB 3P9LB 4P2CG 4ELKB 1U8QA 4G8GE 5IHLB 5JMOC 4QKXB 1QPPA 4P4KD 2AJ3A 2Y5EA 4KROB 1JPFA 5I1EL 4R90H 5LGHL 4OZIA 5DRWA 4RRPA 4AIZA 3WIHH 4OCRH 3DI2B 1AD9B 4BQ9A 1FIGH 3RBSA 4JFEA 1FDLH 1JMZA 3O8XB 3RU8L 1G6RL 4S11A 2Q7NA 2ICEA 4ODHH 5FYJU 3DURA 3MV8A 3NIDE 3RVXD 2HFTA 4FFYH 3VRIA 1MY7A 3HNVL 3NIGF 1FFPA 5DUPL 2NX5E 4N1EA 5HY9B 1GCFA 2DQIL 1UQSA 1HILB 4LP5A 4OT1L 3WKNA 3L7FA 1LO5B 1OTUC 5I73B 4G42B 1G6RH 4TUOA 3DRQA 1EDQA 2RCSL 1N0XL 4FRWA 2PTVA 3U48A 2X89A 4FQQA 4G3YH 4RGOH 3FFCE 3HNVH 5C0FB 1JWUA 1I1RA 2OR9L 5DUPH 2BOCA 3D18B 4FTVA 3MREA 5D72L 5JR1L 4KKNA 4K55A 4XX1G 4I48A 1A1OA 4OIIL 3KPQB 4YNYA 4PRID 2K7QA 4OT1H 3MACL 5D5MA 2FGZA 4Z6AT 4HUUB 3E8UL 3CZJA 5E00B 1U92B 3RDTD 5IROC 2QADB 4XGZA 2F9BT 4DEPB 1N0XH 3RWDA 1CIUA 4K3EH 5DMGD 4F80A 5D1QC 1SHMA 1VDGA 4LEXH 4LF3A 3HI5H 1QYGL 3I50L 2OR9H 1MOEA 5FUZH 1BAFH 2G2RB 1S7QA 1BD2E 2OS7A 4OF3A 4JHBA 5I76B 1A4JB 1MI5E 4JFOB 4PJ9A 4I13B 2VQTA 1J1OL 3VXOA 2V7NB 3LEXB 4H5SB 3MACH 4WU5B 5E5MA 2YPLD 3MTRA 3E8UH 1T89A 1I3GL 4PJAF 2IJ0C 1BM3L 4Y4KD 1RZ8B 5KSVB 1H3TA 2B4CC 1P84J 4PGEA 3QWRA 3IF1B 4OB5L 4ZG1A 1QNZL 3L6FB 3H0TB 4WI6A 1OLZA 3VFMA 1WJ3A 4ELMF 2NNAB 4Y5YC 4YDVA 2R56L 3TVMA 4F37F 4C56B 4Z7WA 3BQUD 2R39A 1J1OH 1RZFH 5I17A 1K9TA 4LSDA 4WO4A 5FGCE 1PG7X 3VFRB 3FOLA 5BVJB 3EFFA 5DEGA 1I3GH 1QSFD 2CUMA 4OQ1A 3O2DL 5ETUA 4OB5H 4BM7A 3L3GB 2CDFB 3MV9D 2ADJA 4CU7A 2NXYC 3WN5A 3MV7A 2X1WL 4PRHB 5KN5A 4YHLL 1N8ZB 1R3JB 3OJMB 4JFXA 2CRMA 4W4OC 1KIPA 4JPWL 2ESVD 4LFHG 2HKFL 5EN2B 4Y5VC 2GTZB 1F4AA 5BV7C 1T0PB 2BNRB 1UZ6E 5HGDB 5JLZA 1EGJA 3ARBD 2APXA 5FGBA 1N7ML 4OCMC 4DZ8A 5IQ7L 1JHLL 5FCSH 3O2DH 5EUOA 3UTTD 2ZG3A 3B5TA 3WUWG 1ZGLA 3KXFA 3VDCA 1LD9B 3VXUE 3OKNB 4WCYH 2FB4L 4YHLH 3U4EA 4BYHA 3IDJB 3EOAB 4AQ1B 1J8HD 5TE6L 3H9HB 1U8MB 5SWSE 4Y16D 4X5XA 2ADFH 1UJ3B 2HKFH 2ZZUT 1KLUB 3MFFB 5F3HA 3QIBC 1MFDL 1M7DB 4Z9KB 4MQXC 2ADIB 3GSNA 3O9WA 3PWVB 2VQUA 3JV5A 2L7JA 4WUKL 1ZT4B 2WWKO 5HI4C 4CVZA 1K8IB 1UB6A 5I19L 1N7MH 1N59A 3QDGE 3CD4A 4HIHA 5IQ7H 4M7LL 3RVVD 4ZS6C 4DGVL 4ZFOB 5C0GB 3NIDF 2NCMA 3RIFK 3PGCA 1TNMA 3BGMA 5C0DA 1YNTA 1DQML 4NWTL 3OF6D 5GRJL 1HNFA 5E4EB 2P1YA 1TTFA 4YXKL 4EXPX 2BNUB 2EKSB 3K1KC 3MNVA 4QTIL 1XF5B 4BZYA 2AP2A 1P84K 1MFDH 2HT3D 4PJ8D 1HQ4B 5EU3A 4D3CH 3KPSB 3U7WH 2VZTA 4NCC1 4X0KB 1ZHBB 3QJHA 5ENWB 2ICES 4M7LH 3GHEL 4PGDA 4JFYB 3V5HA 4DGVH 4Y5XC 3W39A 4ORGB 4LFHD 2BXZA 2P5WA 3DX7A 4HIIB 4K71C 4HWEL 3G5ZB 1ZT7A 3MRPA 5GRJH 3QIUB 4UZGA 5GGVY 4QWWC 1HKFA 1OTSC 4NKMB 4NQDE 4YXKH 5TQ2L 3V5KB 5HPMA 3SY0B 3T0EB 3GMMA 3T1WA 4QTIH 1U93A 1MCBA 1JFQL 4DUVA 4PLKD 3LZFH 4HJJH 1I7ZA 1U91B 4OKVA 1G6VK 4XPAL 4X99A 5DJAA 4JFDA 3DOSA 2GHWB 2XPGB 4ZYKA 4OF0A 3GHEH 3J7HA 1P7KB 3W0WA 1ZLUK 1CVSC 4WW2A 4L3CA 1AC6A 2FR4B 4X4YA 3DSFL 3KPNB 5F6HJ 1MF2L 1INEL 2VWEC 2BVQB 3H42L 3QXVA 4RNRB 5DA4A 3PJSA 5F21B 5B8CB 4OLWL 5ACLA 5TQ2H 4AH2B 4WHDA 4MAYD 4PPTA 1T1XA 5KW9L 4HT1L 1A7PH 5AYUL 2WLZA 4S1RH 1VACA 3G5YB 5HHXL 3AU1A 1JFQH 2CKBA 2BFVL 2EYTA 4M93C 4HDIB 4XPAH 1RHHA 1S9VB 5IBLC 5SX5K 3GKZA 5HD8C 3X13B 5F9JA 4HS3B 5E8NB 3S9DB 3T1FA 2NPLX 1V7ML 2NY7L 3Q6FB 4Q7DA 3DSFH 1OD9A 1BFTA 1INEH 4NNYA 4NC2B 1V5JA 4OLWH 3U46A 2FSEB 2R0WL 3W2DL 4E41B 4W6WB 4PJHA 4X6DA 5KW9H 5AYUH 1KPUA 5HHXH 1CLZH 1HHIB 2R29H 2BFVH 5L7XL 1KG0B 2X9XA 2D0FA 5T1MB 1EERB 1ROWA 4QHLB 1NCBL 4ZAKD 2BDNL 4LLDB 3S5LG 4K3JL 2GUOA 5BJTB 5I1DB 1LILA 5B4MD 1QR4A 1R5VA 1V7MH 4HUKB 3K3QA 2NY7H 4GO6B 3IDYB 3ZKMC 1MLBB 3DUUB 3BJ91 5FK9A 2R0WH 3JV0A 4QRQA 2ZSVB 1QSEA 4GKSA 5GS0D 4XP1L 1HOCB 1FGVL 3QYCA 3UTZA 3O3BA 4M61A 1UZ6F 3SJVB 4NT6A 1CXEA 3DGGA 1NCBH 2BDNH 1NCUA 4LEOB 3HAEA 3TYFA 4K3JH 2A9NH 3MRMB 4HBCL 4Z7QE 1Y6NR 3TZVC 1ACYH 2YPLE 1JHTA 4MJ5A 5C0AA 4UAOC 1G1CA 2MJWA 1U36A 1VFOA 1T1YA 3KNBA 2VLRD 1S7XA 1DANT 4G8EA 3MGOB 1NGYB 3IJYB 2VH5L 3TN0D 3TV3L 4ZUWA 3NGBB 4GS7C