3STLA

Kcsa potassium channel mutant y82c with cadmium bound
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2011-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3stlA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3stlA02
3R1GL 2XICA 4XNUH 1G7IA 2AABH 4LDOB 3EYOB 1F42A 2AK4E 5D6CB 5DEFB 4CVXA 4JPIA 4F9LA 4JREC 5C1MB 5IB3A 3KHOA 1JPTL 4OZFG 2NZIA 5I17B 4YXKL 3SDXF 5D7JA 4KHXL 2QQLL 3H3PL 2NR6C 1WBYB 3MFGB 2IALB 2X4UB 1NUDA 5IB4A 4LHQB 4X5XA 1LEGA 1QSED 1I8MA 3L3DA 4Y16D 4S1RH 3V8CA 5F9WB 5GS1C 4CMMB 4OLEA 4NWUL 3RHWK 4ODVH 1FYTA 4NRYB 5F89B 1FNEB 3SKOB 4FQCH 4U1MA 4NN7C 1I7ZB 2XXMB 1NDMB 5TQ0L 3L3GB 1GGCH 2Z8RA 2EO1A 2FJFA 4HCRL 2X4OA 3MRKB 3RX8A 4JFYB 1JF1A 2AK4B 3RWGB 3OR6A 4F33A 4DGIL 3MR9A 1KTDA 1FJ1A 4Y2DC 1BJMA 4DKDC 5FO8A 4YHML 4RDQG 2AGJL 2GCYA 3C6SA 2FECL 1YMMB 4N9GA 1MFAH 1G7PA 1F11A 5IHUH 3MUGA 1A7NH 4U1GC 5FYKE 1A1OA 4POYA 5I1EH 4FHBD 4ZUWB 1S7XA 3QEQE 1OLZA 4QKXB 4WHCA 3ZLQC 5GSVB 1C08A 1KLUB 1VEOA 1YJDH 1KPUB 2E6QA 4L3EE 3V2AR 4RNRA 5E2TH 2R69H 3MX0A 3NZHL 1TQCB 1S7RB 4MDIB 4P9HH 3GMPA 2YHGA 5EO9B 4GRLD 2VABB 1JL8A 1IBGL 1JPFA 3VGHA 3LZFH 4GG6B 4HHAB 2O5YH 1ZXQA 1OL0A 3UTZA 5C09A 4AMKL 4Q9QH 5DD0H 5CP3H 4ZSOB 5KVDH 3LKOA 4N90D 1I7TA 3WS6A 2HFFA 3IRPX 2FJHB 4HKBA 3EDEA 1CD8A 5HHOE 1QQDA 2BY2A 4Z7VB 4K3EH 5JHDB 4Y0GA 5TDPB 3SDCD 1EMTL 3LD8C 4HIIA 5DA4A 3MOAH 3WKNA 5JW4Q 2PW2B 3QEQB 5DMJB 4HD9A 2R39A 3T8XB 5I18H 3RZCC 4L3EB 4ZPVA 1PZ5A 1DUYA 2Q7YB 4PJCB 3VXTB 1Q72L 2AXFB 1IM9D 5EOTB 3BZEB 2X09A 3U0PB 1HI6A 5E6IA 2JE8A 4KQ4H 5CEYB 3RQ3A 3V4PL 3JVGA 1P7KB 2G60L 2Q76B 3NIDE 4JFDD 5IVXB 4Y19B 1G6VK 1WGOA 4PRBB 3V6FB 5C0RL 4G9FE 4Z7VF 3HPJA 1AD0A 3MBEA 4OLXL 5DEGB 3I3EA 4RMQA 5T1MB 3BQUC 3QUZB 4GS7B 4ONOA 3HZKB 5IMKA 4HV8B 1QOKA 4PJCF 2VAAB 4M7JL 5HHOB 2X1WL 4BQCA 1MPAH 1LD9B 3L6FB 5KZCB 5IVXF 2DYPA 3ISWA 1JHTB 5JPNB 4NYLB 4FXKB 4S1QL 1OW0C 1NCCL 4BKLB 5KVGL 5L7XL 3S5LB 1F4XL 3QDGB 5FM8A 3NFNB 3LN4A 4AIZA 3U9PH 5DF0A 4D9RD 2WUBH 2D9CA 4AENA 2LTQB 3BXNB 1TVBB 4ZS6D 3L3HB 5D1QA 5DK2A 3W9DA 1OAZL 4OV5A 1X5IA 3LY6A 2C3XA 4KTYA 4UDTA 4ZAKC 1KPRB 4JRYA 4N8PA 1AQDB 4FXGA 4HZLA 1OTSD 4MLSA 3FB7B 1L0YA 4UBDD 5DJ0A 2CDEA 4PR5A 3RAJL 4R90H 5EO1B 1J05A 1R5VB 3QIUB 5EZLB 2VZVA 3DV6B 3OHXB 3PP4H 3NIDF 3QIBD 2VH5H 4PG9A 5J13B 5CEZL 3IFPB 4EOWH 3L3OA 4LEOB 3RPIB 3FQXB 4P3DB 3KYMB 3LAFA 3M1BB 2VLKB 5E5RB 4HG4K 2MQ3A 5DURD 4HLJA 1V5JA 1JWUA 1MCQA 5DK3A 4XWGH 5I1JH 3NPSB 1J9CT 1YPZA 2HG5B 2Q8BL 3VXSB 4EVNB 4U1SA 43CAA 2IGFH 5FGSA 4H1LG 4EI5B 5I8CA 3O8XC 1YYLH 4NUJA 5CINL 2VSDA 1PW3A 2P8PA 3IS1X 4LVEA 5CBAB 1Z5LA 1X4ZA 1HN1A 5BS0E 2JIXB 3CFEB 3C5JA 2XZQH 2R29H 4JKKA 1JVKA 4Z5RB 5IHBA 5KVMC 5ANMA 1OAQL 4JREB 5DR5L 4W4NA 4P9ML 1CT8A 3WUWB 5TDNA 1OWRM 3DVGB 4MXVE 2HA1A 2YD5A 3BD5A 1LE5B 3I02B 4OM0H 5F7EH 3UTSD 3MV9D 1MCPL 1PFCA 4RIRA 3GI8L 4I3RH 1ACZA 1QRKA 4GLRI 4K3DL 2ZSVA 2X7LB 4NQED 4D8PB 5C6PB 3IU4H 4P2RB 4O2CA 4LNVA 1UB6A 3IETA 3MUZ1 5CUSH 1MF2L 3IS0X 3FTGB 3UYRL 4LHJB 5GS1B 2B1HL 2VN7A 1SY6H 5EUOE 4WENB 5F1IA 4RX4D 1GC1L 1M71B 2MCPL 1F4HA 5C6TH 4JN2B 5E00A 2ICEA 5BVJB 2H41A 4GKZA 5E94B 4NN7B 2QQNL 2NTFA 2Y7QA 2VUOA 3IU3A 1E4WL 2JJUA 4X6DA 4Y4HC 1ORQA 5J3HC 1DVFD 4YDKH 5FHAH 1VFAB 2CR6A 3GSNA 3CFDA 2J8UE 5F9OL 3CFJB 3MGTA 2DKSA 4JQXA 5ACZA 2RR3A 1LO2H 1C12A 4Y2DB 1YNKL 3QDMA 5DMKB 4X9BA 1C5BL 1NCBL 2XFXA 3C6LA 3H8NA 4NO0B 4L3AA 4MQ7B 5E99L 4R96A 2C7UB 4U1GB 2K7PA 3H42L 2VLRB 1BGXH 4QCIB 2PN5A 3WIFA 4S2SA 1HXMA 2WINB 5T1KA 3VWKC 3WFHB 5EUOB 4G8EA 1JIBA 3ZKND 3I6LE 1P6AB 5EU3B 4FFYL 1BQHA 5TE4L 3GSXB 1N5AA 1MJUL 2BRQA 4GBXA 5D2NC 1BOGA 1G9MH 5HYJE 2YXFA 2VDQH 3SHSA 4MXVF 4PGJA 4YQXL 3QIWC 4NJAL 2JK5A 4J2XA 4J4PC 1GGIL 4YBLC 3O6MH 3B8SA 3L3JB 3QUYA 4K8RL 2FATH 5DFTA 4KK6C 1ONQB 4X6CA 1F6AB 5EUOF 1FN4B 1N3NB 1H3TA 5T3ZH 2DJSA 1YQ2A 4F58H 1N8ZB 4G8IB 4PB0L 4GO6B 4JO4H 3M07A 2C1OA 3LD8B 4I9WD 4OLUH 3ULUE 1RZJH 5FIEA 2R0WH 4IS6B 1FO0A 4WU5A 4ZO8A 3DVIA 3FB6A 3RZCB 2J8UF 5MI0C 1J0IA 3PIQB 3NIGF 4M6AA 1ZHLB 4O51B 5DD6A 1PBYA 5B39A 1NGXA 3KDMA 1NAMA 5FM5O 3MA9H 5F7YC 5AYUL 5BZDA 2P5WE 5TF1H 5HD8C 1FPTH 4FNLL 4HH8A 5DJYA 4M48H 5C0CD 4LSPL 4KRPD 3BQUB 5HVWA 3X3FH 2V7HB 4UT9H 4NCC1 1BZ9A 5DD1L 4PJ5E 1CD0A 2X4SB 3U4EB 3RDTC 4OLZH 4C55A 4NQTA 2G2RA 3S37L 2X4PA 3L7FB 1AY1H 4JGUA 3BKYL 4F8QA 4K94H 3EKCA 3Q0HA 2D7QA 2HVJB 3G5ZA 3MRQB 4D3CL 3VWJC 4KDTC 2Z91A 1UCBH 1UM5L 5E5MB 1CBVH 4AZ8A 1UADC 1CFTB 2WLYA 5LAXB 3ZDYF 1UYWH 2NW2A 3GSRB 2E8ZA 2FLBT 4L4VB 3L3IB 4LARH 2DMBA 2NYYD 3WJJC 3IDIA 2PO6D 2P5WB 1OAXL 3CCHA 5HVHC 2PUQT 4KUZH 4OCSH 4U7KA 5F9DC 5E4EC 4Y8DC 4CJ0A 1FLRL 4ZAKB 1A2YA 3ULUF 2E7MA 5ITFA 1U95B 4JG0H 1TZIA 2HRLA 4XXCC 2XA3A 3K1KC 3EOAB 1AKJD 1TVHA 3UBXB 1QFPA 1E6JL 3GB7B 4TVSa 3LEXA 1W72B 3DUSB 4BFEA 3WS6C 4JRXD 2BNRA 4F7CA 3OKMB 5F7HA 1MRFH 1IKFH 1LILA 3FQTA 1T1ZA 1MWAH 2NZ9C 3FN3A 2H8PB 1DE4A 1FG2B 1RHFA 3GIZH 1WBZB 3MTRA 4NPYB 2CQVA 4CN1A 3KPRB 5F9JB 3EHBD 4DQOH 5F6IC 5GIRA 3BD3A 1EJOL 4HIJB 4DW2L 1XF4B 4XB7A 4ORGA 4YFLF 2EIEA 3HNVL 3JVGC 1Z2KA 2F74A 2DQEL 3O8XB 3NH7H 5IFJB 4LNRB 2AERT 4F37K 4HJGA 2VYRE 5INCA 3BN3B 1UCTA 2G75A 4M1DL 3OAUH 1QFWI 2H2SD 2AXGB 4WY7H 2ORBL 1NC4D 1ZWIB 1W0YT 2FRGP 2H9GA 3X13A 5HYSB 1SEQL 3PABA 3R8QA 3MMEA 3E3QC 4G8GA 3D85D 5L2KD 3NOIA 4UV7L 3NACL 4UT6L 3D0VA 4P2QB 4N8CL 1X4YA 3D69B 1KJ2A 1Q0YL 1XF1A 5ISZD 4PRDA 3VFRA 1JTOA 3KJ6L 3LB6C 1WEJH 1CLOL 3LH2H 2VNCA 2CDGB 2GSGB 1A6UH 4Q9RL 4KROC 2W0FB 3LQAC 3LS4L 4ONFH 4U3CA 3H0TA 4Y4HB 2APVA 5D1QC 5E56A 4W6YB 2DLFL 2FD6H 5GJSL 3BOVA 5K9KA 1FBIH 1MHHB 4PG2A 4WEBH 4CW1A 3WYRA 3F8UB 4MZ2A 5CJ8A 3S37X 5TDOA 2J6EH 4LPUA 3HC0B 3MRNB 4NFCA 2R1YA 4WHYG 4MQXD 1QEWA 3IT8D 2NX5D 3IB4A 4OB5H 5JR1L 4PJ7B 1WCBB 2VLJE 3HG1A 2WQRA 1KNOB 3ARRA 3DGGB 1CCZA 2Y07L 1F4AA 5CGYC 5A2LH 2MPAH 3JTTB 4AG4L 3VWKB 1NDGA 2CRMA 2BJMH 2YUWA 4KJQC 4MMZC 4O2FA 1NFKA 5D2NB 4KVNL 1AGDB 4MQSB 5E2WH 4MJ6A 3GSOB 3QIWB 1DN2A 3S35L 4DOHB 5I15H 2N7BA 3O2VH 1QSZA 3DI2B 3FN9A 4YBLB 3DO7A 2UYLA 3BN9C 4I3SL 3UX9B 2AJYL 3TVMD 4WGWB 3VI3F 1P4IL 4JKPL 1G7IB 5FGBC 4DKFL 1DQTA 1EV2E 4NJ9L 4CVXB 4OAWA 2R0ZH 2CDFA 3QCTL 4Z9KB 5IB3B 3RY5A 5HHMB 5DD5H 1DEDA 1YNLL 5HI3C 3EYUH 3CLEH 5D7JB 1K5NA 3QO0A 1A7OH 2FR4B 3GMLA 2DI9A 5IB4B 3BH8A 1LEGB 3U4BL 1I8MB 5F7WC 1YY9C 5MI0B 1RZGB 1G6RL 4KJWD 3L3DB 2AJXH 2GEEA 4HIHA 1YEFH 3VXUD 1NEUA 3RVVD 2DQJL 5SX4H 3VW3H 4FG6D 2EIDA 1FYTB 2APXA 1A3RH 1AQKL 1OD7A 4K3HA 4OBSA 1X5XA 3B2UD 1AO7D 3OKOA 2XRAH 5HGBB 1SMAA 4ERSL 2FJFB 2X4OB 1EFQA 4FRWA 3OKEB 1JF1B 1NC2B 4LRNH 2YUXA 3AB0C 3RDTB 5C0EA 3ARED 3FQWB 1KTDB 1FJ1B 3WEXA 1T80A 1IE5A 5EBLB 2DLIA 5I76B 2ARJA 4ODTH 3C6SB 3NPZB 2BSED 4Z0BH 2OTWB 5EU7E 4E5XA 1MCOH 3VWJB 1G7PB 2VLMD 1A6WL 1F11B 3MUGB 4IMLA 1A1OB 5I2IA 1CDUA 1U6AL 1OCWL 3N9GL 5DS8A 1IGYA 4BFBD 2FX8H 1C08B 3RKDD 4Z95L 4MB4A 4RNRB 5IB1A 3RWJB 5GS2H 3P30L 3MRFB 5GGVL 3ZKSD 4M3JA 4LCWE 5HVHB 2XN9D 3GMPB 5E4EB 3PUCA 1B0RA 4ELME 2FHBA 4NNYA 4JZNA 1UEMA 5D71L 3VD9A 3GMRB 4OF5A 4YPJA 1BFVH 3UTZB 4OCYL 3B83A 5C09B 3QUYC 1GPOL 1LO4L 1SVZA 4WFGD 4EZMA 5D7LB 3QPQD 1BF8A 1HYSD 4DCQA 2Z92A 1HILB 4HUVA 2O61A 3D0LB 1T21A 5F7LB 2EDTA 3E3QE 4QHMA 3VJ6A 4CDHA 4DWHA 5JQ6H 4LVHC 4X4XB 3O9WC 3PXHA 4KU1A 3TN0A 4HIIB 1HHHA 4PGDA 4HW6A 4L4JA 4G9FA 2VDOL 2YMXL 4HSQA 1H8OA 4ZPVB 3TA3A 1F3DH 5KVEL 4OZFH 3QT2A 1DUYB 1FIGH 5EU6A 2A6IB 1GGUA 1DQML 2YS4A 1D5MA 2XY1A 3S35X 5F6IB 4ODWA 4XWOC 3RGVC 4WHDA 3KXFE 1HI6B 4JGJA 2UWEA 2EXYD 5FDWA 4TUOA 1XGRA 1QYGH 3VXOA 3HPJB 3T4YB 5I8EA 2KPNA 2X40A 1RURH 5EOCL 5EA0L 1OLLA 1RUPH 3ARFD 4MJ4A 2BX5A 2H2PC 5KVFH 5KSUA 2DM2A 4A2MA 1OGTA 1R5IA 4X5LA 4ELMF 2JJTA 2DYPB 5ESQA 2J1KA 4HPOH 3BUTA 3O45A 4U0QB 3BDBA 2OL3L 4GKSA 1X5FA 3RVXC 1CXEA 4P3CL 4YPGB 4NBYB 5ID0A 1NKOA 1XGUA 4WEMB 3BFOA 2D03H 2ZUXA 3FRUA 3KPMA 3LN4B 1IKNC 1UG9A 4AIZB 2Y06H 4KROB 4LLUB 5BW7C 4AENB 2QADC 4Y5YA 1IJ9A 5D1QB 3VXNA 2RAMA 5DK2B 3W9DB 5GS0H 3WLWD 1BEYH 5H35A 4OV5B 2DLHA 2YZ1A 4F3FA 4XNYL 4UDTB 1QSFD 3W5NA 3I9GH 3I50L 1JNNH 4X5WA 4HZLB 4NUGL 4Z8FH 1WAAF 4Y8AA 1MJ8L 1HYRC 3VH8B 5C9JA 1MCNA 2WBWB 1VGEL 1T66C 3F5WB 1G7QA 1QSEE 4MA7L 5T5NF 1UVQB 1LP9A 5EUKA 2ZUWA 3K4DA 2CKBL 5DRNA 3KPTA 1DDHA 3IJYB 5A1AA 1NGPL 3BWAA 1KN2H 5BS0A 4AEHH 4M43H 4OGXL 5I19L 3VFOA 1KCSL 1N2RB 1NKRA 1JWUB 4KKAD 3SJVA 4PUBH 3BKJH 3PQYA 2B8OT 4U1SB 5K9QI 4QF1A 3A6BH 1GOGA 1WZLA 2DOCA 3ZKXC 4B53A 1R5WA 4Z7OE 2P8PB 1Z5LB 1J8HD 2HRPL 4GH7B 1IGMH 3MOBH 3FO2B 4Y1AD 1F58H 3WXWL 3N85H 1CT8B 2H1PL 5CSZA 5TDNB 4DKAA 5DO2C 1JZ6A 1J0HA 5LXGL 3T1FB 2FX7L 1HH6B 3QB7C 4M61A 4RIRB 2ZSVB 2HAZA 2NY4D 1A7QH 4JG1H 4O2CB 4DN3L 1UB6B 3IETB 4H0IA 1UQSB 4U1KA 3OXRA 1FQ9C 3GBNH 4Z7NE 5F1IB 3B4NA 4YDVA 1FZMA 4Y4KA 1A14H 3ZYIA 5E00B 2ICEB 4F9PA 5KW9L 1EBPA 2X9YA 1KN4H 2W60A 3KYOB 1T1YA 4GKZB 1I1CA 2KZWA 2Y7QB 2ZOLB 1XF3A 3TT1L 4HKXB 4JDTL 1A7BA 1S5IL 3CFDB 1INDH 4BZYA 1WVZA 1U8MA 5IUSA 2VUYA 1BM3H 3AB0B 3FCTA 3ROLA 2OZ4H 4P48A 1C12B 3T3ME 4TUKH 1CICA 2NCMA 1AFVH 1HQRA 2V5MA 1U58A 3QG6B 1Z3GL 3AXLA 2XTJD 1FFNA 3UZQA 3GKWL 4EBQH 2XZAH 1NSNL 3P9WB 1V05A 4EDXB 5BJTB 4Z7OF 4S2SB 4QTIH 1ULVA 3VG9C 3FJTA 4HMCA 3ESVF 4LOUC 3S5LG 4XCCL 2J88L 1LE9A 5F7KC 3VA6A 4JFDE 3JV5A 1PQZB 1BQHB 3H9ZA 3Q48A 1N5AB 4KJPC 3UBXI 4MCYB 5L88L 1RUKL 3QXUA 3FN0H 1E27A 1A3LH 3EOTH 2F53D 1XGYL 3LN9A 2P45B 2X10A 4XPFL 5FV2A 3QUYB 1RUML 5TGBA 1Z0NA 3DMMD 3QJFA 2ZSWB 4OGYL 4X6CB 4Z7NF 4KI5C 1DBBL 1I7RA 3UTTD 2NY7L 4KKCC 4H1LH 3C5ZD 1MFBL 1G9NL 1M6OA 3O9WB 4LVHB 5GRXG 1D5ZA 3ULVH 3IXAA 5SWSA 3QEUB 2PTVA 1YYML 4K9EL 1XAUA 1JV5A 1LDPL 4WU5B 1KB9K 1G9EA 1DBML 3FB6B 4UILL 1KB5H 4Q74A 1VACA 2GK0A 3VXQB 4MX7A 5F96H 5E8DH 5B39B 1NGXB 3KPLA 5H94B 3RGVB 1X5HA 1EHLH 4ZXBC 4CVWA 3V8OA 3STZA 4Z76A 5BZDB 4KTDH 1KXTB 1EERB 1NUGA 2BK8A 4HUKB 1UFUA 4PP2A 1NL0L 2P5EB 5CJOH 5DJYB 1CZ8L 3LEYH 4JM2D 3L5WB 3EDFA 4X4YA 1OT1A 1BZ9B 2HFTA 1A8JH 5C0BA 3VFGL 5B22A 3N1PC 1NCWH 5FGCE 3EJZD 3WDHA 1P53A 3WUWG 1CYGA 2X4PB 1FRGH 1MH5A 3PHSA 4U31A 1JFQH 3WBDA 1X9QA 5IK3B 3G5ZB 1ED3B 3KWWB 4PJGA 3ES6B 4NZRH 1HINH 3C87A 1Z9SA 1HHGA 3PE9A 3VMOA 5IB5A 2NW2B 2R9HD 5B4MC 4O02L 5CZVH 5DZLA 2X70B 3CPLA 2QADB 3GHBH 3IDIB 1Z9MA 3D39B 3CCHB 1AHWA 1NLBH 3SE9H 1VFMA 3REVA 4JPKH 3L5XH 4UU9A 1PJ9A 5F7NC 1S7VA 3SQOH 4JCMA 3BSZL 1MELA 5EZOH 1HCVA 1R0AH 1TZIB 4O2EA 3MV8A 1BFOA 3EYFB 5JOFA 3UTSE 3MV9E 3LEXB 3VA2C 2BNRB 5GJTH 4PREA 1E4JA 4JQVC 5FCUH 3CH1A 3VCLA 4FQHA 5F6HI 2QQKH 5C08A 3FQTB 3FONA 1T1ZB 5DD3H 3QO1A 1DE4B 2QR0A 3UDWC 1JPSH 5J57B 2DQGL 2VKXA 5D6DA 5I66A 3TA3C 1A9BB 4QRSA 3EOBA 4RMSA 1N7MH 4LBEB 3CMOL 5E8NA 4MLIA 1V7NL 3RA7H 4A6YA 5GHWL 4ORGB 1ZE3C 5BOZG 4JN1L 3MJ9L 2F74B 1CIDA 4LCYB 3MRGB 4DTGL 5AD0A 1MRDL 2CGRL 4MDJA 3ZKXB 1FNHA 1P2CA 4NO3A 5JW3H 1XFPA 1A6AA 2KZ1B 1MCEA 4HJGB 4M1GH 1SJEA 4RAUB 5INCB 4M7KH 4N0UE 5F72S 3ZO0A 2G75B 5I74C 3O11A 3O6LH 4MNGE 4P5KB 3BE1L 4LLQA 2WBJC 2H9GB 4HWBH 5K9QG 3MPCA 4G6KL 3MMEB 4OFYA 2NY5L 2Y5TB 2R23A 3MO1A 2IBBA 4G8GB 4HK0A 4XVUC 4KV5E 4OFPA 7FABH 1WFUA 4PJBE 3D0VB 2JJTC 3D25B 3WD5L 4WO4A 4WI6A 1BD2A 5HYEA 2F54A 3MV7A 4OCXL 4Y4FA 3VFRB 2HT3D 2R1XA 1AR1C 1N64H 4R0LC 4YDJA 1EO5A 2B5IC 4MJ2A 5JPMA 5L8LB 5LGHL 1INQB 4O5LL 2VLJA 3H0TB 4Y5YC 4E0RA 1F2QA 2QSCH 4G80B 5K9KB 2QV2A 4WFHD 2Q20A 4V1DD 4A2LA 5JO5A 5TPWL 2JCCA 1SBSH 5ALBL 1AE6H 4CW1B 4PS4H 1I7UA 5JDSA 3PWUA 1G7MA 5DSCA 4OLYH 4XPAL 1T04B 4HQQH 3HG1B 2AJZB 4PJBB 4WFED 1INEH 3ULSA 4LGPB 1GZQA 5ERWA 1J1PL 1AIFA 1A3QA 3VG9B 4FQ2H 3WKML 5HI5D 4ETQB 4X9HA 1NCTA 2ZNXA 4O2FB 3GBML 2YPKA 5K9OA 1EDQA 1L4IA 3IYLW 4ZD3H 4HBCL 2O5ZL 4P5TA 2W9DH 4RGND 1DBKH 5C0CE 1MCIA 2X4RA 4HLZG 4KV5F 3DO7B 3HE6C 4PJBF 2VZ3A 2B2XL 3FB5A 1ZEAH 4AL8L 5C2BL 4E41A 1H0DA 3V5HA 4Z7UE 3UBXG 1T0NA 4N8VB 2QQQA 5D72L 2CDFB 4WWKC 2DD8H 1QBLH 5ICXB 5DVLA 4LCUA 4LDLB 3SGKC 3SOBL 4C59B 1K5NB 1JZ4A 2CK0L 4B41A 3GMLB 1FVEA 4YX2H 4S1RL 2XWTA 3G6AA 1GAFL 3BDYH 3BH8B 3JWOH 4HULB 2JLLA 1S5HA 3NZ8A 2R2BB 4NSKA 2YA1A 4J12A 1TVDA 4OD3H 4BQBA 4FQCL 2DQIL 4XCFH 4NCDA 4ZFZB 4ZXBB 4Y4KC 3IDJA 1Z6JT 3HAEB 1EBAA 1FL3B 1ZVYA 3OB0H 4JZOA 3LEVH 1NGWA 4U4BA 5ICZA 1J86A 5GS2D 4QRTA 1RU9L 4K3GA 1P5UA 4OCRH 2R0LH 3BAEL 2XT1B 4JRXE 4LSRH 3F7YB 4NQDD 5JXEA 5MENA 2N4IA 1L6ZA 1QKZL 2EZ0C 4P23D 4NQVA 5C0EB 1T6VN 4TQEL 1SYVA 5IJKA 3G9VA 2CUMA 2WV3A 5SWZA 3WEXB 4ZTOL 1MFAL 5HYSG 4G6JL 3ARBD 5DA0B 5IHUL 1A7NL 1EHNA 4G3YL 2NMSA 2DB8A 4LCWA 3ZKQD 5DJ8A 1DFBL 4Q97A 4IOFC 2ZWLT 4LLMA 4FZ8H 5I2IB 4AT6A 4WHYH 2BZDA 2R69L 3EIFA 5E2TL 5DS8B 1IGYB 3GO1H 3HI6H 5IB1B 3N0PB 2N7AA 3WJLC 2NXZC 3NGBC 5T3XL 5IHZB 1B4JH 1CWVA 3QPXL 1B0RB 1EPFA 5DD0L 1GCFA 1WFNA 1YZZA 3KYKH 1HEZA 3CJJA 4JDVA 1KLGA 4IRJD 3JTSB 4PRAA 1F45A 5IWLC 3HC4H 1AP2A 4J3VA 1K8IA 4TUJB 1OTTC 2Z92B 5IIEB 3LCYA 4PRID 5L2KE 4HUVB 4PRPD 5EU5A 4N0YH 3SKMA 1T21B 4QHMB 5I18L 5E2VL 2JJVA 2PXYD 3V7AE 3MNZB 1HHHB 4PJAA 4LPWA 4PGDB 3NA9H 4PJ8A 1TTUA 2SEBA 3HMXH 3TA3B 4NIKB 1FFPA 2Q6WA 3MRRA 2C26A 1RK1B 4W4OA 4ZNEE 2P46B 4BSVA 2UWEB 3R8BB 5FDWB 5D93C 3O2WH 3HPLB 1EO8L 3ARDC 1BLNB 5I8EB 3AM8A 2NX5E 2K7QA 2OP4L 3L9RA 4KMTL 1F3JB 5I74B 1AXTH 2CO6B 2H32B 5GS0D 2CH8A 1BOYA 2WBJB 4IHOA 2CRIA 4MJID 4RQQA 4CJ1A 1S8DA 4M5ZH 2A9MH 3TZVD 3WFBH 4TNVF 1ES0A 4DUXA 4NNPL 3MXVL 3STLB 1DSFH 4HJJL 3WFCL 5KJRL 3L7EA 4ZS7H 4GKSB 1GC1C 2OM5A 1OAUL 4YO0A 3U9PL 4NC1C 1XGUB 1F00I 3UAJD 3FRUB 3KPMB 4R0LB 3CSGA 2B5IB 5C0ND 5IB2B 1Q9WA 4LIQH 1LEIA 4JKLA 4Y5YB 4BYHA 1QSEA 3VXNB 5H35B 3QDAA 2DQFA 4Y16A 4F3FB 1ODAA 4OF0A 4N5UA 1A6VH 1CLZH 3QFJD 1CS6A 3BH9B 2EYRA 1KXVC 1ZV5A 4QRPD 5C9JB 1I4FA 4MVBC 4RGOL 4UQ3B 4MD5A 1G7QB 3DUUA 3H9SE 3OGOE 4GT7A 1Y0LA 5C92A 3TFKC 1Q9LA 2DWEA 3Q6GH 3QUXD 5EZJB 5DRNB 1DDHB 3DRQB 3RL2A 3S34H 1G0XA 4HPYH 4XC1H 4XBEH 4I48B 3I3DA 1CG9B 1AGEA 3BWAB 4N1EA 5D6DC 3T0ED 1ITCA 5I1JL 5LWYH 1KC5L 2YSSA 2ATPB 3CC5A 3G5VA 5FA4A 2X1PA 1NMBH 3MUHL 3QUMA 3SJVB 3QI9C 3FQRA 5SV3A 4K8RC 3PQYB 5JA8B 4OIBA 2R29L 3GK8L 3VRIA 4ONGL 2CO7B 1R5WB 2P44B 5BV7C 1OSPL 3V5KA 1OOAA 2XKNB 4GRLA 4WWKB 4Q0XL 5CSZB 3H9SB 4WI5A 2VWEE 1DQJA 5CUSL 3PWJB 4M61B 1DEEB 5I1HL 5CZKA 3WL9A 5CWSB 3B3IA 1HE7A 4WO4C 4S1SH 5D9SA 5C6TL 2YD3A 4U1KB 5EU4A 4P59L 4Y4FC 1BBDH 4HC1H 4Y4KB 4BZ2L 3KPQA 4UT7L 3RX7A 3SDCA 2DKMA 2BFVH 4CVZB 5FHAL 5J1TC 2W60B 1T1XA 4WNQB 1OP9A 1XF3B 4WFGE 5EDXA 4S11A 5HDQL 1LO2L 1WQVT 5GRUH 1L6XA 2A6DA 2IMNA 3BHBA 4ZOBA 1IM9A 3HNTL 2EE3A 1CFNB 4C83B 2D7PA 4PRHD 3GMMA 1ZHBA 4JFDA 3D3VE 1WUNT 5CHNA 1HQRB 3VGDA 1J11A 4ORZC 2OL3A 1U58B 2P48B 1TFHA 3BD4A 1QUNA 1JJUA 4WHTA 4XMPL 3QULB 2ESVD 4QOKE 2DI8A 3T2PA 1RFDH 3GSUA 3CDGA 1RJLB 1NBVH 4X7TA 5E9DA 1LE9B 1IGCL 3ULVD 1QD0A 1BQLH 2NXZB 3HZVA 4BM7A 5ICYA 3NGBB 2HTKC 4OI9A 4OUUA 1KENL 4LP5A 2RQ8A 1KJMB 4DN4H 1K4CB 2PW1B 1EEYA 1E27B 2HN7A 1PZUB 5DC0A 3BI9X 3QDJD 4WVRA 1MI5A 5FCSH 4HWNA 3DSFH 5I1GL 1QRND 4F58L 5JW4N 3MRMA 3VH8G 2CKBA 2AJUH 1I7RB 2R0WL 3INUL 4OCMC 1M6OB 1D5ZB 1NH6A 3DIFA 3N1FC 4QOKB 3IXAB 3MBXL 5IBTL 5SWSB 1SJHB 3PDDA 1G7HA 3MGOA 4G6AD 1JV5B 4KPHH 2A6KB 3HKFA 2VN4A 5DWUH 1IM3B 1EIBA 1VACB 1QPXA 2GK0B 4NC1E 3IFLH 3RIAK 4MX7B 4OM1H 5JW4M 5TF1L 3GSWA 3QNYA 4NHUB 5CSGA 3QIBA 2DL9A 4U49A 3STZB 3IDNA 5FA3A 4JY6A 5D93B 3ARDB 2IQAB 4RWYH 4PP2B 1VERA 3OZ9H 4UT9L 3X3FL 1U3ZA 1KIPA 2NLJA 4X4YB 2GY7B 3PXJA 3EJYD 4PTUA 3GHEL 5HGHB 4KWUA 2ZUYA 3JV6A 3LKPB 4MXWH 5IJKC 1IMHC 4MHHI 3WIHA 1KCRH 1MCWM 1MH5B 2L7UA 3ABZA 5FEBA 5IQ9A 4X6EB 2DICA 1QSVA 1UYWL 1T5WA 1H3PH 4PJGB 4LARL 5I0ZA 1NCDL 3FO0L 4M00A 1FDLL 4U6YA 5CIPB 3DPBA 4OCSL 4GMSH 4UOW0 3UTSA 4M6OH 1R3JA 4F7MA 3CPLB 4KK8D 4NRZA 4PBWD 4U0RC 4BA8A 4YWGL 4NQEA 1J8HE 1EGJL 3PNWA 3OJ2C 3REVB 4MAUH 2X9WA 3KHQA 3U0WH 1FYHB 4RX4A 2A38A 1I1FA 2EDFA 2B0SH 3MV8B 2NW3B 4XPGH 3M17A 1FC1A 5JIIA 4DK6A 1DVFA 1MWAL 1X3DA 3K80A 3VCLB 2VQTA 1TENA 4FQHB 2VMFA 2EDRA 5C08B 5L8JB 4AEIL 3O6KL 3QO1B 2QR0B 4YHLL 2WANA 4M5YL 4DQOL 3G6DL 4OBRA 5I66B 3KGRA 4N0UA 1S78C 1MNUH 4CGTA 4UTAH 1N0LA 5AEAA 1BQHG 4MQTB 5GXBB 1U8IA 5DRWA 5E8NB 1CFVH 1LNUA 1JPST 1YQVL 3QI9B 2J5LC 4HGWA 4P5MB 3WFEL 3MLUH 3NN8B 5AD0B 4ZYKA 4MDJB 5E1HB 4OLVH 1MHPH 1P2CB 4NO3B 4EUPA 5BV7B 4WY7L 1A6AB 1ZA3B 2HLAA 1SJEB 3MRJA 2B1AL 2MWCA 4O4YH 2IADA 3O11B 5FOJA 3KAAA 4LLQB 1EAJA 2AK1H 1MFDH 2RIKA 5T3ZE 4YHZH 2R23B 4L5FH 1IAKA 5DMIL 1ZLWH 4Z7WA 2I9LA 4WO4B 1MCLA 1BD2B 3ALXA 1A6UL 2DLTA 2F54B 4MMXC 4M7ZC 4OIIH 1ZHNA 1CU4H 2AV1B 3MV7B 3PGDB 4Y4FB 3B9KA 5B39G 3QQ3B 5LGKA 2R1XB 1Y18A 2YKLH 2BY0A 2A9NH 1U3YA 2FD6L 3C08H 3BGMB 3V4VL 1KTLA 4X80H 1JE6A 3TJHC 4WEBL 4E0RB 5TH2A 1DQLL 3LKQA 5ID1A 1KV3A 5EFIA 4Y16C 1P1ZA 2CIKA 5JUEL 1REIA 1DBAH 5JO5B 3P11H 2JCCB 1YEJL 1I8IA 4OB5L 1LO5A 5FKPA 1I3GH 1MVFA 4MD0A 3CFCH 5JDSB 2GJ6E 1T1WA 1J5OH 5DJ2B 1QLFB 1MCJA 4LLVB 1T83A 2YD9A 2ZCHL 4JVWA 5DSCB 3GJFA 1U3HD 3NCYP 4M02A 2BJML 5C0CA 4KTEH 2BVPB 3VXPA 3KPSE 3PWPD 4BH8B 1GZQB 5ERWB 2V7NB 1AIFB 5SX5H 2VDLL 3A67L 4L8SA 3I6GA 4WJ5A 5E2WL 4Z7UA 5K9OB 4GMTL 5BRZE 5I15L 2DTSA 5IQ7H 5D1XD 4GXVH 4XNMB 1LGVA 4RMRA 2IAMD 4YUEL 4JFED 2QEJA 2FYYB 5DGQA 3RJQB 3O2DL 5DVOA 2EXWD 4K07A 4U1LA 2H3NA 3MACH 4CNIA 4E41B 1Q1JH 1VPOH 4ZUUA 4GW1A 3KR3L 3CLEL 2P8MB 5I30H 2EH8H 4LLAA 5INDA 3EUUA 4X4MA 1P69B 5AUMB 1NBYA 1SQ2N 3H6JA 4ZMAT 3PJSB 2ICWJ 1CFQA 2XQBH 4LCUB 4F7TA 5LVEA 3KLDA 5LBSH 3QXAB 3LQZA 2XWTB 5C07D 5KAQG 4XBPB 1AKJA 1Q9OA 2YUVA 3CVHB 1S5HB 1HQ4A 5AZ2H 1K2DA 3DBXB 3MJ9A 5BRZB 4JVUA 3EOYG 4X7CC 3OB8A 4MCZA 3IDJB 1F5WA 1Z9LA 3SDCC 4NKMB 4Z77A 3OAZH 2ZUQC 1FL6A 2L0DA 5ICZB 5B21A 4FZEH 2BVQA 4LRNL 4KZEL 3SDDD 6FABH 3IJSB 4WEUD 4NN6C 5MENB 3WIIL 2ZNWA 2PYED 4NQVB 2XZCH 3DNKA 2YK1L 1SYVB 4QNPE 5IM7A 1ZSDB 2R2HA 2EDBA 1XCQA 3PV6A 3QH3A 1SJVA 5DJ8B 5E8OA 1U0QA 2APFA 2FX8L 1N6QL 5C0GA 2NY1D 3D9AH 3C8KA 3BJ91 4YAQB 4AT6B 3FO1B 5AAWA 1NC4A 3VXME 3B9VA 2IBZY 4DEPC 1U2HA 4MHHG 1T2XA 1MHCA 1B6DA 4OZHA 1GSMA 3MNVA 4C56D 4NOFA 3D85A 4U0RB 5L2KA 2J8HA 2FECI 3QEGH 4PJDA 2W59A 5D8JL 2F19H 4NO2A 1JZ7A 4QXUH 1HEZB 5ISZA 1HWHB 1KLGB 2RCSH 4JDVB 4U6XA 4Q9BA 1CDYA 1K8IB 1RIUH 2AEQH 1KBGH 2GTWB 4R8WH 3S88H 3C8HA 4Z6AT 5DHVB 1WIOA 5JXAL 1A5FL 3DETD 1BBJA 4LDEB 4DVRH 1AGCA 4PJAB 1FIGL 1FGVH 4TSCH 3SDAD 1TIUA 5BO1H 4UBDC 3VXMB 4TTDD 2NX5A 1W72H 2KUTA 1FFPB 4OZIA 2Q6WB 2VZ1A 2OYPA 2FGZA 2MQ0A 3RUGB 1QYGL 4IDJH 2ENSA 4WFHE 2YRZA 3FFCD 2J5LB 4V1DE 1EHXA 4BSVB 1CR9L 4ALAL 3LV3B 2VISA 4YLQT 1RUPL 1H3GA 4XP9L 4PJIA 2FL5A 3L9RB 4F7PB 1I1YA 3S3JA 5E08L 5KVFL 4NQUA 4IHOB 2EDWA 3MRCA 2IF7A 3RUGF 5KS9E 2D9QB 5FYJD 1G6RB 4IIQA 3TBTA 1QACA 1S8DB 1MAMH 2YWZA 3TVMA 4MXQD 1DQDH 2JELH 3SKUD 2NY3D 1ITBB 2W0PA 2LVCA 4H88H 4XXDA 4PLNC 4YO0B 4M7ZB 4Q6IA 4M7LH 3S8WA 5GS0L 1BEYL 1KCKA 5DFWH 1LEIB 2YA0A 1FZOB 3HAEG 4HK3N 2HYMA 1JF6A 2DQFB 4Y16B 4Z8FL 3MA7A 3VXUA 1PSKH 3QEHB 3AMKA 5TQ2H 5IESL 1T7ZA 2BNUB 3MUY1 3TPUA 5GSRA 4JFOA 4EI6A 2Y1VA 4LEXL 1ACYL 2EYRB 1YMHB 2OXGA 1AO7A 4JFZL 4OLWL 1HNFA 1IC7L 3DUUB 1CGUA 1DVFC 1MRCH 4XC3L 1Y0LB 1SHMA 1J10A 3EBAA 1JYVA 1KCVH 4AEHL 3RL2B 3AREA 1NAKH 2DIJA 2WK2A 3AFLA 3OB0K 1CTOA 4QRRD 4APQD 1MY7A 3VG0H 2YSSB 3CC5B 3G5VB 5FA4B 4NGHH 2VXUL 4NQDE 1BIIA 3TGXA 3FQRB 3BVNB 4RFNC 4G5ZL 3LN5B 5CGTA 3LIZH 5IF0A 3MOBL 1RVFL 1CDJA 5FO7B 3LSOA 4MAYC 3N85L 3QP3A 3TF7C 3BKMH 4ZUVA 1RY7B 5D2LB 4HUXB 5D7SH 1T20B 1G9NC 2XN9A 4P2CG 4ODUB 1EK3A 1RUAH 3RWDA 1F8TH 2PCPA 4U2ZA 4EXPX 4OF3A 2DI7A 2W9LA 4K9EC 3CLFH 1DQJB 3K4AA 4WCYL 1A7QL 4WI3A 2WZPD 3HUJB 4O58H 1AI1H 4XVSL 3RPKA 2IPUK 1YN7A 2HH0H 4OJFL 2OJEA 3TYFA 4FABL 4PV8B 1AC6A 2P7TA 5EU4B 1CQKA 1KELH 2X4TB 3V4UL 1FGNH 3R06A 5D2LF 3B9KC 1YC8A 2AK4D 3BEVA 3DRTA 1FNGA 1ZLVH 4Z0XA 3SDCB 3LPWA 2QSQA 4WWID 2ZUQB 1T1XB 1DP0A 1VADA 4ISVA 1WIUA 2NXYC 3DXAA 3HUJF 2LQRA 4QHNA 4NN6B 4TUKL 1A6ZA 3WE6A 2VJXA 2A6DB 2A73B 5DFVD 2COQA 1IM9B 4KFZC 2BHZA 2C3VB 1MCWW 2BERA 1M05A 1DUZA 1ZHBB 5H37G 1T83C 4EBQL 2XZAL 5CHNB 2FZ3A 2OL3B 2Z4QA 3LKSB 4QTIL 1IAOA 5I1CL 4KRPC 1X5AA 4Y5VA 2VDRL 3BWUC 3ARFA 3V6OA 1YN6B 3GSUB 1H5BC 1YY8A 2VL5A 4DEPB 5E9DB 5HDBE 2WLZA 1P84K 4LPCA 5C6WH 2AJ3B 4LU5L 1A6TA 4XTRD 1UM6H 2YPLE 25C8H 4LAQH 5ICYB 3EOTL 4HS6B 5C0DA 1EEYB 1OTUC 5JA9A 1H8NA 1RJYA 5IW1A 4YHIB 5JHDD 4L3CA 5BXFA 1EEQA 1MI5B 5FYKD 3RIFK 3ZTNH 3QEQD 5DJZB 1OGAE 3DV4A 4PJ9D 2ADIB 4L3ED 2CKBB 2XWJA 4I18A 5CS7A 4M62L 3A6CL 4NZJA 1QSFA 4ODXA 5J4MA 3DIFB 1VDGA 1G7HB 5E8DL 1KFAL 3TIEB 3DVNA 4FQJH 4G6ML 3THML 1SYSB 1EHLL 1NLDH 4YC2C 4LLWB 4CUCA 4KTDL 4DKEL 3CX5K 2ENYA 3QNYB 4PJXA 3RI5F 4Z78A 1K3IA 4JHWL 1ZS8A 3K4ZA 1KYOK 1UJ3A 3CH8A 4XCEA 3R4DA 3LEYL 3TIDB 2ZJSL 5FA3B 2ADFH 4JY6B 4NQXB 3S7GA 5HHOD 1YEKL 1YEDA 3B6SA 4PJEA 3QFJE 2HWZL 3F7QA 2V2WA 1YECH 4HUMB 5KZCD 4JANB 1LO3L 1FFRA 2EO9A 3QAZC 4XP5H 3EHBC 3PWLA 2GITA 2NY5C 1G7JA 1JFQL 4OKVA 3O3UN 3TBSA 3JV6B 4QWWD 1SY6A 4M1CD 2A1WH 4RDQF 3X12A 2ARWA 2AQ3A 4WW2A 4NZRL 4G7YH 5HPMB 1HINL 1NCAL 3PWVB 1HSBA 1J8HA 1ORSA 1I8LA 3SGEH 3G6JE 3CUPB 4Y1AA 3ME0A 5I6XC 3O3DB 3V0WL 3RNQA 4HWZB 3GHBL 2EE6A 4H25A 5MEOA 5L2JB 5DJAA 2I07A 3SDYH 3T0AA 3SE9L 1XH3A 2VDML 3DWTA 4JPKL 4NRZB 5E2JA 3BUYA 3KVQA 1K9TA 4R3SA 4JHZA 4NQEB 5EZOL 1R0AL 5IEKA 2YC1A 3QIUD 1B0WA 2YD2A 3PNWB 2ZCLH 2EH7H 2VXTL 1G0DA 1EEZA 1IC5H 1MCSA 5I1AA 5FCUL 3BYTA 5DTFA 3LQAH 2VC2H 4PGZA 3TP4A 3M17B 1G7LA 2NY0C 1DVFB 3JV4B 4K23H 3QWOB 3D6GA 3W2DL 5I8OH 3DX6A 1JPSL 4KKBD 3KNBA 4K7FB 1FHGA 4WV1A 4URTB 4XI5C 4UB0L 1UWEH 4MQXC 3TJEL 4XB8A 3S96B 2Y5EA 3QR2A 5F1NA 4KQ3L 1X44A 1U8IB 1RPQA 2MJWA 4PP1D 4XMKH 3BP5B 5DRWB 1LNUB 3CDYA 4YXLL 5DYOA 4HGWB 3BO8B 4D94A 2IH3B 2NR6D 4PRHE 4MAYB 2ICWA 2WWMC 1IQDB 4GAGH 2HJFB 3ARSA 3G6JF 3RZWA 4J6RH 3MRJB 3S6CA 4XP1H 4HWBL 4YHKH 1AD9A 2CXGA 4MWFB 43C9A 5D7IA 2HKFH 4NHCH 4N9OB 4P2RD 3MV11 2C9AA 7FABL 3OTTA 2ESVE 4ODSL 2F53A 3P9MA 3S36H 3ZT7A 1MFEL 4OUOA 4IIQC 1F4YH 1OHQA 5DQJA 1IAKB 3TVMC 2PYFA 2XNAB 3DMMA 3ULVE 1LK3L 4PV9B 5J9PB 5D4QA 4Q6IC 1KJVA 3UTTA 4XCNA 3OKKA 1JGEA 2UZYB 3B9KB 4UQ2B 4QXGH 3C5ZA 2YRLA 3QRGH 3QDJE 1OAYH 5I8KH 2XXCB 1KTLB 2B7DT 5FKAA 5ALCH 1AE6L 5TH2B 5D5MA 3P3YA 4L1DA 4PS4L 3LKQB 3WXVH 2NXYB 3BP6B 5EFIB 3IDYC 2HMIC 1MY5A 1P1ZB 2CIKB 2F5AL 3PL6C 4MD0B 3V5DA 4X0KA 4HQQL 1IAIL 3CXHJ 1L7TH 4WDIA 1MCFA 3ORJA 5GZNC 4JM2A 3WO4C 4KRPB 3E6FA 1MEXL 2ITCA 1A7RH 1H5BB 3I6GB 2CLZB 1S3KH 4WJ5B 4EDWH 3AREC 2W9DL 2UZIH 3U7WH 2Y9RT 3NVQA 4KAQH 4PY7A 3QWRD 3O4OC 1EGJA 3JSSA 4XHQA 3ZYJA 4LQFL 2AI0H 3UZVB 2P43B 1I1AA 1MLBA 4POUB 5F8RC 3HCVA 1KEMH 4RMVA 2BCKB 1ZEAL 4LSSL 4FP8H 2EDJA 3OKDA 3CXDL 3RWEB 3QUKA 1PX3A 2H3NB 5IT2H 3S3PA 1MWAA 1UM4H 4ZUUB 3FHAA 4GW1B 4YHOH 5SWQA 2HFEA 3QJHA 2WUCL 4AYFA 1QBML 5AWNL 1IL1B 1XCTA 3I6LD 2BVOA 1U8PB 3NFPA 4FTVE 2YA2A 5HYJD 3LQZB 5EC2B 4ODHL 5IFAH 2OR9H 5HJ3B 4MNHA 5DLMH 1AKJB 1KCUH 3QPQC 3MJ7B 1HYSC 1I3UA 4ZUTB 4YC2B 1HQ4B 4PBXA 4PJHE 4NQSA 3KLHD 3GSNL 4TVPE 1K2DB 4KK9D 4JY5L 3BQUD 5MERA 3HE7A 3UP1A 2ADJB 4MCZB 2A77H 5IKCA 3KYNA 4Z77B 3VE0A 4LSRL 2BVQB 1NFDE 1QZ1A 5ITBL 5FYLE 3U2SA 3RWIA 1KXQE 3ULUD 1M4KA 3QAZB 3SPVB 4ESKA 1P4LB 3MQIA 5IW6A 5FO9B 5IM7B 4KZDH 1FV1A 3N50A 3T77A 5EZIL 3L1OH 4FTVB 4BH7A 4FZ8L 4OSUH 4UIMA 3FAWA 4X7FC 1MCRA 2P5WD 3GO1L 3HI6L 1GH7A 5D7KE 1WBXA 5I6XB 1EFXB 1EVUA 1JGUH 3C8KB 3LHPH 4Y5VC 4YNYB 3U36B 5CD3B 3ARFC 4HFWA 4ZAKD 4FQIL 4ZTPL 1B4JL 1MHCB 3OF6D 4BK5A 3MZTA 4OZHB 2J6EA 3MNVB 4QLRA 4LCCA 4Y5XC 2M1KA 3P40A 3NTCL 3AROA 3TBVA 4M6MH 1ZT4A 2WWKT 4NO2B 1E4XH 5ADOH 1JGLH 3TV3L 5MEQB 5ISZB 4PJFA 2V6HA 1WWAX 4U6XB 3GM0A 2BNQE 2EDKA 4X4ZA 3T2NH 2W9EH 3NIFE 4PJHF 5C0JA 1FO0L 1CL7H 4IRSD 4NQCE 3SEPA 1BVKB 1XR8A 3SE3A 2NY0B 4I18C 4R4BA 3NA9L 5EO0A 1NAML 4L8DA 4NBZB 2HLFC 1BBJB 2OQJA 4V1DA 3QQ4B 1IGIH 3MLVL 1IEAA 2B4CL 5HGAB 2AQ1A 4OQ1A 3O8XD 5T33H 4OZIB 4L4TE 1BF2A 3MYJA 3QHZH 3GNML 1AGBA 3O2WL 1UKSA 4UUJA 3O2DA 1OP3H 5IMLA 3TO4D 5FUCC 1A1MA 4NKIL 1JHLH 2HJLA 3P0YH 2VISB 4LK4A 1TCRB 4R4FL 4QHUA 1H9VA 4PJIB 4YXHH 15C8H 1I1YB 1GRWA 4K2UL 5DQDL 5KN5B 2VZOA 4P2QD 1A0QH 3O3AA 3FRPA 1FAIL 4KKAC 3VFVB 1S9VA 5SX5K 1H3VA 2VXVH 2PF6A 1DSFL 4HS8H 4IIQB 3TBTB 5M94B 2FDBP 2J4WH 4JO3L 3GGWA 3TVMB 1KGCE 1LEKA 2F58H 1I8LC 2Z31C 4XXDB 4Q6IB 4LIQL 5I0DA 1OP5K 1ZT7A 5EBWA 3NIFF 5T3XE 1J1OH 4JQIL 1CE1L 4R7NA 3OL2A 1S7TA 3MCLH 2DWDA 1ZGLA 4XNXH 5FYJL 1UZ8A 4BZ1L 3IDYB 1NEZA 4BQ8A 1A6VL 1CLZL 3B2VL 3FFDA 5DMYA 3V0VA 3VXUB 5J6HB 5C7XH 4QYOA 3W9EA 5DUML 3PL6B 3TPUB 5HYFA 4P99A 4EI6B 3VWKD 3TT3H 3LMJH 3Q6GL 1CD9B 2Y6SD 1BPVA 1BWMA 3I75B 3WO3B 3WO4B 3S34L 2CPCA 1B0GA 2XOTA 4XBEL 4NQDA 3LKNB 3NABL 4OD1H 3U1SL 1VGKA 2IANE 4P23A 1BIHA 3ARXA 5M95B 3AREB 3SO3C 3WS3A 4JO2H 3QXTA 4DZ8A 1OARH 3ARBA 3O4OB 1UT9A 4HX1A 4KK6D 2D0HA 1PG7W 3Q6FA 4GAYA 3P77B 1BIIB 1MUJA 4D0CA 4L9LC 1FVCB 3UJTH 4TN9A 3JWDH 2A2QT 1IFHL 4RA0C 5C9KA 3P0VL 3T0BA 3DO3A 1TETH 2HKHL 4QT5B 3UTPE 4UV4H 5K59E 2C4FT 1N6VA 3KG5A 1CK0H 4IM8A 1KT2B 4JFFB 4W70A 1KJ2L 4OZFA 1A21A 3RVUC 3RWDB 3ALWA 4XVJH 4WTWA 1JNJA 4H26B 4IRJA 4RA3A 2XYCA 2OTUA 4HKJA 4LSDA 4O00A 1PG7H 1HIMH 4HC1L 2OJEB 2C3HA 3EO1A 3TYFB 4PRIA 4K55A 4PRPA 1DL7H 3GM8A 5MP6H 2BFVL 4J3XA 1DZBA 3R06B 4NZUH 5D70H 3RY6A 3BEVB 1NC2D 4XMLH 5GGRA 3IFNL 1RZKH 2GUOB 1DBJH 2D3VA 2PXYA 4Z0XB 2OS7A 2VIRA 3RDTD 1QPPA 4Z7QE 3P0GB 3LRHA 1XGPA 5GRUL 1FL5A 1Q0XH 3IKCA 4LHUB 1VADB 4ISVB 4TPRL 5HY9A 3DXAB 3O81A 3WE6B 1A6ZB 1OF2A 3VWJD 1VCAA 3QA3A 4FQXD 4XZUA 3OKLB 4F2MA 3N1GC 4JE4B 4IOSD 3D18A 1JK8A 4NKDB 1DUZB 3HAEH 3TWCL 3E2HC 1KJ3H 2FZ3B 2Z4QB 3HN3A 5F7FA 2YPVH 2ZUVA 4D9QD 4XVTL 1XF2A 1HHJA 3ZTJG 3GRWL 1U41A 2Q86A 4Y5VB 2YWYA 4L29A 3ARFB 3IAGC 2DQCH 1WITA 3SY0B 4F57H 3EJZC 5K59F 2D31B 4LASH 4LSQH 4MJIA 1B2WL 4UNVA 3ILPA 3LOWA 4Y5XB 2O93L 5D7LD 4UINH 4HKZA 1JWSA 3MYZA 1I1AC 2IG2H 4DVBB 1CFSB 3MLRL 3W11C 5IFHL 4XPTH 4NRXA 2X4QA 5T1DH 2I5YH 1P4BH 5C0DB 1QA9B 2UUDH 5IW1B 2IQ9H 1FORH 5BXFB 5IBUB 5EORH 1R3KB 2NZ9D 3U0TA 1RIHL 1D6VH 4XX1G 3F7VA 3DV4B 2LAAA 4S1DD 4I18B 3U6RA 4Z7QF 5LG1A 4DZBB 4ODXB 1U8KA 1FZKA 4I0CC 1VFOA 3IFLL 1TPXC 3QFJA 1NCUA 4I5BB 3DVNB 4QRPA 2CLVA 2W65A 4B7LA 5FYKL 1PKQA 2H6PB 4JAMA 1Q94A 4G7VH 3O6FD 2EDEA 1KOAA 4RFOL 2EKSA 4PJXB 4RWYL 3GSVB 3RGHA 3QUXA 3HE7C 1ZS8B 1J7VR 4XCEB 3TBYB 2WMPA 5IOPB 2ZKHH 1C5CH 3B6SB 5IVZA 4PJEB 1P9MC 2DTMH 5KOMC 3QCUH 2VDKH 3T0EA 3TCLB 3IDMB 4R7DB 4X8XA 1TTGA 2DYPD 1JP5A 4ZOAA 2GITB 4JJ5A 4OKVB 3TBSB 3JUZA 2DIBA 2IPTL 5I71C 2Y23A 3R1GH 3LB6D 4CKVX 3CSYB 3TNMA 3DUHA 3X12B 3KXFD 3AVEA 4M6NH 1JPTH 2P42B 1HSBB 4U1HB 1NUFA 1AXSA 4YXKH 1ORSB 4L1HA 2I24N 2WP3O 2Z31B 1K8DA 2QQLH 2H32H 4PJEF 4G8FA 2OTPA 4Y1AB 3H3PH 5GGQH 1ZVHA 4GMSL 5F3BA 3JXAA 4X6BA 1ZGLP 4H25B 3SBWA 5DJAB 2I07B 4HJ0C 3U30C 2EC8A 2OZ4A 5DI8A 3QRFM 4LCCC 3BUYB 4R3SB 4D0BA 5JNYA 3PG2A 3U0WL 1ZTXL 5MHSE 5IEKB 2YC1B 2B0SL 2VE6A 1T2JA 5CGYD 4XPGL 3ZHDA 3BDXA 1EEZB 3AAZA 1GJIA 2HT3C 1W0WA 1PGRB 1SEBA 4ZPTB 3HZYB 3S4SA 1FVDB 5HYQA 4KJQD 4HCRH 2CLRA 1KIQA 3EO9L 4DGIH 4FOMA 5KSVA 3VGGA 1MNUL 3SO3B 2AGJH 4JM4H 4QY8A 4PRHA 5HSFA 3S98A 3BN9D 5KG9B 3MRDA 2JJSC 5HHPB 4B7IA 4DAGL 2CIIA 3H9HA 4B50A 3MLUL 1J88A 2ESVA 2FX9H 1MAJA 1YMME 5DYOB 5IROA 4L9LB 1KPVB 5AG9A 4HZAA 5DJXB 1BP3B 1I85A 1J0JA 1NMAL 1FE8H 2ADGA 3NZHH 4MA3A 5HI5C 2MFNA 3FOMA 4I2XE 3IVKB 2AK1L 4XP6H 1IBGH 3UTOA 1AD9B 2C1PA 2XG4A 4H8WL 5D7IB 4RGNC 1KB5A 1QR1B 2EDDA 5AZEL 2OK0L 2A0LD 1A4KA 3QDJA 2V2TB 2FWOB 5DQJB 4BSWA 4GG6E 4J1UA 3UROR 2PYFB 4OIIL 1PY4A 5KTEL 4JFHE 1QRNA 5B8CC 4ZSOE 2YKLL 4KXZI 1EMTH 4X80L 5B3NA 3UTTB 4LSVL 3OKKB 3OGCA 3RVWD 4I0PD 1EHAA 4JJHA 1OM3L 4FFZH 4Z7VE 5JHDE 3CAFA 3F65A 2EYTA 1VKXA 1EH9A 4I2XB 4GW4A 4HUWA 5GRVK 4PJCE 3V5DB 4X0KB 1A7PH 1HHKB 2Z8VC 1HZHH 4OLXH 3MJGX 1OT2A 4WDIB 4KTEL 3E2HB 4IOIA 4ZUSA 2RJMA 1N5YH 3NCJL 5IVXE 4Y19E 1AR2A 1Y6NR 4U6HB 4QHKJ 1FC2D 4LSTL 2EC9T 3FKUS 4IRZL 3BT2L 3IF1B 1U92A 2ITCB 2ZOKB 3OR7B 4ZO9A 5IQ7L 3VXRB 4GXVL 4YIQB 5HDLA 5L9DL 3ARBC 4MD4B 4S1QH 3LRGA 5L7XH 1R3IL 1I1AB 1MLBB 3HCVB 3L5JA 2W0KA 4JR9H 3W0WB 3MACL 3ZHLA 1Q1JL 4GG6F 3OQ3B 3DX7B 1MLCB 4WUUE 2EH8L 3O9WD 3C60C 4P46C 1OAZH 3MOQA 1MWAB 3QDGE 5HHVH 2HFEB 5LBSL 4Q9CA 4XRCA 4GAJL 4XWOD 2BVOB 3TO2A 5CMAA 2GFBB 4X9FA 1E28A 3RGVD 5GGSY 5C3LD 2QKIA 3CDFA 2XA8L 5AZ2L 4C58B 1TPXB 4HEME 1NFDA 2XTLA 3NCFB 4MNHB 1J0KA 1I9RL 2DJ4A 4WU7A 2EDYA 2P5ED 2QHLA 3OSKA 4NQSB 4GRWB 5CEZH 5IGXH 4YBQC 1N4XH 4MNQE 3HE7B 5LQBH 5EOQL 3CFBA 4KJYB 6FABL 3NA4A 3ETBF 2WSKA 3VE0B 4HWBA 2H2PD 1UZ6E 1X5JA 4WUUB 3A6OA 3EO0A 2XZCL 3U2SB 3RWIB 3MUJA 3VFUA 2VLKE 4JPVH 1XGQB 3RVXD 5I71B 5CINH 2Y36H 3FT4A 3VXSE 4BH7B 3O4LA 5DR5H 4UIMB 4OZGE 3OAYH 2AV7A 3D39D 8FABA 1WBXB 2W38A 2BHYA 3EDKA 1D5BA 5GS0C 4KY1H 4HFWB 3FB8A 3ULUL 4D0DA 3BIKB 4Q7DA 4MNQB 3U30B 2F19L 5CILL 2CMRH 4QXUL 4LCCB 4CU7A 3UYRH 3TBVB 2HT2C 1MQ8A 5HHXL 1V3LA 1LK2A 5CBEA 5E24E 4YGVB 1QHPA 2KQNA 4NFBA 4WTZA 4C57C 5SV4A 3F62A 4P2RE 1RIUL 2X6MA 4ZFGL 5CIPH 1IGFL 2QQNH 4PJFB 3BIAX 1JGDA 1E4WH 3G04A 3SCMC 1S9XA 5C0JB 3IDGB 5C0NC 2H26B 5IEHA 5F9OH 2X5PA 2I9TA 4R4BB 3SE8H 4TSCL 1N6UA 4OZGB 4PB9H 5E8EA 35C8L 1W72L 3MSPA 4HFUL 1C5BH 1QNZL 1UZ6F 4WW1A 1C16A 1M7IA 4GRMA 4IDJL 1FNFA 3MRHA 2JB5H 1QP1A 5E99H 4FS0A 3H42H 4ELKA 1U3HA 5I1LA 4XNQA 1NJ9A 1AGBB 4UUJB 5E6YA 5IMLB 1A1MB 1MJ7L 3PWPA 4FFYH 2HJLB 5DO2D 1GZPA 2E7CA 3WHE1 2AKRA 5TE4H 1JI1A 4I0KA 1IGJA 1UEYA 4OZGF 2VLRE 1JNLL 3O41B 4QHUB 4YQXH 4J3TA 1P5VA 5EWIL 3T0EC 3EGSB 4NJAH 5DQ9A 1I9EA 4RGNB 1GGIH 2A74A 3O3AB 2LABA 5D1XA 1UENA 1MAML 4KVCL 2IAMA 4YE4L 1DQDL 1YDPB 1U8LB 1S9VB 4JFEA 4H88L 1C1EL 1BREA 1XF5A 3GGWB 5BV7H 1LEKB 3E6HB 5DUPL 5B8CB 3GMOB 2GJZA 3NIGE 3BEWA 4QHLA 3TYGL 4PB0H 3F7RA 4H20H 4Y88A 3VFNB 1PLGL 1A1NB 1EXUA 3G08A 4NM8H 5EBWB 5I73C 1W2KT 1JZ5A 3SE4A 1IC4H 3SBWC 3CFIC 4GQ9H 5FXCH 4R7NB 1YEEH 4MS8D 2UY7A 5GPRA 5C07A 4MSWA 2J12B 5E1AA 3IXTB 1ZGLB 4RFEA 3EW3B 1UZ8B 2ED9A 4RRPA 3FFDB 3V0VB 3MRIA 3QYCA 4NP4L 2PTTB 1WF5A 2J3SA 4QYOB 5I16A 3EFDH 4FNLH 3C9NB 5CEXA 1MRCL 4L8BB 2NY6C 5KSBA 4IBLT 3VFPA 3DX8A 2ZCKL 2XPGB 1KCVL 5DD1H 5EN2A 1W8OA 4KJPD 1NAKL 1A9EA 3SDDA 1WZKA 1CLCA 4A6YL 2PYEA 3ZDYE 2CJUL 4HF5L 3WS3B 4U1IB 4L9DA 2FB4L 4F9LC 4D3CH 5ETUB 3ARBB 4HX1B 1IILE 1UM5H 2GY5A 4TNWF 1ZA6A 3LIZL 5D7JC 2J2ZA 4GAYB 4EXKA 1ADQL 3WFZA 1RZ8A 1MQKH 4D0CB 1MUJB 2HVKB 2FCBA 1I85C 4R6UA 3C60B 2BSRA 3T0VA 4G43A 1OAXH 2R2CA 4P46B 2FBJL 2R56L 5FM5M 4C56A 1XIWD 1FLRH 3CLFL 3MJ6A 4L4VE 2XQYK 1U42A 2VDPL 3L5HA 4O58L 2A6JA 5D1ZD 2DQDL 4X6FA 1E6JH 4CN6A 2HH0L 1QLRB 4ZXBD 1H15B 4HKJB 4HWEH 1AH1A 1KELL 2I26N 3EO1B 4PRIB 5J7CC 1CGTA 2ITDA 4YDIH 4M9OA 4NNXA 2KKQA 2APTA 4P4RA 3U79A 5GGRB 1QFUH 3KLSA 1RIVH 2VIRB 3Q2CA 2MTPA 1FL5B 3SDAA 5DEZA 4ZDHA 3CVHH 3WDJA 4JFPA 1EJOH 2HJKA 1RHHA 3VDCA 4DW2H 2F8OA 3TEUA 5ESAB 3U7YL 1KTRL 4U2YA 1P7QB 1UACL 1OF2B 3VRLE 2DQEH 4HDIB 3QA3B 5FM4A 4PPTA 3KPRE 2D0FA 3FFCA 5F7DB 3OPZL 3L3KB 4J8RA 3K8LA 4OTXL 1Q38A 1CD1A 3PWNA 4M1DH 2QHRH 2ORBH 5HI4D 4FQLL 1H3UA 5J1AB 1SEQH 3EJYC 2Q86B 2EDLA 1OP3K 4L29B 3STBA 4LAQL 1KG0B 4UV7H 5FF6A 2VDNH 5DRXB 1XZ0B 5DJCB 4MJIB 3ILPB 3DX9B 4ZFOA 2JF1A 4HKZB 1JWSB 2CUIA 5JW5B 2Q87A 3KJ6H 2X4QB 3ZTNL 4Q9RH 4P2QE 5FAAA 32C2B 5A3ID 3QZWA 4XT1C 5HHQA 4PLJC 3LS4H 3DYOA 5CKAA 1EZVX 3SCMB 1UA6H 2I60L 4CL7A 4OGZA 5GJSH 1T7WA 5GRVL 5FB8A 1JCKA 3F7VB 5E6IC 4NKOB 3UEZA 3U6RB 3ARGD 3DSNA 4DGYL 3P73A 4FQJL 1NLDL 4N0FA 3MBEC 5JR1H 3WUZA 1K3ZA 2BRRL 2Y07H 4TOYH 4QRPB 4ETYA 3VRLF 4ZODA 1L7IH 4OF6A 2W65B 2ICWI 5DHVH 4AG4H 1PKQB 4JAMB 1MSPA 3HNSL 1VB9A 3MRLA 4PJ7E 3SDXA 5C0AE 3ARVA 1MIMH 2WBJD 2EE2A 1JRHH 3VI3E 3T0WA 4KVNH 5IVZB 5FUZL 4QRRA 2OJZL 4APQA 3T0EB 3S35H 1JYNA 1F6FB 4I3SH 5D2NE 4JJ5B 2AJYH 5T5FL 5IMOA 5CGMA 1U8JB 1P4IH 4JKPH 4ZG1A 3BZ4B 1TJIH 3VFWA 4DKFH 1AR1D 4NJ9H 4HC1A 3TNMB 4X7SL 1GIGL 4LFHG 4DOHE 3WV0A 3QCTH 3RU8L 1WBYA 2IALA 1R24A 3SDYL 1A22B 3JBG7 5F3BB 3ARPA 4G8FB 1CXFA 1FP5A 3OJDA 4PLKC 5I73B 5DC9B 3BP7B 3U4AA 3F7PC 1N59A 3U4BH 2BSTB 3NAAH 2AXHA 4OD2A 5HHME 1G6RH 5C0AB 3KPOB 4NRYA 2W91A 4F7EB 5EBMA 5DI8B 5F89A 4N0CD 3ZTJH 3N06B 2DQJH 2WW8A 4LHUG 1I7ZA 5IVNA 1GHFL 2GW5A 1AQKH 2XWBA 2VC2L 4JFYA 2AK4A 5J12C 4KK5C 5F9AC 3RWGA 1W0WB 1TDQA 3BRDA 5JIPA 2NY6B 3S4SB 1U8OB 5HYQB 1FYTE 5I1DA 1S9YB 1KIQB 3GRWA 4PJ7F 5TE7L 3K2UH 2DLGA 5E0QA 2FIRT 5CLTA 5KSVB 1WICA 2CKNA 3SJVD 4QY8B 1ZMYA 4KRMB 3HE6D 4JPIB 4HXAL 3MRDB 1U8NA 1A6WH 1OCWH 3N9GH 2CIIB 3H9HB 1U3HC 1S7RA 3GJFK 4BK4A 1FH5H 1T7YA 4WWKD 4X5XB 1IZKA 3P30H 4XP1L 3H9SD 2HKFL 4MA3B 3FOMB 5BMFL 5IBUG 3ZDZE 5E70A 1QFHA 4N5EC 4OCYH 3UO1L 4D9QE 2BC4A 2G9HA 4U1MB 1GPOH 1UGNA 2Z9TA 4YDLB 4IMKA 1OAKL 1FSKC 2B39A 4Z7VA 5JHDA 5TDPA 5E95B 4BSWB 1T6WA 1XR9A 1F02I 5C09E 4P4KD 5JHLH 3QEQA 1QRNB 4JQXC 3IRZA 3T8XA 3OR6B 5D7LE 4F33B 4PJ9A 4L3EA 3MR9B 5I8KL 1OAYL 3BZDA 4XPHL 2Q7YA 2VDOH 2YMXH 5ALCL 3E0GA 3EJJX 3VXTA 4RMWA 5FO8B 2UUDK 3SE4C 3C6LC 3BZEA 4J23A 2GCYB 1U9KA 2P8LA 4N9GB 4WUKL 2EYTB 2AJVH 1VKXB 1S7XB 3BPLC 1L7TL 4UNUA 5DEGA 4IOFD 5DC4B 4RAHA 5CP7A 3B9EA 1QBAA 4GBXC 1BQUA 4HV8A 5EOCH 4IOIB 4ZUSB 5HHOA 4CAGA 1JPFB 4Q2ZA 3MLYL 3L6FA 2E6JA 3SDDC 3U7WL 3FAXA 3QUML 4PGBA 3LKOB 1I7TB 3X3GL 4BKLA 2AI0L 3S5LA 3ZDZF 2HFFB 4LPYA 4HKBB 4FP8L 4R4NC 1QQDB 4RSVA 5DK0A 4P3CH 3D3VD 1S7WA 2NY1C 3JWNC 5CEZD 2VR5A 1S7SA 2OSLA 1WAAE 3FMGL 4TNVK 1EEUA 1PZ5B 4QOKD 5FDYA 1AQDA 2NPLX 2EDQA 4XNYH 3FB7A 2R4RH 5E6IB 3WSQH 1D5XA 3I50H 4YHNA 1I9JL 4XRCB 4UIKH 2ARJQ 4M9PA 4NUGH 3E1F1 1EAPA 5C71A 5DLML 3TO2B 1MJ8H 5CMAB 2B4CC 1AC0A 1AD0B 3MBEB 2QKIB 2MOVA 4R2GD 4JRYE 4TYUA 4MA7H 4GXUN 3ARDD 4GSDL 5IMKB 5J0BA 2FGWL 2CKBH 3TNNA 3M1BA 1WISA 1WFOA 1X6LA 4JRWA 3T0XA 3K1DA 1NGPH 5E7FA 3CFBB 5I19H 4JHAL 5E2UH 1IQWL 1MFNA 4TTDC 5SX4I 5TE6L 4GXUM 5CBAA 4X9GA 5GGTL 3CFEA 4M8VA 3X17A 4KZDL 4Z5RA 3L1OL 4QXWA 3HC3L 4KHTH 3WUWA 3MLWL 1BVZA 2HRPH 3DVGA 4RCAA 4K7PL 4QGTA 3MCG1 3FT4B 1LE5A 1QBBA 1YPZE 2AEPL 3O4LB 3LHPL 3F58L 3SQBA 3WXWH 4JRYB 2IH1A 4DUVA 4JO1L 4FXGB 2X7LA 2Q3ZA 3HMWH 4P2RA 1MCDA 4N0RA 5DJ0B 2CDEB 5ANME 4PR5B 3FTGA 3C2SA 3FB8B 5GS1A 2JJWA 4D0DB 3MJ8A 1J05B 1KACB 1E4XL 1M71A 4DN3H 3MRPA 4KMLB 1JGLL 5BVJA 3VFMA 1VFBA 3IDXL 2YXMA 4PG9B 2NY3C 2O5XL 3AU1A 5CBEB 3L3OB 4LCIL 1DANU 3TFKD 5C70A 4W6WB 4LMQI 5J12B 3W5MA 1JGDB 1K6QL 3TT1H 1S9XB 2X1QA 3VFTA 5MEPA 2I9TB 5EIIA 1IEBA 1IGIL 1YPZB 1FNSL 43CAB 5F7MC 4X6DE 5E8EB 5I8CB 4MQ7A 5F21B 5I9QC 5GRYA 5IBLD 4NUJB 5TFSH 3QI9D 1OPGL 3OX8A 3C5JB 4WW1B 1WCQA 3QHZL 2F9BT 1C16B 1M7IB 2WINA 2GIYA 4GRMB 5ANMB 4AQOA 3QCVH 4W6XB 5EUOA 3GKWH 3HI5L 1NSNH 2NY2C 1JHLL 1U3HB 3H3BC 4E42A 1NJ9B 3UPCA 3WFDL 3MLXL 4XCCH 2J88H 3PWPB 1TQBC 4UDUA 1YPZF 1BX2A 1WLHA 1IGJB 3WIHL 5L88H 1RUKH 2J8UA 3BP4A 4U6VL 5I75C 3CK0L 3L3JA 3MLSL 3QWRA 1ONQA 4XPFH 2A74B 2J4WL 1FN4A 2Z8WC 1N3NA 1RUMH 1MIEL 2F54D 3PDGA 4G42A 3NFSL 2NTFB 1F90H 5BVPL 4OGYH 3IU3B 1LO0L 2X2YA 1FSKB 4X6DB 1ORQB 1DN0A 1N8ZA 4AQ1B 1MCCA 1DBBH 3GSNB 3WN5A 4PG2C 3MGTB 2BDNL 4QHLB 5ACZB 1G9NH 1BHGA 5ACLA 4X99A 4X6CE 1GOHA 1CQYA 4G6FD 3QDMB 1YYMH 3G08B 3HA0A 4K9EH 4O51A 2ZUTA 2XFXB 3C6LB 1DBMH 1BJ8A 4UILH 5HYJA 2P4AB 5J1SC 1QHOA 3RBSA 4R96B 5C7XL 5E1AB 4X6DF 4RFEB 2GK2A 2K3TA 5T3ZD 3WIFB 1HXMB 5T1KB 4P2OD 3BPLB 3RRQA 3TT3L 4G8EB 4UOW1 3LMJL 2LE9A 3BQUA 3U48A 2V7HA 4K7PX 2YN3A 1CZ8H 4GBXB 1BOGB 3D5OF 3U4EA 3QNZA 5CEXB 1UWGH 3VFPB 3DX8B 4OD1L 2JK5B 3BJLA 3UYOD 1U8HA 3SDDB 2HTKD 2P5EE 5DT1H 3BX7C 4CBPA 2HVJA 3MRQA 1OARL 4U33A 5DFVC 2PYEB 1JF5A 2LV4A 3KS0H 5E5MA 2VXSH 5LAXA 5A40E 4JB9L 1QFWM 1FG9C 2LVEA 4RGMC 2GJ6D 3UJTL 4TTGA 3JWDL 1ZA6B 1C7TA 2P5WA 2C1OB 1RZ8B 2NY1B 1TETL 5JQHC 4O02H 4UV4L 1FO0B 3MXWL 4ZAKA 3WHE0 3FZUC 4G43B 1U95A 3OF6A 3KPSD 5DD6B 4XHJC 4X6CF 3KDMB 4PJ5A 1NAMB 3Q1SH 3OAYK 3GUTA 1W72A 3BSZH 3S97C 5GISL 3D39E 5BRZD 3OMZA 1PG7L 4IMKC 1QFOA 4M3KB 2PTUA 1DL7L 2H8PA 3MODL 4IRSA 4NZUL 6CGTA 3V95A 1RZKL 4NPYA 2ITDB 3N1MC 1J18A 1NBZA 4PJ9C 4V2CB 2G2RB 4NNXB 4PIRF 4FQ1H 2BNRE 4P4RB 5IVOA 1J1XL 4HIJA 4K71C 3JV0A 1XF4A 5FYJU 5EH1A 4FFWC 3CMOH 2Z91B 4OQTH 4ZDHB 4JFPB 3O8XA 1RHHB 3M45A 4JN1H 5CJXA 1JGVL 1GXEA 1I9IL 1KJ3L 4DTGH 1MRDH 3IDUA 2R1WA 5LCVL 3FFCB 2VITA 3TO4A 3HFMH 2E5EA 2AXGA 3NMEA 4J8RB 1NGQL 2YPVL 3FRPG 5HYSA 4WI4A 2R8SL 1A2YB 1CF8L 5ITFB 4F57L 3K7UA 1TJGL 2HT4D 4LASL 4LSQL 4P2QA 1IT9H 1TVHB 1X4XA 2P47B 1HK6A 5FF6B 2D7TH 1PVHA 1CDCA 3WD5H 4M1CC 1NBQA 4F7CB 3FT3A 4XPTL 5T1DL 2I5YL 1P4BL 2CDGA 2GSGA 4ENEC 2NY3B 3CVIH 2IQ9L 4G8GE 4OCXH 5IMMA 1FORL 3TN0C 4HXBH 1NEZG 2X42A 1MHHA 3QNXA 1V7MH 3QZWB 4TVPH 1D6VL 5LGHH 3HTLX 3GEWB 5CCKL 4ZOEA 2I25N 4P0DA 3MRNA 5GIRB 1HKLL 3VXMD 4GKOA 5ALBH 1C5DA 2D0GA 1WCBA 3PV7A 5CD5C 5FYLH 5I9QB 4N0FB 4XPAH 3UTQA 5KAQF 1GOFA 5J56B 5DMGC 4G7VL 3VWKA 3QHFL 5IJVA 4KKLD 1ADQA 2NY2B 5HPOA 3LS5H 3X13B 1LVEA 2ZKHL 3PABB 5D2NA 3BGAA 1C5CL 3SDXB 3EYVA 3HG1E 1AGDA 3WKMH 1J8KA 2IBZX 2BOBA 2DTML 1TQBB 5K33A 3GBMH 3GSOA 2YD7A 3RTQA 4AJ0A 3E8UL 5I75B 3MZGB 4H8WC 4HK3J 3CDCA 4QRRB 1KJ2B 4PRDB 2VR4A 1M7DA 4PP1C 2B2XH 1PG7X 3V7MA 4AL8H 4M6NL 4G9DA 5C2BH 5IMOB 4X7DC 3VFWB 1I8KA 5D72H 5GGQL 2FR4A 3VD7A 3TJHD 4ZFFA 3RNKA 4LSUL 4B5EA 3SOBH 1R24B 5TDOB 1RZGA 1ZK9A 5DHYA 4M4RA 2CK0H 2R1YB 3OJDB 1QEWB 4KI5E 1GAFH 1N59B 4OD2B 3RL1A 1L0QA 3AY4A 5EBMB 2PR4H 2DQIH 1RZ7H 3ROOA 4EQ3A 5HGBA 4IEFB 1NDGB 1X7QA 5LGJA 2XWBB 2HTLC 3T2QA 3OKEA 2YBRA 1NC2A 3WCYA 1T03L 4POZD 1MOEA 1HSAA 3H7LA 5E8PA 3RDTA 1NGZA 1RU9H 3FQWA 9CGTA 3I6KA 3BAEH 3V52H 5I1DB 4MJ6B 7CGTA 3VGFA 4I4WA 1QKZH 5EBLA 5KOVC 5I76A 4XNUL 1J0ZA 2Z35A 2AABL 4JM4L 4M03A 2CUHA 2UYLB 4I13B 4TQEH 2YEZA 2OTWA 3EAKA 4ZTOH 3VWJA 4FQXA 4KDTA 2X4NA 4G6JH 4RMUA 4G3YH 3U83A 1DFBH 4OAWB 5FYKU 1U8NB 2FX9L 4NDMA 4RGMB 1E6OH 3RWJA 3MRBA 3WJJA 3MRFA 1FE8L 3QO0B 1SM3H 2UVFA 4DJMA 5DVNA 2ZG3A 4XP6L 3GMRA 4AH2A 4ODVL 4HIHB 1DLFH 5T3XH 2F15A 3QPXH 4XXCA 5D7LA 4KI5F 3QQ9C 1NANI 2ILLA 1GGCL 5IP4A 2EIBA 1AGFA 4F9PC 1HILA 2BC4B 2G9HB 1I75A 2PKDA 5CJBA 3ARZA 3GMQA 3D0LA 3OKOB 2VL4A 1E4KA 4EN3D 4OFDA 4X4XA 4HIEA 1XR9B 3WN5C 3ELAT 1TTFA 4GQPH 5E2VH 2BY3A 4PJ9B 1ZGLM 3RVTD 3Q5YA 3C09C 3ILQD 4LLDA 4GLRH 3X14A 1D6EA 4FFZL 2A6IA 1CICC 4M93C 3BPOC 5I1EL 3P2TA 4K71B 2ARJB 5T1LD 2P8LB 4E5XB 4ELMA 3RWHA 5A2JH 1YJDL 4IMLB 1Y6MR 3P4LA 3T4YA 1A7PL 2QJDA 1HZHL 3KLHC 4P9HL 3O6FA 1JHKH 3LPFA 4KK9C 5EU6E 3MLPA 1EO8H 1F97A 1N5YL 1PKOA 5CP7B 3LZFL 1CXKA 1CE6A 2O5YL 4KI1A 2OP4H 4KMTH 4WTXA 5E9DD 4Q9QL 4NNYB 4JZNB 2UWEE 5KVDL 4JEGB 1HDMA 4Q2ZB 5EG6C 3OKNA 3U82B 3ULUC 5DVMA 4PGBB 1BFSA 3ZDXE 1WAAA 4DCQB 1IAII 4YPGA 2YOCA 1BAFH 4K3EL 3D2UD 4NNPH 2O61B 3MXVH 4J7RA 4HJJH 4JR9L 3MOAL 3WFCH 1MI5D 5KJRH 3KXFA 5DK0B 1OAUH 2ZPKH 4I1NB 4LLUA 3VJ6B 3VDBA 3TN0B 1CXHA 4I3GA 3TBWA 1S7WB 4G9FB 5HHVL 1S7SB 1BJ1H 2OSLB 4NWTH 2OI9C 4KQ4L 4YGAB 5F3HA 5EU6B 1D5MB 4ODWB 3VGBA 3VH8A 3S4SG 4H0HB 1D5XB 3WLBA 4YHNB 3F5WA 2YPLD 1EAPB 4TUOB 1XGRB 2E9IA 3VXOB 1UVQA 1OSZA 4RGOH 1KEGH 2FBOJ 5IGXL 2MKLC 1N4XL 3IJYA 1J0YA 4MA8H 4IRSC 5LQBL 1MPAL 3TNNB 4KUCF 2E27H 3OBAA 5KSUB 1OGTB 1R5IB 1N2RA 1OGAD 1CGSH 1LP9E 2UWEF 5ESQB 1KC5H 4S0TD 3O45B 4JPVL 4ODBD 5HGDA 1WC7A 1JMXA 2WUBL 5ID0B 2Y36L 3ZDXF 5FGBA 5CJXC 3GK8H 3FO2A 5FUOH 4ONGH 3TO4C 1OSPH 4GAFB 3SJVE 1AHWC 3T1FA 2PNDA 3PQYE 1HH6A 4KY1L 4Q0XH 3BMVA 4R90L 2IH1B 5JORA 3UZEA 4X5WB 4FQQA 1ROWA 3PP4L 2CMRL 1UQSA 5I1HH 1GYAA 2VH5L 3MJ8B 1VHPA 3ZL4H 4EOWL 3MRPB 1LP9B 5EUKB 3VFMB 3KYOA 1VFBB 3VD4A 4P59H 3UC0H 2ZOLA 3AU1B 4HKXA 2OXHA 4BJLA 4BZ2H 1O7VA 4UT7H 1SBBA 1CXIA 3QXVA 4OIAA 5KSAD 2YR3A 3C5SA 5BS0B 1D5IH 4XWGL 2AS5M 2DKUA 4I0PA 1MREH 5HDQH 4LPXA 3VFTB 3SE8L 3FO9A 5MEPB 3VFOB 2IGFL 1ETZA 4PB9L 1B90A 1YYLL 5EIIB 1IEBB 1VSCA 4FMFA 4ZO6A 1SVCP 3HNTH 2XZQL 5FECA 3QG6A 1LP9F 3ESUF 4QF1B 1AJ7H 4UAOC 5CZXD 2JB5L 4HIXH 2YN5A 3OX8B 4EDXA 5BJTA 2P24A 2HP4A 4OM0L 5F7EL 4XMPH 4MAYD 4I3RL 4YEFA 2Y6SC 1PQZA 2X89D 4E42B 3RWCA 1OD9A 4GUPA 3IU4L 1V8HA 4MCYA 1IGCH 4N1CA 4UDUB 3HB3C 1SY6L 1BX2B 1UXSA 3WNKA 3RTQC 2Q8AH 5JIHA 2J8UB 3BP4B 4JLRA 3OXRB 1KENH 4K3JH 5EC1A 4JVPA 4H0GA 1RMFH 2ZSWA 4YDVB 1FZMB 5E5UB 4YDKL 3J8F7 5BV7L 1T1YB 4G42B 4V2BA 2W0LA 5I1GH 2DQHH 5JOPE 3B9KD 1QFWH 1DN0B 4JZJA 3O9WA 4H20L 1K85A 3WN5B 3QEUA 3EDJA 4NM8L 3INUH 1U8MB 5F71A 4B0MM 1IC4L 1DQQA 3FCTB 3W81A 3HRZA 4GQ9L 3ROLB 1YEEL 3C09B 2NXYD 4X99B 5IBTH 2DS4A 4TSAH 3MBXH 3VXQA 1BZ7A 1CICB 4M93B 3BPOB 1JTPA 5H94A 3RGVA 1UH4A 2DQTH 2V9RA 5CEZE 3GJEA 3ZKMC 1BGXL 3ARWA 5HYJB 4DK3A 1QO3A 5BOPA 2AAVA 3AXLB 1FFNB 4NOBA 3AY4C 1QG3A 5GGTA 1CDIA 5SWSE 2X05A 3EFDL 2P5EA 2VQ1A 1G9ML 3L5WA 2VDQL 5GZOD 2GSIA 3WMSA 4J3WA 1UKTA 4LPVA 4Z18A 5C3TA 3CFKA 4P5TC 3QNZB 4PY8I 2XY2A 3O6ML 3LKRA 1FZJA 1A4JA 2FATL 3GHEH 3RI5K 3KPPA 1U8HB 4S10A 3CNKA 5CKGA 4OCLC 5IK3A 5TGBB 1ED3A 3AUVA 3GSQA 4FQXC 4U05A 3QJFB 1FIEA 5T3ZL 3KWWA 1OTUD 2HFGH 3ES6A 5C0BE 4JO4L 2LU4A 4NN5C 2V17H 4OLUL 1IKNA 1MQKL 1RZJL 2WAHA 3LQMA 1PYWA 5BW7A 2X70A 1NCDH 3FO0H 3S9DB 1FDLH 3D39A 4OGAD 5K93A 3SO5A 4XP4H 4LVNC 4WTZG 1K4DA 2XZZA 4PJGE 2OI9B 3MA9L 2GI7A 2YZ8A 4YWGH 3Q5OA 2DLEA 3KPLB 4NT6A 1EGJH 4PJ5B 1FPTL 3EYFA 1NPUA 3GUTB 4M48L 4Z76B 3ARQA 4HWEL 2XV6B 1E4KC 3I85A 4FFVD 5EU7C 4OLZL 4U7MA 4YDIL 5JXEC 4IRSB 1AY1L 5C0BB 2V2XA 4Q58C 3MV8E 4K94L