3STLA

Kcsa potassium channel mutant y82c with cadmium bound
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2011-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3stlA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3stlA02
3LQMA 1WF5A 1XGUB 3OGCB 4RWYL 2AABL 1A7BA 2I07A 1A3LH 1PG7W 2F53D 4EBQL 1BVKA 1BZ7A 2FGWL 1A6UL 4PJGB 4Y19D 2CRIA 2H26A 4G80B 4HDIA 2HKFL 2WNGA 4PRHB 2VXUL 1KC5H 3VGEA 3IAPA 3WMSA 3U0TB 4FNLH 4FQQA 2ED8A 3ARYA 1EEQA 4OF0A 1BFVH 4GH7B 1RZ7H 9CGTA 2AS5M 5EU6A 4TRPH 2VOTA 4HLJA 4GAGL 3VRLF 3DVGA 4TUKL 2B1HH 5H35A 5EA0L 1H5BC 4IMLA 4NWTL 3RL1A 3RA7H 4H0IA 3CGTA 1J8HA 2H9GB 4XPBH 3RGVC 5BCAA 3X3FH 4PRID 4P23D 3AM8A 4UT9L 3QUXC 4F37F 3H9SD 2JJSA 1KENL 5ITBL 2VDKH 3PJSA 4CADB 2BVOA 3ARTA 4IOIB 3HC4H 1KTDB 2JJUA 4Z9KB 5BRZD 1DQTA 1B0GB 2W0PA 2YD5A 3QZWB 4Y4KA 1PQZB 4TUOB 1MEXL 5C0GB 2W9EL 4KKAC 5CEXA 1CD8A 3RWFA 3BRFA 2IANA 4P59L 4EZMA 5FM8A 4P3CL 5IVZB 3U9PL 1NGWA 2C4XA 4LLMA 5J6GB 1TTFA 5I17A 5HYJB 2EDYA 3OKNA 4L5FL 1QRND 1T0MB 4XVSL 4P9ML 4YHKL 1H3UA 1CL7H 4F7EA 3O4LE 2XWTB 5ADPL 1RJYB 4RAHA 2P7TA 2A77H 5DRXB 1NAML 2D9QB 4XNQB 3S37L 4RFEA 4P2QA 4PJIA 4RCAA 4X6CE 3VFSB 2Y23A 5EBWB 4PJ9D 3IFNH 3C09B 2V2TB 2AEPH 2BVEA 3HB3C 4RFNC 2WV3A 4YXHL 1B0WA 3EYFB 1W72L 4KV5F 2ZNXA 3VFSA 3RWHB 3GNML 5CS7A 1M7IB 5E8DL 4Z0BH 1EPFA 2CUHA 1NANI 5KANI 4JY6A 1Q9LA 1U8OB 5F9JB 1S7TA 4YK4B 4H8WC 5IHBA 3K4DA 1PY9A 1RZFL 4YPGA 4Q9QL 1BQHB 3S98A 3LCYA 3VU2A 4AEEA 4Z7WB 1I3UA 1R3KA 3ULVE 2VABB 1TZHB 1JGUL 3T0ED 1GGYA 3QDGA 3T65B 3PP4L 4G8FA 5I1IL 3DARA 1LO0L 1MJ8L 43CAB 4R7DA 4FQ1H 3SGDH 4Z7WA 3VD9A 4FABH 5KSBF 1TZHA 4Z8FL 3W5MA 1G7HB 1BX2A 5D7IE 3NCJL 4QHNB 5KVEH 4PG2C 4KKLD 4UT7L 4NT6A 4HEME 3U6RB 3FFCA 5CINH 5BQ7A 2P24A 3CFJA 3LB6C 5A16A 1IAIM 1F8TL 1B6DA 4MAYC 4LLWB 4W6XB 4BUGA 4GKSA 1A1NB 1ZVHA 2GSGA 1LDSA 3GMQB 5CUSL 1AJ7L 2QL1A 4X5LA 5FA4A 5A3IC 5ICXB 3OKDA 4LU5H 3H0TB 3VXUA 3HFML 1MF2L 1FYTE 1MHEA 3W0WB 4IS6B 3RTQC 4DZ8B 1OQOA 3ZHDA 1I3RA 3HE6B 2DQCH 1RZJL 2DQIH 5FV1L 1ZXQA 4NSKA 3O4OB 4MLIA 1DBJL 3QDMD 4F9PC 1T5XB 1IAOB 1TENA 3PWVB 4BZYA 3C6LB 1WAAA 5F3HA 2XTJB 4UB0H 4ZDHB 1LNUA 5C0ND 1X5GA 2VLKB 4JGJA 4ZO6A 2CDGA 1MI5A 4YC2C 1KPUB 1AO7A 4LPTA 1U95B 3GZKA 3QWQB 5DJDB 3P73A 1G7QA 4GRMB 1N6UA 3RX8A 3MOAH 1CN4A 1MVUB 2DBLH 3EYVA 1YYLH 3BUYB 3CX2A 5IBLD 1AQKL 1RJLB 3U82B 2MCPL 1IAMA 1N6QH 3FOMB 5CKAA 1XGPB 3UZQA 1NMAH 1E4WH 4CJ1A 3DRTA 3O8XD 3ESVF 4LPYA 5BO1H 3OR6B 5F9OL 3UTSE 1NLBL 1Y6NR 3FTGB 1H3TA 4N8VA 3T4YB 5JXED 3QAZC 3QH3B 3B9EA 1ITBB 1HYSC 4XCNB 3CFDB 3WLBA 3KGRA 1SY6L 2ED9A 2B1AL 3T4YA 4IRSA 1ZT4B 4G6KH 3WDHA 4OT1L 3GMPA 2BFVL 4G43B 3AUVA 4LSSH 2WQRA 3V8OA 3S3PA 3ECBB 2CLZA 3D9AL 1VACA 2WBJC 4JPWH 3SDCC 3MV8B 4G9DB 1KYOJ 1DVFB 5FUCE 1HQRA 3OWEA 1Q9OB 1MCWM 1RU9L 1U2HA 1C5DA 3UYRH 2NY5C 5TDOB 4D9RD 4O4YH 3I2CH 1X5LA 4MQXC 5JPNB 4RGNB 3TZVD 3VXNB 3U4EB 4Y2OA 3WJJA 1S7SB 1YPZF 5HVWA 4Y1AE 5FHBL 5KVGL 3MGOB 2XN9B 1XIWC 2JTDA 4EQ3A 4POYA 2JELL 4W4OC 4OLVH 1KLGB 3U4EA 2NTFB 1EK3A 1PKQB 1XGYH 2P5WD 4J3TA 3WJLA 4NJAL 1Q0XH 1E6JL 4WTZA 1PZ5A 3EGSA 5I0ZA 4PJ8C 3TIEB 5CJ5A 2Y9RT 1OTTC 4BQ9A 2EEDA 4UTAH 3AY4A 5IB3B 4ZSOB 1S7RB 3TGXA 5T1DH 3QRGL 5IVOA 1KB9K 1ZANL 4QCIB 3CK0L 1WCBA 4AM0B 4GKNB 4FQJL 3SPVB 4L4VB 2PXYC 3WEXA 1CTNA 1NGPL 3UJIL 4E41E 3R8QA 4NDMB 5CP3H 2HWZH 3BPCB 4XCCH 4L4VA 1FGVL 3IFPB 3BHBB 4LLAA 3NIDE 4K2UL 1UCBH 4MD4A 4U6HA 4K3JL 5IB5B 4JREC 2XZQL 4NDMA 1PG7H 4JHWL 1CU4H 2ORBH 5D7LE 5FYKU 5D5ME 5CZVH 1T7YA 4LBEA 1FH5L 3OKLB 1QRKA 1LO3H 3U2SB 1WIUA 4LGPB 43C9A 4RIRB 2VDPH 1DP0A 4F9LC 5I8KH 3U48A 5IMOB 4X0KB 4MNGB 4M5YL 4LP5A 4M5ZH 3O0RL 1MFCL 3DGCR 3ULUL 4CMHB 2B4CH 2OMBA 4ALAH 3GK8L 3BE1L 3ZKSD 5B39G 5EPMB 4OGAD 1Z9LA 1RVFH 4JRXA 2ZG1A 3EO9H 4YDIL 2BOBB 4QHUA 2ZOLA 1G7IB 1YECH 3EFFB 1ZA6B 2HFTA 5SV3A 4DW2H 5JQ6H 2CLRA 4ZAKB 4ZXBC 4HV8A 4NP4H 2OP4L 2A38A 4JFOB 2ARWA 2R69L 4R90L 4YO0B 5MEND 5JA9A 1HHKB 3PWLB 3IDGB 2A6KB 3L5HA 2CRMA 2IPUK 1JHLH 4NQEE 1T22B 2GK0A 2YXMA 4HKXB 4ACPA 5EUOA 2UUDK 1S9YB 1AD0B 4KVNL 4YO0A 5F1IB 3LQAL 4XRCB 4AT6B 1DANU 2HVKA 4RGOH 4MS8D 1T22A 4HKXA 2IH3B 1NBYA 1AD0A 1CD1B 1JP5A 2FX9L 4QOKA 3BZDA 2VN4A 3ARGC 5F9DC 5F1IA 1JGVH 1UH4A 4ZUWA 4XBPB 4GQ9H 4AT6A 1YJDC 4I5BB 4FQLL 4JEGB 5CJOH 1OP3K 2ID5A 4YGAB 4KTEL 5F89B 1H8NA 1MJ7H 3C5SA 3CSYA 1CD1A 2DL2A 2OL3B 4FZ8H 5KSAC 1K4CA 4LARL 4UNUA 3RNKA 3QYCA 3FRPG 2AKRB 5I1CH 5E1AB 2JCCE 2X4OB 4EXPX 3ZL4L 3GMOB 5IB4A 3QEUB 4H25B 3VD7A 4IRJA 2GAZB 3SY0B 2AKRA 2C3XA 3DI2B 3UBXG 4PJFF 1TIUA 3P30L 2VXQH 4UT6L 2D2OA 1P7HL 5JDSA 4OI8A 2IFFH 4KJYB 3EOAB 4NZTL 2VDML 3K1KC 2OM5A 5DD5H 4R2GD 1LEGB 1YEJL 1N4XH 3L1OH 4LAJH 4PB0H 1UADC 3VFNA 3TO4D 4A2MA 1NMBL 1KXVC 3X14A 3EOAA 1B4JL 3O6KL 4P2YA 1JMZA 4P0DA 2OL3H 2ITDB 5F1NB 5BZDB 5L7XH 3ZE1E 4ONOA 2I60H 5D6DC 2Q8AH 3VFPA 1NBQA 3MC0A 1FG9C 4NKIL 3FOLB 4PRPE 4IDJH 1M05A 1YUHA 4UV4L 5GZOC 4TQEH 5I8OH 1VA9A 1IC4H 1H5BA 3NIGE 4JFZH 1KIQA 3I3BA 2HTLD 1MAMH 3FRUA 5T33H 3FOLA 3HC3H 5IWLC 3RGVA 5DK2B 4KQ4L 4AQOA 5I1JH 1INQB 1Q9KA 1KB5B 1YEKL 5JQHC 3GSOB 1NGZB 1NJ9B 1SVCP 1DEEB 3HI1B 2YD4A 3O6MH 4MA3A 3DV6A 4NWUH 1J05A 2BRRH 1ZMYA 2ZPKL 3OJ2C 4M4RA 1J0JA 1AGCA 1U3HC 3O11A 1RMFL 1A7NL 3DX8A 1JPGB 3GIVB 3TBTB 5B4MD 3BIBX 3ZKNC 1EJOH 3HC0B 4NN6C 1CF8L 1JPGA 3GIVA 3PGCA 5HHOD 2HKHH 25C8L 4XNXH 3A67H 3MRMB 4JDVA 3LRSA 1WZLA 3K81A 2GTWB 1YNLH 3SJVE 3STBA 1UEMA 3VI4E 1D9KC 4JFHD 5GS1B 3MRFA 4ZMAT 3W81A 5FYLL 1BOGB 1CQYA 2GITB 1OT1A 5T1MB 1DBBH 2YKLL 4WFHD 1A6WH 4OLUH 3O4LB 4FZEL 4KK8D 5T3ZL 1RK1A 1MREH 5CWSB 5HYQA 3IB4A 5E8NA 3V6FB 3PWJA 5TDPA 2FX8L 4X6CB 1T2XA 4QTIL 4PRIE 5CWSA 4HXBH 2VZOA 1Y0LB 3V6FA 4AG4L 1DUZA 4X6EB 1YEEL 1K2DB 1MIEL 4X4ZA 2F74B 5GSRB 5I15H 4X6EA 3KPNA 4L8CB 3T3PF 3AXLB 1C08B 1OY3B 1FZJB 4YFLI 4U6YA 4GW5B 1A4JB 2NXYB 4J1UB 5TQ2H 3RUGF 3DUUB 4M7KH 4P5KA 3B6SA 3AXLA 3TCLB 3OJMB 1P2CB 2IPKB 3TV3L 4DJMA 4MD0B 1R5VA 4J1UA 1JRHL 3IJYA 4C59B 3LKNA 3LS5H 4HULB 4FRWA 4QRUB 5D7IB 3B2VL 2J88L 4MAYA 4X7TB 2F58L 3KLHD 4QRRD 1J8KA 2ZCHH 4I4WB 1JV5A 3BWAB 3KNBA 3O6FC 3QNXB 2C3GA 3GBNH 4Y5YB 2CRYA 3IFOA 5E94A 3UJJL 4G8GA 5EOCJ 4NO0B 1F4YL 3HAEH 1ZHLA 4N0UE 4G6FD 1QSFA 1YEIH 3H6JA 1QKZL 2AJZA 3E6HA 1XF5B 2GJ6E 3NH7H 4HWEL 4LDLB 3RTQA 1SM3L 5DO2C 5LAXA 4BZ2H 3S35H 1CGSL 1JF6A 3O41B 3RHWK 3O3BA 2YD7A 2IMMA 2DYPD 4PJ9C 4XXDA 4RWYH 2AABH 5MEPA 4YZFF 2QR0B 1TXKA 1HSBB 3O41A 4EBQH 3C60B 2E9BA 1I7TB 1FYTB 1A6UH 2FGWH 5IKCB 5A2LH 4YEFA 4QRSA 4IIQC 2HKFH 2VXUH 4OCLC 2K7QA 4XT1C 4M48L 4Q74A 3SE8L 3IXTA 5DQJB 1FZKA 4O9HL 3MRDB 5FYLE 3MOQA 3W11D 3L9RB 4GAGH 1I8KA 4TUKH 5EA0H 4IMKC 3MOBL 5FOBB 3T0EC 4NO2A 4NWTH 5T3ZE 3MRDA 4NKDB 1MUJB 3QI9B 5DQDL 1P7KB 3BZFB 1BLNB 2ICCA 4CBPA 4JFED 1YMMD 1HH9B 1NAMB 5AEAA 4POUB 1S3KL 4UT9H 4DUVA 1N64L 1KENH 1BHGA 3W9DB 5ITBH 4PGBA 4X5XB 3QI9A 2VDOL 1P7KA 3JWOC 1BLNA 2VL5B 2EXYC 1CLYL 4RGMC 2F19L 2A0LD 2LFGA 2VQ1A 5GJSL 4NM4L 1W72B 3I84A 3S96B 1KTLA 1U8IB 5BVPL 4R7NB 5GRUL 3VXPA 3EW3B 2VL5A 1MEXH 3QCVL 4UINL 5C07D 2GY5A 2W9EH 2ZUQB 4MJ6A 5GGRA 1HK6A 1CDIA 4P59H 4P3CH 5BXFA 5L0QB 3U9PH 4Q58C 4PJHA 1CWVA 5F6HJ 4L5FH 4YHNB 3UTSB 1VB9A 4P9MH 4XVSH 3SGEH 4TN9A 4WW2F 4YHKH 3B5HA 3L7EA 5JIHA 2D4DA 5ADPH 3E3QC 2OZ4L 3MR9A 2GUOB 3UTSA 2AJUL 3SDCA 4R3SA 1NAMH 2OS7A 3QDJA 1CBVL 1RSFA 1X9QA 4APQB 3S37H 1UQSB 2G9HB 5JIPA 2DWEB 3KG5A 1TZGL 4J3OC 2RHEA 5DFWH 4YXHH 3AAZA 4U6XB 4WIQA 1W72H 1ZLUH 1UQSA 3GNMH 5E8PA 5E8DH 1XIWA 3N1GC 4M7LT 4W4OA 2VLJD 3H42L 5C0NC 5JOPD 4PRNB 4WNQA 1RZFH 4Q9QH 5HGDB 4JFQB 5KG9B 1H3WM 1FGNL 4B53A 3IVKB 4Y1AB 1RHHA 1CGTA 4PJ8A 2XFXB 1JGUH 1F2QA 4YHML 1EEZA 3PP4H 5C0BD 5I1IH 1LO0H 1MJ8H 4HWBA 4CVWA 5HGAA 5T1KB 3RWJA 4Z8FH 1QSEE 4I2XA 5IBLC 3I3DA 3EYOB 4LNRB 2R8SL 1IVLA 3NCJH 4TSAL 5FO7B 1D5XA 5CEYB 3RJQB 1HI6B 3DV4B 1NUFA 4I0PD 2PXYA 4UT7H 1OP5K 2IEPA 1UB6A 3NCYS 4XBGB 4PD4J 4F2MB 5F7LB 2Z31D 3AS2A 4NZJA 1RZIA 1F8TH 3OG6B 2DM2A 1FFOB 4FQPA 4PJXF 5EIQA 5JXEC 4F2MA 2EIDA 1S9XA 4LHUB 3CXHK 5JHDE 1J87A 2Y7QA 5FCUL 1FSKB 4E41B 1FFOA 5CUSH 3GKZA 3QP3A 1AJ7H 4L1HA 4U1KB 3ARFD 4OF7A 4E41A 1L4IA 3HFMH 1MCQA 1MF2H 1N59B 3HCVA 1HDMA 5I75C 3V0VB 5D7LB 2FWOB 4LHJB 1F3JA 1TQCC 3C9NA 5D5MB 4WHTB 1FNLA 2X4QA 1RZJH 4RA3A 4P2OB 5ISZE 4JFDE 3B9VA 4R4NC 1DBJH 3SDAD 5D5MA 2X4RB 3TZVC 3QB7C 2GKIA 1NFDE 5CJXC 3G5XA 4JHZA 2WLYA 3OF6D 5L2JA 3BIAX 5F88B 4Y5XA 4P4KB 1YEFL 2CUMA 4XMKL 5C08E 4ZXBA 2X4RA 5GXBB 12E8L 1NL0L 1Q0YL 2APBA 5LCVL 2OK0L 5E4IA 2ZG3A 3U4AA 5MHSE 4J8RB 3UTOA 1NCDL 1ZOXA 5HGGS 2IPUG 5KANG 5ACMA 2PO6B 1AQKH 1EHNA 4UOW1 1B4RA 2MCPH 3OKOB 3OPZL 5JO5B 1EVTC 1TVBB 5EH1A 2AXFB 3KPOB 3HE7D 3TEUA 3MV9A 3S5LG 5DD6B 3QQNA 1CXIA 3UMTA 5FKPA 4K23L 1T7VA 1CDCA 4NQEB 5KVMC 1BFOA 3OKOA 3KPOA 5F9OH 1UA6L 5JLZB 1NLBH 3ZYIA 3MLVL 1DUYA 3QIUB 1O5DT 5LKNA 4RAUB 1SY6H 1WWWX 4XNMA 5DC0A 3HZMB 4I8DA 3DURA 4N68A 4OAWA 4TNWK 5I16B 2HYMA 2B1AH 4X9GA 4OT1H 1N2RA 2BFVH 4QEGA 3NFPA 1S7XA 1Z6JT 4JY4B 4ZNEA 4LIQE 4LVNC 3RWGA 5EO9B 1CXKA 3KWWB 4YIQB 2HH0L 4PRBA 3D9AH 5E2VL 1MCEA 2JCCB 5D2LB 1LP9E 4OM0L 3MFFA 3U7AA 3HN3A 4MXWL 2A2QT 2ESVD 2CXGA 4I9WE 5B39A 4FOMA 3ZSSA 1RU9H 4L3CB 4QRPA 2W59A 5LXGL 4WUUD 3NCCB 4OGAC 2FJFB 2LU4A 4PGCA 3TJHD 5FHBH 5KVGH 3WFHA 1TCMA 3LZFL 1TPXC 3MREB 5D1XA 5D6DA 1YEGL 5DJ8A 4N1HB 2JELH 1MY5A 2FJFA 3FFDA 4JQVC 1GH7A 5D2NE 3CH1B 4HAGA 2X89D 1NDMA 2EH8L 4PREB 4NJAH 4F3FB 3QO1B 5DJYB 1E6JH 2VTFA 5DJ6B 2FRGP 4GW4A 4BK5A 5IWLA 1OF2B 4OCXL 4MB5A 2W0FA 4PREA 3QO1A 4WO4D 3V0AC 3L6FB 5DWUL 1AIFB 3WL9B 2BSSA 5A2FA 2IPTL 1RJCA 3PHOB 3VFTB 4Q9CA 3QRGH 4TPRL 3RUGA 1ZANH 3VRLE 3CK0H 3LPFA 1L9MA 2AK4D 2GJZB 4MS8C 2SEBA 4PRPA 4FQJH 4N5ED 3RIFF 3R06A 3PHOA 3VFTA 1FVEA 2V2XA 4KMLB 4LLUA 4EIZC 4XVJL 1I7RB 1S9WA 1NGPH 3UJIH 4DTGL 2A9ML 1KJMA 5HHPB 4B7LA 1EDQA 3FRPA 1FGVH 2R4SL 1YYML 2DM4A 4YDJB 5C0AA 2YWYA 4K2UH 4OD2B 1TQBB 4K3JH 1VFBA 2ZCKL 2XZQH 3VMOA 4P5MA 4JHWH 4OZFB 2J4WL 3UBXA 3O45B 2LAAA 1C12B 1I1AC 3WUWG 1FH5H 5DXWA 5FDYA 1D9KA 1CD0A 3DBXA 2ADJA 4ZUTA 3LN5A 4PRDB 1O7VA 3ARDB 4Y8DC 4FXGB 4LVOB 4FS0A 1AY1L 5SWZD 1LEKA 4UQ3A 3O0RH 1MFCH 3BKML 2GI7A 1K8DB 3ULUH 3GK8H 4H8WL 3BE1H 2R1YB 3SDYL 3SJVB 4R2GC 1SBBA 1QO3A 1TLKA 4ZOEA 3D39E 2F53A 1U93B 3KPPA 4YDIH 2IH1A 2NW3B 2YPLE 4Y19A 1ED3A 2J7LA 4MZ3A 1JGDB 5C0DA 3OAZK 5DVLA 4F7CB 1LQSR 3V8CA 2HT4C 1KTRL 3UROR 4M7JL 3EOYG 1NCUA 1KLUA 2DKMA 1WCQA 5IM7B 3VCLB 2OXGA 4UDUB 4KJPC 4KV5E 2OP4H 1P5UA 4NKMA 4OZFH 2R69H 2XZAL 4R90H 2DICA 5TQ0L 4ZTOL 4GG6A 3OV6A 4P23B 4PBWD 3CX5J 5EDXA 3LKSB 3SE3A 4I1NB 3RVTC 1XCTA 1JVKA 1U9KA 4KTDL 4KVNH 4XPHL 4PRIA 4P23A 3LQAH 3ULSB 1T20B 2EYSA 3H9SA 3K80A 1IGCL 1UT9A 2DQHL 2HFFB 4W4NA 2FX9H 1WBZB 4QHKI 5BRZA 2EDQA 5GS2D 4FQLH 3FONB 4KTEH 2AEQL 4I3GA 4HUXB 1G7PA 2W60B 3LN4A 4KZEL 5B4MC 4LARH 3MXVL 1KSRA 4E42B 3KXFE 5CZKA 4K8RD 3PIQA 2X10A 4ZFFA 2P8PB 4TUJB 3TLRA 3D25A 1DBML 4HUXA 3BRDA 2UWEE 4G42B 3ZL4H 5CMAB 4IM8A 1QRNA 1X5HA 4E42A 1HWHB 1II4E 3GFUA 1G0XA 2V5SA 1MNUL 2DLIA 3QPXL 3P30H 3IDJB 4G42A 3T3MF 4GFTB 5D7JC 2AAVA 1ZT1B 4UT6H 4IRZL 1E27B 3WO4B 5D96B 3QQ3B 3OAYH 3O3DB 4N0FA 2AJYL 4PV9A 4NZTH 2VDMH 4PJ9A 1JK8A 2R0ZL 4N0UB 5F7DA 1YEJH 4DCQA 2F54E 5C6TL 3O3EB 3QQ3A 4KK8C 1QSZA 2GJ6B 3O3DA 1NMBH 3T8XA 1DSFL 1U8LB 1ZSDA 2F5AL 2P8MA 1B4JH 3O6KH 4IIQA 3F7VA 3G6JE 1JN6A 1A6PA 4HH9A 3JZ7A 2LVEA 3P0YL 3MLYL 3V4PL 4MZ2A 1J0ZA 3F7RA 3VXRD 4NKIH 3DROA 3H9HA 1CG9B 4FN0A 4JPKL 1YN6A 4UV4H 4KJQC 3ROLB 4FMKA 1T0NA 1F2XK 2R2BA 4IMKA 5DZOA 3T0EA 2IBGA 4PJEF 4KQ4H 1LK2A 1YEKH 3CDCA 3F62A 4DN3L 4LLDB 2BERA 3IJSA 3NN8A 4FFYL 4XHJC 4BJLA 3TVMD 1QPPA 3E6FA 2ZPKH 4OLEA 3GM0A 1HIML 3VE0A 3PWPE 1RMFH 1A7NH 1XH3B 4XP4L 2NNAB 5F7NC 4YHPB 5HGHA 4ODBD 2DQDL 4U7MA 4RMSA 1CF8H 4PGDA 3KLHC 1I7ZA 3SO5A 3TNNA 5MEQB 1GOGA 25C8H 3QCUL 3D48R 3P11L 2HMID 3CPLB 1R3JA 1T21B 1KUMA 3QUKB 4Y88A 4U1NB 4CW1A 4ZNCD 5D93B 1QNZL 4TVPD 5FYLH 1K3ZA 5HYSG 4PRAB 1Z0NA 5BJTA 1T21A 4RFOL 2YKLH 5F21B 2M2DA 1NKRA 2EZ0D 4FZEH 2Z4QB 3BGMB 5T3ZH 3AU1A 1EH9A 2XPGA 1MFNA 1RAMA 3VGDA 2D7OA 1JWSA 2NY7L 3C5ZD 3LOWA 1BIIA 1GOFA 1QOKA 1MFBL 2PW1B 3QDMA 2FX8H 2Z4QA 4ZPTB 4MJ5B 4JDZB 4LLYA 1W0WB 2HFEA 4JFEE 4QTIH 4KZDL 2YEZB 1NEUA 3D85B 3FB8A 1G1YA 2VZVA 2YA1A 5EG6C 3GSRB 2H6PA 2PW1A 3DYOA 4AG4H 1MCFA 4JDZA 3EYUL 2BZDA 3MLSL 3HMXL 3CZFA 5JUEL 3LEVL 1YPZE 1YEEH 3W11C 1MIEH 4F7MB 4AENB 1RV6X 1B2WL 1WTGT 1OB1A 1KN2L 5C07E 1A6VL 3K2UL 3L5WA 1BECA 1A47A 5D4QA 2ERJB 4FQXB 3ZDZE 4U1SB 2YSSA 5EIIA 3L7FB 3HZKB 4WVRA 1FDLL 3EZ8A 4PJ5E 1AGDB 4N8CL 3TV3H 3O8XA 2ICWJ 3MRNB 4K94C 1JRHH 2A0LC 4IHOB 1QSEB 5FUZL 3B2VH 1QLFA 2J88H 3VXME 1HXMB 2BNRD 5JXEA 1AGDA 2F58H 5JW5A 1D3CA 4OZIF 5CAYB 1N7ML 2Z9TA 3NFSL 4OZHF 1HXMA 3UJJH 4HIXL 5FGBC 1F4YH 5MEOA 1WISA 1CXHA 1QKZH 4HFUL 5IROC 4LCIL 3I6KA 3RHWF 3PGFL 4Z7QE 4H88L 3JTSB 5JHDB 2P46B 1MCIA 1MAJA 3RDTB 4HWEH 3A6CL 1SM3H 4WI9A 2GYSA 1IRAY 4E5XB 1CGSH 3HS0B 1F6AB 5DI8A 2MMXA 4JFPB 4K7PY 1KIPB 1WLHA 4WFGD 4X4ME 5JMRA 2DM7A 4MJ2A 3ALPA 3TZVA 1A4KA 4HIEB 1T1WA 4XBEL 1KIPA 4M48H 2D31B 4OV6F 4HAFA 3SE8H 5ISZB 4JFDB 5EN2A 4YGVB 2P5WA 4PJCE 4O9HH 3I75B 4JN2A 3WFCL 2EKSB 2YA2A 1NFDB 4O51B 4QF1B 1WFTA 3JWDC 4YGVA 2VLME 3MOBH 1YJDL 5C08B 3MUJA 2R39A 5DQDH 2EKSA 1NQBA 2YD3A 3SCMD 4BKLA 5CD3B 5I66B 4O51A 1S3KH 2FSEB 1N64H 2XWJA 4JM2D 4MSWA 5C71A 2VDOH 1DR9A 2BVQB 1CLYH 1IARB 2F19H 3EJYC 1NGQL 4I0PC 1YEDB 5GJSH 4NM4H 1G6RL 3INUL 5BVPH 5GRUH 5FKAB 4PY7B 3QCVH 4UINH 4OUUA 4X6DA 5DVNA 5IOPA 3CD4A 1KF9B 3MBXL 2BOCA 5ETUB 4NYLB 4Q9RL 1KJVA 1FHGA 4PY7A 3NZ8A 3KHOA 1OGTA 2Z8VC 1EZVX 3S4SG 1OLZA 4QRTA 2ZSVA 4R96B 3U0WL 5ETUA 1KIRA 3QUYD 2OZ4H 3QJFB 1JMXA 1G9NC 3D18A 2A9NL 2AJUH 5ESVB 3ARFC 1CBVH 4XNUL 3P4NA 3EJJX 1SQ2N 3L3GB 1NLDL 2WINA 3QJFA 4KRPD 1TZGH 1BQUA 5KS9B 3GMNA 1FVCB 1G84A 3I6LE 2X4UB 3DMMB 4KROD 3SKNB 4HWZA 1LP9B 1F6LL 3VGAC 1HXYA 3SDAC 1CFSB 4N1EA 3G5ZB 1MSPA 1A21A 2QTEA 1JGEA 4WUKL 1XF4B 4JQVA 3K1DA 3H42H 2GSIB 3MRGA 1P6FA 4D9QD 2Q7YB 3Q1SL 1FGNH 4LF3A 1B6UA 4Y5VB 4YHMH 3TA3B 5MENA 4F15C 4HS3A 4JAMA 1CL7I 4RDQF 4QGTA 5D2NB 5FYJU 4MD5A 1U3YA 4G9FE 3JSSA 4FQHA 2YD6A 4BSVA 3VG9B 2R8SH 2R15A 3LDBC 1MPAL 4P4RB 4TSAH 2NY4C 3OMZA 3HRPA 1P1ZA 3JVGC 2FH8A 32C2B 1K8IB 5EUKA 2QSVA 3ARBD 1VADA 1A6TA 3P4OA 1EGJL 2OR8A 4NQDE 4QT5A 5C09D 4C56E 5F7FA 2ESVE 3CMGA 5JDJA 2DAVA 1QA9B 3HRZB 3LKPA 5FCUH 3RFZC 5EZIL 4WUUE 4RBPK 4EN3D 2E6QA 4J6RL 5L8JB 3O2VL 1GZQB 1OSZA 4Q2ZA 4YQXL 1U91A 5EOQL 4GS7C 1IGTA 3SDDB 1ADQL 2BSRB 2WAHA 4X6BA 1BMGA 4KI5D 2IBZX 4BSWB 3PWNB 4JKPL 3FB5A 4KQ3L 2V2WB 3TO4A 4Y4FB 4RMUA 3PXJA 1S9KC 5J4MA 1GXEA 3MUHL 1PAMA 4K71B 5INCB 1FJ1B 5KVFL 4JRYD 1CFNB 2FIKB 1HHIA 1YEFH 3FQRA 4D2NA 4XMKH 5DJ2A 4JKWA 5BS0D 3D39B 4ZYKA 12E8H 3GUTA 2BX5A 1FJ1A 2YPLB 1NL0H 1Q0YH 4X7FC 5ILTL 5LCVH 3L95A 2OK0H 1JI1A 4P49A 5I8EB 1NCDH 1DQQB 4LK4A 3FJTA 3OKKA 3OXSA 3TNMB 1MFDL 1MH5B 2BSTB 4WO4C 5JPMB 3V6BR 5I8EA 5FB8B 3OPZH 3V0WL 3D69A 3MRJA 3PL6B 5DJZB 1MH5A 4K23H 1BJ1J 5I2IA 2VLRD 5E2TL 3ET9F 1B9ZA 3B43A 4S1RL 1UA6H 4YFLF 2DRUA 4LCYA 4PJBA 5DJZA 3MLVH 5SWZE 1MCNA 5E8EA 3GM8A 2X1OA 3RI5K 4Z18A 4ONFL 5F8QC 5HHOA 3I85A 3QUXB 4YDVB 3WUWA 1LHZA 2ENYA 3CFCL 3VFRA 5DJXB 3KXFB 1TVDA 2HH0H 2C3VB 1WT5C 4HGWB 4X98B 5E2VH 2UWEB 4OM0H 3D0LB 3EO0A 4PJAF 2DLFL 4MXWH 4HH8A 2E7LC 4M00A 4P48A 3DTXB 1MWAL 4MJIE 4J4PD 3D2UB 4MDJA 3GJFK 5LXGH 3BIKA 3VFMB 5DDHA 5F9WC 3OJVC 4JVPA 4LGRB 5HHQB 4OZGA 3G08B 3LZFH 3SDXF 2LAGB 1YEGH 3IJHB 2F54B 4R4FL 4HUVA 4LPXA 5GGUB 3QEGL 2DI7A 3VDBA 5FCSH 4YZFE 2EH8H 3K7UA 3L3DB 3QXVA 3G6JB 1CLCA 2XXMB 4ZQKA 3F12A 3EHBD 3V5DB 2W92A 5DHVB 5C9KA 4XMPL 4UIMB 3AB0C 8FABA 4LL9A 2I9LB 5DMYA 4OCXH 1AXIB 4HK3J 3EOTL 4EI5C 5DHVA 3RKPA 5DWUH 4NC1C 3DO7A 1I1FB 2P5EB 2IPTH 2A6JB 2V9QA 4TPRH 5E7BA 4U1MA 3VWKB 5D6CA 4MA8L 3A0OA 3EOBA 5I73C 3O3AA 1IE5A 3PGDA 5F3BB 3GKWL 5DRWB 1HEZA 2C7UB 3VJ6B 4HJJL 2A6JA 4XVJH 4KK5D 3MLZL 4DTGH 3RWEA 5FO9B 2A9MH 2YMXL 2V17L 1I1YB 2KPNA 2GCYB 4OF8A 5M7QA 1SEBB 15C8L 1RQ5A 2R4SH 5DRWA 1YYMH 4QRRA 2ZUSA 1FL6A 2Y36L 1ZV5A 4K8RC 5FO9A 2ZCKH 1C7TA 3PWPB 4HKBB 5FGCE 1SEBA 3SE4A 4P2CG 2FJHB 2J4WH 3VDCA 2VZ3A 3WS3B 3B9KB 2QKIA 3EJZD 2Y72A 5TE7L 4HKBA 2YD9A 2R9HC 1AY1H 5CEZL 3BKMH 2FJGA 2YOCA 2AVGA 3VXRE 3KPRD 3G04A 4YBQD 4H8WH 2DYPA 3SDYH 3LKQA 3BO8B 3RL2A 1HQ4B 3L3HB 4B41A 4DKEL 2QHLA 3WNMA 1M71B 3CU1A 1LWRA 3BO8A 4ZFOB 5TDNA 2NR6D 1HQ4A 3L3HA 5FO8A 3FT3A 4M7JH 4XNZC 4LLVA 1NMCC 3T4AB 3OXRB 4ZFOA 3CSBA 4W70A 1G1CA 2XZAH 1RZKC 2EKJA 5TQ0H 4ZTOH 3ZKMD 2P47B 4PRHD 2ATPA 4UBDD 1GGTA 1U8KB 4MQSB 1FC1A 4MB4A 4KTDH 1ZHNA 4JM4L 1P69B 4XPHH 4JFEA 1U8PA 1YMMA 2EYTB 1YPZB 1IGCH 2DQHH 3D0VB 4K9EC 2ICWB 2YS4A 2R29L 5IP4A 4O2EA 4YC2B 1CQKA 2BHZA 3TVMC 4XC1L 3KJ4B 4YHOL 2AEQH 1O7SA 4W6WB 1CIDA 3V7MA 1G9MC 1AD9A 4U1HA 5C07A 4KZEH 3MXVH 4NBXB 5B8CB 2JK5A 4NNYB 4PJ5B 2JIXB 5CBEB 2PR4L 1DBMH 1YY8B 1BVLB 3CVHL 2XRAL 4X99A 3RZCB 3FCTB 4YWGL 3VXMB 1BZQK 5IBUG 2P4AB 1MNUH 3MCKB 3QPXH 2HMIC 2Y07L 3T0VA 1NCCL 4OFKA 1BVLA 4PJXE 5L6YL 4IRZH 4M9PA 3RZCA 1CS6A 5D72L 3VXMA 4R97B 1K5NB 3KPLA 3RY4A 2AJYH 5HYJD 4MGXA 4U1GB 4CU8A 5C3LD 2R0ZH 3AS1A 5C6TH 3RBSA 1A5FL 1QLRA 1KJ3L 1MCDA 3NTCL 3F8UB 5DJ0B 3I6GB 1DSFH 2F5AH 2C1PA 4HKZB 2E8YA 1C7SA 1SJEA 4AMKL 1J1XL 3N9GL 5JOFB 3GB7A 5DTFA 3ALXA 1CICC 5HI3D 3P0YH 2VLJA 3MLYH 3V4PH 1T7WA 5HPMA 3RIAF 1I75A 1JZ6A 5EU7E 1NCNA 2IQAB 4JPKH 5GGRY 5CEZE 3O3UN 2W65B 4HK3N 4X4MA 5D1QB 4PJCB 2AQ1A 1BD2E 3MRLB 2WIIA 3LIZL 4WWKD 4DN3H 1FIEA 5IB1B 1VGEL 3JV6B 5IW1A 4X7EC 4FFYH 4PJ7F 4DK3A 4XPGL 1PBYA 4YHYC 3BYYA 5D7KD 1LVEA 4ENED 1FL3A 4I0PA 1S8DB 5GGTA 1PDKA 2FZ3B 1CI5A 3GSWB 2FL5B 4ERSL 1HIMH 1XZ0B 2Z31A 5ANME 4XP4H 3BPOB 5DQ9B 5DJCB 5CHNA 2VR4A 2DQDH 1P84K 4ZOAA 2DJ4A 3JWNC 5CD5D 4ZO8A 5T3XL 3UCRA 3ILQD 1FZOA 4Z7NE 3QCUH 1I7UB 3WXWL 2QQQA 5C0EB 3P11H 3VRIB 4XH2A 1I9JL 4GG8B 2R2EB 4JGUA 1X6LA 4E0RB 1ORQB 2QLVB 3V7AE 3ARFA 1P7QB 1QNZH 1UVQA 4HGMA 1JHKL 2I25N 1IGJB 2JB6A 1EBAA 4LSUL 2G75A 4RFOH 4UAOC 3W82A 2ZP0T 4F7PB 3C8DA 1LE9B 4CVXA 4LEXL 4RMQA 5TJWK 3MRQA 3QIBB 2NY7H 5EZOL 1EAPB 1KIUA 4H1LG 4ODWB 4PGEB 3SDAA 1MFBH 3RY6C 1GL4B 2XYCA 1KN4L 3W0WD 1AR1D 5DUML 4KZDH 4GAJL 3CCHB 3ZT6A 3OF6A 3HE6D 1ETZA 4NGHL 4PJFB 4JY5L 3V5HB 3DSFL 3EYUH 1DEDA 3MLSH 3HMXH 4XCYB 5JUEH 3LEVH 4M3KB 4P9HC 1B2WH 3C6LD 5MP6L 1A6AA 1TVHB 1ZHKA 1DTUA 2J8UA 1KN2H 2XTJD 5JNYB 3GSNB 1A6VH 1I8MA 2L7JA 2VLKD 3K2UH 5HYEA 2XKNA 3V6OE 5CGYD 1FNGB 3OJDB 3GSNA 3HE7A 4JM2C 5DFTA 5EFIA 1FDLH 2LV4A 3BP6A 4Z5RB 3PXHA 2Q1EA 4N8CH 4C83B 1U0QA 4G9FB 4UU9A 3QPQD 4JG1L 5DMKB 5J12B 2X2YA 1MHCA 3HPJB 5FUZH 5EU4A 3VGHA 4OSUL 1C1EL 5DLML 1R5IB 1HINL 2FB4L 4S0TD 5IJVA 4QHKJ 1T1YB 3ORJA 3STLB 1M7DB 2V9RA 2YPKA 4A6YA 4D0BA 3HPJA 1N7MH 5IEKA 3NFSH 3BH9B 5BV7C 4HBCL 3RVWC 1S7WB 3LRGA 4NQDB 4HIXH 4C56B 5AYQA 4H20L 4HX1B 3FB7A 2FECI 2H3NB 3STLA 1IJ9A 4TTDC 2NXZB 2HJLB 4HFUH 4GBXB 2R0KL 4LCIH 3QUYC 2DOCA 4OIIL 3PGFH 4H88H 3OKMB 1J18A 3GI8L 3A6CH 3FQUB 4WUUB 5J13B 2ESVA 2HT3D 5ERWA 5KSAB 3ZHKA 5ESAA 3C5JB 5IVXF 4KRPC 1Y6KR 4G6ML 4YDLC 3OB0H 1FLTX 4WUUA 2E7BA 4JPIB 5T3XE 1H15B 2P1YA 3KDMB 2PN5A 4KROC 3WYRA 3MMEB 1G6RB 4XBEH 3MV8D 3C5JA 1Z5LA 2BY2A 3PABB 3Q6GL 1DVFD 4WFEE 2OSLB 2B2XL 2C3WA 3WSQL 1G6VK 3KDMA 2G5BB 3LD8C 1J9CT 5TH2B 3GBML 4JR9L 3WFZA 2X89A 1YMHB 5IW6B 3KAAA 5D70L 3WFCH 4RGND 3GJEA 4ZUSA 5GS3A 1RK0B 1AGFB 2XN9D 4PG9B 4FG6D 1WFOA 1YJDH 3P77A 3WD5L 5B3JE 4OFIA 4WO4A 1I9EA 2VLLA 2PCPA 3PNWA 3UTZB 5EU5B 4NKOB 4M8VA 3DIFA 4JM2F 1XCQB 4LCUA 1Y18A 1FFRA 4B0MM 2AK4A 5CP7A 1NGQH 3MROB 3MYZA 3G6DL 4NBYB 1G6RH 5HHNA 2VDRL 3ARBC 3INUH 5T1LB 3V5KA 3IS0X 1OPGL 3BP4B 3MBXH 1H3VA 4Q9RH 5CSZB 4LCWE 4L4VD 2QADB 4CNIA 2WW8A 1HYRC 4X5WB 2H2SD 1A9BB 3U0WH 3E0GA 3VD4A 1DLHA 4PB9L 2ICEB 5I74B 2CKBA 2A9NH 3FMGL 3MGTA 1D5IL 1XR8B 2Q76B 4S2SB 1KGCD 2E7LA 4EUPG 4XNUH 5SWZA 1NLDH 3MZGB 3FT4B 1RI8A 1OWWA 5E4EC 4NN6B 4KI5C 4R6UA 4NQXB 3TF7C 5GGSB 1NEZB 4O2CB 5DSCB 3CFBA 4UNTA 5H8DA 2WZPD 2VAAA 4XZUB 1R0AL 3RP1A 2HLFD 2HP4A 4JLRA 5DSCA 4MJIB 5IUSA 2Y5TA 4WUKH 4HIIA 3U36A 4N90E 2LTQC 1PYWA 2ITCA 3Q1SH 4XVUC 1XT5A 3V95A 3VFOB 4NQCE 3T1FA 3TPUA 1I85C 4HUUB 4ELMF 5HBBA 3SGEI 2OX5A 3DUSB 5F6IB 4MDIA 3MFGB 3WV0A 3DXAE 3WHXA 1WBYB 4ZAKD 3WFBL 3DUSA 2J5LC 35C8L 1MPAH 3QULA 2PETA 4NN7B 4PJEE 3ARWA 4LRIC 1EGJH 4L4TE 2NY3C 2EO9A 1UWXK 1V5JA 1KOAA 1YNKL 3GSUB 1INEL 3IDMB 5EBMB 4DUWA 1SYSB 3FO1B 4GUPA 3QUZC 1UZ8B 5AUMB 3G6AB 5EZIH 3U30C 2O5XL 4J6RH 3O2VH 5HI4D 4PJDA 5DEFA 3E2HB 3QEHA 4YQXH 5CZXD 5K9JL 5EOQH 3HUJF 3IKCA 3VFUB 4W6YB 1HHGB 2KDGA 2PYFA 4D0DB 1ADQH 5FGCB 4O2FA 2CD0A 2X7LB 3VFUA 4WU5B 1UZ6F 3UJTL 3BYTA 3M17A 4JKPH 3WXVL 3O6FB 4KQ3H 4NN5C 4J4PC 1SBSL 5I6XB 1MCBA 2FO4A 3CFKA 4WU5A 3SGJC 1ZLSL 4AJ0A 3VXRB 4QHMA 5KVFH 4H0HB 4WW2B 3WE6A 4KH2A 2YRPA 3B3IA 1AQDA 4OQTA 3VXRA 4MCZB 1AFVL 1QFOA 3EBAA 3MRKB 3IF1A 4JO2L 4LKXA 1XFPA 4EXKA 1FO0L 3RX7A 5ILTH 2QQNL 4BQ8A 3FQWB 5J7CC 3L3IB 3EHBC 4U49A 1MJJA 5DS8A 5A2KH 1UXWA 3IDNB 1KJ2L 1D5ZA 1MRFL 4K94L 4QY8B 2EDDA 1MCLA 4U6TA 4XP1L 3VFWA 3TESA 3ARXA 1MFDH 1E28B 3L3IA 3C6SA 3V0WH 3QFDA 5ICZB 2HG5A 1QPXA 1MWAB 3DSNA 1TJHL 1T04A 1PG7X 3FO0L 1UM5L 4JJ5B 4L8SB 3RWCA 5IFAL 1U6AL 3STZA 3X12B 3TBYB 3TVMA 5E2TH 1S7UA 1T1XB 1WUNT 4Z7VE 4OV5A 4S1RH 3KYAA 4CMMB 1JHTB 3T09A 2JKXA 4WDIA 3RI5F 3VRJA 4KK5C 3TBWB 1N0XL 2BMKB 4HJ0D 4LDEB 2PYEE 1T1XA 2EH7L 3JTTB 3N06B 2X4NB 3L3KA 3V4UL 4ONFH 4M1CC 3ARVA 3LH2L 5I1DB 1CDGA 4KRMB 5IHUL 3JTTA 2LABA 1CGVA 5HHXL 3CFCH 1A6ZB 3LQZB 1B0RA 4RGMB 2HJFB 3QZWG 4OZIE 3O2DA 2I26N 1M6OB 2DJUA 3EJZC 4Q0XL 3KYMA 1WBXA 2OLDA 2DLFH 1QR1A 1R3LB 4Z7UF 4OZHE 1QP1A 1A6ZA 3LQZA 3LV3A 1MWAH 4QHLA 4DZBB 2FR4A 4L8DA 5HDQL 3TBVA 1GGCL 3BH8B 5IMMB 3BZ4B 3UTQA 1ZWIB 2IMNA 2AGJL 3DX7B 4PJXB 1R3LA 2N56A 5K33A 3C5ZA 4DZBA 5AAMA 5M95B 3BZ4A 4MCYB 1S78D 2B20A 3OGOE 1HILB 4JJHA 4KKBD 4U7KA 4R4FH 2NR6C 3O4LD 3QEGH 3ZE2F 2R1WB 5DUBA 4PP2A 5FA3B 4BK4A 1WZMA 1KACB 1X5AA 1EIBA 3MJ7B 4XMPH 4PTUA 3DGGB 1TTGA 2D7MA 1NUNB 2RJMA 4MMXC 3ZKMC 3MNZB 2Z93A 3EOTH 2BVTA 2C3HA 1HH6A 5HDBF 4RMRA 3HZYB 3MJ7A 5HXMA 1URLA 4HCRL 3IXAB 2OI9B 1BQHG 3MYJB 5F9AC 3KS0H 4HUKB 3F6IA 5BZWB 3DRQB 1KBGL 4LPUA 4MA8H 4OLXL 1ES0B 4JANB 1ZS8B 3DVFA 3GKWH 1BD2B 2R1XB 4HJJH 4S1SL 3O9WB 2PW2B 3S3SA 3LPGA 3MLZH 2Z91B 2YMXH 2V17H 3ULVD 1QZ1A 4M61A 3KLAB 15C8H 1G9NL 2NXYD 1BD2A 2VISB 5E95B 3HR5B 2Y36H 5EO0A 4N0RA 5GJTL 2DIJA 1QFHA 5ANMB 5AYUL 3VXTA 2XACC 2WANA 4NO5A 5FM4A 4WU7B 3KPMB 3IAGC 5TE7H 2R56L 3MO1B 1OAXL 4MNQE 2BVYA 3MPCA 5BMFL 3MNVA 2YR3A 4HJGA 5CEZH 1CE1L 4WU7A 3KPMA 3N1PC 2VZUA 1CXEA 4Z76B 3C8KB 3S8WA 4CVZB 4NO0D 3FN3A 5FECB 1D5BA 5KVDL 4DKEH 4PR5B 4AK1A 1IM9B 3UPCA 3H7BA 4HPYL 4Z76A 4KKCD 1Q72L 2V9TA 1X5IA 2A6IB 1A2YB 3OX8B 1K4DA 5HI3C 3C09C 4DK6A 2CLVB 2FHCA 2BC4A 4OKVB 1T66D 5FXCH 5C2UB 2VE6B 5D7KE 4RMWA 2XQBL 3C60D 3CVHB 5HY9B 1FYTD 4NRYA 3HHRB 2ARJB 2WWKO 4NUGL 5IESL 3F5WB 2R2HA 2PKDA 2NQCA 4HZLB 4JM4H 4YK4C 4ONHB 2FCBA 3TP4A 3SCMA 3SO3C 4YHIB 1UXSA 3QJHA 4KFZC 4JM2A 1HKFA 2CIKB 3WIHA 4AH2A 3SBWC 1QFWL 1EFXB 5TGBB 3EDEA 2DMKA 2R29H 1RURL 5H37G 1JWMA 4WY7L 1UKTA 1R24B 4XC1H 3P9MA 4YHOH 3LEXB 4WI3A 4MVBD 2X70B 3HG1E 2ADIB 3OR7A 1QQDB 1N5AB 4NZDA 1JZ4A 3ARUA 4X4YA 3IYLW 1AC0A 2CDFB 3V6OA 2PR4H 3WHE1 1T5WA 2NY6B 5E9DE 3V6ZB 3QNZA 5CD5C 4FQIL 3CVHH 3ILQC 4Y0GA 2XRAH 4IOFD 2WWMC 4YWGH 1JYVA 3WNNA 7FABL 3SKOB 1GC1L 2EICA 1NCCH 2Y07H 3QUYA 3RWIA 4KY1L 5L6YH 4XX1E 5D72H 2PTTA 4BH8A 2QQLL 3SKOA 3UTSD 3NGBC 1NGYB 4I13B 5LG1A 1A5FH 3NTCH 1KJ3H 4PJIF 4H1LA 2VXSL 3EYQD 1S9VB 5C7XL 2XTJE 3B5GA 3MV7E 3BEVB 3TPKA 4AMKH 3GSQA 1J1XH 3N9GH 4APQD 1KYOK 2EDEA 3P4MB 3TBSB 1S9VA 1AR1C 1IQDB 2OJZL 4CN4A 4OCRL 1AGBA 1T7ZA 5EB9A 3CFEB 4NNXB 4R8WL 4EKXA 3TBSA 1RIHL 3O4OC 1U92A 3BP7B 5FYKL 5EO1B 3DECA 3C6LC 3QQ4A 4WTWA 2ZSWB 4HIJB 1IC1A 2Z35B 3LIZH 4X6FA 1QBLL 4Z7WF 2DDQL 1VGEH 4Y1AD 5EO1A 5CGYC 1RUML 1ZVSB 4DEPB 2IAMB 2OQJA 4XPGH 8CGTA 4KJWC 2XNAA 2ZSWA 3ZZ1A 4Z0XA 3BISA 1MQ8A 3HNSL 1FVDA 5ALCL 1OOAA 4V1DE 3ARBA 4ERSH 5T1KD 3QPQC 2IALA 3JXAA 2IAMA 5C09A 4ELKB 1OVZA 4KPHL 1F58L 1R3IL 1Z3GL 2VB5A 3MJ9A 3S35X 5GS0C 1YDPB 3D1MC 5T3XH 4V2CB 5C70A 1J1OL 1QEWB 5GGVY 3WXWH 5DK0B 2UY6A 2H8PA 1I9JH 2NY2B 4EN3A 2AXGB 3MLTB 4FXLA 2FBJL 4MA1B 2VDNL 4C58B 2V5MA 1U8MB 3HUJA 2VMFA 1MVFA 4NQSB 5EOTA 5EZLB 5I76B 2MCG1 3QWOA 4LCWB 2VXVL 1JHKH 4LHUD 1DJSA 4KRNA 4LSUH 4KU1A 5EBLB 4E41D 2HT3C 1EXUA 2XTLA 2MOVA 3FHQA 1JCKA 1LDPL 4LCWA 5I1LB 4LEXH 1GRWA 3D5OF 5EZOH 4EDXA 1WGOA 3MRRB 3AGVA 4P3DA 4F33B 4WFFE 4PJAE 4ODUB 4WI6A 3VFVB 3X13A 1KN4H 5DUMH 2UUDH 4GAJH 5D7LD 1DVFC 3AC0A 4F7TB 4ZS7L 4Z77A 3WUZA 4NGHH 2EXWD 4LAQL 4JY5H 1ND0B 1WAAF 2A6DA 2UZYB 4ODUA 4P2OD 5BS0A 1ZLVK 3DSFH 3HZVA 4FTVE 4KKNA 3ZMRA 1DCLA 5TE6L 1I85A 4LSVL 5E0QA 3FT2A 3BMVA 4RGNC 1EEYB 3DNKA 5I18L 5IHZA 5MP6H 2J6EL 4OZ4A 2AJ3B 5SX5K 1TCRB 4HC1A 5E1HB 4P4KD 1S5IL 3B5TA 1EEYA 2BNQE 4NQCB 4LLQB 5EU3A 1EERB 1LE5B 1MLBA 3GGWA 4TOYL 2AJ3A 3NPSB 5I1KL 1ORSA 1MFAL 3AY4C 1CFQB 2VLRA 4JG1H 3DXAB 3QXAA 4XWGL 2HLAB 2PO6D 1TFHA 3BP5B 3PDOA 4OSUH 1YNTA 1C1EH 5DLMH 1J0KA 1HINH 2FB4H 3GRWL 4WJ5A 3S37X 2MKLC 5F6HI 3P9WB 4DQOL 5FYKE 1IM3B 4PJEB 2B4CC 3S88L 5IIEA 4NQED 2DQTL 4HBCH 3BEWB 4L4TB 4XCEB 2HN7A 1JPFA 3GO1L 4DVBA 4H20H 4C4KO 4DN4L 2X9YA 1XR9A 1CDUA 2H2SC 3HLAA 1XF3B 4HFWB 3A6BL 1PSKL 5J11B 1LO2L 2R0KH 3QIUD 4ETQB 4OIIH 1IILE 4JZJB 3GI8H 5EORL 1Q38A 3AS0A 1IKFL 4Z7UA 2Z8SA 1P4BL 2AXJA 3GJFA 5C0IA 3RWDB 2GFBB 2ZJSL 4NRZA 5IG7B 3L5XL 4G6MH 4GLRH 4ZUUA 1BBJB 4J4PA 5EC1A 1BF2A 3SGJA 5CCKL 1GPOL 2FLBT 4U05A 1RPQA 3Q6GH 5DHYA 4GW1B 5DZNA 3AREB 2B2XH 4FP8L 1AI1L 3WSQH 3ZSTA 5SWQA 5D7JB 4CMHC 1U8HB 3GBMH 4JR9H 4XPAL 3HR6A 4KC3B 1SYVB 5D70H 3CC5B 2P49B 1G7LA 1JWUB 2EE9A 3B8YA 3K8LA 1RJZB 3FO9B 3OTTA 4G8IA 1H0DB 3OKEB 5ITFA 3D3VB 3WD5H 4RZCA 1HOCA 1KPRA 1J7VR 1FNSL 1G9ML 3FO9A 4ZAKC 4RISL 2Z92B 5H2BB 2F8OA 4Q6YA 1E4XL 1FZMB 3C2AL 3G6DH 4NC1E 2DWDA 1VSCA 2VDRH 5D1ZB 4RAVA 1OQXA 5HYIA 2NLJB 1OPGH 3RU8L 2O61B 3B9DA 1R5WA 3GIZL 1FG2A 2EYRA 5J6HB 4WV1B 3ARQA 4UNVA 1EJ6A 3FAWA 1CR9L 4TVPL 3REWA 1VFAA 2VITA 3PP3H 4Z7VB 5E6IB 4ZODA 2BY1A 2BCKB 1GSMA 2PYEB 5HI4C 3MLXL 1IAKA 2NMSA 4PB9H 4Z7VA 3FMGH 1QLEL 1D5IH 2DTSA 1KV3A 2W07A 4EI6B 2JE8A 2X1WL 2BCKA 2AV7B 3KPRA 1UJ3A 3MGAA 4MYWB 5J9PB 5F71A 4PGJA 4ODXA 4OZIB 3RPIB 1Q9WB 3ARDD 5C1MB 2L4OA 4HKJB 4OZHB 1R0AH 5B38B 2OJEB 2YBRA 3MRCB 5C0CE 3QA3A 3UTTE 4AEHL 1XGUA 3OGCA 4HS6B 3SJVD 5GRJL 5KW9L 1N3NB 1SEQL 4PJGA 1CCZA 3TN0B 4PLKD 4RNRB 4HS6A 2IADB 1UGNA 1PEZA 4G80A 4PRHA 1GAFL 2E7HA 1EMTL 3U0TA 1N3NA 2AV1B 2IC2A 1IAIL 2W9LA 4NUJB 1X44A 3WFBH 3BQUD 2X4TB 1JYXA 1XF2B 4F57L 35C8H 5H94B 5EUOF 3DX9B 2E9IA 1X5ZA 5KTEL 1HHHB 2X4TA 2D0HA 2Q86B 2PTVA 4BELD 4U1LB 5IR1B 4LSPL 2H9GA 4MQ7B 5DMGD 1BP3B 1LO5B 3OQ3B 5IK3B 2QSCL 5BW7A 4NJ9L 2CUIA 4HJ0C 4PJ7E 1YNKH 1INEH 4CADA 5TFSL 1KNOB 5IR1A 4IOIA 4MQ7A 3OAYK 1KTDA 3RPKA 3RQ3A 1B0GA 1UKQA 4Y8AA 2O5XH 1FO0B 3O81A 4S0SD 3QZWA 1PQZA 5K9JH 3F7PC 4HSQA 4TUOA 5C0GA 3X17A 1DZBA 1ZTXL 1KJ2B 5IVZA 5J6GA 3U9UB 5HYJA 4L8BB 3ZTNL 2W91A 1T0MA 1F4HA 3OHXB 4Y7MA 3TJEL 3UJTH 1PGRB 2IFGA 1BZ9B 3B8SA 3WXVH 1MCHA 2XWTA 4MNQB 2NZ9D 1SBSH 1RJYA 4RX4A 2DLTA 3L3OB 5DRXA 1ZLSH 5GS1C 4XNQA 2DQUL 5KN5B 1KCVL 5EBWA 2V2TA 4KKBC 3VWJB 4PS4L 1AFVH 4JO2H 2GJ6D 3EYFA 1FO0H 2VIRB 2QQNH 3RWHA 3F65A 1M7IA 4EDWL 4WWKB 1KJ2H 1MRFH 1U8OA 4K94H 5F9JA 3WFEL 2VIRA 4XP1H 2XY1A 2AXHA 2LU7A 4JHAL 1BQHA 3TYFB 4WWKA 4NQTA 1U8QB 3BAEL 3SBWA 5K9KB 1WVZA 2VABA 1TJHH 5IFAH 3FO0H 1UM5H 1E6OL 1U6AH 3QUML 3QIWB 2VZTA 3T65A 1UCTA 2OTWB 1AXSB 4Y16B 5K9QI 4POZD 43CAA 2V7NB 2Y4SA 2ZNWA 5DC4B 5FYLD 3QWRA 5I1AB 3DJ9A 2BHYA 1N0XH 1VESA 1G7HA 5ADOL 3ULVC 2EH7H 2FGZA 4QHNA 2NXYC 2D9CA 5FGSA 3V4UH 3VH8B 5T3ZD 3KYKL 3LH2H 5JIKA 5I1AA 3HG1B 3EO1B 3U6RA 5IHUH 3W9EB 1DN0B 5HHXH 3VH8A 5GGQL 4JFXB 4L9LB 4LLWA 5E9DB 3EO1A 3R0NA 3MRPB 1DN0A 4Q0XH 1A1NA 3ROOB 2Y5EA 3DVNB 2LE9A 3V52L 2GTZB 5HDQH 1GGCH 4Y5YC 1T80A 3GMQA 5INDB 1UC6A 2AGJH 2VWEE 1UWGL 3G5VB 4UQ2B 3IU3B 5ICXA 4Q7DA 4JZNB 3H0TA 1VEMA 4U1IB 1I1RA 2OTUB 3W0WA 3AS3A 4IS6A 4KKCC 4DZ8A 5IVXE 3DOSA 3HE6A 3WIFB 4JZNA 3GMLB 3N1FC 2EECA 3MV7B 2OTUA 1T66C 4BSJA 1OP5H 3OL2A 3GHEL 5F44A 2C5DC 3C60C 1T5XA 4KUZL 1IAOA 1TDQA 3PWVA 3C6LA 1A7QL 3C08L 4ZDHA 4RQQB 3D85D 4PGZA 1FNEB 2VLKA 1A1OB 2JLLA 3BD5A 4OCMC 1VKXB 4BFIB 2JJTC 1XAUA 1B3JA 1CXFA 4HCRH 1KPUA 1U95A 4EQ2A 5DJDA 1FNEA 2ZWLT 1A1OA 2WBWB 3LSOB 1KBGH 4OLXH 4F8TA 4GRMA 3RKDD 4RRPG 1LEIB 5AD0B 1T7XA 1TMCB 1MVUA 2E7MA 4S1SH 2PF6A 2IJ0C 3BUYA 2VH5L 3GBLA 4MVBC 3QI9C 1RJLA 4FQXD 3U46B 3ULVF 3BGAA 1CDBA 1G9NH 1OCWL 3FOMA 5AD0A 1AE6L 2MQ0A 1IKNC 1XGPA 3G5YB 4V1DB 5GJTH 4X9IA 4P2RE 4PD4K 5AYUH 4G6JL 1KG0B 3LDBB 3OR6A 1QSED 3VA2C 4IOFC 2NY4B 5IMLB 3FTGA 2EO1A 2R56H 5I8CB 3QH3A 1OAXH 3HNTL 3DETC 3CFDA 4XCNA 5BMFH 3LS4L 1NDGB 1CE1H 5IMLA 5L0QC 4AEIL 1PD6A 2FYYB 1ZT4A 2R0WL 4LHUG 2YHGA 2P45B 5F96L 4G43A 1NDGA 5KVDH 2FYYA 3EYQC 3ECBA 5JHDD 4HPYH 4M6AA 3RDTD 2E8ZA 3MV8A 4G9DA 1DVFA 4QXTB 5IV2B 4GS7B 1Q72H 2BVPB 3CJJA 4APQC 1Q9OA 2AW2A 3ARSA 1X4YA 1CZ8L 1LD9B 5TDOA 1T03L 4QXTA 1MIML 2XQBH 4PJAB 3ZKQD 3MBEB 3UTPE 5JPNA 3VXNA 1T83C 1S7SA 5K59F 4XAKE 3A6OA 3MA9L 5FUCC 3MGOA 4HUWB 4NUGH 2XN9A 5IESH 1LD9A 5CP3A 6CGTA 4M7ZB 1W0VB 4J3SA 1KLGA 5ISZD 2NTFA 4FTVB 4JFDD 1PKQA 2MWCA 4HUWA 4ELME 1TJIL 1QFWH 3SDXB 3IGAB 3Q3GB 1RURH 3TIEA 1VEOA 4BFEA 4WY7H 2H32H 2FNBA 5C08D 2HJKB 2BNQB 1XGTB 1QFPA 5IB3A 4HIHB 4ZSOA 5DD3L 1S7RA 4R9HA 1D5MB 5L9DL 5MHSD 2F5BL 4QCIA 1QD0A 3KR3L 4FQIH 4AM0A 4GKNA 4MJ4A 3SPVA 3MACL 1RZJC 1P5VA 5F93C 2X4PB 1A14L 4KVCL 4QRQB 4ZUVB 5CJ8A 5JA8B 4U1JB 4PJHF 7FABH 2J3SA 3QG7L 1GC1H 3BPCA 1SJVA 3BHBA 3IFPA 4KY1H 4NO3B 3KPSE 4X7CC 5IB5A 1CYGA 2QQLH 4MXQD 1OHQA 4OF5A 1FSKC 3FQNB 4M4PA 1DL7L 2EDOA 2VXSH 3OKLA 1WFNA 5C7XH 3LRHA 3U2SA 4RIRA 5IMOA 3FQNA 4QWWD 4X0KA 4MNGA 3HMWL 1UZ6E 2BP3A 5IFHL 2OJZH 4OCRH 3F7YB 5EPMA 3DMMD 4JPVL 2EXWC 4R8WH 4P2OC 1RIHH 2BOBA 3W39B 2ZUYA 4Y5XC 4I9WD 3MCLL 3L5IA 1IC7L 1G7IA 5FYKH 3EFFA 1ZA6A 2VZ1A 5C2BL 1L9NA 4P4KC 4ZAKA 1QBLH 2DDQH 1CDJA 3CMOL 4JFOA 1RUMH 5IW3A 3S34L 2ICWI 3UPRB 3TA3D 1HHKA 3HNSH 3PHQB 5ALCH 3PWLA 3IDGA 1UWEL 2XI9A 2A6KA 4I0KA 1OLLA 1FL5B 4ONGL 1S9YA 2APWA 5HJ3B 4PV8B 3UPRA 4KPHH 2VSCA 1F58H 1R3IH 1NCWL 3NABL 1Z3GH 4XRCA 2GT9B 4LQFL 3QFJE 4EI5B 1DDHB 2IH3A 4DGIL 1J1OH 1WC7B 5JOEA 1EVUA 4XBPA 4G7YL 5HTSA 4I5BA 3VA6A 5F89A 2E3VA 2FBJH 2VDNH 4GKZB 5D2LE 4S11A 1TETL 2OL3A 5E8OB 4H5SB 3QIUC 2NY1B 2VXVH 5HVHB 5E1AA 4MX7B 4HWNA 2KQMA 4GKZA 5JW4Q 2X4OA 2OMNA 3GMOA 3QEUA 2XG5A 1LDPH 4H25A 4YNYB 3SY0A 2GAZA 1MCWW 4XVTL 4OZFG 1WZKA 5ACZB 1X5KA 1FQ9C 1KELL 1ODAA 2DQJL 4F37K 2EEBA 3SDDD 1P4LB 1QFUL 4PFEA 1EHAA 4KJYA 1CD9B 4ZS7H 5D5MF 4NPYB 5MI0B 4M02A 1BFSA 5T5NG 4LAQH 1LEGA 5F7UA 5TE6H 3MRHB 4Y4FD 2C26A 4LSVH 5D1XC 1MQKL 4NFDA 5GSVB 5C0CB 5I18H 3WNPA 2ITDA 3UTTB 5F1NA 5BZDA 4O5LL 2J6EH 3MRHA 2MHAB 2J1KA 1W2KT 3LKOB 1S5IH 4XAWL 3ULUE 3ZE2E 4WRLA 3SKMB 3D39D 1I8IB 1KEML 2VKWA 5GSVA 5DYOB 2YPLD 3RZWA 1MHHB 4TOYH 5CSBA 2MHAA 3QXDB 5I1KH 1BPVA 1I4FB 1MFAH 3VXSE 3WN5B 3CX5K 1F11B 2DLGA 1RIUL 1T4KB 5HDBE 4XWGH 5DK2A 1INQA 1KB5A 2UYLB 5E2UL 4TYUA 3NCYP 2UZIL 1NGZA 3GSOA 1NJ9A 1IEBB 1IGYB 3GRWH 2D7TL 3PL6D 3PQYE 1DEEA 2H2PD 5CIPB 3HI1A 3T2OA 4KUCF 4DQOH 2X4SB 3CLFL 1ONQB 4X7SL 2QV2A 3S88H 1JNNL 2DQTH 2D7NA 1VGKB 4TTGA 3VXOB 3GO1H 4G6AD 2DQFB 4DN4H 3PV6B 1KXQE 1WQVT 3TBTA 3A6BH 1NBZB 1PSKH 4PJ7B 3WDJA 1LO2H 3HC0A 2EIZB 4D0CB 2DQFA 2CGRL 5EORH 1FYHB 4X7DC 3V4VL 1IKFH 1P4BH 3QUXD 4GAYB 1NBZA 1IT9L 3MRMA 4PLJD 2ZJSH 5F7KC 3WKML 3L5XH 2GTWA 1MCKA 4MNHB 3KXFD 5CCKH 5L2KE 4GAYA 1GPOH 3Q6FB 5GS1A 2XQYK 4CDGC 3ARDC 1BOGA 4LVOC 4FP8H 2GITA 5CIPH 2Q3ZA 5T1MA 1G9EA 1AI1H 3IDYB 4TULL 1J10A 3O4LA 4LEOB 1JPTL 2CR6A 1T1ZB 3D2UD 4XPAH 4U6VL 4YPJA 1A7PL 3FB6B 1F90L 3SKUD 1ZT7B 2ATKB 2BXYA 4LEOA 4X6CA 1FFNB 4G8EB 4PLKC 4NKQB 2F54D 1FNSH 1R3HB 1Y0LA 3WBDA 1G9MH 1CE6B 1ACZA 1JF1B 3HAEB 5KSVB 2BHUA 4YDKL 2K1MA 4RISH 3SE3C 1CICB 5EU6E 3ZE1F 1E4XH 3C2AH 1QHOA 1GJIA 2E6JA 1K2DA 1SMOA 1CE6A 4P23C 2F74A 5GSRA 1IGFL 4M62L 4L8CA 2R23B 1C08A 1NFIB 1FZJA 4QTHB 2NW2B 2P5ED 5K9OB 4GW5A 3RU8H 1A4JA 5FF6B 1J8HE 1RY7B 2IF7A 3GIZH 3MA7B 3VWKD 3DUUA 4HGKC 1CR9H 3DO3A 4TVPH 2NY0B 3TCLA 3T08A 1P2CA 2IPKA 1OTUD 1AGEB 1G7MB 1HSAB 4MD0A 4BA8A 3IRZA 4GRLB 4OM1L 2XWBB 4QRUA 5D7IA 4X7TA 3MLXH 3QNYB 1QLEH 4N0YL 4I4WA 4FQCL 3BWAA 3NA9L 3BW9B 2IANE 3PWPD 3QNXA 4MA7L 4Y5YA 4NO0A 2P43B 3IDXL 1HHJB 2ADGB 3B9KD 5F7YC 3TCXA 3BXNB 2NZ9C 5E99L 1XF5A 1KCLA 1RZ8B 5IBUB 1MCOL 3LB6D 3WO4C 5D96C 1F4WL 4X8JB 4AEHH 2A83B 4P2QE 4PJIE 1RZ8A 3NMEA 4X4XB 5GRJH 4YX2L 3VI4F 2QR0A 1ZEAL 5KW9H 3P9LB 1SEQH 1HSBA 6FABL 3C60A 1I7TA 1FYTA 5IKCA 4L4JA 4K7PL 2L7UA 4HF5L 4P5TB 3ILPB 3MUZ1 4U3HA 4EVNB 5IVXB 1GAFH 1EMTH 3P9LA 4HPOL 4RMTA 4L29B 4D8PB 4GG6F 1NCAL 2JJTA 1QYGL 1CFTB 1IAIH 5DQJA 2GJJA 4F57H 4HW6A 1OM3L 5GS0L 1RIVL 3L9RA 1V3LA 5LGJB 3EDFA 4NCC2 1PFCA 5KTEH 5FOBA 1A7OL 2IBZY 5F70A 4NKDA 3EZJB 4JVUA 3QDGE 1MUJA 4POZC 4LSPH 3BZFA 5LGJA 3SN6N 1NAMA 1HH9A 4KKLC 2QSCH 4NJ9H 4YBLB 3FN9A 3W9DA 2R0LL 1KT2B 1IKNA 5TFSH 4U0RC 2DIAA 4X5XA 4JZOB 2VUOA 3PUCA 1W72A 3S96A 1U8IA 4R7NA 5HSFA 2CO6B 1HN1A 2APVA 1X7QB 1ZTXH 3VXQB 4PJ5D 2JIXD 4J3VA 4S1DD 4P2RB 1BIHA 3BUTA 3ZTNH 3ES6B 4YHNA 3TJEH 3RZCD 1EUTA 3VXMD 2A74B 1IBGL 1Q1JL 4HLZG 5IQ9B 2VQUA 3QUMB 3VI3F 5ENWB 4MHHG 1T3FB 4QXUL 2GUOA 2WSKA 5D93C 2DQUH 2YN5A 3LPWA 5IQ9A 4LGSB 5I71B 4APQA 4CGTA 1KCVH 5IEHB 4LSRL 5D9SB 2G9HA 5I1EL 2DWEA 3S36L 4P46B 1HYSD 4PS4H 4U6XA 3TO2B 1MCJA 4IJ3B 5D9SA 1JZ7A 1T83A 1RHFA 1Z2KA 4XXCA 3FHAA 4EDWH 2F9BT 2K3TA 2RCSL 5A40E 1F3DJ 3WFEH 2G2RB 4YR6B 2WBJD 1WAAE 2KUTA 4PRNA 4JHAH 5HGDA 4JFQA 5KG9A 1SJHB 3BAEH 4HG4J 3IVKA 4Y1AA 1E6OH 1AO7E 2XFXA 4RRPA 3QUMH 3REVB 2Q7NA 4X9HA 4I18B 5D1QD 3RKDC 4QKXB 4OF6A 5T1KA 1M4KA 4UDTB 2UV3A 4KXZH 5SV4A 4ELMB 2ERJC 2YUZA 3EYOA 3NIFF 4FQXC 4LNRA 5ADOH 2QSQA 3KYOB 3O8XC 5FO7A 2VLMD 5CEYA 1HI6A 3DV4A 3KYKH 1AH1A 3CUPB 4XBGA 4R4BB 4K7FB 2KBGA 3QHZL 2X41A 5GGQH 4BH7B 1OTTD 1MAKA 3BGFB 3IU4L 1QVOB 4K7FA 5FYJL 1WWBX 4LHUA 5DVMA 3V52H 4IEFB 2DMCA 4Q6IB 3Q5OA 1UWGH 1S5HB 4U1KA 3KPSB 3BZEB 1A8JH 1AP2B 1P7QD 5IVNA 1N59A 4Q6IA 3NZHL 1AXTL 3CFIC 3V0VA 5D7LA 2FWOA 1S5HA 2Q6WB 3RNQB 4WHTA 4P2OA 5C9JB 3QIBD 4R26L 4QLRA 3GHEH 3RNQA 3KVQA 1IMHC 4KUZH 2MSPA 1DQJB 1A7QH 1V05A 1A0QL 3C08H 3I6LD 1RULL 5GRWA 5F88A 4P4KA 2VDLL 2W38A 2ZOKB 5MERB 1OSPL 1SY6A 2W1NA 1U58B 5FHAL 3P0GB 2LU3A 3MXWL 5LQBL 4NZRL 2LTQB 4RBPH 4J8RA 3BT2L 5MERA 1VCAA 1JNHB 3TIDB 3RX5A 3GSXB 1N0LA 5J1AB 4NHCL 2VH5H 2PO6A 1UKSA 3JV4B 4LCCB 5JO5A 2Q8BL 1OCWH 1TVBA 2AXFA 5DD6A 1S7QB 1XGQB 3GSXA 4JHBA 2V7HB 2GY7B 1AE6H 1UH2A 2E7CA 5IB2B 1U2CA 4NQEA 4G9FD 3S9DB 1AKJB 4G6JH 3FQTB 5K9QG 3UPAA 5JLZA 1MCRA 3OB0K 3QFJB 1EHLL 2XT1B 3QIUA 4D3CL 1AKJA 2C1OB 3LVEA 3HNTH 4RAUA 3LS4H 1JZ3A 3HZMA 5KS9E 5I16A 4AEIH 2R0WH 3MJ8B 4NQDD 4C56D 1NC2B 5F96H 4MXQC 4Z78B 2NXZD 5FV2A 2KZWA 4JY4A 5EO9A 3ARGD 4GBXD 3KWWA 4YIQA 4MB3A 3UDWC 1JUFB 3MJ8A 2JCCA 5D2LA 3ELAT 5ESQB 4QWWC 5KSAD 3PWUB 1JZ2A 4QNPE 1FLRL 1YC8A 4L3CA 2E5EA 4LPCA 1INDL 2XZZA 5IBTL 1CZ8H 4AYFA 3DMMC 1T03H 1MRDL 1MIMH 2K7PA 1UACL 2BJML 5FYJE 5HHME 4JRXE 4ZPVB 3MA9H 3MREA 2AQ3A 3FZUD 3NACL 3CH1A 1KB5L 4ZPVA 4XCFL 1DE4B 3MUGB 4F3FA 5DJYA 1OAKL 2BRQA 1TJIH 2W9DL 5DJ6A 4YEEA 4WI7A 4Y5VC 3TA3C 1OF2A 4L3EE 4MQTB 2J8OA 4JQXA 3L6FA 1JIBA 1AIFA 3WL9A 5DD3H 1NUDA 3GSVB 3QDAA 5EUOE 3NFNB 3VXSB 5L9DH 3VG9C 2F5BH 4EUPH 5HPOA 4U3CA 3KR3H 4X6DF 2GJZA 2Y1VA 3MACH 1IZJA 3BJ91 3NCEB 1A14H 4KVCH 3U83A 3KPQB 1I7RA 4QOKE 3QBTB 5T1LD 2RFXB 3PQYB 3QG7H 5HHPA 5IFJB 3K3QA 4QYOB 3TH2T 5IHLB 4YDJA 1E4KC 1OAYL 4OD2A 2CJUL 2QADD 2FEEL 3HI6L 3CXDL 2NX5D 4OZFA 4M5YH 3O45A 1XGRB 1C12A 1DL7H 1FORL 2XQYG 4PRDA 4J3UA 3ARDA 2YPVL 4OFYD 4FXGA 3R1GL 5E2WL 3HMWH 3ZKND 1K8DA 1FFPB 3TO4C 4NRXB 5IFHH 2R1YA 4M8QB 4N0CD 1NC4B 4JPVH 3SJVA 5L2KB 2RGSA 4KTYA 1LP9F 1U93A 4Y4FC 3MRBB 2NW3A 1KLFA 3MCLH 4DGYL 3BQUB 1NC4A 4LKCB 1IC7H 1JGDA 4K71C 4MJID 5D8JL 4F7CA 4XNYL 5C2BH 1XMWA 2ICES 1F45A 3VCLA 5IM7A 4UDUA 3BQUA 4U31A 1ZAGA 2HTLC 3ULVL 3CMOH 1NUGA 2I07B 2E6PA 5LWYL 1CGYA 4C55A 1BVKB 1LO4L 3S34H 1BZ7B 5E7FA 4ZTPL 5D71L 1IQWL 1UWEH 2H26B 3LKSA 1CLOL 4HDIB 3KYNB 1K3IA 3IS1X 4FQQB 4ONGH 1NCWH 3NABH 5EU6B 3ULSA 1T20A 4LQFH 3PL6C 2DS4A 3KYNA 5E6YA 5KSBE 2H2PC 1GOHA 4DGIH 2HFFA 1WBZA 3DVGB 1YQVL 4G7YH 5H35B 4IMLB 3FONA 3RL1B 2EC9T 5B22A 4G6AC 1J8HB 2W60A 1TETH 2GQHA 2B39A 1A3RL 2P8PA 4TUJA 3PJSB 3GHBL 2BVOB 1FCCA 4OGYL 2OR7A 5CMAA 4F58L 4PLJC 4XVTH 4Y4KB 3IDJA 1KELH 5I9QC 2F8VA 2DQJH 5SWSE 1ZT1A 2ZUVA 1VHPA 5CEXB 1E27A 3RWFB 2IANB 1QFUH 4BFBD 1NCBL 1IL1B 1NGWB 3AROA 5DVOA 3T04D 4LLMB 5I17B 3FO2B 3OKNB 4N0UA 3O3EA 3ALWA 2UVFA 3O6FD 4A2LA 4F7EB 2GJ6A 1IL1A 1U8LA 1MQKH 3FO2A 2P7TB 4NFCA 1GHFL 1EAJA 4H26B 4O5LH 1L0YA 2P5EE 4RFEB 4P2QB 4PJIB 4JO3L 2W0LA 4XAWH 1KEMH 2B5IB 4Y4HB 5DO2D 2Y25A 3FQXB 4H26A 1CG9A 1OAZL 3ROLA 3U7WL 2DKSA 4Y4HA 1RIUH 5AZEL 3FQXA 2DBJA 4L9DA 4JY6B 1Q9LB 3I9GL 1S7TB 2PNDA 5E2UH 2UZIH 1F6FB 4YPGB 2D7TH 4F8QA 4LLDA 1J12A 3Q48A 4ZO9A 5E03A 2CDEB 1R3KB 3CLFH 4PJBF 4X7SH 1ULVA 3VWKC 1JNNH 3QDGB 1CVSC 4V2BA 3SO3B 4G8FB 1OTUC 4R7DB 1XH3A 3CLEL 2CDEA 2NNAA 1NCTA 4YHPA 3NOIA 3SE4C 1BX2B 4PLNC 5J8OA 4LVEA 3MX0A 2GIYA 2CGRH 2NY5L 2VKXA 3V4VH 4RA0C 5MEQA 5DRNB 5I30L 4NT6B 1IT9H 2APTA 3WKMH 3FFCB 3CPLA 2Y06L 5BQ7B 2EXYD 2P24B 2M26A 3CFJB 3WNLA 3QUKA 4U1NA 4G8GE 1QHPA 5A16B 3B9KC 5DRNA 4WHYH 2UWEF 3K2MC 1QSFE 2C4FT 4G5ZL 2EE2A 4GKSB 3ZKXB 1BF8A 1CIUA 4PRAA 2GSGB 1UB5B 4TULH 3BGMA 4OFVA 1JPTH 4OZGF 2CK2A 4U6VH 1OL0A 2I24N 1UJTA 1A7PH 1NAKL 4HWBL 3NGBB 1F90H 5FA4B 4K07A 5EIVA 1UB5A 3ARPA 3OKDB 3J8F7 2O93L 4ZPTA 4MJ5A 5EBGA 3VXUB 1W0WA 2Q3AA 2ZUWA 4MAUL 1MHEB 5C6PB 2YEZA 1R6VA 3D85A 2MKWA 2DMBA 3GSRA 1I3RB 4JE4B 5FAAA 3G6JF 4AZ8A 4YDKH 2BXZA 4NSKB 5K59E 4J7RA 4N1CA 2ZKHL 5KJRL 4F7MA 4AENA 5BOZG 4GLRI 1IGFH 5F3HB 4OBRA 1LNUB 4M62H 4FQXA 2CDGB 3N50A 4U1SA 5CEZD 1MI5B 1AO7B 3DVIA 3L7FA 3HZKA 3DHMA 3P73B 1G7QB 1HCVA 1F3DH 1BD2D 2UVEA 3MRNA 3O9WD 3KJ4C 4IHOA 4OM1H 1QSEA 3EYVB 3UXFA 4YBHA 1V3MA 4N0YH 5B8CC 4FQCH 3NA9H 4S1DC 4MA7H 3K74B 4DFIA 2OYPA 3DRTB 1ZLWH 4PJHE 3IDXH 3RZCC 4DAGL 5GRVK 3PV7A 1BQSA 3GMMB 4N8VB 5E99H 3JTSA 5JHDA 1MCOH 3RDTA 4M93B 3WLBB 3UAJD 1F4WH 2XV6B 4E5XA 3HS0A 1RUQL 4R97C 3ZE0F 1F6AA 3QDJE 4S10A 3GMMA 4IRSB 4U1GC 4JFPA 5A1AA 3GMPB 1CGWA 4YX2H 1EBPA 2CXKA 4O02L 4AEFA 1ZEAH 4MLSA 5CILL 6FABH 1IM9D 4GMTL 1KCSL 5H37H 4HIEA 5HDOA 2CLZB 1VACB 4K7PH 4HF5H 4OBSA 4CUCA 1AHWB 1HQRB 3NAAL 1V3JA 2D31A 4HPOH 1FRGL 1NCAH 5F7HA 1QYGH 4ODTL 5ISZA 1EO7A 3ZTJH 4JFDA 1C5DB 5ID1B 3I75A 5DVKA 1OM3H 1AHWA 5GS0H 3H7LA 1F02I 1RIVH 4HXAL 3RAJL 1NFDA 1WSST 1V7ML 4QF1A 4FQ2L 3DHJA 2IQ9L 1A7OH 1J5OL 2X09A 5ID1A 2OZ4A 5C08A 4R4ND 1TITA 4OKDA 5D1QC 5CD3A 5I66A 2GW5A 2XKSA 2FSEA 4Y2DB 1VFMA 2R0LH 4OLZL 1EFXD 4I2XE 1PZ5B 2BVQA 3EGSB 2Z31C 4CRPA 4PBVC 1SJXA 1JTOA 5KZCB 1YEDA 4Y2DA 3ZDZF 5FKAA 1X3DA 3BPOC 1F42A 1CFBA 1JGLL 2G60L 2NY6D 4NYLA 1WCBB 3WEXB 1IBGH 4AQ1B 1Q1JH 4R96A 4DUXA 3H3PL 3UDWA 4QXUH 1X5FA 2EDTA 5ESVA 1JYWA 3R0MA 4PJFE 5IQ7L 4MD4B 4U6HB 4LSRH 3JBG7 3Q0HA 3L3GA 4BQ6A 3RIFK 5I1EH 1MCPL 3S36H 1BOYA 1T6VN 5KS9A 1FVCA 4EOWL 2X4UA 3DMMA 5CJBA 2MFNA 4Z7QF 4LBEB 3SKNA 1LP9A 3NA4A 3QIBC 4LRNL 4UV7L 3V9FA 4D94A 43C9B 1CFSA 2RCSH 3G5ZA 2MPAL 4N9GB 1XF4A 2GSIA 2X44D 5T3XD 1FFQA 2HRLA 2Q7YA 2XA8L 5HHMB 5DK3A 4JRXB 4N9GA 4WFED 4YHZL 4Y5VA 3EKCA 3TA3A 4QHUB 2ZOLB 3OAUL 4PJCF 5D2NA 3HE7C 2YA0A 1NH6A 4QXWA 2CLRB 1OARL 4HV8B 4OF3A 4P4RA 4CDHA 2IAMD 3NPZB 4L3EB 32C2A 1K8IA 3MV9E 1Q94B 4AL8L 3WNOA 4OCYL 5J12C 2GK0B 3IFLL 4LNVA 5EUOB 3QHZH 4L3EA 3WLWD 3IU4H 1Q94A 1E4KA 1QA9A 2HVKB 5FYJH 1QTYT 3HRZA 1NBYB 4QOKB 3MJ6A 4ZUWB 4R0LB 2NY2D 4ORGB 3SGDI 1GZQA 1MFEL 1ERNA 4LQ1A 2ADFL 3C5SB 4RWHA 3CSYB 2NXZC 1K4CB 4GBXC 3SDDA 4LCWD 4ZNEE 4R0LA 4ORGA 2BSRA 3NZHH 3RNKB 1AXTH 2O26U 5A43C 4YHLL 4XP6L 5J13C 1LILA 5KBNC 4BSWA 2VNCA 3PWNA 5IB4B 3TJHC 4IRJB 2V2WA 4Y4FA 4QRPE 4R26H 5FK9B 1NEZG 3WFDL 3QG6B 3QISA 3VG0L 5INCA 4DOHB 1I1AD 4OGXL 5JDSB 1A0QH 1CFNA 1UWXH 1RULH 2FIKA 5FK9A 1RFDL 4HUNB 2VDLH 2J8UF 3FZUC 3QG6A 1OSPH 3D39A 5FHAH 3VFNB 1CT8B 2YPLA 1CK0L 3X14B 2D7PA 3MXWH 5LQBH 4NZRH 4X80L 3BT2H 1DQQA 1HNGA 1CXLA 4KHXL 4OCSL 4N90D 1CT8A 1F5WA 4RSVA 4NHCH 3TNMA 4M6ML 1BAFL 2BSTA 5JPMA 2AI0L 4NQCD 4ZFGL 3VFPB 5FB8A 3PL6A 4N5EC 2Q8BH 3B9AA 3T3PE 2HT4D 1M05B 1YUHB 5ALBL 2NX5E 4TNWF 5LBSL 4KJPD 4J2XA 5EOCL 3RUGE 1H5BB 1KIQB 3DXAD 4IBLT 1NPUA 3FRUB 1FCGA 2DM3A 3RGVB 1Q9KB 3VW3L 2WBKA 2QEJA 5KSBB 1EHLH 1MCSA 4D3CH 4OD1L 3RVTD 5FM5O 4MA3B 3DV6B 1J05B 5C0AE 3QUXA 4L4TD 5KSBA 3DLQR 2QADC 4KK9D 4YDVA 3W2DL 1H3XA 3T0DA 1AGCB 3O11B 5GISL 3N0PB 3DX8B 5DJXA 3HI5L 3KXFA 5AZ2L 2C3VA 4HGWA 4X98A 5I74C 2UWEA 4KRLB 3D0LA 4LOUD 3PGCB 3DTXA 5TF1L 4OD3L 3BKCL 1FLRH 4JDVB 3D2UA 3LRSB 1INDH 5IBTH 2VXTL 4N0CC