4P2RD

Crystal structure of the 5cc7 tcr in complex with 5c1/i-ek
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
199
structure length
196
Chain Sequence
GDQVEQSPSALSLHEGTGSALRCNFTTTMRAVQWFRKNSRGSLINLFYLASGTKENGRLKSAFDSKERYSTLHIRDAQLEDSGTYFCAAEASNTNKVVFGTGTRLQVLPNIQNPDPAVYQLRDSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
source organism Mus musculus
total genus 39
structure length 196
sequence length 199
chains with identical sequence I, N, S
ec nomenclature
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rD02
3NGBB 2NXYC 4WUUD 1MJ7H 1W2KT 2AV7B 1TDQA 4U1GB 5MENB 1NAMB 4HJGA 3L1OH 3B43A 2VDLH 4PJEB 2FIKA 5GS0H 2X1XR 1G9MC 2VLRE 3OBAA 5E99H 4BH7B 2V9TA 3KHQA 3MODH 2HTKD 3B9KC 1VFAA 5DUBA 5HHVL 4J3VA 1FE8H 2P5WB 3EIFA 5GZOD 5M94B 2XXMB 1EEYA 1WAAA 1D5IL 1NUDA 3GHEL 4MCYB 3JWOH 4EUPG 4DKFH 1EFXB 3PIQA 3BAEL 5GS3A 5TF1L 1Q9KB 3VGAC 4ACPA 4Q58C 5F21B 5IB2B 1MREL 4NCC2 1YA5A 5E5MA 5JIIA 4KI1A 5ESQA 4D9QE 2A73B 1XCQB 4U6HB 1JGDB 4PJ8A 1N64H 1I1YB 5DFVC 1BZ9A 1NDGB 4IRSC 3VI3E 4H5SB 3TNMA 4Y4HC 5BMFL 2R8SL 3WHXB 3U30B 1HCFX 4RAVB 1CFQB 1TMCB 1F4XL 3QWQB 4U1JA 5DD5L 4L4VE 1CICA 2B1HH 3CVHB 4ONGH 4Z6AT 4FQQA 43CAB 1S5IH 2L7UA 3RTQD 5SX5K 5DHVB 4M5ZH 2CDEA 4CJ0A 4PGCA 2XWJA 3RUGB 1YEKL 1BZQK 3TT1H 1S9YA 1YEEH 4K3JH 5FDWA 3MO1A 5I30L 3KPRE 4LSRL 5FM8A 1Y18B 4GS7C 3T2PA 2KQNA 3DUUA 5D8JH 4ZDHA 2FX9H 5ID0A 2AEPH 4P3CH 3LRGA 5K59E 3O41A 1CE1H 3RWCB 1UQSA 4LVHC 5HHOB 3L3IB 2Y36L 3F7YB 4OKVB 3OKEB 4Y5VC 3MCKB 5MEQB 3IKCA 1KN2H 1P69B 3V8OA 5F3HB 4G80B 4FABH 3IXTB 4DTGL 4M5YL 5BCAA 1QP1A 3ARVA 4L4JA 3RX7A 1YMMD 4AT6A 3GKWL 2JELL 1JHTB 1G1CA 5D6DA 1B2WL 4RFNC 4UIKL 1KLGB 5FGSA 3OAUL 5E56A 3T0ED 5DRXB 4JKLA 3CSPA 1KUMA 4N68A 1KG0B 4XXCA 4PRAA 3HB3D 2VDKH 4L4TE 5E8EB 2ED9A 5GRJH 3CDGA 3MRHA 5TE7L 1A3RL 4PLOB 5IW3A 1KJMB 3QEQD 5D7JB 4PJDE 4LLUB 3LKQA 1NDMA 4Z7QF 4KTEH 3L7EB 3A6CL 4I0PA 3V6OA 2QQKL 1HHIA 3B5HA 1U3ZA 4JO3L 1PG7X 5F9JA 3PWUB 5F88B 5JHDB 4HHAB 2XTJB 4OV5B 3WIHH 1H0DB 1DCLA 3RTQC 1HHHB 2JCCA 3ALXA 4HG4K 2I9LB 3VD3A 2DYPA 3UZQA 2XN9B 5J7CC 3GJEB 4LAQH 1F3JB 2CMRL 4ODTL 1KN4H 2VQ1B 4OQTL 1SMOA 4OLYL 2FBJH 5FHBH 5TGBB 3IFPA 4NRYB 1FYTE 1XZ0B 5ERWA 5I8OH 1U92A 3T2QA 5F96L 2DI9A 1AHWB 4WWKB 1T7YA 1T1ZB 1P9MA 2VAAA 4MWFA 1T83C 4JFHE 3G04A 4NO5B 4B0MM 4NZUH 4FG6D 3L3GB 1DBBL 4ETQB 3B9VA 3MRRB 3W5MA 1QLRA 3GK8H 5CZKA 3T3PF 3VD5A 4QT5A 4YFEA 1AJ7H 2A83A 1KIRB 7FABL 2HFFB 1G9EA 3T8XA 1CR9H 4RFEB 1E4JA 4XRCB 4H1LA 4UT6H 4G7VH 5T33L 1JWMB 5IROC 5SX5H 5E95B 1I1AC 4JZJA 1S5HA 1VGEL 3FB5A 4PJ9B 2N56A 3SPVB 4M1GL 4OUOA 1FG2A 1KF9B 2W65B 2VZOA 5FAAA 3GB7B 1WEJL 1KSRA 2DWDB 3KYKH 4L3EA 1AC0A 2MHAA 5HI5D 5CJQH 4H0IA 1XF4A 4UTBL 4YEFA 3T0EC 5ESVA 4A6YB 1FVDB 3CFCL 5I1IH 1SJHA 4OM1H 1YPZA 5ADOH 3MUGA 1TJGH 4OZGA 4PRHD 2VJXA 4O2CB 4IOIA 2NNAA 5E9DE 2E7BA 1FL3B 2OJEA 4Y16A 1KCSL 2BP3A 2XQBL 1LO3L 5DZNA 4OIIH 5HVWA 4N9OB 4M6NL 1TTUA 3FOLB 3DUSA 3C5ZA 1RJYB 3QXDA 4NIKB 3WHE1 4Z8FH 4LLYB 3WD5L 1C08A 4NP4L 3ZHLA 5CJOL 4X7TA 3QDMA 5K9OA 2AXGB 2H2PD 4HFUH 4HJJL 4Z76A 4J12A 1GAFL 3BP7A 3IDXL 3E0GA 1LK2B 1OP3K 2X70A 4Z7OF 4LSDA 1FZKB 5IB5B 1WLHA 2H32A 4LHUG 5DK3A 5GGQH 5B38G 3QRFM 5BS0D 1UM5H 5A16B 5DJ8B 2YUXA 3U2SA 2VLJA 4LDLB 2WANA 5C0CB 4RSVA 1PKQE 3SKJH 2X4UB 3L3HB 3G6DH 3MV8E 3JZ7A 5ICYB 4MGXA 1HSBA 5C6TL 4PBVC 4R26H 1U8OA 4UZGA 4NRXB 3UYOD 4P3DB 1EERB 4WHTB 2L4OA 1SEQH 4Z7UE 4O58L 4F33A 3MBEA 1FO0H 3VFUB 3RY5A 3LZFH 4N9GA 1PDKA 3MNZB 4MXWH 2K3TA 2OXGA 1MI5A 4WY7L 3IDJA 2PCPA 3UTPD 1MRDH 1U42A 3GM8A 4PJFE 1ZLSH 1UB5A 3DVGB 3MR9A 3I02A 4TSCH 5T3ZL 3U46B 4DKDC 3KHOA 3G08A 2Y07H 4Y1AE 4TUJB 5DD1L 5HI5C 5IJKA 2BNRE 3NBNA 1CU4H 1F4AA 4HUVB 2C3HA 1L0YA 1HI6A 5C86A 1GHFL 3TV3H 2AAVA 2B8OT 1EXUB 1VA9A 2VMFA 4GRMA 4R4FH 5ETUA 5KS9F 2FX8H 3FT4A 3FRPA 5BQ7A 1A6ZA 4LQFL 5CWSA 1KJVA 4RGMB 2NR6D 2IG2L 2Q6WA 1P5UA 1INQA 4FQPA 3F12A 2YD1A 1P7KA 1JHLL 3LS4H 3SJVD 3THMH 4OSUH 2ENYA 2Q86A 4F57H 3LKNB 3N85H 5KAQG 1RIHH 2XKSA 4LBEA 1IGTB 3O0RH 5I15H 1QPXA 3MLVH 3UTSB 5T3ZE 2AK4A 3B83A 2H2PC 2V5SA 1B88A 4FFZL 1TZGH 4TULL 1DQDL 2EC8A 3FO9A 3WIFA 4ONHA 1H15B 1RU9H 4NBYB 1A6WH 1A6VH 2HAZA 2WQ8A 3MBXH 4YHOH 4LHQB 1TJHH 2ZOKA 4PB0H 4GAYA 3V7MA 4QNPE 1N2RB 5J6HB 5FYJU 5FOBB 4JEGB 5I74C 3DARA 3ZYOA 2N7BA 3ZTNL 4ZXBA 3W0WD 1H5BB 4JFYB 3MLWL 3MNWA 1NCCH 1GZPB 3HI6L 4P5TB 4IMKA 4ODXA 4BH8B 3EKCA 4KTDH 3DIFA 1M7DB 4PJ7E 1CL7I 4JKWA 1UWEH 3O2WL 1WZ1H 4ZS6C 4Y4FD 5C3LD 4HS6B 4P0DA 1KPRB 3E8UL 2DQJH 3MGTA 2BY1A 5IESH 4XBEL 1IGYB 1U8PA 2DJ4A 2HFGL 5IMOA 1CE6A 1G7MB 1UB6B 3CPLA 5J4MA 1GGCL 1DSFH 4NBZB 1HDMB 5BVPH 4CL7A 4WV1B 5ALBL 1OP3H 5HHNB 3QDJE 4GO6B 1QA9B 3LKRB 1F8TH 3NIDF 2LAGB 3T2NH 1CXIA 2EC9T 4PYHA 2CQVA 3E6FB 4PREB 1BQLL 4WJ5A 3I3DA 5FYKU 5GGTA 3LDBB 4K7FB 3BZ4B 5IW6A 4GT7A 3MXWH 2ADGA 1VCAA 3VH8G 3CLFH 3B9AA 4ELMF 2DAVA 4YK4C 4G42A 3ULVL 3M17B 4BQBA 4UTAH 4OCLC 1BJMA 5IKCB 1JNLL 1LNUA 1JJUA 5GIRA 5KSBB 3QUXB 4DKAA 5C8JB 3BW9A 2I07A 3WFCH 2ESVA 2XFXB 4ZNCD 1JZ7A 2R4SL 4GXUM 4HKBA 4NQCA 5H94A 3S97C 2NR6C 1QSFA 3BGMB 2YKLL 3GRWH 3RKDC 4M6OH 4PRBA 2VSDA 4XMLL 1PZ5A 3BXNA 4F80A 5CJ5A 3NCFB 4LDEB 4G5ZH 3DOSA 4QY8A 4GQ9H 1PQZB 5A43C 3X14B 2W0FA 4QHKI 4CN6A 2XWBA 4P3WA 5EIVA 3ECBA 4KKBC 1Z6JT 5D93B 3ZKMD 4KJWD 5DA0B 5JNYA 3VE0A 1F6LL 4QRUA 1IKFH 2IPUK 4KRPB 4WNQA 1JTTA 5AYUL 5L8LB 2VLKE 3HCVB 3PL6A 3SEPA 4JPKH 5JIPA 2G2RB 1HCVA 2ATPA 1I1CA 5JW4Q 3SHSA 2NXZD 1BFVH 3O3AA 1A1OB 1OARL 4J4PD 4U6YA 5AUMA 3TBYB 3S3JA 5IB3B 4Q97A 2VDPH 1SY6H 5FUCE 3C8HA 4YHYC 3QCVL 3O6ML 4CRPA 4V1DB 3SKNA 2OXHA 3Q48A 3D9AH 3D5OF 1FVEA 2ICWJ 4TPRH 3X12B 3H0TA 4U7KA 1J8HB 2WV3A 2C3VB 1BWMA 4NQXB 2D4DA 1MUJA 2BMKB 3NZHL 1C5BL 3GI9L 5GGSA 3TP4A 1BFOA 4GMTL 1NMCC 4TVPL 2F8OA 3TA3D 4YJZL 4LLQB 5KSAA 2P5EE 3QH3A 2RJMA 2VH5H 4EVNA 4XVJH 3CIQA 4Z95L 2VXQL 3IJSB 3R0NA 1T80A 3UJJL 1VESA 4S10A 5DJYA 1IEAA 4ODBD 3QR2A 1NH6A 3U9UA 3V4PL 1AGCB 5DTFA 5IFJA 1FNSH 2Y5TB 4WHYG 3EYQD 3U1SH 1NMBL 3L5XL 3VFVA 1HIML 2GIYA 1H3VA 2EDXA 3S4SG 2ARWA 5AWNH 2I5YH 3F7VB 2ARJA 2COQA 1QKZH 4APQA 4EBQH 4TVPE 4KHXH 3RHWK 1ORSA 3V4UL 3ZKMC 1N8ZA 5F7EL 4MA3A 4LNRA 3C60A 2EO9A 1TETL 1H3TA 2Z8WC 4PUBH 3DI3B 1OQOA 3QI9A 4JRYE 1KPVA 5E6IB 3RIFF 3QP3A 1D5ZA 3S3SA 2CRYA 4Q9QL 5C9KA 5FIEA 4BELD 3OGCA 4ZO9A 3HZMA 3F7RA 3O3BB 5AZEH 1IAII 3MLYH 3E6HB 3CSYB 2FEDD 4KQ3H 2ZOLA 3PWVB 4K3EH 4PR5B 1A1NA 4L4VB 2BVPA 3ZSTA 3ULSA 2AJ3B 3KJ6H 4WEBH 1BD2D 3UYPA 3CXDL 3DV6B 2PXYC 4XH2B 1HXMA 3EO0A 5JPNA 1FAKT 3HAEH 5EU3B 3QDHA 3QNYB 1C7TA 1MQKH 4NC0B 1G6RH 3C5JB 4HIXH 2X05A 3RQ3A 5KS9A 3KPRB 1MJ7L 3FTGB 4HZLA 1NGXA 2VDLL 5EU6A 5IHBA 3BH9A 5GS0L 4PJXF 1QFPA 4Z77A 1T7XA 4OUUB 5E99L 2IANB 1PJ9A 3O81A 3MODL 5ACZA 1K8DA 3BQUA 4JFEE 2BVEA 2KUTA 1NAKH 1Q94B 1S7TB 5DXWA 1NEZA 3N1QC 5TQ0H 1FE8L 3B9KA 4YPJA 2IBGA 3JWOL 3MRNB 4X6CA 2VDQH 4DKFL 4EDXB 4MJIE 3IVKA 3MFFB 5IMLB 2FJFB 5CGTA 2F54E 5C7XH 2Y1VA 4NFDA 3EYQC 2VL5A 1RZ7H 3ARDD 4FTVE 5D7IA 4HKJA 1N64L 3G6JE 5ANMB 4G8GE 3UBXA 1ORQA 1AIFA 5T3XD 4XZUB 5A2JH 3SKOB 4LSPL 3BDBA 1ZGLA 4HQQH 1XGRB 3OKKB 4L4TB 5DHYA 1Z3GH 4U1IB 5CJXA 4IRSA 4DZ8B 5DRNA 4Y4HA 4Z7VF 1IGMH 1JI2A 1AO7B 1T2XA 3EDEA 3WN5C 1K3IA 1HZHH 4HUWA 1T03H 1XF2A 2B1HL 5B39A 4ONGL 3ZO0A 1S5IL 2A6IB 1CGSH 1WIUA 2UZXB 2YD3A 3GBNH 4JFDA 3MNVB 4M5ZL 1SBBA 4OGXL 2FEDC 2D7MA 2OZ4H 2KPNA 4LCCB 1QLEH 4JB9H 1TQBC 4K3JL 1NGZA 3GM0A 2IFFL 5SWZE 3PP4H 2FZ3A 3P4MB 4MA1B 2APVA 4ODWA 2IPTH 2MWCA 2GSIB 4QYOA 2YN5A 5HVHB 1FV1B 4ELMA 3MRDB 5C0EB 4XAKD 2BNQD 2FX9L 2AEPL 4P3CL 1BJ8A 1W72B 2IADA 4R8WH 5EC2B 1X4XA 2OR9H 1XIWD 4KI5E 1I9JH 4MAYD 4UQ3A 1J12A 1FYTB 4P2QD 4MQSB 4UV4H 5JOFA 1UGNA 2IGFH 4KK8D 4WUUA 3OKNA 1S9XA 3X17A 3LVEA 5CEYA 2P8LB 5JQ6H 1KN2L 4H8WL 3G6AB 4Y5VA 1H3WM 4FABL 1YUHB 1JF6A 5GS2D 3FQTB 1AE6H 1F58H 2VXVH 3KXFA 5AG8A 5D96C 2JTDA 1U3HC 1MHHB 2XWTB 5IOPA 3S35X 3QO1B 2EICA 2V7HB 3EBAA 2KZWA 4JLRB 4WIQA 4E41D 2VDKL 4ZUUA 3VWJB 2UYLB 3PE9A 5GRJL 3S96B 4HULB 1U8HB 3TT3H 2ID5A 4P46D 4AIZB 1IC1A 2GCYB 1Q9LA 2WSKA 3RIAF 4J1UA 3DVNB 1X5JA 4KTEL 3ILPA 3BHBB 4JDZA 2IH1B 5BOZG 5E9DB 2X4RA 1KV3A 2DMCA 4X6DF 1RZ8B 1WUNT 5I9QC 4FQIH 4C55A 3MJ8B 3OKOA 1SJVA 3K2UH 2B0SL 3WIHL 4JFQB 2EKSA 1BIIB 3EJYD 5FFLA 3PWPD 4NC2B 5DQDH 1N4XH 3V0VA 1G7QB 5L2KB 5EBMB 3LN5A 3VXMA 4ZO8A 4YAQA 5GZND 5HDOA 4AENA 1MOEA 4ZNEE 2V17H 1F6AB 1KN4L 3JWDL 1S7VB 2FBJL 4PRDA 5FHBL 1N5AA 3CFJB 3GMQB 4K94L 5I8OL 1FJ1A 3IXAB 1R0AH 5HY9B 4PGEB 1ADQH 1F6FB 3K4ZA 1EHXA 3V52L 1UZ8A 4NZUL 4PJHA 4MB5A 3LN9A 3DXAE 5FA3B 1WC7A 4MAYC 1T83A 2BX5A 4U1SA 5EUKB 3GK8L 2ZUWA 1IJ9A 1AJ7L 2R2BB 4ZFOB 3HMWH 4M7ZC 1S8DA 2IWGA 5CP3H 5I1DB 1CR9L 1IGCH 4PTUB 2CUIA 3M07A 2P8PB 4U6TA 4G7VL 4UT6L 3HI1A 4ZQKA 5BRZA 4JZNB 3S5LA 3VRJB 3MRBB 5IROA 3VFMB 2C1PA 2EYRA 1I1AA 2HKHL 3OKLA 2J8UF 4F9PC 3VI4F 3EYOA 3KYKL 5LAXB 1F02I 4G8IB 3C6LC 3FQWA 1T20B 4XP5L 5CJQL 3UP1A 1YMMA 4PJFB 2JK5A 3QUYB 4G7YH 5DDHB 2JLLA 3RPIB 4H20H 4BKLA 5K9QG 3FMGH 4QHLA 5I1IL 1HQRA 1HNFA 5KVFH 5ADOL 1KIUA 3GSOB 5D7KD 2O61B 1F11A 4U6XA 2MSPA 2XKUA 1ROWA 3FQUB 4N5ED 5DMKA 4P46C 5IG7A 1Z9MA 4WFHD 5JORA 5LXGH 5ITFB 1LP9F 4MZ3A 4OIIL 4ONOA 3D69B 5I1KH 5F9DC 3QEQA 8CGTA 4A2MA 1RZJH 3GIVB 5K93A 1MNUH 4LP5A 2DICA 3ULVD 4Z8FL 3S88H 4P4KB 1EHAA 1WCBA 3LQZA 3SCMD 4U0QB 3JUYA 1IILE 3IDIA 4HFUL 3T65B 2E3VA 5CSZB 5EORL 4HMEA 3G5YB 1YNLH 2X4NB 5DO2D 3EJYC 3RZWA 3DV4A 4BQ8A 3VGFA 2HJLA 5MEND 1RZIB 3VFRB 2VZ3A 4PJBE 1QFWM 4PJXA 3KPOA 3MJ7A 5GGQL 1MFDH 1WFOA 1AQDA 4OZHF 1UM5L 4UV7H 2BFVH 4HWUA 2Y25A 3CUPB 4X99B 4AM0B 1V05A 5L8JB 1TITA 3VXRA 4LCWB 4NQDB 3SKJL 5HYSA 4D9LH 3G6DL 5DYOA 3MOBH 2P5WD 5E2TH 2X4SB 3AU1B 4R26L 5J9PA 3PHSA 5ICXB 1BBJA 1EFXD 3DETD 3CJJA 4C56D 5I1GH 3L7FB 3MUHL 3VDCA 1SEQL 4KKNA 3L3JB 1FO0L 2ITDB 1Q0XH 3LZFL 4MD4A 5ACLA 1T6WA 4MXWL 1HILA 2W9LA 1TVDA 1MHCB 3PXJA 1IAKA 1JMXA 1MRDL 2FWOA 5TPWH 1LO4H 3IETB 2H2SD 2BOBA 1RHHB 1OM3L 1ZLSL 4NPYA 3KJ4B 3OKDA 1M1SA 1WFNA 3IDYC 1OCWH 3TCXA 2FECI 4TSCL 4GRWF 1KB5H 2VZUA 4MD5A 2EEDA 3BO8A 25C8H 4KJPD 1OF2A 2Y07L 2XPGA 3MRIB 3ZDZF 5HGDB 1CU4L 3BJLA 3RWIB 5FK9B 1UXWA 4AH2B 4Z7VA 1G7LA 4PJIF 3MRPA 3IFNH 5IGXH 1MCOH 3ZKQD 4CMHB 1EBAA 3F62A 4I0KA 3TV3L 2HMIC 2G5RA 4NJAH 4R4FL 3WO4C 4CBPA 2FX8L 1DP0A 5AAWA 4N5EC 4PRHA 4DK3A 2HRPH 3PJSB 3IDGA 4JY4A 4JO1H 4L8SB 4HUMB 5HXMA 4LCYB 1J87A 5DK0A 3LS4L 3THML 4BSWB 4OSUL 1N5YH 4U7SA 4F57L 3ULVC 3FFCE 3M1BB 3N85L 4QWWD 4WO4B 4P5MA 1RIHL 3QXVA 3O0RL 2IALA 5EZLB 4AZ8A 5I15L 4N8VB 3MLVL 1ZHNA 3SCMC 4OAWA 3SDXB 5I8CA 4P23B 1OQXA 2QR0A 5GQBA 4FHBD 4HGMA 1LEIA 3RFZC 1A6VL 1CTOA 1CZ8H 5HHOD 3O2DH 4YHOL 3BUTA 1ETZB 2NTFB 5D5ME 1KCLA 3D18A 3D85B 4U1MB 1TJHL 1ZA6B 4PB0L 1RZGB 2ZPKH 3B2UD 5HI4D 4LSSL 2AJUH 2QKIA 3Q5YA 2ADFL 4K71B 5C07B 1U95A 1YEDA 1MHEB 1ZVYA 2BXZA 2P7TB 3PP3K 2Z35B 1NCCL 5FUOH 4YWGH 4PIRF 4OCRH 1M71B 5BS0A 3NIFF 4RGNE 1B3JA 2CIKA 3RVVD 2H6PB 3IU3B 4KTDL 4NQUA 1T5XA 1UWEL 1WZ1L 2V2WA 3DETC 1RURH 4XC3H 4Y5XC 2VLKB 4AIOA 2WIIB 2DQJL 3D3VA 3HC0A 4XP6H 5EPMB 5DF0A 1FZOA 5IESL 3P0GB 2CLVB 3T0AA 1DANU 3KYNA 2YPLA 1P1ZA 1H3GA 5CINH 1IARB 1R5VA 1SYSB 2VO5A 1JZ5A 1DSFL 5BVPL 2OMBA 2CUMA 4RCAA 2EYTA 4QRQA 5D7JD 1F8TL 3ESVF 1YJDH 3O6FB 3T2NL 1IRAY 3L6FA 3T77B 2JKXA 4S11A 1VGKB 3RDTA 5LGJB 3MXWL 5DRWA 1I8MA 1PG7H 5FKPA 3AREB 3CLFL 1VFMA 3MC0A 5JHDD 2XTJD 2YSSA 1LD9A 3D0LA 1EVUA 4UTAL 4WFED 2HTLC 3WFHA 2OR8A 3NCJH 1NFDB 1GIGH 3TYFA 3WFCL 2FJGA 5IWLC 2YPVH 3MJGX 4LCIL 2XZQH 1EDQA 2PR4H 2XN9D 1QEWA 2GTZB 3LH2H 5C09A 2GKIA 4U1KA 1CF8H 4N0FB 5BV7H 1W8OA 1FCCA 3GRWL 5IUSA 4M6OL 3O45B 1JIBA 2B4CH 3OX8A 4QWWC 4PGDA 4F7EA 2X42A 4LNVA 1I3GH 2YOCA 4M3KB 4WWKD 3SJVA 4G5ZL 4K8RL 4UNTA 2QHLA 4U1HB 4JM4H 5IEHA 4GQ9L 1NCTA 4RX4A 5KN5B 5DJDA 1BOGB 4JGJA 4LVNB 2H32H 4RQQB 5E2UH 1P4LA 3ZDXF 1DBMH 4KWUA 4FZ8H 3BDYH 3V5HA 5HI4C 3B2UC 4NQSB 3KR3H 1IKFL 3SN6N 1KNOA 3DRQB 5MHSE 3UAJD 2ZUXA 3GSVB 4H1LG 4CUCA 2YMXH 3NABH 2R2HB 5EOTB 4JPKL 5IHZA 3IFLH 1ZT7B 4PJ9D 3RVVC 4ZFFB 5C0IA 1BFVL 3IDMB 2KBGA 1NCWL 1EAPB 5J13C 4PFEA 2VDPL 3HR6A 4ZTPH 1SY6L 1U8LB 3T04D 1ZHLB 3D6GA 3MOQA 4XI5D 4NT6A 2GITA 1ZK9A 5GGRY 3RVWC 3D9AL 4CW1B 3FOMA 5CLTA 4TPRL 1QQDB 2FYYA 2QQNH 2VLRA 4HXBH 2Y72A 4LLAA 3AUVA 5D7JC 2XYCA 4EUPB 1AXTH 1LDSA 1T21B 4PGBA 5CIPA 4F8QA 4FQ1H 3SQOH 4KMTH 5GS1C 4QXTB 2ZUTA 5D7LE 5JW5A 2DLTA 5I1CH 4JN2B 2V6HA 3PP3H 4MD0B 3DO7B 1AD0B 4NC1E 5C0GA 2O5YH 1GGUA 2O5ZH 3RGVD 1TPXB 2EEBA 3DGGA 4OGZA 1U8KB 1ZANH 1S7RA 2VH5L 3RWEB 4XVJL 5GS0C 4PJGF 3ALPA 1YECH 3B9EA 3IDNB 3BEVB 1BAFH 2RGSA 1OAUL 2EE6A 1BVZA 5FGCE 4U1NA 1FNSL 1IC5H 2YA0A 4OZHA 2E7MA 3BMVA 1QR1B 3U1SL 5C0CD 4Z78A 4G8FB 4PG9B 2EIZB 3RNQB 1S7SA 4H0GA 2VDMH 2BRQA 3WE6B 3ZT7A 5C0AB 5AWNL 2F54B 2I5YL 4PBWD 4UIMA 3CZJA 3CMOH 2IJ0C 2PW2A 4EBQL 1N26A 3ORJA 1NKRA 3D2UB 3DURB 4KHXL 1JUFA 4R0LC 4QRRD 3CC5A 3EYUH 4FTVB 5EO1B 4G8GB 4PUBL 3E1F1 4JJHA 3TCLB 3ROOB 3IU4H 1GSMA 3G5XB 5DQ9B 1KBGH 1KT2A 3EOAB 1HYSD 1L7TH 3ES6A 4WEMB 3BPCB 3GMOA 2NZ9D 1NGWA 5AZEL 1QACA 3KPPB 3MLYL 3I3BA 4HWZA 4MA8H 2V2TB 1T1XB 4KQ3L 3UC0L 4K3EL 4F7TB 5EU7E 4L8CB 3WJLA 3KJ6L 3S9DB 4WEBL 4D8PB 4I13B 4B50A 1Y6MR 1FL6B 4PRNA 1J1XH 3H3PH 5IMKB 3ZKSD 2BVUA 1Q1JH 2DQFA 4U0RC 2EDFA 5B8CA 2RHEA 3MV7E 3O9WB 2A74A 3KLHC 3DX7B 1MQKL 2PXYA 1MLCA 3GMMA 1G6RL 3EDDA 1C7SA 1RK0A 1MCLA 3FRPG 4HIXL 2J2ZA 5SWZB 1CD9B 3MRMB 1HKLH 2VOTA 1NC2B 1HHGA 2UZIH 4G9DB 5GRWA 1RMFH 2BZDA 3DROB 1WZMA 2VR5A 4KKAD 5HJ3A 4BUHA 1WBYA 1CGWA 3UTSD 4R7DA 1NAKL 1JGUL 3BKJH 1IKNC 5ESAB 3RGVC 4TSAL 2OQJB 3GUTA 2VDQL 2HLAB 3GJFA 5DI8A 5I1LB 3TFKD 2G5BA 4H88H 4X6EA 4H8WC 4YHLH 2AJZB 4OF8A 4PJDA 5KW9H 2Z31B 5C7XL 5EUOF 5J1TC 1TVBA 4LLDB 1RZ7L 3BGFB 3ARGB 4P5TD 5EO0A 4RAUA 4ZYKA 3WO3B 3RVTD 4XMPH 4O51B 3BZEB 1KLUA 3OGOE 3V5DB 3WNOA 4NKIH 3ME0A 3VCLB 3X3GH 3B2VH 2CUHA 4XPHH 4HQQL 4U7MA 1NUNB 1Z3GL 4AL8H 1TFHA 5KBNC 3BH8B 1IGML 1HZHL 1EIBA 3QUZA 1T03L 2RFXB 1HYSC 4ZTOH 2NY3B 3JUZA 1QFUH 1CGSL 1ZOXA 3WN5A 4JQXC 1ULVA 3GBNL 5IF0B 1G1YA 2NZ9C 4KZDH 5CSGA 4WFGE 4JFXB 4WW2C 4S1QH 2OZ4L 1M6OB 1HH6A 1QLEL 1YEGH 3EZ8A 1X5YA 4JB9L 3I6LD 4XNZC 4CVWA 3PP4L 4Q2ZA 3ARFD 1BD2A 5KOVC 3ULVF 1DN0A 5CEXA 4UUJB 4GAJL 3QUXD 4R8WL 1ES0B 1S7UA 1I9JL 1KJ2H 4NOFA 2R56H 4P5KA 5DJCA 1J05B 4UV4L 1H8NA 3JWDC 5F70A 3ZKND 2IGFL 1BJ1J 2OYPA 4PJEF 4K94C 4YGAB 1FL5B 4KKAC 3QIBD 4X0KB 5JQ6L 1AKJA 5ISZB 3B4NA 5IM7B 3QIUB 1MFBH 3IFOB 5E8NA 5J11B 1AE6L 1F58L 1N59A 2VXVL 4YDVA 1L0XA 4NSKB 5C08E 3TFKC 4KDWA 4OM0H 4XCFH 5KOMC 5JXAH 2Q76A 3QCUL 4FMFA 1U3HA 4LKXA 4JE4B 4YHPB 4JFFA 2NLJB 1JF1A 1T1WA 4XP4H 1EAJA 3EDJA 1ND0A 2VITA 4O00A 1NGPH 3TT3L 3RVTC 2BY2A 2ARJQ 4LKCA 3INUH 1JNHB 4I5BB 4FFVD 4JM2C 1EA9C 4J8RB 3TIDA 3OJ2C 1TZHB 4LHUB 5B38B 4IRZH 1E6OH 3TJHD 3O3DA 3OHXB 4FQIL 2UUDK 3N1GC 1F45A 3K2UL 1N0LA 2K1MA 4HD9A 4W4NA 4WV1C 1JWSB 2Z4QA 4M1CD 4QXUH 1J8HD 1N4XL 5DQDL 3HE7D 3HRPA 1WZLA 5BW7C 1PKQA 2N7AA 5C0DB 4LEXH 3LDBC 3MV8A 1A6TB 1Z5LA 3DSFH 5IJVA 1OW0C 4OV6F 2R15A 1RUMH 1BFSA 3ARFC 4JGUA 1JZ6A 1R0AL 4Z7UA 1CL7H 1FN4A 1ADQL 4M43H 3HPLB 3UDWC 3QUXC 4U3XA 3H9YA 1GXEA 4DAGH 1YEIL 4MCZA 3X13A 2WNGA 1LGVA 1A7PH 3VFOA 4I3SH 4MSWB 4I18B 1MWAB 4MAYA 3HMWL 3EYFA 4P2QA 2X7LB 1IGCL 1PBYA 3H7BB 3QIBC 2AGJH 4JFOB 1AY1H 1T3FB 4XCCH 2Z92B 3D39E 4OZ4B 5JUEH 1S9WA 2DKUA 3FQRB 3KPLA 4W6YB 4Y1AA 5FYKE 2BNRA 1U8MA 3BP6A 3F7QA 5L88L 2DIAA 4L9LC 4D9QD 5CGMA 4YDLB 2PETA 3QDGE 1NFIA 5JIHA 5F71A 4LGSB 5FKAA 4G7YL 5F1IA 3I2CH 1CBVL 4H20L 3C6LA 4HUNB 3FMGL 1HH9A 1RJZA 2I25N 2W60A 5D6CA 1B0RB 2GJJA 4GKZA 2WWKO 4UDUB 2A9NH 4HGWA 2BHZA 2XY2A 5AD0A 3LKSA 3U0TB 4Q7DA 1K9TA 4UOJA 4DKEH 4ETYA 3C87A 1ZSDA 4E41A 4PB9H 1JFQH 2R0ZL 5LXGL 4FFVC 5TDNB 2CKBH 3BP4B 4QTHA 4P46A 3TNNA 5I1KL 4ZUVB 1WAAE 1Q9OB 1CDGA 1RZJL 2LAAA 3BEWB 1MNUL 1EO5A 4PJ5B 1G7PB 1JWUB 4WHDA 2K7PA 3TJHC 1F90L 5BZWA 3S88L 2NY0B 5JOPD 4X4YB 4BFIA 2DJSA 4WHYH 2FIRT 3PQYE 1P7QB 4LASH 5FCUH 1YNLL 1ZT4B 2HVJB 3KPRD 2H9GA 4M1CC 1DLHA 5EIIA 5A3ID 1RJCA 5DHXB 1J7VR 3HE7C 2DS4A 3L95A 1OGTB 2IMNA 5TH2B 1QRNB 5FO8A 4Z5RB 1MFDL 4PJ7A 2IAND 4UV7L 2BFVL 3RIFK 2P24B 3CFDA 4K8RD 1AXSB 5MEPA 4HCRH 3FB6B 3VW3H 4CMMA 5H2BA 4D9LL 1J10A 1NEZG 1UVQB 3JSSA 4OZFA 3MOBL 2EDHA 3MA9H 1OSZB 1RSFA 4GXVH 5E2TL 2HJFA 4G8EB 1IAMA 4J3UA 1TNNA 4MMXC 4AK1A 4KJYB 1OP9A 5I1GL 5FYLD 3D1MC 2GW5A 1T0MB 3LCYA 3RWFA 1Q0XL 4U1LB 3VH8B 2CDFB 3MPCA 2OL3B 3RWHA 2UUDH 1T4KB 3CH1B 5HHPA 5T5NF 4OD2B 3LQAC 3S36H 2XIDA 5EUOA 2JB6A 5TPWL 3ARZA 1LO4L 1D6VH 1ZA3B 3UBXG 3WFZA 5EN2B 1OCWL 2JJUA 3RAJH 5D2NC 2X4QB 1KB5L 1A8JH 4L4TD 25C8L 2XZCH 1INEH 1K2DA 4NNYA 4F7PB 1FFOA 1AO7D 3TO4B 3IFNL 5B39G 5IGXL 1MCOL 5MEOB 1WBXA 4YBLB 4NJAL 4KJQD 4X5XB 1E27A 1Z9LA 4ZPTB 1UZ6F 4Y2DB 3WJJC 3BWAB 2HRPL 3REVB 3ALWA 4JO1L 4RDQF 4ZUTA 2A6DA 4NN5B 3KLAA 4LHJB 5J56B 2MCG1 3K81A 5I1HH 1OTUD 5IIEA 4EDWH 1DVFA 4OFVA 1N5YL 3QISA 2VRAA 1R3JA 1VADA 3ZE1E 1E28A 4L3CA 4FS0A 4NO0A 2V9QA 2R1YA 3Q5TA 5L6YH 3O11A 2D9CA 2YK1H 2YUZA 5D7SH 5A3IC 1RV6X 1CZ8L 3VXUE 3O2DL 4LLMB 4YXKH 1F3RB 5KG9A 2YPKA 4PJCE 3GI8L 2ZPKL 4UU9B 5F7WC 2AJUL 3H9SB 2CIIB 3CMGA 3P9LB 2EXYC 3ARUA 4K8RC 1WK0A 2E5EA 12E8H 3CCHB 3VGGA 1IAIH 2VKWA 4JJ5A 4YWGL 4OCRL 1FLRH 5JQHC 3MMEA 2X9XA 1KEMH 3HC3L 4X7FC 3SO3B 3T4AB 1RURL 4XC3L 1M7IB 3S35H 3K8MA 4XP6L 4QRTB 2HFEB 3SDCB 2W0PA 1HSAA 4C56A 3MRLB 2KQMA 1IBGH 2W9EH 4JN1H 5C9JA 4Y5XA 3FT3A 1U93A 3HRZA 1Q9KA 4XVUD 5FA4A 4PY7A 5CINL 4EN3B 1PY4A 2Q7NA 3VWJD 4KXZI 5IVXB 1WTLA 3QO0A 1UXSB 5TQ2H 3C5SA 1DEEB 1YJDL 1GGTA 4OIBA 2VN7A 3TVMB 3ZHKA 2QLVB 3VRIA 4N0UE 2P5EA 5KSUA 5T5FH 3B6SB 4XX1E 15C8H 1PG7L 3TPUA 2WBJB 4QXWA 4KDVA 3MRGA 2FO4B 3QJFA 4F8TA 2BSRB 4H26B 3NCJL 4YHIB 5D7LB 3S4SB 2UY7A 4KJQC 5GRZA 4IRJD 5L2KD 3L3DB 4OLZH 3C8KB 2XZQL 2IPKA 2PR4L 1KEGH 3LH2L 3W82A 1CF8L 3AXLA 3DX6B 2R2CA 5BV7L 5IWLA 5D70H 4HC1H 4Z7WE 3PNWB 2EEAA 2B4CL 4L3EE 1I3GL 2NYYD 4X6FB 4FQCH 1JL8A 2IBZX 5L2JB 2NY2B 4X4ZA 5SWSA 1UACH 5CJ8A 4ZO6A 5JPMB 3VXSA 4JM4L 1KPUA 1GGIH 3OF6D 4WW1A 2V7NA 2P8MB 3KYOA 3C2SA 1BX2B 4JRYA 4HBQA 4JQIH 3RIAK 5E2UL 2G9HA 1DBML 2BSTA 4FZ8L 3BDYL 4DFIA 1WV7T 4M62H 4KV5F 4J3TA 1L4IA 3KR3L 2EDNA 3QFDA 4R96B 3FFDB 4XBGB 3GHBH 3MCKA 2E6JA 2J7LA 3NABL 3VXPB 4YE4L 2V2XB 1JNNH 3IFLL 3MRCA 4AJ0A 3AMLA 1JN6A 5DURB 1RZKC 3CU1A 3HS0A 4DVBA 3S37H 1QPPA 4OFDA 4PRPB 4ZTPL 3OTTA 1BHGA 4K55A 1JPFB 1FH5L 2K7QA 4PV9B 1U3JA 3RWDA 4B5EA 4JRXA 4HKZA 2MQ0A 4M48H 3QULB 3HA0A 5E1AB 5FECA 3BUYA 3WL9A 5K9JH 1CFNA 2VIRA 4KUZH 2QQNL 2VLJE 4HIIA 4HXBL 5GHWH 4I9WE 2D7TL 1AXTL 2GT9A 3NCYS 4FQ1L 4JFEA 3SQOL 2H3NA 2OTUA 3MV7B 3BP5B 4KMTL 3HZVA 2ICES 5D2LB 3UTQA 4JDVA 2AEWA 5I1CL 1BP3B 3BE1H 2J5LB 5GS1A 2O5YL 1UM4H 5DJ6A 4TNVF 4MJIA 3UEZA 4BZ2H 5AEAA 5T1LB 2JJTC 1MI5E 1ZANL 5C71A 4IRJC 5KSBF 3CH8A 4B7IA 5FDYA 3O6LH 5ALCH 4OFPA 1YECL 5I71B 4CU8A 1NUGA 2I9LA 1BAFL 4K2UH 4FQHB 3G6JA 2H1PL 3P77B 1I3UA 5TFSH 5L7XH 3VFGL 4CNIB 4X8XA 1IC5L 4JREB 2DQDH 2FL5B 1ZAGA 2WZPD 4GW5A 4LCWD 2X09A 2F74B 5C0RH 2NX5E 1CT8B 4HLZG 4NQDD 5HYSG 5DJ2B 3I9GH 3MRQA 4FQXB 5F8RC 2VDML 2FHBA 2I26N 3DX9B 4ISVA 2A6JA 5FO7B 3UTTB 3CMOL 1FZJA 5T1DH 4G6KH 5HGBB 1MIEH 1RZFH 1V3LA 3QUMH 3IJHB 4FN0A 3P30H 1OAYH 5DVKA 5ENWA 3FRUB 1IQWH 3EYUL 4XXDB 1DQQA 2LFGA 4R0LA 5DK2B 5FF6B 1FNEB 1A14H 4BSJA 4IS6A 1FFNA 3IU4L 4LARH 4MXQD 5I66A 4XAWL 1L7TL 3ZE0F 1I4FB 3G5ZB 3K80A 3VXTA 1D6EB 4QRPB 3ZE2F 2EDTA 2NW2A 3H42H 2A6KA 4LPUA 2AK4E 2W07A 3WIIH 1DZBA 2BVQA 4L9DA 1MCQA 2R0LH 1U8JB 2XI9A 3NACH 1YDPA 4JRWA 3TIEA 1J1XL 2PYEE 3H3PL 3IKKA 1BJ1H 3SY0B 1MHPL 5IMMA 4MQ7B 4IEFB 5CFHA 1QBBA 5C2BH 4O2CA 5EOQH 5CKGA 2EDLA 5IB1A 3U4EA 1TQCC 1HKLL 3IAPA 2H26B 4NO3A 1D9KA 1I7RA 4A2LA 2UZIL 1RMFL 2FX7H 3O4LE 3H9ZA 4R2GC 2YD8A 5JTWA 4MNQB 2ZSVA 3O2VH 4CVXB 1RJYA 4LEOA 4P23D 2FGWH 1A7BA 3LD8C 3BKJL 5IBLD 2OS7A 2VLLB 3CLEH 4NKDB 4OJFH 3KYMA 1IKNA 4XVTH 3D85D 1E4KC 3RGVA 4MHHI 5L0QB 5M95B 5ACMA 3D0VA 1CFBA 5DC4B 5C07D 5EBWA 4YHLL 4UQ2B 5KW9L 1CLZH 4Z7QE 1VERA 2VL4A 3MREB 1DQJB 1XGPA 1ZHKA 1YY8B 2D31B 4XMPL 4LPXA 3CFEA 4OT1H 1O7SA 4PTTA 1QSEA 2IFGA 4NKIL 3X3GL 2VLKD 3B2VL 2UWEB 4XPHL 1NGYA 3SGDI 2Y06H 4DZBB 4JY5L 2D0HA 4AL8L 3WS3B 1P5VA 2ESVE 4WHTA 2VNCA 1A47A 4IDLA 3CGTA 2GYSA 4NQCE 3MQIA 4ODUA 5ELIA 4QRRA 3MRKA 4LCUA 4ZTOL 1QFUL 3W11C 2GUOB 4HV8A 4ZNEA 4UNVA 4KZDL 4UAOB 4S1QL 3Q6FA 2EDEA 4JQXA 3VA6A 1G84A 4ORGB 4POUB 5GSRB 1YEGL 1KIQA 2R29H 1ZGLP 3MROB 4WW2A 3EJZD 5D1XC 2OTPA 4KTYA 3ARED 3C6SA 4GJTB 2BCKB 3DXAA 3EFFB 2GHWB 1M05A 2PTTB 4QHMA 2AW2A 4CMHC 2B5IB 3T3PE 1HWGB 4AQ1B 1W0WB 5CIPH 4UT7H 1LVEA 1XH3A 3WIHA 4Y7MA 2Z91B 5I17B 1WZKA 4MJ4A 1KJ2L 1BVLA 5I75B 1I9IH 2R56L 3MTRA 3PHQA 5ICZB 5CBAB 2WP3O 1OOAA 3V6BR 5I1EH 4KY1H 4XPTL 5I8KH 1F13A 4G43A 5D1QB 5E1HB 1LEKB 1GOGA 4GRLC 4NQVA 1I9RH 1RJLB 3VFNB 1T0PB 4X9FA 1WWAX 1MFBL 5EU4B 3FZUD 1W8NA 3OG4B 3RJQB 2EECA 1FZMB 4OFYD 1XCTB 1KCKA 4R4NC 4OM0L 4XCFL 5JXAL 4QOKB 1AR1D 1D5XB 4LFHD 4XP4L 3RBGA 4KKCD 1MAJA 4QLRA 1A9BB 2J6EL 3HG1D 1A2YA 1NGPL 2DLHA 4KRMB 3INUL 3GBMH 2FIKB 2HKFH 2VLME 2X4PA 3QPXH 1FQ9C 1E4XH 1QBMH 1I7UA 3PGCA 4JM2A 4IRZL 1E6OL 1KGCD 1NC4D 2ZUUA 4Z7OE 5DUBB 3RVXC 2VE6A 4PJBA 3B5GA 3T2OA 1EEYB 3MRFA 1A3LH 4HZAA 2HT3D 4Y8DC 3OKYA 4QXUL 4GRWH 1HDMA 3PIQB 4RWYH 2R8SH 1TCRA 4PP2A 1RZJC 4OTXL 4JKPH 2QJDA 5F7KC 2VDRH 5FCSH 2DLIA 3EJZC 3DSFL 5E5MB 3R06A 3AREC 3BISA 2W0LA 5FGRA 5ESQB 3AS2A 1RK1A 2ADIA 1CGVA 2LV4A 4OLUH 1OW0A 4PJ8B 3OXSA 1BZ9B 4EQ2A 1BQHA 4K3GA 4M43L 2GJ6E 2MQCA 4GUPA 3ARFA 2PYFA 4DAGL 3KNBA 5HI3C 2EZ0D 3TNMB 4X8JA 2ZNXA 4NN6B 1A7PL 5I19H 3OL2A 4I3SL 4XP1H 3E3QE 5DVMA 4R97B 3OSKA 4ODSH 2C1OA 4U1JB 3U36A 1CICB 2AGJL 5EBLA 1AY1L 4XCCL 4FQQB 2HH0H 1X5HA 5JUEL 4UNUA 3QIBA 5C0AD 2CDEB 2YN3A 4PGCB 1EJ6A 2F54D 2XWJB 1B90A 1X4YA 5I76A 1S9YB 3D2UD 1MEXH 1FSKC 2C4FU 3MO1B 4IOFC 4M6AA 5FDWB 4FTVD 1R3LA 5KS9E 4L9LA 1FO0A 2A0LC 3I2CL 3GSNH 3RZCA 3DUUB 5EU6E 1S3KH 3IDUA 1WFUA 2A9NL 4ZDHB 1OGAD 5ID0B 3BPLB 3O41B 3HN3A 4DKEL 1TLKA 4PB9L 2JELH 1JFQL 1UQSB 3FFCA 2DM3A 2R4RH 4UIKH 3WDHA 3MUZ1 2CKBL 4LPTA 3IKCB 2BHYA 4AEFA 5GGUA 4O2EA 4NQTA 3O9WD 5D5MA 2QEJA 4ORZC 5TE7H 5DS8A 4LSTH 4LASL 3VXOB 5FCUL 2B20A 2BXYA 5SWZD 4AT6B 3U4AA 5F97E 1T89C 1OWRM 4YEEA 3QNXA 1R3HA 3HE7A 4IDJH 2X41A 4W70A 4F3FA 5A2KH 2F8XC 3DGCR 4FQ2H 4PRAB 1ZHBA 4K7PX 4HCRL 1NANI 3VW3L 3V6FA 3CDGB 3HE6B 3MRHB 5DMIH 4LOUD 3MA9L 1T66D 4GXVL 4XP9H 3W9EA 1V3MA 2XZAH 3LKQB 4KK6D 1NDMB 3OR6A 5L8KB 4I0PB 4S1RL 1F4WH 1HHIB 1MRFH 3MRJA 1A7NL 4KQ4H 5F9JB 4YR6A 3NIDE 2Z31D 3STZA 1JK8A 3S36L 3ARGD 3QXTA 2BK8A 3GSUA 3QEUA 1D6VL 3C08H 2JCCB 2X9YA 4BSVA 1DBBH 2DYPB 4UDTA 3OJVC 4ELME 3RAJL 3T09A 2XZCL 1INEL 4MNGE 2ZWLT 5D2NA 1T7WA 3IFPB 5ERWB 3P73A 1U92B 4LVOB 1FCGA 1UKTA 4WUUE 3BD4A 4MWFB 2VAAB 2FNBA 3UO1L 3G04B 3P11H 1YJDC 5GGVH 4PJAF 4OF5A 4S2SA 3SE3C 5T3XH 1MFCH 1QLRB 3SDDD 3H3BC 1J0HA 4QT5B 3K74B 1I8IA 2A83B 5I1HL 2WBWB 3CSYA 4F58H 3WJJA 3T8XB 4EDWL 4PR5A 4YC2C 3ARYA 2IBZY 4H1LB 2KZ1B 1FNHA 4NNXA 4P2RA 4JZJB 3OAZK 1S5HB 2VXTL 3FB5B 5L6YL 2KH2B 3R8BB 2YK1L 3VGHA 1FG2B 4UB0H 3QQ9D 5D7SL 4L3EB 3RHWF 2NY4B 2MHAB 1PYWA 4YXKL 1H8OA 5DD6A 1XF4B 3T3MF 5IQ7H 2B4CC 4JZOA 5ESVB 1JI1A 1SJHB 1A02N 3GRWA 1YPZB 4L1HA 3MUGB 4OZGB 3Q6GH 4HJJH 3FN9A 5ISZD 4EQ3A 12E8L 3JBG7 1IAIL 4DEPB 1FLRL 3QIUD 2NNAB 2V5MA 3M8OH 4ZUSA 1TNMA 3OKMA 1DQML 2PUQT 1KEML 1T66C 2OJEB 1B4RA 5LKNA 1KLFA 2I27N 4MQXD 5IR1A 5DC9B 4HX1A 3KWWA 2ATKA 2B7DT 3DUSB 4YHMH 3C5ZB 3S35L 3CFBA 3QXDB 1IBGL 2W9EL 2Z93A 4JN1L 1FGNH 1C08B 3VXME 3QQNA 3CXHJ 4X7TB 4F9LC 3QDMB 3HR5A 5K9OB 5EOCJ 4Z76B 5IVOA 5GXBB 1BVKB 3BOVA 5DWUH 1F2QA 3TH2T 1ZWIA 4PPTA 5F3BA 3BP7B 1MCPH 5HDLA 5TQ2L 3WUWA 3WS6C 2X70B 5GS2H 3JVGC 3ETBF 4LHUD 2H32B 3GMPA 5E8OA 5T5FL 5E4EC 1EUUA 1SY6A 3U2SB 2VLJB 4NN7B 2P44B 1R5WA 1ERNA 2ERJB 4HK0A 4PGZA 4YGVA 1CLOH 4NKMA 3IGAA 4DZ8A 3QPQC 4YUEH 3NZ8A 1HSBB 1T5WA 3UZVB 5J1SC 1U8OB 4RMQA 2I9TA 5FM5O 5C0ND 4OLZL 1KEGL 4F33B 3MBEB 4HWEH 4ZOEA 3SDDC 2PTUA 4N9GB 5D70L 4HC1L 1IC7H 4J23A 3LKPA 4L8DA 4XWOD 1MI5B 3WLBA 3IDJB 2PCPB 5H37H 2FRGP 1GHFH 4FQCL 1YMME 1UACL 3P4MA 1YQVH 3SDXF 1UB5B 1GGIL 5C0EA 1GOHA 3DUHA 3I02B 5IV2A 3QQ9C 3PHOA 1ZKAA 3T0EE 4JQIL 2YWZA 3GSQA 32C2A 5SWQA 2WK2A 5DUMH 3G08B 2BHUA 4M62L 2VISA 2PO6D 3BKYH 3VD4A 4OFKA 1YC7A 4GXUN 5HPOA 3NFPB 4WI4A 3WFBH 4KMLB 1HI6B 3GHBL 1J8KA 3QEQE 4GRMB 4TULH 2Y4SA 5ETUB 4ALAH 1JNNL 3FT4B 3QIUC 5AZ2H 5BQ7B 1A6ZB 4O5LH 5CWSB 3DBXA 4MQXC 5J11C 3VDBA 1KJVB 2Y7QA 2Q6WB 1VSCA 1INQB 3S37L 5J6GA 3F12B 1F97A 1P7KB 3FQTA 3VXNA 2EE2A 2D7NA 2Q86B 5F9AC 4M48L 3OAZH 3QCTH 4LBEB 3C09B 3KS0H 3HI6H 3TBTA 3R4DA 2C7UB 5K9JL 4PJXE 3FO9B 2V7HA 3EOYG 3OQ3B 3WIFB 5B4MC 4ONHB 4KUZL 1JBJA 2IBBA 4U33A 5GHWL 4LF3A 5JMRA 2ZOKB 4MNHA 1S7QA 4FZEH 4GAYB 4PJ5D 1QR4A 3U0PA 5E0QA 3BE1L 1KCUH 4LLWA 4ZXBB 1GGCH 3I6GA 1DL7H 5JHLH 4AG4H 1UM4L 1CXFA 3I85A 4ODXB 1P7QD 4BZ2L 3HAEA 5JDSA 3DIFB 3REWA 4AQOA 1AGBA 1NBYA 2EDYA 2X40A 1QD0A 1NFDF 3IF1A 2XKNA 3O6LL 5ALCL 4DN3H 1QRND 1VFUA 3MYJA 4IRJA 4KROD 1U8PB 5IMOB 4K2UL 3MGOA 2YD5A 1VHPA 4ODVH 5TFSL 1CE6B 5L7XL 4W4OC 3CPLB 3ULVH 1MCRA 2DQDL 1U8IA 4QHUA 1P4BH 5C0RL 3NA4A 2P42B 4OZFG 1K5NA 3I9GL 1U8QA 2WINA 4XCYA 4Z7VE 4WJ5B 5J89A 5CEZD 2VQUA 5T1DL 4G6KL 1CDCA 3MGAA 1MIEL 1RZFL 1NAMH 3QUML 3EOTH 3P30L 1OAYL 5EA0H 1PLGH 5IW6B 3STLA 2P49B 1IQWL 2PO6C 5JW4M 2ADGB 4PRHE 4TUKH 4XMLH 2ZUSA 4G42B 2P45B 1A14L 1T7VA 4LARL 2CD0A 1LNUB 1KCRH 5GIRB 4X5WB 2E9BA 3BW9B 2I07B 4URTB 2ESVB 1MELA 1QSZA 5CLWA 1UEYA 2F9BT 4HKBB 5CBEA 3H42L 4NQCB 5H94B 2N1KA 3WIIL 1QO3A 1QSFB 4ZOCA 2R0LL 3NACL 2QQQA 4HS8H 4PRBB 3RL2A 1PZ5B 3BXNB 2DM7A 1H3PH 3V8CA 3ARPA 4RMUA 4QY8B 1JPST 1NCDH 1FNGA 4P4RA 2W0FB 1UEMA 1KIPA 5C2BL 1EEUA 4Y2DD 2XWBB 4HIHA 2OX5A 1IGJB 4PJAA 5EOQL 3DTXA 2YEZA 3ECBB 3QAZC 5BS0E 2YUVA 5F1SA 1S7WA 1HOCB 4LLVA 5JNYB 3OJDB 3VE0B 4QRUB 4E9LA 3FO2A 4NM4H 2OZ4A 4WNQB 2NY5H 2FX7L 3BRGC 1XF3A 3O2VL 4G6FB 3D69A 3VA2C 5DEGA 3PL6B 2ATPB 3CVHH 2YPLE 3O3AB 1JYVA 5F6HI 4LPCA 3CLEL 3FQNA 4U6YB 5DHVH 3BRDA 4OJFL 2DQUL 5AUMB 4WU7A 3LHPH 4YO0A 1A5FH 2O5XH 3WV0A 2DB8A 3NCYP 1ZVSA 1I1FA 1I8LC 3H9SD 4F37F 3UTPE 4KROC 1LMKA 1E4KA 2HFTA 3SKNB 3HLAA 1CLZL 1NJ9A 1OTSC 4GAFB 2VABA 1FVEB 1EGJH 5C0BD 3ZMRA 1MFNA 3H0TB 4DUWA 4LCWA 2IAMD 2BVYA 4Z95H 4NQDA 3HUJF 3ZLQC 5M7QA 1ED3A 2ZG1A 1NCUA 4X6DE 3NIGF 3MYZA 2Y06L 1MUJB 3SDCD 1OD9A 4X9BA 3V4PH 2IH3A 5GGSB 1BFOB 3HPJA 3ILQC 3JV0A 1TIUA 5C09E 5HHXH 3FB7A 4KUCD 1OHQA 3L5XH 1W0YT 3SKMA 5KSAB 3QH3B 4HWBL 2MKLC 4EVNB 2C3WA 2GI7A 4BM7A 3NPZB 3PGDA 1A6AA 4GBXC 3SJVE 5DJYB 1IEAB 4Q9BA 5KVEH 3OXRA 1B4JH 3U9UB 3WNKA 4F15C 5DTFB 5IFJB 2WBJD 3E3QC 3BDXA 1KJ3H 5FB8A 4Y4KB 5D1XA 3VFVB 1UENA 1OLLA 3RWJA 1D5MB 2X1PA 5D7LD 1QFWH 4UT7L 3G9VA 2ARJB 4Y2DC 5I73B 5IBUG 3V79C 5EZIH 4E5XA 1I9IL 3RU8H 1ORSB 2WQRA 3D39A 1N8ZB 2DRUA 1MCSA 3K2MC 4HUXA 3QWRD 3C60B 4LNRB 4MA3B 4UOW0 4Y5YA 5I1EL 3H8NA 4KY1L 4OI9A 3ARTA 1PW3A 5I8KL 3QI9B 2EYSA 1KPVB 5DJ0A 5KZCB 2J8UE 3VI4E 1I3RA 2NY2D 1I9RL 3OGCB 3HZMB 3M1BA 3QDGA 1V5JA 4NDMA 4WEUD 4GRLA 4I0CC 1ADQA 1P2CA 2V9RA 2ZOLB 1MCWW 5GJTH 1A1NB 2BVPB 1BFTA 1FORH 1C8PA 3ULSB 5FGBC 1AXIB 3WXVH 1HXMB 3EO0B 4HF5H 3D85A 3EOBA 4YBQC 5JPNB 1B0GA 3BVNA 5CP3A 5ID1A 5CILH 4MDJA 5KVMC 1LP9E 3V5KA 4QRSA 5E8DH 2EE9A 2ZUVA 4YXLH 1JNJA 4ENED 5KS9B 2AXFA 5JIKA 2IAMC 5DURD 4HZLB 2GJZA 1NGXB 4PRPD 5EU6B 3GBML 2HKFL 3BH9B 3PQYA 4Z77B 3QPXL 2D7QA 2YZ8A 4YHNB 1E4XL 2R1XA 1QBML 1RUKH 5ACZB 1QVOA 1K8DB 1J0KA 3BQUB 4JPIA 1MCBA 3DLQR 1NEZB 3B9KB 1A3LL 4OZHE 4X6CB 4LSPH 2EDRA 4RWYL 1IVLA 5F9WC 3VFWA 3IVKB 5A2FA 3OWEA 1YNKH 4JKPL 2DQEH 2VDRL 4K7PY 5IVZB 1X7QA 2SEBA 2WBJC 1MJJA 4A6YH 2VL5B 4ZAKC 4Q6IC 2F5BH 4OLUL 5FO9A 4N90D 4HKJB 5D7IB 3UBXB 1SJXA 1ORQB 3SDAC 1AIFB 4NO2A 3WEXA 1UKQA 1WTGT 4OGXH 4NQED 1ZGLB 3FCTA 3ARBC 1A7QL 1D3CA 2BC4A 5I19L 5DHYB 4XP1L 3FL7A 4IRSB 2IFFH 1FPTH 5DRNB 2WIMA 4ODSL 4Y4HB 4HUWB 3LSOA 2PTVA 4KXZH 1XF2B 4GRWE 1IAOB 2XQYK 5B39B 2HH0L 3IT8D 2NY2C 3ZDZE 3QQ4A 4FQXD 2WMPA 4JFDB 4LQ1A 4HBCH 1P7HL 4DW2H 3F58H 4I4WA 5DJZA 3UTTD 4RRPA 4PJIE 2VUOA 2Q87A 5JW4R 1MEXL 1NGZB 4Y19A 1CIUA 2FZ3B 3LEYH 4H8WH 4ODWB 2HTKC 4QYOB 3GSNL 4ELMB 5A1AA 4WTZA 1S3KL 1SM3H 2AQ1A 4UILH 4TNVK 1N3NA 2AEIT 2DLFH 1JV5A 2IADB 5GZOC 4QRPD 4ENEC 4JHBA 3ZKXB 2VKXA 3AY4C 4UQ3B 2R4RL 5JMOC 2ITCA 3HG1A 1DUZA 3L9RA 4ZFFA 5JOFB 3TZVD 1KB5A 4WUUB 2YRLA 3OKNB 1S9XB 3ABZA 5CEYB 1JGVH 3EO1A 4KVCH 4IOSD 4Y5VB 1RY7B 3QFJA 3LPWA 1J5OH 4M61B 3VXUA 4PJCA 5E5UB 1IM3B 1P4IH 4LSUH 4LSTL 1NC4A 2RQ8A 3HC4H 1YEJL 3TYGH 4RFOH 3KXFB 4JPVH 1XR9A 2B1AH 5SV3A 2NY6D 1J86A 2WAHA 4QCIA 5IOPB 5HVGB 2Q3AA 3NIFE 4R7NA 3I75B 1T89A 3OB8A 4IDJL 4RFNB 1MH5A 1R5IA 2MJWA 1EEZA 2D0GA 4MNQD 4FQ2L 4LK4A 1UADC 2B0SH 4ZUUB 4NZTH 5DMIL 3BN9D 1MCHA 5EOCH 5HGAA 4XP9L 2FHCA 5D4QA 1Q9LB 3FT2A 1CVSC 1AR2A 1JRHI 2XZAL 4J1UB 2E6QA 3ILPB 4Z7NF 4JDZB 1F4WL 2OM5A 1MRFL 3O2DA 3JWDH 3L5IA 4KQ4L 4NJ9H 2X4RB 1U8NA 4XNUH 3SE9H 1IGFH 4K94H 3WBDA 4JREC 3BEVA 3OKOB 1IZJA 4YZFF 2EDDA 3MCLL 3O3EA 1FFPA 2EKSB 1IL1A 4N0UA 5HD8D 3BKMH 2NY1B 1HXYB 3V52H 3C08L 5K9KA 4U49A 4FQXC 3V0VB 1K4CA 1FDLH 3LN5B 1BD2E 3ARQA 3VXMB 3LEVH 2GY5A 2Z0BA 1HHJA 3HUJA 4YAQB 4AENB 2ICWA 4KAQH 2C3GA 4PRDB 3MFGB 2PF6A 1N5AB 1FJ1B 5CKAA 4CVZA 5KAQF 3QEHA 2AJYH 4OCWH 4I2XE 3L3KA 3P11L 5GGVL 4Z7WA 1UZ8B 4PJHB 2HKHH 3DMMD 3NTCL 1WC7B 4K9EH 5T3XL 1OGAA 1MFCL 4I48A 4U1SB 5H8DA 5IVNA 4XP5H 3ULUH 3KPPA 1A4JA 3TZVC 3SE3A 4F58L 1S8DB 5FYJD 3UROR 2NW3A 3KDMA 3HB3C 3HI1B 2WUBH 5DQJA 5EH1A 1LK3L 4ZQKB 3ZDXE 5BRZB 4MJ2A 3S5LB 4HS3A 5GRVK 4YDJA 4JFFE 2C1PB 2EYRB 3A0OA 1I1AB 4UB0L 2EE3A 3LIZH 3OKLB 1BLNA 1MCIA 4X6BA 4HIEA 1TENA 1DBKH 3EYOB 3W39A 4HDIB 2NY6C 3FQWB 2ADJA 1HEZA 3SE4A 1YMMB 1S7XA 1U58A 4P9MH 5IQ7L 1TCMA 2GSGA 2HT4D 2Y9RT 4BKLB 5D1QD 4D0CA 2YC1A 4QHLB 1HQRB 3RWGA 5E2VH 3Q6GL 5EORH 4P2OD 3DROA 5T3XE 1F11B 4U6XB 1CS6A 1DJSA 3EJJX 3M8OL 5DMKB 5IG7B 5JORB 2X89A 3OR7A 4EIZC 5A2LH 1WT5C 2P4AB 5L0QC 4O02H 5J0BA 4BUGA 4YHML 1DE4A 1XF5A 5B22A 5FYKD 4QOKD 4XBPA 1FGNL 4WFFD 3QYCA 1WCBB 3LQZB 4OIAA 2LVCA 5FXCH 3IDIB 1A0QH 1OP5K 2ZCLH 2FJHA 4XC1H 1X9QA 5DWUL 3FB8A 2K9UA 4F9LA 5HD8C 2HVKA 1MCPL 4YXHH 4FG6C 3DV4B 5JLZA 2A1WH 2CH8A 1R3KA 1KELH 2FSEA 1DN2A 1A6UH 4PJXB 2AP2A 3KPOB 3JVGA 3MJ7B 2FH8A 1AQDB 3P4OB 3T0DA 3VCLA 4AEEA 2HJKA 3VXRB 1CLOL 5HYSB 1F42A 4KKLD 5DYOB 4YUEL 1OM3H 5J9PB 4P2QE 4PGJA 3VWKB 1BBJB 5F7LB 4FXGA 1F3DJ 3DMMC 1DBAL 1QFHA 3QXUA 5CCKH 2FR4A 1HHKA 4AEHH 4HWEL 2NX5A 3OV6A 1WIOA 1V3KA 4MD4B 3QA3A 1IC7L 1HILB 4MS8D 4FRWA 1FVCA 3SDDA 5JXED 2EIDA 1INDH 1IAKB 2R2EB 1A3QA 3EDKA 2FWOB 5JDJA 4PJ8D 4OI8A 2BOBB 2B5IC 1YQVL 1BQHG 4NPYB 1SVCP 3OKDB 3VFTA 3SGDH 3WXWH 2CLRA 4ZD3H 3D48R 1AGDA 2NPLX 4MD5B 1H8SA 3BO8B 1OF2B 5I8EA 5DUML 2B2XH 2XPGB 1ES0A 4U05A 1GPOH 3BKYL 4E41E 5LVEA 1TZIA 2HT4C 1UXWB 4X7EC 4Z7VB 5D1QC 5LJYH 1G7LB 1CICD 1UH3A 3MRPB 3WFBL 2FLBT 2FB4H 1XGQA 4P2OC 2FH6A 4U2ZA 5TJWK 3SBWC 4ALAL 3BN3B 4MMZC 2UVFA 5IEKA 5AZ2L 4PRHB 4O5LL 5ISZA 2PYEA 3VFPA 2XY1A 1CFVH 4JY4B 5IFHH 3VRLF 2XG4A 5BO1H 3F8UB 4LSSH 4RMSA 5F7UA 4Z0XA 1Q9WA 2ADFH 5DK0B 1N6VA 5D1ZB 3AS0A 2J3SA 3IJYA 5HYQA 3K7UA 4P5MB 3QCTL 5CJBA 2IALB 3EGSA 5I8CB 3ARWA 1ZHNB 4OAWB 3LQAH 3OZ9L 2AV1A 2QR0B 2J4WH 3O4LA 1KENH 2GEEA 1LEIB 2GTWA 5IVXF 3ZTJH 3D18B 3IYLW 5TE6H 4XB8A 4FZEL 2AK1H 1JPTH 4ONFH 4GFTB 1XGTA 1KCUL 1U95B 1YEDB 1NBVH 2EKJA 4QF1A 1C12A 1DL7L 4MA7H 5JHLL 4AG4L 5I74B 5BS0B 2CIKB 1T5XB 5HSFA 2V2WB 1I9EA 5EUOE 3DX8A 1ZT1A 1BMGA 4J3WA 3CSGA 3D3VB 3HC0B 4DN3L 1UCTA 4XPGH 1FZOB 3X3FH 2Z8SA 4UMGA 3KYNB 2YPLB 3EAKA 5F6HJ 3R1GH 1P1ZB 4K23H 4ODVL 4XCEA 1OP5H 5FM4A 5JXEC 1R5VB 4C58B 5CHNA 4NRZA 1P4BL 3HE6D 4W4OA 5C92A 2EYTB 4QRQB 4LCIH 3ZZ1A 4ZSOA 2HG5A 2J12B 3VXQB 3FHQA 4HAFA 3CD4A 3L6FB 4NN6C 4DOHE 4I0PD 5IHUL 4DGVH 1NAML 3EOTL 5EA0L 1PLGL 4RMVA 3RDTB 3W9DA 5DRWB 3V0WH 1I8MB 5FKPB 4TUKL 5D7KE 5MERA 3QIWB 2YSSB 1LD9B 3D0LB 2PO6A 4NKOA 3NPSC 4K8RH 4OKDA 4WFHE 1KCRL 2X4OA 3WFHB 1V7NH 1MRCH 3RNKA 3TYFB 2FJGB 3WKML 3G5VA 2DYPD 1OT2A 2Z92A 4X9GA 3BGAA 1QEWB 3ZT5A 5C09B 4EI6A 4U1KB 1QYGH 3NCCB 3ULVE 2R9HD 3QB7C 5FYLH 4RISL 4CN4A 5BXFA 4JCLA 1OAQL 4HS8L 5JO5A 4HEME 1VKXA 3OX8B 4PGDB 4F7EB 1H3PL 3HI5H 2DTSA 3QHZH 3SJVB 3UTZA 2J88H 1BM3H 5IEHB 3EYVA 1NCDL 4JHZA 3QWOA 5DJDB 4PJEE 1NCWH 4Y4FC 2DD8H 1P4LB 3V5HB 5B3JF 1K85A 1AI1H 4RNRA 4NM4L 5DRZA 3CFKA 2NY5L 1KNOB 3CNKA 4HPYH 4OLEA 2P5WE 5D2LF 1A7RL 3QQ3A 5IHZB 4C56E 1JWUA 3CVHL 5C0IB 3VD9A 3CZFA 5E00A 2QSTA 1NEUA 1V8HA 4OLWH 1RD6A 3LHPL 2NY4D 1A5FL 1IM9A 2O5XL 1RIVH 1KJ2A 3TBWA 1ACYH 5T1KA 1GRWA 3KPSA 1CIDA 2X10A 3PGFH 3GEWB 4NT6B 2VDNH 1I8LA 4YHYB 2GITB 3QBTB 3CVIL 2GFBB 1XGUA 2ED7A 1EGJL 3HE6C 2FYYB 1OB1A 2VLRB 1AXSA 1W72H 3BESR 4PGBB 1CD0A 4Q74A 3BZDA 1A21A 1AH1A 4I0PC 4HSQA 3C5ZD 5I2IA 3BWUC 1OAUH 5JW5B 4EOWL 4DFHA 4C83A 1JPSH 1BF8A 4I3GA 5HHXL 3QDMD 5C0GB 4CADA 3VG0H 4TNWF 1QBAA 4MJ5B 3L5WA 3DGGB 4S1DD 1OY3B 2J6EA 4OD2A 1S7RB 5C6PB 2JJVA 4HH9A 3VFSA 4LMQE 1P53A 2DQIH 3U7AA 5KVGH 3PWLA 1J0IA 5SWSE 1RZKH 3O8XD 5D9SA 2R9HC 3VXSE 4WI2A 4KJWC 5KVEL 1B4JL 3QZWA 4GBXA 4MZ2A 4U1NB 1NANH 2GJ6A 4YIQA 2R23A 1KJ3L 2CR3A 4Z78B 4MYWB 3P4NA 4D0DA 4OLXH 1S7SB 2XZZA 3AC0A 3FONA 5HHOE 1QFWL 1NBZA 2NXZC 4UIMB 4J4PC 3UC0H 4CGTA 1C5CH 2PW2B 4WUKH 5DFTA 4TTGA 1PSKH 3LV3B 1XEDA 5EZIL 3TF7C 1JUFB 3RU8L 3VJ6A 3CC5B 5ADPH 1S9VA 3V6ZA 3MV9D 1KT2B 4RWHA 2F53A 5F72S 3ES6B 5F93C 4JZJC 4JRXE 1CDIA 3GMOB 1NGWB 4HWZB 4WDIA 4OF0A 4XGZA 3UPRA 3HKFA 5GJTL 1T22A 4FFWD 4GKNA 2XTLA 2NY4C 1FORL 2Y6SD 2VWEC 3QXAA 5F6IB 4S1SH 1Z9OA 4PRNB 4W81A 4XCNA 3WXVL 3JTTA 4HF5L 3GMNA 4LL9A 5EZOH 5B8CB 5FGBA 3TA3C 4XHQA 1IE5A 1K8IA 5CILL 1JGUH 2PXYB 1MLCB 3GMMB 5E8DL 4TSAH 4YXLL 1RK0B 2C3XA 2JIXA 5EDXA 1RFDL 3CDFA 2E9WA 4LRNH 2BSED 1JHKH 3CSBA 4MJ6A 2VR9A 5C0BA 1HHGB 3DHJA 3NA9H 2IAMA 3ZDYF 1ONQA 2UWEF 2XTJE 4NFCA 5FHAL 4WFEE 1RUKL 4PRIA 1WBYB 4R7DB 2E7CA 3SDYH 1R6VA 1CGXA 4PP1D 1VACA 3GUTB 4S1DC 1EPFA 3GJFB 5DI8B 2X4TA 2G5BB 2CJUH 3O8XC 4X6EB 3TO2A 3ZYJA 2DM4A 3O4OC 1YNKL 3KGRA 2YBRA 2CKBA 2DQEL 3TJEH 2HT2D 3CDCA 3KPQA 4PJDB 4ZXBD 3V0AC 3BYYA 4JANA 3GMRA 4A6YL 2PKDA 1TVBB 2F5BL 5EO0B 4RAUB 4JHWH 4ZYKB 1A4KA 1DQLH 4M7LT 4JFPA 3LN4A 3HAEG 4WTWA 2IEPA 5GJSH 3G9AB 1XR8A 2FO4A 2YXFA 4ZAKA 4Q6IA 1KLUB 1JGEA 5GGRA 4G9FA 1WIPA 3SDAA 3H3KA 1F4HA 5IT2H 3KPTA 1DTUA 1LO2H 1FPTL 2IPUG 3ARBA 3BIKA 3J8F7 3QUZB 2XNAA 2CGRH 4GAJH 4HCRA 3WN5B 4MNGA 3MUJA 4HBCL 4DW2L 1SQ2N 1O5DT 3F58L 5HYJA 5JPMA 4FFWC 2CRMA 3PABA 1HH6B 1U91A 2Y6SC 4NBXB 1LWRA 5IJKC 3QNZA 3BD3A 4AYFA 1UZ6E 3AB0C 3LEYL 4Q2ZB 1BD2B 3UJTH 1SM3L 1DN0B 5CEXB 4UILL 1OLZA 3U79A 2CK0H 1I7TA 2DLFL 2EC9U 3MOAH 4MX7A 5I1JH 1S7UB 4R6UA 4G6MH 3JV6A 1T0NA 4HPOH 5DJCB 1QNZH 1QSFD 3QCUH 5LWYH 4R3SA 4XNMA 3AY4A 1I8KA 1JGVL 4BK5A 1AKJB 4KVCL 4TUOA 2Q1EA 4GAGH 1J5OL 3ARDC 3K1KC 1MVFA 2VTFA 5K9QI 1IEBA 1P4IL 4CAGA 4LSUL 3HC4L 5E8NB 3TYGL 4PP1C 4RFOL 1N59B 1OTTD 4YDVB 4JPVL 1MCKA 2B1AL 4H25A 1CGTA 2Q76B 5D96B 1U3HB 4LKXB 5C0CE 1QSEE 4JFFB 3GBLA 2HT2C 5INCA 3UJIH 5HPMA 1JF1B 1T1WB 4G6FD 4ZXBC 1CFSA 3PL6D 3C9NA 1PX4A 3FO0H 1ND0B 2VITB 3QRGH 1AGEA 4NZTL 3B9DA 5EOCL 2YA1A 3MLPA 4LKCB 4LSQH 4QRRE 1A1MA 1YN7A 1EZVX 5CGYD 3RTQA 3Q2CA 3TIDB 1UJ3C 4NZDA 4NJ9L 4NQEA 4N0CD 4JY6A 4XNUL 3SE9L 3O3DB 1IGFL 1KTLA 3P40A 3ZT6A 5I9QB 3BKML 1UH4A 3GIZL 2Z4QB 1YEIH 1PKOA 1XIWC 4TQEH 3UPAA 2YHGA 2IQAA 5BVJA 1FDLL 2E8ZA 2APFA 3LEVL 3PWNA 3LY6A 1PKQB 2RIKA 5HDBF 2VYRE 4M8QA 4IMLA 3MV8B 1Z5LB 4KK8C 4KAQL 5IJVB 1ZEAH 1PAMA 4IM8A 3RL1A 3IS0X 1ZGLM 3ELAT 1BZ7A 1MCNA 3RRQA 2DBJA 4Z7UB 5KSAD 2AJYL 4OCWL 1FN4B 3VMPA 5FF6A 1J1OL 4JG1H 5L88H 4QTIH 4MCZB 1LILA 3X13B 5DEFA 1EFQA 4K9EL 3VFOB 2A38A 4M1DH 3BX7C 1HYRC 4QRPA 3ARXA 5FEBA 3ULUL 2GK0A 2PN5A 3UTSE 3BT2H 1CBVH 3EYFB 3T4YA 4F37K 4P2QB 1N6QH 4IJ3C 4Y4KD 5JR1H 3B3IA 3TZVA 2WUBL 4M7ZB 3T0EA 1I7ZA 1YN6A 1DUYA 1S9WB 2FATH 3GO1H 3KPLB 4Y1AB 4KV5E 5J3HD 2BNRB 1U8MB 5DA4A 3BP6B 4CN1A 2R0ZH 1OTTC 1LO5A 3LIZL 2DKMA 1DBKL 3PDDA 3VGBA 2EDQA 4IIQC 1WJ3A 1NFIB 5FKAB 5BJTA 5F1IB 3QI9D 4P9ML 2ZKHH 5F1NA 3LKOA 3C6LB 1F90H 1HH9B 1RJZB 2W60B 4HC1A 5KZCD 4V2BA 3JV4A 5D6CB 4JCMA 4GKZB 5E2VL 5CD3A 1G7JB 5AD0B 3LKSB 1H3XA 4D94A 1ZSDB 4E41B 4LGRB 4OGYH 1NQBA 2BNUA 3F5WA 1EHLH 4QTHB 5GZNC 4P46B 3TNNB 4O02L 4X7DC 5E2WH 5KANG 4F7CB 4P48A 2I60H 3QEGH 1MCWM 2GQHA 1CD1A 1WT5A 5BZWB 4BZYA 4X9HA 5DJXB 2G75A 1DEDA 1EMTH 5EU5A 4BFIB 2BOCA 1A0QL 2ZCLL 2YD9A 4XC1L 3BI9X 5DD3H 1F4YH 2H9GB 4YXHL 1DLHB 2AJVH 2ZUQC 3EO9H 2JCCF 3L95B 2A1WL 3I6LE 4N5UA 5EU6D 2D31A 1XGYH 1CG9A 1KELL 1AP2A 1KTKE 5FO8B 1A6UL 2JF1A 2R0KH 4PJ7B 4QO1A 2R1WA 5AYQA 1JCKA 3CFDB 3BQUD 5KSBE 2HLFD 2R39A 1LE5A 4JO2L 4CMMB 2E6PA 1HNGA 5H2BB 1KB9J 1RUAH 4DCQA 4OZFB 3B9KD 2FLRT 2HJFB 3BRFA 4PS4H 2ZCHH 2NTSP 2EDOA 1BBDH 3K3QA 1CDUA 5CCKL 3P3YA 4AEHL 4GG8A 3RWFB 3DMMA 3QDJB 1UCBH 4B7LA 1D5BA 2DQGH 3RWHB 6FABH 4ORGA 2F15A 5HHPB 3VG9B 1INDL 2Y5EA 4W6WB 4QGYA 4Y4KC 4WVRA 2JB6B 5D72H 2UV3A 1HK6A 3D25A 4NWTL 4U6VH 1UFUA 1A9EA 2BDNH 4O2FA 5F89A 5J3HC 3PDOA 4GW1A 3WXWL 4HIJA 4ZD3L 4EUPH 3K1DA 1IFHH 3IDYB 2B2XL 4IRSD 3ZE0E 1K2DB 4NNYB 1GPOL 1CXLA 1IAIM 1NCNA 4Y4HD 4HUUB 3ZE2E 1FFOB 1E4XI 5FOJA 3JWNC 1ZS8A 2FB4L 1WBXB 1YPZF 2CXKA 5LGHH 4OZGF 4LRIC 4JFDD 5DO2C 3HNVH 1E27B 3NGBC 4P2OA 3VFNA 4U1GC 2BY3A 4RRPG 1CFVL 2A9MH 4ZUTB 5IFHL 2A6DB 5BO1L 3GI8H 3KLAB 1MVUA 4GKSA 4GG6F 5IIEB 4QEGA 3K8LA 4FXKA 3QUMA 1DVFB 1C16A 1LEGA 1R3JB 1VADB 5DT1H 1E28B 4L3CB 3CX5J 4WTZG 5GRVL 1J8HE 3LQAL 4NO0B 2R1YB 3Q3GA 3O11B 2J4WL 2DLGA 3HC3H 1RVFH 1KENL 3SKUD 2DL9A 5KG9B 5E4IA 5TE6L 3KPMA 2AABH 2AK1L 2M8XA 1JPTL 4RMRA 2VZSA 4ONFL 2P47B 4HKXA 2APWA 3AS3A 1NBVL 3BQUC 2CLZA 2HLFC 4IHOA 4JJ5B 4MA7L 1ZLWK 2Q7YA 2H2SC 8FABA 3MMEB 4TRPH 4XHJD 3KXFD 3N06B 3WMSA 3SQBA 4OZIF 1B0WA 1SYVA 2R69H 2NZIA 4HXAH 4KJPC 4U3CA 5JZ7D 1CXKA 3U30C 2NY5C 4XPGL 1HSAB 4C56B 1KTDA 4OLVH 5EWIH 3T1FB 3X3FL 5C9JB 3JXAA 4Y5XB 3FT3B 1U93B 1TVHA 5GSVA 3HRZB 3P0YH 1RULH 3R1GL 4K23L 4NKQB 5FA4B 4PY7B 4K7PL 4X6DA 1MY7A 4YNYA 1EH9A 1N6UA 1RUQH 5D2NE 3L3OA 4Z0BH 3QO0B 5JXEA 3V95A 1EUTA 1IQDA 3C5SB 3UPCA 2AQ2A 1UC6A 5I1AA 1CN4A 2LTQB 3VRIB 4DGVL 3WLWD 2P5EB 5CJXC 5KSUB 1NLBH 1EHNA 3V0WL 3WSQH 1L9MA 3TPUB 4F7MA 3MRGB 4P9HC 1QLFA 5EC1B 2DIJA 3QJFB 1JPGA 4M93B 4ODHH 4O4YH 1V7NL 1MRCL 2HWZH 2NY1D 4XX1G 1ZTXH 3LRSA 3QG6A 5IBUB 3VXMD 2IPKB 1URLA 4P2RE 1J9CT 2OSLA 4ZODA 1QYGL 3AXLB 3K0WA 3NAAH 5FYLL 5JOPE 1WBZA 4FOMA 1SJEA 3HNSH 3I6KA 3HI5L 2IQ9H 3QHZL 4YE4H 4YBHA 5SWSB 4GQPH 2J88L 3VXSB 1BM3L 4L3AA 3W0WA 1KPUB 4WW1B 2V7NB 3KYOB 4HWBA 4JRYB 1WWCA 3ZKXC 2DD8L 4D3CH 2G9HB 3RJDA 2BSTB 2J8UA 2IANE 3P4LA 3CU7A 1FH5H 1B6DA 1AI1L 4Y4FA 3QFDB 1VFOA 5DD0H 4HPYL 3WNLA 5BRZD 3PWJA 4BQ6A 4I1NB 2MNUA 4WU5A 2D9QB 3MRCB 5FYLE 1HWHB 3ZYZA 5C0JA 4XHJC 1JMZA 2D7TH 3DPBA 1I1AD 4ZUWA 1JN6B 3UCRA 1KULA 4OLWL 3HS0B 4DVBB 4X4XA 2LE9A 1VENA 2N4IA 3VXOA 1LP9A 2Q3ZA 4X98A 1RIVL 5JZ7C 2VUYA 1SEBA 3RWDB 5TDOA 2FDBP 1ACYL 3GMLB 4HKZB 4JRXB 5J13B 5LQBH 3PGFL 5FECB 3BUYB 5ANME 2XTJC 2VDNL 3WL9B 4L5FL 1Q8MA 1CFNB 2VIRB 2HP4A 2AI0H 4HIIB 1U2HA 1W72L 2GT9B 2WLZA 2M2DA 3HE6A 4ZG1A 4JFEB 2H3NB 5ECJE 2ZSWA 2OTUB 2OR7A 1AO7E 3HZVB 3WLWC 3UTQB 2H1PH 4GOSA 4JDVB 1XFPA 4EXKA 3VFGH 2ICCA 1MPAH 1JPSL 4L8BA 5GS1B 1ZLWH 5DJ6B 1AHWC 3WDJA 4WWKC 4MJIB 4MB4A 1MLBA 3VG0L 4NHUA 5EFIA 2NY1C 3MLXH 1EX0A 1L0QA 3U6RA 2DQIL 1EO8H 5KVGL 1RZKL 3DRTA 1D7FA 4NUJA 2YD4A 3G6JB 1AQKL 3AMKA 3UAJC 4ZPVA 4GW5B 2E27H 3VXRD 2B39A 4XAWH 5E08L 3JTSA 2CO7B 4BK4A 4OLXL 1DLFH 4PJ9C 1JRHH 1RPQA 3MRQB 1KC5H 5ILTH 3VWKD 5IB4A 4J3XA 4ISVB 2A6JB 4MXVE 1C5CL 1FZJB 4WUKL 4XNQA 4DGYH 1PSKL 4F2MA 5GRUH 4PYGA 2DM2A 5ENWB 4NOBA 4J4PA 3ARSA 2HN7A 4RIRA 5ADPL 3QHFH 1DQQB 4R0LB 4CDHA 1MHPH 1Y0LA 4IS6B 1FFNB 4XI5C 3NOIA 3WCYA 5I66B 3IAQA 4PJIA 3AS1A 2CO6B 4FQJH 3VXTB 2NW2B 1YMHA 2A6KB 3AVEA 5EBGA 4O9HH 2BVQB 2DMKA 4KK5D 4PLJD 2H8PA 3U7WH 2ICEA 1EBPA 4S1SL 1YDPB 4CDGC 2QSVA 1F00I 4LU5H 3TIEB 1IT9H 1OSPH 5EZOL 3HZYB 4WTXA 5IMMB 4HAGA 3MUY1 2W92A 2P46B 5HGHA 4U0RB 5TF0A 3TA3A 3UX9B 5BZDA 4G6JH 4LRNL 3U4EB 5IB1B 1JHKL 4KRLB 1D9KB 1I7RB 4NO3B 4R4BA 4AEIH 1YYMH 3NA9L 4GG6A 2CSPA 5D1ZD 1W0VA 4ZFOL 5I18H 1MWAH 2ZSVB 3GKZA 4NYLA 1CK0H 4JO4H 5HBBA 4LEOB 3SDYL 2M26A 3GSNA 5L2KE 4PV8A 4QHNA 4HFWA 3P2TA 3P9MA 3DWTA 3TBSA 4TSBH 1UM6H 3KYMB 1BVKA 2DKSA 1DDHA 1X44A 3ULUD 2BSSA 2CJUL 3RGVB 1KB9K 4NFBA 2WBKA 4JY5H 3GSWA 3D0VB 5EO9A 3MLSH 4GW4A 5EBWB 3TJEL 4RBPK 3O8XA 2CDGA 5JW3H 4OBSA 1G7IA 3ET9F 1XGPB 5I0ZA 1ZHKB 4JHWL 1U2CA 1DQLL 5GJSL 3CFEB 1EZVY 3VWKC 4PTTB 3QUKA 2OTWA 1QSEB 4J3OC 3D3VD 1NGYB 2BVTA 3GNMH 4YHKH 4OZIA 4EI5B 3PG2A 4ZS6D 2ED8A 5IT2L 4Y0GA 1AD9A 4FXLA 1LO2L 3ARRA 2YPLD 4E42A 2LQRA 4KFZC 5IK3A 4ODUB 1CWVA 3UTOA 1HE7A 4QRRB 5CAYB 4JAMA 3MRKB 3FQXA 4LCUB 3HZKA 2CGRL 4HV8B 3MV9A 1T04A 3C2AH 4RGMC 3Q6FB 1AFVH 4I3RH 4KK5C 4MDIA 4PLJC 1KIQB 4D9RE 1CLCA 4XPTH 4WW2B 3RDTD 4I2XA 3C6SB 1JP5A 1VFBA 3P0VL 4PJAE 2DN7A 2ZG3A 4YQXH 3DXAB 3QIWD 3UJTL 7CGTA 1M05B 3NCBB 4QHMB 4XNZB 4POYA 43C9A 2CK0L 1BWWA 3NFPA 1T2JA 1XH3B 1BECA 3MOAL 1C5DA 5I1JL 4G6ML 3R8QA 1BVLB 3CX5K 5E6ZA 5C09D 3N50A 4HPOL 3PHQB 1QNZL 1NLDH 4R90H 2DBLH 4LPVA 5CEZH 5LWYL 2VC2H 2WWKT 4KRPD 4GSDH 4N0RA 5D1ZC 2PW1A 1K4DA 4G43B 5F7DA 5HYFA 4M7LH 1CDHA 2OL3H 1CFTA