2K45A

C2a domain of synaptototagmin i solution structure in the fgf-1-c2a binary complex: key component in the fibroblast growthfactor non-classical pathway
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
128
structure length
128
Chain Sequence
b'EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synaptotagmin-1
molecule tags Protein transport
source organism Homo sapiens
publication title FGF-1-C2A binary complex structure: key component in the acidic fibroblast growth factor release
rcsb
total genus 21
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2k45A00
4IQHA 4OVVA 4XE0A 3R7QA 3NZUA 2WXQA 2CHDA 3PFQA 1DJHA 3HHMA 3N5AA 1QATA 3PYCA 4EZKA 2ENPA 2EP6A 2WXOA 2Q3XA 3FBKA 3PRZA 2WXIA 4QAMB 2WXGA 1BDYA 1GMIA 2KI6A 3HN8A 4BGDA 4F92B 2X38A 3L08A 4QJ5B 1BCIA 3OHMB 4DK5A 1HE8A 2CM5A 4TV3A 4HLEA 3L16A 4TS6A 2A5UA 3T8MA 2WXJA 1E8WA 1QASA 4ANUA 3CSFA 4QJ4B 5CCJA 1RSYA 5G2NA 3TWYA 4F1SA 3ZVVA 1UGKA 2CHXA 1DJIA 1DJGA 1E7VA 1E8YA 4L23A 5G55A 2R83A 3F05A 4A55A 1W15A 3JZYA 3NSJA 2Y3AA 2ISDA 3B7YA 1CJYA 3NZSA 5CCGE 4WWOA 3W56A 3MJWA 2LHAA 2WXPA 5EDSA 2YRBA 3F04A 4EZLA 4ICXA 4GNKB 2K3HA 1DJXA 2FK9A 4WWNA 1DJZA 3RPBA 2DMHA 3GPEA 3P2BA 4FHJA 2NCEA 2QZQA 4KZCA 1UOWA 1E90A 1RH8A 1V27A 4LCVA 4JPSA 2JQZA 3W57A 4ANXA 2ENJA 2V4LA 2QZ5A 3FDWA 3RDJA 4Y1TA 4ANVA 1WFMA 3F01A 3L9BA 3L17A 3IM1A 3QK0A 4LT7A 1UOVA 4OVUA 2CJTA 2K4AA 2WXRA 4WWPA 4J6IA 3L13A 4WAFA 3ZW3A 3S2AA 4KITB 4XX5A 4L1BA 2N1TE 3PREA 3QARA 4AOFA 4EZJA 3APCA 2B3RA 2YOAA 2Q0ZX 4QJ3B 4G11A 4AJWA 1K5WA 1E7UA 2CHZA 1E8XA 2RD0A 5CCHE 3TJPA 1DJWA 3R7RA 2WXLA 4Y1SA 4V11A 3IBEA 2FJUB 1TJMA 2A4ZA 3HIZA 3ML9A 4WEEA 4BFRA 4L2YA 2WXHA 4DNLA 4FULA 1DQVA 4ICWA 4F93B 2NQ3A 4URKA 1W16A 2WXMA 4MJJA 4KZ0A 2DMGA 3L54A 4NS0A 4PS8A 3ZIMA 5H4YA 4LDCA 4F91B 1WFJA 3M7FB 3QR0A 4ANWA 4FJZA 1DSYA 3DPDA 2CJSA 4HVBA 2UZPA 4FLHA 2ZKMX 2WXFA 4FJYA 4PS3A 3ML8A 4FHKA 4L1LA 2WXKA 2Z0UA 3KWTA 4GB9A 3OAWA 1BYNA 3APFA 3CSTA 3QR1A 4TUUA 3F00A 4NPKA 4PS7A 3SD5A 4FA6A 5JHBA 1YRKA 3APDA 3L4CA 3LJ3A 5JHAA 4FADA 1E8ZA 3QJZA 4NPJA 3DBSA 1A25A 3KWUA 1DJYA 2ENQA 2WXNA 2CM6A 5T8IA 4XZ4A 1RLWA 3QAQA 2CHWA 2D8KA 3PS6A 4NP9A 1TJXA 2BWQA 2K8MA 3TL5A 4IHBA 3ENEA 5KJ7E 2K45A 5H4ZA 2NSQA
chains in the Genus database with same CATH superfamily
5IKCB 4ABVA 3KGRA 5ICZA 3RGVC 3OLDA 1IO4C 3GMRA 4Q6KA 4U1MA 4LEXL 2XU9A 4RISH 3RNQA 4ABWA 3NIGE 3K6IA 3U4BH 3VXOA 3SDAA 5FGSA 3HN8A 4Y4KD 5DUML 4XBGA 1JXJA 3O3EA 4C56A 4PCKA 3GM0A 1S7QB 4E9SA 1CF8L 4KH9A 4HT1L 3GTNA 3RWIA 1B2WH 4FQ1H 1QR4A 3MLVL 3RNKA 3F7VB 1ZS8B 1T1WA 2O30A 5IB4A 3CZSA 3VMNA 3U0PA 1MIMH 1UM6L 1T0OA 3GB7B 2XIBA 3DJ9A 1U3YA 3ZQWA 2PLTA 3GSRB 2I5YH 3IMSA 3MNVA 1UEMA 5HHVH 1F11B 3S34H 1XD1A 1QHQA 2PWFA 5EN3A 1J18A 1YEEH 5C0BE 4AK1A 2KHAA 2KERA 2PXYA 3UYRH 5IJVA 4RWYL 2HTKC 2AAVA 5HPOA 1RUMH 4ZS7L 1WA1X 3CBRA 4HJUA 3QIUA 5CP7A 1W9XA 4OD3H 5B4MC 1X5KA 3BN3B 2F58L 3F7LA 1WQVT 2IQAA 3QFJA 2ROYA 4JPSA 1UZ8B 1RZIA 4MCZB 2D3VA 2ED6A 4F20A 3K6SA 4QGYA 2WCGA 3L3GA 4OLVL 3IM1A 4ZX6A 1XCQA 3BGFB 5I66B 2B15A 2Y25A 1O9WA 3LKOB 1E67A 4HKJB 1I8LA 5BMFL 4PY8I 2DBJA 1P5UC 2CGZA 2HJLB 3MO1A 4QJ3B 1DHKA 3HE7B 1NBZB 1JDCA 1OGSA 3VFTA 2YAQA 2AJYL 3PJLA 1A6TA 5IW3A 1GKOA 5DEGB 1BAFH 4Y9CA 1WISA 4KTEH 3UGUA 3DTXA 3WFCH 5AVYB 2AK4E 3DV4B 4CMMB 4D0CB 3VXMB 5ID1B 4TTDC 3KDMA 2Q6WB 3STLB 1F3JA 4GXUN 5E4OA 2X2YA 3MNZA 1FNHA 3FQTA 3OR7B 1IC5H 4WKXA 3GI9L 1WO2A 1NAML 5DYFA 5LCVH 3OZKA 5FOJA 5IW1B 2E7HA 4YSCA 1Z3GL 4HIEB 3ARTA 4P5SA 1R3KB 5DXWA 4G9FA 2WLKA 3EO9L 1R17A 3NIDE 4PP1D 2HRHA 1IC1A 2A83A 1JGIA 3BP7B 2ENYA 4Y5XA 5D1XB 1FWXA 5H2BB 3SDYL 1ORSB 3II3A 3QUXA 5E1AB 1T5WB 2Y6SC 5LGYA 4NQDE 3WO4C 1FFOB 1G6RB 1T04B 4NQQA 1D5IL 1CIDA 1EZSA 1QEWB 3EOAA 3EUUA 2NNAA 3LPGA 3WY1A 1BOGB 1MFDL 1TZIB 2YQBA 3W2DH 4R5VA 1Q9WB 5D2LA 4B41A 4WJG3 1SYSA 3DMMA 4PGDA 2G5BB 2XZZA 1R24B 5CFAA 2R4RL 4J3OH 1IE4A 3EOBB 1EERB 1RK0A 4JEGB 4RMRA 5A3ID 5D7IF 1I8KB 5IREA 3FO0H 5CJBA 3LPFA 4HIIA 1DBJH 3MRGA 4O2CB 4ZTOL 4I8DA 1X5XA 5KSUA 3E8UL 3QDGE 5HGDA 1BM3H 5IOPB 1DLFH 1AGBA 1UZ6E 3FT4B 1KCRH 1Z1WA 4FHJA 3CFBB 1E90A 3IU4L 5BZWA 3ZO0A 1XO8A 1QA9A 2NOYA 2QZ5A 2DQHL 5LO7A 5HGDB 2DBLL 3OMZA 5IOPA 4RZCA 5FHAL 1TEGA 3MGTA 4ZUWA 5T1LA 5D2LE 3QXUA 4EUPA 5DZJA 1D2PA 3DDGA 4HS3A 1HK6A 5BUAA 2X6VA 4M62L 1SMDA 3MYZA 3ARFD 3BT2L 1Z66A 4WWID 4M1CC 2ZCLL 2RALA 4FMKA 2NNCA 2E9GA 2ZE0A 3T65B 5KZCB 5L2JA 2QTEA 2GK0A 2O5YL 1EDYA 3N06B 2HA1A 4GW4B 2QDWA 4KKZA 1IKOP 1PQZA 3OF6A 4B0MM 4PIBA 4Z78A 1I9RH 2XFXB 4BKTC 4Y19D 3KLLA 4HMCA 3M45A 1J5OH 2PPFA 4PJAF 4AM0A 2IQ9H 1BQ5A 1N64H 1ZANH 3D25B 1VZGA 3K6FA 4EDXA 4M8UA 2IWKA 5HVGB 4EVNA 4KJWD 3TZVB 4JUTA 3RKPA 1E6OL 2QMKA 4HX1B 3BP7A 4Y5XB 5D1XA 1BAGA 4Z7NB 4FADA 4NCC1 3LQAL 5EUKB 1AOHA 2HVBA 4APXA 4GS7C 3FKUS 3MYJA 5BCAA 3RBSA 5K1JA 2IH1B 4Y4KC 4JS7A 2UWEE 1XGRB 4PJBF 5IFAH 4BK5A 3UJTL 1QTSA 4JRLA 4LVNB 3ZMNA 1VFBA 5HYIA 3VYOA 3LRMA 4FL4C 4A39A 4KXBA 1FVCB 4NZUH 4ONFH 4U1IB 2CA3A 1U4FA 4P5MB 1XIWC 4NHUB 5F0LB 1OAUL 5CZXC 5C8JB 4EI5B 1BZ7A 1L7IL 3UTPD 1VJSA 2JJWA 4DPAX 1AS8A 4J8RB 4WEMB 3SIKA 1R46A 5DSCB 4N8VB 3BJLA 3JV6B 1JNHA 3BDBA 1XGUB 1AXTL 3CXFA 2VLKA 4N22A 4D0CA 5ID1A 5F1NA 1KIRA 1WV7T 3E9UA 2V7NA 3C60A 4JL2A 2E74C 1KYFA 1IIKA 3BT2H 3KPQB 4FABH 4L1SA 4XVOA 2XC8A 4XN9A 1AO7B 4PWJA 3KAAA 3IDIB 5JLZB 4EDWH 1C5BH 4OLYH 1ZTXL 3PL6A 5I1KL 3BAWA 3MO1B 4N2LA 4NO0D 5F1IA 1GGCH 3EGSB 4ZUTB 2QELA 2XRAH 2FGWH 2JCCA 3D7PA 3T2OA 3S8WA 4YHYC 1D5ZA 3HZMA 5BRZB 1UASA 1ZLWK 3RVXD 3T09A 3F2LA 1QBML 2UZYB 4B27A 4LOFA 5F9OH 1W72A 1KGYE 1XR8A 5LB1A 1Z5HA 1XZ0B 4PS4H 1MIEL 3SODB 1IAKA 1P6WA 4K3DL 5DVLA 4W4NA 3M1CA 4KUCF 3HC4L 5J0BA 1QNZL 2FD6L 5GJTH 3PABB 4OD1L 4YSAA 4XOBA 1YYLH 5KJRL 4ZUSB 3OKLB 1AY1H 1EJOL 1KPVA 4BJLA 4ES8A 3DX6A 2IH3B 1OARH 3HG5A 3QXAB 3ZBMA 1DBKL 4PN6A 5BS0D 4FKKA 5IJVB 1PVHA 3QIWB 4MAUL 5AB2A 4JFFB 1H6UA 1JZHA 1ADWA 1JV5A 3WN5B 1TTAA 4ZOAA 3VUAA 1OK0A 4GSRA 3LN5B 4OCYL 1CDJA 1HCYA 2CLVB 1SVZA 4BUHA 4KKQA 4UQDA 4PG2C 4HXBL 3GB7A 4P2OA 2DLEA 3VGFA 4LNRB 2VAAA 2KLTA 4KVPA 4YQXL 1Y1DA 2YKLH 5DRWB 4GBXC 1WWWX 1ZS8A 4M56A 4NKOB 5ALCL 1KPUB 1HYRC 1OF2B 1X7QB 1N0XL 2ADGB 2YQGA 4MJHA 3D69B 3CQFA 4LPYA 3WTSA 2R4SL 2YIHA 5C09E 4LPUA 1KCBA 4YHLL 3PQYE 3SDXE 2JNZA 5KAQG 4PP1C 4TNGA 4F93B 4R4BA 2A0LC 2E8YA 2AF2A 2YMXH 4RMWA 4XNXL 4BWTA 3R8QA 4LVOC 1I8LC 4YDMA 1NFDE 3B3IB 4NGHL 1CR9H 4GT0A 5CEZE 1BFVH 3OAUL 2FVNA 4HBQA 2X9ZA 1AG0A 4KHTL 5EN2A 1CFTB 5BW7A 3Q05A 1JNJA 1EBAA 3BKJL 3F00A 5F3HB 3MUJA 1LE5A 1UM5L 2HFTA 3I9GL 4W9GC 1MFDH 1WF5A 3AM8A 1QSFA 1TSHA 2NY1C 1BHGA 1R5VB 1NGWA 3L2NA 4XOCA 1YAZA 4YL9A 3D4CA 2IBZX 4U6VL 1X6LA 5LAPA 3RZCA 4DVRH 2A73B 4XMTA 4JFFE 1BQHB 3MJ8A 1PG7W 5IM7A 1L9RA 2WXOA 1MFMA 3FBKA 3QWOA 1ZGLB 1ETA1 4V2CB 3GJFB 5E23A 2CR6A 1JGLH 2A1WL 4GQ9H 2GJ6B 4Z7VA 1U93A 2EIMB 3RIAF 4QO1B 3V4PL 3GBLA 5AYQA 3A0OA 4FQXA 3A6BL 1ECYA 2W0PA 2ATAA 3ZE2B 3JVGC 3ARQA 4AQOA 2DQHH 2N01B 3MV11 1E27B 1GTFA 4IS6A 3A6CH 3KNBB 4QY8A 5TK2A 5E6IA 1C08A 1NDGB 1RJYB 1BJ1J 4UM8A 5AKVA 1NCAL 3C2SA 1JD9A 3NMEA 2MKWA 1TTCA 2H47C 1J8HE 1EAOA 3HR6A 1XIWD 4XT1C 3GRWH 4TUKL 3MV7B 3PF2A 2OPCA 3HFMH 4IJ3C 3VGHA 5C0RH 3RDTD 4F57L 4YHLH 2E59A 1MAML 3F65A 3LAFA 3ZQXA 1OF2A 2VKWA 43CAB 1S7WB 1ZJAA 4KI5C 1IQDB 5DJCA 3TN0B 4ELKB 5IHZA 1QWNA 3IAPA 5E4EC 2VAAB 1EGJL 4EUPH 1JVLA 4ODXB 5KSAB 3ZW3A 1VZIA 4YHOL 3ZKXC 2V2XB 1P7KB 5D1ZA 4QWWC 1PZ5B 4BFNA 2XQYA 4DF9A 3MBWA 3QNZA 2YPVL 2D4DA 4MS8D 5HGHA 2L7UA 1QHPA 4V11A 4IRSB 5EH1A 2K4WA 4JFDA 3ZZSA 3U6RB 1IJ9A 4AL8C 1G7JB 4JY5H 2WXHA 3OKNA 3QYCA 4XMPH 5EU3B 2Y7NA 5HGGS 3GS0A 5EBWA 4XWGH 2Q8AH 5IQ7H 1FV1B 5FW6A 1F42A 3BZEB 1DQLH 3QDMA 1QUNB 2J88L 3DGGA 4XP5L 3MNWB 4MAZA 1PLBA 4MCYB 4TNWK 1NANH 1QG3A 3EJYC 3P11H 4R83A 5CZXD 1FZOB 5SX4I 3VSTA 4NPKA 5D7JB 4F7CA 2X1WL 4LFHG 2Z31B 5HSFA 3VRJA 3MCLL 3BLBA 4BQBA 2AEPL 2KZWA 2Y3NA 2MPAL 1KTJA 4FNTA 1A25A 5IFHH 3FNKA 3SDDB 4AUYA 5JLZA 2J1WA 1TPXC 2H2SC 2Y5QA 4NQCD 1AGCA 1J5DA 4FQCH 3EJQA 4G2AA 2XVGA 5DHVB 1E50A 2WWOA 5D7IB 3O8XB 4CVUA 5TE4L 2V7NB 5JHMA 4RCAA 5F1NB 5KSVA 1N8ZB 2FYYA 5HBBA 1ITCA 5IESL 4UTBL 2PKDA 1LJMA 2B1AH 3ZYIA 4XWOC 3D5OF 1Q9LB 2BINA 4M7KL 2J5LC 1LVEA 5ISZE 4W9DC 4H25B 4RFNC 4GKSA 4HJ0C 4HSQA 4WI8A 1HI6B 2EC9U 3X1GA 3GSVB 5AB1A 4O5LL 4I1PA 1BVKB 2PXYC 4G8AC 4DGIL 1AQ8A 4LQ1A 1NFAA 5EC2A 3B1UA 3UCQA 1H15B 4WO4D 4YBQD 1BQLL 4C4KO 4UYQA 3KL0A 4WJKB 2HPOA 2OYMA 3K7UA 1VGEL 1EEQA 1SOXA 1MRFL 1R47A 3OAYH 3VSQA 2BIMA 1WC7B 1XT5A 5INCA 3CFNA 3IS1X 5IEKB 1U3HD 3GNML 4D7BA 1SRDA 3D0LA 4L0PB 1IEHA 1NLBL 2GTWA 3V6OA 4UT9A 4DH2A 3FUKA 3ZTDC 3Q6FA 4WNQA 3TYFB 1I1FB 1XIWA 2BIHA 3B9KA 3NQIA 3ARFC 5T3XD 5LXVA 5D7EA 3QPXH 4RQQB 1N7MH 3BIKB 5IG7B 3MCLH 4PJAB 3RI5F 1UM4H 4FTDA 4OZHE 4AW4A 3VU1A 4ACTA 2X4QB 1G0XA 1IVLA 3L3IB 5LGJB 2AITA 3BO8A 3QDJE 4NRYA 4Q56A 4Q4EA 5CBEA 1T6VN 3ETBJ 1Y1UA 1JPFB 4LSRL 4M8RA 3SOBL 3TEXA 1PZBA 3BZ5A 4KK8D 2YO3A 1KCLA 4AI7A 3SQBB 4RZCB 1INDL 1ZD6A 3FAXA 3W39B 4GW5B 4AQ1A 4LHUB 5I0ZA 3JYBA 2CA4A 4GUCA 3GLAA 4G43A 4XCEA 3D12B 5HYJD 3ZIYA 2B9BA 4PPTA 1XH3A 3TA4D 2VZSA 2OX5A 1A02N 3SKMA 4U3CA 3UTSD 1QFWL 4I3RH 1AGBB 2FEDD 3FT4A 5HY9A 4YVNA 3NACH 3DLQR 4O2FB 4NUGH 1ET8A 3L5WA 3BZFA 5GHWL 3ZLQC 3SKOA 1MFEL 2ODHA 4K3EH 2ERJC 4R7DA 3QHZL 1WHPA 3FO2A 3QIBB 1DQDL 3JWOH 4MDIA 4RISL 1G6RL 3NZHL 1YMHB 1SHXA 4DFIA 1H3PH 2DH2A 4QF1B 2O5NA 3CBKB 4HGKC 4Z95L 5ADOL 1T89C 4B7IA 5H4ZA 5E1HB 5C97A 1EXHA 2P46B 1XF3A 2J7LA 4N5EC 5IHUH 4PAZA 1EUTA 2CGRL 2Y72A 2ESVB 3F64A 3L1GA 4K8RH 3W3BA 4X0KA 4YK4C 3PP3K 3MBXL 4LLWA 1HSBA 1IGJB 3AM8C 3UPRB 1B2YA 1ZA6A 1H3UA 4NO5B 4YMPA 2WUBL 4IDJL 1ORSA 2AMGA 2R2HB 3TBYA 1EUUA 2WLLB 1ZTXH 2C3XA 2VITA 4KK6C 1MFNA 3FOMB 4R4ND 2DMBA 4U1KB 1M6OB 1M3JA 3OXSA 1NOAA 4YSQA 5DRZB 2NR6D 3BGAA 4G9FB 1R3KA 2Z35A 2IBGA 3CH1A 1CU4L 2D4FA 3UP1A 1M42A 1BLNA 2WMPA 2VQ4A 4P8QA 3DSFL 1TOXA 2AJ3A 4Q9RL 1KXQA 4YEFA 3ILEA 1B90A 2HCZX 3S5LG 1N4XL 2R56H 3CFEB 5TDNB 3EH1A 2WLZA 2DTMH 2E7BA 4JZOB 1UJ3C 1MWOA 1N9PA 2VXQH 1HOCA 4Y2DD 5B3JF 4UINH 4CNIB 1V10A 1A4JA 3QUML 2LU4A 2Z1KA 4QHUA 4F37K 3L3OC 1S7VA 4Q9CA 4EQ2A 4Z23A 4XWOD 1O5DT 2AK4B 1RIUH 3UO8B 2WIIA 2A6JB 1RD6A 4JZJB 2WWNA 5DRZA 3P3RA 2WQAA 4RGMC 4HUVB 2AJZB 4QIRA 1ZSDA 1NIDA 1F86A 3P3UA 5I66A 3NZ8B 3OLEA 4BQCA 4WV1C 3N85L 4FZEH 5I76B 1YUKB 4V1DD 4JKMA 4KRLB 3K6SB 3KW8A 4X4ZA 2ESVA 4ATWA 5EEUA 3HJEA 1KXVA 1T22B 4IBQA 4X6DF 3K6NA 1N12A 3O45B 1XSKA 4L4VB 4AXWB 3TVMB 4B97A 5JOFA 3MUUA 1OV8A 4P46C 2CUMA 4ZFGH 5HHME 5I8KH 1EBPA 1OOWA 1NIBA 3QG7H 3APNA 5L7XH 4AQ8A 3QJRB 4MA7H 5DFVD 1KTKE 3SY6A 2PR4H 5BPPA 5TK4A 3E80A 1KG0B 4GBXD 3CHXA 3TN0D 3GKZA 5MENA 3PWUA 4MQSB 4XCYA 4FNUA 2PUQT 4JFOA 3KXFA 4MASA 3KPRD 5AKRA 1UVQA 1MW2A 1NM4A 3CDZB 2BOCB 2PWHA 3ISRA 1AHWC 2O72A 2O6DA 3MLUH 1NCOA 5A2CA 1M7XA 3ZKNC 3BZFB 4OD1H 1IQWH 3CSPA 2YRZA 5CFHA 3PUUA 3TL5A 4HFUL 2XQ0A 4M5YL 4GAGL 2NLJB 3GXPA 4WUUA 2CO3A 4Z7WB 4F33B 5HP5A 1F6AB 2XZAH 3K74B 5D70H 3T3MB 2IDUA 3NSXA 3DUUB 5AZEL 5E51A 2C9UA 4ZMQA 3BPOC 4YLQT 4FQJH 4QT5A 3SYPA 3GSXB 4XNUH 2WUCH 3C5ZC 4JZNA 5FM8A 3X14A 4YR6B 1K4DA 1U9KA 3HHSA 3OHMB 4A2DA 2FJGA 4Y16D 2H1XA 2YEQA 1A65A 2JK5A 1QKZH 4DP4X 3BQUB 2MJWA 3BO8B 3C75A 3NDZE 4JE0A 4A68A 4NO0A 4X8JB 5GRXG 1CFSA 1JPGB 2OMXA 1PDKB 1CD1A 1UGKA 3NIFF 4KKBD 4P57B 4RGND 3AT8A 5BJTB 3OL2A 2ARJQ 1RURL 3B43A 4P59H 3MACL 4DERA 5IG7A 4YX2L 4B9ZA 1MFAL 4JFEB 2HH0H 3NFPB 1Y0LA 2JKTM 3ARGC 3LKPB 4WU7B 4PJEE 2VSKB 2W07B 2X6MA 1FPTH 2YRBA 2ZXDA 1P1ZB 3EBHA 2HG5B 4TNWF 3KPLB 1LDPH 3OB0K 4JDTL 1JF5A 1KULA 3CVIL 1OAJA 4AEIH 2QR0A 5BO1L 3D0LB 3MRPB 3T6VA 2YPLE 1DQJA 1I9JH 4NHCH 3B2XA 1S6NA 4HCRA 3T0XA 4YPGB 2VXTL 5ILTH 2VNCA 4WWPA 2WZAA 4BSWB 4W9IC 2EDXA 3S36L 5SWSE 5JHDA 5CMAB 1RZPA 5BXFB 3F85A 4WI4A 3QUMH 4YIQB 5EC2B 5EU7C 1BPLB 3RGVB 4L8CA 4P2OD 4LO9A 3ZDWA 1J0ZA 2P5EB 4YFEA 3QEUA 4YHNB 3UG4A 2EINB 4FXGC 4O9HH 3NIDB 3PDOB 1XH2A 2JKJA 2X4TA 1JERA 1F4YH 4YLCA 5GS0L 3JUYA 5TH2A 3SCMB 1RHHA 2WANA 4PJ9B 5D7SH 4LB8A 2RCSL 3CIAA 5CJQH 3AXHA 3QJVB 4NQDB 2L0DA 3KS0J 5JW4R 4KNSA 1KNOB 1LP9A 5AEAA 1FORL 4N5ED 5SWQA 1DUYB 4HZAA 2VL5B 3V6ZB 3VFUB 2PYED 4XXWA 2DB8A 3QUYB 1JIBA 4N0CC 4NQED 4I9WE 2DD8L 4DO6A 4U33A 1OQOA 1HDMB 4DUXA 2CKBB 4DEPB 2FL5A 3S37L 4YDKH 2XTSA 1YEDB 4W9KC 3V5DA 5AVUB 3P54A 3BLKA 1CICD 1WZKA 3WIHH 3ULVF 1BEXA 1MFCH 4Z0XB 1ET5A 5I1CH 1CGWA 5E6RB 4D8PA 1YMMA 4GEIA 1NEZB 1K8IA 4U7KA 5I9QB 1PLCA 2IDCA 4FTVA 1P84K 2V2WA 4JO3L 2FLMA 4KTGA 2HX7A 4J3UA 4G8FB 1F90H 1SFHA 4AJ0A 1JYWA 1DQIA 1MAKA 1TF4A 1MIEH 3LVTA 2DLIA 1J88A 5F9DC 5ESAA 1QRKA 15C8H 4ILDA 2ZXBA 1S7XB 3KPSB 2C9RA 2XWXA 1BW8A 2FQDA 4WGWB 1YNKL 5DEZA 3VX1A 1ZPLA 5JMOC 4H44C 1B4JL 4DGVL 4DSYA 2VR3A 3KM2A 3B7RL 4IRJB 5H8DA 3GSOA 3FT3B 5AD0B 2OKMA 1PDKA 5C0AA 2QPEB 4QOKA 3ZKND 2VH5L 3CJJA 1X9QA 2HVJA 2ZXQA 4GUPB 3OKEB 5CJQL 2NT0A 5K5YA 4FZEL 1MWAH 3H56A 4M29A 3KNBA 5L9DH 1FG2A 1JWSB 2GC4C 4ANXA 1T83A 4AH2A 4L5FH 1HL5A 4TULH 4Y1TA 3SE9L 2W1NA 2DM7A 1DEEA 5DVOA 3X14B 2ZJSH 1BVLA 2KDYA 5BOZG 2IH8A 3D87B 2D3JA 1C12B 2XZQL 3VAEA 4WJ5A 1HE7A 1IARB 2F61A 4AGPA 2YGVA 3MRRA 4PV9A 4QO1A 1KJ3L 3SZ6A 5HGAB 3H3PH 2GJ6A 2VMDA 1R3HB 2EIKB 4WWKD 1J11A 4Z7WA 3MCKA 4MMXB 3BWSA 4PJ7B 4D9QD 3ZE0B 2V3EA 2DEWX 5C92A 5CJOL 1WITA 1T5KA 5AVSB 4KKBC 4HEME 1D5MB 1FH2A 3VXNB 3PAVA 3HAEG 2P80D 4KTYA 5TE7H 5GIRB 3ZR6A 2WQVA 3KXFB 2YGOA 4NQSA 4YK4B 4LCCC 2WWKO 4WK2B 1IBGH 3COOA 5E6YA 5I5RA 1E9QB 3QZMA 3OKOB 1TETL 4U7MA 3RURA 1JTTA 2FR4B 3NZHH 5EU5B 3TBSA 3L3OA 1JPTL 2ED8A 2G4EA 5F7HA 1IMHC 3DROB 5JA9A 1Y18B 4L4VA 5F97E 4AXWA 1FZMB 2DWXA 3DUSB 3HBZA 5IUCA 4AL8L 5HGAA 4H2CA 4NJAH 1MI5D 1J9QA 2NNRA 15C8L 4L4TA 4E41D 4PTTB 4H5SB 2TRHA 4KK6D 1CICA 1A5FL 4LCWD 4HUKB 2ZAGA 1AZBA 4Z95H 3AFLA 2PO6A 4GUOA 1DBJL 3PFQA 1SYVB 4CJ0A 2VN7A 2A77L 1CFBA 4HOMA 2OAAA 5MI0C 2YPKA 1LQSR 3V4UL 1LK3L 1M7IB 4UNIA 3WFEL 3X13A 1JN6A 1B0WA 2JXMA 3INOA 3QWRD 4GKLA 4PJGB 3IGLA 1HEJC 2QV4A 4LPCA 1LHZA 4O4YL 4XPHH 4X6CA 3ZE0E 1P5UA 1XQ4A 1GY2A 4EI5D 1JYXA 3MOQA 4Y4HB 2CLVA 2UX6A 1HOCB 1TCRA 1M57B 2Y07L 5CCKL 2FB4H 1FLTX 2F53B 1A0QH 4BRJA 4L05A 4CU8A 3ECWA 3RQ3A 3CN1A 2CHXA 4FERA 1JZJA 5CLZA 1QFWI 3UTQA 5DD3H 3EO1B 3NG5A 2DLGA 2UWEA 2Y1ZA 3HKFA 4MS6A 2I9TA 3G3LA 2H0JA 3L4XA 3ZU8A 2Z35B 4PVLA 4G1MA 3UZVB 5EBMA 1O6TA 3C09B 4XBEL 4FFWD 1YDPA 3AMKA 1WP6A 3V7AG 2WLIB 1BIHA 3LIZH 4TLUA 4WI5A 3STBA 3MOAH 4O9HL 4XCFL 4BIKA 1SJEA 1ZA6B 2H6OA 3EGDB 4AL8H 5ENWB 3UPRA 2VWEE 1R5IB 3FB6B 1M2VA 3BT0A 5G5DA 3BIAX 3T0EB 3RVWC 1FE8H 4M7LH 3W11C 3QR2A 3WO4B 3O6FA 4WHCA 1VA9A 1P4BL 1MEXH 4ZW7A 1IGYA 4MBOA 3A5VA 2N7AA 2UYLA 2VDKL 5DSCA 1LGVA 4F2FA 4U05A 1HVXA 1GW0A 4OUUB 5I19L 4M61A 2O26U 4WRLA 5CZRA 1J1OH 4Z5RA 1NOLA 4KC3B 4IMLB 3P0VL 5BZDA 1KJ3H 4AV5A 4JMNA 1WIPA 1IX2A 3QIUC 4HMEA 3TNNB 3ARWA 2ZX9A 4NJ9L 5G4MA 1AFVH 3ZZLA 5FEBA 4XPGL 3EH5B 3ELAT 4FMVA 1UCTA 3WDHA 4YHNA 4ODVH 1DE4A 2X28A 2DI8A 3QR1A 4QTFA 3NIFB 2QHLA 5E8DL 3SDXF 3ZHDA 2OX5B 3K4AA 1N5YH 3QJZA 4N25A 3DBSA 4OZ4A 4B0MB 4L8CB 2PABA 1RU9L 5I6XB 2KH2B 4ZO9A 3OHXB 4GW5A 3FF7A 4IHBA 4M6NH 4AM0B 1NCGA 1NKRA 2CUIA 3AW5A 3SQBA 1YJDC 2A74C 3QDJB 3VJ6A 3HLAB 4EIZC 4QRRE 1RUPL 2YAMA 3GLEA 5IHWA 2FIKA 4MXWH 1N67A 4ALAH 3HHMA 3HC0B 3NCBB 5TDOA 5EOCL 4EKXA 2QR0B 4TL5A 4X4KA 4RGNC 1YECL 4TF4A 3DJZA 3GXTA 1OAZH 2CSPA 1YQVL 4APQA 3V0HA 4FFZH 1TNNA 1Q0XH 2BW4A 3IMVA 4MFHA 2R0WL 1QTYT 4NYLA 4NRXB 2SEBA 2V5RA 4WFGE 1KCRL 3HC0A 5TDOB 1PFCA 3EJZD 3FC8A 1HYSC 3FQ4A 4LLVB 3RWJB 5CGTA 3TYFA 4PJCE 2K9UA 1SZNA 1T20A 3WLWD 4PRBA 3P9LB 3OHXA 2ZXAA 4NC1E 5I30L 3MV7D 1QA9B 2R83A 4MNGE 2F15A 3BQUA 2JTYA 3UC0H 3WD5H 3ZE1B 3RVVD 1TMCB 2BO0A 3GO1L 2DQDL 2R69H 4LKXA 3GINA 2EYSB 3BFWA 5INCB 1NINA 3Q9PA 2FIRT 3BLPX 2RHEA 1SJHA 3ORJA 4LSRH 4ZMPA 2NY0D 3ZO9A 5EU7E 3REVA 3TNNA 1KJMB 4RMTA 4X5WB 5DJ0B 3S96A 3ZT5A 5KBLA 3KJ4C 3MRGB 3BX7C 4X98A 3RIFF 2GUOB 3TC9A 1F4XH 1DLHB 2OL3H 3PIQB 1FBIL 2X6BA 3IE9A 4KVCL 5F0MB 3UC2A 4WFEE 4ZFOL 1F0LA 3FQWA 4QRRB 4UOZA 3DXAB 1HS6A 3D39B 1IAIH 1G5GA 1CDGA 1GGBH 1XGTA 4HK3N 2YOAA 1YYLL 2YQ3A 4M43H 3ZKMC 1L3NA 1NGYB 2FBJH 3DKHA 5TGBB 3AG1B 3VG9C 3QYMA 3EW3B 3O8XA 4X6FB 4IEFA 3K91A 1URZA 2H0PA 4AVJA 1JXKA 1CTMA 4HQQL 2YUVA 2MQ3A 1F2QA 5DZPA 5BOPA 2G3MA 1E4HA 4QHLA 3GXNA 1NH6A 3HNSL 3IDUA 4JGMA 3FB5A 1SOSA 3V0GA 3TV3H 4ZS6D 3DX4A 1FDLH 3WKYA 1IFHH 4ZTEA 3VXRD 1ZXQA 4FDWA 2BERA 3K0WA 3KL3A 4WU5A 2HVKB 2IWEA 4FP8L 4AMKL 2VJXA 2GY7B 2DRUA 2GJPA 3BUIA 5FPIA 4A2EA 3IU3A 3UG3A 4NDMA 4XODA 4XPTH 1PS3A 1HCZA 1JZ2A 3EO1A 2JKWA 1AZVA 2I9TB 1K72A 1G5AA 5HYJA 4E9XA 3QT2A 3VM5A 1BFTA 4BWUA 1JZ6A 4JZJA 3S4SB 5KJ7E 2P5PA 2UUDK 3EOTH 3HKZA 4HDIB 4G6JL 2R4SH 2EVFA 4IU2A 25C8H 2VDML 2BNQA 3G6DL 2OJZH 4NB7A 4YHIA 2QADD 4JFDE 4X6EA 5CO1A 2HT2C 3TT1L 3VXSD 4ELKA 5IHZB 3T2NL 5I1IH 3IMBA 2XBDA 2X53A 4TOYL 3C9NA 3KWXA 1SYVA 4JKLA 5EZOH 1EHLH 4TVPE 3UDWA 1S78C 4P2RB 3SGKA 2WN3A 5CCJA 2BSED 3ROOB 5MEQA 4UM8B 1ZLWH 1M9SA 3MRCA 4YSDA 1NDGA 4P3CL 4NNXB 3WTXA 2FX9L 3HAEH 1PSKH 2NW3A 3HNSH 3SSGA 1M6OA 1I8IA 5JUEL 3NP3A 4OD2A 4N2CA 1NC4B 3KD4A 3HTLX 5CIPA 1Z7JA 3OB8A 1FHGA 2XKUA 4RGNB 2C9XA 4DGYH 3BDYH 3IJEB 1UT9A 4YQXH 5C0DA 3V4LA 3OKOA 5JW4M 5CGYD 2J57A 4U1SA 4G7VL 4NN6B 1GL4B 4S1QL 3P30L 2ICEB 2HLAB 1LD9A 4L4VE 3VU2A 2F8OA 3FO0L 3N04A 2O61A 2WO4A 1D7FA 3NTCL 3AQDA 3BUDA 2TRYA 3G6JE 4P3WA 5AW6B 4ISVA 4PJ7A 2XTLA 3MCKB 4MMXA 4YHZL 4DP0X 3DXAA 3FQ2A 5K93A 1E7UA 4PRNB 1Q9KB 5IVXA 3BJ91 3RZCB 3T0AA 1L0QA 5F7AA 4OCXL 4OGYH 4WJ5B 3RNQB 1KYAA 3HRPA 1GZQB 3OKYA 1Z5LA 4O2EB 2Q2LA 3GRWL 3BUTA 3M07A 3VA2C 1XXDC 2HT3D 1TNMA 1II4E 2Z4TA 2XYCA 3MNMA 1BIIA 2UZPA 5BVJB 1BMWA 3ZUNC 4PJEB 3AB0B 3MC0A 3FUNA 3EYOB 4A2FA 1NCBL 1VEPA 2IFGA 3HG0A 1HH9A 3FJTA 1C7SA 4OI9A 2BSBA 4MNHB 4URTB 4IRJA 4KI5D 1RPKA 4TUJA 4UT6H 3SQOL 3FU5A 4GUQA 5F88A 5KTEL 1IKNA 3IMRA 4ENEC 4G6AD 1X9UA 4K5LA 3WS3B 4NYLB 4PG2A 1T0NB 3QWNA 2WHVA 3CLFH 4P2OB 3UX9B 3ZKMD 3NSCA 2BNQD 1BECA 4ZFOA 4LEBA 1JZFA 3Q8CA 4FI6A 3BIKA 1A64A 4QAMB 3WTYA 2N0KA 2P24A 2VLJA 1ZT4A 3HUJA 4AQAB 3QIWA 2QQLH 4XMKH 2W9DL 4KNQA 1NCCL 1VHPA 1QAWA 1MEXL 5F7YC 1NCDL 4PVMA 5JHDE 4NUJA 4BGLA 1FSKB 1BG1A 4R5TA 4BH8A 5KYWA 2GTWB 2YGPA 5T3ZD 3ESNA 4K94L 4RESB 1XZ0A 4OZIB 1CGXA 3ET9F 4H0LC 4X4ME 3QUYD 4UQ2A 1ODUA 3A4AA 3IXTB 5GS2H 2EE0A 5I5JA 1NBVL 3CK0H 3TO4C 5F1IB 5FB8A 1WFNA 4KOBA 3PL6B 1WA2X 1KCKA 3HZVB 1XV8A 2GEQA 1W8OA 3QO1B 4MNQD 4TQHA 4OU3A 5KBKA 2GYSA 4B5EA 3RU8H 1QLEH 2WWMD 3VO0A 3KLDA 4QKXB 3VQ1C 2MFNA 1RH8A 3B83A 4GAYB 1Q9LA 5C3IA 4XMPL 4LSQL 1YEGL 2VLKB 1SLXA 4F3FA 4JLRA 1NC2D 4N2AA 4MD5A 1MCBA 4LCCA 5AZUA 4YNYA 4W4OC 5D7IA 4XCFH 1SVBA 1ZVNA 3H7BA 2FATH 1G7HB 3T0EA 4R4NC 4YXLH 3V0VA 4XC1H 1ILSA 1FVCA 4HIQA 1MH5A 4P2QA 3B7TA 5T33L 3WXVH 1WUZA 5JHDB 1FZOA 1NSNL 3QDHA 3V4VB 1B88A 3QISA 4MCYA 5HVWA 4YAQA 2XNAB 5AW3B 3ZYJA 1L9TA 3IYLW 1NCNA 3N55A 3T8VA 5E6IC 2YEZB 3O3DA 4ABQA 4TVPL 1GC1C 1TJIL 1NCIA 2NY6C 4HK3J 4QRSA 4X7DC 4NQXB 2FO1A 4NZTH 2VLME 4WFFE 2RR3A 2ZUQB 4L8DB 4Y2DC 1G7JA 4MQ7B 4BCXA 2EDTA 1QBMH 3EJCA 2OR8A 2ZUXA 3F7YB 4I2XA 2PP8A 4KDVA 3PNWB 5GPRA 3RWHA 2X87A 4MWFB 3FUJA 2BZ7A 3CQPA 3GMLA 4JFEA 4XPGH 2G9KA 2BP3A 3BH9B 1OLLA 3MUHL 3AU0A 1CD1B 2QGEA 1KPRB 1SEQH 2YR3A 3RIKA 4ODXA 5CJ5A 2Y06H 3SPVA 1L6ZA 2GBVA 3X13B 3QA3A 2EUWA 2JELL 3ZQ9A 4P5RA 4IOIB 2J6EH 4Q9RH 4LL4A 4MA1B 5D7KD 2AEOA 4M6NL 3UPCA 1YYML 4DKTA 1NBVH 3CK0L 1FL5B 1WFTA 2VXUL 3V55A 4IBVA 1U92B 1U0QA 1XGZA 4XO8A 3MFGB 4L3ED 3NJLA 3AUVA 5KVMC 3V6FA 4F8OA 1ZK5A 2J6WA 1FO0B 1SM3H 1F3RB 2A6KB 3QWRA 2VQTA 1J1PL 2YAOA 3KS0H 4JM2A 4DPBX 3APMA 3ZKQD 5DEJA 5J1AB 4LOVA 5TJWK 3DUSA 1NKGA 2C4XA 3IJHA 3SOTA 3L3OB 1TTFA 4UB0L 2W9DH 2F74B 1T7XA 5CKGA 3U0WH 4JDEB 3F12A 4GMSL 3HS0B 3CDZA 3UIZA 1ECZA 4KHTH 2EACA 1U93B 5I17A 4RWYH 2I9LA 4JZJC 4H26A 4DW2H 3E3QE 1WVZA 2WKOA 2NX5E 2XPZA 4ODSH 2JTDA 2GY5A 3VFMA 2WZ6A 1JL8A 1UXMA 4TXVB 1JRHH 1ZGLA 2ALWA 4J3VA 1GXEA 3WL9A 1BOGA 5KOVC 5GZOD 3ERXA 4RIRB 5DRNB 1JZ8A 1R3HA 5C6PB 1T22A 3TURA 4DKAA 5IK3B 4M5SA 3OWRA 1C8PA 2BHYA 4AVIA 1WH0A 3P9WB 4N0UB 2DQ6A 1Q0EA 4P2RD 4M7LT 1HTYA 4JCMA 1K5WA 3LEVL 2F1EA 2VDMB 1T7ZA 5KVFH 4PGJA 1F4AA 5IWLA 4PEEA 1VRSA 2BNRA 3EH2A 5AYUH 4D8OA 4JG0H 2HP4A 4PU2A 4BSVB 4H8WC 2WIIB 3MRMB 3FQXA 3SE6A 1ZVSA 1X9LA 5EPMA 1HCFX 1G4RA 4OF8A 3CD4A 2HVJB 4GFTB 5AZEH 4CC1A 4I85A 5DJ8B 5EULV 2CDGA 2AQSA 3HLKA 2EADA 2P5ED 4HBCL 2QQNH 3F83A 1NIFA 1X7QA 2ADGA 5E9AA 3LZFH 1G7QA 2IDQA 3G04B 1WG3A 3IGUA 3HMXH 3NSFA 4OB5L 4ZTOH 4MQXC 4CMMA 1IAII 3FUFA 1TO4A 2FLBT 1KLFA 5CD3B 3MI6A 3RJDA 2CM6A 2FCBA 5LJYH 1VKXB 3P30H 1Z32X 2D8KA 2X6UA 5IBLD 5J6HA 4PY7B 3LN5A 4G8GE 1Q38A 3OJDB 1MKFA 2QSQA 2FQFA 2HZHA 2V2WB 3T0EE 4XE0A 4N8CH 1S7UB 3KPSE 4YUEH 2HJLA 3QH3B 1NCAH 4U1KA 3U46A 1KJ2B 3PXJA 3RBGA 4CMHB 3OJVC 3UBGA 2VXVL 1RZ8B 5HVFB 3OMNB 3BPNB 3L3GB 3F5WA 5FO9B 1LO2L 4A6YL 1SMOA 3FRPB 5KVEL 5ESQA 5AVZB 3ZDZB 2OZ4L 5B39B 2ZPKL 4JQIL 3H4FA 1F8TL 3DPBB 5IHBA 3HZMB 5JZ7C 5E1GA 4JPWL 4K9EH 3L9EA 1ERNA 4QTHB 4M48L 1IEBB 4Y4FD 4LVHC 1GJWA 4BKSC 5SWQB 1JF6A 1ZHBB 2FNBA 4Y0GA 1EEYB 1LO0L 4MDIB 4Z3FA 2Q7NA 4DGWC 1YEHH 1NPNA 2BW5A 1MCRA 5AAWC 2OMVA 2J8UE 4HEPA 4EPSA 5KTEH 4PWIA 3QJSB 4JHAH 5GSRA 2HFFA 1L9SA 4DAGL 3QORA 3NJHA 2FTAA 4U3XA 3VDBA 4EIUA 1QSZA 1MCFA 5HHOE 3RP1A 4L18A 4OLZL 4XBGB 2F54A 2P42B 1OWRM 4WO0A 4KQ0A 4OBRA 4RX4D 1Q8MA 4NCDA 1MQKH 3HN3A 5E6SB 4U1IA 4N5UA 3C87A 3D0VB 2GVYA 4UTBH 4NZTL 4AITA 4J3SA 3N40F 2JJUA 4AQ1B 3RE0A 8CGTA 5FYKL 5ICZB 3UJJH 2DQTL 2X09A 3C8DA 1OE2A 4HWEH 4YPGA 4FYRA 5GRJL 3S34L 3AWFA 2KC0A 3QO0B 3ZZQA 3QGVA 3SYOA 1DQJB 1JPFA 1MY7A 3ZDZE 1WCQA 3TZVA 1OVZA 1IM9A 2WZ0A 1A6AB 5T1MB 4J3OF 4DNLA 5D7LD 4G82A 5C08B 4ODWA 1P1ZA 3RJOA 2CG9X 4HHGA 3ATBA 1ZA3A 3UBXG 3Q3GA 5DWUL 5ITFB 3MV9D 4XAKE 5C0IA 1F13A 2X7LA 5E0QA 4G7RB 1OSPL 3D4GA 2VERA 4BSJA 4TTGA 3ML8A 4QUOA 3MLYL 4LIQH 1RMFH 3CSTA 2DYSB 4YDIH 4KFZC 5FFLA 1SEBB 1BD2D 3IFNH 3BKCL 5I1HH 2VMJA 2P5WB 3CVDA 3I75B 4LCYA 3TPKA 1KWKA 3HCVB 4K3DH 2UY7A 1HOEA 4PWEA 5T1LB 5L6YH 4M7ZB 4POZD 3DXAE 3CVHL 3H42L 3D3VE 2F53E 2WXQA 2AERT 1H15A 1MCLA 1FFPA 1XB6A 4MNGB 1GSKA 4P4RA 4OFIA 2WXIA 5BZWB 4N8UA 1BEYL 4LF3B 4YZFF 2AV7B 2DWDA 1F6LL 1QPKA 1HKFA 4XMLH 3A6OA 3K72B 1F6AA 3OC8A 1DFBH 1W72H 4LOEA 4PCYA 1INDH 2L3BA 5D2NC 3JV4B 3S48A 1K6QL 3DX8B 5EEXA 4FGMA 2EE3A 5KSUB 3LZQA 5KUMA 3ZRFC 4L3FA 4MA3A 4AYFA 1BGXH 1UVQB 2F7PA 2G3XA 2BNRE 5DHYA 1DR9A 4F9PA 3PWUB 2DL9A 1AGCB 2VDOB 2PP7A 1E8YA 2D9QB 2J25A 2KZBA 1GYAA 3SDDD 4P9ML 1DN0B 2BCKA 1JWUB 4R8WH 5HPMB 3EXJA 1CLCA 1KBVA 3UOAB 3B2UC 4EZLA 4U6VH 2B20A 1B9ZA 5T3XH 4ERSL 3OJ2C 1RIHL 2E86A 3CV5A 1TPXB 2GSIA 3GK8L 2XVKA 1HN1A 1IEAA 1UM5H 1EHAA 3WFCL 3QUYC 1G9HA 3DK2A 1UUNA 5B8CA 4ZW3A 1MNNA 3O0RH 4Z77B 1CDHA 5I76A 3F6JA 3IFPA 5EU3A 1TQBC 2XHNA 5J89A 3D3VB 5EEYA 1ZSDB 4JFDB 3U6RA 4XCNA 1XAKA 1S5HA 5F89A 5DYOA 5HGHB 3EHBC 4G5ZH 4R7XA 4XVTH 3HC3L 3QULB 1IFHL 5BNXD 4GT7A 5L8KB 4ZFZA 2GUYA 4WWKA 1LEGB 1HXMB 2PWDA 5HJBA 1V3KA 4AENB 5DMKB 5EIIG 1NCTA 1I53A 5F9WB 3G08B 5AWNL 3TEUA 5BQ7A 1GAFH 3CXDL 1OP9A 2W94A 5IVZB 2XA8L 4XRCB 4I0PA 4AE1A 1SVCP 2J88H 3ABMB 1PKQB 2OYPA 1T21A 3DVGB 1YN7A 1H8LA 3IJYA 2WMPB 1BLNB 2BY1A 3KBHE 2IXQB 4OCLC 1DFBL 3U4AA 4NO2B 3ULUH 4MX7A 2IBBA 2PR4L 1KGUA 3MA9L 2IANA 4GQRA 1M4KA 4UNTA 3T6WA 3U9UB 1U42A 4IS6B 2DKUA 3X12B 2ZWYA 2D03H 2OK0H 3N1FC 1I8AA 1NKOA 3CFCH 4FLSA 5I5IA 4OVVA 1ACXA 5C0GB 5HHPA 4XP1L 3WUZA 3KR3H 4M5YH 4W9CC 1XSIA 1UZ8A 4JHBA 4OTXL 1KELH 3P77A 3UBHA 4NENB 3LZOA 3NDYE 2ZT9C 3L2MA 2GHWB 1N3NA 1I8UA 3E6HA 2JJTA 1UG9A 2H26B 4HXAL 5BRPA 1KEGL 2R2EB 1WWBX 3UGXA 1F11A 2Y22A 4R97C 3GRWA 4E2OA 3IDGA 1TQUA 2ZYRA 3JTBA 2YN3A 1CQKA 4DVBA 4PSRA 3FQNA 5SWSB 5JA8B 3CC5A 2YRPA 5IOKA 5ACMA 3U0PB 4LFHD 1YEIH 25C8L 2QPUA 3O9WD 4J8QA 5FGRA 1T1WB 2Y7MA 4ZMYA 5IB4B 1QSFB 3HE6D 1RQ5A 5AG9A 2PTTA 4XVTL 2VDQB 2ZWKA 4QHMB 3Q6GL 5DUBB 5CEYB 1O9VA 4QNPE 1S9YA 1LEKA 2W0LA 3D39D 2AABL 3V7AE 1L6XA 4N0RA 3VWJB 3ZHKA 4U3SB 1NIAA 1NFIA 2BSEA 2ED9A 5AW8B 1I7UB 5CEXA 4PBWD 1DJSA 4DKFL 1YNLL 3WIFB 5FW7A 4HV8B 1RFDH 3WOVA 2CJTA 4P9HH 1JFQH 2NY0B 3AAZB 1PD0A 2IQ9L 1IZJA 2UVFA 1KPUA 3NAAH 5LLIC 3TBTB 3L1OL 4BKLA 1BM7A 3H2WA 2Q3ZA 5EBLA 3H7LA 5SX4H 1GYWA 1LO2H 2WQ8A 5DJ6A 4A6YH 5LGJA 1NLDL 4H1LB 3UO1L 1VESA 1VFAA 3S36H 3VQ2C 1MFBH 1HAWA 5JIIA 3GMNA 1LDSA 4KO6A 2VYRE 2Y7QB 3IB4A 3TCLB 3W9DA 4OAWB 2NY2B 1XVSA 4NHCL 4LKCA 1E5BA 2PP9A 3RVVC 2E3VA 2MEJB 3C6SA 3Q6FB 2OMUB 4I18B 4PJ8B 4QTIL 1IM3B 4PLJC 3D6GA 4WCYH 1AIZA 5AW4B 1YO4A 1YZZA 2WXKA 1HWGB 3LPPA 5F7LB 1SHSA 2DAVA 1CLZH 1S5IL 1YEIL 2YMTA 2XY1A 2O1AA 3CFKA 1URIA 2B0SH 4JG9A 4OJFH 4UT6L 5I8CA 4F7KA 1NC2B 3LRGA 1BVOA 2DMKA 5CN2A 43C9A 2X4UA 4JANB 1T03L 2P8MB 4WK0B 4S1DD 3QUZC 1F45A 1KJVA 3C6LA 5CR8A 2BNUB 2Z9TA 1G7LA 4KJPD 1KCWA 3L4UA 1JYVA 1RUML 1TZAA 4TPRH 4G42A 5A7BA 4P04A 1OSZA 2GKIA 4JFYA 2R39A 4IM8A 5BMFH 3FT1A 3KXFD 3EYQC 5KSAC 2ETWA 3UL4A 4YDVA 3NIGB 3OQ3B 5KSVB 3MLTB 3O2VH 2V17H 3ZTNL 3VDCA 4S10A 5IROA 4BA0A 4P3DB 1P7HL 5CSGA 1JPSL 4ZFQA 5C8JA 3HI5H 3N3EA 3EFFB 3GXMA 4HJ1A 4MXQC 2Q76A 4CJ1A 4RA3A 5D7JA 4F7CB 1QI5A 3O3AA 3TCTA 2FUTA 3BI9X 5IGXL 1HQRB 3WFZA 1HXYB 3BQUD 5E1QA 4APXB 3S5LA 2H2SD 3U1QA 1UA7A 2FLRT 3VI4A 4GY4A 4M6AA 3HG4A 3HZYB 2Z64C 3B9KD 3J7HA 3ETBF 4R4FH 1CFNA 2PCPA 4CADB 1F4YL 5GS0H 4JFQB 1XB8A 2Z92A 5K9OA 5EOTA 1GJIA 4N1HB 4PJFF 4KNTA 4ALAC 4IRSA 2BFVH 1UCBL 4ZQKB 2Z4QB 3CZEA 2Y7LA 5JPMA 2VLJE 2HT2D 4JHAL 4L1DA 3QNZB 4JPVL 1EMTL 1RZFH 2BH0A 1IGTB 2R0ZH 4YN3A 4JFXA 5GRJH 4XX5A 1E4KA 5L2JB 1F5WA 1SUHA 3H53A 4HWBA 5E9DB 2H3NA 2Z7YA 3AQZA 2ZONA 4X4XB 3FXIC 5M95B 4WI3A 3ARFA 3TJPA 5ID0A 2DZEA 5F9WC 4ZG1A 4Z7VF 1GCYA 1DVFB 4JFXB 4MJ2A 1ES0A 3U79A 5I1GL 4LLDA 4WSJA 2BRQA 2VGLM 3GMQB 1FZJA 3ELQA 3QXTA 1OCWH 4GG6F 5JTWA 5G4NA 3FCUB 3ARDC 3DRTA 4JFSA 1OHZA 5EOTB 5FV2A 1LNUB 4OV5A 1MHPH 4N85A 4OKVB 1NFDF 2EDFA 4GRMA 5T5FH 4DN3L 4U0RB 3QUKB 4ONOA 1CFNB 5C0CE 1BYNA 3TO2A 1ETZA 3ZXAC 4NIKB 5JHBA 3NA4A 3L4CA 2GI0A 5K9QI 3ULUD 1N18A 3JWDL 3G6AA 1COBA 3TVMC 1ADQA 4F2MA 1HXYA 4OQ1A 2LLLA 3TYGL 2V9QA 4N2GA 1WT5C 2EDNA 2FBJL 1DQLL 5J6GB 2PYEB 4GQZA 1NMBH 5E95B 3RVTD 3STZB 4FQXC 2A9BA 1Z9NA 2ICCA 3RVUC 1T6WA 5EA0H 2AQ1A 4JO4H 4TNVF 4HZLA 4EIGB 5ACZB 1JD7A 1LWRA 1D6VL 5TPWH 1FL6B 3R0MA 1M1XA 4X5XA 3VG0H 3CSYB 2EYTA 3BP4A 5F8QC 5ADPH 1E42A 2VDPL 3BP6A 4QRPE 5B7EA 3X3GH 1KGJA 3QZWG 2K6ZA 4J3WA 1FYTA 4YXKL 4YFDB 3L16A 4HPOH 1TU2A 1FFOA 4HISA 3T8MA 1QQDB 2BSTA 2IFFL 3GWJA 2EDKA 2FJHA 1CLYL 1K6QH 1TCMA 4Y4FA 1LMKA 2A77H 5FO8A 2PWGA 2I32A 2QPDB 1A6VH 1NC2A 1EJ8A 2PCFB 1X7SA 3NZSA 5K39B 4L9LC 3U2SB 2W65B 2LTQB 4WTZA 3HI5L 1HEZB 1KBWA 4UDTA 3NVQA 2Y5TA 1UACH 3SJVD 3U2IA 4HFWA 1KB5A 3RWCB 1JHKL 4BZ1L 1GYUA 1WWAX 5IY5B 1TJGH 3TJHC 1HILB 3TWCL 1UZ6F 2Y6TE 32C2B 2ZKXA 4AIZB 4BELD 3Q43A 4FXTA 2CKNA 1CD8A 3OXRA 5DCCA 3HI6L 3EBGA 4RRPG 2C26A 1VFMA 5DEGA 2ZCZA 3W1ZA 1BV8A 4JQVA 2H6UA 3WN6A 4HW6A 3WN5A 4PRDB 1P7QA 4JFFA 3SKJL 1XR9B 1DQQB 3HC4H 3TLRA 3QQXA 4JN1L 2GAZB 1QWUA 3IMUA 4XAWH 4IKLA 4M00A 1TEYA 3AAZA 1I82A 3KYKL 3LRHA 4HFWB 5J3HD 2VTFA 5J5EA 2BP5M 1FUNA 4D3CH 5A6IA 1IAKB 2C9VA 2OMZA 2ZX7A 4DP8X 4J4PC 2K9FB 5E2VL 1L7TH 1NFIB 4FQ2L 4G6KL 2GJ6D 2N59A 2Q7AA 4IBZA 1MCOL 4JK0D 3RB7A 1E9PB 3SGKC 1KCVL 4JRYD 3LRSB 4ZUTA 4R7LA 4FXGB 3N44B 2AGJL 3P4OA 4LDEB 2PMZA 3LH9A 2AXJA 2F1AA 3VW3H 3ZHNA 3IDIA 3DO3A 2YXFA 3QCUH 4X9GA 2WNWA 1OGAA 4W70A 1EO8H 1JCVA 2UUDH 2TSAA 4Z3GA 4Y5VC 2APXA 3L5IA 1FYTB 5CLTA 2CNZA 3MV01 3Q8BA 4JDTH 1LLAA 2ZPKH 2BOLA 1CT8B 2V7HB 4ETQB 4ZW8A 1HH6B 1UHVA 4NM8L 4HHAA 3W38A 5F7KC 5ICYA 2H26A 4C8XA 4OCNC 3CZLA 4QXVA 5H35B 1N3NB 1GMIA 4EBQL 4HZLB 5HYSB 4PW4A 4HIPA 4PJ8D 4JO2H 5FV1L 3TH4T 4DHLA 3HE6A 3BPLC 4NHUA 3KPNA 3KWVA 2HB0A 4PBVC 4XGZB 3JTTB 3I6LE 1DCLA 1J48A 1QFPA 3RUGE 4BFJA 4KXAA 1C5CL 3GMRB 4PRIE 4FHBD 1AGFB 2NY6D 4K73A 5E8OB 2JMRA 3CZJA 2IH1A 4G8IA 2V2TB 1SXAA 1HZHH 3BEVB 4A7UA 1H3PL 2QKIB 4XNXH 1VF5C 1B4JH 5E2WH 3HMXL 4O58H 3U9UA 5C0FA 3SDAC 3UH8A 2IANE 3TVMD 1EXUA 3ESOA 2D7MA 3PGFH 4YXLL 2C3WA 3L5XH 4NQTA 4NNPH 1M2OA 3VGGA 2HG0A 2BIQA 5F72S 1AMXA 3O41B 4YSUA 4OSUL 5CJXA 3RVUD 4XP6L 1J8HB 5L8JB 3MA9H 1TQWA 2O5XH 4QDGA 4BQ9A 4PJAE 3MJ6A 2FEEI 1ASPA 4AYEC 3L3JA 4JG1L 4LPTA 3SE3A 5FYJL 5ID0B 4IRJC 4WW2A 3CZNA 4G1EA 4ZMLA 3MUY1 2IBZY 4TPRL 3IJSA 5KG9A 5B1JA 1ASOA 1PBYA 4GRLA 3RWFA 2OL3L 3GGWA 5KS9A 3NCWA 4X4YA 4PREA 2N7SA 5GHWH 4ZUWB 3OBAA 2ATKA 4PP2A 3O8XD 1FZKB 3FTZA 4YHOH 1E5YA 1N5AB 5JPMB 3TIDB 2R0WH 1VADA 4OZGF 3MXWL 4AZ8B 3L3DA 5ANMB 5DO8A 2NZ9C 5C0BD 1T66C 2PCPB 4CADA 1JGEA 3F58L 4R96A 2PTVA 3L54A 2FJFA 5JPNC 4YDJB 3MJ7A 4XI5D 5DK3A 2Z7WA 2FWSA 1RP8A 3IDYC 4TMPA 1RZKH 2VISA 4AIEA 4WI0B 2AC0A 3QG6B 4G9DB 4JO2L 4TUUA 4WENB 4LHUG 1I8KA 3KLHD 4LZKA 2MSPA 3FYEB 4OJDH 3JVFC 4TSAL 5GRWA 1JHLL 1E3ZA 2VDPH 4B3VA 5CLYA 2HJKA 1BFOB 3NJIA 4LL1A 4WTWA 4ELMF 2IPTH 3FK3A 1CLZL 3WNOA 4I3SH 1L7TL 1IBFA 2EH7H 3V52H 3OB0H 5ETUA 3MPCA 3S3JA 2YGQA 3MV9A 4G7SB 3NRPA 4NXSA 1MREH 6FABL 4AYFB 4ADIA 3O2DH 2W95A 3ZUCA 4XMZA 1CTNA 1I9IH 3DSFH 4Y2LA 5C70A 2G2PA 5F7UA 5ICXA 1UENA 3RA7H 4JJHA 2ATPB 1M56B 2CCLA 2CKBH 3H2QA 1A14H 4M43L 3T3PE 2ZQKA 3KYOB 3OG4B 3L3DB 3P73A 4KQ3H 5D55A 5ANMA 2AEIT 4LF3A 3JSSA 4P4RB 2FEJA 1FFPB 4U6XA 4IKNA 4LLUA 3BH8B 1NUFA 3V4PA 5EEWA 3QIBD 1MQ8A 3N41B 1MWAB 1FNGA 3A4DA 5LAXB 3MXWH 1S7SA 2H32B 3G6JB 2R15A 1S4IA 2DTML 4F1ZA 1L9OA 3LKRB 3N6YA 3UADA 5I8OH 3AS0A 2P5WA 4FX5A 1HHKA 1PY9A 3SJVB 1OOAA 1GIGL 3B3BA 2XZAL 1WT5A 1ROCA 4HQQH 2A6IB 2X12A 1V7NH 3TIEA 1BM3L 1QKZL 4PJ9D 4UOQA 4DKEH 2JJVA 2FDBP 3HRZA 3J8F7 5DJZA 4NQDD 4HU2A 5FLUA 5KVEE 4MXQD 3CU1A 4GMTH 4OF7A 3O41A 4N2MA 4BQ6A 4FQCL 1TTGA 4CVXB 2R0ZL 1XCXA 2GT9A 3VMPA 4X7TB 1BEYH 2EQDA 5IUSA 3RIFK 1VFAB 3VFTB 4ODBD 3HE7A 4DP6X 4DZ8A 3AXLB 2CU9A 2K7QA 2NQCA 4P46A 3WKMH 4K15A 1IM9B 3KYAA 5HI5D 1YY8B 1YPZB 4WHYG 4UQEA 4G80B 5DHDA 3BEVA 4U6HA 1MRCH 5B39G 4CDGC 4PH8A 4N2HA 1RK7A 1ZMYA 1P1VA 1DSFL 1EEZB 2E8ZA 1H5BC 4RFOH 3UYRL 3ATEA 1NDMA 4PLOB 3ULUC 3U4KA 1GH7A 2FRGP 1XGPB 2P5WE 3ALWA 4ICWA 3L1FA 3Q13A 3QDGD 3QXDA 4NAQA 5IVXF 4R84A 4BCYA 2B5IB 2FWOA 2ZSWA 3VFPA 3L5JA 1FGVL 3DHUA 1ZDSA 2HFFB 1TYJA 1U8OB 1XB3A 3AWGA 3CZFB 4TN9A 4FJYA 2Z8VC 1H9VA 3JWDH 5D96B 2YJLA 3PXHA 2X3CA 3QUGA 1YRKA 2F18A 3FQNB 2J43A 2DIJA 1JMZA 3LS4H 3CLWA 5D72L 1DANU 4ZSOE 3EJUA 2WXNA 4PD4K 4B9FA 3AS3A 2AKRB 1HL4A 5DRXB 5EA0L 5E5MB 1S7RB 3QPXL 4MA1C 3P4OB 2J8UA 4JQIA 4HAFA 3FN3A 4C56B 3TA3D 3GBML 1RZKC 4GXUM 1W6WA 1XGPA 2CNYA 3N5AA 2VZTA 4UB0H 4U1NA 2AJSL 2CIIA 5B39A 3BC9A 3QZWB 1P4BH 1N19A 3TNMA 4G7YL 3MLXL 4LCIH 5BUPA 4HK0A 4Y5YB 4EUPG 3SYQA 1EFXA 4BK8A 3UTTD 2W0KA 4OM0H 5E2TH 3WFHB 3GI9H 3IJ7A 3Q1SL 1CE6B 1KBGL 2RA1A 2WZPA 5AB9A 4NKDA 1EEUA 2DQGL 4FCHA 1CS6A 2FBOJ 1FVDA 1C7TA 4Q2ZB 3H1ZA 3QEQE 4YSPA 3QNXA 1DO5A 4PRDA 4PGCB 2JLPA 2WWKT 2VXVH 4NO2A 5D7JD 2XQBL 3R4RA 2ORBL 4K4KA 4QRQA 1QBLH 2HRPL 3UTTB 5HHXH 2O93L 5ILTL 4V1DB 5G55A 5IHUL 3P2TA 4X6DB 5K33A 3WKNA 5C6WH 1I1AB 2PCYA 4JFEE 5I18L 1GPOL 4JJ5B 2B39A 1QFOA 5F7EL 1AR1C 4R2GB 2H2PC 1WS7A 4Y5VA 4AIZA 3FSZA 4ICXA 1CR9L 4C55A 1Z0NA 4CVZB 3HG3A 2FK9A 4L3CA 4PBXA 4QNPF 5IVZA 2EVHA 4OW6A 3FU0A 2AS5M 5DZAA 5AW2B 2VC2L 3FSAA 4E5XA 1EZVY 3GTTA 1WUNT 2N4IA 2YPLB 4KXDA 1THCA 4HCIA 4TYUA 2WN2A 1KYDA 2W65A 5D72H 1J9RA 5B1AB 1LEGA 1O0VA 4U4BA 5A6MA 4CA4A 1AG6A 4BSVA 2ICWI 3WAJA 4JB9H 1JGUL 3KZ8A 3IDXH 4JM2C 3LS5L 1U8IB 2IV8A 3MOBL 2JE8A 4EI5C 2O5ZL 2LU3A 3C09C 5CSZA 1A7OH 2NXYD 2FJHB 4XPBH 3GS7A 1YNTB 4KJYA 5I1LA 2J21A 2JVUA 4KZDH 1IL1A 5I1HL 2K78A 3LSOB 4FFVC 4IRZL 4ZX5A 4IU3B 5IK3A 4P2AA 3BP6B 1QLRA 3A67H 3ESVF 3IK2A 4GS7B 3UP6A 4QOKE 4LSPL 4NQUA 1M1XB 1CL7H 1PY0A 2JB6A 1MW0A 2XDHA 5GZNC 4MSWB 1N8OE 2F5AH 5CJXC 3L4TA 4X6DE 3P11L 5JQ6L 1A66A 4YO0A 2HUEA 4LDLB 1CDIA 3LOWA 4UQ9A 1P7BA 3RWDA 4PIRF 3V4UH 1PJWA 3WFEH 1I7ZA 1XAUA 1MFUA 5DHYB 5E8PB 2QVMA 2W9EL 4I48B 1VSCA 2OJ1A 3NIGF 5JQIB 5D1QB 4H88L 3HPJB 5GSVA 4IJ3B 4JDEA 3ZDXE 2QVFB 3I50H 5B1JC 1U36A 1KB9K 2VOTA 1MFCL 3ULSA 1A7RH 2K45A 5I0WA 3O2DA 3Q01A 3QG7L 1ZAGA 5I1JH 3DECA 2LABA 4UMGA 3T6QC 4PJHA 1CURA 3FQUA 1GIGH 1RV6X 3HVNA 3QJUB 3U48A 4B3EA 2VR5A 2WYZA 3GSNL 1EGJH 1ZGLM 4RSYA 2L7JA 4KV5F 1QLFB 4G7QB 4R90H 5I5MA 4XN1A 3QHFL 1I75A 1OTTD 1RXLA 2DLFL 5JPNA 3V4PH 1QO3B 3FN0L 1QUPA 2NUPB 4IOIA 1ZS2A 4KY2A 1JGDB 2DQUL 1TZGH 2OTPA 2OTUB 3OWEA 4X4XA 4ESKA 3MXVH 3FH5A 4LSUL 4L5FL 2P49B 3CDGB 4R3SB 3GZOA 4XMUA 3SE9H 1U3NA 1RVFL 3UZQA 3UCRA 1E7VA 2VMEA 1A9VA 2X40A 3NIDF 3PWPE 4OFKA 3X1EA 1XHHA 3NCJH 4ONHB 4PG9B 5GGUA 5IMMA 5C0IB 3OM3B 2Z4QA 2LHAA 1L7IH 5FFOA 2MCMA 2P3YA 3MMEA 2OQJA 1DL7L 1PPIA 5FKPB 3WDIA 2ZOKB 1BZQK 3ABZA 1OO2A 4YEEA 1UCBH 5I2IB 5GZOA 3HZKA 4P9MH 1GA2A 1VEOA 3JQOB 4OZFG 5ACLA 1HKLH 4ZPVA 2IPUG 1A6UH 2ITDA 3C8KB 4PUBH 1QSVA 2XWTB 3PE9A 2A74B 2J6EL 5TQ2H 4YPJA 5TDPB 2X1OA 4FOMA 5FM5O 1JXFA 2IOOA 1W0YT 4G11A 1AZCA 4NBYB 3EJJX 3ZL4H 1L0PA 5AOMA 1FH5H 3EFFA 3B2VL 2LR4A 3NP4A 1K2DB 3H55A 4N3UA 5D1XC 2XWBA 3AACA 2AV1A 3LS4L 3CZUB 3KPOB 4JRXB 4AM0Q 5IJBC 1YMME 2XG4A 1IFGA 4PRPA 1UATA 1WYJA 2R59A 4LCCB 3ZE1F 2LVEA 2OK0L 2OULB 2WY3B 1Y6NR 3PJSA 4MJID 1KXTB 3ILPB 5LBSA 2VXSH 1WTLA 3CVHH 3H42H 3LQZA 5FCUH 5LQBL 3E2HC 1CL7I 4ZAKB 1TYEB 2MCPH 3ETTA 4ORZC 3VXRA 4JRXD 4KK9D 1MJ8H 2A38A 2XVLA 4DK6A 1X5AA 4DKDC 3QRLA 3VGAC 3OTTA 2OM5A 1KJVB 3O6LH 2HAZA 3ECBA 4QTHA 4S1QH 3V5KA 4FQIH 4XOEA 4DFHA 4F7PA 4ZNEE 1X5JA 4BFKA 2QJDA 5KJRH 1FFTB 4XP6H 4EN2A 2COQA 3U36B 2FZ3A 1MXGA 2SODB 4JN2B 3U1PA 3ALXA 3BDYL 4WW1A 5AW7B 4FC3E 1UXSA 5JQ6H 3NCYS 4QPEA 2YFOA 1QP1A 2JJSC 1B2WL 3IKCA 5C0ND 2CIKA 5GGSA 5IMKA 5DZOA 3F5WB 3WEAA 3QIBC 2NXYC 2XTJD 3PYCA 3GSQB 3OKDB 5FYJD 4OJAA 2C9PA 5B8CC 2YLHA 2OMUA 4PJ8A 4FFVD 3U46B 2MTAA 2W0FA 2X38A 4D0BB 6CGTA 1JRHL 2NXZC 2VZVA 2ZXGA 4ZFFA 4OAWA 2Z7UA 3Q06A 3IJ8A 1C5BL 1HC1A 4M03A 4TOYH 1KLGB 1P4IL 1AY1L 1EJOH 1OCOB 5JOEA 4J39A 1T7YA 4KKLD 3DI3B 4L3CB 2YC1A 4N28A 4WHTA 5BQDA 5DR5H 3RDTA 3QS3A 4CL7A 1HSAA 3K2MC 4IRSD 3DX0A 3NOIA 4Y16B 5MENE 32C2A 1M05A 3EO0B 1FFNB 3BGFC 1W15A 3JZYA 5F88B 3HS8A 1KB5B 1E9OA 3L6FB 3RWCA 2HKFL 1DQTA 3V2AR 4M7JL 4N24A 5LXGH 4RDBA 4PGCA 4ZK8A 1V55B 4C54A 1FYTD 3ARRA 3CC1A 1NPJA 2EDDA 1MHHB 1EDHA 1F97A 1RUQL 3EF4A 4WO4A 5DFVC 1ZVSB 3MVSA 1CFQA 2M1KA 2VZ1A 3FB7A 1M9WA 3MRJA 2PCFA 4OM1L 3FRUA 1L0XA 4WLCA 1BIIB 4XN5A 4YHPA 1MCCA 2YHGA 5I19H 3SE8H 3P02A 5CEYA 3U0TB 3RB5A 3O6MH 5FAAA 2VR6A 1BAFL 3EYQD 1C16A 5IFJB 3EJRA 3S98A 3O2DL 6PAZA 4NGHH 2OP4L 3PREA 3VH8B 4BINA 2GB2A 5CU9A 3KWWA 2QGCA 2PW2B 3I02B 2NT1A 2VH5H 3VGDA 1UB5B 1DL7H 2OW6A 2VKXA 3IDGB 5DZNA 2MIZA 3Q1SH 4PRIB 4KJQC 4RIRA 1AD9A 3ESMA 3L3KB 1NCUA 1S78D 2B1OA 2VABA 3SDCA 3U30B 2ZKYA 5EIIA 1XCTB 2CBTA 4PRPD 3WUWB 4AGLA 1BF8A 4ELMA 1O7DC 5ACZA 3OZ9H 1BQRA 1E6JH 2AQQA 2EEBA 2BVQB 2JKIS 3WNPA 2WCPA 4PS8A 2XOTA 4QXTA 1ZWIB 5D6CA 2E9IA 1EJFA 2CUAA 4NPYB 4FQLH 3DBXA 5LHDA 3B9KC 2BS8A 5J6GA 4X83A 5FKAB 2YSSB 2FWOB 2W60A 2ZSWB 3H8NA 5GS0C 1NANI 3CN0A 2BJML 1T3FB 1WZ1L 3IJHB 3LQAC 3W9EB 4J2XA 1J5HA 1OM9A 2XPGB 4J12A 5DD5H 3GBNH 3U1SL 4AG4L 4E0RB 1UQSA 4AYDC 1JDDA 4GAAA 3MZTA 4H20L 4YC2B 2X6AA 2ZIDA 2YAFA 3I6KA 4U6HB 1FO0A 5HDWA 1V8HA 3B56A 2VW6A 3O11B 4LLDB 4RNRA 1BQUA 4PB9L 4HF5L 4UYPA 3AS2A 3PWVA 1RJCA 1FIGH 1OP5K 5KS9F 5KSBB 4XRCA 4OF0A 1IZKA 1NCHA 4U6YA 4XN2A 3GUFA 5KN5B 2GT9B 1D2OA 4PD4J 2VSDA 1AAJA 4CVXA 3G08A 4PJDF 5DI8A 4N2DA 4YHIB 5D5MA 1ZDQA 3NCEB 2EECA 1JFHA 1PU0A 2BNQB 2NY5L 4GRWB 3WHXA 3PCYA 4HDIA 3HRZB 4OT1L 3S88L 1TUPA 3EBIA 2FJSA 3TIEB 5DDHA 1CL7L 4MWFA 4FNSA 3MRIB 2PYFB 5DTFB 5KYUB 1N26A 3RLSA 4JO1L 3GEWB 2DWYA 5HYJB 3MJ9A 3BWUC 5EUOA 1I31A 4DZBA 4X50A 3VXUA 1MCJA 5DHVH 4Z77A 5IQOA 2IMNA 3SYCA 1A3RH 3DWTA 4WUUE 2BHZA 4WWNA 3RVTC 4XCCH 3O3DB 3VI4B 3ARBD 3QJTB 4HOXA 1G9EA 2RQ8A 5I23A 3KYOA 5DC4B 5AZ2H 4P2QB 3FFCE 2JKLA 2NCMA 1JWUA 5L88H 5CN1A 2WSKA 1TLKA 1AR1D 4XVSH 5EU6A 4S1SH 1OPGL 2C3VA 1TEFA 2H3KA 3RGHA 3L4YA 3DV6B 2QQKL 4RZKA 3T3PB 3VGEA 2NMSA 2D3LA 4J3TA 4GG6E 1Z9OA 4P2QD 4PRAA 3EF7A 3PU7A 2MQ0A 2E7LA 1WJ3A 3NT0A 3V0WH 2UX7A 4A6YB 4G42B 1AQKL 1KIPA 2KBGA 3MXVL 4LSUH 4YSOA 3U0WL 4O51B 5GS1A 2P44B 5E7BA 2AV7A 4KZ0A 2H41A 2XKNA 4G9DA 2EVIA 2A9CA 1UC6A 4M7LL 4DOHB 1PMYA 4EO5A 1H8NA 2X4UB 4JANA 3PLYA 1H9DA 1N68A 4HPYH 1U8MB 1CBVL 4HIXH 3NFNB 3VYPA 4PW9A 1OAYH 2Y7OA 3NUKA 3VXSA 2R1WA 3MACH 4NKMB 1UT1A 5KSAD 2RBLA 3DOSB 3ETSA 2R29L 2N1KA 2NUTB 5EO1B 3QAQA 1AS6A 4OT1H 5INDB 3ENEA 5GZND 1PLAA 3D8MA 3FTYA 4PP2B 3I50L 5JOPD 4D9RD 4G71B 3CSBA 3POCA 3T04D 4IRSC 4LP8A 2SEBB 4PTUA 4OQTH 1MPAH 4G1EB 2WUCL 1U8JB 2X2JA 4LRIC 2O5ZH 3MAWA 5A2IH 1TXKA 2CGYA 1QFWM 2F7QA 5KSBA 3QYNA 5HHMD 4UIMA 4RNRB 3TBTA 3C08H 1H8OA 3NABL 2YBGA 3LKNB 5E4EB 1OE3A 2XA3A 1E8WA 3ZT6A 3WFDL 1U8CB 4PJIB 2OCCB 4HKXB 3BOVA 3UG5A 3REWB 1UM4L 4E68A 2ZUSA 1F3DJ 2I60L 4JKNA 4Y4HC 1GS7A 5F6HI 3BAYA 1JUFB 3KCWA 5MERB 4G72B 4M6MH 1A22B 2I85A 4E0RA 4U3SA 4O02A 4RAUA 1J9CT 4OTXH 2CO6A 2P48B 4UTAL 2BSRA 5KANG 4MMXC 2RCSH 1S9VB 5E9NA 3KYNB 2YSSA 5D93C 3FSVA 4PLNC 5CEZH 2NRDA 3AG3B 3HFFA 3BXNB 4JAMB 4Y9BA 3QI9B 4L8SA 1FSKC 3CC5B 3IDJB 4XGZA 1D3CA 4FL4B 3MBED 3RDJA 1T1XA 3VFWB 1YNTF 1KTLB 4ZUUB 1EHNA 1EEYA 5H35A 1GGCL 5DO2D 5JXEA 2ZOOA 3ARXA 3Q5YA 1P5VA 5IJCC 1XCTA 3BRDA 3DGCR 2R2EA 2NTSP 1SPDA 1E4XH 2VIRA 4F5CA 4XC3L 3BSGA 1UXWB 4LMQE 4DTGL 3BP5A 2LLGA 4FYQA 2BOBA 1C8QA 5IR1A 2PPAA 1ICTA 5F71A 4UAOC 1JK8B 4U6TA 5DVKA 3T1FB 1I1AD 4MHHI 5GRZA 2I24N 5I8OL 2NDFA 1Q72H 2WYTA 5C2BL 4AC2A 3CVBA 3F7RA 1QSEE 2EXSA 1A9BA 3CTTA 4PV8A 5HGBA 3FRUB 1NC4A 5IHHA 2BM3A 5I16B 4X7EC 1X5GA 5IMLB 4XE5B 2HKFH 1MHHA 4WO4B 2YPLD 5DHMC 1P53A 2OMZB 4WCYL 3MRCB 4UF7C 1AZNA 3MLSH 4NPJA 2DM3A 4NSKA 3ATFA 3IPFA 2A6DA 2AQ3A 1BVNP 3OKMA 1WE5A 3MLXH 1FFNA 1UH4A 2VN4A 3ZYZA 4BCZA 2Q86A 2YWYA 3TO4A 3OZLA 4B50A 1AD0B 1T21B 1XF2A 1AACA 1OAKL 3U9PH 1T7WA 3EAKA 1P7QB 3EG9A 2QHRH 4KAQH 2JKSA 3C12A 4H8QA 3UXFA 1RAMA 1V54B 1TCRB 4KKLC 4M6ML 3Q6GH 1USQA 2RJMA 1ZGLP 2WUBH 4W1TA 1KIQB 4X6CB 1XFPA 1CXFA 4KBPA 5JW4N 2CALA 3OXRB 4BGDA 2UY6A 3P3SA 4QLRA 3GEFA 5DHXB 2AEPH 3OPUA 4JFVA 5ES4B 4XN7A 1X5IA 3I9GH 2V3FA 3OKDA 5CEZL 5LN4A 2L7EA 4XX1E 3MNDA 4BFIA 2A2QT 5F89B 2QFPA 5MHSE 3EH4B 3ARBC 4UDTB 4OIFA 2PETA 1HEZA 1SN2A 2XWDA 3IXAB 4NDMB 4F8PA 2V9RA 4HLZG 4NQEE 3HI6H 2C3HA 4I9WD 1DBBL 3HR5B 2LGNA 3ZDXF 4PJCF 2J1KA 3B9VA 4PRHD 5DFWH 4X5PA 1RPUA 2B16A 1C5DA 2D31A 4U4IA 1Q94B 3TBBA 4BFIB 1MJ8L 2A4CA 5I15L 3NJKA 1FNEB 5E4AA 3ZHFA 2EDWA 2WZPD 4F8QA 3WL9B 2G9HB 2Q5BA 1T80A 3P4NA 4QXGH 1AO7E 5DD0L 1E9QA 4LOUC 3DVIA 4HFUH 3II2A 5I17B 1S9WA 4X6FA 5AOIA 5CSBA 4G9FE 4H1LH 2C34A 1UFUA 4OVUA 4KKAC 2OR9L 3WKPA 2Q86B 3TO4B 1GZPB 2ZCHH 3APCA 3QDGB 4R7NA 3W0WA 1WBYA 1NAMB 5B1BB 2FWLB 4XH2B 5LGHH 4KWUA 2LLNA 3CPUA 1CYGA 2XQBH 2EEFA 1OQXA 4RETB 4MNGA 2A6KA 4E9YA 3KVDD 2MHAB 3DSNA 5DQDL 4FMFA 4MZ2A 1ETZB 1P2CB 4E9WA 1JMXA 1FL5A 4LK4A 2ALAA 3QUKA 4XXDA 1MJUL 3US1A 3WMQA 1NAKH 4L48A 5F2FA 2ZKMX 2AXWA 2A3TA 2EIDA 1O6SB 1F2XK 3QA3B 5A2JH 1A14L 5T1KD 4FQLL 4IBWA 1SQMA 1L9MA 1A47A 4PRBB 4YBHA 1L0YA 1XGQB 2Z8RA 1NM9A 1XH1A 3CPLA 3ECUA 4FZ8H 1REIA 4AWJC 1ESOA 4IKIA 4AQZA 5EU6E 1KGCE 1QHOA 3NJGA 5E2UH 4KZEL 4LMQI 3PGCA 3VXME 4IBSA 2J6EA 5ESAB 4ZXBC 3RDTC 3IKKA 5GGSY 5M7QA 5JPNB 4KXCA 4MQTB 1RURH 5HHMB 1JHLH 2OMNA 2X70A 4N20A 1QLFA 4WW2C 2HWZL 3IBOA 3IPBA 3PXLA 3WCYA 1A3LH 4Y19E 3QC6X 4HG4J 1YMMB 2DQIH 2OI9C 3D06A 3LNEA 4HXAH 4L4TD 4BFBD 1LE9A 2CO6B 4R2GD 3QZOA 4O02B 3EXLA 3H85A 3A22A 2QVIA 5LBSL 4KTDH 4Z7QE 4RAHA 1UEYA 3VFNA 1KTCA 4LASH 5KWYC 2ICEC 1CPUA 1NL0L 5D4HA 2CBQA 3ME0B 1NUGA 3RPIA 4ANKA 4JO5A 1BZ8A 3CHPA 3ULVH 4Q4IA 3BD4A 2Z34A 1FYHB 4GI8A 1BMGA 1YLBB 3VQLA 4E41E 2N3JA 3ZE0F 1V7MH 2G30A 5HJGA 4G6ML 5D2NA 2Y5EA 5D4QA 2R0LH 4YO0B 5BZDB 3AGWA 1DBML 5DQ9B 3BKML 3TA3C 5L2KE 2XN2A 4H8UA 2XRAL 2RFXA 1A2YB 1RHHB 3QO1A 3CAFA 3MLTA 3HZVA 4BHUI 4F8NA 2V5MA 3L9BA 3MV8D 5B1CA 4LRIA 1F3DH 4OGXH 1ZT7B 5GGRY 5JHLH 4AC4A 1OSPH 3P9MB 4GSQA 5D7SL 4OJYA 3FFDB 5IW6A 3QAZB 2APSA 5EO1A 2EDOA 3HC2A 1KZYA 5DD0H 3ESPA 4P23B 1EK3A 2BNUA 4K3JL 1BXVA 2H1PL 1U8KB 4JKKA 5C0JA 5ENWA 1A7QL 2HX9A 3QEGL 3VACA 4XB8A 1R3JB 3NFNA 4C4BA 1NGXB 4DUWA 1L9PA 2F54D 4LSQH 2V6HA 3ZDXB 2Z31D 2KDGA 1QBBA 2VR4A 2VDRH 4FG6D 4JFHD 4AUJA 1DVUA 3UJJL 1DVFD 2XWRA 3MRPA 3RX5A 3SEPA 3B2UD 5CJ8A 1NIEA 5J6HB 5ICUA 3VFGH 1Y7VA 4A6YA 1H3TA 2YA0A 3KPLA 1AP2B 1FL3B 2YUXA 1XWVA 1U8HB 3EBAA 1WAAA 3C6SB 3CZGA 4OIIL 4KY1H 2EH8L 5HYEA 4P5TB 1I1AA 1KBPA 2X1PA 4A7GF 2WLJA 1ZV9A 4A2LA 3UAJD 1CGTA 1H0DB 4D3CL 4QYOB 4NI6A 4DJMA 2J8UF 5DC2A 5CGYC 5DJ6B 3PNRB 1TQCC 2X89A 3L3HB 4HCGA 5I6PA 5CD5D 4GG6A 4Y1AD 4GBXA 5L88L 2DMCA 4NKDB 4QHPA 1CE6A 2VR7A 4OZHA 3WFHA 1CU4H 3LCYA 2DQJL 1J5CA 2F08A 5MEPA 2PO6B 2ZWSA 3VW3L 1TO5A 3D34A 1HQ4A 3PQYA 3SDXA 4YS4A 1CXEA 5I24A 2AJYH 3QZWA 1G84A 3QZLA 4U1NB 3EYFB 4UQ3B 4DZBB 1K5NB 3CMGA 2BVPA 3LN9A 1LEKB 1I9RL 4G3YL 3VNYA 1OCZB 2VLLA 1J1PH 2CDFA 1Y18A 4GH7B 5J6SA 2VDKB 2D9CA 3E38A 1DJIA 4NZRL 5SWZE 2IF7A 3T0DA 4ELME 4LSSL 4JN1H 5CZKA 5FWQA 3VFMB 1BXAA 4AYMC 5IF0A 2N0MA 4ZNCD 4JL1A 3H9SE 4LLQB 5ECGA 2HT3C 3WJLA 4WWOA 2WXPA 1KJ2L 2XV0A 1LD9B 1OD7A 2A9AA 3VFGL 3MLZL 4OIBA 3GPEA 3UFIA 2G60H 5AVTB 2NYZA 2NX5B 3CVHB 4G8EA 4JREB 1SY6L 2VDQL 4X9HA 5CIPB 1SJVA 2VN3A 1VLXA 1LO5B 4LT7A 1UOLA 3PHAA 4YVUA 4ZBJA 5CCKH 3QFGA 2D2OA 2B2XL 4AJWA 1JPSH 4P2RA 4ZMXA 5I73B