2K45A

C2a domain of synaptototagmin i solution structure in the fgf-1-c2a binary complex: key component in the fibroblast growthfactor non-classical pathway
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
128
structure length
128
Chain Sequence
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synaptotagmin-1
publication title FGF-1-C2A binary complex structure: key component in the acidic fibroblast growth factor release
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 21
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2k45A00
2Q3XA 1TJMA 4OVVA 4F1SA 4NPJA 3F01A 2EP6A 3L54A 3ENEA 2ENJA 3NZUA 2NSQA 3DPDA 3FBKA 3PREA 4NS0A 3MJWA 4NPKA 2WXLA 5JHBA 3ML9A 5KJ7E 3N5AA 4WAFA 3QR0A 4EZLA 4JPSA 4FJZA 4NP9A 2WXKA 4QJ3B 3L9BA 3L13A 4LDCA 2KI6A 4PS7A 3KWTA 3RDJA 3L16A 2D8KA 4DK5A 4ANWA 1BYNA 5T8IA 2FJUB 4TS6A 3W56A 4Y1TA 3RPBA 1DSYA 3FDWA 5CCJA 1UGKA 4QJ5B 1WFMA 4KZ0A 4FADA 4Y1SA 1RLWA 4PS3A 3IM1A 3KWUA 1E8ZA 4FJYA 4FA6A 2Q0ZX 4URKA 5H4ZA 2WXJA 5CCGE 2Z0UA 1E90A 4IQHA 2YRBA 3QR1A 4F93B 2WXGA 3SD5A 4LCVA 2WXRA 4ANVA 4ICWA 1DJXA 2BWQA 3ZIMA 4WWPA 4ICXA 2CHDA 1BDYA 2CHWA 5G2NA 4BFRA 4AOFA 4OVUA 4IHBA 4WEEA 1E7VA 2A5UA 3F04A 1DQVA 3R7QA 3T8MA 1E8XA 3DBSA 4EZKA 2YOAA 3QJZA 2V4LA 3L08A 4A55A 4MJJA 2UZPA 4ANXA 1K5WA 1DJGA 2QZQA 2LHAA 3LJ3A 4DNLA 1DJWA 1WFJA 2ENQA 4L2YA 4BGDA 4AJWA 3B7YA 4QAMB 4XX5A 3QARA 3HIZA 2DMHA 2ISDA 3TJPA 2WXOA 3TWYA 1W16A 3PYCA 2CJSA 3TL5A 2NCEA 3S2AA 2CM5A 2CM6A 3OAWA 2WXNA 2CJTA 3L4CA 1UOWA 2ZKMX 1DJYA 1YRKA 4WWOA 2ENPA 2K8MA 3CSTA 3IBEA 3PFQA 3W57A 1RSYA 2A4ZA 3PRZA 1W15A 1E8YA 2CHXA 2JQZA 4FULA 3ZW3A 1A25A 3ML8A 3F00A 2WXIA 4WWNA 2WXQA 3APFA 4L1BA 2B3RA 2DMGA 3HN8A 4F91B 3QAQA 4TUUA 2NQ3A 4L1LA 4XZ4A 3R7RA 3PS6A 2K4AA 5JHAA 4J6IA 2WXMA 4F92B 2WXFA 4QJ4B 2RD0A 2K3HA 1GMIA 2K45A 1DJIA 1QATA 1HE8A 3P2BA 4LT7A 5H4YA 2QZ5A 3CSFA 3QK0A 1RH8A 1BCIA 4L23A 5EDSA 3OHMB 1E8WA 4KZCA 3HHMA 4XE0A 2CHZA 4GNKB 1E7UA 3L17A 4FLHA 2R83A 4G11A 4V11A 4EZJA 2WXHA 3NSJA 1DJZA 2Y3AA 1TJXA 1CJYA 2X38A 4GB9A 4HLEA 1UOVA 3GPEA 4KITB 4FHJA 1V27A 3F05A 3JZYA 1DJHA 3APDA 3M7FB 2WXPA 3NZSA 4HVBA 4FHKA 4TV3A 5G55A 1QASA 3APCA 3ZVVA 2FK9A 5CCHE 4PS8A 4ANUA 2N1TE
chains in the Genus database with same CATH superfamily
4Y1AD 5BO1H 3N1MC 2FX9L 1YPZF 2IXQA 3BKJL 4HAKA 5AW5B 3Q1SL 3RFZB 2BNRD 1JGEA 4M7JL 5MI0C 2VLKB 2CKBA 4DPRA 1EVTC 4IGBD 2ED9A 3HMXA 4NBZB 5DRNA 4CN6A 1RZKL 1S7XB 4YO0B 5GRYA 5EO9B 3LSOA 5JHDE 4U6VL 3RGBA 2Z35A 1BGXH 1UD3A 1A3ZA 4OSUL 1OPOA 1D5XB 2WLNA 4PJ7F 3KVQA 2W81C 1GMEA 1EQWA 5DSCA 2BVOB 3OKMB 3ZHFA 4NHCH 5F7UA 5ICYB 4GO6B 3NYKA 5C0AD 1DL7L 3LZFL 4QRAA 5IB5B 5KBNC 1QA9A 2FGZA 1PJWA 1RHFA 4QEGA 4L0ZA 1QABA 3GMOB 2CIIB 1LK2B 4MNGA 4ZMVA 2WBJC 4YX2H 2A6JB 4H2CA 4XCEA 1ADWA 4P46C 1BZ8A 4MZ2A 3FUFA 1JZ2A 4DKTA 2IDQA 2O5YL 1JYWA 1V3JA 1AC0A 4FLRA 5IQ9A 1WO2A 2VH5L 4AX3A 4M3JA 5ECJE 1KACB 3CXHJ 4TSAH 3FO2B 4XI5D 3L5XL 2XN9D 4OGQC 3P77A 5GGRY 2O5ZH 3OKDB 2P5WB 4AJVA 1LL1A 4QHKI 1YSOA 1U3ZA 5AEAA 3FZUD 1ZTXL 3F2LA 1QLEL 5IY5B 1HNFA 4L9LA 4OIFA 5TK2A 4Z7OE 1PDKA 4PRDB 4OIIH 5C0RL 5HJDA 3LKQA 1OGSA 1T2QH 5HI4C 1XSKA 4D8PA 4F80A 4HEME 1ZHKB 3WFDL 1MFDL 1MUJA 5I66A 2ZX9A 3MLSL 1P7BA 4ODWB 2G0LA 5HGAB 5EUOA 3KWXA 2WYHA 4X7SH 3B9EA 5AZ2L 3VXMA 4EDXA 5JW4M 4RRPA 4Y4KA 5FO9B 3P0GB 1DN0A 4B60A 3RWGA 3PE9A 1M6OA 2DLEA 3POHA 5IJVA 5DJ2B 4U1NB 3FTYA 4R7LA 2NY1B 5IB4B 3NZHL 5I6XC 1TJIL 1RUPH 3DX6B 1VZGA 2X4OA 4MS6A 3QUYB 2J88L 2WSPA 4D0DB 4XBPA 1R6VA 5K9JH 2HMIC 1XR8B 5DHYB 2BFVH 2RALA 3DO3A 5DC4B 1G7LA 2FCBA 1NOLA 1XAKA 5FDYA 4N5UA 4U1LA 4KMTH 3D39E 2GTZA 3DX7B 4X83A 3NRFA 4UUJB 2FHBA 2V9QA 4QTIL 3X14A 5BW7A 5ECGA 5BPPA 1WEJL 1S8DA 3WNLA 3BLKA 1PKOA 3E6HB 2QELA 3GNML 2FH8A 5A6IA 1BZ9A 1IBZA 2DYPA 1HHIA 3ME0B 4LAJH 4M3KB 3S8FB 2YAMA 2DWEA 4GRMB 5CNHA 3X3GH 5CINL 1M7IA 1SHWA 1T0PB 1KTJA 2DKMA 2GJRA 2OMZB 5CWSA 4RCAA 3WJJC 3GJFB 4RA3A 3H56A 1LNUA 4U6HA 3VXMD 1P5VB 3HE7A 4JZOA 4Y4KD 4BKSC 4N0FB 3HJEA 1XEUA 4K07A 3TTYA 5IG7A 4NDMB 2YPLB 3CC1A 3VX0A 2QSCH 4FFYA 1EUUA 1RSFA 5E2WH 3ZKXB 4QXGH 5HVGB 1SLXA 4G8FB 3L95A 4PSRA 4TUKH 4CNIA 4CSZA 1CC3A 4DZBB 4W4OA 1OV8A 1RZKC 4RMUA 4ZXBA 5JW3L 3BRFA 1U8LB 4GY4A 1P4IH 3WFEH 4BDVB 1J5DA 2DYRB 5HY9A 5C2BL 1Y18A 1HSBB 3CPUA 3Q5OA 1UH3A 1OF2B 4MJIA 2FQEA 4Y5XA 2G60H 4RMVA 4AZ8A 5DJZA 2BIIA 5ACZA 3HN5A 4KY1L 4DGVL 2E7HA 4CL7A 1JMXA 1AZUA 3IDXL 2EDDA 1A6AA 4NC1E 1IU1A 1CT8B 1GGBL 4OD1H 3RIAF 2UZIL 3ZR6A 1DQMH 4OI7A 3IPFA 4BH7A 4DCQB 4K7PH 1VADB 1KLUB 2DYPD 5IFJA 4GSDL 1NSNL 5H37A 4FULA 4HFUH 4GIOA 4AIOA 3EJQA 1LVEA 4UINH 4O9HL 1DJSA 4GG6A 2XRAH 3H0TB 5J6SA 3RG1C 3B56A 1JWMB 1SF3A 3NIGF 3BMVA 3FB5A 3SDDB 1SOKA 3LZNA 2WLHA 3AXLB 5CILL 1OGTB 4BGLA 3KJ6L 4WV1B 3JTSB 3IKCB 1F56A 2UZYA 3PQYA 4R7VA 2PCXA 4LLVA 4OGXH 1FA4A 4IJTA 4OV6F 4XE5B 1T80A 2GCYB 1S7TB 2FHFA 2Z92A 5HI3D 4LHQB 4P4RB 4C8XA 2YWZA 1KJ3H 4KZCA 4ZXBD 2DLFH 3H42H 3LNFA 4JPIA 3QEHA 2Z7ZA 1N8OE 1RY7B 1UACH 3G6JF 1IE4A 5IJCC 2YXVA 1OHQA 4F7CB 3SO3C 1JV5A 4MJID 1C5DA 3BP4B 4OJCA 1T89A 4F57L 4H1LB 4IDLA 4C56A 3IS0X 5C9JA 1X5ZA 3FOLB 4LEOA 3C6LC 5HSFA 1AD9A 1GZHA 2OS7A 4IBWA 4JFDB 3NCJL 4RNRA 4MMZC 3I50L 3TN0A 4KUZH 1GJUA 1BYPA 3D69A 4FQ1L 5DJ0B 5F97E 3BPCA 1KIRB 5IVXB 5T8IA 2XT1B 1SHXA 2IF7A 3ATBA 4R5XA 3LKOB 5E9DE 3MA9H 1CE6B 1UZGA 4X9BA 4AEHH 3OKLB 5IBUB 3LH2H 4FL4B 3GXFA 1E9PA 5CP7A 3BZEA 3PQYD 3HE6A 4ODBD 2I69A 3PWPE 5GRXG 1T1ZA 4M9OA 2AXGB 1PSKL 4XMKL 4XP1H 1EBAA 1PD1A 1C5BL 4MKMA 1RK0B 5AWNL 3ULUD 4KJQD 5MEQB 1RMFL 5C0JA 4PJ5E 3ZN6A 1W8NA 2XZAH 2GHZA 5D7JA 3T8MA 2ZZUT 3DYOA 4O4YL 2D03L 3QUYD 2TSAA 3EFOB 4M8UA 2E7LC 4YLQT 4Y19E 1DVTA 4C56D 5M7QA 3WNOA 1F5WA 4KK5C 5DUBA 1GKEA 2HG0A 3CZJA 2ZCLL 3OWEA 4YK4C 4B7IA 2KZWA 5ITBH 3WKMH 4K8RD 2VC2L 1SJHA 4XMUA 4BKLB 1GS7A 2VN3A 4XXWC 3T8VA 3TN0D 2ZNXA 4O02A 2QSVA 3FUKA 5JZ7C 1Q0XH 3T4YB 4KQ3L 4AJ0A 4Z3IA 4AQZA 4U2ZA 1MRFH 3FN3A 4QXUH 4AGMA 1YG9A 3AFLA 4OCXH 3NCMA 4Y5VA 2NW3A 1OB1B 1CFVL 3TX4A 1B2WL 3VFNA 4QRQA 2I60L 2QSQA 2YFOA 3GSQB 3OLGA 2ID5A 4P2OA 4KGLA 4GRWE 5E4AA 2DJSA 3V4UL 4XN8A 1JCKA 3CUPA 3DNKA 1WK0A 2V9TA 2WPGA 3B34A 3CZUB 3DHUA 5IT2H 3QYMA 2V17H 1QRNE 4JO4L 3L6FA 4G70B 1VPOL 1QHPA 5D7JD 2W9LA 4L4TA 5I8EB 3PL6C 1H3GA 3EYUL 4ONGL 3LS4H 2QTEA 2DWDA 5KUKA 4OFKA 2GBTA 2G2RA 4M00A 1KXQA 1T1YA 5DMKA 4YFLF 5E8NA 5EOCH 5FS5A 5FYLE 4LLMA 5CLZA 3VI4B 2CRMA 2XWXA 1E3FA 3EJYC 4K3EH 3WLWC 3VI3B 1KB5B 2XWJB 1U58A 5C0FB 1MCRA 3IFNH 4ORGA 4XNZB 1HCZA 1MIEL 1BQHB 1H5BC 1ICTA 5MEOB 3BD5A 3K91A 1SGKA 1ZD6A 5IKCA 4RISL 3MR9B 4GT7A 4IHOA 5DMIH 3IRCA 3WUZA 1BVZA 1U8MB 1J0HA 3MV7D 4FFWD 2W80C 3QUML 2BS71 4HJGA 4NQCE 3N43F 3CLWA 1EJOH 1NGPH 4WDIA 3E1F1 3QZBA 2P28B 4P0DA 3MLTB 4P2OD 5SWQB 4PJXB 4RAHA 5L7XL 3BN9D 4GINA 4KJPC 4P2RA 1ZIAA 2F2HA 1F4YL 4MJ6B 2B2XL 1UXLA 2E9JA 4XCYA 3APMA 3KPLA 1A9BB 2XXFA 2FAUA 3KS0H 4NQXB 3ZZLA 4AQ8A 2NQCA 1DVYA 4LVOC 4XMWA 3WCYA 1TUPA 3SDCC 1A66A 4L4TD 1KZYA 1X5HA 4DP4X 3EGDA 3QJQB 1OARL 1YO4A 2DQHH 3D8MA 4Z77A 3EYOB 2ZOUA 1PFCA 4FYQA 3FFDB 4JS7A 2V6HA 1LE5A 4OI9A 1MWAL 1KF9B 2BW4A 1IM9A 5AVXB 3UPRA 4A37A 1KTKE 1NMAL 4NRXB 2FT7A 4O5LL 2Z93A 7FABL 1HH9A 1RIUL 4KMLB 1CTOA 1TQWA 1YCSA 5JPNA 1D7BA 1NBCA 1O6SB 4UTAA 4Z7UA 1LO0H 4DIXA 3MRJA 5DJ8B 3KXFA 3WGUB 3VYOA 3V6FA 3AC0A 4XX5A 4HUNB 2JCCA 3VFRB 4FQXA 1JNNL 1H15B 2HT4C 3CE1A 2DQJH 4DAGL 2Z6FA 3RP1A 2X2HA 1U2HA 4UV7L 1S7VB 3QPKA 1XH0A 1WITA 1WFNA 4GMSH 5BVJA 3GBMH 4JKWA 5D71H 5IMMB 1DQLH 1YDPA 1M56B 4P2RD 5FYJE 4K15A 4G9DB 1G9NL 1DLHA 3P0VL 3L2LA 4YSEA 2ZF9A 5LGHL 4RAVA 3GTTA 4B9IA 2PWGA 1A4KB 4UDUB 3J2PA 4JN1L 1HINL 2JXMB 3UYRH 4IBQA 1XGRA 3C9NA 3MRMA 4PV8A 2H2SC 3FQNB 4L8SC 3HR5A 1NCHA 1J5IA 1U8CA 3WJLC 4ONFL 3NCXA 2AJSH 6TAAA 5KSAC 2DQFA 1XVSA 1NPUA 5KOVC 5L2JB 1AACA 1NUGA 5J6GB 4JMXA 5E7FA 1CQYA 3S2CA 2D7OA 3ZT6A 4PJHE 4AEEA 2QKIB 4N0RA 4BSWB 3KXFD 4WJ5A 1U8HB 2JELH 3E2HB 1YPZE 2WLLA 3C5SB 4ZMNA 1C16B 4FQXD 3T1WA 3LAFA 2XNAA 1T83C 2F15A 2MPAL 3U2SA 1U92A 3MX0A 1OL0A 1XCTA 4JO2H 4RBPH 1BD2A 3MGTB 4Z95L 4JFFB 1NLBL 2H32A 2ICWJ 2WUBH 3LQZB 3DARA 1TTRA 3MV9E 4G42B 4LDCA 3SE9H 2WVUA 5I6NA 2XBZA 3LD8B 4WENB 4X5XB 4PJ7E 1L9OA 1ADQA 2NUPA 4HIHB 1K3ZA 4R7XA 3PWVB 3RWDA 2JLLA 2R1WA 4JFEA 3V0VB 1THCA 3PP3H 1EMTL 2D3JA 2EEBA 2GW5A 5D2NE 2HFFB 2QHLA 1RZJC 3H3PL 3QFDA 2Q0ZX 1S9VB 4F1ZA 5LHDA 2IDTA 3UZEC 5BRQA 2HH0L 5ETUB 1YEJL 3KBFA 4UWQB 2B20A 1YNTA 2OR8A 3Q2LA 1WJ3A 1ZLUH 3RA7L 3O9WD 4D0BA 4HSQA 5IQLA 1VKXB 1H8LA 1OOAA 1QSEE 3EDEA 3IDJB 1JPFB 3TCLB 5DVOA 3LQAC 5INDA 3GXNA 1EXUB 3F04A 3LRSB 4AYEC 2PNDA 5DURB 3SBWA 2W9DH 4IOIB 2VITA 5D1ZC 2V4LA 3FFCE 3I9AA 2A38A 2D31A 1EXHA 4W9LC 5D4JA 5GRUL 1MCCA 4Q74A 4DN3H 1AGBA 4PY7B 1XF1A 2CLRB 2FIKA 5C09A 3VQLA 2EC8A 1BD2D 3GXUB 3LKSA 4BE6A 1VGKB 4F9LC 5FC9A 4S1QH 1I9RH 1Z2KA 2H2PD 4JO8A 2ZOWA 5A2FA 2AJ3B 3U7AA 4XXDB 1WWAX 3S2AA 1XWVA 2EC9U 2VE6B 4G6JH 4OLXL 4UM9B 2BNQB 4H0LC 5E1IA 5LKNA 2XWDA 4R5TA 4U1KB 4JFED 2VLJA 2XZQL 3RVTC 1NCOA 3VDAA 5I8CB 1ZLSL 3BE1H 3CFEB 4KKAC 3CFNA 5IBTL 2AANA 4BQBA 3ASOB 3P9MB 4NSKA 2V0AA 4WUUB 2EIDA 1KTLB 3ET9F 4XMXA 1OP3K 3BWZA 4PJCA 1JS4A 3IF1A 4ZTPL 1V8HA 4NFDA 4P23B 5LCVA 2XN1A 2BVUA 2QKSA 3NG5A 3G7TA 5F9AC 1T4WA 3M1CA 4MA7H 2C9RA 3QCTH 3PV7A 1K8IA 2BW5A 3PXJA 4FFZL 3ZZSA 1WC7B 1D6EA 3JWNE 1KMGA 2EYRB 3CMOL 2DQEH 4JQXA 1T3FA 4PJFB 4XMPL 1UASA 3MLXH 2BOCA 1F97A 3HPJA 1UXMA 4EXPX 4DH2A 1F11B 4JFZH 3S88L 2AXFA 4GW1B 5C09D 3LN5B 1KLFA 3H9SB 3OJDB 3JZYA 4G9FB 5EO0A 2ZOKB 5FR3A 5AOKA 5I8KL 3ARDA 2HVJB 3KYMB 4MA1B 5AVYB 5JR1L 4X8XA 3QJOA 4NZRL 3FTGA 4U6YB 1XSJA 3OLIA 1R24B 2J56A 2P46B 4UMGA 5HDQL 1A14H 1NAML 3TO2A 4LSRL 3GIZL 3MLWH 1MCJA 1NFAA 3VRJB 1AO7A 3MREA 1AGEA 5AW0B 3DV4B 4OJFL 2X05A 5GGTL 5MHSE 4BINA 4DP8X 3RE0A 4HCIA 2ESVE 2X4UA 4Q9QH 1J9RA 3PIQB 2NXZC 1F3JA 2I27N 4YAQA 3X3FL 4FN0A 3S7GA 4X8CA 4F2FA 2C9PA 4KNSA 5SX5H 4YXHH 1AXTH 3NFSH 2ZWSA 2J1XA 3KW8A 1JV2A 1BF2A 1HYSC 4PHZA 4ZFOL 1N5YH 2E7DA 4BWWA 2NY2B 4ZRGA 5JHDD 1LHZA 2IPKA 4BSVA 2AEPL 4HH9A 3BUBA 3IJYA 4Y8DC 3BT2L 3OKNB 4YDKL 3ARDD 3ESMA 1A7OH 2NYYD 1J5CA 3F5WA 4AGNA 4I3GA 4XNUL 2JK5B 3CH1B 3RUGF 3T0EE 2R29A 4HEMA 4A7GA 1OZTG 2ICCA 2YC1A 1W16A 2CDGB 1OE2A 3I9GH 3P3RA 3FCTB 4AM0B 5AYUL 2UY7A 5CJQL 4IBVA 3QI9A 3IJSB 1ED3A 3FHQA 2MNWA 2F7RA 3K2MC 4WWOA 1UM4L 3F7PC 1MCHA 3IMVA 4XP4L 3IDGB 4MAUH 5AW2B 1J8HB 3NIGE 1VESA 3C5ZC 4MQSB 1TNNA 1IL1A 4N6RA 1LP9B 1B0GB 5ABZA 3MSPA 4ZOBA 3L4WA 3O2WL 4P04A 3RDTB 2ICWB 1MAJA 3H8NA 3PNWB 1NGZA 4I89A 3LS5H 3QQ3B 4RMQA 4CJ1A 4NM4H 2C7UB 5D7EA 3U4KA 4LIQE 1I1AB 1KIUA 2DMCA 3QHTC 5DURD 1KJ2H 2QQKH 4CMHC 4HS3A 4XX1G 4NQDE 3CD4A 3D39A 4FNUA 1WISA 2GJ6B 3G6JE 2FH6A 3GSNB 4OUUA 4KQ4H 5EBMB 5IB1B 4LHJB 1REIA 2W91A 4N0YL 4NUGL 2H26B 5AUMB 1TJXA 5AD0B 3U30B 3P11H 2VM9A 4JFPB 5DF0A 2P8LA 4MDJB 1E43A 3QJHB 2EICA 1V7NH 4PJBE 5CCHE 5LNGA 4NRYB 2IOIA 5HGHA 3UJIL 2BC4A 1BMGA 3MI6A 3O6KL 3QI9D 1GSKA 5EU6E 4DEUA 1SXAA 3MJWA 1VZIA 4GAJH 5CSGA 5E0FA 4UQ2A 2WGXA 4DP2X 1UJ3A 4ZUWA 4JRYB 2XN0A 4PG2C 3FRUB 3FUDA 1IBFA 2WLMA 2ZYRA 1CGWA 1RVFH 3TT1L 3KLSA 1LILA 3KVDD 2BERA 1JP5A 1S5HA 2GJJA 1CS6A 1D9KB 3U0PB 1OSPL 3T65B 5BQDA 4MDIB 2PPFA 2XDHA 3D39D 2PF6A 4LPCA 2J4WH 3KYNB 1NCTA 3MPCA 4R0LB 3SDYL 4XAKE 2IAND 5TE4L 4KDWA 4L8BB 5K9KB 1SDDA 1FNGA 2IDCA 3B9VA 1HHKA 3IFPA 3WEXB 4APXB 2AK4B 4YXKH 2AEIT 2B14A 3MNWA 4TVPL 4WEMB 1ADQH 2I5YH 4P2AA 1W0YT 4E36A 4QKTA 3WIHH 3COOA 2M83A 1ZGLM 4OFYD 3AY2A 4OZHF 1KTDB 4YC2C 3LJ3A 4HG4J 5DC2A 1P5UA 2HWZH 4K71B 5I16A 1PZBA 4TSBH 2J8UB 5I8OH 3ARTA 1QTYT 1R5VA 5K1JA 4R96B 5LJYH 2XOTA 1ZEAL 1A1MB 4W9IC 1EAOA 2WQ8A 4X98B 5KVFE 5C1MB 1VACA 5I82A 2EXSA 1E30A 2NDFA 2OXGA 3SGJA 4B96A 2CR3A 4M7KL 2M2DA 2X40A 1OP4A 2ZKMX 4FYTA 4NNXB 2AJYL 1KCUL 2ENPA 1MIML 4DKAA 1FORH 3T0DA 1CD1B 2VQ1A 3BPOC 1DSFH 3MUGB 4X0NA 4L2LA 1VFBA 1FBIH 1QQDB 3HVDA 4A04A 3QUXA 4ZK8A 5K39B 5B1CA 1RPKA 4LLWB 1CXFA 5DJAA 3V4PL 2EIZA 4NJAH 2NY4C 2NY2D 1R47A 3O3BB 2CJUL 1EEZB 4Q4EA 1DVXA 3DDFA 3RLSA 1EHLH 1J18A 3H4HA 3GK8H 1AGCB 1SY6H 2X7LB 4KJYA 3ZKSD 3D87B 3SE8H 2UVEA 4NCC1 2F74B 2AMGA 3O41B 4K3HA 3MYJA 2Y6SC 5FV1L 5E9DA 2DQGL 4NAJA 4QPEA 1SDAB 4LLAA 3G3LA 4A39A 3APDA 4IGBC 3LH9A 4C47A 5EOTA 2OMUA 1QUNB 2ITEA 3AABA 3PWPA 3NIDB 1NEZB 1RUKH 2XG5A 4QHLB 3UBXA 4NQVA 3KVPA 3GMLB 1F02I 3JWDL 5ELIA 5CIPB 4YDIH 1UKSA 3P4OA 4PJ5A 3QR0A 4CUCA 3QWOA 2K0RA 3F7VB 1OVZA 3VWJD 3VXQB 2MIZA 4JLRB 2OMYB 2XBDA 5EC1B 2O6CA 2AQPA 4Y19A 1I3RB 2H5UA 1A9EA 2VDML 1FV1B 4GJTB 1FQ9C 3VQMA 1RURL 3CCHB 4TQHA 2DJ4A 4XH2A 4G5AA 5HHNB 1OTUD 3KPMA 5B7FA 5D6DC 3OLEA 5JW5A 4LHUG 3D6GA 4MAYB 5EU5B 5F1NB 3IJ9A 5FF6A 2AF2A 3PGDA 1DJXA 1F2QA 2L3BA 4DGWC 1Z3RA 3S4SG 2VB5A 3B3IB 4XI5C 5E9DD 4I1NB 4PREB 4UTBA 2BP8A 3CZKA 4YS4A 1KJMA 4PIRF 4PGEB 3OL2A 1FZOB 3UX9B 1G5AA 3EJSA 4OAWA 5E70A 3FZUC 3REWA 2YZ8A 1C08B 5GJTH 3ISYA 2ZJSH 2OR9H 3D5OF 1BJ1H 3VD9A 4I4WA 4JRYD 4YLBA 4MAZA 2OCFD 3FQWA 1FZMB 4EOWL 1QRNA 4C57C 2X2UA 3AZUA 3BEWA 1BX2B 2BIQA 2WMPA 4WI5A 4WKZB 4N24A 3GMMB 1II4E 4XO3A 4KRMB 6FABH 4JHAH 3SKMA 4OH2A 4ZBJA 4YHIA 3QBTB 4GAGH 4Y19D 3ZSSA 3VCLA 1E8YA 1HCVA 4F7EB 2ZUUA 2DLHA 1MLCB 2CLVA 5ESQB 5C0DA 2DH2A 2RHEA 5I1DB 4KUCF 1R5WB 5DK2A 5BMFH 1J8RA 3DETD 1SFDA 1QLFB 4M5SA 1ZGLP 4I0PB 2R29H 4NGHH 4HQQL 2AXWA 4K5OA 5CN3A 3PAYA 2OPCA 1EAJA 4Y88A 5I17B 3GM8A 4NUQA 3IMTA 4M7LL 2VZUA 3K6FA 1JPGB 4TQPA 1I8LC 4TNVK 3OBAA 4GRLA 1X44A 3PG2A 4IRJC 4XCNA 3MRLB 3T2PA 4NQCA 4Q9RL 2MNUA 3UO1L 1M7UA 1FN4B 3JTTB 3DX4A 4N8PA 5ISZE 4MB5A 3FB6A 3CN1A 5IK3B 1RULH 1UA7A 2H47C 4OLVH 1OSEA 4X5LA 4G7YH 4TQ8A 5AFAA 2FE0A 4HDIB 2GJZB 1N10A 1QRND 4JPVL 4YBQD 5CP3H 4E9XA 4MMYA 1DVFB 2JNZA 4MHHI 2RA1A 1WIPA 2VCOA 1K8DA 2YA2A 2Q8BH 2ENJA 3DUSB 1CYGA 1HILA 2KHAA 1GC1H 1I85A 3FONB 5FYLD 2HPTA 3TYGH 5ILTL 3GTNA 3E6FB 5DO8A 3BWUC 5GS0D 4Y4KC 5ID1A 2MFNA 1WFTA 4EI5A 5BMFL 3OZKA 2J44A 5E94A 5T3ZH 4XOCA 3G5VB 4NAQA 3RIKA 1ERNA 3QDGE 4EQ2A 4GW4B 5CD3A 1JHKH 1RV6X 4ZPTA 2E27L 4QT5B 1Z9OA 3AT0A 2MSPA 3UEZA 4GRLD 2JKJA 2WXGA 4YHLL 2ZG1A 1Z32X 4RFNB 3QHZH 5F0LB 1A1OA 2N01B 3HOGA 3LEVL 3JV4B 3JWOH 3RWCA 1Q9LA 4KX7A 1VF5C 1W72L 3H7BA 4QHPA 1CF8L 3GXTA 3GMPA 2CRYA 4Z7VB 2V2XA 4HX1A 4P4KD 1NCBH 4F5CE 5BW7C 1Z3GL 1W6LA 5KYUA 2HT2D 4X50A 4YGVB 3P4NA 2EE0A 2N4IA 1MG3C 4MJ5A 4MXVF 4L37A 3U4EA 3SHSA 5D9SA 2Q7YB 4LVHC 4RFEB 2OJEB 3OKEA 4GO8A 1UB6B 2VXSH 5B22A 3TIEB 2VNCA 1H3XA 2XTJB 4I18A 3MRBB 3VFUA 3K72B 2D3NA 4OZFG 4LO9A 2HTLD 4HUUA 5EOCJ 4EI5D 4Z1PA 1OOWA 4U33A 3VTMA 5F1IB 4I5BA 4G7VL 2YPKA 3IDYB 4OR1A 4S1SH 4DZ8B 4ABVA 1BIIB 1PFOA 3WE6B 1JZ4A 4X9FA 2OYKA 5HI3C 1T66D 4PJHA 1U0QA 4JR9L 4ZXBC 4UZSA 1C9SA 2YRLA 1YPZA 1M71B 2A74A 5C3IA 3CVBA 3RFRA 5FYKL 4S10A 4PWEA 2EDHA 2BZCA 1OAXL 3WNJA 3D3VB 4MA8L 1AD0B 4U1HB 3MV8E 5CMAA 3UDWA 5KSBB 4IBLT 3ARFA 3GO1L 3O2VL 5FYJD 1DJIA 2VDLL 3PHOA 2A3TA 3BCDA 1NCAH 4KKPA 4WWKB 4JX0A 4HIXL 4F7TB 1RFDH 3LNEA 4PJ7A 1WD8A 4UOW0 1FYHB 3MUZ1 3BHBB 4LBEB 5F9JA 1E4XH 5IHWA 3QNYB 2X87A 35C8L 5D2NA 1X4YA 2NSMA 4WFEE 1ZLVH 1LM8V 3HLAA 2LR4A 4HHGA 2B4CC 3U4AA 1DQQB 1DQTA 5KVEE 2W07B 1S7RA 1T5KA 4X4YB 1ES0A 3QYCA 1BVNP 5JQIB 1QSEA 5KJ7E 2VWEC 2XQBH 3GJFK 1CB4A 3BH8B 4GUPB 4PHXA 4Z0XA 1A2YB 4WNQA 1IGIL 2OMNA 4C54A 1J12A 4HWBA 3ULUC 4KJQC 1WQVT 3FFCA 3K1DA 4JFHE 4BA8A 5FFLA 2E86A 1NCJA 1XIWA 2NY1C 4AVIA 1TCMA 4HULB 1A6WH 1MCOH 4RGOH 4AYFA 3Q1EA 2V9UA 4PRAB 4OF8A 2EXTA 3QUYC 1QZNA 3ZE2B 3ARFD 1WBYB 3Q8BA 1ORQB 3NQKA 4NYLB 4Y4HA 5JIPA 1D5IL 2D0FA 1MQ8A 3LEYL 3MV9D 4JFTA 5B8CA 2PKDA 5E2TL 1EAPA 4RIRB 4ZX4A 2B0SH 4K8RC 2HX7A 3DDGA 1TZAA 3TF4A 2A9NL 2YKLH 4AUJA 1I7UB 3TN0C 4FQCH 2DKUA 2ZWLT 1YEHH 2A73B 4HUXA 3RUGE 4OBRA 2I7SA 4QXTB 2GBVA 2DTML 3H9HB 1SEQL 5AW3B 3D18A 5DQ9A 2JB5H 1QKZH 2WWMD 3TBYB 1OPGH 1QSED 1QFWI 1SEBA 4HKBA 1AZRA 3RPIA 3CFDB 5DA0B 4NQSB 2BSTA 3FH5A 3BUIA 1VFMA 1W6WA 1DBKH 1W0WA 3O8XA 2VXQL 1GXEA 2C4FT 2DF3A 3R06B 1MFCL 1QNZL 2X4QA 3F6JA 1OE3A 3FFCD 3ZKXC 1WAPA 4L05A 3QDME 3TBVA 3QJFB 2VSKB 1UEMA 2BIMA 5D7JC 3UTSE 3AWFA 1VGEH 2DL2A 2SEBB 5FW6A 2OTUA 2YXWA 3GB7B 4U0RC 1QFWL 2GSGA 1DZBA 4Y4HD 5BXFB 5ALCL 3MGOA 4CSTA 1PVHA 3LSOB 3JUZA 3P4MB 3QXDA 4U05A 5FLVA 1D7CA 4PIBA 3KG5A 4FEIA 4NM8H 3CSFA 1LTXA 3HZKA 4OZFH 5T5NF 1JPSL 2RCSH 2NW2A 4XPGL 2HLFC 3I3DA 4Y5VC 2CK0H 5GGUB 3D08A 1QA9B 2ESVA 1KBWA 5E6YA 3SDDC 3HZMA 2OSYA 4M6MH 1UM5L 1KN4L 1NLDL 2A9DA 4P2OC 4XCEB 3TA4D 6CGTA 1BXVA 3CXHK 5AVWB 3O8XD 4ODSL 5TH2B 4YN3A 2K9UA 2YPVL 5IQ9B 4TUJA 4G3YL 3R1GL 4OQTL 5FM8A 3QNXB 3IJHA 4ZPVB 2VJ0A 2KI6A 1TQCC 1MFAH 3P77B 4MRCA 1QBLL 3ZGHA 1H9DA 2D7PA 3KLAA 2J72A 4PTTA 5E1AA 5JIDA 2YD8A 1PQZA 4N2LA 4CC4A 7PCYA 1UGKA 4NQTA 4K5LA 3WFZA 2PP9A 4Y4FA 5DQJB 4FA6A 2R4RL 1E8ZA 1FSKC 3T0EA 1SHSA 2R39A 3C2AH 3QUZB 3TBBA 3LKQB 4Q0XH 2NY3B 3UTTE 4FMKA 3T0WA 1HQ4B 2CE6A 3WIIL 1XQ4A 4L3EE 4F7KA 2QR0A 4YQXL 5DO2C 2WXRA 1IJNA 3C75A 2FBRA 4GO9A 1TTGA 3HG1B 4PJGF 5DZJA 3TPKA 4XBGB 3X12B 1JHTA 4OZHE 2ESVD 3LH8A 3AITA 1O5PA 4EDXB 4FL4C 3BH4A 3D12B 2ICEA 2JVUA 1AI1H 1L9RA 1ACYL 5H35B 4DNLA 5ADOH 3QEUA 1QWNA 1TQBB 1U3HA 2VDRH 4BSJA 1CICA 5I0ZA 2C9VA 2WGNB 1VFAB 1OQXA 2XPGA 5E8EA 3K71A 1XGPB 4KZDH 5F3BA 4AQ8C 3V4LA 5AVRB 4DESA 1B4JL 1OCRB 3FMGL 2ITCA 3PWNB 4NQDA 1CGTA 4P8QA 3OAZH 4XBPB 5EU3B 3G6JA 5T3XH 5EBGA 1U95A 3KJ4B 2YA0A 3RY6A 1JI2A 4ZT1A 4EI6B 5CBAA 4ABWA 1ZVNA 2TRHA 4HOWA 1Q38A 4Y4FD 2AFNA 1UXWA 3T0ED 1ET8A 4G8GE 5KVGL 2WXQA 1KFGA 3X14B 4GH7B 1L0PA 3BIKB 1A6UL 3L4XA 4AGQA 5JPNC 3FUMA 1TVHA 2JTYA 4B6ZA 1B0IA 2QFPA 4PJ6A 3MU3A 4OUOA 1BZ9B 3QXAA 3RU8H 3T1FB 4J6IA 1XB6A 4FQXC 5EU6A 2IDFA 1BFOB 1M7IB 5DA4A 1HE8A 2YAPA 2FGWH 4K2UL 4JZOB 1SLVA 4QR7A 2HT3D 2PXYD 4RFOH 5IG7B 2QHRH 1TLMA 3CWGA 3HMWH 4CW1A 1KSRA 5CHNA 1U3HD 5J13C 2LAAA 3NPSC 1LJMA 1LK3L 3CHSA 3O4LB 3GLAA 4N85A 5IGXL 3L95B 1UGNA 1DFBH 1I7TA 1UWXH 3DSFH 5KYNA 4NQDD 3CTTA 1JWUA 5IW3A 1TO4A 2EE9A 2YQGA 2X9YA 2CH8A 4Z76B 3A6CL 3CBJB 3HRZB 3EOAA 3CXFA 4HGKC 4RAUB 3U2IA 3CFCH 4KTEL 1TKWA 2DM2A 1PEZA 2EEDA 2X89A 4JY5H 4LOFA 3O9WC 3EJPA 2IGLA 4ODXB 4PWJA 1E65A 4NQEA 4QYOA 1DEDA 3FDWA 2EDYA 1A5FL 1XGYH 4B97A 3VA2C 4PJ9B 4XNZC 3S5LG 4OY9A 2P4AB 1G4RA 3VGBA 5EU6D 2I7OA 3N04A 4M8QB 3STZA 3U0WH 3VRIA 1UATA 4UT6L 1JZ3A 1DUZA 3ZDYB 3FAWA 3QC5X 3FB5B 4S11A 3UTZA 3V8OA 4IMKC 3VGDA 3VX1A 4FQQA 4QI3A 3NCWA 1TLKA 1GYCA 3L7FB 2CHWA 2FD6H 2FT8A 2IH3A 5C0EA 4O2CB 2H2PC 2VR9A 4WEEA 3UGEA 4JKNA 4LNVA 3GS0A 3ARWA 5AAMA 3RX7A 3ARGB 1JWSA 4HPHA 2PYFA 1JERA 2FQDA 3CBKB 3LIUA 4JPIB 3QUHA 2H45A 4LL4A 2Y7QA 1FJ1A 3UTPE 1WFJA 1USZA 1JK9A 2XPYA 1EA9C 4HKXA 5D96C 5AKRA 4KPHH 3K6SA 2VL4A 4JY6A 2VZOA 4XAKD 1K4CA 4HU8A 3TO4D 3SKOB 1C5DB 5KBPA 3CQFA 5LB1A 2F7PA 3CFKA 3WUWG 4PUBL 4P9HL 3F58H 2X89D 5F0PB 4DW2L 1AJ7L 1J0KA 1OHZA 4DO4A 1AD9B 2GUOA 4ZTOH 3UTOA 1NCNA 1SVBA 3IFLH 3KLQA 1ZHNB 5IWLC 3ATAA 3OJMB 4PRPE 3MRPA 1FFRA 1KDIA 1HXYB 2HTKD 4CC0A 3ZXAC 4J1UA 3D69B 4GQ9H 5GZND 1MVUA 2HP4A 4FZ8L 3ELAT 3TA3A 5ID0B 3JT2A 5I1JL 1EZSA 5DLML 3WMSA 3WO4C 5CP7B 1SM3L 1T20A 2JKTM 1R3IH 3ZZQA 1U8OA 4MWFB 4N0CD 1FWXA 1X5FA 4JM4L 1OAUL 2BFGA 2IDSA 3HE6B 3JWNH 4G7QB 3ZO0A 1HH6A 1AZBA 3ECQA 4KU1A 3SPJA 3GI8H 5E08H 3E0GA 3KDMB 4P5MA 4MDRA 5AENA 1ITCA 1NKOA 4QKXB 1XMEB 4FABH 5GRVK 4C83A 1ETB1 5PAZA 3ARBA 2KS0A 3QJXA 2MNJB 1HJBC 3FQTA 3QWRA 1ZLDA 3SQBB 5BJTB 1B0RA 1XZWA 2C3VB 4WSKA 5L0QB 4LOEA 3T6QC 2WWKO 4G71B 4KTDL 4LXFA 4FQHA 1S9KC 3PV6B 5I1HH 3S35H 2BVTA 3DLQR 4Q6IA 4GXVH 3T0VA 3HA0A 1MFNA 3PHAA 4UAOB 5CN2A 5SWSE 4WW2B 1JF5A 1SMDA 5CGYC 3CLEH 4WO0A 2DB8A 1LO4H 3RZCA 3DVGA 3MJ7A 5IESH 3I3EA 15C8L 3TA3D 1A8JH 4DEPB 1KC5H 1CFQB 5FO2A 5HYEA 1H3PL 1KCSL 1LO2L 1FNFA 3RURA 4QRQB 4AYDC 1AYRA 1NM9A 3O0RH 5BZDB 4OLYH 1CIDA 4JG1H 4IDJH 2NYYC 2YOCA 1MZZA 4XPFL 3NVQA 1FDLH 4FTVE 5GS3A 1UB5A 1VZHA 3QE5A 4LQ1A 5HDLA 3Q2VA 1IX2A 1DVZA 4TVSa 3S9DB 3LD8C 3BSZL 2Z4QB 1JNHB 3L6FB 3BZ4A 3G6DL 3CLFH 4MXVE 5D7LE 4KBPA 3M1OA 2DWDB 2MQGA 1DZ0A 1Q94B 1T1YB 2GFBA 5DMKB 1F6LL 3QS3A 3QWQB 1H8NA 5F6HJ 5FO8A 4IU2B 3K80A 3RVUC 8CGTA 1IAIM 2B5IC 1FI8C 4L9DA 2FWLB 2ICWI 4QY8A 1U58B 3U6XA 1PW3A 4XC3L 3ZDZB 1I75A 5K33A 2EO7A 3D4GA 5MENB 3ZSTA 3B2XA 5K59F 4RGNE 4TLTA 4WFHD 1CL7H 1CFNB 3QRGH 2EYSA 5ISZA 4ZD3H 4BCZA 1K2DB 3IBOA 3MRKA 5TTRA 2YD2A 3WN6A 1NOFA 4G8IA 3NK3A 2MCPL 2J5LC 4M5ZL 4QRUB 5JXEA 5IJKC 1AP2B 1CDUA 1MPAH 1YEGH 1GW0A 1G6VK 2D0HA 1DL7H 3I75B 1RZ7L 1T7XA 3LZFH 4M6OL 2ZXWB 4F3FA 1CD9B 3LXCA 1YEFL 3BAJA 1ASOA 1JDAA 3LRLA 3A4FA 3Q6FA 3D09A 1NJ9A 3QI9C 3EGDB 2AVFA 4KO6A 1BYOA 5B1JC 3NJMA 4Z77B 3MRCB 2DM3A 1MJUH 1D3CA 2ZP9A 3BQVA 1LE5B 1G7IA 3V52L 2VH5H 1BM7A 1A8ZA 1IM9B 5CEYB 2E56A 3QDGA 5J3HD 3L5XH 4P3DA 5IIEA 1HXKA 3F7QA 3PDDA 1CK0L 4LLDA 4HBCL 1W2KT 4P23C 4F58H 1SVCP 5EZIL 4P07A 4Z7UB 3W5NA 3Q7JA 4RA0C 3RX9A 3SKNA 1K3IA 2Q3AA 2ZKXA 3WTSA 3SGDH 1CD0A 3IFOB 5E2UL 3X13A 4AYMC 1F45A 5ISZD 2WN2A 4J8QA 5DRWA 4ZMOA 1KJ2B 4F5CA 5EPMB 4WI4A 3V95A 2ZUQB 1F2XK 5JXED 4AMXA 1TMQA 4ZDHA 1PX3A 4IMLB 4QF1B 3L3KB 3ZKQD 3MLSH 1VCBC 4KZ0A 4OZIF 3EO9L 5HHPB 3ALWA 1BF8A 2FL5A 1P7QA 2YHGA 5DK0A 5DTFA 3RI5F 4EDWL 3BDYH 5IFAL 4HWZB 4RAVB 4I1PA 2A9ML 3THML 4L3CA 3GEFA 2R59A 4O2FB 1GHFL 4F37K 3WXWL 5J5EA 1ETJA 3ZIMA 1HZLA 3BC9A 1BBDL 1PZ3A 2Y69B 3C9NB 5I2IB 5JHLH 3UP6A 1W91A 3CFBA 1UJ3C 4BFJA 5TF1L 2PR4L 1OO2A 4AYID 1TJIH 1WFUA 2DJMA 3QDGD 4CDGC 3TURA 1GTFA 4BFBD 3KGSA 4MXQC 5D1QD 4HFWA 2YMOA 2K6ZA 1E4KA 1EDHA 4N1CA 1XH1A 4EI0A 2VISB 4E41B 3HPLB 3VXUE 1TZHA 1INEL 5K9QI 3MV8A 4RGMC 4WJ5B 4QRPB 3K8LA 3VD1A 5KVFH 3LIZL 3TNMA 2FLMA 1U8KB 3PYCA 1NGQH 4R7DA 1FFPA 2CMRL 1AR1D 2PPCA 2XNAB 4MBOA 4FKEA 2NY2C 5E00A 5ACMA 1GYAA 4JK0D 2NY5H 1R5IB 3MX0B 4LGSB 1IVTA 1XCTB 3ZMEA 3BW9A 1T04A 4Z7QE 3HG5A 3FUEA 4AGPA 3EYQD 5CINH 4TNWF 4PCKA 1P7QD 2ZOOA 3ETTA 3HUJB 3T2NH 2PUQT 3IE4A 4JDTH 3C5JA 3RWDB 3WLBB 4H26A 3MOAL 1NGXA 4XRCB 2X5PA 4GIPD 1F58L 3A23A 3P4LA 5F88A 4XO4A 3SGJC 5F7HA 5IEHA 5JW3H 2XWZA 5GGVH 3V7MA 2OW6A 4H8VA 4UTCA 2CK2A 3MRIB 2CNYA 4AYBA 1KOAA 3VWJC 3MV8D 4HSAC 4PJIB 4DGUA 4WI9A 4PRHE 4KY1H 1HOCA 4DKFL 3OR6A 3Q6GL 4YWGH 5I0VA 3QZPA 3BSHA 4KROD 5SX4I 1SBSH 3H3BC 1U4FA 2BY3A 4MZ3A 4OJYA 5BO0D 1CLOL 1J1XH 3G04A 1JTTA 1PZ5A 2EXWD 1I82A 3ZE0F 3H2WA 3LKSB 4GSDH 1E6OH 2NZ1A 5GRWA 1PIFA 3H7LA 3ZDXB 2WXKA 4JG0H 1PKQE 4AWJC 5J12B 5LXGL 2P9RA 1U2YA 4GKZB 1AKJB 3RUGA 4WFED 5CILH 5CLXA 2XX1A 2E7BA 3WKYA 1CXIA 2ZX7A 3S96A 2XETA 2VLJB 1AS7A 3FO0H 4UQ9A 4XP9H 1IT9H 3N1PC 3EDFA 4G43B 1QI5A 1J1PH 2GK0B 3DSNA 4JB9H 4PJGE 3EJCA 2WW8A 2OMWB 2NY0D 3ERXA 4PJCB 5LBSA 4PAZA 3V6ZB 1YYLH 4JFHD 3DRQA 3QDMA 4H5SB 2G75B 3UTSA 5A3ID 4F57H 1U8PA 1Z9SA 2JJSC 2BCKA 4ANXA 4Y5YB 5D1XA 3REVB 5CU5A 4FQJL 5GS1C 4ZFFA 4DHLA 2WKGA 3HPJB 4ALAL 2H8PB 2PYEA 3MRFB 4PVLA 1JN6A 4PR5A 3FN9A 3I50H 4GXUM 5IEKA 4Y2OB 5A16A 2P52A 3DKHA 1UADC 2FLBT 2EH7L 1AMXA 4XOAA 4V33A 4Z18A 4NHCL 3HBQA 4OF6A 2AAAA 2ZAGA 5H2BA 3WN5A 3TBWA 3TO2B 3DTDA 4GG8B 2PO6B 4P2QE 2X0WA 2ITDA 1XDTT 5C08A 1LXMA 2CXKA 2QV4A 5LO7A 1OK8A 2FJFB 1FG2A 3ULVL 2ATPA 1PSKH 4I9WE 4YX2L 3WHE0 1AO7B 1AGEB 4J3OG 1Q8MA 3ILPB 1RMFH 1XH2A 2HZHA 2Y1VA 4HK0A 3WEAA 1YEDB 3DX9A 3B5TA 3QDMD 1KV3A 2FNWA 2DTSA 2DIJA 3UTSD 5L9DH 5MEPA 3LRHA 2GVYA 5IW6A 1F4WH 1JV2B 4PW9A 5A6MA 2O5ZL 1T0MB 3VD0A 1UWEH 2FTAA 3VGHA 2GTQA 4POYA 1NGWB 3INOA 3UYOD 4IOFD 2YUWA 1MOEA 3BGFB 1G0XA 2EXYC 5GS0C 2IPKB 1QAWA 1HAWA 1OQOA 1NAKH 2G4GA 2IWFA 4GSQA 4OIIL 3WYRA 2CO1A 4L3EA 3TBTB 5C70A 3C09B 2B77A 2NYZA 1CFVH 1CXKA 2BSEA 4JPKH 4ZFGL 4ACTA 3FT4A 4KWUA 5JHBA 1B2WH 3SPHA 2ATKA 2X4NB 4GRLC 2I60H 1X5JA 4OKVB 4WU5B 1AGFA 2YO3A 4OZHA 3CX2A 2VABB 1MI5E 4X7SL 4WFGE 3W56A 3Q2CA 1TENA 2CO6A 2G3ZA 5CZXD 2H0EA 4AT6B 4DSYA 2IDUA 1DSYA 3OQ3B 3DOIA 4BCYA 2Y4SA 4P4KC 1IL1B 4M1CD 4N6RB 1VPOH 4UM8A 4K9EH 2HT2C 2MEJB 3IU3A 4IQHA 5D7IE 1PYWA 1RUPL 3GSUA 4PB0H 4ILDA 3T5WA 2JMRA 1J9TA 3NZ8B 2Q76A 5K9JL 5K9OA 1I85C 1QSFE 1UZ8B 3FSOA 4GIAA 4JHZA 4J7RA 1ZA6A 4OCLC 5IMOA 2W94A 4HS3B 1JZ5A 3N91A 1OY3B 2HTLC 4KMTL 4N2EA 5CJ8A 3JVFC 5CBEA 4KK6D 3PWLB 3RTLA 3NT0A 3LYRA 1MIEH 4E9YA 4G8GA 4OUUB 1LD9B 3UTTD 3BPLC 3MNZA 4L3ED 1YNLH 1AC6A 1T66C 2YA1A 3K2IA 2KUTA 2DQDH 2BSED 2ZUTA 3TWYA 1NMCB 2NRDA 3NFPA 1J87A 4KOCA 2C1PB 2P24B 3X3GL 7PAZA 3T6XA 5JIHA 4K5NA 2Y5TA 2BC4B 3QIUA 4BHUI 5L7XH 3IGUA 5I73B 5L2KE 1EEYB 3QGVA 1MF2H 1E4WL 2YBRA 3OX8B 1HN1A 2HLEB 2VAJA 4AQEB 3QIBB 5C0CE 4ZUWB 4KRPD 1E28B 1KCRH 4QXGL 2FIRT 1K5NA 2BHFA 3W2DL 2JIXB 5AL0A 4LCYA 3WHXA 1P4IL 3WFEL 4L1LA 2R2HA 1QSZA 3AQDA 2OX5A 4ZUTA 5CEZE 5E03A 3BD3A 1S5HB 3VTTA 1I8IB 3QJRB 1GYWA 2WOYA 3WJMA 1QLRB 4NRZA 1BECA 2VIRA 3CPLB 2VTFA 3GMQB 2OBGA 2Z3FA 3HCVA 4MSWA 4OD1L 5DJYA 3WDHA 1DQML 2BSRB 4XNBA 1G6RA 3Q2NA 2E5EA 4LHUB 5G4MA 3VFWA 5C8JA 3DXAE 2VERA 3S4SB 3ABMB 4HFUL 3RY5A 4A2HA 3UC2A 5DU7A 4UINL 2NNFA 2XRAL 1JF1B 1TJMA 3LEXB 4J3OH 3UDWC 1P5UB 1YZZA 3QIUD 1FE8H 1NCUA 2MTAA 3WI9A 4EN3A 2F54B 3U6RA 5I16B 1OWRM 3O3EA 2PTVA 3ARFC 8FABA 1HCYA 4HWNA 1JD9A 2K78A 1NFDE 5AW8B 5EV7A 3DJTA 5ENWB 5LGHH 1YJDH 4JN2B 2IQAB 5F0MB 2XA3A 1Z9PA 4KKLD 2BIHA 1IKNA 1UXSA 2O26U 3BI9X 3WDIA 5IW1A 1WBZA 2EEFA 4UDTA 4GQPH 3H42L 1QD0A 2IIJA 4GP8B 4ZQKB 2EDLA 1HEZB 1JFQH 4GSUA 1UACL 1LEIB 4NX0A 3MC0A 3SE4C 1DVFC 2XVLA 2XVKA 4NAMA 5D2NC 4D94A 1JI1A 4LOVA 4D7PA 1GTNA 3WY4A 1R75A 4D3CL 3ABLB 4M93C 4Q14A 2B7DT 3FQ2A 3CSYB 5DJAB 1U8IA 5KSVA 2WWMC 2C8NA 5HHXH 2F8VA 1O9WA 2AV1B 4X6FA 3D85A 5LNDA 2VMJA 4PRPA 3EJJX 2B9AA 1CLCA 4JMNA 2XKNA 4KJYB 1HSAA 4KUZL 3H4FA 4U3XA 3I6GB 3NTCH 1L9NA 1VRSA 2MPAH 3MRDA 3ZBMA 3ZYIA 1T0NA 3HS0A 3DX8B 4LPVA 5BZXA 4EN3D 4IBUA 2I85A 3AREB 3MA9L 5I9QC 1GCFA 2QQQA 3FFOA 4Z95H 1AOZA 3BZDA 3GZOA 4XNYL 3LH2L 3DIVA 4U1JB 3V5HA 2XWTB 3HC0A 4Y4HC 2X70A 4TL4A 4NENA 4BXSV 2OL3A 1A4BA 5D5MF 1DBAH 3PWPB 5B8CC 4AH2A 4NQQA 4TRPH 4ADGA 3NSYA 1ZTXE 1F8TH 2JB6B 4NQVB 3NJXA 3C8KA 2A4EA 3LKRA 1NWOA 2Y1ZA 4YOKA 3UTPD 4PJ5B 2IFGA 2CKBL 3NSDA 2XZAL 4CMMB 5IF0A 5BUAA 3MRRB 4MNQE 1YEJH 3Q48A 4XNQA 4R2GD 5E1HB 3ZL4H 4AQ1A 4UT9A 4HXBH 3MRGA 5L6YL 1OAYL 3KGRA 2XTJC 1A9EB 4UBDD 1ODAA 4LP5A 3AS2A 2YMXH 2YRZA 3L5JA 3D85D 4KUCD 1KCKA 3WKML 3CX5J 3FTZA 4JPWL 5SWSA 3BAYA 3MBWA 5EDSA 3C12A 5GRUH 2J55A 4FJ6A 5FF6B 4A66A 1Q0XL 1YN7B 3VE0B 4NZ8A 4KO9A 2Z0BA 1MRFL 4CVZA 4OCXL 4ZAKA 5E6RB 4FMFA 5JMOC 5KWYC 4PCSA 2BVPA 3W39A 4OAWB 1YEKL 1QFUL 4TQIA 3V55A 3EJRA 5CKGA 3ENEA 4HZLA 4FTVA 2QGDA 2D0GA 4X0KB 3FT2B 1WH0A 3QT2A 3QQDB 1RD6A 5IT2L 3L2MA 4DFHA 3FCUB 1MEXL 5DVNA 1BJMA 2C9UA 5FDWA 4OZIE 1BPLB 4RSVA 1OP9A 1BBJA 1NC2D 2Q3ZA 3LS4L 5D7LA 1I8MA 1Q90A 4OZFB 3WGVB 4ZTPH 4UNVA 5EOCL 1FL3B 1W9XA 4I77L 5E8OA 1WCBA 1XL6A 3FNKA 2UVFA 4K3EL 4FFZH 1HQRB 1AGDA 3M17B 1HZKA 5SWSD 2R2EB 3RB7A 3VXPA 1LLAA 3RL1A 3IFNL 5JORA 3FQUB 4LP8A 3Q06A 4I2XE 2Z31A 2QVMA 3TIDA 4LLQA 3AY4C 3KHQA 4AENA 1BVKA 2D9QB 2HUHA 4FRWA 5DMIL 4NKMA 2P5EB 3Q43A 1X9RA 3G08A 2EVGA 2BNUA 2NX5E 5D55A 1EJOL 4GKOA 4N2AA 4Z0BL 1NGPL 1NC4A 2QZQA 2F54D 3MNDA 1EFXD 5IR1A 1LEGB 1M57B 4Q2ZB 4CN1A 1AE6H 1GOHA 2Y2TA 1F1AA 4FTVD 1BVNT 5B1AB 1F1DA 2ADGB 3GIZH 3IWVA 1RHHB 1E2VA 3BQUD 3R18A 1FO0A 1QW9A 3GS4A 4PP1D 4IEFA 4MMYB 3DGDA 5JDSB 2XV0A 5TK4A 1FL6B 5D7LD 4JANA 4EQ3A 3IXTA 1KIPB 5BZWA 1DEEB 1TEGA 3E3QE 2VZVA 4X4XB 5C3TA 3VGAB 32C2A 1IM3B 5E4IA 2X9XA 4XHJD 2ICEC 1IC7H 1Z0NA 2PXYC 3QEQE 4YE4L 1VIWA 4YZFF 1PCXA 4M5YH 5TE6H 1BQUA 5AW1B 2GABA 3EOTL 4TLSA 3TFKD 2Z31D 5GSVB 1LO0L 4TLUA 1IB5A 2VDRB 3N85H 4RGND 4X8JB 2FWOB 3MTRA 4IIQA 4X5WB 4QXVA 1IGJA 2G9KA 3BT2H 3GJEB 2IG2H 4YDKH 2DQJL 5DJ6A 1IAOA 2FUTA 2JSFA 3RY6C 1KNOB 2IBBA 3ZL1A 1NC4D 4XNUH 2CNZA 3I84A 5JYLA 4FKHA 1VERA 5D71L 1DQLL 2ADIA 2VDPH 4F2EA 4U7KA 3GMPB 3X1BA 5HHQA 2V2XB 3SYAA 2ADYA 3VSTA 3ZE0E 2ADFH 1BZ7B 1YC8A 1MJ8L 2VSCA 5AYUH 3UG3A 5KYUB 4QHUB 4AXWA 1M6UA 2DM7A 4YNYA 3G5ZB 4MD5B 4U4BA 4XP4H 3V0EA 3KYKH 4NPKA 5HGBA 3WY2A 3UYRL 4N2IA 2AJUH 3OKEB 3VFTA 3BUTA 1T1WB 2FLRT 1OCCB 2HJFB 4I18B 4ELDA 5EUKB 3CC5B 5AW6B 3UTQB 3O2WH 4NO3B 3MN8A 4NXKA 4Z78B 2AJSL 3RWEA 3MO1B 2VERN 1R3LB 2HG5B 4JO3H 3N42F 5LG6A 4ZSOB 3Q5YA 5D4HA 2WD0A 4GS7B 5EU4A 5IUCA 4FG4A 1QTPA 3VXUA 2WLIA 3AQZA 3ZHDA 1WCQA 4MNHA 1F00I 3NCYS 2ZAIA 4NT6B 1GZPA 1P4LA 1J5OL 3WFBH 1YEIL 1JFHA 1B0WA 3WXVL 2A74B 1GGTA 4F93B 4PGDA 3D1MC 3TYFB 4QRRA 1GS6X 2J6EA 5B38A 1SXCA 1TZ8A 4N0YH 3ARZA 5CMAB 3JTBA 2E9BA 4G1MB 3TO4C 4CGUB 4H8PA 1XBDA 4JO2L 5DHVH 3LTVA 3K0YA 5CN1A 1WZAA 5GISL 2WUBL 2BZ7A 1M05A 1K5WA 3SE9L 1YA5A 2IQ9L 5E2JA 2ITFA 5AOIA 3GTVA 2EDNA 4G82A 1F13A 4LARH 3BXNB 3OMIB 4U7SA 2W59A 3C60A 5GZNC 4APQB 5F9JB 2KERA 4FQLH 4BH8B 5EN3A 5ALBH 3EO0A 1G0DA 3US1A 1FG9C 4G83A 5B39G 3B3BA 3TT1H 4ETQA 3FAXA 1OAQL 4F8PA 3SDAB 4N0CC 1PGRB 3AU0A 4OZGF 3FO9B 2NOYA 5I5IA 4LCWB 3K2KA 3ULSA 1K4DA 1QFPA 4Z0XB 2JKXA 3VXUD 4AYSA 2IV9A 5AAMC 1TQBC 1ZT1B 4WNQB 3KZ8A 2APTA 2XFXA 2W9DL 4PRHA 3QFJB 4DN3L 4HAFA 1XIWB 5TDOB 3L3OA 4XZUB 2KDYA 3FUNA 3DRTA 5IHUH 1AZZC 1UCBL 4NEHB 4X42A 4MKTA 4TVPH 3EG9A 3KJ4C 4S1QL 3A67H 5A2LH 1I9RL 1AHWB 4BUGA 1PKQA 3F12A 3EHBD 3PF2A 3B2VH 5KS9B 3WD5L 4NHUA 1FNHA 4G6JL 5GS2H 5AALA 2VJ8A 3HG4A 3FW6A 4WI3A 1VFUA 4NKOA 1IAKB 2BPBA 2B3IA 5D7SH 5DZPA 3UERA 1SRDA 1JCVA 1ZEAH 3O2DA 2WXPA 3C60D 4TV3A 3BE1L 2QBWA 1J7VR 2VKXA 5DJXA 3TA3C 2VR6A 4G6FB 4ZW7A 4LFHD 3QXUA 4TNVF 4H2AA 4M7KH 5LAXA 4PJGA 4ELMB 3MRNB 4XN1A 2BY1A 2FQFA 2AJYH 4WTQA 5DRXA 3BCFA 1UG9A 2VXUH 3SJVB 3UPCA 4AK1A 1HI6B 4JUSA 2AQNA 4XO8A 4GPVA 4HKBB 1WV7T 3GI9L 1TDQA 1KGIA 5MP6H 2BSTB 3S36H 3JBG7 4MA7L 3IDNA 3QCTL 2XCMC 5JW4N 4M1GL 4ZMXA 4TSCL 4PRHD 3RX5A 2DQEL 3PFUA 1BG9A 4LAQL 3MLXL 1BAWA 3ZTDC 2AJXH 2HRGA 1NINA 3KBPA 4JFZL 4WEUD 5I75B 4RBPK 3NEEA 3VFGL 3SDXF 5H4ZA 3OKYA 1LEKB 4F9PC 1V3KA 3B2UC 3QNZA 2OSXA 1MWOA 3SBRA 2GSGB 4P5TA 2O6DA 2X9WA 4UQ3A 2H6PB 3SD5A 4ODVL 4HZAA 4HKZB 4WWID 1IQDB 4LCIH 1BXXA 3QXDB 1ZV5A 2J12B 4MHHG 1G7QA 5HYJE 2A6IB 1FZJB 5JXAH 3PP3K 2AXHA 4EZKA 3GMNA 4P2QA 1FFNB 3LVEA 1PY0A 3MLWL 1UUNA 1YY8A 1J1OL 2LHAA 3S5YA 4QO1B 1ZLUK 1QPKA 4QAMB 2FSEA 3KPOA 4Q9QL 3OKOB 3HIZA 1QBAA 4AL8C 3HZMB 2FO4B 3RNKB 3U25A 5HGDA 1XAUA 2R4SH 4FC3E 4OF7A 4JQIA 3DOSA 3TVMB 4YXHL 1B2YA 1AXTL 3NFSL 2ZXDA 4IRZA 4BM7A 2I9TA 2VDMH 2WTOA 1N5YL 1P7KB 1GZQB 1A6PA 1F42A 2EEXA 3U6XS 2NXYD 1QEWB 1A25A 2XG4A 1MW1A 2O61B 1FLRL 3N9GL 2BIPA 2B3RA 2DD8H 4F91B 4PI0A 3MRHB 1PQZB 1A7OL 2GTWB 3KPNB 5J3HC 1BLIA 3QXWA 3S8GB 1A3QA 4PGJA 3TZVB 2P7TA 4KO5A 4UOZA 3FB8B 3F7YB 3S5LB 4MJ2A 3I9GL 4PYGA 2WBJA 3MBXL 2QR0B 1KBPA 3VW3L 1MI5A 4LVEA 4I9WD 1RJLA 5DD6A 4B7LA 3MMEB 3OGCA 2ZYIA 3OF6A 2NY6D 3ULUF 4K94L 1VENA 2FATH 4ONOA 2IADA 3P9LA 4E9LA 4NOBA 2RAMA 4M4RB 3IRZA 4LASH 1R0AL 1Q9KB 4LU5H 3OXSA 4UV4H 1OD7A 3UAJD 4PRNB 5D93C 4BZ2A 2Z91B 1CICB 3NK4A 1I3GH 1A4CA 4UOW1 5E8EB 3LS5L 3FBKA 4Z3HA 1OSZA 4NM4L 4P05A 2VW6A 3OVUB 1QSFA 4H1LG 2X1OA 4XP6L 1KJ2L 2QQKL 3K7UA 3OGOE 2ITCB 3Q8EA 1UM6L 4GQQA 5I1LB 5L8KB 1RJZA 4K7FA 5ICZB 5J1AB 5E2VH 1U95B 5CBAB 3WUWB 4KQ4L 3PXHA 3F62A 2QVKA 4S0TD 5DWPA 4M7LH 5J11B 3D7PA 3EYSH 3MROB 4I1RA 5INCA 3II3A 5D1QC 4PV9A 1V7NL 4YDVA 2WBJD 4JFOA 5KTEH 3WS6A 3IVKB 4WW2C 3TESA 2OTWB 4WFGD 3QXAB 4NWUL 5L2KA 1XXFC 3OF6D 3FU6A 3QIWB 4P57B 4G6FD 1NBQA 2ZCKL 1WTLA 4DEPC 2CBOA 5DHDA 4E0RB 5G5DA 5C0CA 4LVNB 3MUJA 5SX5K 2IAMA 1QWUA 5KANI 1JHLH 2FR4B 4U49A 4HGWA 3AW5A 1RVFL 1FGNH 3EYQC 1ND0A 1Q72L 2GUYA 2YGOA 5D5ME 2XY1A 3QZWA 5F7DA 4HU2A 1L9QA 4NI6A 1QSFD 1O5DT 3UEQA 4G6MH 4KV5F 1VCAA 1MCEA 3AM8C 1I7TB 4F7PB 3GGWA 1Y7VA 2J4WL 5F1KC 1DTUA 2MCMA 5FLUA 2QV2A 2F8XC 1JNLL 2OMVA 5HI4D 5LN8A 4JRFA 4G80A 4DUWA 1IFRA 5BS0E 3FT3A 5KBDA 4ZJ9A 3PGFH 4NO5B 1J48A 2K6YA 3NN8B 2WZ6A 3DXAA 3HAEA 1A7QL 1TKWB 3OAUH 4N8VG 5E6IB 4YXKL 3E9TA 1I7ZA 3TEXA 3WJJA 4ZX3A 1JDCA 3DHMA 1ADQL 5T5FH 3Q44A 3B7SA 3R8BB 1DVSA 4FFVD 4M56A 4NQEB 3ECBA 2QJDA 1U8NB 2NNCA 3RL2A 3RZWA 1RJYA 3S98A 4KKZA 2HWZL 1TVBB 1W72H 1HEHC 2GY5A 3RVXD 3G5XB 1HHGA 3O6FB 2EDFA 5L2KD 3OLDA 2P8MA 2R1XA 4WI0B 1IIKA 2LW3A 1E8WA 4I0CC 3UTZB 5C0CD 1BJ8A 4U1GB 3X1FA 1E9OA 4L29A 2IAMD 5C6TH 1I9EA 4EUPA 4Y9BA 3MCLL 2HMID 3T4AA 3ZJAA 1FORL 3IETB 3MUY1 4POZD 1DSFL 4N0UB 5CEZD 4HISA 4FHKA 4BFIB 4QHMA 3KCPB 2CPCA 3OC5A 2X0VA 3QUKA 4HK3N 2QQLH 3RVWD 3LPPA 4ZUSA 1ZHBB 2EDQA 2Y7QB 3GBEA 1OT4A 3PJSA 4G7VH 2Q10A 4HKXB 3HZYA 4RZCA 3V7AG 3D2UB 3HTLX 1Q1JH 3FXIC 5CZKA 3V5KB 2JJUA 1K4CB 3GDBA 2I07A 3VMNA 1WIUA 1R3JA 4JR9H 4NN7B 1EHLL 3GK8L 1PZDA 2WQSA 4MA3A 1SY6L 1FVCB 2NY0C 4BZ1A 5IVXF 7CGTA 1I3VA 2GUOB 3FO1A 5SV3A 2VUKA 3O2DH 4ESKA 3MRPB 4P06A 5A3IC 1D2PA 3EBGA 2C1OA 2NUTB 1N0LA 2SODB 1IFHL 2VDLH 2AV7B 2YXFA 4OZ4B 4AIZB 3HFMH 3FOMA 1E90A 4HJJH 5IHZB 5C3LD 1YEEH 3K5SA 1VB9A 2CU9A 4FNRA 4X9YA 3OSVA 3TC9A 2CHNA 5FB8A 3G5YB 1EVUA 4R4BA 1FUNA 1T20B 1RUKL 3N43B 3EYVA 5E9NA 3WTTA 2Z7YA 2EDEA 2N1KA 2YUXA 4YDIL 1ZXKA 3DUUA 3ZHNA 3HHSB 3IYLW 3EGSA 3WKQA 3MLUL 4MNQA 1FZKA 3OMZA 3IDIA 2EYTA 4R83A 1GGYA 5CEXB 4DGYL 3ARBB 1T7ZA 2EE6A 4G8EA 4J23A 2GBAA 4LSUH 5FGSA 4C4UA 1ZS8B 5EOQH 1B0RB 2LVCA 3N41B 4X5QA 3WL9B 5FKAB 1JGVH 2LT9A 1IEAB 4N3TA 1UKQA 3ZQ9A 1PD6A 3U9PH 5LQBH 2BNRE 4YZFE 4GT0A 4BA0A 3RNQB 2V2TA 4JRXE 4HUWA 2WINA 4YDMA 2VDOH 1TCRA 5F3HA 4LF3A 3B6SB 2RQEA 3RZCB 1UA6H 2P80D 3DVGB 3MJ7B 2X44D 4IOFC 2NQ3A 3BJLA 4A2EA 3HZVA 3QDHA 4X6CB 5GGRA 3OAYH 3S8WA 4HT1H 5GJTL 1M42A 2ZJSL 2OR9L 4QRTA 3KPPA 4I88A 1NDGA 3HZ3A 4N2OA 1ZA3A 3BP5A 5DZVA 1N8ZA 4EE2A 2CQVA 2DTMH 1SEQH 4OZIA 5I0WA 2X6MA 2XXCB 3JV6A 4HXAL 4MNQD 4ELKA 3Q5TA 6FABL 4JHAL 3IJEA 4W6XB 1HEJC 4GAGL 4PJAE 5HI5D 3WIFA 4HLEA 3P9WB 1WA1X 3OJ2C 3VI4F 2HAZA 1P2CA 4HJIA 5I74C 4BK5C 4JDVB 4BQ6A 1KGUA 1CE1H 3D0VA 4H25A 3UBGA 3VI3F 4DO6A 2Z1KA 3NUKA 3ZTNH 2VXQH 1A6TA 1MFCH 1IEHA 1BV8A 3GSXA 3T6VA 1WZ1H 1QOKA 1J0JA 2R29L 4N2KA 4NGHL 2X42A 2AQ2A 4I2XA 4F8QA 1OIOA 1I9IL 4M1CC 3QZOA 2XN9E 2R69A 2IBGA 4NP9A 2APVA 2IGFH 4ODHH 1N5AB 5FUZH 3VFPB 4M7LT 3M46A 3QJVB 2X6CA 1OB0A 2NX5A 5ALCH 2OAAA 5GIRA 5BQ7B 2BJML 4YDLB 4NO0A 1IKOP 4PJXF 3QPXH 3VG9C 4JJ5B 2BINA 4L4VB 1XXDC 1RULL 2ZWNA 3DX2A 1CO1A 2WM0A 3WS3B 4OLVL 3GXDA 4KTYA 1FPTH 1TEYA 4G7YL 2BWIA 5TGBB 4G8IB 2G9HA 3BUYA 2DEXX 4WTXA 2L8AA 1ZSDB 3L3DB 3PL6A 4KC3B 3CXDH 3HNTL 2GITA 4FI7A 4KK5D 3FKUS 5ABAA 3TYGL 1D7DA 1UM5H 1NLDH 4JDZA 1N70A 2E6PA 4A2MA 2Z64C 1G1KA 3QEQA 1H5BA 4HUVA 5T3ZL 2YPVH 3ECUA 3QZMA 5JZ7D 1CCZA 2YUZA 3R1GH 4KRPC 2JKNA 3S5ZA 4OQTH 4M6NH 4UQAA 3B1UA 5EC2B 1JHKL 1TZIA 3Q2WA 4OZGE 3VD2A 1F0LA 5DZNA 5IIEB 5EZLA 3VXRB 2X4SA 3GS7A 2NX5D 3QDJD 2HCZX 4J3XA 3V4VH 3D48R 3QHZL 1MCKA 5FKPA 1JK8A 1OT1A 3JWOL 4NO0D 4AIEA 3SY0B 1MHEA 4KFMA 2JI2A 2AKRA 4Y5YC 4PGBA 2CBPA 3WIIH 2KC0A 4NJ9H 5J8OA 1GGIH 3SDCA 1YUKB 4U1SA 2CBMA 3VO0A 3RWHA 5JOPE 4NO2B 4C55A 1SXNA 2Q86A 3KNBA 1RZIA 3VACA 4AVJA 2W65A 3O11B 2ARJQ 2VXSL 2DQMA 2OFQA 5C0GB 1GKOA 1NGYB 2OYLA 3OD3A 3RGVA 1ACYH 3QA3A 1KCWA 4Q58C 5C0BB 3B7UX 1PX8A 2XN2A 3QEQD 3PNRB 4TUOA 1GGCH 2J73A 4S1SL 4WNSA 1SLUA 4FXGB 3TH3T 1MCPL 5D4QA 4KI5C 1OCOB 2V2WB 1CUOA 4LOUC 1S78D 2EDKA 1S5IH 4KKLC 4I9XA 1MCWM 3WFCL 1ECZA 3BH9B 1PF3A 4FD0A 1RLBA 1J11A 1OWWA 2E46A 4L1TA 4XCCH 5IOKA 5C07B 5DJDB 3VJ6A 2VLKE 3QORA 3KPRD 2XKSA 4HETA 4M1DH 1YECH 2WJ5A 1AOHA 3IDMA 3TNMB 3W0WB 3HI1B 4KHTL 2J71A 4FQ2L 1JUFA 3NFNA 3SBQA 3SQOH 4HHAB 1IGYA 2G5BB 4LSVH 4UYPA 3EOBB 1T04B 2IWGA 5MERB 2BK8A 5SWZB 2ZCHH 5DMGD 5FA4B 4OM1L 4S0SD 1G84A 3BO8A 5JNYA 4FZEH 1E4XL 1QR4A 4L8SA 3KWWA 3U36B 1TU2B 5EFIB 5KSAA 3RGVD 3C5JB 1ZCRA 4JAMA 4LLUB 5HJ3A 2C9AA 3NOIA 4ERSL 2GAZB 3EH3B 1A6ZB 4HH8A 3J27A 2WZPD 3DBSA 4BZ1H 2XQBL 3UBXI 2FYYB 6PCYA 2HT4D 1AQKL 2YD4A 3MKKA 5A7BA 4QOKB 1I8KA 3EADA 4LSTL 1MCOL 4RGOL 3QORD 1JGDA 2P5WE 3GSRA 3VXOA 4R2GC 1AANA 1R3KB 4KGJA 4PRBA 1R4XA 3OR6B 1KPUA 5AKTA 4AMWA 1A0QL 2H3NA 3D50A 4PCTA 2J57A 1AMYA 4UBDC 5ICXB 3ARPA 5KZCB 5EBLA 2X1WL 4KNQA 1GC1C 5EBWA 5T1LB 2B0SL 2NZ9D 4ZYKA 3IB4A 4B5EA 1RERA 2PCFA 2X6AA 3Q3GB 3HB3B 4RDQG 1JMZA 3C2SA 4FQCL 4UT6H 2H2SD 3AU1B 1HHJA 3UZEA 1YEHL 4TPRH 3RJQB 1P69B 3ABGA 3RUGB 4F2ME 5KSAD 3IDUA 2JB5L 2UYLA 1QKZL 3QXTA 3VWKD 3QUMA 5DUMH 5TDPA 1OPGL 1S7WA 1ORSA 1FYTD 1RH8A 5IVZA 2G2NA 4YSQA 2NNAA 3PGCB 5HYFA 3DJZA 5D1ZA 1LO5B 4XPBH 1RZGA 3QIBC 4PRIB 4UTBL 3AUVA 5GSRA 3DRQB 3NEOA 1C7SA 2OXHB 1YUHB 2VLRB 1X4ZA 2CUAA 4P9HH 1QASA 5DMJB 4GMTL 1FRGH 4DK3A 1MY5A 2RFXB 5D1XB 5F7AA 1MFEH 4LSPH 2DMBA 4QHNB 1N12A 2PYEB 2VN4A 1MWAA 5HVHB 1JN6B 4PR5B 5HYJA 3LPWA 4NM8L 2ZYSA 1A7RL 3BVNB 2Z8VC 3IS1X 3V8CA 1ZLVK 1L9TA 1XR9B 2ORBH 3LNDA 4M9PA 3D0AA 2CBQA 4Y9EA 3STBA 1MHHA 5CJXC 2PWDA 2YAFA 1SM3H 4J39A 2CK0L 1JPST 3TBWB 3U46B 3WN5B 1FNEB 4JM4H 1DP0A 5C08B 2X3CA 4YHNA 4JFXB 3KWUA 1FG2B 2XBTA 4UIMB 2ZXEB 4YL4A 3K8KA 5CCGE 3RWIA 4M6ML 4TVUA 3J8F7 2VAAB 2YPLE 3ZT7A 1ZE3H 3FU0A 2KKQA 3AAZA 4ICWA 4EF3A 3TJHD 2R69H 1IC1A 1XT5A 4MMXB 4F20A 2BDNL 3E1ZA 4X6BB 2VN7A 5H94B 3T2QA 4OVUA 3T77A 3VQ2C 3ZMRA 3DX9B 3BQUC 5CZVL 1J05B 1PD0A 2NR6D 2ADJB 4PP1C 2YOAA 5BV7C 3FCSA 5IUSA 3KPQB 5MEPB 4M5TA 3S35X 4XNXH 1QO3B 1MFAL 5IW6B 1EEUA 3O81A 3MBEB 2ENQA 4KV5E 5HYIA 1KEGL 3L9RA 3OB0H 4X2UA 4F37F 1TZGL 3K74B 3STLB 4MGXA 3L5WB 4PLKD 5E6SB 5DYFA 5I76B 3DA0A 3FRPA 5HYJD 3MV11 3TNNB 5AYTA 4QTHB 5K93A 3O3DB 3C2AL 3W9DA 2HLAB 3L4UA 1HNGA 3TFKC 2L7UA 2KL6A 3C08L 4NUPA 5I1EH 4AQAB 3AT9A 2WO2B 4KNTA 1H3PH 1G9MC 1HU8A 3MV7E 2OYMA 4Y2DA 5FK9B 4XPAH 4OF0A 3BAEH 3EUDA 1LP9F 5ERWA 4WIQA 1OP5H 1O0VA 1UD6A 5FYKE 5A6LA 3GZPA 1RIVH 2CCLA 2E0PA 3QAQA 4XPFH 3QRFM 2ARJA 4DWHA 5ADOL 2VDRL 3KAAA 2ZWZA 4JM2D 43C9A 4YDJA 3BSZH 5DDHA 5K9QG 4KZDL 3GF8A 4UM8B 3G6DH 1IC0A 1PCSA 3DPBA 2QZ5A 1XH3A 2AAVA 3FH8A 5TPWH 3WY1A 2HVKA 1PYWB 3BEVA 3GSUB 4X9IA 5DMYA 2EJ1A 2PTTA 5KVDH 1WWCA 5T3XL 3B9KA 3EIFA 3F8UB 3B2PA 1PJ9A 1KB3A 3ISWA 2VM3A 3LDBB 3APCA 4IU3A 4EJ1C 4KZEL 4FS0A 4G8GB 2ZXGA 4JFDE 2FEJA 2DMKA 2ARWA 2VQTA 4O00A 4WHTA 2OZ4A 2YD3A 4TLKA 1UOLA 4X6DB 1AQDA 4Y2DD 2OZNA 3H2PA 5IVXE 4IIQC 1DDHA 4Y9FA 2KPWA 3C5ZA 3A47A 3QQNA 1L9SA 3WAKA 2MCPH 3ZTEA 4M5ZH 3AGWA 4FF9A 1MELA 1JXJA 3HFFA 2YQBA 5JHMA 1ZWIB 1JIBA 5I1AA 1E5BA 1HL5A 2QHRL 4RFOL 3HMWL 4NBXB 1ACXA 4H88H 1KPRA 2D7QA 3VDBA 2W0LA 3L1GA 5D5MA 3CDGA 2X28A 1RK1B 5EZOL 1K5NB 2VDPB 3QS2A 4YH6A 4M7ZC 4LCYB 5KYWA 3DSFL 3UG5A 5J06A 1L4IA 5JPMA 4G5ZL 4PJEB 1JGLH 1HHHB 3DV6B 1CBVL 3N40F 4JHVA 3B9KD 3NGBB 5EU7C 3NJJA 5AZUA 1TTBA 4NRZB 4XP5L 2YXMA 5BS0A 4UZGA 4LDLB 2VIRB 3CFCL 4H20L 1Q9WA 1XF4A 4HBCH 2FJHA 1KB9K 4JY5L 3VXSB 3SQRA 4AITA 5HYSA 5EZIH 1DJWA 2WLYA 1U21A 2MQ0A 4XHQA 5E2UH 2OR7A 3TBCA 1CYXA 2J8UF 1RZ8A 3VFWB 3WEOA 3L3HA 2V5MA 3C5ZD 4R97B 2H1PH 3U0WL 2AJZA 2OA9A 4JY4B 4ENZA 5AAWC 4PG2A 2BM3A 4GAYB 1SYSB 1JD7A 2C7FA 3O3EB 5DZLA 3RTQD 4W9HC 3F85A 5IFAH 2V3FA 5HVWA 2I9LB 3EHBC 3K6DA 1YVLA 1QMUA 5DHVB 3I6KB 3UL4A 5BRZB 3THMH 2XA8H 1YMMB 4UDTB 4TUUA 3VFOA 2R9HC 3E9UA 3GSWA 2OP4L 3OAZK 3RHWK 1RCYA 5K1NA 1ETZB 1XF3A 3C60C 1NAMA 1S7SA 4KPHL 2BCMA 2E7MA 3M86A 1ZK5A 5BS0D 4PG9A 1SBBA 1BHGA 1KEMH 3VI4E 3F58L 3MJ8A 2AQ1A 2DLTA 5GGTA 3VFSA 1KLGA 1PU0A 1T7VA 1ZOXA 2DWYA 2J20A 3VI3E 2HVBA 4ZTOL 1ETA1 3VGAC 1CJYA 4X6FB 4DQAA 5JQ6H 3IFLL 1RZJH 1P1ZB 2H9GB 4V1DB 4MCYB 4W9JC 2CMRH 2XKNB 3HBGA 4JREB 1TPXB 1A64A 2WTRB 4GQ9L 3UCRA 1E6JH 2X3BA 4ZFZB 3VFMA 3QHFH 3PHQA 4F1SA 3L3OC 3LHAA 3TJEH 4Q9CA 4ZFOA 3DPDA 2YIHA 2YR3A 5EO1B 3LQAH 3GUTB 4W9ZA 1JL8A 1XCQB 1R3IL 2ZICA 3V5HB 3FU9A 3V9FA 3TPUA 2X70B 2KQMA 4PJXE 4AEIH 4ISVA 1SLWA 1XZ0A 4XN2A 2GSIA 3PWJB 2G2PA 4TS6A 3GI8L 2HJLB 3D07A 3GQFA 4Z7IA 4EIZC 1UUSA 1UWXK 4YVNA 1E27A 3QB7C 3C8KB 1WT5C 1SMOA 2VRAA 1NL0L 1N59B 1T22B 1F58H 3IPBA 3GD1C 3LKPB 2OMXB 3FQ4A 4OIBA 5IF0B 4B9YA 4XO5A 1XGQA 2YRBA 4LPTA 4UNUA 2ZSWB 2OQJA 4MB3A 2R56H 4LCVA 5E5LA 3OHXB 4HPOH 5I1HL 3S35L 1H19A 1Z5LB 3IJ8A 3TU6A 2BNRA 3ESOA 1UWFA 5GGSB 1VAHA 1CFMA 3Q6GH 1KJVB 4IGBA 3CLEL 3D34A 1LO4L 3FTVA 5IESL 1WUZA 4KKQA 3O4OB 5IB3A 1KC5L 1D5MB 2CLZA 1ZTMA 1BWWA 3F84A 3UTQA 3TT3L 3DIFB 2G3NA 1BAGA 3N0AA 1IC5L 2BVPB 4JUTA 1UEYA 4OLYL 3O6LL 5ITFA 1CGSH 1JBJA 4WEBH 2FECI 3EFFA 4FE9A 3L81A 4JCWA 1MJJB 4KXAA 2DWSA 5HD8D 5SX4H 4Q97A 1FDLL 2X9ZA 1Z9NA 4R9HA 3CDCA 5A43C 5KVGE 4KK8D 4KXDA 5FGBC 4WZ9A 4FDWA 5FM5M 1LMKA 3CLFL 1FC2D 3IGAB 4HK3J 4CAGA 1W8OA 1BBJB 3SBPA 1NBYB 3G6AB 5D6DA 5KYXA 1CL7I 1XTLA 2NY6C 3VTAA 4BUHA 2FECL 2Y6SD 2OCCB 3U9UA 4MXWH 2XN9A 1EJ8A 3SDAC 1ESOA 1KN2H 3UAJC 3VXPB 4JRXD 3RL1B 1FNAA 4FQJH 3V9EA 3AMKA 1I4FA 3TIDB 4LLQB 3T8XA 4ALAH 1OTSD 3DBXA 1BVKB 1ZJBA 2X38A 3L45A 1X7QA 1KGCE 2LE9A 1CL7L 3QRGL 4ZD3L 5EIIB 2VDMB 4P5KB 2KYIA 1TOXA 2BS8A 2HJKA 2CDFA 2NLJA 4J4PC 2EH7H 1TETL 2Y06H 4HD5A 3WFHB 4WTWA 4ZNCD 1PEWA 3FHAA 3IN2A 4JFFE 1CFTA 1MPAL 1YEGL 1HCFX 4TF4A 1ZVSA 4I48A 4LIQL 4N9GA 1AHWC 1ZT4A 3UGXA 4ZS6D 3D25B 1S4IA 4B9PA 3ULVH 5K5YA 2Y23A 4H44C 3CHQA 4F15B 3P73B 1LE9A 3I02A 4OT1L 1VHPA 5F8QC 4KAQH 4N8UA 5KUMA 3SGDI 3WSQL 4L0PB 3IXTB 5B39B 5IP4A 1MJUL 1RU9H 1TXKA 1HWHB 4QGYA 4LKXB 3FU5A 2A83B 32C2B 2ROXA 1I8LA 1YHPA 4OZGA 2OZ4H 3L1OL 2AQRA 4IRJA 3UYPA 1U91A 4U1IA 4YVUA 5CCKH 1OEZW 3VH8A 4F58L 1IGTB 2JKSA 4GAFB 4U1MA 5FA3A 1W0VB 4L8CA 2CHDA 4ZW3A 4V1DD 4KKNA 1EH9A 3N50A 5D70L 3MA7B 2V5YA 1IGJB 4Z7VF 2W0PA 4MJJA 1IAOB 5I75C 1S9WB 1OAJA 1U4EA 4GBXB 3V4PA 4FG0A 3C6SA 1WP6A 5IZ7A 3ZL2A 4ZFGH 3ARUA 4RZKA 3EH4B 1IRAY 2AS5M 4NKDA 4U6XA 4AI7A 4B0MB 4NNYA 2J1WA 4HJTA 5HHQB 1M3JA 2ENYA 2ZYHA 3BDYL 1H6UA 2BNQE 2JJWA 4NLAA 4FFVC 2XUWA 3WS6C 1DBMH 5KYYB 2EINB 2Y7LA 4N28A 3I6SA 4YNYB 3RVXC 4HUKB 3O3UN 4OD2B 1BMZA 1HXMA