2K45A

C2a domain of synaptototagmin i solution structure in the fgf-1-c2a binary complex: key component in the fibroblast growthfactor non-classical pathway
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
128
structure length
128
Chain Sequence
EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Synaptotagmin-1
publication title FGF-1-C2A binary complex structure: key component in the acidic fibroblast growth factor release
rcsb
source organism Homo sapiens
total genus 21
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2k45A00
4QAMB 4GB9A 1QASA 2WXFA 4FA6A 3F00A 3P2BA 3S2AA 4QJ4B 1E8YA 3KWUA 4A55A 1E8ZA 4ANVA 3OAWA 1E8XA 3L17A 2NSQA 4V11A 3W57A 1YRKA 5G2NA 3F01A 2RD0A 3NSJA 2NQ3A 2V4LA 2Y3AA 5CCGE 1DQVA 3L08A 5H4YA 3F04A 4F93B 4URKA 3L16A 2ENPA 4QJ5B 1K5WA 4KZ0A 2R83A 3NZUA 3QK0A 1GMIA 4NP9A 3L13A 3RDJA 4DK5A 2QZQA 1DJHA 4J6IA 2Z0UA 2CHXA 3DPDA 4IQHA 2K45A 3PREA 4MJJA 3TL5A 3ZW3A 3OHMB 2CHWA 4FADA 2CHZA 1DJWA 3PFQA 4LDCA 5JHBA 2Q3XA 3FBKA 1E8WA 3MJWA 2WXIA 2WXHA 4WWPA 2NCEA 3IM1A 3M7FB 2A5UA 3QR0A 4XE0A 5H4ZA 1W15A 2DMHA 4ICXA 2K3HA 3HN8A 2CM6A 1E7UA 1RSYA 3RPBA 2K8MA 3T8MA 2A4ZA 4KZCA 1RH8A 3ZVVA 4IHBA 2JQZA 1E7VA 3KWTA 2WXPA 4KITB 4L1BA 2YRBA 4XZ4A 4EZJA 1TJXA 4L23A 4FULA 2CJTA 2BWQA 2EP6A 4FJYA 4NPJA 4F1SA 3GPEA 3L54A 1RLWA 4LT7A 3R7QA 1DJZA 3APFA 1BYNA 1DJYA 4GNKB 1DJGA 1QATA 3NZSA 3ENEA 3CSFA 1DJXA 2KI6A 2WXNA 2CJSA 1TJMA 3QARA 2D8KA 4WWOA 4F91B 1WFJA 1UOWA 4AJWA 3HHMA 1HE8A 1BCIA 2QZ5A 2YOAA 3DBSA 2ZKMX 4L1LA 5KJ7E 3FDWA 3N5AA 4TS6A 1V27A 2FJUB 4ANWA 3ML8A 2DMGA 5JHAA 3TWYA 3PS6A 3L4CA 1W16A 4TV3A 5EDSA 2WXLA 3APCA 4BGDA 5CCHE 2CM5A 4OVVA 3R7RA 2FK9A 4FHKA 4L2YA 3TJPA 2CHDA 4LCVA 4EZKA 3QR1A 4OVUA 4JPSA 2WXJA 4NS0A 2B3RA 3QAQA 4TUUA 4PS7A 2WXMA 3ML9A 1A25A 2WXRA 2X38A 3F05A 4Y1TA 4PS3A 3ZIMA 3LJ3A 4ANUA 4HVBA 4HLEA 4WEEA 4ANXA 1DJIA 1WFMA 2Q0ZX 1UOVA 4FLHA 3CSTA 2ENQA 4G11A 3B7YA 1BDYA 5CCJA 4NPKA 2N1TE 2LHAA 2WXOA 1E90A 2ISDA 2UZPA 3HIZA 2WXKA 3IBEA 2WXQA 4Y1SA 1UGKA 3JZYA 3SD5A 3W56A 4F92B 4BFRA 4WAFA 4ICWA 4QJ3B 3PYCA 4PS8A 4AOFA 2ENJA 3PRZA 1DSYA 2WXGA 4WWNA 1CJYA 4DNLA 3QJZA 3L9BA 4FJZA 2K4AA 3APDA 4FHJA 4XX5A 5G55A 5T8IA 4EZLA
chains in the Genus database with same CATH superfamily
1U8OB 3WLWD 4AIXA 4S1QL 4BBWA 5K39B 2H3NA 2AQNA 4M93B 5JOPE 4V11A 1D6VL 3AACA 3OLIA 4QY8B 4XVUD 4Z77B 5DMIL 4ZFZB 3GB7A 4WJG3 1Z0MA 4BUGA 4X6BA 3QZLA 1JI1A 2A4EA 4OFQA 1AS7A 5CLTA 4GO6B 5E1GA 1I7TA 5JQ6L 3GSXA 3WD5H 4A2EA 4NUPA 3P77A 2DB8A 5F71A 1ZD6A 2XFXA 3F6JA 1UD2A 5H94B 4PJHF 3RL1B 3TL5A 4LQFH 3U0PB 3W0WA 1Y1UA 1KPRA 1LNUA 2ZXDA 5JXAH 1RVFL 4JHBA 1URZA 4IRSA 3OZ9H 3H9ZA 2WCSA 2WNWA 2FVNA 1TZOA 3DV4B 3POCA 3QP3A 2AVGA 3AXLB 5FUZH 2BCMA 1WE5A 1IGIH 4WHCA 1E2ZA 5EFIB 3FTWA 1ZLWH 2HX8A 2CDFA 5IEHA 2VJXA 5GS0C 5D5MF 5DEZA 3SE4C 1PG7W 1FL3A 3Q7JA 1CLZL 4POYA 4QRSA 5IJCC 4E9LA 3L3KB 4IM8A 2AVFA 4MNQA 2P44B 5DS1A 5L7XL 4PBWD 1C16B 5CM1A 3O2DA 1DQJB 3QXWA 4GW4A 4PRHE 5MEOB 3O4OB 5F1IB 3QXAA 3ZX1A 4D0BA 4YHYC 3WFCH 3KPLA 4WO4D 5HVHC 3KL5A 1QA9A 4H2AA 1KF9B 3MXVL 5MENE 1UH3A 5A40E 3FB7A 5KSAB 5CUSH 5IFAH 2CMRH 1OP9A 4YK4C 1J0KA 1CE1H 3ALPA 4WY7H 3MOBH 4JG0H 4XO8A 3CFIC 4ALAC 3IJYB 1KJ3H 2DTML 3TPUB 1VGKB 4NNPH 3NJGA 3STLB 1BD2E 1AGFA 4NXKA 3OX8A 1RPKA 2WXJA 1QEWA 3QI9D 3LPPA 4DZ8A 4HEPA 3QGVA 2O6EA 4XPGL 5AVTB 3FQRA 3SDDB 4XOAA 1RIUL 2W60B 2P49B 1P1VA 5ESAA 5I66A 4G3YL 4RAVA 2EDOA 5EBLB 1JGUL 3B2VL 5F3HB 2AQSA 3B3BA 5F93C 1A4JA 3IU3B 1HILA 4HC1A 4IS6A 2Z8SA 4MA3B 4W9DC 1HKLL 2UYLB 4GRWB 1NGXA 2BSEA 3NCBB 2Q76A 3KLAB 3WELA 4KKAC 2JXMA 3UH8A 1HIML 2KDGA 1CFNB 3B7TA 1CGSH 2I60H 3WTTA 3N40P 3MLPA 1BQLH 4DGWC 1CT8B 3BVXA 3RWHB 1JPGB 3CPLB 3FYEB 3ZGIA 2BW5A 1SHWA 4A7GA 2E9GA 4JHAH 4QAMB 1FPTL 4G7QB 4BFJA 3S2AA 3ET9F 1H8NA 4U3CA 4LNRB 4BQ9A 4CVZA 3O3DA 2YPVH 1S9XA 3N42F 2AAVA 3AXHA 4KROD 4U1KA 3F85A 4G83A 2BP5M 2EIJB 4D0CA 2V5SA 3TWCH 2UXFA 1DQVA 4P5TA 5IF0A 3MTRA 2IOMA 3I50L 4NM4H 4PWGA 2PCPA 1M7UA 3WD5L 2VN4A 1ZWIA 4PUBH 3M8OH 4D9LL 4Z7WF 1CQYA 1QUNB 3EJYC 2HJKB 5AWNL 1ZTXE 5E4IA 2I9LA 1WWBX 1AR2A 3D85D 2AAAA 3FRUB 2DM7A 4X4ME 3W3BA 3NIDB 1HE7A 4OI9A 5C0ND 4Y5XA 2VDOH 2WUBL 2EXYC 1KYAA 4GT7A 1IGIL 4CW1B 1LO0H 3FC8A 4IKLA 4DP4X 3OKLB 5E2WL 2DKMA 3ULUF 3PQYD 3ZTJH 5I1EH 1G6RA 1BP3B 5SWZA 3INOA 5D72L 3WY1A 4GQPH 3B37A 4K9EH 4Y8AA 1AHKA 1WAAA 4D3CH 1JK8B 2W81C 3WFCL 3HBGA 5C9JA 4NXSA 5TJWK 3HS0A 2IALA 1D5IH 2O30A 1YY9C 1CURA 4N0FB 2WIMA 3UG3A 2WTPA 3FT4A 3MOBL 4JG0L 1ETZA 1NCCL 4HH8A 1KJ3L 4NNPL 5JIDA 5CILL 2EZ0D 4N85A 3H9YA 1LMKA 1IVLA 1CXIA 2Y7QA 3QEQE 1IM3B 2HJFB 4LLYB 3CH8A 1IGCH 2V9QA 4OZGF 3O6ML 2BDNL 5B22A 2E74C 5I6XC 1X5FA 3CZEA 1T0NA 3ULSB 3TJEH 3VFVA 5D4QA 3KS0H 3IPBA 1L6PA 2FEDC 1KBGH 2DKSA 4BH8A 3L6FB 3U48A 2H6PB 3B2UD 1YC7A 2N0MA 4Z8FH 3LX9A 4DP5X 1KNOB 5JIMA 5BV7B 4URTB 5LBSA 1GOFA 1MHHA 2RH0A 4Y1SA 4ZW6A 1JHKH 3CLFL 2V2WB 1WZ1L 3ULVE 4RAUB 1K4CB 4WWNA 3BJ91 2XHNA 1CGSL 1JXGA 1DYZA 2J7LA 5DWPA 1BQLL 1BVKA 2ZX6A 4MNGA 5FV1L 1A02N 1HZHH 1T21A 4N68A 4R84A 5T8IA 4XO5A 3H9SE 4JHAL 1R24B 3BH9A 3Q8EA 3L1GA 4H0GA 4KX7A 2YPVL 3ZZSA 2AXGA 5HGBA 4XPAH 1VFUA 3GO1H 3V6OE 3TWCL 3MUUA 3EJJX 1Q72H 2FYYA 5A7EA 5D4IA 5GZOC 1NPNA 1OOAA 3WGVB 4NM4L 1M2VA 4PIRF 4NQDE 1N70A 4GG6B 3K71B 2BZ7A 3M8OL 4MNQD 3R8QA 2QJDA 2DDQH 3X1FA 2DL2A 3P3UA 4X7TA 1TIUA 4YBQC 3CDGA 3FUMA 3IETB 2NZIA 2ZSVA 2GVYA 3GDBA 5H4ZA 1JWMB 4F2ME 2FWOA 2DQFA 2I9TB 3S36H 3IJEB 3PGCA 3QIWC 5GRZA 3B43A 4WIQA 2MCPL 1AH1A 1NFAA 4MJIE 4F7EB 1HH9B 1GIGH 4WEMB 5I1EL 3FOLB 4RGMB 4WUKH 4TOYL 1SXZA 1A6VH 1T2XA 2O61B 3Q6FB 5CGYC 4E68A 1I1AD 1HS6A 3C6LD 4W9HC 4LO9A 2VITA 4CMHC 1F4YL 3TBWA 2BVTA 4YHNA 1TKWB 4D3CL 1UD8A 3NGBC 1HEHC 3UTTB 2BFGA 3BPOB 1KMGA 2J20A 1SN0A 1NAKH 1U6AH 5FO8B 4QF1A 3WIAA 1KB5H 1D5IL 4JQXC 1FWXA 3RUGA 1A1NA 2IMMA 4X4KA 3U46A 1AIFB 3B83A 3NABL 4MMXB 3K2KA 5EUOF 3HS9A 3T0EE 2DWTA 1W16A 3FMGL 2ZT9C 3AGVA 1IKFH 2WO2B 5FUOL 2V5YA 4AQAA 4WFHE 1I8IB 5D7LB 1WICA 2BSED 2GCYB 4JO5A 4PQXA 3HPJB 4JAMB 4P5RA 4W4NA 2D3NA 1F1DA 4HCRA 3TJEL 3AITA 3BXNB 1HWWA 1XMEB 1FP5A 3WHXB 3DYOA 2NY3D 3U30C 2CK2A 3FS9A 1MJ8H 4OJDH 1UOVA 2DWEB 2ENQA 3GZKA 4Z8FL 3QJUB 1JVKA 4I18B 1BM7A 2YA0A 3EOTL 3QEGL 1CL7I 4Z7IA 1HJCA 2HFEB 4XCYB 2DWDA 1FVDB 1A6AB 5HHNA 1JHTB 1HZHL 2W9LA 2PYED 4KNTA 3V10A 4GAYB 2OZ4H 4K5OA 3M1OA 2GAZA 4WHDA 3S4SA 3MUHL 3GGWA 3EFFA 1T5XB 1BQSA 1A2YB 2ARWA 2GHWB 4JK0D 2DQEH 1YRKA 3GO1L 4KNSA 4NRYA 3VI4F 2RD0A 3UTSA 4MZRA 3T8XA 2F74A 1MI5A 2KDYA 3MPCA 3CUPB 2LOEA 1LK3H 1JNNL 5HD8D 3ISWA 2WWMD 1BQKA 4NO0A 4Y16A 3T4AC 5HYEA 1TNMA 2F1BA 1SDDB 2FHFA 1UJ3A 1XO8A 4KJQC 2DDQL 4UB0H 3N40F 2K45A 2YD1A 1G5GA 4WO4B 3U0TB 4XNZC 5LN8A 1I1FB 3MJWA 3TBBA 4QRQA 2WBXA 2NYYD 3FFOA 5EO0A 3TTSA 3PIQB 4PSPA 4XVJL 5GS2H 2DJUA 2R69H 2XWXA 1J7VR 2VXUH 3FZUD 4MKTA 2P1YA 2Q7NA 2VN6A 4E9RA 3L9RB 2P45B 2PNDA 3D30A 1G7HB 3RDTA 3QFDA 3IDXL 5E6SB 1KGCD 3QI9B 4AYSA 2BWQA 3M7OA 1F4XH 5DUBA 1QLRA 4LASH 5GS1B 2OTWA 2P8MB 2EDRA 2ATKA 4N5UA 5CEZE 3SJVB 2ZOKB 4W4OC 3WOVA 1OARH 4DUWA 1NAKL 3OWEA 4LEEA 5IVXF 1KB5L 3WS3A 4K8RC 5I1KL 3KWVA 4N2HA 4CGTA 4B95C 2P7TA 4PWJA 4MDIB 5C0FB 3ML8A 1XH2A 2R0KL 2GHZA 4LSPH 3W2DH 1R4XA 1E9PA 4HS6A 2R23B 1IKFL 4GRWE 1U8LB 5G4OA 3OJ2C 2YUXA 3WNJA 1P4UA 3O8XA 3HE7B 3UTQB 3Q43A 1JTPA 4Y0GA 1MRDL 3ABZA 1VZGA 2B59B 5DK2B 4ZG1A 1HVXA 2EXTA 1T2JA 4KO9A 2XG4B 2SEBA 4XT1C 1R5WA 3RVUD 2EE6A 3LAFA 3QUXA 3SCMC 4JRYA 3V6OC 1MH5A 1S9YA 3B5GA 1ZANL 2CJ3A 2IAMA 4B53A 3BEWA 5IZ7A 2WQ8A 1PFOA 4OFPA 1X5XA 4CU7A 4OCLC 1AHWC 1N2RA 1MUJB 5T5FA 2I07A 1XDTT 4BXVA 5C0DA 1LMIA 2W0KA 4EI5A 1SVBA 4FHJA 4ABWA 3E8VA 5BCAA 3X12B 5F7LB 1G9MC 4GB9A 4G6AD 3EJZD 3OBAA 1BOGA 4F9PC 2OX5B 4HXAL 3KPOB 3RTQA 3I6SA 2YMXH 1XT5A 5IFJA 4F33B 3T0BA 2X3CA 3I6KA 3HE6C 2DBJA 1OAXH 4P2AA 1A3LH 1HSBB 3PQYB 4CKQA 5HHOD 3LHAA 1MCJA 4PJHB 1E5UI 2VDKL 2EUVA 5DS8A 5CEXA 5E99H 2PTTA 2EYRB 2WB7A 5MI0C 2VDQB 1EFXA 2QV2A 3L13A 4JZOB 3IFLH 4Y4HD 1I7UA 1KWKA 3B3IA 1IC7L 3STBA 4OQTH 2HX7A 3FB6A 3H2QA 5H8DA 2VR4A 2Z6FA 3V7AG 1A8JH 1BBJB 2JJSC 1UB6B 1ZLUH 3CFKA 3IJ9A 1XGQB 2ZZUT 2R69L 4HJJL 1E7UA 4H1LH 3T0EC 1IIIA 1FFPB 4J8RA 2VXUL 3RL2B 1BIIA 1O6SB 1P84J 2FJFB 3GMPA 4YQXL 1PJ9A 3SPVB 4J4PC 2R2HB 3HKZA 5IMMB 2ETWA 3MRIA 3MNMA 4I7ZC 2E7LA 1SXAA 3ZZ1A 2AV7B 3KDPB 5I5IA 3LB6C 3GC3A 3UP1A 2V2TB 1OF2A 1TSHA 2DIEA 4LDLB 4AITA 1PZBA 3HI1B 3BC9A 3QS3A 3DROA 4ZX6A 4LL4A 2NLJB 3MBEA 4I3SH 1KXVA 3G5ZB 1DJXA 3KWWB 1OARL 2WVTA 4R96B 4RMTA 3TFKD 3TNMB 2XWZA 3GMLB 3WYRA 1A22B 1ZJBA 1TQVA 5EZPA 5C08B 5CN3A 4P48A 5IWLC 3MA9L 2DQUL 4IMLA 5BRQA 2QSVA 4LSPL 3W2DL 3QO0A 3LKRA 5EOCH 2BCKB 4J27A 8FABA 3APCA 1Q0YH 4L4TA 1JTOA 4WCYH 3QUZC 4IBTA 4F2FA 2J1WA 3RNKA 5I24A 4HUWA 2YAPA 4HEMA 4DOHB 1CLYH 1LE5A 4NN6B 2CO3A 1DDHA 2VDLL 3IFOB 4RSVA 3RGBA 5EOTB 4NRZB 4ZUSA 1T7VA 2X38A 2YWZA 3IPFA 2V33A 3OMNB 4FQXA 1UC6A 5D4HA 7PCYA 1TU2B 3UDWA 4JRFA 3NZHH 1FYTD 2VDRL 2YFOA 3JTSA 1KTCA 2V6HA 4G9DA 1MW1A 1D5XB 4Q8BA 4L8CA 3ZKND 3ZQXA 3DK0A 2VAAA 4LESA 1EXUA 2VSDA 3UTSD 4XX1E 3C5JB 1HC1A 2AJZB 5E94A 3D4ZA 3I6GB 5KBDA 1PLGL 5CBAB 1E4KA 1I8MB 2J2ZA 3NP3A 4NO0D 2EILB 4GG6E 3N42B 5F8QC 2B4CC 2ITFA 3GKZA 1J0HA 5DU7A 1UXWB 3FUEA 3OG6B 1UM4L 5I5JA 1HOCB 2KQMA 2YMXL 3MBXH 4QKXB 1ZT1B 3QUML 3QIBD 5KSAC 1JPST 1CLOL 4AGQA 2OR9L 4KXBA 1NC4A 1A3LL 1RHHB 4P5SA 3K2MC 2ITCA 4HG4K 5GGTH 3RWEA 2W91A 3X3GH 4XVOA 2VL5B 3MLTA 5E6YA 4DPCX 4TLKA 3NBNA 4I0PA 3VI3A 6PAZA 3MRNB 3IFLL 1G9NH 3KW7A 3MNZA 3P4LA 4LBEB 1H3XA 4BM7A 4NKMA 3VRJA 3EJQA 5H37A 4JFDB 1KCKA 3UTTE 2FYVA 4GBXA 4AUJA 2EVGA 3NRPA 2XZCH 2DMHA 3UADA 1TZIA 2W88A 1N3NA 2O6PA 2FEEI 4H25B 3WSQH 2EVHA 2XZQL 1HNGA 3V0HA 2ZNWA 1KLFA 3CDYA 3SKUD 2C7UB 4PJ9A 4F7KA 3FUKA 3N06B 4G9FA 2FNWA 3IFNL 3TZVD 2DMKA 5D7LE 3CMGA 1E27B 4RH4A 2WZPA 4I3SL 1KJMB 1HWHB 3CSFA 1GJWA 1EDYA 5F9AC 4HZLB 5FUCE 5DQDL 4S1RH 4JVPA 4NUJA 5KVDE 4NBYB 1QR1A 5ESQA 4FG0A 4JRYD 4OZGB 2XKNA 2YBGA 1KUMA 3NH7L 4NJ9L 1Z9SB 5EOCL 2IAMD 3HG2A 3HZ3A 4PCKA 2FDBP 1ET7A 2DY2A 4H26A 3H53A 2PWEA 4I4WB 2VSKB 3GLAA 4Q58C 1J1XH 3MO1A 4WK0B 3DSNB 1SEBA 4EI5D 2CR6A 3C5SB 1QPXA 3ARXA 4B9GA 4UT9A 3NZHL 2DI8A 4ZSOA 1NMCB 2HTLD 1WFMA 3SPJA 4HIQA 3WN6A 2VN7A 1Q38A 3MODL 5CLZA 3NCXA 3IBEA 4JFYA 3SYPA 1UGKA 1KYOJ 1OSZA 3EYQD 3OKDB 1JZDC 1D2OA 1X5AA 3OXSA 2YD0A 2Y24A 3ZDYB 3KPRD 3C08H 3VH8A 4XH2A 1KELH 4Q56A 4O51B 4NERA 3QAZB 2VXQL 1HL4A 3HLAA 2ZUWA 3VG9C 3MBXL 4GS7B 4BE6A 3IJHA 3LH9A 1VRSA 4ZO9A 1YEHH 1FG2B 5L6YL 4MSWA 3CFBA 4EDXB 4BFIB 3GJFB 3OJDB 4XRCB 5HTSA 3TXAA 5IMKB 2VN5A 4A7VA 3N1GC 3X3GL 1UWEH 1VDGA 5I8KH 5L2KB 1GC1C 1WFTA 3H56A 3OR6A 1MPAH 3REVA 1G9NL 2WLKA 4MD4B 5AG9A 3C8HA 1CDUA 1F8TL 2CLRA 1X6LA 5GZNA 3SJVE 2OMWA 1WGVA 1C8QA 4NFDA 1YJDL 3DX3A 2NXYB 5DWUL 4GUPA 3L95A 2YN3A 4K3JH 4U6HA 1XXFC 4ZFOA 4HDIA 5E00B 4X4XB 3HN8A 4XCEB 1I3GL 5IT2H 5BZWA 5BV7C 5HI5C 3TEUA 1TEFA 5I16B 4KDTC 3OV6A 2BNQB 3BMWA 5ANMB 1U3YA 4GKZA 2YXMA 4FFWD 1XL6A 3TU6A 5A6MA 3B2XA 3TCTA 4XB8A 3WFBH 4Y9BA 5E0QA 4PGCB 5DFTA 4XXCC 3M17A 1CXLA 2WVVB 4R7VA 3D52A 4FE9A 4E0RA 2WXNA 3G5VB 4NQVA 2QR0B 5DQJA 5EUOB 1KEGH 1SMDA 1OCWH 3R4DA 5CNHA 1KSRA 1L4IA 4JE4B 2LV4A 2VLKD 1J87A 4S1RL 1QBBA 1R75A 4MMZC 1LGVA 1EHXA 2DMGA 4N8CL 2WKLA 2BWIA 2GQHA 3DVNB 4IHOA 1V7ML 5E6IA 1QLFA 4YDVB 5LXGH 5KZCD 2D7PA 2AKRA 5KSUB 3FTYA 2HZHA 1R47A 1EO8L 5JMOC 3EUDA 3RURA 3ARRA 1USQA 1IAMA 1UXMA 5EU3B 2L8AA 2A77H 1LDPH 2FWUA 2XWDA 1N4XH 4DPRA 2Z7WA 4WW2A 5HJDA 4TMPA 3B8SA 4LPTA 1WT5A 2MPAL 1GKOA 1EWHA 1IAKB 1VFAB 4HC1H 1MCBA 3GTVA 3HNSL 3UAFA 4YDZA 4GRMA 4NX0A 4U6XB 2EUXA 4PJHE 4JY4A 2FHCA 1QX1A 2WV3A 2PP7A 3ARQA 1KELL 3NZ8B 2AJ3A 1ONQB 5ICYA 2VDMB 2UY7B 4RMUA 2FAUA 4OLYL 3VI4B 5FECB 3IGAB 2F1AA 2XY2A 5FFLA 5D5ME 3MOAH 4QRBA 4GBXD 4PGEA 1NEUA 4MMXC 1A6WH 2Z1PA 5FK9B 1KYFA 2F5BL 3KL0A 1A7RH 4HCGA 1JPFA 1UWEL 3V0AC 1T1YA 4XAWH 5ACZB 3HG1A 3TT1H 3HTLX 5E1AA 3WLWC 4G9FD 4ZI8A 4LHUA 4PRPD 4NQTA 3O4LB 4U6VL 1Q94B 1OTUD 1RUPH 4DEWA 3DXAA 5FUCC 2DICA 4S2SA 2WQWA 2NY4B 3TO4B 1W2KT 4P46B 4MX7A 4GKSA 4PP1D 3B8YA 4XVUC 2PUQT 1YEEH 4I3GA 4KDVA 4I18C 2AS5M 1S9WA 5G5DB 5GRVL 5C08E 4BINA 4GI9A 4WHTA 2ZWLT 4QXWA 1V05A 1G6RH 3UGXA 4HSAC 3VU1A 1BJ1H 1WZKA 4ELMF 4HK0A 3DA0A 4LSRL 2QQLL 4MXWL 3WFBL 2EDFA 3X14B 3ZDZB 5IVXB 1GZPA 4DOHE 4B7IA 5DCCA 1DJGA 3AFLA 2O6CA 3GRBA 1JTTA 4P49A 3WN5C 2XG5B 4KVPA 2BP0B 3SE6A 1FYTB 5AD0B 3QDMA 4W6YB 4WI8A 5AALA 3MYJB 3BDXA 3QJFA 3THMH 1F13A 2WLLA 5K5YA 1JNLH 3T77B 2GABA 4HWBL 5T3XL 5E9DA 3G6JF 5FIEA 4C58B 4TLTA 1NPUA 1EUTA 1AGEA 1JZFA 4E42B 5I1JH 2I85A 3RWCB 2AK4B 2EDDA 3UBXG 2BSSB 2WQUA 3C5ZA 4XXWA 2BMKB 4F5CE 4JFFE 4KBPA 3VGBA 1A21A 4TNWK 2GUOA 4CVUA 4NC0B 6FABL 4WO4C 1TQBC 1NDMA 4LKCB 1NJ9A 3TVMB 4LB8A 1FVCB 1LDPL 3T09A 1N4XL 4E5XG 3MRJA 3CSTA 2VKXA 3HVNA 4UAHA 3RFZA 2A38A 1HZKA 1QW9A 1REIA 5LBSH 4OIIH 1IGTA 4PJAF 4CBZA 4H5SA 3WAKA 2X09A 1NANH 4LCWE 4NRXB 3L3DB 5DD3H 5HGDB 4JPWL 5A43C 4AOFA 4IGBA 4N26A 1A3ZA 3QI9C 4JL1A 1NKGA 3F7KA 2I25N 4OLXH 1UWXH 5GS1C 5TTRA 4KQ4H 4W70A 2H32A 2VIRB 1L9RA 1NUFA 1OE3A 4PJBF 1A1OB 3AABA 3NJLA 1O7SA 4Z7UA 2EH7H 4CVXA 4HHGA 1PIFA 1EGJL 5D93C 4MS8D 4JFDE 2ZG3A 5A2LH 1UB5B 1YVLA 4DP7X 1A6WL 1A4KA 4Z76B 5AFAA 5HI4D 3G6AA 5DHEA 2DIBA 4WFEE 2XA3A 1A7RL 5CIPA 2VJ0A 4JPKH 5GGSB 3TT1L 4Q6KA 4JJHA 5BRZD 3X2QB 3TBYA 2XQBH 1DVFA 3GMQB 3I84A 4OKVA 2FL5B 3KNBB 2GJ6B 1U8PB 3OHMB 1B90A 4PG9A 5GISH 3BZ4B 1AXTH 3UBFA 3VFGH 4JB9H 5D7IA 3N50A 2APBA 5EPMB 1KJVA 5FYKE 4KROC 2J88L 1GGBH 4WI5A 3LOWA 4JG5A 1YEEL 3L3IB 2XVKA 1RIVL 3MR9A 3OXRA 1AR1B 4ZFFA 3VFNA 3J27A 3KBHE 4TRPL 1CC3A 5C0BD 4DF9A 5BS0B 3BWUC 3UZEC 4WK4B 1UEYA 4OZGE 5KBLA 1PZUB 4GMTH 4H20H 2FSDA 1QI3A 2WBJB 5E70A 3VXPB 5I5RA 1J8KA 3HC3H 3DO7B 2V2XA 4AJVA 4LT7A 1B9KA 2CE6A 4UDTA 4NHUA 2WN2A 5C0NC 3R06A 3LQMA 4L5FH 4R2GD 1ZGLA 1T4KA 2H1XA 3IPEA 1T89C 3MNDA 2YD3A 1TTAA 4D94A 5AVZB 1S9KC 4HWUA 5HY9A 1S78D 1AG0A 5BQDA 4MQ7B 1NTDA 3IK2A 3G9VA 1OE2A 4GO8A 4MKMA 3UC2A 3WEMA 3VGDA 3LZFH 4HK3N 4IJ3B 2IH3B 3P30L 2H9GA 3EH3B 3Q5OA 5ACMA 3ZTJG 4P2RA 2GIYA 1MHCA 4GI8A 4UTCA 5DJYB 1B0IA 1NMAH 3KPRB 3FT9A 1NCNA 4MD0B 4XNMB 1E30A 2JKWA 1U58B 4Y88A 5GJSL 3ZDYE 4JVUA 3WUWG 5TDOA 4PU2A 1W0VB 3F2LA 4EI0A 1TCRA 4DIXA 3DX6A 5EF1A 3KDMB 5ECGA 2IANB 1XCXA 4JBSA 4JFWA 3MJ7B 2D4DA 1RSFA 2PXYB 3C60A 4OY9A 3FSAA 5MEQA 4PRDB 4OIIL 4XGZB 4XNQA 4JHZA 3WMPA 4MLSA 2EZ0C 1A7BA 4AZUA 4L9LB 2XN1A 5E4OA 1II4E 3IN2A 2WXGA 1KGCE 3DJRA 2YOCA 5EC1B 5L2KE 2VCOA 3B7UX 4OLXL 3HRZB 2P4AB 3PV6B 3PGDA 5BO1H 8PAZA 5KYUB 4KQ4L 4WFGD 1K8DA 4HF5H 5HYJD 3SDCD 4W9IC 2IPUG 2C9VA 4LHUD 3PWLB 1IAOB 2XUWA 2EH7L 3IDMA 4PI0A 1KCSH 2C4FU 2WQSA 5E08L 1WUZA 3NEXA 1HYRC 3OR7B 4IRZL 2ARJQ 1ZDSA 2K0RA 2Z93B 1ZT7A 3EAKA 4UINH 3EYVB 4L3FA 2GT9B 2BNQE 3GMOA 1AQMA 1NBVL 5ANME 4LLMB 3DX9B 5SV3A 2ENPA 3KLDA 1BIHA 4J3UA 1G5AA 1W8OA 3CBJB 4HUXA 1SGKA 2OJEA 1FLTX 2XQBL 4O2EA 4Y2DA 2VAJA 3PHQA 4GEIA 3H9HB 1JF5A 2XQYG 3ZO0A 4KK9D 1G7MA 1CG9B 3VNZA 1W0YT 1U92B 5EUOE 4X8CA 4ZODA 3EGDB 3M1BB 3QDGD 1AY1L 4WGWB 4LVNB 2M2DA 5D96B 3QDMD 4MDJA 4R97C 1JI2A 3FU9A 1H3PH 4OLEA 3MRHA 1IAIM 5IV2B 4FNQA 1SYVA 1CFVL 1BFOA 1N26A 3KPTA 4M7LT 3AB0C 3DNKA 4UQAA 4AK2A 5E9DD 1B9ZA 1JN6B 4LARL 4ZXBA 4MQSB 3Q1EA 4HKJA 1JYXA 2N0KA 1LO2H 4JM2F 3HN3A 1IBHA 4O2FA 4OW6A 1CFSB 1UWYA 3ARUA 3TF4A 1OCOB 4L5FL 5B1BB 1EJ8A 4NOBA 1DTUA 2VLME 4DCQB 3GZPA 3HBQA 4AW7A 4YHLH 1OM3H 4FZ8L 4H2CA 4B9FA 2WKOF 4D7PA 1BXUA 3LZFL 4PBXA 2NY6D 5ID0A 2IBBA 1XTMA 3U0WL 4U1HA 1A1MB 1I1AC 3C6LC 3UJTH 3VGFA 5E7FA 1A9EA 4FQHB 2ADIA 3LSOA 3TNNA 4FEMA 3HUJF 2HN7A 2QFPA 2TAAA 2ZUQB 3BH8B 1VEOA 4HZAA 2MIZA 4X5XB 1JMXA 1XGPA 3T6VA 2EEDA 1WFOA 2PPDA 2FSEA 2X4PA 3INUH 3VI4E 5JMRA 3ARDA 5FM5O 4UZSA 4YSOA 2YAMA 4ODHH 3SKNB 5C0IA 3VACA 1XF3A 3OPUA 4QOKA 1GGIH 2NY0B 3V5HA 1WFIA 1J1OH 3Q6GL 2YSTA 3AT8A 4PRPB 5TPWH 2K7QA 4PMEA 3GHBH 1X9LA 2NY3C 5LNEA 3FQTA 2E76C 3I3DA 3O4LE 3ZE1F 3F12B 3DI3B 4CVWA 4FQQB 4GKLA 1KCSL 3SGJC 4K23H 5GGUA 1B0GB 1S9VB 1WV7T 2UZXA 3IJSB 4WO0A 4Y7OC 4UINL 1DJSA 4OIFA 4WSGA 3TT3L 4YUEL 2ODHA 1RZGB 3I02B 5FYLL 3A4AA 4JVWA 3E2HC 4FTVA 3UACA 2MPVA 2AEQL 1IJNA 5H2BA 2F9BT 1WSST 2Y06H 3VFOA 1USZA 4LXFA 4HPOH 4PJDF 5IVXE 1PPIA 3ZDZE 4OZIB 2HLEB 1I8LA 2PTVA 5JQHC 1JV2B 2IQAA 3FBKA 4JRXA 2YO3A 2K8QA 2LR4A 2RALA 1MKFA 1FYTE 1NMCC 4MBOA 4N90D 4Y5XC 4LP8A 1HHJA 4J2QA 3CSYB 1AQHA 4ELKA 5KAQG 5TF1H 4N8PA 1I4FA 1OPGH 3PLYA 5LBVA 3S7GA 2LTQB 1CE6A 1VHPA 3VMOA 1AXSB 1PYWB 3ZVVA 5C9KA 1FRGH 3LRSA 5HD8C 1ACXA 5T1JA 2WWMC 1GZHC 4EZJA 1XIWA 2GSGA 3PNWB 3KCPA 1GSMA 5HHPA 2V5MA 2AK4E 3BWSA 4U1NA 3ZKXB 3QIUA 4AEHH 1FN4B 5I8EA 1J11A 3F7VB 4N8UA 4LCIL 5FLUA 1LEGB 2ADJB 2IGTA 3BRDA 5D4JA 5BJTB 4GW5A 3QAZC 2NT0A 2NYYC 2WWKO 3NSCA 5JPMB 2G5UA 4GS7C 1OD9A 3TEZA 1MJJA 1DZBA 2VW4A 1IO4C 4PREB 1JGVH 3FZUC 4LLQB 3VXOB 4JO1L 1KC5L 1U95B 4YHLL 2Y7OA 1ZXKA 4L1HA 2YR3A 3I6LE 3C60D 4IU2A 4W9EC 3OQ3B 5LB1A 5LCVL 1N9PA 1MWOA 4ZW5A 4TUOA 4JM2D 3H42L 3EH1A 3FSVA 3SZKC 3UJTL 4KI5F 4QRUB 1YYCA 4HKZA 2V7NA 1NGQL 1WBXA 2M83A 1P5UB 3QAQA 1T1ZA 3PAYA 5I1LB 3IB4A 4PLNC 4IIQB 1JUFB 3LEYH 4A38A 3QUYD 2NXYC 3MCKA 1L5GB 2EDXA 3LQAC 4JO4L 5AOMA 3IXAB 5JORB 1BF2A 2XVLA 1CXHA 1N67A 1GGIL 1A64A 2VZ1A 3SE9H 4X7EC 2FGWH 3NVQA 2ZWKA 3EG9A 5BRZB 3PE9A 2ZOUA 4Z78A 3NRFA 5TPWL 3GHBL 1XCQB 4K3GA 4KQ0A 3LCYA 4MWFA 4QTHA 5LAXB 1DE4B 1C1EH 3DX7A 2GJ6E 3V4PA 4Q9QL 3RVUC 3ZT5A 6CGTA 4L37B 1FO0A 3L4YA 3UTZB 4XXDB 1DUZA 4K23L 1JL8A 2NR6D 3RX9A 3CIQA 1M56B 4FERA 5C0BB 3N43F 5G2NA 5AB9A 1CI5A 3SKOB 2JCCA 2Q2EB 2VUKA 3AQDA 3WL9A 4OD1L 5BS0E 5IJKC 1B6DA 4NT6B 4URKA 1AQDA 3SDAA 1G7QB 4R0LA 4E9TA 3T0AA 4FXLA 1U9KA 2Z31A 4G6AC 3RAJL 4MRCA 3EJZC 2ALWA 4EKJA 5FXCH 3ARBB 4TL5A 5DLLA 2L7QA 1KY6A 5A2JH 5JNYB 4L29A 4YSAA 5TF1L 4KNQA 4ELMB 3T8MA 1OPGL 2F61A 2UVEA 1WWAX 5M94B 1QOKA 3IU4H 1FRGL 1QPPA 4YVUA 1NWPA 1PZAA 2DQIH 2GBTA 1E7VA 2MNWA 4HU2A 4UI2A 1RAMA 3QSKB 4YSCA 5TDPA 4Y4HC 1T1XA 5HPOA 4KHXH 1KOAA 2WZ0A 3KPRE 3MRGB 4FQPA 1D6EA 2E4TA 4PRBB 1SJEA 4XP6L 3X3FL 3NACL 4DWHA 4WV1A 4NO3A 5IB2A 5F6HI 3M46A 1HHIA 2C7FA 3DO3A 3Q8BA 1CYXA 3G6JB 3QJHA 3QQ9D 2EDLA 4FN0A 1BYPA 2VB5A 2A6JA 2IANE 2WUCH 3JSSA 3O2VL 4BE5A 2BH0A 3QQ4B 3QXDB 1KB5B 1YEGH 3RX5A 4F9LA 5IW3A 4DPBX 1DBMH 2GTQA 3TN0D 3TA3D 4I1PA 4PVLA 3ILQD 4OVVA 1E6OH 4U4BA 4XMKH 4Y19A 4PJCA 3LS5H 5ISZA 4KZEH 3L45A 2O5XH 1JF1A 4XMZA 3ESNA 2DF3A 3QZOA 3O3BA 2FB4H 3EJRA 4KX8A 4PJ8D 3TFKC 1FZMB 3QORB 2P48B 5F72S 4UT9H 4PVBA 3ZIMA 4HLEA 2NY4C 4YHOH 3FPXA 3ESPA 1EDQA 2WZ5A 4KVCH 2VW7A 4YZWA 4R7XA 1S7VB 4G11A 5GSVB 1QABA 1KZYA 5K1NA 1U3NA 4P8QA 2P5WB 1DBAH 4KI5D 5DD0H 1NIDA 43C9B 4F3FB 3H7BA 4YHIB 3J7HA 1XB8A 4PJBB 4X42A 4N3TA 3ZZQA 3FUFA 4DNLA 5JQIB 2H0PA 4FNSA 3OVUB 4ORGA 1I1RA 5DC2A 3C2SA 5F7WC 4PV9B 3LXUX 4YVNA 4LVHB 4ZOCA 5I0ZA 3RPKA 1IM9B 2GI0A 2I7OA 1IU1A 1ODUA 2OMVB 5D7EA 3TCXA 2FIKB 3UCRA 2X1WL 5TE7H 4N2IA 4XMPL 4QRFA 3BZEB 1HXMB 4A7GF 5FCSH 2GG1A 4M8QB 5I9QC 3VCLA 1X4ZA 4O00A 3MV9A 2IJ0C 4U3HA 3L2MA 4LE8A 1E4WL 4LLDA 2XPGB 3DVIA 2EKSA 4MJ6B 1M1XA 4PCYA 4DGIH 1AD0A 5EEXA 3PPSA 1VFMA 4I48A 2WLYA 4M29A 2VMDA 3KGTA 4GY4A 3MLWL 1KGWA 2MRYA 3QIBC 4LRIC 3D3VB 1V10A 4MA8H 4OGQC 3ZLQC 2OFQA 3TFBA 2X12A 5C71A 3IU4L 3S96A 2VXTH 3DIFA 4R4BA 4E2OA 4K4KA 4QNPF 4NCC2 5CWSB 3MXWH 2JJTA 2XIIA 2L7UA 1KTKE 4KHXL 1T04B 1JYNA 2MTPA 4S0SD 2B9BA 4LLUB 3BX7C 3VA6A 3QCTL 5CJ5A 4X7SL 3L1EA 4RX4D 4D0DA 2NSMA 1UYWH 1D5RA 1OAJA 5ITBH 2BRRL 5KOMC 1KXTB 3OM3B 2OQJB 2CJSA 1J9QA 4K5MA 4PJ5B 2ZG1A 5TE6H 3UPAA 5BZDA 2CXKA 4EVNB 1T0MB 5I17A 4Z0XA 3NPSB 1EHAA 1BWMA 2IH1B 2Q3ZA 4IMKC 1WAAF 1UACH 2NQCA 5KYWB 4KY1H 3U4EA 2OL3H 4TKWA 3TZVC 2AV1B 3T04D 4KZEL 1P7KB 2O5XL 4AIOA 2CO6A 2RFXB 3P3SA 1AJ7H 3FHEA 1R6VA 3NCEB 2X2UA 4BSVA 5T5NG 5KVEH 2ICEB 4PRPE 4NSKB 3MGTA 3QT2A 4OZHB 2VDLB 1UADC 3BP7A 1U8JB 4TUJB 4AVJA 3VSVA 5FO9A 1YYLH 2W07B 3LN5A 1ED3B 3MLXH 4BCXA 3Q05A 5A7BA 2GB2A 1SFDA 2J4WL 1K72A 2C26A 1RU9H 1J8HD 3BPNC 3V2AR 2WCGA 4GSUA 2Z7UA 3HBPA 4PB9H 1EJ6A 3BYYA 4ICWA 4YL9A 4JJ5A 3UX9B 2NOYA 3OMIB 3MYZA 3FU8A 5FDWA 3K4DA 5T3XD 4HJIA 3HA0A 3KG5A 1ORSA 1JZHA 3LD8C 5DJDB 1PEWA 5DEFB 3VE0B 4AKQA 1O6VA 1VFBA 4K94H 4EI5C 3FCTB 3EJCA 1SBBA 2APSA 2DMBA 4OZIE 2OJ1A 2HTLC 1OV8A 3MV8B 3JWNH 3T0VA 3KYKH 2AW2A 4JQVC 2VJ8A 3DOSA 4IJTA 1QSVA 4Z95H 5DSCA 4X0KA 1IGYA 3WEBA 4G6KH 4ZS7H 2Z4TA 5INDB 1JPTL 4ZUTA 1R3HB 4UOJA 2G75A 3EYQC 3QUMB 1D5BB 4I9WD 3UO8B 1BQHA 3BCFA 1ND0B 1M7IA 1FQ9C 4JFHE 3LNEA 1LQSR 3N41B 5TQ0H 4NQXB 3NEEA 1OAUL 4DGIL 1GR7A 1XD0A 5F3BA 2LLNA 4TQEL 5AAMA 4OIAA 4DAGH 1HAWA 3K3QA 3NMEA 3EHBB 2P5ED 1GRWA 2XPYA 3EDDA 2NW2A 3OTTA 4Z6AT 1H15A 3T8VA 5D8JL 1JAEA 3TEYA 4RMVA 2CLVA 2VR7A 2BINA 4NZJA 1JK9B 1DVYA 4M61B 2MNJB 2YEZB 5D1XB 1LQBC 1D5MA 4JM2B 3B2DC 4G43A 3BUQA 2G9KA 2GFBB 4FXGB 3MXWL 4X5WA 3D07A 3LZPA 4NKOB 3BPCB 2ZXBA 2EABA 2OR7A 1DQDH 4V1DD 1RLWA 5ISZD 3NP4A 4JY5L 4N2AA 4MHHG 5BZZA 3MACH 4ILDA 5JDSB 2B5IC 5HPMA 5IHUH 5TE6L 2F8VA 5T3ZL 5BOJA 1Z9OA 1RP8A 3ZT7A 3P02A 1CCZA 3AQXA 4XP4H 5CFAA 1A47A 1RULH 3VTMA 3SHSA 3NCWA 4IBWA 3P9MB 4GSXA 3PWPA 1AD9A 4ANWA 4FFWC 2B08A 3LRMA 3D69B 3NFPA 4HJGA 1FFOB 3C8KA 3HUJB 4UBDD 4DTGH 1GL4B 2OL3L 1MRFH 4NKDB 3OLDA 1YEIH 2XFGB 1QTYT 1A7QL 2MOGA 1J86A 1HSAB 5BRZE 4M02A 4G6ML 4MJ5B 1EPFA 3RUGF 5IHZB 4NS0A 4TUUA 4PS7A 3ML9A 1IGFH 2K1MA 2H26B 3S3CB 1HNYA 4NJAL 4XWOD 5FGBA 3X11B 4AH2B 4ANUA 1K5NB 4MMYB 1IBYA 1YYLL 4LVNC 3FB8A 3MLXL 2FJGA 5AENA 1N7MH 1UFUA 2EDHA 3ARED 4M5SA 2BC4B 5C0RH 3TBSB 3WJMB 2WMPB 4GXUN 1EHLH 2N3JA 3S8WA 3GSUA 1Q9OA 1S46A 3AC0A 4NNYB 4KRNA 2ENJA 1DVUA 3GMNB 3QJZA 4XI5D 5T1MA 2X4TA 1MHPH 5B8CB 3RGVA 4HIHB 3WIFA 3FXIC 35C8L 4Z95L 3IMSA 4YE0A 2BVOA 1P4LA 4PJ6A 3FQXA 5IFHH 4X8XA 1S5HA 1Z1WA 4RVBA 3E6HA 4ELME 2J6WA 3OKMB 3T0XA 4KUCD 1NDGA 4UTBH 3ZO9A 4NNXB 4PJDB 5CIPH 3T1FA 1SVCP 2P8PB 1KTLA 3JWOH 3E1F1 3KPPB 2BHFA 3VJ6A 4B9JA 5DHMC 4FQJL 3AWEA 4HMEA 4M7KH 4GAJL 3N55A 5KJRH 5A3ID 3JV6B 1QRKA 4IK6A 2JELL 4OCRH 4DAGL 4XNDA 1TLMA 3DPDA 2FH6A 1UT2A 2ZP0T 3F65A 2GTWB 4BZ2A 3TCLB 2ZXGA 4QYOA 4DGYH 1FH2A 2XNAA 3KS0J 3P4OA 3EO1A 4GAGH 4XP9H 4FFZH 3V0WL 5LGKA 4XO3A 5JW4R 3G6JE 3CCHB 4GBXC 2OYPA 3V55A 5LQBL 1PG7X 2ZP8A 2R1WA 3SGEH 1MHEB 4B50A 1VEMA 4HKXA 1VFOA 1MWAA 4AYFA 1YQVH 5D70L 3WJJC 3TA3B 3L7FA 1A3QA 1QYGH 2EIMB 2Y22A 5FOJA 1LWJA 3OAYH 4JLRA 5J6HB 2F5AL 4HIIA 2G2NA 4PJ8B 1YO4A 5G4NA 3VQLA 1EBPA 1EEUA 1OTUC 3MACL 2OPCA 3Q2WA 4QTIH 3ZYOA 4FFYL 4YR6B 2DZEA 1IT9H 4JANB 3B5TA 3FQNB 4PP1C 5ESVB 4PJAE 4MNHA 4NBXB 1UOWA 3BP4B 4XP4L 1NBCA 4R9HA 1RULL 1KIPB 4KOCA 3BVTA 4XPTL 5D1ZA 2X9WA 1J12A 2XU9A 1J0JA 4AL8L 4AT6B 2R2EB 3WTWA 2JWYA 3EFOB 1OB1A 3AS1A 2XTSA 2P5WE 2CK0H 1Z66A 4ODUB 4XO4A 3ARGD 1T03H 1BECA 2Z92A 3VWJA 3TYFB 3ZSSA 1RZ7L 2CUAA 1YEIL 2V3DA 4O5LH 4PJBE 5INCA 3WKMH 4F33A 4G59C 4ZPVA 1IEBA 3SOTA 4P3DA 4HIJB 2WXMA 5AUMA 3FSZA 3S34H 4B9PA 2MEJB 1IGMH 2RB8A 1GW0A 4NYLB 1NFIA 4CSZA 2PYFA 3BSZH 2OYMA 2ARJA 1KDJA 2E4FA 4HZ1A 4YIQA 5FGRA 1WZAA 1FL6A 4UOW1 2YRZA 2LTQC 5HBBA 5E6ZA 3BHBB 1N7ML 1RZKL 3F62A 3MN8A 1S7XB 3VRIA 2QVKA 2HRPL 3PJLA 3QEUA 1LO4H 4OCSH 4KO6A 1V55B 2DWXA 4HFWB 1QACA 3VFUA 2ZX8A 4Y5VB 3RRQA 3ZKXC 1YEFL 1ZA6A 3FN3A 1NSNH 4Q6IB 4HWZB 4N0YH 1G7IB 3D33A 5EH1A 1ZLSH 3SKJL 4OTXH 4MAYD 3AS3A 2YA2A 5ACLA 4QRPB 3N43B 5JPMC 1XR9A 3PDDA 3WLBA 1A9BA 5SWSB 1EA9C 1NFDA 3PFUA 3D3VE 5IFHL 4XMUA 2R56L 1NEZA 5J12C 4AQ1C 5AL0A 4UTBL 3DTXB 4LOVA 3JWOL 4ZUVB 2VQ1B 1BF5A 3U9UA 3E3QE 3ETTA 3OGCB 4TSAH 3GB7B 3FULA 4YSEA 3ILPA 4M7KL 3K4AA 4X6BB 5KJRL 3BKMH 3WXWH 2HTKD 2IVFC 3GSXB 4E9SA 2XC8A 4EBQL 5HHXH 4MS8C 2PCFA 4XP9L 4FFZL 4GAFB 3U6RA 1IFGA 2DLIA 2VQ4A 1WZLA 3RLSA 4FNRA 1UASA 1LNUB 3W0WB 2G4EA 4WTZA 4EQ2A 4PJ5E 3EDFA 4IRSB 2XI9A 5AKSA 5HI4C 2EECA 1XTLA 2B39A 3BW9A 3N04A 4EUPG 4KZCA 1YQVL 4EZMA 2WXPA 4P2OA 3L5JA 5CCKH 3BO8A 1ZSDA 2BS8A 4ELDA 1QYGL 4QWWD 4XBGB 5E56A 3S0PA 1Q1PA 4APXA 1GZQA 1FL3B 4RGNB 3FU6A 4QRSB 4ZJ9A 1GY1A 4RWYH 1BZ7B 5CR8A 1W72A 5FYLD 3GSNA 1RJYA 4GW4B 4CMMB 5JHLH 1PSKH 1A6TA 2IQ9H 4EAEA 1IT9L 2N4IA 5KANG 3NFNA 3VFMA 4M7ZB 1U3HA 3D50A 3GBLA 3O6FA 3UTPE 3KPLB 4AUUA 4CKVX 4H8QA 4HX1B 1J8HB 1A7OH 1GW6A 1J10A 2CK0L 3PWVA 3LH2L 1T03L 3UJIL 1KCUH 1ZV2A 1TSRA 4AYBA 4PVNA 4CSSA 4OF3A 4AQEB 2ZUXA 1FGNL 3NCJL 1HH6B 2ICWA 4A7SA 2YIHA 2R9HD 3OX8B 4R2GC 1BPLB 1CDGA 1IGML 2VDPL 1ZY9A 3NCFB 1ZHBB 2QMKA 3BSZL 2A83A 3MV8E 1S78C 5LDUA 1KYUA 4WTWA 2GTZB 1UM5H 2Y9RT 2NY5H 3B9KD 2N1TE 4NO2B 2N01B 4HXBL 1LO4L 3VFRB 3NPZB 3MRQB 5CMAB 4IS6B 3QWRA 1RFDH 1QI4A 1IZKA 4J3TA 2IO5A 3L9BA 3WFEH 3TURA 2EDEA 1ZLSL 4FL4C 1NPJA 2P5EB 4OTXL 4Z7VB 2EE3A 5F7AA 3JVGC 4JN1L 3CHXA 4KTYA 2C3VA 4TNVK 2L04A 4K3HA 4NZTH 1Y6KR 1RQ5A 1WGOA 1MFAL 5HGAB 4N6QA 3O3DB 3LN4B 4XCFH 5DYOB 3ARFD 4N2NA 3AQYA 4U1KB 5D1XE 2G3XA 1OAYL 4HG4J 1X5IA 3QNXB 5HDQH 2BVPA 5JO5A 3C2AH 1ZS2A 2ZX5A 2EDJA 4V1DB 1K5WA 3HAEG 3OD3A 2XTJD 1CVSC 1FNGB 3QFJD 4M6MH 4NN5C 5CP7B 5DR5H 3SDCC 1U8IA 1GGCH 2VR5A 4X7DC 1ZV9A 2PCPB 4R7LA 3QYCA 2CKNA 3U4KA 4AQOA 1G7LA 4ONOA 3P9LA 1Q8MA 2E6JA 3CFMA 1DJWA 5DD1L 1HK6A 1ZA3A 1OSPH 4EMZA 1T6WA 4JKWA 4MASA 2WVSA 1I85C 5EIVA 1AGDA 4J3VA 5D7SL 4YFDB 2K3HA 4AKOA 1RJZA 2OV0A 3VI3F 1MCWW 2IGFL 5E95B 3GSRA 5D1ZD 4UIKL 5CCKL 5K33A 3FH7A 4MTMA 3HUJE 4QAWA 1E40A 2O93L 1CMOA 4JHWL 4PJ7A 4LPUA 1JRHL 1G6RB 4QXGH 4C56A 2AJUL 3FFCB 2PWDA 4KK9C 4WI2A 5L4IA 5SWZB 4RWYL 5BPPA 4G42B 5JHLL 1PSKL 2PPFA 2Y23A 3FAWA 3MRDA 5AB0A 3QNZB 1BAGA 1TVHA 4Y9FA 3QDAA 5AAPA 3QC6X 2ZUYA 5DFAA 5IROA 2QLYA 3AREB 1W6LA 1A7OL 3HS0B 4Z23A 2DQCH 2ZWSA 4WU7A 2CR0A 1JHLH 1SLWA 2WOYA 5GHWH 1KULA 1R5IA 2PR9A 3W11D 5B39G 5HJBA 1KCUL 4L8SA 5CD3B 3O41A 2WQXA 5F88B 1CGXA 3VWKA 4UV4H 5I6LA 2NT1A 5AVVB 3ZE1E 3CZNA 3V0GA 12E8H 4U1SB 1RJLA 3FTXA 1LEIB 4JE0A 3KVPA 3RKDD 3SYQA 1Z5LB 1VLXA 4KO5A 3QHTC 1UQSB 3US0A 4P2QD 2VQUA 1BREA 4HVBA 3PXJA 1T0NB 2NUTA 3BAYA 4EXPX 3JV5A 2Q0ZX 5IQNA 1UM5L 3KW8A 3QQ3A 3Q0HA 2NY5L 4UANA 3RPIA 4BH8B 1P4BH 2LHAA 4KUZH 2NY6C 2ZXCA 2HG5A 3BKCL 4G8IB 4PJDE 1J88A 3AM8C 1KV7A 5HI3D 1DQQA 1RFDL 4CNIA 1OGTB 2V5TA 1OANA 2EYTA 3DURA 1SY6L 4G1MA 3WFHB 1LXMA 1DQLH 2QQQA 4QMEA 3V4PH 1FO0H 2VLJD 3PDOA 2UUDH 3Q8FA 2AGJH 4BFEA 4I0CC 2ZCKH 1WC7B 3AGWA 3NPSC 1DBKH 2N7BA 2QPEB 2O5YH 5CU9A 4XCFL 2X42A 2AXGB 2BSBA 1OP4A 4HGMA 3TH4T 3E7JA 2Y3AA 5EOCJ 3N1PC 2W9DL 3C2AL 4UV7L 4Z1PA 2HVKA 5MERA 3DGGB 4UT6A 5F7KC 1FFTB 4M6ML 5DR5L 1GGCL 3RDJA 1M2VB 1ZPLA 2YPLB 2H0JA 3DSFL 4U1GB 3WNKA 3A21A 1CDJA 1YDPB 3C09B 4JG9A 2HT2D 1DBJH 3DIVA 1BJMA 1OSPL 2OI9B 4K3EH 1FNSH 3CMOH 4LIQH 4X7TB 1DO5A 2GUYA 5SX4H 4PY8I 2YKLH 2QVTA 4U7MA 4CU8A 5IBTH 1NUDA 5MP6H 3MLZH 4TULL 2GJRA 4KI5E 2FEJA 2DQFB 3HC2A 4N8VA 1ZGLP 3PGCB 2Q7YA 3GXMA 4F8NA 3GXNA 5EZOH 2DQGL 3IGFA 2JIXA 1FHNA 1BMZA 1PCXA 3MRPB 1YEKH 1CICA 1JDCA 3MNWA 1QVOB 3APFA 3HG5A 1MG3C 4I2XA 2PWHA 3IKCA 4QKTA 5TK2A 4KXZI 3FT3A 5F0JB 2VITB 3QH3B 3TBWB 2VLRA 1QRND 3KYMA 3TO2A 4UM8A 2BJMH 2UVFA 1ECZA 1TITA 1JHLL 5GHWL 3MRCB 5DVLA 3RUGB 4X8JA 5F89B 1YEDA 15C8H 5JHAA 4PJFA 1T22A 2XX1A 3MBWA 5AKRA 5DZNA 1L7TL 3S5LA 3VTAA 3O0LA 4P4KB 3M1CA 2CGRL 2MQGA 3NJJA 2YXWA 4UV4L 3KM1A 4NWUL 1GJIA 4N0UA 4OV6F 2AEPL 3RU8L 2J1YA 3KHQA 3ARPA 3J2PA 3BP5B 5C0AA 2FD6H 3O3EB 2VH5H 4AQAB 2C3HA 2ZSWA 1BGXH 2G5BB 2DPKA 3WKYA 1T66D 1G4MA 4QRPE 3ESUF 4BSWB 5KW9H 1OTTD 2VO8A 4X9BA 2BNUB 2JKNA 4TSCL 3KJ4B 4FJ6A 5SWSE 3C60C 5DDHA 2OCCB 4W9ZA 3VFPA 1PL3A 4DN3L 1DSWA 2QADD 4G1EA 4JM2C 4MAZA 4PV8B 1LTXA 2ZCLH 4FXGC 4H8VA 3MNVA 5F7MC 4K73A 3U82B 3VFTB 3TONA 2CO7A 4WW2F 4JFQA 2AITA 4J6RL 3HAEB 2DWDB 1QSEB 2QSCL 5IM7B 3QUYC 4JFOA 5HHNB 1SJHB 1HYSD 4D9RD 1AYRA 2BIOA 1JNHA 3QZNA 1MCDA 2GAZB 5CU5A 3D2UD 3W0WE 2NX5A 1DBKL 1RZJH 4M4RB 3EFFB 5A2FA 1GKEA 2OTUA 4ZNEA 4M43L 4U0RB 1H8OA 1IFRA 2R29A 4NO5A 5D6DC 1J9SA 5DFWH 2RCSH 1MFCH 4XMLL 3O11B 2G3MA 5EU6D 2QVIA 4QHMA 5FC9A 1R34A 3BIBX 4RGNE 4OQ1A 1BVLA 4OF6A 1PFCA 1YECL 4UZGA 4UDUA 1F3DH 3DIDA 5I1GL 1H0DA 3VU2A 4G2AA 4LIQL 2NR6C 2X4QB 2YKLL 1FFNA 1RIHH 1W15A 2X4NA 4BZ1A 2XWJA 1CXKA 2EVJA 4QRQB 5DJXB 5EO0B 1L9NA 2XIBA 5IROD 3HEIB 5B1JC 4X99B 1FORL 4AMWA 4OGYH 1SYSA 4ZNCD 4P23D 1K3ZA 4OM0H 3RDTB 1YEKL 2A6DB 1YNTA 3QFDB 2BIHA 3VXSD 3GYRA 5HDOA 3VWKD 5LLIC 4NKIH 3V6BR 4U1LA 5B8CC 4QT5B 3REWA 2Q87A 1QLRB 2OTWB 5HDLA 3MZGB 3WUZA 1U4FA 3D0LA 4JPVH 2H0EA 2UUDK 2ZICA 2BJML 2CG9X 3WS3B 5TH2B 4M03A 3ZHFA 4I9WE 3DECA 5KEZA 3AU1A 2P7TB 4XPFL 15C8L 1MDTA 1UFGA 2X7LA 3H4FA 1N18A 3L3GA 4G8EA 2R4SH 1UUSA 4B96A 2FO8A 1RK0A 3DTDA 2Q8BH 1CTNA 1BGXL 1H19A 3B1UA 2P5EE 1N59B 1ZK9A 3QQ9C 2CO4A 1WISA 2ZTBA 1Y0LA 5KW9L 1NA8A 4EIZC 4Z18A 2GSMB 3HJEA 3MDJA 4JCLA 5F9DC 5B4MD 1YJDC 4WKZA 1R5WB 3LDBC 3RQ3A 3TN0C 4RDQG 3TA3C 2E9BA 2IC2A 2ZCLL 3ILQC 4LDOB 5T3ZD 1NCTA 4M1GH 4JFPA 3BEWB 2W38A 2YD7A 4U3SA 5I30H 2NYKA 3UEZA 2YC1A 4IDJH 1QSFA 4PJ8C 4V1DE 3V4VA 3VXRA 1AZNA 4YDNA 1X7QA 4M6NL 4AYDC 2V9TA 3AAZA 1G0YR 1UA7A 3CN1A 1TQSA 1U8QA 3EYUH 1BBDL 3L7EB 2C5DC 4A2MA 1TZHA 3SKMB 2BY1A 4LGSB 1BOGB 4KI5C 4QNPE 4YC2C 4JPIA 1EHNA 1MNUH 32C2A 4L18A 2CKBA 3I6KB 3SO3B 2RCSL 4NQCB 4Z7UF 3F04A 3PNRB 4L1TA 4N2FA 1BLNB 1ZT4B 3BUDA 2IDFA 1EFXB 3BVVA 3FFCE 1KIRB 5SWZE 2AQPA 4JZJC 3MMEA 2AJXL 2QMJA 2J43A 4MB3A 1I7UB 2EEAA 3B3IB 1IBFA 4QXTB 4WJ5A 1WAAE 4I1RA 1NBZA 2DJSA 3RYMA 1JCVA 4DVRH 4JHVA 3L3HA 4ZUWB 4HJTA 4J8RB 2GJPA 4OGYL 3ZRCC 1FH5L 1JWSB 4Y5VC 4NGHH 4CUCA 1S7RA 2DQ6A 1QBLL 3MRIB 3MROB 3QDJA 4L4VA 4NLHA 4OM0L 5DXWA 4DZBA 4A7QA 4NKIL 3D25A 3RNQA 5DJ8A 4P2QB 3T71A 1OCRB 5ABZA 3IFPA 5EBMB 1GPOL 4R26L 3IE4A 3MBEB 4Y5YA 1PZ2A 2XN2A 4LP5A 3FU5A 1I7ZA 1AKJA 2D2OA 3R1GL 4XPHL 3D05A 4HH9A 4RMWA 5E6UB 5IIEA 1RUMH 4TNVF 3ZKSD 4V2BA 1NGZA 3ECBA 1IL1A 4MAUH 2A1WH 4GXVH 4ZDHA 5DVOA 3QO0B 3UZVB 8FABB 5L8KB 4KRPB 2X70A 3G9AB 5DJAA 4HUWB 3GSOA 3VFSA 5AZUA 4AXWB 2G60L 1FCGA 2VLJB 5BVJA 2P80A 2ODIA 4QRRD 3BAEL 4XVSH 4KXCA 2OK0H 2VR3A 4FQXB 1DJIA 2DLFL 4TM9A 1RJCA 4JFEA 2KLRA 1KGIA 5HJ3A 1OAKH 1E90A 3P73A 3LMJL 5GZOA 4G9DB 2Y7SA 3SZ6A 4L8CB 1XEDA 1AZCA 1BJ1J 2DBLL 4JDZB 2ZXAA 4TQHA 1EXUB 3GTNA 4A37A 5E94B 3QQDB 2YPLE 3WKQA 4ACPA 4LRNH 3EYFB 1J9CT 4YXKL 3T3MF 5CJBA 4G8GD 4M7ZC 4ZTPL 5J6SA 4NC1E 2AP2A 3T65A 1KIQA 1E8XA 3OAWA 3VD4A 4ES9A 3CH1B 3QIWA 2YD6A 5SX4I 4L48A 3V0VA 5I73B 2XXCB 3M07A 2BY0A 3EJTA 2ATPA 1NC4B 4OSUH 3TBCA 3WE6A 1L6ZA 1QO3A 2ITCB 4E9QA 4IW4C 3VXUD 1S3RA 2AXFB 2YRPA 3RWEB 1F3RB 4JR9L 3MLTB 2WVUA 3P4NB 2QHRH 3ESMA 1DVZA 4B3VA 4BZ2H 4I0PB 3VI3B 4F37K 3HNTH 4LF3A 2OJZH 5I73C 3VDBA 1QRNB 3IMRA 4B97A 1FHGA 1I1YB 4NKMB 2R1XA 4JQXA 3QPKA 4W9JC 2E86A 3RZCD 4NENA 2XKSA 2H1PL 4PR5A 4X6EA 1QFWI 1U8CB 1MCHA 1WAPA 4L5FE 2X05A 4X6CF 1CFQA 1TZIB 1ASQA 1N3NB 1Q9LB 3RUGE 4F8PA 1BPVA 3EO9H 3NIFF 5LVEA 4GXUM 3WY3A 1QZ1A 3CHQA 4PJ9B 4QI3A 5M95B 1H9DA 1S3KH 2B1AH 3IYLW 2YD4A 3MHZA 5KS9A 2B0SL 5K9KB 3PAVA 3DX4A 4WV1C 3ENEA 3L5WA 4PP2A 3EGSB 3W38A 2JFCA 3LKSB 4AM0A 5DK0A 2FUTA 2VM4A 3BQUD 3PWJA 4WLCA 5D2LB 3OHXB 2APTA 1BXXA 4WF7A 1EERB 1GTNA 5CFHA 3D5OF 2D9QB 2RQ8A 4ODWA 4FLSA 3OB8A 3HHSB 4JPQA 1QR1B 3S8GB 1N0XH 4GXVL 5E5MB 1TZAA 4YDLB 5CN1A 2VZOA 1PU0A 3H2PA 2VYRE 5C92A 1FBIH 3G5XB 1QSEE 3JBG7 3KBPA 4FX5A 3MO1B 3D2UB 5GIRA 2J6EA 2PMZA 4X80H 4HETA 5I8OH 3PJSA 3F5WA 5D71H 4GFTB 5C1MB 4PRID 1OAKL 4ZSOB 1X5KA 3LNDA 4UBDC 2ERJB 1J8RA 3IDYB 1T5WB 1MLCB 1CDYA 3BGMA 4PN6A 3TIDA 3HFFA 1NC2D 3S6CA 1XWVA 3IMVA 2MKLC 4JFYB 2W65B 4BQ8A 5ELIA 4HS3A 5KSVA 1OSZB 1C08A 1UZ8A 3WJLC 4RDBA 2ZCHH 1MI5E 3SDXB 2KYIA 4LVEA 3DYPA 4PTUB 4DUXA 1J5CA 4QHLA 1KIUA 3BWZA 4XWOC 3IRPX 2DS4A 1X9UA 5IB3B 3A4FA 4LRNL 1P2CB 4XNUL 3ZE0F 3VH8B 4XH2B 1NFKA 1UXLA 3HHRB 5BXFB 3K4ZA 2E59A 4FOMA 4POUB 3AREC 3HLAB 3RI5K 4G6FB 3LZRA 1XL4A 3BVNB 4ERSH 2NY2D 4QHNA 4S1SH 3W39A 5A16B 2L0DA 3RBSA 4MSWB 5CGBA 1V7NH 3QEQA 2XPZA 4GIOA 3IAPA 2W0PA 4XOEA 2DI7A 3GXTA 2F7OA 2H6OA 4XI5C 3TV3H 3U7WH 4K15A 4DW2H 3ILDA 2QHRL 2G30A 3G7TA 5F6HJ 2R1YB 3QDJD 2W80C 1ZHKA 4W4OA 4WKXA 1BEYL 3REVB 3HNTL 3KPNA 2OXHB 2F8XC 2WGXA 2COVD 3OQRA 2BNRA 4JY6A 2CLRB 2F6AA 1OB0A 3FCUB 2KH2B 2ADFH 3D48R 1LE9B 5JOPD 4F20A 1ZCRA 4F7TA 4GUPB 3H85A 1OW0C 5FYKU 3SBWC 1Q9KA 1WVZA 4ZFOB 4HDIB 4ZW3A 3FONB 1RUQL 4H8HA 4TN9A 5BZWB 3T4YB 3EO9L 2Y1YA 1BAWA 2CRYA 3QZWG 4W9FC 2DI9A 4Y4FA 3H9SA 1G6VK 1S3KL 3GSNH 1IUZA 5C7XH 1O7DE 1H5BC 3I2CL 1T6BX 1YNLL 2J8UF 3GF8A 3LEVH 3NZSA 3M17B 2VZUA 2EEFA 1XV8A 5KVDL 2ZCZA 5C6TL 1TYRA 4E0RB 5I1HH 5I19H 3KLHD 4GI6A 5DQJB 3SCMA 3EF7A 3V6OA 2APXA 2A9BA 4Z0BH 1PG7H 2V5RA 2A73A 2Y5TA 2Z35B 1M42A 2XETA 1QKZH 3I9AA 4G70B 4M1CD 4OKDA 5CZRA 1QBAA 1AHWA 3P4MA 3QYNA 2WK2A 1B4RA 2HRHA 2VN3A 3QG6B 1U30A 4LCVA 4N1EA 4YHZH 1HFUA 4PRHD 4E9VA 2OL3B 5DQ9A 3KJ6H 3TIEA 3X13B 3ROOB 1MCWM 1VAHA 1FBIL 3UL4A 1NIBA 4NFCA 5JOFA 2AKRB 4Y2LA 2OI9C 4F9PA 4YE4H 1MJ7H 4EJ1C 2ZYSA 5MEND 1INQB 1BFVH 1VENA 1SN5A 5HGHA 5I8OL 1P7BA 4EIUA 3HE6A 5HHMB 2HWZL 4YMPA 1YN6A 3NAAL 3ARGC 4WW2B 1J8SA 4U7KA 3T6XA 3HJ0A 3SQOH 3OKEA 5D2NB 2WIIA 1T80A 4AGLA 2P24A 3W1ZA 4KGJA 2CIKB 1BD2D 4NQCE 1TJGL 2OTPA 1DLFH 3AROA 4GRMB 4F7CA 5F0LB 3UAEA 1TZGL 4D8PA 5I15L 4N9GB 3BDYL 2JJSA 1NCAL 1FI8C 5TQ2H 3ZUCA 5ICYB 1MFDL 4OZFA 5EBWA 2IADA 4I3RH 5J11B 5D7JD 3T0EA 5GJTL 4DVBB 1U8KB 1KPUA 3ULAB 4DKFH 4UT7H 4J4PA 2JKXA 2B3IA 4XPBL 4XOBA 2F53A 4AENA 1WHOA 2EDBA 4XNXL 3VXNB 3IGLA 2F19L 4OUUB 4AEIL 3AU0A 5FYJU 3TV3L 2YFNA 4Y2NA 5HYFA 3U7WL 3EZJB 4DW2L 3R4RA 4MAYC 5IG7A 1ITBB 1U8OA 4TVPH 1X44A 3HG1B 2QGCA 2JCCF 1GOGA 3UPCA 3AS2A 2WXHA 2JH2A 2VC2H 1I9IH 2ADFL 2F8OA 2JK5A 5T1LA 5F9JB 4QY8A 1IC4H 1NBYA 5IWLA 4Z77A 4KKZA 1YMHB 4RIRB 3ZHDA 2BIIA 4OB5H 4CU6A 1S9WB 1MREH 3QUZA 2Q3AA 3L5XH 4GKOA 4PJIF 5B7FA 1V5JA 2FBJH 2HTKC 1E50A 3IJ8A 4L0ZA 5E9AA 4FEIA 2IEPA 2OAAA 5H94A 2X87A 4L4TE 1G1KA 2EIEA 3CFEB 2BW4A 3L9EA 3LRHA 3BEVB 4XCCL 4IOFD 5I28A 4HEME 2R7EA 3LEVL 4F1ZA 1KT2B 2F7RA 4JRLA 3MJ9L 3L9YA 2VLJE 3DV4A 1D9KD 2VXSL 5EIIG 3ZJAA 5I19L 4O9HH 4Z0BL 1TFPA 4JO2L 1PG7L 5EFIA 4Z3JA 2A74C 4WEBL 2LLLA 3FDWA 1QKZL 1MRCL 3ZYZA 4B3EA 2A0LD 4QWWC 1DUYB 5KVGL 5J1SC 1XBDA 3L3KA 5JA8B 2E6PA 1DQJA 4OJFL 2EIBA 1IBZA 1D3CA 2B2XH 4OUOA 5MEOA 2CHDA 2Z3FA 5F1IA 3KJ6L 5FA3A 3RFRA 1TXKA 4YZFF 3WO4B 25C8H 3FFDA 4G8GB 5F7BA 5AW6B 3IDGB 3FTZA 3GDCA 2GUOB 5FGBC 3PWUB 4YE4L 1F3JB 1MJ7L 5EC2A 5F7EL 3OPZH 3U2IA 1BFVL 4P9ML 3CN2A 2P8LB 3UFIA 5KSAA 1B4JL 2OP4L 2HKFH 1XB6A 4HLJA 3ZHKA 3MRJB 3MLVL 3IJYA 4YX2H 3TPUA 1VGKA 3B9VA 3SD5A 3RFZB 3STLA 3MLYH 5D7HA 3PABA 2Z9TA 4XBMA 3VXUB 3HOGA 5CN2A 3QEQD 5T1DL 2YJLA 2R9HC 3IXTB 4P57B 1CLCA 1MCFA 3W9DA 5JPNC 1XGTB 1CR9H 4JMNA 1O5DT 4F2EA 3CZKA 2W60A 2GBVA 3BKJL 4HJUA 3VI3E 3P0YL 4F15C 1QRNE 1MXDA 3RZCB 3QRGH 2CRZA 2JB5H 3B9KC 5F3HA 4W9CC 4Z7UB 1UOKA 4BK8A 3QO1A 1IKNC 1R19A 1ZLEA 2AQ1A 3RVWD 4DKFL 1HCZA 2X4SB 4MA3A 1EEZB 2UYLA 3KGSA 3KLAA 6PCYA 5HHQA 1HI6A 5EU7C 3G6AB 3ULVD 1CFNA 4U1JB 2KUTA 1SHSA 4UT6H 3K6NA 1T7XA 2XVGA 4R4FH 3UGEA 3RWHA 1JPGA 2I26N 3CPLA 3QZPA 3QZWB 4X9HA 4M3KB 4Y4FD 2YBRB 3H9SD 1LO3L 4HKBB 3O3AB 2Q86B 3TBYB 3BQUB 1XH3B 3BUBA 4JM0A 1SLXA 5D1QD 1I9IL 2QPDB 3VQ2C 3ARFC 3BT0A 1KJVB 1WCQA 3SBRA 3N6YA 3CQFA 5D2LE 5DJZA 5EV7A 1G9EA 4XC3H 5D1ZI 1EMTH 3QVAA 3CU1A 1JYWA 4ZFFB 5GGRY 1MREL 2E7DA 4UNIA 3VFNB 1EV2E 5I0YA 2XTJC 1XF5B 4OD2A 2FBJL 1TJHL 4UU9B 4NQDD 4HJ1A 3HN5A 5DEJA 2HJKA 2FECI 3CZJA 1CVRA 3FRUA 2V2XB 4G7SB 2CU9A 3EUUA 3RWIB 2VDNH 2GIMA 3ZY7A 5J57B 1CK0H 3PAZA 5FX3A 5EU5B 2JKJA 3BN9D 5D1ZC 4QGTA 4ZSOE 4Y4KD 3ZYJA 4BKLB 3GXIA 1NC2B 5HY9B 1YUKB 2CLZA 2OSYA 4MJID 1MF2H 4R5TA 4IKNA 3P3TA 4MQTB 4PGBA 4PWEA 1M7XA 2H9GB 4P2RB 1MHCB 2ZXEB 5FA4B 3SDXE 1I3RB 2LQRA 3US9A 1JK8A 1YUHA 5IJVB 4K5NA 3D9AH 1FZOA 2ED8A 3LJ3A 5TDOB 4NDMB 4FNPA 4F80A 3STZB 1FIGL 4FXKB 3SOBL 3HPLB 2HKFL 1TCRB 1QWHA 1H9VA 3DX6B 4AGMA 5CCJA 3W11C 4G7YL 2P9RA 3QC5X 4YX2L 3QFGA 3LKPB 4BFGA 3EYOA 4XNQB 5ECJE 3MUY1 2HP4A 3UP6A 1IM3A 2HJFA 2X9ZA 4WFHD 3UXFA 3GSQA 1DQKA 4I85A 2E6QA 3RKDC 2CIIB 3V6ZA 3KYNA 3ZTCC 2FX9L 3ULSA 3S97C 1ZS8B 3ULUL 2DJ4A 1DN2A 3BWAA 4AK1A 3QB7C 3ABMB 5DS2A 4F7PB 2Q10A 1K8DB 3L6FA 3NA9H 4DQOH 5E8NA 3HZMB 3C6SB 2QELA 3IDMB 3EO0B 3M45A 4J1UB 2J8HA 3GJEA 1KTRL 4XVTH 5LBGA 5FEBA 5TGBA 5GS0H 4EIGB 4HCIA 1Z32X 2R29H 2V2WA 5DRWB 5HI3C 2GY5A 1K4CA 5J13B 2VISB 4UT6L 4R4FL 4L3CB 3GMOB 1KTDB 1X4XA 4BV1A 4XXCA 1OD7A 2WSPA 5FYKL 2GITA 4FI6A 2QZQA 5E8PA 1MNNA 1R24A 2A6KA 3RA7H 1ASPA 2OJEB 4XNBA 1HHKB 2YS4A 3BN3B 4O2EB 4Y2DB 4X6CB 3PHQB 3DARA 3NFSH 2Y36L 5LDSA 3NIFB 4DKAA 1QWUA 3T08A 1JGDA 5EIIB 4MMZA 3CU7A 4RMQA 4ALAH 2EACA 1SHXA 1EMTL 2HJLB 1OLLA 3RWJB 3MRHB 1JPSH 5L8LB 1E9OA 1BFOB 4K7FA 4AQZA 4PRHB 1CIDA 5DHXB 3K71A 3A6CH 5I0DA 3GUTB 3DVGB 4GQQA 2DEWX 1DJYA 1EAJA 2HT2C 4HKJB 1R3IL 2GI7A 1TT6A 2ICWI 4KK8D 3WCYA 4YDIH 5KVEE 3ZR5A 2VDNL 1CGWA 2EEXA 2W0LA 2I24N 2I9TA 3IJEA 1E6JH 2IH8A 3AW5A 3H3KA 3AUVA 3CK0H 4F7MB 5HHME 1HH9A 2C9AA 1U33A 4OV5A 2E56A 2MCMA 1N5YL 5EDSA 5D2NE 3TESA 3P54A 1FNEA 1RKRA 3Q6FA 5C09D 2FNBA 1KEMH 3RI5F 5ID0B 1JS4A 1NGWB 4BQ6A 4U1MB 4KTDH 1TKWA 2JJWA 2WNGA 1Y6NR 2HXAA 3UTTA 2ADIB 3LSOB 3PCYA 4FFTA 5F0PB 3OLGA 3UYRH 4Y1AD 3TNNB 3WFDH 2LAGB 3SDDD 4BH7B 2HN7B 4MD5B 3LKNA 3Q2VA 3ABGA 1XGPB 1AIFA 5IQOA 2FSEB 4MMXA 4UQDA 1IFHH 3JWNE 3ARDB 2D4FA 4MXQD 1J5DA 3C6EA 3FL7A 3T6WA 5DRXB 5C0IB 1XF3B 3WG7B 4ZMYA 1BVOA 2NTFB 1I8IA 4RSYA 5D7LA 3ZE0B 2GCYA 2D0HA 4Z3GA 4UNTA 4BZYA 3V4VH 2H0FA 4HWEH 4KGLA 2VQTA 4JAMA 3HMXL 4KXDA 3VFWB 3JYBA 1R5VB 1T66C 4JQIL 1KBPA 3BXNA 4YLCA 4HHWA 1SBSH 2HMID 4LSUH 1OTTC 2C34A 3HG1E 5DGRA 2DWEA 5FYJL 3FQTB 2QADC 2QPSA 3OHXC 4U33A 3ZU8A 4I18A 4XVTL 5GS0L 5GGUB 3DDGA 2PPCA 2CKBH 2UZXB 3DPBA 2MQCA 4ZW8A 2DIJA 1C5CH 4P3WA 3MVSA 4OCXH 4XCYA 5FOBB 1N6QH 4B9YA 1UXSA 2EDQA 1IAIH 3AXIA 1JHTA 4YDLC 5IW1B 2OMTA 3CX5K 3Q5TA 4FTVB 4NP4H 2QSQA 1HYSC 3H2WA 3O6KL 3VM7A 5H2BB 3WN5A 2B16A 1Q9WB 1D9KB 3LZLA 3VD7A 3NFSL 5BVPH 1T5XA 5JZ7D 2AK1L 2DH3A 1A2YA 2IQAB 4JRXB 3DMMD 4J3OD 4NI6A 3P3YA 3WKPA 3H4HA 1RH8A 5FF6A 1PLAA 3KEDA 2IV9A 1BX2B 4XBPB 1JPSL 2J8UB 4IKKA 2CRMA 3A6CL 3IGKA 1XIWB 2GSGB 3KCPB 5HHPB 1A7NH 4U1NB 4WO4A 2A9NH 4GNKB 2UX6A 3KPMB 3QIUB 4M8VA 5I8EB 1L9OA 4MCZA 2YQGA 4G8GE 2HRGA 1INEL 1PKQB 4ETQB 2W59A 4NCDA 3P11H 4FKKA 5IROC 4F91B 4UQCA 5C0JA 5K59F 2R51A 2WOBA 3SPGA 3FO9A 3CK0L 4ZD3H 1L6XA 2VMJA 4P23C 1LYQA 2KZ1B 1G7HA 2YGPA 4LPCA 4GRLD 1KJ2H 1AZRA 4IU2B 1CXEA 3QI9A 5DJ0A 2KQNA 3WTXA 5GRXG 4TUOB 4ODSH 1MW3A 1G1OA 2VDML 3GXFA 5GS1A 3SD2A 3UGUA 4KTDL 1EEYB 4XN2A 5TDNA 3SJVA 4TNGA 2ZOKA 1JNJA 1GHFH 3FTSA 3HZVB 1T1ZB 5EULV 1OAZH 2K6YA 4NN7C 4RRPG 1WEJH 4U49A 1UKSA 2J21A 2PCXA 4GMSH 4MDIA 4ZAKD 2F2HA 4YEEA 1NDTA 4Z7UE 5C0FA 4FMFA 4IDLA 1Q1JH 1JVLA 3CWGA 5I6MA 2WXOA 3CHPA 4WSKA 4EE2A 3QWQB 5LGJB 2QVFB 2F7PA 5D9SB 3I9GH 2YEQA 4NZFA 3DHMA 2HUEA 5C7ZA 1A0QL 2NY7H 1WWCA 4CADA 4HWEL 1U8HA 1U42A 1Q0XH 1IBGL 4LLVA 4BGLA 3EOBB 5AW3B 1PZ3A 3DWTA 3FRPG 3FCSB 5DK2A 2R0LH 4LSUL 4CDGC 2XG4A 5D1QB 2F54D 5B4MC 4ZO6A 5KN5B 3H3BC 3DHPA 1MW2A 2D7OA 4FNLH 4HLZH 4GQ9H 1NCOA 1OAQH 1FO0B 3NJVA 2Q5BA 3LXAA 3UZEA 2J8OA 4E9YA 1F6AB 2JCCB 1N6QL 3LKOB 2Y7NA 1YHPA 1OZTG 5KJ4A 3U7YH 4NP4L 3X12A 2WINB 3SDAB 5J4MA 3AVEA 3UEQA 3UYPA 4MJJA 2EVFA 4NFBA 1LP9A 2XOTA 2Z31B 3HKFA 2OX5A 1HCFX 1T89A 3KPOA 5DHYB 5I8CB 5E24E 1IZJA 1A6UL 1PD6A 2X6UA 3ELQA 4EIBA 3MKKA 3DUHA 4PJIB 5JIKA 1HSBA 2A4ZA 3PQYA 4N6RA 2WLMA 2AXWA 5I18H 3OKOA 1QR4A 4LAQL 2CBTA 2Y7LA 3CZUB 3T6ZA 5HVWA 1XF4B 2V9UA 3CBRA 1I9RL 3MRLA 3SIKA 1X6NA 1KBKA 4JZOA 5E9NA 5TDPB 3VG0L 5FB8A 4P2RE 2A9NL 2YAFA 2WTRB 4O58L 1BBJA 1SJEB 4OLZL 4WU5B 4A39A 4C83B 1KFGA 3UTTD 1QNZH 1XGQA 5IB2B 4A67A 3P11L 4OJYA 5ADOL 1FFPA 1O6SA 5DVNA 1WFNA 5IMMA 2R2HA 2ZXQA 4I77H 5I1IL 2AI0H 1KJ2L 2AV7A 2X5PA 3RP1A 3RKPA 3LPGA 4A6YL 5IJBC 1QNIA 5L9DH 5FM8A 3L3OC 5EF2A 2EDNA 3HI1A 3T3ME 1EBAA 1ZTXH 1CGUA 5D7LD 4Y19B 4GUOA 2NLJA 5KYYA 1VACB 2YUZA 3G5ZA 3KWWA 4OIBA 4P5KB 1JF1B 5IK3B 2X28A 4R96A 4WNQB 3TNMA 4B9KC 1OAZL 3O3BB 2J6EH 2EH8L 1WEJL 3GMLA 4OFIA 1CDCA 3IBOA 2QGEA 4GMSL 1ZXQA 3AT0A 1TNNA 2YLHA 1BZOA 1CL7H 4UOW0 1F4WH 3F58H 3ASOB 1Z3GL 3CVBA 3SB3A 1QHPA 3GRGA 5A2KH 1NKOA 3I9GL 4H13C 3KVQA 4LVOB 2VUYA 2NY7L 2Y25A 1AG6A 1U8MA 4YBHA 3IFOA 1AKPA 4AYGA 3C8DA 4AQ8C 4YPJA 5FM4A 2R0LL 5AVUB 2Q9OA 1TU2A 1BQ5A 3EOAB 4JN2A 2MNUA 2PF6A 2X9XA 3SQBA 4PY8J 4X6CE 5GQBA 3E38A 2AJVH 5L0QC 3RHWF 1OAQL 4F8LA 1D5XA 1L7IH 2HVJA 3NIFE 3ETBF 4XX1G 4ZMTA 3ABLB 2XBZA 4AL8C 5CF3A 2XWTB 3C5JA 1M57B 2AJZA 4F5CA 4S10A 3AWGA 4W9KC 5CBAA 3CVHH 2OS7A 1TLKA 1V3LA 1XR8B 4HOWA 3DDFA 3WO4C 2DYPD 4XAKE 3HR6A 2EKSB 1UXWA 1NLDH 3CLEH 4I48B 4K8RH 1QFUH 1ZT1A 4ZOAA 4G6JL 3EFDL 4Z7NF 4KVNH 1MCNA 2PR4L 4QPEA 3QHFH 1BYOA 1RHHA 2R0WL 2YKKA 4G5ZH 4NLAA 5FV2A 1RZKC 5C09B 1QFPA 2VL5A 5F9OH 3ARVA 4DN4L 1I1AA 3W82A 3C6LA 4H88H 2H4EA 1QZNA 5HVGB 4LBEA 4OJCA 5AYUH 5B21A 1INDH 4Y1AB 1YYMH 5JOEA 5IW6A 1MVYA 1E28B 4HIEB 4JFDA 3SJVD 2AHIA 1ZHNB 3RZCC 3BE1H 3K5SA 4U1IA 5E1HB 4ZK8A 3N1QC 4RA0C 4PJ7F 1TJMA 1WCBB 4H25A 2BOCB 3MI6A 3U1QA 5I17B 4Z0XB 4RGOH 2C7UA 2GK2A 3MOQA 1XGRA 3TTYA 4JJOA 4QOKE 3NSYA 3ZE0E 5IVZA 2XX0A 1E27A 3U4EB 3QJVB 3UERA 3HE7D 1KJMA 1TTGA 1G9MH 1KENH 3KLLA 2XYBA 3GZQA 4BSVB 2EO7A 3FRPB 3BQUC 3SGJA 3MGTB 2KT6A 3J8F7 3PPEA 2JF1A 2FATH 3T3PB 3IJ7A 1E3ZA 3ABKB 3G5WA 2CUMA 3QCUH 3LN5B 1CL7L 3UJJH 1W80A 5ETUA 3F58L 3MU3A 2VERN 4CC4C 3VDAA 2J44A 1OZUA 2PYEA 5IY5B 5J1AB 2YK1H 1RXLA 3SE8H 1SLVA 3WBDA 3DSNA 3D39B