2XYCA

Crystal structure of ncam2 igiv-fn3i
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
291
structure length
291
Chain Sequence
QPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPINISCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Model and Trans-Interaction of the Entire Ectodomain of the Olfactory Cell Adhesion Molecule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords NEURAL CELL ADHESION MOLECULE 2
total genus 64
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2010-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
A PF07679 I-set Immunoglobulin I-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xycA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xycA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xycA03
1L0YA 1OP3H 2VC2L 5FHBL 5HDQH 2NY5C 2ORBH 2ILLA 3DURA 4GG8A 2V2TA 1G6RH 4PRHE 4ETQA 2CPCA 2OK0L 1CDIA 1OTUD 3PHQA 1PDKA 3LS4H 1SVZA 3S88L 3LY6A 4WRLA 1SY6A 3RX7A 3VCLB 2YA2A 3BRDA 4O2EA 4KAQL 2FECI 1NGWB 1ZHLA 4XAKD 1N6QL 2EZ0C 2Y1VA 3HG1B 1N5AB 5F97E 4KAQH 5HHMB 3BYYA 4V1DA 1RJLB 5AZ2H 3VGEA 3UBXG 1KXQE 2C4FT 3M17B 4G6KL 5K9KA 5IVXA 2KZWA 4UT9L 2OL3A 1NFDE 3TCLB 2IBBA 3BPOB 4MDIA 2GFBA 5D5ME 3UBXI 5KVGL 3EHBC 4XXDB 4P46B 4JFOA 5FM8A 1B6DA 3VXNA 4U1LB 3ELAT 2EYTB 2RJMA 2C1PB 2I9LB 4W68A 3W39B 2ZCKL 3PGCB 4PR5B 4XH2A 5EA0L 3UEZA 5B8CB 1CS6A 4HZLB 2ICES 5DT1H 1MPAH 3VWJD 4GS7B 2OR9L 1F4HA 2J8OA 4LCIH 1ADQA 3TO2B 2HVKB 4Z7UB 3UTTD 5T33L 1KPRB 3QIUC 5DJ2A 3OKNB 3C60A 4RAUB 1UACL 1EX0A 1KXTB 1MLCB 3N1PC 3VXTA 3HAEB 5INCA 3GBLA 3RY4A 4XCNA 5KZCD 3VFSA 3BVNA 4I0PA 4WNQB 3S5LB 4ZPVA 4PG2C 4Z7WB 1ULVA 3VDBA 5L6YH 5EUOA 5J6HA 4ODTL 1KEGL 2ED9A 2C7UA 3KYOB 2XN9B 4TPRL 1Z2KA 1CDYA 1NSNL 5TDPA 5D6CB 5FYJL 3HNTH 4HUWB 4HKBA 5DF0A 2EDLA 4WFFE 1R5IA 3HE7A 1ORSA 5E70A 3PWLA 4QHUB 4S1QL 3ARGC 2VKXA 5TDNA 5TPWH 3MLYH 4OLXL 1KJ2B 3L9RB 4YXKH 5E2UH 4FFYL 3QPXH 1JZ7A 3MRBA 4TNWK 4EI5D 3F65A 1HH9B 1M6OB 5GSVB 5LAXA 1AGFB 7CGTA 2F5BL 1JGVH 5ICYB 2Q76A 1NFIA 1LEGB 4P5KA 3X14B 3BKYL 2AJUH 4IRSC 5DWUH 3RVTD 3S4SG 3FZUC 4IRZL 3GJFA 2A38A 1Q9KA 5DD1L 4MA8L 5I16A 4NDMA 3FQWA 5FGCB 3TM6A 1N5YL 2CH8A 3VXMD 2P8MB 5JPNB 5D7SL 4OM0H 3D0LA 3NIFF 3L3DA 1CXKA 4HIEB 4WW1B 2R0KL 2A74A 5I15H 1INDL 1DSFH 1IGYB 2AK4A 3KPMB 3SO3B 5BQ7A 1OTTD 2UWEE 1QHOA 3H9HB 4LAJH 3QI9C 1NMBL 4PBWD 1P6FA 3BP6A 3H3KA 3WS3B 2Z91B 4UT7L 1IGCH 5DEZA 1Q94A 4NQDD 4U1HA 2OJZH 4M6ML 5HI4D 4ZD3H 4MB4A 3VW3L 2HVJB 1KC5H 4JDZB 4ZXBC 3N1MC 1JWUA 1TJIL 4DVRL 3GRWH 4M8QB 5KVDL 3V8OA 3RIAF 1ZGLM 1QHPA 5TH2B 4WO4A 1S7RA 3RWFB 5LJYH 1Q9WA 3GNML 4PTTB 3ILQC 2B2XH 4Y19E 5IB1B 1S8DA 5D7LB 5B8CC 4G9FD 4UV7H 3T2NL 4Z8FL 4LVNB 4Z5RA 5DI8B 3QUYC 4QRPA 3RWGA 3RAJH 3E8UL 2VMFA 3BT2L 4QXTB 4PJHE 4MZ2A 3EGSB 3AB0B 1Y6MR 3RWJA 5FEBA 1X5FA 3BIKA 4PJ7F 3FAWA 3QR2A 3R8BB 2YXMA 3JBG7 1BFOA 4JFHD 3STLA 1RJZB 5IM7A 1F8TL 2FX8H 4FQXB 4KVCH 3GGWB 3BPCA 2UVFA 2XTLA 1BBDL 2HG5A 4YE4H 3ES6A 4DFIA 2HKHL 1S9WB 5D1ZD 1AD0B 2E6JA 2MQCA 4I2XB 2X4RA 4OF5A 3MV8D 3OPZL 3KPRA 3FB7A 3IDXL 4OZFA 4YK4B 3OJDB 4S0SD 1G7PA 5FKPB 3WNLA 2XG4A 1IAOB 2BY2A 2MCPL 1Y0LB 4GRWE 4CVZA 4JFFD 3S98A 4NT6A 2BXZA 5DZOA 2WINB 1K8DA 4PFEA 1FNSL 1U3JA 2AEPL 2CJUL 1UYWH 3RRQA 1MCSA 3DGGB 1WEJL 4NNXB 3DGGA 4P3DB 4XP5L 5KAQG 2P49B 4UBDC 1W0VB 3SKUD 2D31A 2WBJD 3UPRB 5MENA 4I13B 3A67L 4HIJB 3HC4L 4Y4FD 5CD5C 5GS0L 3Q48A 4YBLC 3PP3K 3L1OH 1X6LA 1JMXA 3ULVD 3O6KH 2Z92A 1SYSB 3PGFL 2D0FA 4UIKL 2XZAH 1JPFB 3VXUA 3S97C 4I0KA 2EEBA 4K2UH 1U8QB 1F6LL 1HCFX 3TYFB 3ET9F 4PJCB 3WFBL 4QRTB 5CZVH 2X40A 1KIRB 2PKDA 5H2BA 4G3YL 1J8KA 1VSCA 4HXBL 3VMNA 3C8KA 1ZK9A 5BCAA 1FVDA 5TE6H 2F8VA 2ITDA 4PP1C 4MDIB 4QRUB 3F6LA 4OFYD 5HHQB 1S5HB 4M7JL 5H35B 4MS8C 5K9KB 4I9WD 4L3ED 2HLFC 4I3GA 4F9PA 2VZTA 4X80H 2IALA 3BE1H 3T2OA 2FWOA 1EHNA 4CVZB 1HHKB 3PJSB 4JKPL 3VRJA 4NZJA 1PZ5B 1YA5A 5DD5H 4ENEC 1G7PB 2VUOA 4ZFGL 4NJAH 5TF1L 5HD8D 2AEIT 5C6TH 1UXSA 1WZMA 5DJDB 4B41A 5JNYA 3HMXA 4U1NB 3D39D 4JANA 4MA3B 4PGDB 1INQB 2P5ED 3TNMB 4RSVA 1ACYL 3QNZA 3RZCB 5D96C 1URLA 3CFJB 3SE8H 4HKJB 1Q9LB 2VDKH 1YZZA 3EDJA 1V5JA 5ILTH 1YUHA 4KMTH 1DFBL 2VDML 4XAWH 5E24E 1ACZA 3IU4H 1T20A 3CSPA 4IMKC 1R3LA 4MJ4A 4TVSa 2GT9B 2D9CA 2FX9H 5IBLC 5C09A 4F9LC 3OAUH 4JM2B 1REIA 1YMHA 3BXNA 4RFEA 3Q5YA 4PJ8C 1G7QA 3U30C 1QUNA 2BVOA 2Y5TB 4KV5F 3RPIB 1MWAA 5EIIB 3BI9X 3H0TB 4Z6AT 4CJ0A 1EXUB 4Q6IC 5D1XC 4J8RA 2R4SH 4PJIA 4DVBB 4OD1H 5GSVA 5DFTA 4KJWC 1Q94B 5C70A 1J18A 4NQXB 4WW2A 1QSZA 3OKKB 3N06B 3O0RH 5I75C 4K7PX 3O6MH 4R96A 5F8RC 4X6FA 4Q9BA 1GC1H 5L2KD 4D9LL 1U95A 2DB8A 4J3SA 1M7DA 3V6FA 4NO5B 3QHFL 3QQ4B 2ZKHL 5C0JA 1NAMH 1ORQB 3SDAC 2Y25A 2KH2B 1EAJA 3UYPA 2RQ8A 3V0WH 1IQWL 4YZFE 1NGPH 4IS6A 4Y8DC 4ZUUB 2P5WA 1A02N 3RQ3A 4MXQD 5HYSA 4J4PD 1KENL 4OZIA 5C86A 3WJJC 4M6NL 4JB9L 4MDJB 5I66A 1OARL 3S3SA 3C6LB 4YR6A 2AAVA 5SWSD 3P0VH 1F3DJ 3NAAH 2FLBT 5IVZA 2V2XB 4HS3A 1U8PA 3D3VD 3D48R 4KKCC 4U6VL 4NYLB 3RVVD 4WTZA 1RZFH 2MOVA 1GVIA 1BF8A 5DFVD 3PABB 4OUUA 4ZFZB 1VACB 2E8ZA 2J5LB 3MV7B 3MNVB 4NN6C 1KF9B 2V5MA 5DHVA 5DFWH 4W81A 3BRGC 1GC1L 4F33B 3EDDA 5CS7A 4W4OC 3OG4B 4UOJA 1QSFB 3OKMA 5GRJH 5FCUH 5I0DA 3S36H 1BOGA 3CVIH 5EUOB 1L7IL 3OL2A 5IWLC 3MZGB 3V0VB 5CEXB 1UJ3B 2VDNL 4U1MA 2X09A 1R3IL 4P2RB 3GSWB 4IDJH 4QHLA 5ADOL 3FQNB 4IJ3B 2I07A 1WT5C 5BOZG 4NRXA 1C7TA 5H37H 1NBZA 5D70H 2FR4B 5C2BH 5KVFL 4J4PC 1MCOH 2NCMA 3SCMC 2ICEA 4UINH 2BVPB 2OR8A 1KTDA 3UJTH 3ILPB 4PRHB 3ULVH 4PJAF 1DLHB 4NQED 1RFDH 4XNXH 1CXFA 1A6VL 4QT5A 5HHOE 3BP7B 2Q86B 2FX9L 4HZLA 4QHNA 5DS8B 4XH2B 3U7YL 3U4EB 4C56B 2X4UB 5F7KC 4XAWL 2HJLB 2R0WH 4L1DA 2ZUTA 5JPMA 4PJDF 3C5SB 1KNOB 3CXHK 4P5TA 4R4FL 4GBXB 4LLVB 1IFHH 3NCJL 1TTFA 4D3CL 4MMZC 1RHHB 2HWZH 5IEKB 5IEKA 1P53A 2IPUG 1B2WL 5D1XB 4ZAKA 4N1HB 3KPTA 1L6XA 3VFOA 4N8VB 3P73B 1IEBB 2ADIB 1F13A 2SEBA 4CADA 1CYGA 2V5TA 4UOW0 4WFGE 1KIRA 4KK9C 1UQSB 4OGXL 5DD5L 2YKLH 1TETH 4OT1H 3ZKXB 3K2UL 3LPGA 2VXVL 5BZDA 2BC4A 2W92A 8CGTA 1H3UA 5AG9A 4ZSOE 3HG1E 4O2CA 1RJYB 4AQOA 3SCMD 2BVQB 4ETQB 5KN5B 3SKNB 2DRUA 1T0NB 3UTPD 4JZOA 3ZKSD 1UM4L 2AVGA 3T0EC 4NJ9H 1PKQE 2WUCH 4P3DA 4JM4L 4QF1A 4GRLA 3MLXL 3E2HB 4LGPB 1A6WH 4HXBH 3RWCA 3KWWA 1HOCA 1R5WB 1ZLWK 1FYTE 1JZ4A 2DLFL 1SMOA 4GW1B 1IKFL 2ZSVB 1LO2L 2AI0L 3VFOB 5EC1B 4R2GD 3MPCA 4RFNB 2CK0H 3P9LB 1QACA 4IHOA 4OLWH 1N0XL 4C56E 3QXDB 4FQJL 5JHDD 5IF0B 3KXFB 4Q9CA 3GSOB 5ELIA 1FO0B 4LLVA 1PKQA 2OJEB 1KCUH 2EE2A 1BX2A 3L1OL 4GW4A 3QUMH 2MMXA 3EJJX 4KDWA 2R1WB 2H3NB 1GJIA 4NHUA 1WLHA 1AGBB 3WHE1 4Q9QL 4XP5H 2IQAB 3ARFD 4Z95L 2FLRT 5K9JH 1PG7H 1ROWA 3GSRB 2YD5A 4BK5A 3MA7B 4GKNA 3D18B 1WITA 5JW4M 1DTUA 5HHXH 4OV5B 5IJVA 2YZ8A 3IDYC 3BYTA 3P0YL 4J6RL 4K9EC 4XNYL 3S4SA 1WBYB 1NBZB 2FR4A 2VAAB 1LQSR 1RU9H 3SDDC 4LP4A 3IFLH 5F9AC 5DRWB 1MCCA 3LRGA 3NFPA 4K3HA 3OZ9H 3DRTA 3SE9L 1NFDA 5CP7A 3SCMB 5JOEA 4LVHC 4P4RA 5DJYB 5C0BE 3LHPL 3E8UH 2WIIA 5KJRH 4Q74A 2VZ3A 3UAJD 1YMME 2K3TA 3OF6A 4KTEH 3SDXB 1FNFA 4PRNA 3H9HA 3S9DB 3IETA 2AJ3B 3IYLW 4RDQF 1R6VA 4JHWH 1RMFL 2JJWA 5ADPH 4HIEA 1QRNB 2A83B 4WW1A 1BM3H 1LO5B 3DUSA 5KSVA 2PXYC 2OMNA 4ZUWB 1AKJA 5J12B 3BPNB 5KSAD 2FJFA 1A7OL 4X83A 1BM3L 4XCEA 4HJJL 2BVYA 1IAKB 2YD2A 1JHKH 5IK3A 3UTSD 5F7FA 2W9DL 2BVEA 1NGYA 1WBYA 3B9KC 4ZD3L 1CZ8L 1T6WA 3WIHA 2D4FA 1BP3B 2HH0L 5F21B 1IGCL 3ZHDA 1JYXA 2Q6WA 5JR1H 5IQ9A 1C5CL 1UZ6E 1D5IL 1F6FB 5BVPL 3TA3B 1DBJH 5I1LB 1VFUA 2KKQA 4OD2A 1JZ3A 2PW2B 3GI9H 1CDHA 1XF1A 3L5XH 4H26A 3VFWB 3MRBB 4PD4J 6CGTA 5IMOB 4KTYA 1M7IB 1KPUA 2EYRB 4UILH 3GKWL 2ZG3A 4EN3A 1AY1H 4N0CC 4XNUL 3T3PE 3HFML 4XVUD 4ODWA 4R0LA 3P9LA 1A1NA 1YYMH 1IBGH 3H6JA 5EC1A 1D5BB 1A1OB 3FONA 5F1IA 3T08A 3QDMB 4JRYB 2UVEA 1JV5A 3C5ZD 1F6AA 4TUOB 3HN3A 4HK3N 4ZAKD 2PYFA 4Z95H 1AP2A 4HFUL 4TTDC 3QNXB 1YQVH 4HLZH 1ND0A 4JZOB 5E2UL 3BP5A 2HA1A 4D9RD 1FFOA 3L95B 1G7QB 3G6AB 3MXVH 2K7PA 3HUJA 1YQVL 1FVDB 1S7TB 3ARZA 4HUVB 3TO4D 4HFUH 3GMNA 1U8OA 4X9IA 1OL0A 3QDHA 1A21A 1T2JA 5T5NF 3KPRE 3QUXC 1FVCB 4LSUH 4MVBD 3QA3B 1X4ZA 1FFRA 3HPLB 2X4PA 1IMHC 4OUOA 3U4BL 1EV2E 1YPZB 1SJVA 1WZ1H 1GGYA 1ZLWH 2GITA 4NGHL 3O8XA 4JM4H 3DO7B 3P73A 3QH3A 3TBSB 4HX1A 3OAYK 3H9ZA 3AMLA 3LRSB 4Q6IA 3SDXF 5AYUL 1UM6H 4RGMC 3RU8H 3T4YB 4L5FH 3L5XL 4J3OC 2NXZC 2QR0A 1GGCL 2R2EA 3ARVA 3CFIC 1FVEB 3TZVB 5E0QA 3QYCA 5DDHB 1DUZA 3IFNL 2YUZA 4P4KD 4QRQB 3SGKC 2PR4H 4OZGA 1KLGA 4WCYL 4I4WA 1TETL 1ZT1B 2R2BA 2B4CC 5DZNA 2HH0H 4TYUA 4BKLB 4KHTH 2X9WA 3F6IA 1NGWA 1ZHLB 4I2XA 2VR9A 1GGUA 4ESKA 1UWXK 2X1WL 1S5HA 3TIDA 4YJZL 1RV6X 3OR6A 4OLYL 1S7WB 2ZZUT 4GLRI 4CU6A 3DO7A 3TFKD 1BFOB 1IZKA 4OAWB 3DURB 4JFZH 4JHWL 1DUYB 3MRDA 4HQQH 4DKAA 2W0FB 4G5ZL 2OTWB 1JTOA 4MXVE 2YPKB 4FXKA 4LLYB 5E4EB 3VWJC 3PWPA 3AGVA 3RPKA 5MEND 3BPOC 4LARL 4OIBA 4ONHA 4XCYA 2FX7H 3VXUB 3X11A 4F33A 4RISH 1AC6A 1TNNA 3MV7A 4ELMA 3QIWD 3W0WE 1KELH 2Q8BL 2ZCHH 4PB9L 4PGZA 5GGSA 2IGFH 3NTCH 2ZP0T 4DEPC 5FYLH 5ID0A 1YJDH 1G9MC 1W0VA 2H2SC 3UPRA 3ARBD 3GMQB 5I8EA 2F15A 2H26B 1J0HA 1G6RL 3OKEB 4IDJL 2R9HD 4NUGL 1TVBB 3W11D 2XKSA 2IANE 1R3IH 4U1KA 1U6AH 1ZLSL 5C08B 4DGIL 4CUCA 2PXYD 3NN8A 3MCG1 1G0YR 4LLMB 5FHBH 2XNAA 3LKOB 1PQZA 3BP6B 3CVIL 3WS3A 1RURH 3VI3E 1KB9K 3QCVH 3CUPA 2HKFH 2OSLB 4I77H 5DQDH 5HYSB 2JF1A 3BZDA 2ADJA 3BRFA 1MJJA 3SKOA 4YAQA 2O5ZL 5JXED 4NKDB 1E4KC 4UT6H 4MAYA 4HBCH 4AMKL 3V0AC 4GRLD 4DK3A 2FSEB 1K4CA 1HH6B 1VGKB 3U0PB 2YD1A 5IESL 4F7PA 2P5WE 3T1FA 3LDBC 4X5LA 1ZGLP 1CR9H 3MRPB 4BFBD 3N1GC 5K93A 3QQ4A 3CVHB 3DETD 2Q3ZA 3G6DH 4JKKA 2HT4D 3HC0A 1J9CT 1G7MA 4M9PA 1U95B 2WAHA 2AKRA 2BHYA 1AI1L 1LO2H 5FAAA 1FSKB 3JUZA 1XIWB 1F58L 1M7XA 2O61B 5DHYB 4K7PL 2V9QA 5SWSE 2IBZX 3O2DH 5K9OB 4FMKA 1AGFA 3GMPA 1NEZA 4P5TC 3SJVA 2F54D 4I18A 4XCEB 2N56A 5L9DL 5JXAH 1WFNA 2BRQA 1DEEB 1EDQA 1NGPL 5KSVB 4F2MA 3GJFH 1VEOA 5F93C 2AJSH 4LP5A 1H15B 1QNZH 3H0TA 3EOAA 3KJ6H 2ZKHH 2DYPB 4EI6A 3TWCH 4LLDB 3NFSH 3H9SA 4HKBB 1EEYB 1YMHB 3SGDI 4ORZC 4HIHB 4J3WA 2QSQA 5IROA 2XRAH 2NY0C 1JGLL 1I1AC 3BH9B 4L4VB 2DQUL 1U91A 3WJLA 3MV7E 4TSCH 2DQCH 1EBPA 4P46D 4Y5VA 1X4XA 5E5UB 4LRNL 1B88A 3V4VH 3ARWA 5KANG 4NQEA 4Q97A 4ODXB 5TQ2H 3FOMB 5INCB 3RP1A 5DRWA 1SY6L 5HYQB 1DBML 5J1TC 2CRMA 5CJQH 3O9WC 1T1YA 4GMSH 3TGXA 3VFPB 2P8PB 4YPGB 3THMH 4ELKA 5BRZE 1T5WB 2HVKA 3MBXH 4J12A 4MQXC 2QADD 5A2JH 4EDWL 2EE6A 4UQ3A 5D7JB 2VABB 2CKBL 1EJOL 4MCYA 4ODVL 4NHUB 5GS0C 4UUJA 1TMCB 3THML 2YUVA 3AS2A 2NX5B 3OKDB 1NAKH 1DN0B 2EO9A 2G60L 1QKZH 4JLRB 4EKXA 2EC8A 5CJQL 3BEVA 4K3JL 4FTVE 5IEHA 5HHQA 5LG1A 4YLQT 1BVZA 4FZ8H 2JB6B 1PLGL 2HFFB 2KQMA 1I3VA 3F7YA 5MHSE 4UAOB 2JK5A 4POYA 4GXVL 1OWRM 1KSRA 4KDTC 1P4LB 3AS1A 3CPLA 1WCBB 3O3UN 4LBEA 1HOCB 1R5WA 3P4MB 5I1KL 1Q0YH 2IQ9H 5I18H 3EOTH 4LDOB 3F7VB 3QEHB 2EECA 1FZJA 2V6HA 1G7HB 2GW5A 2VLLA 4F3FA 4OBRA 4G8IB 4KGLA 5DVKA 3EFFA 4KC3B 5DK2B 4PJXA 2IPUK 1KB9J 2PN5A 3ARQA 3UTPE 5TF0A 4RAUA 2NZ9C 3EFFB 5F9DC 5GJTL 4ORGB 2VLLB 2N1KA 4YBHA 3VDCA 2EDQA 5E7FA 1DVFD 2NYYC 4WDIA 3S5LG 5IOPA 3BZ4B 3VFTB 1D9KA 1RK1B 1NAMA 4KKBD 4XC3L 3QAZC 5F6HI 2P24B 4PG9A 2W9EL 1A64A 1HHIB 5I1IH 2ADIA 2QADB 2HFGH 1I8KB 4Q7DA 3SN6N 5C9JB 5CSGA 5MP6L 3GMMB 3RWDB 4NC0B 2PXYA 2BFVH 3HCVA 3HNSL 2PYEB 2HG5B 5DMGD 5AYQA 3KNBB 5E8NA 1IAIM 1KNOA 4UT6L 4YDLC 2NMSA 3V79C 4Y19A 5DS8A 3ARGB 2V7NA 4X7DC 5F7EL 4BJLA 3U2SA 1XF2B 1P5UA 1M71B 2VR5A 4LNVA 1ZLVK 4MQTB 5D93B 2CMRL 4MD4B 1NUDA 4O2EB 4OFIA 1TIUA 1QQDA 2ZG2A 5FYJU 5LXGL 2EDXA 3MV8E 5KTEL 4WV1C 1S8DB 1A6UH 4JRXD 1RZIA 1P7KA 1IGIH 4M1CC 1MREH 2X4SB 1DQDH 4PV8A 3VXQA 4Z7VB 5EO9B 3PWJA 2B1HH 5B22A 5EN2A 3NTCL 2DMKA 4P59L 1J0YA 1OGAE 3PWVA 4MNQA 5JIIA 2FHCA 2LABA 1BQHB 2JCCB 3MUHL 5EWIL 2CGRL 1J8HE 4FQXC 1MFCL 2Z91A 3BPNC 4BZYA 1LEIB 5IJKA 3LD8B 4PUBH 3IGAA 3QFJA 1G7LA 3AM8C 4O5LH 5JHDE 5DK3A 1AXIB 5IG7B 2BJMH 5HYSG 4UMGA 2VZSA 5ILTL 3EOAB 2HJKA 3PQYE 3L3IB 4KVNL 4OI9A 3QEQB 5C0EA 1EVTC 1BJ1H 3G6JB 4NQCB 4WI6A 4L8SB 4ZSOA 1QFUL 3CFDA 3MLVH 3UTSE 5KVDH 2UZYB 5CMAB 4ZG1A 1VPOH 1EH9A 4HGMA 4XNZC 4Y7MA 2FDBP 4GKZB 3NCMA 2H6PB 5I1JL 4OF0A 3L3KA 4APQB 3FO9B 1SJXA 3L7FA 1F97A 3NGBB 5FFLA 4ZDHB 1NFIB 1S7VB 4NO2B 1VADB 4UAOC 4KY1H 5C0RH 3GSVA 3FFDA 5H37G 3CFEA 2DIBA 3QUYB 4ZFOL 4WWKB 1HK6A 5D7LE 3JUYA 3RWEA 3RI5K 5C0JB 1GH7A 5JA8B 2VUYA 5AYUH 3RZWA 1EO7A 4HMCA 4Q9RL 4GKSA 3UPAA 5C07B 3D69A 4PV9B 4XXCA 1G1CA 4NGHH 3QFDB 1IT9L 1JF1A 3KPPB 1IQDA 5TDPB 4Y4HC 5SWQA 4NQXA 3WFBH 4LU5H 5FOJA 1QRKA 4KJWD 3TNNB 3LAFA 5DZLA 5FUZL 1ADQH 1B0GA 3QDGA 4M1GH 3I02A 1RIUH 2QQQA 2F5BH 3O6LH 1BZ9B 1GL4B 2VDLH 1IE5A 1KJVA 1T2QL 3MLUL 2VDQL 3PGFH 4D9RE 4MD5B 5LBSH 1B90A 2BVOB 3OHXA 2Y5TA 2DQFB 2AK4D 2EDRA 5DC9B 4TULL 4GRWB 4TTGA 4CN1A 3VD4A 1FJ1B 4YFEA 4D9QE 3C60B 3VA2C 1MLBB 4M7ZB 5DLMH 5EU6E 4HFWB 5DD3L 1PEZA 1FRGH 1UM5H 2H8PB 5FYJH 4PRIE 1NSNH 5FKAB 4UB0H 5E8PB 1DQTA 4JFFE 3QHTC 4OZHF 4CKVX 3OPZH 5F7MC 3WXWH 4XX1E 5HDOA 1OT1A 4O9HL 5GGQL 2C1PA 1FDLH 1FSKC 1JRHI 1X5KA 4P4KA 4PJAE 4NFDA 3T65B 3LEXB 4HLZG 4JREC 3T8XB 3QUYD 4AL8L 4ODSL 5KSAA 1UJ3C 4OZGE 1JWSB 3BMVA 1P7QD 4NM8H 5GRWA 4E9LA 2KZ1B 3KHOA 1G6RA 4K3DH 5AUMB 5IMMA 1SJEB 1AO7E 5I19H 4XVSL 3Q5OA 2X9XA 4LCWB 3MGTB 2LAGB 1C5CH 4E5XA 2FWOB 1HHHB 3LD8C 2DLHA 3P9WB 1YEGL 3HS0A 5AUMA 4ALAH 4M62L 5C0CD 2HMID 4FA8A 3C5ZC 3L3GA 3GNMH 3UAJC 1NC4A 3TIEB 5EORH 1JHKL 3VWJB 4KJQC 4NRZA 1MIEH 1K3IA 1CFVL 5MEPA 1KYOK 2NY4D 1MCHA 1NCBH 3VFVB 3TJHC 4ETYA 3D0VB 3TP4A 5F96L 1W0YT 4NRYB 4OSUL 3VW3H 3N1FC 2MKWA 5L2KB 1FFNA 5GS1B 5L2JB 1MNUL 3EO1A 3WLWC 5E8PA 3HI5H 5ICZB 5AD0B 4L9LB 5F72S 1NUGA 1U8OB 3I50L 2HAZA 1P5VA 2BX5A 5HPMB 1AGEB 3OX8B 1NCAL 1NMAL 3FB8B 4GW5B 3RHWK 3F12B 3RGVD 3ARDA 3DROA 3N9GH 4S2SA 4WFEE 1IGTA 2XICA 4LDLB 5BS0D 2OBGA 3V52L 4FN0A 3OKYA 2JKXA 1N2RA 5ENWB 3HUJE 4KJYA 4J3VA 4PBVC 4PJIF 1ZA3A 4JRYA 5F6IB 1KCSL 3E3QC 1U2CA 2XZZA 3QJHB 3UJIH 5DHXB 3ZMRA 2YPVL 3SPVB 2X70B 4LCWD 2X89D 3HKFA 2NY6C 3FQTB 4FFYH 1Q0XH 4ZFOB 1JNLL 2X4OB 32C2A 3BO8A 3OXSA 4FTVB 1DBAL 2Z93A 3S96A 3H7BB 4GRWF 3FFDB 4XBGA 1MJ8H 4HS6A 2JE8A 2FEDD 2CK0L 3QXVA 2VITB 4WUKL 1GOFA 4LVEA 2AI0H 4Z5RB 3T0ED 8FABA 2FIKB 3FFCB 4IJ3C 5EBWA 4YHOH 5HGBB 2XACC 1RY7B 1BFVL 2YPLD 1AHWB 4KPHH 4OQTH 1Y18B 4X5WB 5T1DL 1I9EA 3JWOH 3O45A 4NQCA 1CLZL 1I1AB 4XTRC 3WIHH 2YMXL 3SDYL 1YC7A 1E28B 1ZVHA 4Y16D 1W0WA 2QHRL 4N1CA 5KS9F 4AT6B 5IKCA 1SYVA 2AJ3A 2H2SD 5T33H 4XC1L 4NO3A 4PJIE 4Z76A 1XMWA 1UWGH 4X6DE 4QLRA 4YDJA 4JPKH 1OGTB 3C5JB 4Y4KD 5CBEA 4ODHH 2JCCA 1CFTA 2QQLH 1C08B 4L8BB 4CBPA 3VRLE 1RK0B 3PWVB 4X0KB 1JJUA 4NC2B 1N4XL 3G08B 1CU4L 3EZJB 1A3RH 2CQVA 5JW5A 2R4RL 4OCXH 5IHUL 5EU7C 3O9WB 4XWGL 1FFPA 2PCPB 1T1XA 2YR3A 4U3HA 5FO7A 4UDUB 3NCJH 5C0CA 2IH3B 5EOCL 5B39G 4G6KH 2X4TB 4CL7A 5GJSL 1G9NH 5CLTA 2D7TL 1OAZL 2WWKT 3CMOL 3MRCB 3U9PL 3BX7C 3N50A 4U49A 1TVHB 3K1DA 4U7KA 3T77B 3GM0A 3KJ4C 5IW1B 2F5AH 5KW9L 3FN0L 5F7DB 5LCVL 4ZOAA 5IB2A 3V4PH 1NC2D 2EKJA 2H41A 4JN1H 1KJ2A 2XZCL 1FCCA 3RUGF 2VR4A 3VXSD 1MCIA 4L4TE 3S88H 2VZ1A 3ZKNC 2AJZA 1F4WL 4QO1A 4G8EA 3KPQB 4TVPH 5FDWA 1AGCA 4XI5D 2W91A 2AJXL 4QRSA 3IJHB 5JUEL 3CXDL 3UP1A 2IBGA 4L4TB 3U9UA 3S36L 5F7UA 5FCUL 1DQML 3KDMB 35C8H 3TN0C 4OLZH 2APXA 1BD2A 2O5XH 2V9TA 4WV1A 2CDEA 3H2WA 3KYMA 4X7SL 4E0RB 4ORGA 2HFEA 1II4E 3V7AE 4N0FA 2VNCA 4P2OB 5HVWA 2F19H 4UIMA 3HI1B 1K5NB 3TVMD 1INEL 2Z31B 1TZGL 5D2LE 5FV2A 1RJYA 3AY4A 3KR3L 1CL7H 2A6IA 4OLUL 5SX4H 2XA3A 3NAAL 3MR9B 3O9WD 2G2RA 5GRYA 3TPUA 1OF2B 4FFZH 3LS5L 2ARJQ 4OJFL 4E42B 3L5WB 3DETC 1OLZA 1JMZA 3ARSA 4RGNB 2AV1A 4EQ2A 3FQXA 4L29B 1D5MB 4JPWL 1JBJA 1QFHA 4WO4D 3RDTA 1GPOH 3FO0L 4FRWA 5E7BA 4JO1L 5MERB 2M26A 4YDJB 5EZIH 3V0WL 3PXJA 3V6OE 3F58H 4XI5C 2LTQC 2Z9TA 3BH8B 4NSKA 4FNLL 3DARA 3DECA 5HGHA 1PZUB 3VXSB 4YQXH 1ZS8B 2DWEB 4LCCC 3IRZA 4MCYB 2BOBB 2JIXB 1F3JA 2Q7YA 1QR1B 5DMJB 3V95A 4HUUA 2LU7A 5BO1L 2A73B 4WHTA 4I3SH 1K9TA 3PDDA 3SO3C 1NJ9B 4L4TD 2R0LL 2ICEB 1HSBB 2X44D 4LLQB 3OGCA 2DWDB 1TENA 3LQAC 3VXME 4Z0BH 2HT4C 4JM2D 4YWGL 3GSWA 4N9GA 5CJ8A 1BIIA 2DLTA 3HLAA 4XPTH 4MQ7A 3JTTB 4NHCL 3MRRA 4X5XB 2UWEB 3QIUD 1CF8L 3K3QA 4K94C 5E1AA 3WFHB 1J8HA 2P7TA 3E6FB 2FGWL 4E41E 3TVMB 3RX5A 5L0QB 3EO9H 2XWTA 2XTJC 1HQRB 2R69H 2RAMA 3T4AB 4DW2L 2EIZA 3FB6B 3HZMA 1A6AA 4KHXL 3ZYJA 3GSUA 4KRPB 5ESAA 3ZKMD 1UA6L 3IFOB 4YFLF 4KROC 1WBXB 4M8VA 5ALCH 5DJ6A 1K85A 3DSNA 1S7XA 4OD3L 4WEUD 5JQHC 4KV5E 1MQ8A 4WEBL 1X9QA 5GS2H 1FLRH 5K33A 4U05A 5DTFB 1E4WH 5HI3C 1VEMA 5E8EA 4QCIB 2JJTC 3PIQB 5GS0D 2QHLA 2B5IB 4NWTH 3MSPA 2ED7A 5ERWB 1YMMB 1AXSB 4R4BA 3DNKA 5JHLL 4RQQB 3C5ZB 3BUYA 2XTJB 4DN3H 2OM5A 1PW3A 1XF4A 1KGCD 4ZQKA 2W60B 3W9DB 2P48B 1S5IH 5DUPH 4YO0B 3DROB 4S2SB 1DQJA 1I3UA 3F5WA 3IDNB 4LPCA 1DZBA 5GISH 2C3VA 3IKCA 3BD4A 3FB8A 3KPSA 4JKPH 2F58L 3MRJA 5F44A 2NY5L 4WUUB 5A2KH 5CINH 4PJGB 4RMVA 5BVJA 4GAFB 4XP1H 3BAEH 3CSYB 4DKDC 4JFHE 4ZUTB 1J1OH 4MMXC 5D1ZB 5CP3H 3MCKA 1VGKA 2R29H 2AGJL 2FSEA 4M48L 4IRJA 4PGCA 3RGVA 3I6KB 1HI6A 1K2DB 3JV6A 3QG6B 2EH7H 3MLSL 1YEEL 4FQQB 1CGSL 2XKUA 5GGTH 3FB5A 3RWIB 3HNVH 4MHHG 1OAQH 4G3YH 5MEPB 2AK1L 1T89C 3MLRL 4X8XA 5HHPB 2F74B 2C3XA 3O2VL 1OTTC 4AEIH 2F53A 5E2VH 3CFBB 4XP6H 1IC5H 4Y4FB 5HHVL 5J9PB 5C0GA 4G8GD 3SOBL 2XA8H 2BCKB 1YC8A 3WO4C 2B4CL 1AQDB 3IDJB 4O02H 4CNIA 3GMRA 3PDOA 1NUFA 4GSDH 4ZTOL 1MVFA 3ESUF 5DD0H 3RTQD 1CFNB 2RFXB 3MOQA 3WKML 1HDMA 2CUHA 1PX4A 4FFVD 4PGBA 1RZJC 1YMMD 1SBBA 3WFDL 4XGZA 2XZQH 3DVNB 4G8GE 1DQLH 5DA0B 4DTGL 4MAUH 2GJZA 4G7YL 1PX3A 2E27L 1A1MA 4D94A 4I48A 2IAMA 1D5XB 1NCWL 3UROR 4F9PC 3GI8L 2H32B 3V5KA 1UB6B 3MRKA 4YE4L 4F8TA 1ZVSA 4WUUD 1MHPH 1NLDL 4F8QA 2ATKA 1ZHBA 3KLHD 4NCDA 4U1NA 2DD8L 4JAMB 3U79A 1MCBA 3W5MA 4LVHB 1CDJA 4AIXA 1YNKH 4YFDB 5C2UB 5HBBA 1A7PH 2R2HB 1CG9A 4GRMA 1FFQA 1FZMB 1CDGA 4HZAA 4DEPB 3U7WH 5T3ZD 1X5XA 1R24A 4QRQA 2JJVA 4KKCD 3V6ZA 1LILA 3RZCD 1KTKE 3QXAA 3UBXA 5GGVY 1OSZB 1QR4A 4XP9H 2A6DB 3WJLC 2HJFB 3FO1A 4PRBB 5SWZE 4TVPD 2DQEL 4CU8A 5CJBA 4IOIB 4K9EL 4DGVH 5LQBH 3VXUE 2GITB 1JUFB 1WAAA 2JJSC 3RHWF 5L8JB 3QO0B 1U8LB 3LB6D 1T21B 2QL1A 2YBRB 4A2LA 1NCDL 3W0WB 2E3VA 4N5EC 6FABH 5FK9A 5D6DA 3K0WA 2B1AL 4PJ7B 5AZEL 4QWWC 4MQXD 3FL7A 3QRGH 3AMKA 1UADC 2E6PA 1S3KH 2MQ3A 3UPCA 4WU7B 3TO4C 4PJHA 4HK3J 3VI4F 3TBTA 4BFGA 3FT2A 4IOFC 5GSRA 3KPSD 4OTXL 3SGEH 2WBKA 1JHTA 5JW4N 1KIQA 4JFQB 3QNXA 4LSTH 3IAPA 4R3SB 3WFEL 3E1F1 2NY7H 5FOBB 1EZVX 1F6AB 3T1WA 4OIIH 5ANMB 1QFWI 2EZ0D 5F1IB 5F70A 4RRPG 5TE7L 4HAGA 4ZFFB 4G80B 1FBIL 4JZNB 5L2KE 1MRFL 4HHAA 3IGAB 3BFOA 3O3EB 1LO3H 3AAZB 3ES6B 4YHMH 2DYPD 5EO0B 2XWBB 2CSPA 2J8UF 4YXKL 3Q6GL 3WUWB 3LB6C 1RVFL 4DUXA 4LLUB 1F90L 3D9AL 3TVMA 3S36X 4O02L 1B4JH 1JWMB 15C8L 1R3KA 4F37F 3IJSB 3MRRB 1P4BL 1FZKA 3WKNA 3C6LD 3GM8A 1CT8B 3PP4H 4Q0XH 3VXQB 1N3NA 1ZA6A 4XBPA 4NNPH 4NQEE 2ZWLT 1TCRB 1NL0H 4X6DF 2ADGB 4KI1A 5CWSA 3FO2A 4ZO8A 5LWYL 1WISA 1MQKL 3L5HA 1QYGL 3IKKA 4NKIH 5D7JC 5E2TH 1QRNA 2A83A 2ZUQB 4P9HH 2XOTA 4S1DC 4XMLH 1V7ML 1LD9B 4OGAD 5D2NC 5FA4A 4Y4HD 1U58B 1L9NA 2Q8AH 2ESVD 5EH1A 4Z78A 4J3UA 2FJGB 1JZ8A 3ORJA 2A6JB 4AEEA 1PYWA 4NZTH 5GS1C 1ZHKA 4BFIB 4GG6B 4H20H 2I24N 3GMMA 1MPAL 1IEAA 3QEUA 4KUZH 5HYJA 5C9JA 3AXLB 5ICXA 1QBLL 1XF5A 4HWUA 1YN6B 2OTUA 2VXUH 3QIUA 4OZ4B 1AR1D 5GRVL 3W11C 2BSTA 1A3QA 5BRZB 5B39B 4BSWB 5FUOL 5D7KE 3TA3D 3BDXA 4MCZB 1UZ8B 1A4JB 5TFSH 1MWAH 5D5MB 4GAGH 5CJOL 5KBNC 2GKIA 1HSAA 5E8OB 1DP0A 4OCYH 2VDOL 1H5BC 4YPJA 3IDMA 4FABH 4POZC 1K4DA 1P4IH 4XMPH 2F9BT 5D7IE 1VB9A 3MV01 1XGQB 5HHNA 5LGHH 5GGVL 3HE7D 3V4UH 4ZOCA 2MSPA 5EPMA 1IC7H 3STZB 3LQAH 2UYLB 3QO1A 4P2QA 3FTGB 1RUMH 4NQSB 5DURD 1T5XA 3LZFL 3BDYH 2X1PA 1RUQL 2CDEB 3BQUD 1HQ4B 4JRYD 3S37X 4ZO9A 3HMXL 2A9NH 4ZS6C 2FL5B 2CIIB 2WUBL 2DL2A 1UVQB 4DKFL 4X99B 2XKNB 1A6PA 5TE4L 2ATPA 2C3GA 4XPBL 2YEZB 4PJDA 1B0RB 4FQHA 4R26L 3QSKB 1PJ9A 4QXGL 3TBYB 5HDQL 1HKLL 2CUMA 3TBVB 5BOPA 5C7XH 1ZHNB 1UH2A 3S37L 1A7NL 1OB1B 12E8L 4X99A 1Z3GL 3BKML 2P42B 3U0WH 1QEWB 3TO4A 4CDHA 4X6EA 3SDXE 4UV4L 3IXTA 1IGMH 1Q72H 4NZUH 4F7MB 4EBQH 3T77A 3AREB 5E94A 4OI8A 5JDSB 5CIPA 5GZOC 4PJFB 4PLOB 2NXYC 2A0LC 3UTZA 3SKNA 1KBGL 1PG7X 1OAXH 3REWB 5KSUA 5ITBL 3M8OH 4YQXL 5IFHH 2FCBA 2JTDA 3SE4A 2B7DT 1IM9A 3MLPA 1JNJA 3N85L 1I1YB 5CLWA 4EZMA 1EHAA 4HGWA 1YEFL 5EU5B 5JHDB 5IROC 1EGJH 4M7ZC 3QWRD 5J4MA 5D7KD 4JFOB 5J06A 1T03H 4P46A 4K3EL 2P43B 1TJGH 4NQVB 4I8DA 4HIHA 4RFOH 3MODH 1XGTA 3AU1A 5IB4A 1ZHKB 1QLRA 5C8JA 3H9SB 4WI3A 1BQLL 1VDGA 2P45B 1ZAGA 4LCCB 5DD6A 2VE6B 3PL6A 4Z7QE 1X7QA 1I9RH 2X4UA 2HT3C 4F80A 2J2ZA 4HWZB 4U1SA 3O45B 2NXZD 5TQ0H 1D6VL 4OZFH 5DJCB 4O58L 3ZT5A 3U0TA 5FYKU 4OLZL 1UZ6F 3IF1B 5INDA 3MLWH 3SKMB 3GDBA 1CD1A 1XIWA 5MEOB 1YY9D 4WI8A 3UTQB 4U1IB 4X4YA 5C7XL 4HWEL 2X6MA 3QDGD 5ETUB 3NFNB 1QVOA 5JUEH 4EIGB 2HTKD 1FZKB 3KPLA 1FC1A 1QP1A 1VFMA 3QUXD 5FYKH 3VGBA 5JQ6H 4OLEA 4UQ2A 1CFSB 4RAHA 5IIEA 4MAYB 4PRHD 5C0AB 4TNWF 2B5IC 4HDIA 2AJYL 5EB9A 3BDYL 2LV4A 1DDHB 1QRND 2Z4QB 2OSLA 3R1GH 4R7NB 1DN2A 2VSCA 4QKXB 3CUPB 1YPZE 1OGAB 5GGVH 5DRXB 1NEUA 3LKNB 1JI2A 3QEGH 5ACMA 5FB8B 3IVKB 3B9KA 2WMPA 1QG3A 43C9B 5GGUA 2EEDA 3ZYOA 3A6BL 3SGJC 1BVKB 2DQJH 4NWUL 5IHUH 3EYSH 5HJ3A 2Z0BA 5K59F 4H5SA 1K6QL 4OBSA 1JNHB 3MCLL 5CCKH 5D1ZC 3LMJH 4QYOA 3I3EA 2FRGP 2BP3A 4X8JA 1BWMA 5GGSB 3QUKA 3MUGA 2OZ4L 1QBLH 4FMFA 5I17A 1CQKA 5IB5A 2YD9A 5M7QA 1J12A 1MH5B 4OM1L 1FL3B 3NPZB 1NH6A 2G5BB 3H42L 1CICA 1XZ0A 1OVZA 2HN7A 3EO1B 2F54B 5KOVC 4M6AA 4H8WL 1HYRC 1U36A 4BK4A 4JY4B 5C0FB 3FZUD 4NKMB 4LIQH 3TN0B 3UJJL 3BQUA 2EDKA 4G9FE 1FNAA 2W65A 2P5EA 2V5YA 1HHJB 3B6SA 2JELL 1EFQA 1IGJB 4P23D 3L3GB 5T5NG 3OAYH 1QBML 4JKLA 1GOHA 2X4NB 3O3AB 1S7UA 5IV2A 4D0CB 4EDXA 3LKSB 1JK8B 5IVXE 2CR6A 3QFJE 1LDPH 5FV1L 3ZT7A 4ZAKC 3VD9A 3N0PB 4KTDH 5J1AB 3PQYB 1OGAD 1VFAA 3MRNB 3IFPB 1KCRH 3SY0A 3DMMC 2VH5L 1I1RA 5C09D 4HEPG 1J0ZA 3OKOA 5EOCJ 1J8HD 3Q6GH 1SEBB 1D5ZB 3L7EA 1YECH 4RA3A 3HR5B 3RL2A 5D4QA 3ARFB 4MX7A 1RIVL 3QHZL 4L3AA 5IHZA 5I2IA 3QJFA 5JHDA 1J1XH 1Q9LA 4P5MA 1WICA 4D0BA 4EOWL 1C5BL 2BDNL 2D3VA 1B3JA 5ESQB 3RZCA 2AXHA 1HKLH 3IJYB 3WEXA 4F57H 2VDPL 2NTFA 3WNOA 3LKPB 5GGRY 4WWID 2Y23A 3MYJA 4K8RD 4FHBD 2V2WA 3MXWH 4PGBB 3Q6FA 4LSDA 5BZWA 4ODUA 3L6FB 5TDOB 3HUJB 4DOHE 2FECL 3GMRB 5DUML 3CZJA 2Y07H 4JJ5A 2WUBH 4DGYL 2YD4A 3N9GL 4IBLT 3IFPA 1LE5A 4IRSA 2DN7A 5JW4Q 5C07E 3PJSA 3OKLB 3IXTB 3DV6B 4F15B 5EUKA 2MFNA 5DUBA 5IB3A 5J89A 5SWZB 5SWZA 4CU7A 1QEWA 5AZEH 5HGAA 2F53B 2EIEA 1FN4B 3VG0H 1EA9C 5F8QC 1GIGL 4PRDA 3B2UC 5HHPA 2BVTA 2Y7QA 4IRSB 1DVFA 1UT9A 2EH8H 4RWYH 4KK5D 3RA7L 5FO9A 1FIGL 1MCDA 1Z5LA 1RAMA 2VL5B 2VTFA 1U8MB 3X12A 3DTXB 4U6YB 2VZOA 2FATH 3IRPX 1U42A 3FMGH 2FL5A 1G1YA 1CXLA 5IMLB 3VFMA 4X9GA 3REVB 4FXGA 1XZ0B 4XP9L 1G7IA 1TITA 4LMQI 3GSVB 4XT1C 5BJTB 4L8DB 1HN1A 4RGOL 4JM2C 3F7PC 5D2LF 1LO4H 3U7WL 4YHIB 5I73C 3H3PH 4XVSH 1A6ZB 4X6CA 2IF7A 3G5ZA 4NP4H 3GRWA 3V6OC 9CGTA 2E5EA 2O5YL 2UZXB 3O3BB 3P30L 1LE9A 4ZQKB 3W9DA 1TQCB 3O6FB 4PRAB 4RWHA 3MACL 4XMLL 5EFIA 1P84K 2R1YA 3DIFB 1ZOXA 3WYRA 3IDGB 1NBVL 3OTTA 2I5YL 3CDGB 4Y89A 1MHPL 1FNGB 3CX5J 4LKCA 1F4XL 5E1HB 4DOHB 4DAGH 2CDFB 3GI8H 1JK8A 2QJDA 2EDTA 4O00A 1NCWH 2GYSA 5E6IC 2VISA 5HI3D 1AE6H 5IBTL 1UXWA 4BQ9A 3MA9L 1UB5B 3DX6A 3O4LD 1KB5A 2N7BA 4JPIB 2DL9A 5IUSA 2BNQB 4GAJH 1V7NH 1UM5L 1GGIH 4PJ9D 1T1ZB 5DJZB 1YEKH 3ZDXF 4JQIH 1B4JL 3IXAB 3O6FC 4P4RB 5DJYA 5GGSY 4OF7A 1FLTX 1P1ZB 1F90H 1AD9A 2J88H 1RVFH 3NZHL 4MXWL 5EN2B 3QFJD 5CEZD 2AEQL 3CD4A 4NKOA 2GY7B 2R0ZL 2VXSL 1UGNA 5GQBA 1RULH 4G42A 5J0BA 1N8ZA 3SDCA 1BLNB 5JOFB 1OOAA 5HHVH 3TBWB 5A2LH 5F9JB 1KIPA 2V7HA 2A73A 2Y36L 3G5VA 5E08L 3WD5L 5B38G 1I3RA 3PGDB 2RCSH 1NBVH 5IBUB 2FGZA 1JWMA 3DVFA 4PJEE 1JRHL 5HDLA 2XPGB 3ZDZE 5GGUB 3AFLA 2YA1A 1NC2B 1OHQA 1QFWM 1Z0MA 5FYJE 3SGDH 1TFHA 3H3PL 1VHPA 1JFQL 1C16A 4OB5L 4LCYB 5D9SA 5IFJA 1V3JA 3LN5A 1NGZA 1D6EA 1OT2A 5E8DL 3RVWD 4DKEH 1Z9LA 4QXWA 5F9OL 3GIZL 3CH1B 2QSCH 4LNRB 4U0QB 3JV4B 1N59B 5GISL 5ANMA 1IGFL 2A77L 3GZKA 1C12A 1YY8B 2YK1L 3SDCD 3SJVD 5EIVA 2HTLD 1U3YA 1O5DT 2BNQD 1BJ8A 2G2RB 5LQBL 4C83B 3MLVL 5E9DA 5GIRA 5CD5D 1MAML 2KPNA 5IMKB 4R4ND 1KJ3L 3O4OB 2NY1B 5JO5A 1WBZA 4X4MA 1BZ7B 5DJAB 3IDIA 2KDGA 1KACB 4P5KB 1I75A 5BS0A 1CXIA 1FV1A 2BRRL 1HH9A 3QP3A 2ERJB 4CMHC 2FEDC 2PO6B 5BV7L 3M1BA 1X5HA 3QO0A 4JZJA 3MRGB 2FGWH 4CADB 3V5DA 3LCYA 4NQDE 3QI9D 3WDJA 2YUXA 4XPTL 3MV11 5FDWB 3QWOA 4EUPG 1I1CA 1A2YB 1RHHA 1C5BH 2OLDA 3DWTA 4Z77A 2YC1B 5ESVB 4HPOH 3WHE0 1MHCA 2DF3A 4KJPD 4YHNB 1SM3L 3DV4A 1MVUA 5H94B 4G7YH 3UTTE 4AENA 2GJ6B 1BEYL 1DQLL 5D7IB 4P2QB 3MRHB 4GRWH 4H1LB 2PO6C 2FJHB 2WK2A 4YHYC 1KCVL 2GUOB 4KKAD 3BWAB 3C2AH 3WKMH 5E6IB 3FQRB 1CICD 3NOIA 5D2NB 3U36B 5DRZB 3TV3L 4H1LG 3UTTB 3ETBF 4O2FA 3RL1A 4JQXA 2PTUA 5E6IA 2BFVL 2EIBA 2B20A 3SOBH 1CE6A 3NIGE 1A4JA 4CW1A 3UTZB 1UCTA 5F3HA 4Z7OF 1GPOL 3MX0A 4ERSH 5FF6B 4X0KA 3QIUB 1XIWD 1BFTA 3QIBD 4JVUA 2APTA 1GCFA 1OAQL 3ZTNL 1NDGA 3VXRD 3PWNB 1T2XA 4FFZL 1KCLA 2BXYA 2NNAA 1FGNL 1AGDB 3MNVA 3MFFB 1CL7L 1A4KB 3RNQB 5MI0B 2Y4SA 4U6TA 5IR1A 4JGMA 3ULUH 5CUSH 4KK8D 3P4OA 4OM1H 3RNKA 1NBQA 1D7FA 4O2FB 4P99A 5TGBB 3QULA 3BW9B 4Y4FA 2WZPD 3GO1H 1U3HD 5SV3A 2AV7A 3QQNA 4L4VD 5EU6D 1XGYL 4O51B 1HXYB 5I1KH 4NFBA 1C7SA 4GUPA 1H3GA 3MCLH 3O11B 4ZXBB 5CCKL 2FJHA 2BNRB 2GJ6D 2I9TA 1QO3B 3DXAE 4IM8A 2EDDA 4PRPE 1HI6B 5H8DA 4PGCB 3RGVB 3QB7C 1ZTXH 4U3XA 1NDMA 3MGOA 1A6TA 2FO4A 3F8UB 1HHGB 4TUJA 1K4CB 1DBKL 4MNHA 3VXMB 3RVXC 1G9EA 3R1GL 5FGSA 4N1EA 5IWLA 1HNFA 1WGOA 2APVA 5I9QC 1X5YA 4OF3A 2EDEA 1MRCL 3LQZA 2YN3A 1DCLA 4JN2A 4L4JA 3K4AA 2NX5D 1HEZB 5T3ZL 1CF8H 4RQQA 3VXRB 1U58A 1FIEA 3WSQL 3L5JA 4PP2A 5A2FA 1BZ7A 4JY6B 3U7AA 5I8OL 1A3RL 3EW3B 3HR6A 2D0GA 4FP8L 3EYVA 4R7NA 4HC1A 1JN6B 4OCLC 2QQLL 5CBAA 1LK3L 2OL3H 3JTSA 3FQUB 4UU9A 5HTSA 1YNTB 1Q1JH 2YSSA 1ITBB 4HC1H 4YDVB 1HHGA 1U3HB 1U8IB 2XWTB 1I9RL 3TWCL 2HYMA 3GHBH 4FXKB 4LLYA 3HRZA 3WHXB 2XY1A 1T21A 3TT1H 3KPLB 3DHJA 2BNRD 3K2MC 4EVNB 3NA4A 4R90H 5I1EH 4G6JL 1TJGL 2ICWB 3MV9B 5EZIL 2O93L 3TNMA 4XWOC 5L9DH 4FQ1L 1J5OH 1T7WA 4NRZB 1NJ9A 4UTAL 3C09B 1ZT4A 1T1WA 2CLZB 1RZKC 4XPFH 5T3XL 3P4OB 5A40E 1RUKL 1F3JB 4JFYB 3UYRL 1VERA 4HIXL 3DO3A 4RMTA 4LDEB 4M1DL 4F7TA 5BW7A 2DWEA 2ZCLL 3DSFL 3HC3H 4ZS7H 1SJEA 1FZMA 4AM0B 4DWHA 1MJ8L 1JF6A 1OTSC 2EIDA 5IW6B 4LLWA 1JWSA 2XYCA 4U33A 4G42B 4OCSL 2F19L 3Q3GB 3C08L 4NM4H 3T8XA 1ED3A 3T0BA 2Y9RT 5GZNC 4QRUA 4RMSA 4U1GB 2MCG1 4Z0XA 1MHEA 3O3DB 3C09C 1BMGA 4UV4H 1N64H 3DX7B 1TZIB 4JRWA 4YXLL 35C8L 4JHAL 4R7DB 3I3DA 5ACZA 2J5LC 4PJAB 4W6XB 1MCKA 2OP4L 4HK0A 4WU5B 2BNQE 4L3CB 1BPVA 4JCMA 3TVMC 5L0QC 1JPFA 1AO7A 3ARRA 1WF5A 3V52H 3KPNB 5J6GB 1FJ1A 3KGRA 2OR7A 2YOCA 5EBMA 1I7RB 3CLEH 1IAIH 4U1GC 3EO0B 5EZOH 1OP5H 3V7MA 4KKNA 4PRDB 1YEDB 1E6OL 1RJCA 3O81A 4GT7A 1OM3L 2VAJA 1JE6A 1G7JB 2R23B 3LOWA 5C0GB 1E27A 1HNGA 4P23C 3MJ9A 4ELMF 3BGAA 1P4IL 2NLJB 3OJDA 5FKPA 2N4IA 3DVGB 4N9OB 4JG1L 2XWJA 1G9NL 1K3ZA 5DEGA 1T22A 4K23H 3DPBA 5CP3A 3WN5A 2R1XB 2CIKB 5I30H 4RAVB 2G9HB 2GTWA 4X4ZA 3MROA 4PGEB 3SDDB 2Z31D 1K2DA 4RBPH 5FUCE 3WLBA 3UC0H 2YRLA 4NC1C 1EMTL 5KVMC 2VXUL 1FGVH 1U8MA 1TZHA 3X3GH 3Q1SL 4TSAH 3CSYA 3R8QA 1EZVY 2IAMB 3QQ9D 3C87A 4EUPA 3UX9B 4YGVA 3CZFB 2FB4L 1UCBH 4CAGA 3IDIB 4LL9A 5T5FH 2DM4A 3RKDD 4OIAA 3HR5A 3RL2B 5I1CH 4G43B 2A2QT 1U92A 1D5ZA 4K3DL 4APQA 1JGDB 4FG6D 2W60A 4C83A 3AROA 2VQ1A 4L5FL 3RVTC 1UM6L 2IPKA 1QYGH 3BUYB 1VFAB 4Z7VF 2FJFB 1CIUA 3MBEC 4ONFH 4XZUA 3BHBB 1HCVA 1YDPA 2F8XC 3M07A 2BCKA 5ERWA 5DJXA 5B4MD 2OP4H 2DI7A 3BMWA 4EN3D 2BOCA 4ODUB 2EKSA 1CFTB 4Y5VC 4DQOH 3KLHC 1I4FB 4YXLH 3QEUB 1PGRB 1EVUA 1KT2A 1HHJA 3B6SB 4AH2A 2DLIA 4WUKH 1HZHH 2Z35B 1HINL 2HLAB 4G9DA 4D0BB 1A5FH 3EOBB 1KPVB 2QKIA 4PJ5A 4DQOL 4PP1D 1T0MB 1ZLUK 1OW0C 1NFKA 3R0MA 5JIKA 4BFEA 1N7MH 1DLFH 4N8PA 5JLZA 1Q0XL 1XCQB 2ZCLH 1EFXA 4KRPC 1KIPB 4YHML 1BBJA 3HPJB 5DK0B 4QNPF 1I8MA 3MJ8A 2YPVH 4KWUA 4WUUA 5DYOB 3GBNL 1ZEAH 2YPLE 3QDJE 1RUAL 4KRPD 2EYSB 1U41A 4FQ1H 1J5OL 2C3WA 4CVXA 3MJGX 1WQVT 1RQ5A 25C8L 5SWSB 5I1AB 5DURB 3GKWH 5D72H 1A9BB 4N5UA 4LEOA 2EXWD 3BQUB 5GS3A 1PKQB 1RZJH 3LKNA 4OZFG 4U2YA 4EI5B 3AAZA 3NA9H 3D3VB 3RI5F 4KQ3L 5EBLA 4ZYKA 4Y16A 4NN7C 3ZKMC 1DDHA 1WVZA 3ZKND 3LN4A 4J1UB 4L29A 5C1MB 4NO0A 1MNUH 1JZ5A 1U3HA 3CFCH 5ENWA 1CFBA 3FB6A 3KVQA 1UEYA 5I1JH 4X9HA 3MGOB 1QSFD 2CKBA 3E6FA 5EOTA 4X4XB 2Y72A 5HI5D 2NY6D 5D71L 4NN6B 1BVLA 1QFUH 1CQYA 1BQUA 4X8JB 1CFVH 4X9BA 3HAEA 1MIEL 3FJTA 4H5SB 4KVNH 5MEOA 2CDGB 1RSFA 3QUMB 3MRQB 3ARYA 1JPGB 5M94B 4N0FB 1FO0H 4KUCD 4LSPH 4Y2OA 3ULSB 4BZ2H 4E0RA 1IM3B 4XVTL 4HIIB 3QDJA 3O4LA 1KB5H 2W38A 3CDCA 3DBXA 1WUNT 4PLJC 3WDHA 1MCNA 3VFMB 3LHPH 1XGPB 1DBKH 3AVEA 3ZL4L 3D5OF 2CUIA 1N64L 3PG2A 4NBXB 3GUTA 1Q9OB 3W2DH 5BXFB 5IP4A 1HWGB 5HYEA 1OAUH 2W9LA 2C1OA 3U46A 4X7TA 3D2UA 2XWJB 1CD8A 4XRCA 5C71A 1WIOA 3P40A 4ZPTB 4JFXA 4WFGD 4P2QE 3CCHB 2X2YA 3OR7B 1MFEH 3DLQR 4R8WL 4J6RH 4GMTH 4CJ1A 4MJ5B 5D1XD 4JDTL 3AY4C 2PTTA 1I1FB 2VYRE 3MLZH 2VDRL 2BSSB 4NN5C 3TPKA 4MNQD 4GG6F 1YEDA 3D6GA 4XPFL 3GIVA 3T0WA 5C6PB 1FH5L 2FBJL 4Q9QH 2VQ1B 1RIHL 1DQQB 3VCLA 1OSPH 1JGDA 2BNUB 3ZHLA 1T1YB 3T3PF 3MRMA 2WWKO 4P2OA 1N0XH 3P11L 3O6LL 3ULUE 5J11B 3DMMB 3TT1L 4JO4L 1QFPA 3VD3A 1FP5A 5F89A 5D7IA 4AEIL 2HFGL 3MV8B 4MD0B 3GHBL 5L8KB 5IHZB 1I9JL 2NY2C 3MRLB 4XNMA 4OCRH 4LCUB 1FZOA 4ERSL 1CLOH 5LVEA 3O3DA 4QHKI 4WUUE 5B38B 4BELD 2R8SL 4OGYH 1OP5K 4HXAL 2BHUA 3GSNL 4PJ5D 5FGCE 1YEEH 3Q3GA 4NJ9L 3HE6A 3X13B 1GHFL 5T1KA 4D0DA 3ZZ1A 1H3PL 1AQDA 4Z9KB 4YZFF 1X5IA 2XFXA 1XR9B 3BQUC 4HKXA 1WZKA 3BAEL 4YXHH 4KY1L 1OP9A 1F3DH 4FQIL 4M43H 5B3JE 3VRLF 5IB2B 1BFSA 2VXVH 3K81A 2VDRH 1T5XB 2C5DC 2ZJSH 2CR3A 4YFLI 3EO0A 3RTQC 1PSKL 4XVJL 2F8OA 5J6GA 4FQQA 3CU1A 3ZE1E 4F15C 4LSRH 3U1SL 1MVUB 3HMWL 5H94A 4G6AD 1ONQB 1BZQK 4Y1AD 1F2QA 5ESVA 1LVEA 3DX9B 5EU4A 3W2DL 5F9WC 1OAYL 3KXFE 4L3EB 1HH6A 3U0PA 1FLRL 5BVJB 3FOLA 1NEZG 1MSPA 5AWNL 1S7VA 4K8RL 1N59A 4PJBE 2VLJE 5K59E 5CSZA 2XQYG 5ALCL 2BRRH 3GUTB 1D9KD 3HB3D 3GSNA 2CLRA 3MO1B 5E95B 4KHXH 4S1RL 4LPXA 1PQZB 5DMIH 7FABH 4JR9L 4HV8A 3GO1L 2VLJB 3D39B 1BVKA 4L8SA 4GMSL 4G9FA 1JYNA 2J6EA 1GGBH 1R0AH 3HRPA 4AG4L 5DJ0B 4CVXB 3BSZH 1UWEH 2YWZA 4TSBL 5EIIA 4QOKE 4BQBA 1UG9A 2GSGA 1H3PH 2AS5M 4TRPH 2GY5A 3O41A 1YEIH 2P1YA 2CMRH 4HS8H 2DQUH 3NIDF 2CKBB 3EOYG 3UTSB 5C09B 5DYOA 3DUUB 1JGLH 5ESAB 5KSBF 2QSVA 3HI6H 1CFQA 4YK4C 1ES0A 4OB5H 4X7FC 4P46C 4N5ED 4TQEL 5FUCC 4QRPD 4PJ8A 4J23A 1KFAL 4KZEL 4U0RB 3DX8B 1B0WA 3F58L 3GSNH 1KG0A 3OGCB 4KZEH 2B0SL 3SGKA 4YHLL 2XWBA 2IH1B 2R8SH 2FHBA 5BV7B 2C3HA 2E6QA 3FCTB 5T3XD 3EYVB 4HUKB 4P0DA 5I76A 2DM3A 3GBNH 3BW9A 3QULB 3VXOB 4RGND 2H2PD 3LS5H 1WWAX 5DJ0A 4TN9A 4PGJA 2IPTL 3X3FL 2LU4A 4PYGA 2R9HC 1FNGA 5D7LD 2NW2A 3QDMD 5EOQL 4G9FB 3PL6B 1W72B 1GAFH 5DMGC 4HMEA 4PJCE 1G0XA 1J05A 2D2OA 3NZHH 3DYPA 4YDKL 1UWEL 4JFQA 3O6FA 4JN2B 4AG4H 2GAZB 5CKAA 1I8MB 4LRIC 2VLJD 4HH9A 1U92B 3JV5A 3IJSA 5CJXC 4HKZA 5KG9A 4JR9H 4LFHG 2O5XL 4J4PA 5DXWA 5I18L 4RZCA 1MFEL 3JWOC 2IFFL 5ICZA 2QQNL 5D1QC 3A6OA 1S7SB 3RBSA 3VWKC 1WFOA 5EO0A 1AR1C 1QSEB 4FS0A 4LSPL 4M6OL 4HHAB 1OAUL 4NUGH 1CBVH 1I4FA 4K3JH 4JFFB 2CIKA 4M61B 4IOIA 4D8PA 2AQ2A 1XGRB 2E7BA 3O11A 1P7HL 3OHXB 5HXMA 4PRBA 2WBJB 1KB5L 3R0NA 3ZYZA 5KW9H 4RISL 5EFIB 4NPYA 2FB4H 1BZ9A 1FO0L 2WINA 4XVJH 3O3BA 1I85A 4LBEB 3L3JB 4LCWA 3QNYA 3U9PH 3PNWB 3NCFB 5D93C 1FGVL 2HLFD 4HD9A 1OAZH 3CMOH 3NIGF 3K8LA 4G5ZH 4OGZA 2FIRT 5EBMB 4PRIA 2ERJC 2Q87A 5JZ7D 5K9QI 1FAIH 2XIDA 3W81A 4G6FB 1FIGH 2R4RH 4Y5XB 2F53E 4KZDL 4FQXA 5EU4B 3CFCL 4HH8A 4KJPC 4ZNEA 1HQ4A 1ONQA 3ZE0F 1GIGH 2NQCA 3D3VE 4UUJB 4WWKA 4CVUA 3MV8A 3CFEB 1OD9A 1T3FB 3TJHD 4ZMAT 2DKUA 1ZSDA 3STZA 4M3KB 4S10A 4KQ3H 3GJEA 4JQVC 3WXVL 3UYOD 3FO1B 2APWA 1TLKA 5F1SA 5ID1B 3MFGB 2VLKE 25C8H 2G75A 3RU8L 4JZJC 4OLVH 1VFBA 1VFBB 2CK2A 3CC5A 3WFCL 5C0DB 4PJ8D 2C26A 3PV7A 2OCFD 4LNRA 3L3IA 3KPNA 5ID1A 5F1KC 4U1HB 2BSRB 2UV3A 1ZV5A 4JFXB 2LVEA 5ITFA 4XHJC 1E0OB 1DLFL 5C0FA 1Q9OA 4UNTA 4V2BA 5FA4B 4JZJB 2VXQL 4WGVB 1AO7D 3B8SA 2J8UA 4LHUA 5GS0H 1CI5A 5T1MB 5ALBL 3ROOA 1JNLH 3MRMB 5AAWA 4YDIL 5C0BA 3A67H 2I5YH 1Y18A 2FYYA 3QUZA 1BOYA 4YHKL 5T3XH 4PJEB 2VAAA 3E2HC 5IW6A 3IDJA 3JVGA 4RNRB 4LHQB 1KYOJ 5C0AD 2ARWA 2NZ9D 2FIKA 2DJSA 3FFCA 4N8VG 5E56A 3IDXH 3SEPA 4QWWD 43CAB 4KXZI 3HC0B 1ZLSH 1M71A 1XF2A 3OGOE 5LAXB 3WLWD 4RFNC 2YHGA 2XG5A 3WMSA 3WJJA 4MWFA 1ETZA 4X9FA 2R1WA 3G6JA 5EZJB 5GRUH 32C2B 2GSIA 2IGFL 4MGXA 3FMGL 5GRZA 1I7ZB 2XQBL 1S9XB 1YNLL 3VMPA 3BT2H 3QXDA 4H8WC 3LQZB 2ZG1A 1JL8A 3JV6B 5ABDE 1EERB 4TSAL 4PJ8B 2EH8L 4RWYL 2YD6A 1KTLB 3B2VH 4HIIA 2GSIB 4WEMB 1CGWA 2ENSA 1CFSA 2B2XL 2ZPKL 5IOPB 3UTOA 4Z7WA 4DZ8A 3E6HB 3MRQA 5C0IB 3GMQA 2W0PA 5CBAB 5I30L 4HKZB 1NCBL 4XCNB 4OLYH 3A6BH 2CXKA 5CILH 3RY5A 4K23L 5EUOE 2HFTA 5GRUL 5DGQA 4HCRA 4YO0A 1H8SA 3ALWA 4DK6A 1I85C 2E9WA 4A6YA 3BISA 4LLQA 4RNRA 1HSBA 5GZOD 5INDB 4O51A 4JJHA 5BJTA 1QQDB 5DJCA 2PR4L 1OM3H 3S35X 4LF3A 4J1UA 4EOWH 2YPKA 5EZOL 5JLZB 2UY7A 3W0WA 3HTLX 5F88B 3SKJL 1IAIL 4ZYKB 3GSNB 3RKPA 2FEEI 5IR1B 3QPQD 4H0GA 2EYTA 1BIHA 4LCCA 5DD6B 5HDBE 3VFVA 1YECL 3LPFA 3MJ7B 3TYGL 3BZEB 5HYJD 3BGFB 1UWXH 3WXWL 1NDGB 2IFFH 4XNYH 3MLWL 3DSFH 1ZT1A 3C6SB 1R24B 1IKNA 5B4MC 3BKYH 1S9YA 1EO8L 1V3MA 1YDPB 4LHJB 1CFQB 1S9VB 1FL5B 1MI5D 4YUEL 4YNYA 5CUSL 3C8DA 3C08H 5IHLB 4FFWC 2D0HA 2HT2C 3QPXL 4JRXE 1LE9B 4KK5C 2ENYA 1KTDB 1SHMA 5ISZE 4Z7WE 4Y2DB 3MLYL 1GAFL 4OLXH 3QUML 4C56D 1UH3A 2E9JA 4LIQL 2Q7YB 3UJJH 4LSSH 4OLVL 3MODL 1NMCC 1MJUL 1T6VN 4FQJH 4R90L 4ZXBD 5I1EL 2IPTH 2CRYA 1X7QB 3AREA 5E94B 3D39A 2J12B 4NN7B 3QA3A 3I6LD 3WL9B 3PXHA 3OJ2C 3WXVH 1Q1JL 4Z77B 2OYPA 2CRZA 4CMMA 2B0SH 3Q0HA 4Y5XA 5MERA 2YD8A 2VLRE 3WNKA 5DEFB 1WIPA 5AG8A 1FYTB 1MFAH 4ZFZA 4MD0A 1MCJA 5BW7C 4IRSD 3UC0L 3SQBA 5F3BB 2VLMD 4N0CD 4KZDH 4XHQA 3O2DA 4M3JA 4XZUB 1H15A 5DC0A 2X4QB 1U8HB 3GI9L 3VFRA 5DRNB 3HI6L 4F2MB 1DBJL 3OKDA 3TJEL 2VLRB 3MUJA 3O3AA 5IV2B 1G7JA 1BEYH 4P9MH 5HPOA 2WP3T 3ARBC 1CGVA 1LP9A 4LHUD 5I8OH 1WBZB 2EXYC 3BSZL 1P6AB 2PTTB 3WSQH 3GHEL 2NTFB 2O26U 4IS6B 4X6EB 4XMKH 4MA1B 5ISZA 3SBWA 5HYQA 1WIUA 4QNPE 4ZPTA 2PYEE 4PTUB 3BGMA 4LQ1A 1NBYA 5CD3A 2A9NL 1FL3A 4X7TB 1MRCH 1M7DB 3V6FB 4D0DB 4PRIB 2YN5A 3J7HA 4OFPA 5I17B 3MOAL 1MY7A 3ESVF 3MLTB 1E4XL 4K8RH 4MYWB 1OGTA 3L7FB 4N0UE 4L8CA 3VMOA 4HH9B 1N6QH 1DE4B 3RJDA 4JHAH 3SE3C 2PO6A 4WW2B 3O4LB 3MRLA 4XNMB 3OZ9L 3SE9H 3SY0B 2AJVH 4GO6B 4Z78B 1MCOL 4Q2ZB 5C08A 4R9HA 1T80A 3UDWA 1I8IB 1XCTB 3DUSB 4U6HA 2X1XR 2WLZA 4W4OA 1MCPH 1JPGA 1QOKA 4LSRL 3BZFB 3J8F7 3RX8A 3VXSE 2NYYD 4D0CA 5IMKA 3G5VB 4JEGB 4PJFF 3HC3L 2A1WL 1IGJA 3QFJB 4ZS7L 1QSEA 5HHXL 2QSCL 3I75B 3VXRE 3BXNB 1RUKH 2IH1A 3ZSTA 5E8DH 5C0ND 2VLRD 3ZTNH 5ACZB 4APQD 4P3WA 4Z7WF 3ULUL 4UTAH 2BSTB 1UKSA 3SCMA 4Z7NF 4M5YL 3BEWB 5GGRA 4F7EA 1C08A 4L8BA 4F7EB 3SO5A 4HT1L 3N85H 3HLAB 4Y88A 3WV0A 3TFKC 4XPGL 1H0DA 1SJHA 4G6JH 1C16B 1OD7A 1ZWIA 4G7VL 2DQTH 3BZEA 1H3VA 3JXAA 1NC2A 5C08D 5MEQB 5IFHL 4JPIA 1XF3A 1OARH 1NL0L 3K4ZA 4Y4FC 3D25B 3C2AL 4JHBA 3KPOB 4I9WE 1KCVH 1JVKA 4JO4H 3OXRB 3G5YB 3G5YA 3BZFA 3QZWG 2WUCL 5I1DA 4OZGB 3D25A 1VESA 1P4BH 3ZDXE 1CDBA 1IQWH 4LQFH 4HV8B 1N6UA 3SDCB 4QOKD 2PYEA 4AJ0A 3MRIB 1X3DA 4FQLH 3DX8A 2VITA 4LOUD 3I2CH 2CD0A 1LO0L 3BIAX 5CSZB 4X4XA 5GGRB 2WBWB 2YD7A 5CGYC 2NXZB 5TE4H 4GW1A 4HPOL 2IQ9L 3VXMA 4ONHB 5CEZE 2YSSB 2AEWA 4HSQA 3P2TA 3WUWA 4JY5L 4DZBB 4Z7QF 4NO0B 1NGQH 1TQBB 1F4XH 4QRRD 2W0FA 1B2WH 5L8LB 2VL5A 5I6XC 1U93A 2HWZL 4JHZA 4X4YB 4JY6A 4XMPL 1RI8A 5FO9B 2O5YH 3P30H 1OWWA 1LMKA 2FD6L 2Y7QB 5JDSA 4XVTH 1FN4A 2GJJA 1S3KL 1T66D 4Z7NE 5DR5H 4JFPB 3FRPG 2QEJA 1PSKH 5KS9E 3H8NA 1U3ZA 4PJHF 1NCTA 1NKRA 1YQ2A 1DANU 4P49A 4PJXE 2ZJSL 1XR8A 1G6RB 2R2HA 4YHIA 1MAMH 1A4KA 3RNQA 5J8OA 2HFFA 5C2BL 3WE6A 5HSFA 5IB4B 4M43L 3I85A 2ZUXA 3ARDD 3Q6FB 5BZWB 4H20L 4ODWB 2Q7NA 3LEXA 4HJ0D 2X10A 3T65A 2XKNA 4HPYL 5E6ID 4JLRA 2ATKB 3LKPA 3KPSE 1CDCA 3QUZC 3QZWB 2VDNH 3NGBC 3VFGH 3C5SA 1N26A 2HJLA 5JPMB 3ULUC 5FF6A 5BV7C 1YPZA 4F7CB 2GTZB 1V7MH 2I9TB 1D5XA 5GRJL 1FNEB 5C6TL 1FQ9C 1X6NA 3FT4A 3O6FD 1U3HC 1I8LC 2FZ3A 2FEEL 4G6AC 5I8CA 4IMLA 4YC2B 3ZKXC 3FRPA 4ONGL 5D7LA 4NNPL 5B3JF 1E27B 3HS0B 2ZSWA 4NO0D 1QNZL 1MHHA 3RVUD 3P11H 5GHWL 4X6CF 4QXUH 4NFCA 5DQJB 5KVEL 3BP5B 1S9VA 4P2RA 5F7LB 1A3LH 3DYOA 3MRHA 4ZUWA 1F5WA 5F3BA 4MXWH 2IPKB 2G75B 4MXVF 4RMRA 3DV4B 3X13A 1RIHH 3CLFH 5HHMD 1J1XL 4JQIL 1TPXC 1NFDF 4L4VA 1MIML 4XCFL 1AHWC 1L9MA 3BKJL 4GAJL 3K80A 4DTGH 3D2UB 3MLZL 1LO3L 4L3CA 4XRCB 3LQMA 4ZS6D 3WL9A 4JDTH 3TH2T 3FT4B 4EI6B 3D69B 3G5XA 1CR9L 2VZVA 5F3HB 3MRGA 1TZIA 5CP7B 1E28A 3AC0A 4HS3B 4DAGL 5A2IH 5IVZB 4HBCL 1MY5A 1YEKL 1FG2B 3MCKB 4M9OA 5FA3B 4OQTA 3WFEH 2G5BA 3FHAA 4PBXA 4I77L 4JO3H 1CICC 2NY6B 3MRNA 1QBMH 4MA1C 3BN3B 4XP4L 4AM0A 3P0GB 2A0LD 2PETA 2AK1H 4DGIH 1NGYB 5T1KD 1MHCB 2CLZA 2IQAA 1EPFA 3CFBA 1Q38A 5D2LB 4OFKA 1BBDH 2PYED 3OXSB 1F45A 3RDTD 5TDNB 4PB9H 1QSFE 1W8OA 5I1CL 1RD6A 4HPYH 3T3ME 5C07A 3BWUC 4Y16B 2FX7L 4Y0GA 2YK1H 2Z4QA 3D3VA 1MCFA 1JTPA 2F54A 3Q1SH 4PJFE 3MMEA 2OZ4H 1FORH 4HK0B 3FFCE 4DZBA 3NMEA 3B3IB 3DRQA 5DJ8B 1S5IL 5DUPL 4PJGA 1N2RB 1K6QH 1O7SA 2WANA 1A14H 5DR5L 1ACYH 1J86A 1F3RB 1X4YA 1CXEA 3PGDA 4HG4K 2APFA 4ZTPL 4OZHE 1MLCA 3TBTB 4DGYH 3FO2B 2EYSA 4U1IA 1JRHH 5GZND 4TVPE 2KBGA 1P7KB 4FFVC 4R4NC 5SX4I 3BD3A 3X11B 5I71C 3ULUF 4ZFGH 1ODAA 1XT5A 2Y36H 5E08H 4LK4A 3PIQA 3EJZC 4JVWA 3BE1L 1KTLA 1UQSA 3GSRA 3I6LE 3ROOB 5T1MA 4X6CE 3KPOA 1ZEAL 3ECBB 5IT2H 5DUMH 2R69L 1R3JB 3B8YA 2OMBA 4OZHA 1XF3B 3RIFF 2R0KH 2SEBB 5A1AA 4JKWA 3HA0A 5FYKL 1GC1C 2Y6SD 3KNBA 1JYWA 1LO0H 2AEQH 2VDPH 3OR6B 3CGTA 3BGFC 4MNHB 4OV6F 4L8SC 3JWNC 3QBTB 1N7ML 1H0DB 5I71B 5DD1H 3ECBA 2P7TB 3BPLC 1VENA 2BOCB 2B4CH 3DI3B 1I3RB 1V7NL 2CDFA 5LGKA 2XA8L 4JVPA 3MGTA 4YDVA 4I3SL 1HXMA 1LDPL 1X5JA 4H0IA 4LVOB 4PV8B 3CC5B 3CDGA 5E9DD 2CXGA 1AE6L 5E2VL 3SKMA 5HGGS 4CDGC 2YZ1A 1BBJB 1KCRL 2J7LA 5GSRB 4AY0A 3K1KC 1MAKA 4M93C 5GGTL 3ARFC 5LGJA 4FNLH 4S1QH 5KANI 1OTSD 2JCCE 4EJ1C 4HIXH 4GQ9L 2NY0B 1UB6A 2BOBA 2EH7L 3C6LC 4K3EH 1I8IA 1XCTA 4U6HB 4HT1H 3FO0H 5BZDB 1ZS8A 1T03L 4OKVB 4KK9D 5DHVH 5KSAC 2MCPH 4M5YH 4JPWH 4GH7B 4TPRH 3VWKD 4PJDE 4AZ8A 1XGTB 2VRAA 5T5FL 5B21A 3NCYS 4AH2B 4L4TA 3GMNB 3F7YB 4XWOD 1QTYT 2VKWA 2V9RA 1V8HA 5L7XL 2OS7A 1F8TH 3MOBL 3OQ3B 2CRIA 4LKCB 2YEZA 4PJDB 5T3ZE 1EGJA 3H42H 5EC2A 1CE6B 4DN3L 4P5TB 5ISZB 2AXFB 4XTRD 3NCBB 1BGXL 1HE7A 3DV6A 2E7HA 4JG1H 3RIAK 2UYLA 1CN4A 4UQ3B 5D7JA 4RMQA 3LMJL 2E7CA 2IAMD 5IVNA 1A0QH 3VD5A 4HJJH 3W82A 2P8PA 1T3FA 2GTZA 1GGTA 3T09A 2DQJL 4NWUH 5FA3A 3VFPA 1DR9A 2AJYH 2VLRA 2X4TA 3H7LA 5FGRA 3KDMA 5T3ZH 2AABH 1TJIH 4DW2H 1C5DA 1KC5L 2N7AA 1ORQA 1UJ3A 4U1MB 4I0PC 2NY1D 3WE6B 4UT7H 5KZCB 1P9MA 5DEGB 1MHEB 4HJGB 4U7MA 1U91B 1G6VK 4Z0BL 2NLJA 4XGZB 4EXKA 1GSMA 4YEFA 2BY0A 2AQ1A 1IC7L 3F5WB 4H0HB 3QNYB 5D96B 4NCC1 3UZQA 5C9KA 2NY1C 3ZDYE 1EEYA 4B5EA 3KYNA 2CKNA 1S7RB 2J6EL 5FM4A 5TQ0L 1N5YH 3VFNB 1EBAA 4NM4L 5TFSL 5DJAA 3F7QA 4D8PB 4ELKB 5FUOH 4RX4A 1K4DB 1U93B 1CU4H 3P0YH 4PPTA 1BQLH 5KS9A 5L7XH 4O58H 4POUB 4P5TD 1WBXA 2OXHA 1ZE3C 3K8MA 1PG7L 5K9JL 2NXYD 4P2QD 3CSGA 1I7TA 3A6CL 1RK0A 3BJ91 4QY8A 2WNGA 3EJZD 5IVXF 4UNVA 2LE9A 4NC1E 3E0GA 1IAII 3KHQA 3JWDH 1CICB 4LSQL 4YBLB 2J4WL 4CRPA 3EYFA 4RFOL 4LSSL 3MRIA 4NQTA 1MH5A 4KH2A 3B9KD 4LSQH 4LSVL 4LLWB 4NNYA 4LLDA 3JTSB 2FJGA 3KR3H 3MJ9L 2I25N 4JCLA 2EC9U 4KI5E 4HAFA 3IDNA 4GQPH 4YUEH 1U0QA 3K4DA 5E00B 5L6YL 2GK2A 3VXOA 1H3WM 3MBED 5I76B 4ZUVB 1JNNH 3DUHA 3CU7A 1LHZA 3KYKH 1QLFB 1BX2B 3D9AH 4Y1AA 1EK3A 5I0ZA 3QAZB 4NSKB 4UTBH 1N3NB 5DRXA 3KXFA 2WWMC 5E2JA 2YUWA 4R2GC 1KBGH 1TQBC 1SJHB 1H3TA 4ZNEE 3TYGH 3V5HA 5EUOF 4LCIL 4AEFA 5C0IA 3FFCD 4BA8A 1AD9B 1CD9B 2YRZA 3RTQB 1VGEL 4FTVA 1J1PH 4OI7A 4DKFH 1PBYA 2C7UB 3IXAA 3D87B 4LVNC 5C07D 2X4OA 4JN1L 2D7PA 2RHEA 3TYFA 1ZKAA 3FN0H 2IMMA 3P4LA 1A7QH 1MJJB 3DX9A 1L0QA 3RY6A 4X5XA 2X05A 4R26H 4XNZB 3S3PA 4NRYA 3ULVE 5DVLA 1CTNA 5CGTA 1S7WA 4R4FH 1ZA3B 2AABL 1QLFA 1A9BA 4ZTPH 5B3NA 4PJ9A 5GJSH 1A8JH 4MWFB 2BC4B 3GJFK 5AZ2L 1NMAH 5SV4A 1SMAA 4HWEH 4AIOA 3B9KB 1HHHA 4NKQB 5FGBA 5SX5K 1Y0LA 1HHKA 2UUDH 3MO1A 4GW5A 3UJTL 3MLTA 4WU7A 1CG9B 1IEBA 4ACPA 1D6VH 4E41A 3HZYA 2IWGA 4ODHL 2J3SA 4JPKL 3NABL 3GMOA 1AGDA 4L8DA 1UWGL 4OSUH 5JTWA 3LVEA 5CD3B 3T4YA 2GCYB 2FYYB 3QUZB 1YNLH 1G7IB 3ARXA 3QT2A 4XCCL 1P9MC 5B38A 2C4XA 2Z31C 4HWNA 4QY8B 1XAUA 2OTPA 4GG6E 4C54A 3X12B 1P1ZA 1IVLA 5F89B 4DKEL 3HG1A 1T1ZA 5T1DH 1MQKH 3IU3B 1F2XK 2Z35A 1OQXA 4KPHL 4OQTL 4JFDE 2EDFA 3I75A 4ZUSB 1JFQH 1KT2B 2MNUA 2A6DA 1OSZA 4C4KO 1QFOA 3I6GB 3PV6B 1VKXB 5D2NA 3QG7L 2VISB 4JO3L 4LPYA 1S7TA 5DFVC 5EUKB 4G8GA 1PY4A 5C0DA 5CIPB 2XFXB 4NQEB 3AM8A 4M8QA 3RUGE 2W1NA 3B9DA 4H88L 1V3KA 4M6NH 5J9PA 3SQOH 2MJWA 3TNNA 5FXCH 5AEAA 1ZHNA 1KENH 1RULL 2F74A 4ONOA 3FONB 3KS0J 2DTMH 3MRKB 5D1QA 2FZ3B 3U82B 2VXSH 1SM3H 3QCTH 1MIMH 4XCFH 1MRFH 4EUPB 1A7RL 4EUPH 5E6ZA 4DUVA 3KPQA 1FBIH 5EU5A 4HGWB 5BQ7B 2IJ0C 1A7NH 3FHQA 3DMMA 3S37H 3ZSSA 2CIIA 4Q6YA 1XH3B 4OIIL 3RWEB 3WFCH 3BN9D 5GGTA 4RGMB 2IEPA 3DTXA 4U6YA 3QDJB 5C0NC 1OP3K 2IFGA 3QUZD 5MENE 2Y06L 4ZNCD 3FQRA 5BS0B 4KMQA 1EHXA 3WN5B 5T1LD 1AH1A 3BWAA 5IT2L 1IC5L 1ADQL 3MRJB 4M1GL 4ONGH 5IQ9B 3GIVB 2Q6WB 5EBWB 2Q20A 4MJ2A 4IMKA 1NCAH 4I3RH 1S9YB 4IOSD 4NBZB 1CGSH 5I8KL 1T04B 5DUBB 5IB3B 1T1XB 3T04D 4NPYB 2X4NA 3V4UL 5CMAA 5EC2B 3CCHA 4MHHI 4XBEL 4K3GA 3HI5L 2WBJA 3IDUA 2LTQB 4OTXH 1A2YA 1OQOA 1NCDH 2VLKB 1FYTA 3EBAA 4JDZA 2YS4A 1YN7B 4KROD 5C0RL 2X70A 3V7AG 2WWMD 4FTVD 3QRGL 1NGZB 2XN9E 4IDLA 2A77H 2F58H 1M7IA 3QIBC 3DBXB</