2XYCA

Crystal structure of ncam2 igiv-fn3i
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
291
structure length
291
Chain Sequence
QPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPINISCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords NEURAL CELL ADHESION MOLECULE 2
publication title Structural Model and Trans-Interaction of the Entire Ectodomain of the Olfactory Cell Adhesion Molecule.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2010-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
A PF07679 I-set Immunoglobulin I-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xycA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xycA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xycA03
3RWDA 2BFVH 4WHYG 4YFLF 3L5JA 4RX4D 5FB8A 1AIFB 2X9XA 1XMWA 1J9CT 3FQXA 4DQOL 5KSUB 3SN6N 4XP6H 5DEFB 4WO4B 1NFKA 5CP7A 2EDHA 2LTQB 4LBEA 4NQDD 1ORSA 4H1LH 1IQWH 2ZSVA 2O5XL 3D6GA 1HZHH 2QTEA 4UDTA 2BMKA 5I73B 3VRIA 1OB1B 1VFUA 5EA0L 3CZFA 3EFFB 5HHPB 1YA5A 1CN4A 4W6WB 2KKQA 5HXMA 4Z7UF 4DN4H 3HG1A 1B0RB 4L4TA 1Q1JH 5DC9B 2IPKB 5IWLC 3S5LG 3WO4C 2IPUK 5D93B 5TQ0L 1X5HA 4O4YL 2WSKA 1S9KC 1MRCL 2YZ8A 4PYHA 4P4RB 3MCG1 2B5IC 4JFED 4LF3A 2Z4QB 1M7IB 4KK6C 5CJXC 1GGBH 5CD3B 2EICA 3MLZL 4ELMB 3NCJL 3QEQB 4H5SA 4LHUD 3WFHB 4F9PA 5TDNB 1U6AL 1GOHA 5HGDB 4POYA 4DGVL 1HILA 1BVLB 2AJYH 4NKMA 4QHNB 4XNUH 1JZ5A 4PJGF 1ZANH 3N85L 3AM8A 3HI5H 4QRRE 4Q0XH 3DV6A 1NFIB 2NXYB 1VHPA 4Y5VA 1AR1D 4UNTA 1ONQA 1UWEL 3KG5A 4XH2B 4YWGL 5J7CC 4BSJA 5F7EL 1ZKAA 1T04B 1QHOA 4ZPVA 4NJAH 1T20B 3BP4B 3T0EB 4HIJB 3C87A 5F3HA 1XGTB 4LVOB 1UQSB 2LAAA 2X44D 4YXHL 3RDTC 3BUTA 3IDGB 5SWSD 3IETA 4HIEB 2AP2A 4UUJB 4OFYA 3D2UD 1U95B 3T65B 3ZT5A 3BO8A 3P40A 4NQEE 1OPGH 1U8MA 1NGZA 4JKLA 2HWZL 4M61B 5GS0H 3SDXE 2CRZA 2MHAB 3S98A 2GJ6B 1RHHB 1RY7B 2EDLA 4NHCH 4ZD3H 5JTWA 2VLKD 4LNRB 4F7PA 4X7CC 4FQ2H 4O2CA 2AXGA 3QXTA 5IG7A 3TVMA 2EE6A 1QBBA 2DMKA 4L3EB 2IQ9L 2JK5A 4DKAA 3WE6A 2AK4D 4FTVE 5FM8A 3UJTH 3TBYB 4M5ZH 4K7PH 5F70A 4H88H 2I26N 1EFQA 3JWDL 3OR6A 1M6OB 3ZKND 3WIIH 2LE9A 3QQ4B 4YHOH 1EEZB 2JB6B 4QHMA 1FNAA 4XHJD 1RJYB 2V2XA 3OF6D 5IBLC 3C5ZC 1SBSL 3QR2A 4MJ2A 2XY2A 4XNQB 2IGFH 3SJVB 1T1ZA 4U1MB 3GK8L 1TETL 4KHXH 3BDXA 3ULSA 3EBAA 4G6ML 1M05A 3PIQA 5B3NA 4XMKL 1XGQA 5D70H 1IGCL 1XIWA 2VDNH 4XI5C 4N8PA 2CGRH 1OAKL 3PNWB 3ZE2F 4LLUB 2KPNA 3WL9A 3AU1B 4HW6A 4WUUD 4ISVB 4PB0H 4LCWB 4FP8L 3MNWB 4JRYD 4JY6A 2BVTA 4P5MB 4M3KB 1PG7H 4NFBA 3MA7A 5FYJL 5FO7B 1X5AA 2X4RA 1NGYB 2FBOJ 4G8IA 5IMMB 5E8PB 1H0DA 4LHUG 1I9EA 3LQZA 3MX0A 4XNZB 4M7LH 2EIDA 2Y1VA 3D3VD 3VFMB 2ICWJ 5JUEH 4FZ8H 4PLKD 5D7IA 4UV7L 3VI3F 3MLWL 4OGYH 4ODTH 1CFSB 2H26B 2J1KA 4TNWF 1FBIH 4JM2B 1MIEL 1JV5A 2N7BA 5E5MB 1WJ3A 2YA2A 1R6VA 3JZ7A 3S37X 1FNSH 4NN6C 4BQBA 5BVJB 1SBBA 3B5GA 3VH8A 4LDLB 2BDNL 4Z7WA 2ZUYA 2E6PA 4KDTC 5J13B 2X05A 3VGFA 5JW3H 3I6KB 4JY4B 4MDIA 1AE6L 4FQJH 3MRRB 1YEJL 2BSED 3MLUL 5C0AA 3BQUB 1G7JA 5DO2D 1O0VA 2J4WH 2JB5H 3SQOL 2IBGA 3QEUB 1CTOA 5TGBB 1AGCB 1IM3A 2I27N 3MO1B 3KWWB 4OLUH 5FF6A 2VAAB 5FV2A 2I9LA 4Z7NE 2X4OB 1FRGH 4U3HA 4GAGL 5M95B 1ODAA 2OLDA 3IKCB 2F8XC 2BNRA 2IBBA 4MX7B 5D1QA 3DURB 5DQ9B 3ECBA 4TSCL 1GGTA 4Z5RA 2LFGA 2EYSA 1GVIA 4O00A 1D9KA 4LLDA 5F9JB 4XBPB 1QRND 3WFBL 5D2LA 4XCEB 3R0NA 3LN9A 4OLZL 5JORA 3B9DA 4D94A 3WYRA 2GW5A 2NR6D 5F88A 4YZFE 3HI6H 3ALPA 2WBJA 3NZHH 4K23H 3FO1A 4X99A 2JCCB 4PUBL 2AJSH 5HYJE 2R4SL 1N5AB 3OKOB 2B2XH 4WCYH 2AERT 4M9PA 4I8DA 1BMGA 3JUYA 5ITBH 3ZMRA 3S6CA 4NO3A 2HLAA 4AT6B 4GRLA 4P3DA 2X1XR 3QEGH 3MGTA 4YR6A 2EH8H 3QXDA 1MLBB 2H41A 4U3CA 5IKCB 1R3IL 4QXGH 1I85C 5DRXA 3WIHL 4C56B 2NY5H 2R1WB 1JTTA 1S7TA 3G5ZA 4WY7L 5EZJB 5JZ7C 2VDRH 5C3TA 1CDBA 5A2LH 4JFFB 3V4PL 1NANI 1F4WH 1JUFB 4P2QE 4RQQA 2BOCB 2DTML 4AEHH 5D5ME 1QSVA 3U82B 5FYLH 4OCNC 4DQOH 5TQ2L 4XAKD 1CDCA 2C5DC 5L88L 3GGWA 4FN0A 5C0CE 4U6HB 3OAZH 4P2RA 1DLHB 1G9MC 1RZJH 5F7DA 2QV2A 1RMFL 5EN2B 3C08H 2IJ0C 4DCQA 2NXZC 3F12B 1S7UB 2Y5EA 3ETBF 3OGCA 1RZKL 1GHFL 5EA0H 3SDAB 1NDMB 1TXKA 2VC2L 1CQYA 3CIQA 3FZUC 3P3YA 4QXWA 4ZSOE 4QOKA 4RGMC 1HOCB 1PAMA 2VABA 1U8HB 4JRXD 4PFEA 3D0VB 1FZJA 1IE5A 5DK0B 4HUWB 1A47A 1OQXA 1ZSDB 3BDBA 2AXFB 2R56L 2X70A 5IM7B 3VFPB 2YUVA 1NUFA 5HSFA 3DTXA 1QR1A 4O4YH 3ARFC 3FMGL 1A6TA 1MRCH 1D6EB 4HK0B 4KKBC 3EO9L 2DLTA 4PR5A 5DUML 5E70A 3STZA 3GSWB 1T66C 5E4IA 2FHBA 4Z7VB 3IFLL 4L8SA 2XQYG 1CXFA 3MLZH 5KVGL 1YEHL 3NCJH 4YDLC 4AM0B 5KN5A 3ZTNL 2IAMA 3MCKB 4DGVH 3ARDA 5DRNA 3WN5B 3TF7C 3VG9B 1RPQA 3ZYOA 4HUNB 3G04A 3HG1D 3ZTJH 4L4TD 4K7PY 4MDJA 3BZFA 2OYPA 1A0QH 4GBXD 4ZAKA 5GQBA 1SYVA 5IJVA 2XZQH 5CSZB 4MJ6B 4XVUC 4JFEB 4PJAB 4POZC 4X6DB 2VDOL 3PWNA 4YWGH 2VJXA 1R3JA 1VESA 3SGDH 5KS9B 3QUYB 2XXMB 1RK0B 4MNQA 5IVXE 3EO1A 3NFNA 2MKWA 4EUPG 3RKPA 1JTPA 1MCLA 2F54A 3LDBC 4HAFA 5IFHL 1RHFA 2EE2A 2VKWA 4J4PA 5MENA 2R9HC 4JFQA 1IL1A 4OIBA 4YXHH 4JFDE 3E6FA 1T6WA 4V1DA 2XRAH 4RFEA 4F2MB 4Q97A 1FGNH 5DFVC 1H3PL 5DUPH 1A7RL 3BGMB 2HWZH 3M17A 4XPHL 4KAQL 1BZ7B 2FR4B 3S4SG 4P4KB 1HE7A 2BNQA 2WIIB 2P8MA 4QRTA 3VA2C 5IW6A 1A6WL 2OI9C 5FM5M 2IQ9H 4UNUA 3OKEB 2VWEE 1FC2D 4OKVB 1JE6A 3ROOB 5SWSB 2VR5A 4AIXA 2FGZA 4I77L 5C86A 3UTZB 3LD8B 4WW1A 3BFOA 1HKFA 4G6JL 4JFZH 4HPOL 3VXMA 1GC1C 1SBSH 1OP3H 2GUOB 1D5BA 5FGCE 2VLKB 2W38A 4N68A 1TZGH 3AY4A 4OT1H 2OXHA 4PP1D 2QADD 4QHLA 1TETH 5E94A 3TVMD 1BQHB 1UM5H 3DVNA 1PKOA 4R97C 3S8WA 1IGCH 1A6ZA 4PRPB 2HKHH 4CN6A 3SE8L 4EBQL 2XT1B 4OZHE 4RWYL 4HS8L 5GGSY 2LU7A 2A73B 1OSZA 3E0GA 3MOAL 4Z77B 1YMME 3BHBA 3CFJA 3F7YA 5DUBB 4MD4A 8FABB 1H3TA 4PGEB 5GRUL 3NFPB 3CX5K 1DN0A 5GISL 1F58H 1EVUA 3EHBD 1VSCA 3HZVA 3QUKB 5E03A 4PRNA 5GRJL 3OB0K 5MP6L 4O2FA 4CN4A 3ULUC 1LNUA 1BP3B 2YPLA 2PETA 4Y2DD 4FMKA 4KI5D 4UINH 3ZDXE 4Y1AD 1MIEH 4OQ1A 2RIKA 3DUHA 4HIHA 4R0LB 1VERA 4ZUUB 1CGUA 3BAEL 3MRCB 3MYZA 1ORQB 3N50A 4PJHE 2BDNH 2P7TB 1I7RB 2D7MA 1J87A 1G7HB 3U7WL 3O11A 1DANU 4JREC 4O5LH 1KT2B 3FT3A 2CRYA 4LOUC 1V8HA 1YEJH 1FAKT 3MLUH 2OP4L 1XT5A 3FAXA 2XZZA 4MAYA 3AS0A 3D3VB 5FGBC 3TBTA 2EKSA 2I07A 1FG2B 2H2PC 2H9GB 2X1PA 1Q9KA 4GKSA 1K4CB 5D1XA 3RWJA 1T6VN 2VR4A 1UFUA 1ZT4B 4NO2A 3GJEA 1N6UA 5ID1A 4PLJD 2NY2C 3MRLA 1J0ZA 4BELD 3FFCA 4AK1A 5GZND 1KJMB 4MVBC 4PREB 5DSCA 5A16B 4GAGH 2QHLA 4X9GA 1T4KB 1OTSD 2C7UA 4TSCH 3BPOB 1MHEA 5F6HI 3PQYD 3NA9L 5I18L 1J12A 5BOPA 2J6EA 2NY0C 5D7JA 3WFBH 3AVEA 3SDDA 4OLZH 4CU8A 1T03H 3I3DA 5C0DB 3JTSB 1UJ3B 4G6KL 4ZUSA 2Q86B 3EJYD 1WBYB 4GMSL 1G1CA 3H9SB 2F58H 2FZ3A 2R4SH 3HE7C 4PUBH 2QLVB 3LV3B 4PJ7E 1PKQE 3ILPA 4XPBL 1U8IB 1NMBL 2BNRD 2E8YA 1RU9H 4S1QL 4KK5D 1XGUA 2ADGA 2J8UA 3QHTC 5CLTA 3LKQB 3RWCA 3C6LB 3BGFB 3CCHB 4ZFOB 4UQ3A 1PLGL 3BN3B 3CX5J 4PGZA 5EC1A 1QRNB 3V6FB 1A6AA 4JFHD 1MCBA 1W72A 1NCTA 4MCYA 4PJ5B 1R3IH 2XA3A 1KPRA 2OMNA 3A6BH 5HGAA 3WIHH 1I1YA 1P2CA 2DQEL 4WY7H 3V4PH 4NT6B 3G6JE 1CLOL 1CFNA 3CFDA 1C08B 1E28A 3DECA 1YNKH 2DTMH 3H2WA 4P99A 3K7UA 1EXUA 2G60H 3ESUF 3NCYS 4GRLD 5TQ2H 1UT9A 5C70A 3RVUC 5L88H 2VXTH 3ZKXB 3TT1L 2HT4D 1QSZA 4WFHE 3KYMA 3ULUF 1RMFH 1M71B 4ZTOL 2RFXB 5IK3A 2X4TB 3I6LD 3VFSA 3QO1B 4C83A 2XWJA 3D18A 4IMKC 4L9LC 4LGSB 4FQLL 4GOSA 3HCVA 4WEMB 4F80A 5JA8B 1GHFH 1JP5A 3QUMB 4X9FA 3DHMA 1ZLWK 3RU8L 5FUZL 5FYKE 4PRDB 2VC2H 2HKFL 4UT6L 3RBSA 4BUGA 4WU7A 4M1GH 3OKKB 5TPWL 4LLQA 5HJ3A 4RAVB 2DLHA 5IFJB 1NEUA 2OBGA 4KXZI 4NQDE 1U8NB 2F53E 2R56H 4KRPC 5TE7L 4XVJH 35C8H 4O9HL 2DD8L 1T0MB 3N1GC 1RUPL 3FMGH 4G3YH 5C0EA 4LVNB 3T8XB 5DUMH 3WNOA 2WMPA 2A1WL 5SV4A 3S3PA 1RZ8B 2JJVA 1MQKL 4MQSB 4UOW1 4QXTA 5KVGH 1YEHH 1GOGA 4ZODA 2XWTA 5CJBA 5I1IL 1UM6H 4TUJA 3ZTNH 2PYFA 2YA0A 4GKNA 4X6EA 3TT3L 2DS4A 4MQXD 5K9OA 3OMZA 5JHDD 1A1NB 2FECL 3QULA 1A7OH 4GAYA 4MLSA 3HUJB 4WWID 5IMKA 1YEIL 5CP7B 4LBEB 3VJ6A 4U3XA 3ZSTA 2VDOH 1ORSB 1FO0L 2ZSVB 3C8KA 1BZ9B 4PY7A 3WJLC 4K9EH 1KENH 4UDTB 3PABA 4P2OD 3GJFK 2FL5B 1IGIL 2VUOA 3CZFB 5KSBE 1NCCL 5FM5O 5SWQB 2IAMD 2R29L 5IFHH 1R3KA 2CIIA 1AO7E 1MWAL 4P5TD 1J8KA 3HG1B 4L4TB 4Q6IC 2EIEA 5IMLA 4PV9A 4ZAKD 4DFIA 1H3PH 3BH9A 3IDYB 1A7RH 1JZ4A 3LKRB 3C60A 4XPHH 3X12A 4M02A 4ONHA 3V7AG 3TO4A 4LF3B 2L0DA 1XR9B 3DMMA 3T2PA 2PO6D 3HAEA 2EDOA 1KJVA 4I18C 3K1KC 5IB2A 3MJ7A 1A6WH 4KMLB 4DEPC 4AL8L 2I5YL 5IESH 1ZT7A 4NFCA 1T7XA 4FQHB 3U9PH 1HILB 3QI9D 1S5HA 2KUTA 4NKMB 5MEND 3G6DL 2A83A 3HZKA 4DVRH 4I77H 3KPSD 2VDLL 2HRLA 3DV6B 4RMUA 2ED9A 1C5DA 4Y5VB 1ONQB 5E95B 3KYNA 1A4KB 5KZCD 2AK4E 3RFZC 1U8QB 3RNKA 2A6KA 4ZPVB 3GI8L 5DTFA 2WQRA 4ALAH 4OIAA 3AMKA 3ALWA 4Y4HC 1F2QA 4PJ9C 5I1DA 4R7NA 3VFNA 3SE8H 4EBQH 2CMRL 5BV7L 5TE4L 3CXHK 1U41A 1X4XA 1YEFL 3IETB 2IALA 4HS8H 4QRSA 4KKLC 1V3MA 3UDWC 3P9MB 2EYRA 1DVFA 1J86A 4FG6D 1U8MB 5GRUH 1DEEA 3RVWD 3NFSL 5MHSE 3WSQL 3V0VA 4HHAA 4QWWC 4K71C 5CJOL 4F7PB 2FEDD 2NX5A 3QUMH 4N0UE 1WK0A 2PXYC 1DBML 4HZAA 3TVMB 4U1LB 4XPAL 2YD5A 5MP6H 1KIRB 1YJDC 4YUEL 5DD1H 3MUZ1 5GRXG 2FO4A 4MNGE 4PJFB 5BVPH 3I2CH 1N7ML 1JGDA 4JRYE 4JKKA 4X7TA 3SKNA 3OR6B 1YY9C 1OGAD 4K7PX 3K8MA 3TJHC 4QHMB 4NQVB 3BAEH 2V2XB 1WEJL 1AC6A 1NGQL 1XCTA 4PTTB 3U7WH 4KJQD 4YDIL 4JEGB 4X6BA 4WI9A 4P3WA 1T1ZB 5KVFL 2OP4H 3MRHA 3C5SA 1ACYL 2Y5TB 1P4LA 4Y5XB 5CKGA 3IDXL 2O5ZH 1CF8L 3OTTA 4MJID 1M05B 3IAPA 3PIQB 4KUCD 5EOQL 5F8RC 4BH7A 1XGQB 2YPLD 3SGJA 1XIWB 5ESVB 4Y2DB 3D69A 3DXAE 4JDZA 2YN5A 2NTFA 4PRID 1B0GA 5J6GA 5CCKL 1MCJA 4ENED 3WL9B 1SJHA 4KK9D 3QFJD 2QSCL 2YS4A 4PBXA 4FABH 4JY6B 4OB5L 1ZGLA 3MA7B 1KXVC 4JQVA 4G8IB 1PG7X 4Z7OF 1H0DB 4TSAL 2XFXA 1JRHL 3HMXL 1I8IA 2BRRL 1P1ZA 4UU9A 3RIAK 2DF3A 5D7IB 1HHJA 3NA9H 5I18H 3MRBB 5D1XD 5F89A 2R2EA 5E4EB 4RISL 1ERNA 1FQ9C 1D5XA 3KVQA 4OD2B 1JV5B 1INQB 3QUXC 1AXIB 1F3DJ 1QYGH 3UTPD 3FFCD 4N8CL 4G6KH 3GKZA 3VH8B 4N5UA 4N0YL 4GMSH 4Z7WB 4JHWL 4LSSH 4BYHA 1YEEL 2FWOA 3V95A 2UVFA 4P9HL 3CXHJ 1TCRB 1NMBH 1MIML 2DIJA 3OXRA 1MRFL 3PDGA 1G7JB 1NJ9A 3SEPA 3D9AL 3PQYB 1PLGH 2R2CA 3MBEA 5D7JD 1QPPA 4X4ME 3SDDD 2LU4A 3IDJB 1IM3B 5JXAL 5HI5C 1RULL 3QXUA 3OG6B 2OTWB 5FEBA 4E41A 3L1OH 3TYFA 5IHBA 2CK0L 5E6ZA 3UJIH 4GS7C 3VRLF 4HBCL 5F71A 3MLVL 5JXEC 1CLOH 3THML 2BNRB 1AGEA 4MB5A 4NDMB 2WWMC 3WHXB 3BEVA 3ECBB 2W9EL 4UOW0 5BV7B 2AQ3A 1I1FA 4HFWA 4Z5RB 5ISZE 4KVNL 2EYSB 4XNXL 2DRUA 1D9KB 2ATPB 4XPTL 3LEYL 5DA0B 4M4PA 3CVIH 4XMPL 5D2LB 3TT1H 5C07A 4OLVL 3F7RA 4N0RA 4HKZA 3PWUA 4ZTOH 3DI3B 5I75C 2ZUTA 5FECB 1TNNA 1NC2D 5F9WC 4FQLH 2WBJB 4Z7QF 3FO1B 1SMOA 1V3JA 4YQXH 5C3LD 2H2SD 3RU8H 2NLJB 4PJXA 5FUZH 5J4MA 3DWTA 3K74B 2HKFH 4XAKE 5MEPA 1S7WA 5F6IC 5EBMA 3VGAB 2DQFB 4YBLC 4UZGA 3OAYH 4NO3B 2HLAB 2ICWA 4GRLB 3L6FA 4P3DB 4F7EA 5TE7H 3MGTB 4YR6B 4O9HH 1X5JA 4YPGA 1RUPH 4UAOB 4Y88A 4IDJL 1Z5LA 5D8JL 2A6JA 2BVUA 4YPJA 1MQKH 5HY9A 3UTTE 2DIAA 5DRXB 2ZSWA 3PV7A 2VWEC 5L2KA 2X4SB 4DAGH 3G5ZB 4IIQA 5I1IH 1JPTH 3U2SB 4RQQB 4Z76A 3FN9A 4TVPL 5D5MF 1A3RL 1C5CL 3WD5L 3TT3H 3UTQA 1AD0A 4G8FA 3BN9D 3IFPA 1FNGB 3E6HA 1C1EL 2PUQT 2VITA 1FYTD 3B9KD 3GGWB 3QZWG 4PLNC 2W91A 5F7DB 4YHNA 4U2ZA 3CMGA 3RWGA 4WGVB 3WUWA 3OGCB 2VZVA 2DMBA 2V7NA 1R5WA 1MF2H 4G9FD 4KZEL 1IGIH 3SDCA 1CICA 4QOKB 2R29H 1OAXH 5H35B 1R0AL 2BZDA 2IH3A 1XF3A 2CLRA 3FB6A 1K4DB 2R0ZL 3RZCD 4NSKB 4HULB 2X70B 2EZ0C 4PJXF 3CH8A 5D1ZD 3DTXB 1QR1B 4WHCA 1A6TB 1QOKA 5L6YL 1KIQA 1YUHA 4PR5B 3STZB 1GC1L 1LDPL 4PJDA 1OGTA 5D7KD 3OX8A 4O58L 5HDBE 1H3XA 1IILE 1BQLH 4L8SB 2A77L 4P2OB 4JKWA 5KN5B 2A6DA 2AJ3A 4AL8H 2I5YH 2IAMB 3VCLA 7FABL 5DRNB 3MLRL 5J8OA 4PJCE 2X4PA 3KYAA 3G04B 2OX5A 4MDJB 2VDLH 4BSWA 3PP3K 1FP5A 4ZAKB 1L7IL 5IB3A 1SYVB 1JNHB 2BVEA 2FLRT 4JG1L 4XB7A 4BA8A 3HRZB 4G5ZL 3JVGA 3P9WB 3PWNB 1KXQE 2UWEA 1QFOA 5IV2A 4K7FA 1R3JB 1BOGA 4L5FL 2PO6B 1T22A 4L4VA 2NY3C 3QQ9D 4NQUA 5IVXF 3LN5B 3EO1B 5AG9A 2K3TA 3NFNB 4IRJD 2F54B 2IAND 3GHEL 3LPFA 3B2UC 4KTEL 5MENB 5BV7H 2CMRH 4JFQB 5TE4H 3GBNL 3E6FB 5J1TC 3PJSA 2J6EL 4MWFA 2EIBA 4RFEB 5GJTL 3IGAA 1O5DT 1F90L 4D2NA 5E9DE 3M17B 5D71L 3NFSH 3GDBA 3WSQH 1CXIA 1FN4A 1KCSL 2FDBP 3RA7L 4O51A 5CJOH 5KZCB 3PWLA 5AUMA 2SEBA 3OQ3B 5C09E 3VXUA 1JI2A 1DBMH 4JLRA 4F9LC 2I25N 5IW6B 1JHLL 4XPAH 5F96H 2MMXA 4PG9A 5ID0A 4G80A 1QP1A 1UB5A 5EUOA 4L1DA 5K59E 1N7MH 1CFBA 5SWZD 3EOAA 4LCYA 4YHMH 4FQIH 1W72L 3AAZB 2HN7A 5D9SB 4MJ5A 1NGQH 4OCXL 4X6CA 3KPRA 2FD6L 1QSED 1D5BB 3DSNA 2BERA 3RHWK 4P9MH 1L9NA 5KVFH 5J12B 1F6AA 3EDFA 1OTUD 4QHLB 5E94B 5EB9A 1UWXH 1DANT 3S3SA 1EEUA 5HHOE 4PV8B 3RX7A 5I1KH 1CF8H 3GSNA 5EOQH 1ZGLP 1A6ZB 4I0KA 2UWEF 1FGVL 5FDWA 4PJIA 5CCKH 1OGAB 1OSZB 2RR3A 2HT2D 3KPTA 5ALCL 4KQ3H 3BHBB 3CFJB 3F7YB 4MD4B 3O2DA 3DX8A 2QSCH 4GMTL 1OCWL 4OB5H 2XACC 4IMLA 1X5FA 3OJDA 5E1AB 4ZOEA 4TSAH 1JRHH 4WI6A 4RBPK 3MV9D 5KOVC 4I3RL 4O2FB 2DKMA 4MJIB 1LNUB 5GJSL 2YPLB 2GK0B 3RI5F 3NABL 3ZDXF 4RISH 2Y72A 4LLAA 1TJHL 3KJ4C 2OL3B 4PRIB 1KN4L 2JKXA 2JJSA 1MFAL 12E8H 1CDIA 4N8CH 4HIHB 4ODVH 1Z9MA 2X89A 3CDGA 3QFJB 1AR2A 2PTUA 4K07A 2FX9L 4WTZA 1QSFD 4JHWH 3P30L 1H9VA 4TSBH 1YEEH 4P9HH 3FQWA 2NY1B 5TF1H 3BJLA 4YHKL 2H8PA 2I07B 3BOVA 3TA3D 2X10A 1Q9KB 4GKSB 5D1XB 3RWJB 1OF2A 3RUGA 1WSST 5B8CC 4G6AC 3GJEB 5ID1B 3VFOB 2E6QA 3FFCB 3W11D 3JWOC 4M6OL 1MH5A 2CK0H 5INCB 2EXYC 2NCMA 4ZMAT 1GOFA 4WEBL 4XC3L 1OM3L 5BOZG 5DSCB 8CGTA 3VXSE 3FHQA 4HBCH 1R24A 3MLVH 4LKCA 4X4YA 3THMH 4PJIF 4WWKC 1E4XI 2CPCA 5DRWB 2W9EH 3GMLA 4MYWB 1WBXA 4JE4B 2EDRA 4XPTH 3V7AE 3LEYH 1TITA 5D7JB 1LE9A 4I0PC 4XMPH 2CKBA 1KC5H 2JIXA 4OLVH 5EO1B 3SDDB 1GAFH 4E41D 1S9XA 3VXQA 3MV7D 2IH1B 1CIDA 2NZ9D 4ZUSB 2FZ3B 1EHXA 3EJJX 2YD2A 1G0YR 3ILPB 1JZ7A 3W9DA 4UTBL 3T0VA 5ICZA 1XGUB 2J8UB 1N59A 1BQHG 3QIUD 5T3XL 3U4EA 4IOFC 4GG6E 3UYRL 1MAMH 1IKFL 1S7XB 3H0TA 4F58L 4S2SA 3ROLB 4HD9A 5EC1B 3HB3D 1NLDH 1A6AB 5C07D 4IS6A 4IDJH 3QRFM 1KPRB 3K8KA 4WI8A 3IFNL 4LLYA 3CFBB 4YDKL 1NC2B 1MHHA 3VFVA 5HGAB 1BJ1H 4I3SL 4XCYA 4EI6A 1Z3GL 3O2VL 4Q74A 3RUGF 3TWCL 1RV6X 1CFNB 4BFIA 3CFDB 1E28B 4TVPH 1ZVSA 1A3RH 1C5CH 3WFDL 3WD5H 1UKSA 4DGYH 1EXUB 2OZ4A 3QXAB 3RL1A 2D0GA 1C1EH 1IEBA 1ES0A 3KS0H 1W0VA 5IROA 1ED3B 5B4MC 5CBEA 5IK3B 3VFSB 1SVCP 2HFGL 3U83A 3BW9A 3EFDL 3LRSA 4C83B 1TQBC 2P49B 2P5ED 5L2KD 1NCUA 2ICES 2J8OA 4R6UA 5JHDE 4DOHB 4KZEH 3VWJC 5IOPA 1JPFB 5A2IH 4WU7B 5HYSA 1X3DA 5HHVL 2HVKA 2VOTA 1QQDB 1A7QH 3RVXC 1R0AH 5HJ3B 2NYYC 2WWKT 4LGRB 4P46C 2R0ZH 3WO3B 2XY1A 4XVSL 3S96A 2PTTB 4M62L 3B9KB 4LAQL 5C0EB 5C1MB 4Z0BH 1LO5A 5L6YH 2BRQA 5CEXB 2NNAA 1LDPH 1U9KA 5BW7C 4GRMA 4O58H 2KBGA 4Y4KD 4WEUD 3O9WA 4YHYC 2A77H 4QXTB 4I2XE 4G9FB 2XWTB 3RRQA 2BOBB 4WI2A 1Y6NR 3D39A 4TUJB 3AFLA 3SDCD 1O7SA 2PYFB 1CICD 4GKNB 4X6EB 3TLRA 3GO1H 4DZBA 3SGDI 1REIA 5K9OB 5EPMB 1EEQA 1L0QA 1ZE3C 2AGJH 3QULB 4KKAC 4EN3C 4P3CL 1RUAL 1LP9E 1JGUL 1ZWIA 3QDJA 1L7IH 5CJQL 1LVEA 3L9RA 4APQC 1UZ8A 1BOYA 3ARBC 1BPVA 3MA9L 4JG1H 2F15A 1I1RA 1RVFL 2BHUA 3VJ6B 4G5ZH 3RKDD 1P84K 3C8KB 4PY7B 1F02I 1QLRA 5KSVA 1D5MB 4MD5A 4G6FD 1MJ7L 2FJFA 5KSBF 3I3EA 2QQNH 3PL6C 4CADA 1CL7L 5IEKA 1R3KB 4U1JA 1B9ZA 4LHJB 4OLXL 4PJBF 4KTEH 2CIIB 3KXFD 4HS3A 4NGHL 3GBNH 1DE4A 5IMLB 2Y23A 4EJ1C 2J6EH 5GJTH 4PV9B 2FX7L 1H8SA 3LN4A 1AHWB 3BH9B 3PXJA 1F2XK 3U4AA 3X12B 1NGXB 2F9BT 3C5JA 3L5IA 2R69L 5D71H 3WUZA 1SHMA 4ONHB 2Y36L 4EI5D 1KCSH 1K8IA 4M48L 3LEXB 3BD5A 3SKOB 5J3HC 1HNFA 1KJVB 4PJ8D 4HGWA 4CVXA 5IB2B 1GGIH 3MJ7B 1JHLH 1EO5A 2CR6A 4ZFZA 5D7SH 3E2HC 3G9AB 3A67L 3HPLA 1E6JL 4NKOA 3QG7L 2VH5L 3VXRA 1S5HB 2EDDA 3EOTL 2DLFL 2DWEA 2RJMA 3HZKB 1FZMA 2HJLA 2B4CC 1FVCA 1N6VA 5IHUL 1W72H 1C5DB 4BFBD 3LS4L 4GSDL 5DEGA 3W0WA 1U58A 3OL2A 4OCXH 4EDWL 2FD6H 3TO2A 4ETYA 3KYNB 3LQMA 4WDIA 4L3EE 3RNKB 2A6KB 3W5MA 3B8YA 3VXUD 2DOCA 2Z35A 4NP4L 5DTFB 1YYML 4QRPD 1GSMA 4FHBD 2FATH 5I1DB 4JFXA 3VFNB 3GB7B 1FGVH 5SWZB 2IALB 5E8EA 3GMQA 2BC4A 3FRPA 4LLMA 3O6FC 5ALCH 3UAJC 1G7QA 4N9OB 2EYRB 4OZGE 5IW1A 1KXTB 2CK2A 3SJVE 1DVFB 1DUYB 4GMTH 4HJJL 1OCWH 6FABH 3KPLB 3V0VB 4HHAB 4RMWA 4KK6D 1QVOA 5DK3A 4XBEL 1NDGA 5T3ZL 2NX5B 5EU6D 4M6NH 3WIFB 4UNVA 4W4NA 4I3RH 4UILL 3DRQA 1AFVL 5GJSH 2FO4B 3MV8A 1MHCA 3NABH 4BUHA 3F7PC 4X7DC 3FQNB 1JGDB 2DJUA 3GSXA 1P84J 1TJHH 3SKNB 2YN3A 3V0AC 1I7TA 1MFAH 2CH8A 3CFCL 1TQCC 1A1OA 1ZS8B 4KV5F 4GUPA 1XCTB 1VGKA 2D7QA 3BSZH 3P30H 1I7ZB 2XNAA 4X6BB 1PDKA 4M4RA 5D2NA 4IJ3C 4D8PA 5IJKA 2CQVA 4CDGC 2A9ML 4HK3J 3C5SB 4YHKH 3MV9B 1GYAA 5M7QA 1AP2A 4L9DA 1KCVL 1MLCA 4ZFGL 2HG5A 3DIFA 5F3BA 2XQBH 4GLRH 3UZQA 3RDTD 4U6XA 3T1FB 4JDZB 1JNNL 1ZMYA 2NTFB 1B0GB 1A02N 4Y5YB 1RZ7L 4HFUL 4Q2ZA 1FL3A 3V6ZB 1OM3H 4XC3H 1U93A 3U9UA 4QGTA 4IRSA 4OM1L 3MNZA 2VLRA 4OCSH 2XFXB 2X4UA 3ARSA 1G1YA 4M7ZB 2R2EB 1QPXA 4U7KA 4J3SA 4CKVX 4NQCE 4Y89A 3VFWA 3DGCR 4G42A 5HDOA 5JW4Q 3C5ZD 2VLME 4NNYA 2KQMA 5SX4I 1KPVA 2MPAH 3MRPA 4NJ9L 1MREL 2FWOB 5C0FA 2ERJC 1RZFL 1UB6A 2BK8A 3HAEH 4UTBH 2DBLH 5CEYA 4UBDD 1UWGH 1NJ9B 2PYED 4XI5D 2QKIA 1IKFH 4WIQA 4F58H 3MBEB 1WF5A 4I1NB 1IFHL 1IAIM 3GMPB 1XR8A 5DVKA 2JIXD 2NTSP 4WTWA 1MI5E 1X5LA 3EUUA 4MS8C 4YDKH 1R5VA 4E41B 3MV7B 4HIIB 1BFVH 3TYFB 4I3SH 4F37F 1Z3GH 1DQQA 5C6TH 2OTPA 2BSTA 4IHOA 3TWCH 3HKFA 5F6HJ 2VLJA 1MCPH 1KTRL 1HQ4A 2FB4L 5I8OL 1AGEB 4EQ3A 4NBZB 3DETC 4RAHA 3BEVB 1I1FB 1KF9B 4ZFFB 3QHFH 2JELL 5C07B 3W39A 3ES6B 2E9WA 1QFWL 4HKZB 3PWUB 4HUUA 5I30L 4XXDA 1DUZA 2HFGH 2WUBL 2EYTB 4JFFE 3EFDH 2DLEA 5I15L 4RMTA 2E9BA 3AB0C 4LVHB 1WC7A 3D48R 1URLA 1BBJA 1UENA 4PP2A 1KIPA 1AY1L 1LD9A 2K9UA 1YMHA 5F72S 5MEPB 1FYTE 1P4IL 4N0FA 4FQQA 4OLYL 4KU1A 4J3VA 1WIPA 3NIDE 2ICWB 3TZVC 3BZ4A 3L6FB 4OD3L 4XVSH 1EA9C 4WFGE 4M62H 1CXKA 3MZGB 4YPGB 5FYJE 4LAQH 3U48A 1BJMA 4X83A 3QIBA 2Z91A 3ZLQC 2FLBT 2A6JB 1JF1A 4OZIF 4W6YB 2ZSWB 1XGRA 2WLZA 2P5EB 3MROA 5L2KB 2XICA 4HWBL 2EDQA 5E0QA 3K1DA 2WINA 5GIRB 4PRHD 4Z76B 2FX8H 3ARGC 1AD0B 3FTGB 3GSNL 4G8FB 1X7QA 3CH1A 4R4ND 5DS8A 3JV4A 1VFAA 4YHZL 5E8DL 5IBTH 4P3CH 4NWTL 4WFEE 3E6HB 4MXWL 1JGUH 2VITB 4HLJA 5CJQH 1B90A 3VWKC 3BRFA 1L6XA 3TM6A 3R0MA 5I6XB 1NUNB 3BJ91 3RWGB 4Y19D 3EJZC 3O2DL 2GCYA 3UZEA 2EDFA 2X4NA 4Y4KB 3WUWB 3L7FA 4KVCL 5GGRY 2V7NB 1R5WB 1PSKH 5BJTB 3SDCB 3HFML 4FFVC 4QRRA 1CL7H 1CICB 4HWZB 4JN2A 3WLBA 4PG2C 4OLXH 1KN2H 2IH3B 4U7SA 1XF3B 3Q6GL 3HS0A 2CLRB 3FB6B 5DC0A 3T09A 4NGHH 3QDJD 2J5LB 1KJ2A 2FX7H 1DQLL 5MI0C 1YUHB 2JJTA 2R69H 2Y36H 3VD7A 4PJDB 2IANE 4M48H 5FIEA 3FO2A 1KTLA 2EDJA 3OX8B 1BFOA 4TUOA 3BZEA 1LMKA 5JZ7D 1NUDA 1RAMA 2C1OB 4BK5A 1J0JA 4G6FB 4ODXA 2A6DB 2AJ3B 4YFLI 1WZMA 4JB9L 4NQEA 1E6JH 4FXGA 4HMEA 3VCLB 3SDXA 3EOTH 3AS2A 5EO0A 1VB9A 4OZFA 3JSSA 1IQDB 2X4PB 3O8XC 4F8TA 3CDYA 2D4FA 4AH2A 4F7TA 4BSWB 3PWVB 5IB3B 1U8OA 3STLA 5IEHA 5IHUH 1FNFA 3LS4H 4GSDH 1VENA 4EI5B 5D6CA 1XZ0A 1SYSA 5D7LE 1G0DA 4FTVA 4K7FB 1ZVYA 2Y7QA 3HMWL 1BOGB 3OPZL 1T22B 1QBML 3OG4B 4NP4H 4PJ8B 3U30B 2Z31C 5IBUG 1BJ8A 1YYMH 2OK0H 1GGYA 1NBQA 1WWAX 5CZXC 3O3EB 1PD6A 4XRCA 4BM7A 1YY8B 3AGVA 3RGVC 3FB7B 4YX2H 3W2DL 2R8SL 5C9JB 1K2DA 3O4OC 3PJSB 3VMPA 3I02A 1UJTA 3ARFD 1KFAL 1WAAE 4HJJH 4P23C 4KKBD 3ZYZA 5I74C 2VL5A 1FN4B 2V9TA 1T66D 1DL7H 3NGBC 5FKAA 3PWLB 5AUMB 5T3ZH 4X80H 4FOMA 2OR9L 3GSQA 3VXUB 1F3RB 2C1PB 4PRPE 4JLRB 1HK6A 4PG9B 4UILH 4NQSB 3SO5A 5ID0B 4G80B 3BPLC 4D3CL 1UB5B 5EUOB 3O3UN 3PDOB 3QCTL 5K59F 3GZKA 4YDJA 1A7BA 2YPKB 3EOAB 1PQZA 4LCYB 1MCOH 2W60B 4NN5B 3RX8A 3CNKA 5CZKA 4XVUD 2HN7B 2YD9A 3TNMA 4JDVA 4POZD 1LO4L 4X6CB 4HJ0C 5GS0C 5IB5A 1F6AB 3REWA 1E4KC 2OSLA 4RZCA 3OB8A 1Q9WA 1KCVH 5C08D 2L7JA 4G7VH 4R9HA 4ZFGH 4LSQH 1IGJA 2QSTA 3VGGA 3KLDA 1VPOL 2AABL 5DZNA 2R9HD 3WJJC 4LSUL 3V6BR 1JNNH 2FSEB 5FDWB 3F6LA 3LKOA 3Q3GA 5HHME 1RZ7H 2BY3A 4HFUH 4ODBD 3DX8B 5J57B 3C9NB 4OUOA 3W9EA 3DUUA 3I3BA 4ODHL 4IMLB 1YPZA 5C0BE 2LV4A 3FN0L 2G5BA 4OM1H 3OJDB 1MPAL 5AAWA 4U1GB 1CWVA 2R15A 4L29A 4R3SA 3SO3C 2DL2A 4FQXA 3RDTB 1FVDB 4LCIH 5CUSL 1P7HL 1UACL 2OJEA 4QY8A 3L7EB 4RA0C 3CDGB 3O4LA 3HE6C 4ZS7L 3P4NA 3NH7H 1MFCL 4N0CD 1ROWA 4NJ9H 4LPYA 4U1IA 1MREH 1EJOL 1RZFH 4JZNA 2LTQC 2VLRD 3DOSA 2ZG2A 1CBVL 3P4OB 5HD8C 2XTJB 3UXFA 3A0OA 3NVQA 3DHJA 4LIQL 5D6DA 5I73C 4AENA 2WIMA 4X5WA 5AEAA 3MMEB 1IFHH 1OF2B 5GSVB 1WBZB 3MRIA 1NFDE 4XCFH 1NCNA 3H9SE 1TIUA 4OD1H 1AXSA 3ESVF 1XFPA 1MH5B 2V2TA 1EAPA 3FONB 5D93C 1N64L 4Y16A 1VFBA 3O3BA 4X4YB 4ODUB 2FB4H 5I8OH 5F7MC 5KAQG 4K3EL 3GMLB 3ULUD 2VZSA 2X6MA 1WBXB 4DWHA 1NCDL 3EOBA 1YPZF 2JELH 1LE9B 5FAAA 2CKBB 2JIXB 25C8L 5MERB 1QFWH 5I30H 1F6LL 4U6YA 3SKJL 2WUBH 4DTGL 3VXQB 3DYOA 2NY7L 4WO4A 3GI9H 1KUMA 1AY1H 2Z9TA 4LOUD 3W9DB 1OAZH 1BAFL 1P4IH 3CVHL 5D4QA 4OLYH 1N59B 2PCPA 1CK0H 1HINL 3K81A 5CBAA 2H2PD 1CYGA 1MCCA 3H0TB 4MSWB 4RMSA 4S2SB 3Q5YA 3T0EC 1H5BC 2D0HA 4Z7UE 3TN0A 4U0RB 4IS6B 2NY2D 4ZSOA 2CRMA 4NUGL 4LLYB 5ERWB 4NN6B 1MHHB 1T2JA 1L0YA 4NZJA 5IIEA 3RWFA 2ZOLB 4RGNB 2IWGA 3JV6A 1EDQA 1QBLL 2HRPL 1BD2A 4BFIB 4PD4K 5CD3A 4M8QA 3DO3A 4ELMA 3DSFL 1EUUA 4HZLA 3KPPB 1G6RA 3WFHA 4JJHA 3GSNH 2VL4A 4YHZH 5E8DH 3RL1B 4NWTH 1IEBB 4MXWH 4NRYB 4QHNA 2WLYA 5GGSA 4L4JA 1W0VB 3QIBD 2H6PA 4PJGE 5DLML 5CBEB 4M6AA 3QQNA 1KB9K 1NFIA 2ZPKH 3QWOA 3O2DH 3BW9B 3LRSB 3B4NA 2F5BL 3HE7D 4KVCH 4YO0A 3P0VL 1NBYB 2VSCA 5IOPB 2NY5C 3HFMH 1X5KA 4FS0A 2HVKB 4GRWB 4G8GE 2CKNA 3WXWH 1T20A 3DPBA 1KEML 4M5YH 1AQDA 3B2VH 3Q6GH 3BP4A 2QQQA 1X5IA 4FQPA 1XGTA 3RY4A 5JIPA 3PHQA 5JO5B 5HI4C 1DCLA 2B4CL 1DQLH 1FE8H 3BZDA 1LO5B 1U95A 2NNAB 1ITBB 2AJVL 5E6IA 4Y19B 4ZUTB 3ET9F 4HH9B 1RZJC 4GRMB 5DQDL 2GJ6A 4X5LA 5T33L 3KXFE 2Q8BH 4LNRA 4W68A 2ZCKL 4RRPA 4JB9H 2OMBA 2ED8A 4DZBB 4M8VA 5CINL 2EDYA 5FGSA 3OKNA 3RVUD 1HQRB 5EOTB 3O0RL 1ZWIB 3TBYA 3QDJB 2IADA 1BREA 3L9RB 1X5XA 2MJWA 1BGXL 4ELMF 2EDEA 1YQVH 3QQ4A 4JM2C 1CU4L 1QBMH 1QLRB 4L3CA 4HKJB 2FJFB 5L7XH 1FAIL 4CADB 4WUKH 4HK3N 3BRDA 4NQED 5IEKB 5J13C 4U1JB 5FUOL 3MRNA 3MOBL 2Z8RA 2PW2A 4WFFE 2R8SH 2YSSA 3B43A 1HH6A 4HS3B 4KRPD 2WUCL 1DE4B 5FXCH 4XXCC 2EKJA 4XBGB 2CKBH 2E7LA 1KFAH 1CFVH 4LLUA 3BYTA 4PD4J 3SE3C 1I1AA 3C5JB 4RIRB 3ZE2E 2MSPA 1K8IB 2DYPD 4WHDA 4R90L 4FTVD 1H15A 4ISVA 4CNIA 1BX2A 1G7MB 2W59A 3MNWA 4HGWB 4CVXB 5FO7A 2PNDA 4ZFZB 4D3CH 3HPLB 4IOIB 4NKOB 3VXRB 5JDJA 1KB9J 5AWNH 3X3FL 1TVHA 1FZMB 2VRAA 4OF0A 2HJLB 3TBWB 1FC1A 4XPFL 1FSKC 5EU6E 2XN9E 3JV5A 3GBLA 4KJWC 1MCIA 3W0WB 3MGOB 5E5MA 2FJHA 3TO2B 4WDIB 4LSPH 3VXPA 5CILL 4YXLL 2I60L 1EH9A 2Z35B 3CPLA 4TULL 4TYUA 3VDAA 5BO1L 2CUMA 1CDYA 3V52L 4EIGB 3I6KA 4JY4A 3MRRA 3S34L 1VPOH 4JFXB 2AABH 5HDQL 3BQUA 2Y06L 2OZ4H 4X9BA 1JRHI 4ODWA 5E8EB 2DWDA 2FCBA 1IBGL 5SX5H 4LLMB 1CI5A 4AQOA 1G7QB 4NZDA 5IW1B 3WV0A 4P2CG 2DLGA 1T1WA 2Q8AH 4J7RA 1TJIH 2QSVA 1RFDL 4ODHH 5AZ2L 3KWWA 4ORGB 3FN0H 3SCMC 1QVOB 4XTRC 4B7IA 2EC8A 5JQ6L 5HVFB 4L8BB 3M1BB 4Y7MA 4Y4FC 3DRQB 4GRWH 1IAKA 3MV8B 1RJCA 5DQ9A 4ETQB 1CD9B 1T5WA 3GSXB 3B83A 5CUSH 1MCEA 1UACH 4RDQG 1U0QA 1I7TB 5IGXL 2EE3A 1FYHB 4L3AA 4ZS7H 3K80A 5CWSB 1CLYL 3JTTA 3PE9A 5GGVH 4OF5A 3FCTB 5D7IE 1CBVH 1N5AA 1LO3L 2OI9B 2WP3T 5EDXA 1AP2B 1IT9L 4PJ9D 1MLCB 4JM2F 4LIQH 4QRUA 4OI9A 3DIFB 3SDAC 3VMNA 1RK1A 3TIDA 3D25B 5T5FH 4FQXD 4U6XB 4K8RL 4PJ7A 1PKQA 4OM0L 3NTCL 5AYQA 4K55A 1J0YA 4Q2ZB 4L8DB 1FL3B 1CGYA 1X5GA 1U93B 5F7KC 1N64H 2HJKB 5C0AE 2BX5A 4HKBA 3DVFA 4IRSB 3OB0H 3MNZB 4YXKL 2VLRB 2PXYD 2R1WA 4WV1A 1IGML 1T1XA 1UZ6F 3HAEG 4K3EH 2X4UB 4EQ2A 4K3GA 4R26L 4P49A 5GSRA 4JCLA 3SE4A 3QP3A 3AREC 2XA8L 4DZ8A 5HYJD 4IOSD 1PFCA 3TH4T 25C8H 3WN5C 5HTSA 3VG9C 3G6JA 4K3JL 5GS1C 4RMQA 1KJ2L 4DTGH 1FHGA 2JTDA 2NY7H 1DLHA 2XKUA 3DGGA 3RTQC 5BS0E 4NNYB 2P45B 2ZUVA 5E2VL 3QUZA 1KPVB 3F12A 1S7UA 1DSFH 1DQML 5C0FB 4TNVF 1BAFH 4KDWA 3O2WL 2A6IA 5A3ID 3V9FA 4DKEL 1HINH 3QUYC 4HV8A 2ZCLL 1DJSA 4RX4A 1FZKB 3D0VA 4OGXL 1A6PA 4HUWA 1XR8B 4OGAC 2JCCF 4NUGH 5IM7A 3UC0H 4P2QD 2DQTL 5KSAC 1R5VB 3GJFB 4GQ9L 3KPNB 5I19L 1CD0A 2HFTA 3O3DA 1DQQB 4NYLB 3DV4A 4NQDA 3GSWA 4M43L 5DJAB 5E1HB 2VLJB 1QBLH 2HRPH 1HQ4B 5C0CD 1N8ZA 2DIBA 4Q9RL 4AM0A 4P4KC 1K85A 1M7DA 1EFXA 3MCKA 5DJXA 5JMRA 3X3GH 4Q6YA 3QUXD 4JPKH 3RIFK 4HUUB 4B5EA 2DQHH 1WT5C 1DUZB 4XXDB 4PRHE 4ACPA 5L0QB 1AXTL 2P1YA 1WC7B 3LD8C 1U3JA 4PJAA 1BBJB 3G5YA 3P0VH 4PP2B 1KIPB 1LD9B 1YMHB 5KS9A 2ATKB 4ZOBA 4N0FB 4FQQB 4LHUA 2MCG1 2BJML 1KEMH 1EGJA 1IGFL 4P2RE 5IFAL 2ARJQ 3BZ4B 2XOTA 4JZJC 1IAII 1TENA 3QIBB 2Z91B 5HI5D 3WDJA 4A6YA 5H94A 3MLSH 1KCUL 4PGDA 3BGMA 1XGRB 5DQDH 1AO7A 1OLZA 4QOKE 5T33H 2WINB 5JXED 5IMOB 3IJYA 2J8HA 1SVZA 3L3GB 3MRJA 2Q7NA 4TQEL 5J11B 1X7QB 3CH1B 5DS8B 5DJCA 3JV4B 1VFAB 4CVUA 4MHHG 3O0RH 2LVEA 5DA4A 1NUGA 4Z7VF 4JRWA 2E9JA 4Y8DC 1CFQA 5LJYH 1AD9A 3D2UA 5IR1B 3UZVB 3HI5L 3UTZA 4Q0XL 4L1HA 1ZLWH 2GCYB 3LQAH 2X4NB 1CU4H 3L7FB 4GXUM 5E2WL 4JFDD 3DI2B 3ARWA 1FAIH 4QRRB 4IM8A 4JN2B 4NJAL 3WLBB 2ZKHL 5FUOH 4XT1C 3HS0B 2P42B 3NIGF 2WUCH 4PJAF 2AK4A 4X6DF 5CAYB 3VXOB 1KJ2B 2LABA 3ILQD 4HS6A 5KS9F 3AXLA 2A73A 4NOFA 4UIKL 4Z77A 5L9DL 4L9LB 4DVBA 1DR9A 4MNQE 3H9ZA 4QXUH 1KTLB 1MRDL 2F54E 5GS0L 3OF6A 1WIUA 3BZEB 2JLLA 4ZD3L 2J12B 4JFPA 1OHQA 1Y0LB 4ODXB 4K9EC 4H25B 4NQEB 1N26A 3QUKA 2J2ZA 4V1DE 5EH1A 3SDXB 3HR5A 1V05A 5EZLA 1YNTA 5EO0B 4OZFB 3MBXL 4TTDC 3X3FH 4KRPB 4AH2B 4F7TB 2KQNA 5HHNA 5I17A 4QO1A 1EK3A 4N0UA 4OUUA 4XPFH 5I76A 3Q2CA 4Y0GA 3WFZA 1H3UA 1U8OB 3STLB 4K7PL 2XXCB 2BNQE 1PZ5B 1B3JA 5ACLA 5AYUL 2WANA 5D6CB 4V2CB 3C09B 4YHOL 1SYSB 4R0LA 4MNGA 2DYPB 4WUUA 1IKNC 4FTVB 4YXLH 2VLLA 2I60H 1ORQA 4JRYA 3M8OL 5GGVY 1I7RA 1UJ3C 1CFTA 1JJUA 4AYFA 5KW9L 5BO1H 5D96B 4OTXL 1YMMD 3L3KA 3VG0L 2FRGP 3S34H 2Y4SA 3QIWA 2VKXA 1XF5A 5HDQH 1S9YA 1WQVT 3MZTA 5H37H 1A3LL 1HKLL 2Y06H 1IEAA 3F7QA 4DKDC 2VDNL 2EZ0D 3VXME 1IBGH 4LQ1A 2CGRL 2BY1A 1QR4A 5K33A 3C6LC 1CVSC 3BGFC 3BUYA 2BXZA 2VISA 1T83C 4N9GA 1ZLUK 2VL5B 3TV3L 1RFDH 4TVPE 1IM9D 5EOCL 5AZ2H 1YC7A 4OFPA 3IXAB 5E2JA 5FKAB 4PB0L 4XHQA 4Y2OA 3GSQB 1JF5A 4OF3A 3VFRB 2EEDA 4JO1H 1UG9A 4R4BA 1J0HA 2D2OA 3T4YA 1T4KA 3SKMA 4YDJB 1ZA6B 2H1PL 2FBJL 1EUTA 1QA9A 4OGYL 5IGXH 2ZJSL 3TESA 3X14A 3INUL 5DZOA 3SE9H 4JDVB 3TNMB 5HVWA 5JPMB 1F3DH 1CLYH 5A2FA 2YD8A 4BK4A 2ENYA 4HBQA 3BP6A 2NY3D 5IB5B 4ZXBA 3REWB 2OSLB 4RZCB 4WI5A 1HDMB 1LO3H 5E2UL 1D3CA 4E5XA 2QJDA 1IT9H 3RWIA 5JW3L 1U8IA 3BKCL 2YRZA 4LFHG 5KVDH 2DQJH 3EYFA 1JZ8A 4R7DA 4K8RH 2B1AL 4JM4L 4EVNB 3NTCH 2JB5L 3LKOB 3Q3GB 3V5KA 2NY6B 1X4YA 4QLRA 2K7QA 1L6ZA 1S7QA 3ARZA 4LVNC 3MNVB 3FL7A 3RJQB 1GIGL 3LSOA 4L29B 4JJ5B 3B5HA 4R26H 4NWUL 4R3SB 3IS0X 2FHCA 4FQXB 4D0CA 4IRZH 1HH9A 3MFFA 2Q6WB 2OJEB 4LQFH 4QY8B 5GRZA 4CL7A 4AEIL 1CZ8H 1WCQA 1KJ2H 4S0TD 3VI4F 2ZOKA 3VFUA 3OXSA 4OCWL 5E2VH 3P4NB 5LGKA 2X4TA 4CU7A 3L3IA 4K71B 4U1IB 1DQMH 4JZNB 4RMVA 5HPOA 1HSAB 3G5VA 3O2WH 4PRDA 3PXHA 4WCYL 3TIEA 1BEYL 2G5RA 2ZCLH 3TEUA 1UA6H 3MJ8A 4X5WB 4NO0A 3T3PF 4RAVA 2G9HA 4OZFH 5IFJA 1N0XH 1WGOA 3BMWA 3K4AA 4FFZL 3FB8A 3ZKMC 1U8NA 2DQTH 2G2RB 1AXSB 4Q9BA 1Q8MA 4GQ9H 1AGBB 3BWAA 1EAPB 3QAZC 5I19H 2V2TB 4F15B 4QXGL 3T8XA 4Y16B 3IDYC 1RZ8A 4OFKA 1EBPA 1RJLB 1VFBB 3O3BB 4UMGA 2NY5L 1F13A 2HFEB 3WCYA 4WFHD 4Q9RH 1IEHA 1F4WL 2GEEA 5CP3A 4MQ7B 5CSBA 4CVZA 3EOBB 1RSFA 4TVSa 5J6HA 4JRXA 1QD0A 4AEHL 4F9PC 3GSVB 3WS6A 1T2XA 1M7XA 5DZLA 1A1NA 5FYLL 5FYKD 4OFIA 1DBJH 4U6YB 1MFEL 1AXTH 3HUJA 3AM8C 1RZJL 1JCKA 1AH1A 1PGRB 3C08L 4ZS6C 2KL6A 2DJSA 4Y5VC 2F53D 1BZ9A 4M93B 5C0CB 1GZPA 3QPQC 4NQXB 3RY5A 3R4DA 2FL5A 3D5OF 2BJMH 2IFFH 2PCPB 1B88A 1IGFH 4PJEA 1PYWA 5CBAB 5IFAH 5SWQA 3G08B 1EFXD 5KG9A 4G6AD 3TN0B 2V7HA 4ZSOB 2MNUA 4L8CB 3NZ8A 2AVGA 1QZ1A 4GBXA 1KCUH 4DOHE 3LKRA 5IIEB 1MHPH 3RWFB 4OCYL 3QNYA 3CC5B 1T3FA 3JV6B 5JHLL 4MA7L 1XR9A 3P73B 1BD2B 2GI7A 4M8QB 1FV1A 4DKFH 1S9WA 4HZLB 1G6RB 2HLFC 3T3ME 4TQEH 1MEXL 2RGSA 3TVMC 4FQHA 3I75B 1MCWW 4I0PD 3KNBB 4H20H 5EU3B 5GGSB 1N6QL 3BVNB 1JTOA 3FFDA 2H6PB 1A0QL 3QWOB 3F62A 4MHHI 4S0SD 4GKZB 2XZQL 4PJCA 1AO7D 3EYVA 3GNML 3N0PB 5CKAA 4YO0B 5E2WH 1A4KA 2AEIT 5GHWH 4Z0XB 2IF7A 1U8QA 2HT3C 2ZKHH 1H3WM 3CZJA 3EHBC 1AQDB 4IOFD 4LRIA 5LKNA 1I9IH 1MJJA 3ZHDA 4XNMA 3PHQB 3F58L 4KI1A 1V5JA 2D31A 1XIWC 1MFDL 3H9YA 4KI5C 2XRAL 4UIKH 3P9MA 5L9DH 1FGNL 1CCZA 5E6IB 3P77A 5DUPL 1MRDH 3UTSE 4N5EC 2VB5A 4JFDB 4ZNEE 1QFPA 5F6IB 4PTUA 4U1LA 5INDB 3DX9A 5CEZL 1KIRA 3MBXH 4CBPA 3OKNB 2V5TA 4PJFA 3X13A 3TPKA 4LARL 4X4ZA 3QDGD 5C09A 2IADB 3E1F1 1ZLVK 1VEMA 5LCVH 1Y18A 5HYQA 5GXBB 5E4EC 5AYUH 3ULVL 2YMXL 3WLWC 4NQVA 1C8PA 1CGXA 4NO5A 5T3XE 5DVOA 3M8OH 4JFZL 4PTTA 4L3CB 5KW9H 5GZNC 3VWJD 4U6VL 1D6VH 1P6AB 4OTXH 1TZGL 1T21B 3MRGB 2APBA 4OT1L 3VG0H 3RVXD 1JWSA 4DUWA 2Y5TA 2NYYD 3MRNB 2Z0BA 1UM5L 2PW2B 4P46D 4Y5XA 5MHSD 1A3LH 2F19H 1HKLH 2YSSB 3OAUL 5ITFB 5FGCB 1HH6B 4XWGL 3B6SA 4OAWA 2HKHL 4Y2DA 5ESVA 5FCUL 2IMMA 1QNZH 3VWKA 3QH3A 4Y1AA 1I1AB 1S5IL 4XB8A 3TV3H 1A4JA 5EOCH 4NZTL 4QYOA 1H15B 4CNIB 1BX2B 1S3KL 4HXAL 4OZHB 4LEXL 5B22A 4JHBA 1F58L 1R5IB 1MJ8H 4Z7OE 3QIWD 3FO9B 2H1PH 3PP3H 2FBJH 4KKAD 1TVHB 1GGCL 3MGAA 4KK5C 5D1QC 4EN3D 3MRBA 3O6ML 5BZDA 5BV7C 2VXSL 2ZJSH 4UINL 3VD5A 3ARBD 2AXHA 1D9KC 4OD2A 2NY4D 1INQA 3INUH 4X5XA 5I8EA 2FJHB 1G84A 5TJWK 1IM9B 3UBXG 4I48A 3VXPB 1T89A 1T2QL 1NGPL 1F5WA 1FCCA 1RJZB 3DXAD 4PJFF 5FA4A 3CPLB 4KKNA 5E2UH 2R1YB 3Q6FA 3SBWA 4O5LL 2WBJC 1TCRA 3MC0A 5CS7A 2FNBA 5HYSG 3BKCH 3HZYA 1G6RH 4PJHB 4MQTB 1W0WA 4GH7B 2B1AH 4JM4H 1BVZA 4HCRA 4ODWB 3VGAC 1GZQB 4RMRA 1B2WL 2DWDB 3PQYA 1JFQL 4EDXB 1SQ2N 1XF2B 3TP4A 3KPMB 4GRLC 1T1WB 5CJ5A 3IDJA 3OKLB 2OTWA 2BSSA 1F11B 5J3HD 4ZXBD 3GSUA 4FFWD 4KI5F 3VRLE 1GIGH 4NWUH 4JO2L 4P2YA 2DB8A 4CMMA 4EIZC 4K3DL 4NDMA 5ETUA 1IAKB 3WHXA 3CSPA 1XGYL 1EGJL 1J0IA 1T5WB 1EZVY 4BQ8A 4TNWK 2ATPA 1MY7A 4AEIH 2QL1A 2B0SL 3RL2A 3QPXL 3T1WA 1S9VA 4AEEA 5GS2H 1J8HE 3IS1X 4OCWH 4A6YL 2ED7A 4HF5L 5I1CH 4PY8I 1T03L 5FECA 3JTTB 2AXJA 5D7IF 2YHGA 3QDME 4Z7QE 1FFOA 2F58L 1BIHA 4CDHA 2IBZY 2NLJA 4G8EA 4PGCA 1BEYH 2UUDK 4QRUB 1RU9L 4NN7B 3ZHKA 1RK1B 3TIDB 4UV4L 4GQPH 2DQFA 4FFZH 4PJ7B 4JO3L 2APFA 1HWHB 1PKQB 4Z7WF 5HHXH 3O6FD 4NOBA 2GTWA 4FFYH 1DQDL 4FQCL 2AAVA 4U4BA 4X4XA 4HKBB 5ISZD 3A6BL 1OD9A 5IB4A 3DARA 1OAUL 4WV1B 5FA3A 2X4SA 1T1XB 3EAKA 3WHE1 4P9HC 3N1PC 4LRNL 1EHAA 5GSRB 5E7BA 1NPUA 4ELKB 3U2SA 3WJJA 1YNKL 4NO0D 5BRZE 4DZ8B 2G60L 5EC2B 2ZUXA 1JGLL 2DM3A 3ARDC 1T5XA 1NMAL 3G6JB 1FNGA 1J5OL 3QCUL 1MFEH 3KLAA 2VXTL 2ITCA 3DGGB 3GFUA 4H26A 3A6CL 5E5RB 3QJHA 4MXQC 2GY7B 4ZAKC 1JIBA 4OI7A 3QUZB 1Q9LA 4EKXA 1CIUA 2DICA 1MCDA 2K1MA 1G7IA 4BFEA 4P57A 5D2LF 2A6IB 3GMMB 1ITCA 4HV8B 4M1GL 4S10A 3UTTD 5TE6H 5H35A 3GSRA 1AJ7L 3OWEA 3BRGC 1K4DA 3KJ4B 4OV6F 5LBSL 5JHDA 3MXWL 4MMZC 4NSKA 1Q9OA 5T3ZE 4J4PC 1KLUB 4XVJL 35C8L 2VDQH 3FRPG 1AGDB 3H42L 4PJXE 5HHQA 2YPVH 3CSGA 4G3YL 4W81A 4K94L 1ZTXL 2VO5A 4YHPA 4OCYH 3TCLA 3O3DB 5LQBH 3DV4B 4NQDB 2F53B 4NRXA 5JHLH 2YRLA 4XGZA 4RNRA 4MA7H 2AEQH 1N8ZB 4GG8B 4PYGA 4P2OA 5M94B 1UM6L 3CK0L 1M7DB 1MEXH 3IT8D 5IHZA 1EFXB 3EDDA 3O3AB 5DJXB 3V4UL 4P5TA 1N6QH 1I8LA 4XCNA 3TC9A 3EYOA 1A7OL 3U36A 4BZ2L 3CGTA 4H0GA 1X6LA 3U0PB 3U6RA 4AZ8A 1Q0XL 1JNHA 5FM4A 4CW1A 1CQKA 4MCZB 3GNMH 5HYIA 3I6GB 1J10A 2WZPD 3G5YB 3HRZA 4JVWA 4HQQH 2I9TA 5DR5L 3KYOA 1LP9A 4K9EL 1U42A 5B3JF 2PO6A 2DAVA 1KENL 4FNLH 4Q9CA 5E7FA 3LN5A 4LHUB 1EHNA 4JVUA 3AY4C 4RFNB 1ZHKA 4F8QA 1YZZA 3L3DA 43C9A 5F9OH 3QI9A 3F58H 3O6LL 4I0PB 2V5SA 5E8NA 1I4FB 4A6YB 3VMOA 1MFDH 3DX7A 2D7TL 3KPSA 5H94B 3LZFL 4PGDB 3QBTB 1AO7B 1A1MA 4LSVL 1CXEA 3KJ6L 2BCKA 2XG5A 5I8KL 2HTKC 1IRAY 3IJYB 4NC0B 3DETD 4KJQC 4NC1E 2ESVD 4MLIA 1NAMB 2PTVA 5CEZH 3MRJB 3FAWA 4PPTA 5IESL 5DJCB 1S78C 4MA1C 5GRVL 3U9PL 1CDHA 2XTLA 4LARH 3VXTA 4DVRL 4ZFOL 1CFQB 2YD7A 1AD9B 3D2UB 5A1AA 4NM8L 3VE0B 2Z8VC 3ULVH 1HI6B 2MQCA 2BP3A 2CSPA 1DBKL 1QEWB 2C3HA 1OQOA 2EEBA 2YMXH 3AAZA 4HLZG 2FEEL 5D9SA 3ZYJA 3OKMB 2YBRA 5FFLA 1CGTA 4U6VH 4KK9C 4ESKA 4OCRL 5LWYL 4C4KO 3H3KA 1JPGB 4WW2A 1PY9A 3EZJB 3UX9B 5E9DD 4ALAL 3W81A 5I0DA 3LH2L 3OAUH 4PV8A 4JR9L 2NY1C 3ARXA 4XWGH 4MAYC 2P8PA 2AK4B 2HP4A 1P9MA 4QHUA 1FFPA 5FCUH 5C09D 2UWEE 1IGTB 4HS6B 3AXLB 3IU4H 5LG1A 2VERN 5D1XC 1OGAA 1S5IH 1G9NC 4L4VE 4HUVA 4XZUA 4NZTH 4DVBB 1TQBB 2GITA 4PRBB 1S3KH 3HI1A 4HXAH 4LEXH 4JFPB 5MEOA 3VWJB 5E1AA 1EX0A 3W82A 3QUML 4J1UA 4U1NA 3RGHA 5DWUL 1JYWA 3ARGD 2WV3A 3HR5B 2ILLA 5EZLB 1YNTB 4P46B 3T2NL 3VXNA 4MJIA 5H37G 1GGCH 2APTA 5DD1L 4P48A 2GK0A 5BVPL 3I2CL 3O6MH 5HHNB 5I17B 4N0UB 4OUUB 5I76B 2VXSH 1I7UA 3VWKD 3GMNA 5FUCE 5HYEA 4JFYA 4ERSL 5KAQF 1G6VK 2OL3A 4PRIA 5D7JC 5HHOD 2VQTA 3EJZD 1QO3B 1NL0H 1JMXA 4MNGB 4WUUB 3UJJH 1T2QH 3V6OA 1NGPH 2VLLB 3QFJA 1HHKB 3RVVC 4JRYB 1CFTB 2DI8A 3BMVA 4FFVD 2E27L 3GM0A 3L3KB 4D9QE 3QNXB 3UBXI 1BBDL 4JGJA 5EUKA 3QIWB 4X7EC 1XF5B 2AEPH 1QLFA 1S9YB 3V4VL 1JWMA 2O5ZL 3TBSB 1IEAB 4EN3B 2CXKA 1B2WH 3H9HB 2Q87A 1JFQH 3KPRE 5T5NG 4PGBA 3BUYB 4J8RA 3ARBB 2NW2A 1FFQA 2VISB 5ESAA 2NY4B 4N9GB 3VFOA 2ARJA 1G9EA 3MTRA 5ESQA 5GGUB 4H0HB 3I84A 1ZHBB 5INCA 4FABL 3UYOD 4NCC2 3DXAB 4R4BB 1P53A 4UQ2A 2NW3A 3WFEL 5I8CA 2V2WA 4JO2H 3IJHB 2ORBL 3T4YB 3SKMB 5C0RL 4OV5B 4K3DH 1ACZA 4PJIE 2P5WE 5DRWA 2OJZL 1XGYH 1EGJH 3ZL4L 3O8XD 4XNYL 4BFGA 3WHE0 1QA9B 2B0SH 3QPXH 4CVWA 1EIBA 2ZNXA 5EO1A 4A6YH 2GKIA 3X14B 4HF5H 1QYGL 2EECA 3EYSL 3J7HA 3WNPA 1YN6B 4KUCF 3SGKA 2IH1A 4QT5A 3BP6B 4ZXBB 2Z31D 2D4DA 1JZ2A 4LSSL 4NQCA 3E2HB 5CZXD 4E5XB 3RWIB 3UPAA 1MFBL 3RGVD 3EYFB 4UV4H 4R7DB 4GXVL 3WFCH 3ZT7A 3VXSD 3BPNC 4JO3H 5I71B 2VN4A 4U7MA 1S7XA 3ROLA 3V5KB 5MEQB 4TRPL 5F7UA 1WFUA 3BEWA 4P23D 2ADJA 2ADFL 1S7QB 1DQDH 4FQCH 3CFBA 3BKYH 3GIVA 1NC2A 1DDHB 3ARPA 2XTJE 3L1OL 5GGRA 4YK4B 1OAUH 3UJIL 1R3HA 4KRNA 1DQTA 3LSOB 2YK1H 4ZO8A 4LRNH 3RUGE 1MI5A 2HTLC 3HC3L 4UIMA 4JGMA 4WENB 2EDTA 4D0CB 5JIIA 3MFFB 1JGLH 1HH9B 3QXAA 4OZFG 1NMAH 3ZYIA 4B53A 1J5OH 3QCUH 3BD4A 5CJ8A 3CVIL 2Y6SD 2ZOKB 3VFUB 3OXSB 1SEQL 3H7LA 1ED3A 3T0AA 3A6CH 3L3IB 4KRMB 4HJ0D 5FGRA 1KTKE 1ADQA 4JFOA 1Z9LA 4M1CD 4YQXL 5EWIH 2GSGA 3G5VB 4YC2B 5E00B 4O2EB 1BHGA 3TIEB 1JPFA 2MKLC 3RX5A 2AJZA 4QF1A 1QQDA 3MJ8B 4JQXA 4NO0B 1UEYA 1AJ7H 2G9HB 3FB8B 5LBSH 3MXWH 1OWWA 1J11A 2PTTA 1XH3A 3IU3A 1FYTA 3B9KA 2QQKL 3B5TA 3H42H 4ZNCD 3IVKA 2IG2L 4QTHA 2L7UA 3BWAB 4K94H 1ZTXH 2J8UF 2OCFD 5CEXA 5DHYA 1BWMA 3C60C 3WS3A 4NUJA 3IRPX 4H1LG 5JDSB 3TO4C 2PR4H 4DAGL 4G9FA 3TH3T 2BOBA 3CK0H 3DMMC 4GW1A 3WNKA 1VFOA 1JPTL 2A0LC 2UZYB 4CVZB 5J6HB 5HVGB 3UTTB 4JRXB 3V4UH 4D0DB 5LGHH 4ZUVB 5EPMA 3RZCA 2VQ1A 5CFHA 4BZ2H 2VZ3A 3G6AA 5D1ZA 1Q0XH 3QWRD 5FCSH 2AV7A 3HE6D 2EO1A 4KQ4L 3B9AA 4HWEL 5DR5H 3VGDA 1VKXA 5L8JB 3MYJB 1GZPB 1ZT1A 2Q76A 2X09A 1D5MA 1MF2L 5HD8D 4U1SB 4KXZH 1A6VL 4PJEB 5IHLB 4QTIL 1PYWB 5EFIA 15C8L 1GPOL 1OAXL 5TH2A 1P4BH 4HWNA 2RCSL 3O6LH 5KG9B 4NNXA 4PJBE 1XF1A 1X4ZA 2D7PA 4MJ4A 2V7HB 2D7TH 4I9WE 3NZ8B 3LZFH 4GBXB 5DURD 1EMTL 1IAMA 1AHWA 2N1KA 1OP5H 1TCMA 1NGXA 3WKML 5IT2L 1QTYT 3QNYB 4HJGA 4LSVH 1DVFC 3KJ6H 1T3FB 3LEXA 1TZHB 2ERJB 3FJTA 1T1YB 3K0WA 3SKOA 5FO8B 5I8KH 1BQLL 5FO9A 1FV1B 2MQ0A 3UYPA 4FQ1L 1S9WB 1VEPA 3QDAA 3T3MF 4IRJA 3UPCA 1FLRL 2IANA 4RAUA 1QHPA 1UXWA 1EJ6A 1I3UA 2DDQL 1ZA3B 4U1KB 4WRLA 4HCRL 3FFDB 5ACMA 4NM8H 4LSDA 1DBKH 2VYRE 2GK2A 4W6XB 3D39E 3C8DA 4PJCB 3EYVB 1CG9B 4LIQE 2G75A 1P5VA 4OCRH 5LWYH 4RDQF 5E99H 4I4WA 3QDGE 1RZGA 3LH2H 4NNPH 1MJJB 4JR9H 4XNMB 5D7LA 3T0ED 1B6DA 2AV1A 4OQTA 2ENSA 3GB7A 2D31B 3SGJC 5SWZA 5AD0A 3UMTA 1CLZL 4HUKB 1BZQK 3WXVL 3MODL 3PV6A 1P7KB 1Z6JT 2R2HB 3P77B 1DUYA 3AB0B 2W9LA 3KPLA 1QSEA 3OZ9L 4LCCA 4OKDA 3T0WA 2DM2A 2D7OA 5DWUH 4JKMA 2RAMA 2AQ2A 5I1GH 2QADB 1P5UA 3WIFA 1WAAA 4PTUB 4JQVC 5E9DB 3DX9B 4XP5L 5F96L 3T2NH 3MV11 1FIEA 4L3ED 3X13B 3FQNA 5C09B 4HAGA 3Q5OA 5C0JA 5DMKA 4KROC 4ERSH 1KPUA 1Y18B 2IEPA 4YHML 5HYQB 3MCLL 4FQIL 2X9YA 3ISWA 4NO5B 1ZS8A 4KV5E 4ZOCA 1Q94B 1I7ZA 5DYOB 2E27H 5JOFB 3OR7B 1P7QD 4P9ML 1BBDH 5I1EH 3SJVD 1JWSB 2R23A 3MV9A 5I1LA 2BHZA 3V4VH 4TOYH 5I1KL 5CP3H 3W0WE 4BH8A 3MV01 2D0FA 3B6SB 4OAWB 5HI4D 1MCQA 1BF2A 3VWKB 3T1FA 3QH3B 1C7SA 4AMKH 4Y1AB 3MBEC 4WNQB 1A6UH 4Y5YA 1A4JB 4KQ3L 1XGPB 4QYOB 4KPHL 1KELH 1L7TL 3V6ZA 2CXGA 1QSFA 1ZVHA 3BKML 1F6FB 1SJXA 3WFEH 1CDUA 2ORBH 5C0RH 5FV1L 2OJZH 2F5AL 3ZL4H 3KAAA 2LQRA 1MCKA 4TUKH 4ONOA 4XNYH 5C0BA 1FJ1B 2XWBB 3TA3A 3MUGA 4AJ0A 3TJEL 3MXVL 5BZDB 5TFSL 3GUTA 4MD0A 3EYSH 4X5XB 3HB3C 5I8EB 2E9IA 12E8L 4JM2D 4ODVL 3L5XH 4I48B 1C5BH 1EV2E 4ZDHA 2VUYA 5FA4B 3MV8E 2D9CA 1UXSB 3J8F7 3Q6FB 2YD6A 4TSBL 3HR6A 4LVHC 3BIKA 1MFBH 4HXBH 3V8OA 5TF1L 2HAZA 1KBGL 1Q72H 3HZYB 4R96A 1N5YH 4GXVH 1W0WB 4ZO7A 3MLXL 4PLOB 4TRPH 3GMPA 5J9PA 1FNLA 1LDSA 5D2NE 1HYRC 4I0CC 4M3JA 2ADFH 3ZE0E 3ALXA 3CU1A 1SY6A 2BSSB 3MV7A 4HIIA 5BQ7A 2Z31B 4G7YL 2ZUUA 3GSUB 4FZEL 2E7CA 3DO7B 4NQCD 4LKXA 2XYCA 1N4XL 1NKRA 3HC3H 4ZO9A 4CMMB 4R4FL 4RRPG 4IIQC 5ETUB 2X1QA 3QXVA 2VLMD 1V7ML 3QIUA 2A74A 2C3VA 4ZG1A 3F6IA 4ZFFA 1FORL 3O4OB 1A9BB 1U2CA 4W4OA 3FQUB 3RL2B 1OW0A 1S9VB 4EEEA 4KJWD 4P23B 1KC5L 1SEQH 3ES6A 2BVPB 1BIIA 4KK8C 3ZE1F 3CLEL 2ZNWA 1GAFL 3PG2A 5CD5D 3NGBB 2EYTA 1RIVH 4U6TA 1JYVA 2LU3A 1R3LA 1FFOB 1NSNL 4G8EB 4PGCB 4YIQA 3RPIA 1MI5D 5FOBA 3LMJL 3E3QE 2X2YA 1RI8A 3SDCC 5I2IA 2D7NA 1CICC 1HHGB 1VADA 1NEZA 4URTB 1MAML 5CIPA 2QQKH 1NLDL 5DJZA 4NC1C 2GTWB 3QO0B 2IG2H 4A2MA 1I8MA 2J5LC 3EYQC 4NPYA 4X4XB 3SCMD 4GG6B 1S8DA 5IB4B 4XTRD 4OZIE 2P5EA 4LPUA 5FA3B 1VA9A 1ZHLA 1HHHA 1A2YA 5GIRA 4Y4FD 3PWPE 5DK2B 4JFFD 4YJZL 2XPGB 5DDHA 1OY3B 4DGYL 4RFOL 4MB3A 3FTGA 2EE9A 1HXYA 1Z0NA 1T5XB 4XMLL 4DUVA 2QQLL 3KLAB 2ITCB 1TNMA 2H45A 4H26B 4KQ4H 3QJHB 4HWEH 1Q9LB 1K6QL 4WFGD 3GKWL 1NGWA 2GQHA 1WZLA 4Y4KA 1G7IB 3F7VB 5FYJD 3JVGC 1FZOB 4P57B 4PJGA 4X7SH 1A6VH 3FB5B 5BJTA 1MCRA 3L5WA 1SM3L 3SO3B 4QTIH 4POUB 4HWZA 3U30C 1F42A 1RD6A 15C8H 3BESR 1GPOH 1A7QL 2RCSH 3GSRB 1BFSA 5CGYC 2ZP0T 4N90E 3RY6A 2GAZA 5JHDB 5DT1H 1Q9OB 2HFFA 4BJLA 2EIZA 3ZTJG 3BI9X 3L95A 1EMTH 4G8GA 5HHQB 3HE6B 2OL3L 4Z0BL 4YHPB 3WKMH 5IT2H 5HI3C 4ORZC 3TCLB 5E24E 4G43B 4NRXB 3Q5TA 4WFED 4RNRB 4XGZB 1TVBB 2C1OA 4X98B 4FQ1H 1KG0B 5FUCC 3KHQA 3MUY1 2MFNA 1VEOA 3ARED 4XWOC 1FLRH 4FRWA 5IHZB 1G7LA 5ABDE 3T0XA 4QHKI 4Z18A 4CUCA 3GO1L 2DDQH 3MRKA 4P5TB 4WJ5B 1IQDA 4XCNB 5ICXA 4I2XB 3KXFA 4HCRH 5F7WC 2AGJL 3EYOB 3O45B 3K46A 4HPYL 3U36B 3BKJL 1G9NL 3PWVA 1HCFX 2ZZUT 5DURB 3U6RB 3RTQD 4CW1B 1J1XH 2ESVE 4NN5C 4NC2B 4EI5A 2QHRH 2I9TB 4JAMB 4OZ4A 4J3UA 4HWUA 1TPXC 3FQRA 1MY5A 3KYOB 1LP9B 1O7VA 1II4E 4FXKA 4PJ8A 1WFOA 2QQNL 3RBGA 3QUYD 1NQBA 1ZHKB 3O3EA 4GW5A 4KZDL 5DJ8A 2UYLA 1YY8A 3L3DB 43C9B 3QI9B 3FB7A 2ZUSA 3VGHA 4ZQKA 2AJUH 4OGAD 2BY0A 5JMOC 5E8NB 1CLZH 5C9JA 4HSQA 3DX7B 3WXVH 3KPSB 3MODH 5KSAD 3MSPA 4BQ9A 5E56A 1FNEA 5J06A 4B41A 1LGVA 1JZ6A 6CGTA 1A1MB 3ZKSD 2P46B 4X6FA 2FJGB 4NZRL 3OZ9H 5DVMA 3KPQA 2BCKB 3R1GL 1WWBX 3CSBA 3ZHLA 2C1PA 4P4KD 1GGIL 5HGGS 4H8WL 4XP5H 4QRPA 5D7SL 3EIFA 4LP5A 5HPMB 4NQSA 5HVHB 1OWRM 4U1GC 43CAA 4GW4A 5D7LD 3PDOA 1MCSA 4PJDF 1H5BB 3VXTB 2YPKA 2QEJA 1HXMA 5B21A 5IWLA 3LKSA 2W60A 3MCLH 1RUMH 2A38A 1NBVL 5C0NC 4GKOA 3C6SA 3DLQR 5H2BA 2JJSC 2AS5M 1XCQA 2YBRB 2DN7A 3G9VA 3KLHC 1HWGB 5CJXA 5IVZA 4WW2B 5EU6A 1K8DA 3ZO0A 2XN9A 2FATL 3FOMA 2CDGA 4QCIB 4QHUB 2P8PB 2XTJC 2GY5A 4UB0L 1FFPB 1YC8A 3D85D 2N56A 4TTGA 4PRPD 2FSEA 2DKUA 5FKPB 4EXKA 4HUVB 3JXAA 2ZWLT 4QNPF 4XZUB 1N2RA 2GITB 3C9NA 4KPHH 4NCDA 6FABL 1L7TH 3HI1B 3WMSA 1VFMA 3BKMH 5MEOB 1ADQL 1P7QB 4OZGB 4J1UB 4U1NB 1FVEA 4M6NL 2YD3A 2F5AH 3VXNB 4OIIL 2GT9A 4JPWH 4UBDC 3TJEH 3IF1B 3MXVH 5K9JH 5IW3A 5TFSH 3U46B 1DLFL 3RDTA 1FVDA 1I7UB 1YDPB 3GMNB 4JFYB 1RIHL 1XF4A 3L7EA 3O41B 1YEKH 3T2QA 4X9IA 2YEZA 5EUOF 4PIRF 5J89A 1FO0A 1U2HA 3BSZL 5HHMD 5ECJE 5EUKB 4J23A 4LLWA 1X5YA 1KBGH 3P4OA 1QLFB 1ZLSL 1EO8L 2R0LL 1JWMB 1INDH 3MLXH 4J3OC 5C0BD 4X6CF 2XQBL 1MWAA 3MMEA 4B50A 4CN1A 4YGAB 4PGBB 5GSVA 1WBZA 4J8RB 3QZWB 2NW2B 5ESAB 4AG4L 5L2JB 2PW1A 1Y6KR 2ARJB 4U0RC 5ESQB 3QB7C 1VCAA 2MTPA 2P43B 3WBDA 3C5ZA 3FONA 4G7YH 3VGEA 4FZEH 1MOEA 1J88A 2NW3B 4UQ2B 1N4XH 5I8CB 1MJUL 2V2WB 4ODUA 4OCSL 4R4FH 4RGNC 3ZDYF 5A2KH 1V7MH 4TTDD 3RI5K 1UGNA 2PYEA 1FORH 1T7ZA 3BPCB 3NACL 1BLNA 3ABZA 1M4KA 1YPZE 5A43C 4RGOH 1OTTD 5MERA 3CLEH 2PN5A 3N1FC 5FK9B 5IROC 1BVKB 5DGRA 3LRHA 4QT5B 4CMHC 1HYSC 1YN7A 1PY4A 1NSNH 1TZIA 4JQIL 2MPAL 2XZCL 4NQCB 1YNLH 3H9SD 3ARTA 4X7FC 1F4XH 5TF0A 5FDYA 3C2SA 3LMJH 2ZUQC 5HGBA 4F33A 2DBLL 1UH4A 3TFKC 2ICEA 5BS0A 3Q1SH 1UWGL 5CMAA 1UH2A 5T1KA 5DHVA 1X5ZA 2WQ8A 3O4LE 1FPTL 2DQGH 3LB6C 2NZIA 1FSKB 4MSWA 1IARB 2B39A 3DYMA 3C6LD 4R4NC 2GHWB 3BEWB 2ADJB 3I50L 1EEYA 4D9RE 5IVNA 4PJ5D 3GIVB 5ERWA 1F8TL 1S7RA 1E4XH 1BFVL 5GGRB 1R3HB 2ZOLA 5C6TL 4KDTA 4N1HB 2HYMA 1MI5B 3O9WC 4UIMB 1MCPL 1KGCE 3MQIA 3KGRA 3KPPA 4RFOH 4PY8J 3X11B 4YBQC 5EIIA 4JGUA 4XMLH 4OQTL 3QHFL 3DVGB 2QQLH 4NRYA 3FO0L 3NPSC 5T1MA 2UV3A 5DVNA 5ENWB 4J3WA 4Q9QH 3FRUB 2C9AA 3SCMB 1K6QH 5ACZB 4UT9H 3GKWH 4JFOB 1HEZB 1NBYA 2GSGB 1K3ZA 3T08A 2YWYA 4U05A 3SDYL 1SM3H 2CDFA 4Y4FB 4PRHA 4K2UH 2AJZB 3T04D 4QF1B 3L3HA 5DMIL 1AGFA 5JO5A 3IU3B 1XH3B 3ORJA 1FYTB 3IVKB 4QTHB 2OL3H 4OBSA 4DK6A 3O81A 4JG0L 3NAAL 4Y19A 4ZUTA 5DHYB 4HH9A 5GPRA 3WS3B 1I9JL 4IEFB 4NUJB 3QNZB 2O5XH 4LEOA 1V7NL 4GW1B 3I85A 1D7FA 3HMXA 2FX8L 1NCAL 3RZCB 3VGBA 2VQ1B 5IBTL 1HQRA 5J1AA 4HPYH 5EOTA 3P0YL 3BKJH 1G9NH 3G6AB 5D1ZB 4G8GD 4E42A 2AV7B 4WI4A 4D0BB 1ZXQA 1BD2E 5TQ0H 2X1OA 4ELME 3QEQE 1I85A 1ZK9A 4C57C 2HVJB 1VKXB 4KH2A 1ZT1B 2Q76B 3VD3A 1KLGA 4HKJA 4S1DC 1PSKL 5LGJA 4KZDH 1TTFA 3AREB 3ZDZF 5EFIB 3LS5L 1PEZA 1JPSL 5TH2B 1J05A 1KN2L 1U6AH 2W0LA 4NNXB 2XKSA 4NBYB 4NZUL 3ZKMD 5AG8A 2B7DT 4QRQB 1ZEAL 5GS1B 3S88L 4U1HB 4XBGA 3N85H 1LK2A 4WTXA 3RTQB 4GRWF 2C4XA 4RIRA 1OT1A 1IJ9A 4HJGB 4NZRH 3UP1A 3R1GH 3S35L 1UWEH 1G7MA 3T0EE 1OAQL 1BQSA 1MVUA 5FO9B 1RZIA 5F7EH 4H8WH 3NCFB 1U92A 5JW4M 4LSTL 4IRJB 2IANB 4RAUB 1U8JA 1UXWB 1JPST 4IOIA 3HRPA 2FYYB 1J7VR 1WTGT 4PGJA 4ZPTB 3FKUS 3TBWA