1YMME

Tcr/hla-dr2b/mbp-peptide complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
246
structure length
246
Chain Sequence
GAVVSQHPSWVISKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSARDLTSGANNEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unconventional topology of self peptide-major histocompatibility complex binding by a human autoimmune T cell receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 31
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymmE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymmE02
1FZKA 3Q48A 4JGMA 3BIAX 4LASL 4L29B 1PGRB 3VRIB 3MJGX 4UTAH 1T83A 3C5ZA 1LP9B 3QULA 2NX5A 4RAVB 3BPCA 4JRXB 2HH0H 2A73A 1DANU 4YHOH 2F53D 2AJZB 4Z6AT 1P69B 4MA8L 1UB6A 5LAXA 3MLTB 5HDOA 3HKFA 4H20H 2ZKHL 4IHOB 3CFJA 1EERB 4LEXH 4XCYA 5JOPD 3BP7B 3TBVB 1MVUA 3BUTA 3LS4L 4X6DF 2R23A 4HPYL 1BFVL 5IVNA 5L8JB 2IH1A 1NBZB 2PNDA 4RMSA 3MRQB 3MFFA 2EIDA 5IEHA 1IGYB 1ULVA 2D2OA 1I8LA 1IL1B 1QSFD 4TVPD 3DRTA 4Y5VA 2ZJSL 5CJ8A 1IEBB 2GSIB 5A16A 3MLRL 3NFPB 5LVEA 4MAYD 5KOMC 3I6KA 4JFEA 3MR9A 1BIIA 1KB5B 2RAMA 4OD1H 1Y6MR 5H2BB 2J8UF 3ZTJH 4LFHD 3MJ7A 1YPZE 1EEUA 5EZIH 1TTFA 3QJHA 4DK3A 1F6FB 3L3DB 1YYLL 3AAZA 4QHUB 1DVFB 2J88L 2OR9H 5CKAA 3MRGA 2GJJA 3ARDA 3QUYA 5EOCJ 3L3IA 4G42B 3RY6A 2C7UB 2IQ9L 3OKOB 5HD8D 4NM8L 3MRPB 4JM2A 5CIPA 3U9UA 5I73B 2QADD 4OZHF 5GRJL 3NGBB 4MYWB 1TQCC 4APQD 2R2BB 3EYQD 5GS0D 2B4CH 4NWUL 4QXUH 5EOTB 1X5IA 4Q6IA 4LQFL 1R5IA 1FL6A 1G7QB 1B2WL 3CVIH 1Z6JT 4HJGA 3OX8B 2F58H 1UM6H 2FGZA 5EA0H 4FQQB 3BGFC 4LVOC 5EG6C 5HHQB 1AFVL 4U1HA 4F57H 3Q6GL 4AT6A 1C08B 3UTSA 5IMKA 2C9AA 5E4EB 1JE6A 2IANA 5I1GH 1T0NB 1MRCH 1FE8L 1R3HA 3S4SA 5I1GL 3MGOA 2AJYL 1UACH 4M00A 1JHTA 3JTTB 5HGBB 2QADB 2A74B 2NX5D 4XZUA 4H5SA 3RU8H 4ZO7A 1YJDH 3H7LA 1W0WB 5I1EH 2FBJL 1RD6A 3VXME 2HT2C 3MRQA 3WNNA 5A3ID 1IRAY 1UM4H 1KNOB 5DJ0A 4PRID 1IEAB 3QEGH 2NXZC 5HHNB 5EOCH 3RUGB 5KVFH 1HNFA 2E9IA 1EHAA 3MA7B 3MNWA 3ZSSA 1J87A 4OAWA 5KS9B 2QADC 4N9GB 4HF5L 5DUML 2YD7A 3FB6A 3L5IA 1KLFA 4K71C 2UY6A 4CVWA 1QFWH 4HWZB 1OAXH 5FO7A 3NCYS 1F4XL 3BO8A 2A1WH 4PRPE 5FYLH 2MTPA 5E1AA 3MCKB 3UTTA 4FG6D 1NFDB 4PBWD 3OL2A 4X4YA 1LWRA 4Y2DD 1WK0A 4GRWF 3BD4A 4NKMB 4S1QL 4XP9L 1JTTA 2XTJE 3T3PF 2XIDA 2AABH 4HKBB 1FZOB 4UILL 1RZKH 4NRZB 4TN9A 4JB9H 4CKVX 5EBGA 3CDFA 2Y5EA 1MCWW 2AQ2A 3O45A 4QCIB 4UTAL 4LSPH 1G9EA 4BH7A 3RVUD 1UH4A 3SKJL 1F4HA 1RHHA 2DICA 4H1LB 1KG0B 5HHQA 3CXHJ 1HDMA 2B1AL 1P5VA 3GBNH 2BNUA 3MCG1 2ZSWB 5E9DB 4LMQE 3P0GB 4NBZB 3OJDB 3MRRB 3QCVL 2P8PA 4LPYA 3QUKA 1JPSH 4I48B 1INEL 5B3NA 5C0JA 1DLFH 4C54A 4F9LC 2BY2A 4YHIB 2P5EE 4XHQA 4B41A 3WUZA 4HC1L 4PJXB 4QRSB 2IBZY 5KN5A 4OZIA 4KUCF 1RZ8A 1FBIH 1TZHA 4WI8A 2V7HA 5B4MC 1A21A 2CRYA 5EZJB 2Z92B 4NQCE 4P5TC 5T1LB 4KRLB 5FKAB 1S7TA 5B38A 4PJIF 1P6AB 1AR1D 4UIKL 4JO3L 4IS6B 4OT1H 4TUOB 5DQDH 2VXQL 4ZS6C 1KENH 5HVGB 2VR4A 1X5FA 3FB5B 1BIHA 4OAWB 5KS9A 1FLRH 4PLOB 3O8XA 5C6WH 3QUZA 1UWGH 4RX4A 3MO1A 2CLRA 5HHNA 3LOWA 1HOCB 4MJ6A 5GGSB 4H26A 1S9VA 4LIQH 4O4YH 3C6LB 5DD3H 5I71C 1P4LB 3LMJL 4FQPA 4QEGA 4RQQB 3ARXA 2BNQB 2JLLA 3VD7A 1F4YH 3D0LA 2BSSB 1I3VA 4G6JL 4MA3B 5CLTA 4G5ZL 1CLOH 4PR5A 5I75C 3GDBA 1VFUA 1JV5A 4MQXC 4MNGB 4BFEA 5FB8A 2DQTH 1I4FB 3MLYL 1RZIB 1XF5B 1AXSB 2AJSH 1PQZA 4Y4KA 2F5BH 4G7YH 2EYTB 4G43A 4JDZB 3STZA 2XY2A 2R56L 5FAAA 1DLHB 1FORH 1AE6H 1CICD 2EXWC 5DHVB 4LKXB 3DO7A 1YMHB 1SVCP 1SYSA 5EBMA 5K9JH 4F7MA 3BRDA 4DUVA 4RGNC 5DVMA 4E42A 3K8KA 4PJGE 5T1KA 4NSKB 2EO1A 3IF1A 3QIBD 4HT1H 2IPKB 4JQXA 3TN0C 1NDGA 2E27L 1YQVL 1EDQA 5C7XL 4PJXA 2J1KA 4OZGA 4XNXL 1HINH 2CDFA 3VFTA 4JFDD 3HUJF 3F7RA 2WIIB 1GPOL 1KFAL 5A16B 2AV7A 2IPUK 4XMLH 3KNBB 3HC0A 5GHWL 1SEQL 5IFJA 3EOTL 3FMGH 5E6ID 2V2TA 3TPKA 4L1HA 4LHQB 3SCMD 3O6LH 3MRDB 3H9SD 3IETB 3MO1B 4M6OH 1WWWX 3AGVA 3IDXL 1MF2H 1CFNA 3IFNH 4YXHH 3IFLH 2VABA 5JA8B 1OM3L 4X7TA 5DC9B 3QIBB 1E27A 4XBPB 5BS0B 1A6UH 4P2QE 4XWGL 1BFOA 1CLOL 3EO0A 4JFDB 2BCKB 3MJ6A 3ZYZA 5HPMA 5CD3A 3TWCH 2X44D 3OKYA 5MI0B 3UBXA 4FS0A 3FQTB 4HGWB 2I9TA 3A6BH 3R06A 4CNIB 5F7UA 4NNYB 3KLSA 2XWBA 3SPVB 3PWPE 4NHUB 5E6IB 2BXYA 2W92A 3BMVA 5JW5B 3RNQB 1OWWA 2FJFB 2E6PA 1RUQL 3FFDB 3WN5C 1KIPB 3LPWA 4DZ8A 1TETL 4O2EB 3IJHA 4U6YA 1I7TA 3IRPX 1AGBA 1FVDA 4WWKD 2EYTA 4G43B 1U3HC 5ANMB 2EIBA 2VB5A 1QYGH 4J1UB 4NQEE 5C0FB 2UV3A 4JAMA 1X5KA 2DLTA 2X4QA 4PJCA 3TYGL 1RZIA 2OJZL 4YGAB 1JZ4A 4WW1A 3KJ6H 3KLAA 4G7VH 3RGVB 3DETC 2IFFH 5SWQB 4TTGA 1RFDL 2LTQB 1FNFA 5DMKA 3VG0L 4D3CH 4L8SB 3ZT7A 1ZMYA 3LMJH 4Y1AB 1MY7A 1NBQA 1XGQB 4HIEB 3EJZD 5HI4C 2KBGA 5A2FA 3GNMH 3JTSB 1YNKL 1OVZA 5C1MB 4U49A 5JA9A 1BJMA 2QHLA 3ARDD 2R2BA 1ZEAL 4ZUTB 2X4PA 3TM6A 1NCUA 2APTA 5ICXA 1PKQA 1OPGL 4M03A 4XNMA 4P46A 4I77L 2B5IC 1W2KT 4UIKH 3SDAD 1S5IH 5I1HH 5GSVB 3FFCD 3HHRB 5DEGA 1TJIL 4NZDA 2F54A 5DK0B 3FRUA 3KNBA 4OCLC 1R5IB 3JBG7 4UINL 5JQ6H 2CIKB 5I1JH 3GMRB 4WENB 1MEXH 1JGVH 4ESKA 3BX7C 3CSGA 3GO1L 1C12A 3OG6B 3MCLL 1CQKA 3QRGH 1AR2A 1NAML 5E03A 3RA7L 5MENE 3H9HB 5IQ9B 2M8XA 1CGYA 1QFOA 5DUBB 5TF1H 3VFWB 2R0WH 3DETD 3G08A 2Y07H 5ELIA 5C0CE 1NUNB 1HKFA 2VSCA 4ZFFA 3HNSL 5EO1B 3JTTA 4LHUG 3TYFB 2FGWH 4ELKA 4YX2H 1BMGA 2PO6B 3ESUF 3TJEH 2G5BB 4O58L 5E0QA 2D7MA 1DUZB 4P57A 3RWJA 2Z31D 3V5KA 4Z76B 2P8PB 4JO1L 4O00A 3X11B 3SHSA 3U0PB 4EI6B 1ZHKB 5A3IC 1S9XA 3LKQA 3S88H 4YBLC 3D9AH 1AGBB 3DX9A 1O7SA 2Q8BH 2JJVA 1TZHB 4MVBD 4DKDC 5IF0A 5IGXL 3EYOA 3DUUA 4KJYB 5A1AA 2DQJL 1S7RA 5J57B 3QO1A 2FRGP 3OAZH 1S7TB 3PGCA 4L29A 3RWIA 2G2RA 3S3JA 1E0OB 2RFXB 3FTGA 4Y5YC 4M7ZB 5IHUL 3T2OA 4U2ZA 4H0GA 4L4JA 5BO1H 1JGUL 2NY6B 1WWAX 2VLLA 4JFFE 3NCBB 3ZT6A 2R0ZL 3OKNB 1T20B 4P23C 3L3KA 4N8VG 1UCTA 3L3HB 4E0RB 3K2MC 4I18B 3IJYA 1OGAA 5IVZA 3V0VA 1YUHA 2D9CA 1AFVH 4OGYH 3K1KC 4PJBB 1QKZH 3KS0J 3JUZA 4R7NB 1WZMA 4YUEL 5J89A 3TN0D 2Z4QA 4X8XA 3SOBL 1NANI 1KBGH 3TT3H 5HVFB 4JZOA 2VXVH 4R2GB 1U8PA 2FLBT 4Y19E 4UT7L 5CJ5A 2HFGH 1ZT7A 2ARWA 3JSSA 4NQTA 5FYKE 4G8GE 4M7JH 3D2UD 4F3FA 4RWHA 4XGZB 3TFKC 4Z7WA 3RWEA 3K0WA 4EI5B 3T8XB 4XX1G 3TZVA 3TIEB 4NPYA 1YEEH 3FQXA 4WUUA 4MCYA 1QFWM 3RRQA 5EBMB 4MJ4A 1PZ5B 1JZ8A 3QG6A 3B3IB 1YEGL 1QG3A 2IF7A 1EVTC 4GLRH 1HCFX 4M5ZH 1HIMH 4G9FE 2DKSA 1XIWB 2I60L 3P0VL 5ESQB 4G6AC 4LAQH 4AL8L 3DBXB 5I0DA 4KRMB 5I0ZA 3NH7L 4M7LL 1G9MC 1M05B 3CX5J 4QKXB 3ZL4H 4JY5H 4J3XA 2XKSA 5D2NC 5J11B 4WTZG 1RJCA 4U4BA 4H26B 3HC0B 3RZCD 4YAQB 1OAQL 1FO0B 4Y8DC 5DJAB 5EIIA 4F2MB 3QAZB 2CXGA 4KMTH 1PG7W 1LDSA 1U93A 4PRHA 3FZUC 4FZEL 1N64H 4I3RH 3X17A 3QO0B 1S7VB 1G0DA 4ZPVB 2DQJH 3MRNB 3F12A 5C3TA 1MI5D 2P5WD 4NQEB 3GSVB 5ICYB 2HKFL 1S9YB 4X5XA 3RVTC 1IBGL 4MXVE 3QPXH 2I5YH 4OLUL 4LARL 1LEGA 4S2SA 4X99A 3RPIA 3D39A 5JQ6L 3EJZC 1NC2A 4Y5XC 3VXRA 2X89A 4PGCB 4M7KL 2WP3O 4JKKA 4ZDHA 1HXYB 3RP1A 3QUMH 1NFDE 1S7QB 2LFGA 1SJHA 4JDZA 1L4IA 2CK2A 5D93B 5F44A 3SGJC 4K8RH 1F4AA 2X7LA 3CFEB 3MRMB 4P2OD 5KSAA 4PREB 4GSDL 3GKZA 4W4OA 4YNYA 5CHNB 2BOBB 2BY1A 5C2BL 4X6BB 1OF2B 1RIUL 4U6XB 3RQ3A 1J11A 1T2JA 1K4DA 1M7DA 1T21A 3SGDI 7FABL 2X1OA 1FVDB 4L4TE 4KJQC 2HLFD 1A5FL 3WXVL 3BZEB 4FQXA 5JXEC 4GOSA 4JKLA 2PW1B 3C2SA 3MV8B 4U1MA 4F7CB 3B8YA 1N0LA 2HH0L 5JXEA 3AREC 5CBEB 3DURA 1I75A 4XPBH 5E95B 2HT3C 1XH3A 2NPLX 3MOAL 3V5DB 2QV2A 3G6DL 3SN6N 4K3GA 2A6IA 6FABH 5KOVC 1I9JH 3ZHLA 1EUTA 3C6SB 3LKPB 4X5LA 4BQ9A 2X4TB 4YHYC 1GGIL 3CSYB 3DVGA 4OLYL 2EXYD 4X0KA 5ECJE 4ZUWA 2ATKA 3ZDXE 1MCNA 4WFGE 1IZKA 2BCKA 5GXBB 1WTGT 1N26A 3FOLA 5KJRL 5H35A 2Z8VC 4M93B 4MMXC 1FO0A 2VWEE 1UKSA 4GJTB 4NN5B 1S7XA 5DO2D 1U8NA 5HYSG 1Q9OA 4M6AA 4LEOA 5TPWL 2AKRA 4NM4H 5FYJL 5TDPA 3S8WA 3BEWB 2D4FA 1LVEA 1VEOA 1E6OL 3CU7A 1F6AB 3BP6A 1S3KL 5FK9A 4BH8A 1EEZB 3OJDA 1ZLUH 3DVNA 1ROWA 3GSQA 4PJ8A 3GMRA 3ULVC 2MNUA 3HZVA 4WTWA 1QPXA 1U2HA 1T89A 2QR0A 3BDBA 4RNRA 1NCWH 5D6DC 5KSVB 4OGXH 3L95B 3QIWB 4YPGB 2VDPH 2V6HA 3VGHA 4XH2B 1NC2B 2F9BT 2JB6B 4OV5B 4KK8C 1DQJA 1IGMH 2EE9A 2GT9A 3C2AH 2JIXB 5DD0L 1LEGB 4M02A 4EDWH 1ZLWH 1A4KA 3CUPB 3WEXA 1NAMA 4NKOB 4IOFC 3MXWL 4PB9H 4YXKH 1EGJA 5DJ6B 1NANH 4J6RH 4PJIE 2R69H 2GJ6B 1FL3B 3FHQA 3PHQB 3O4OB 3GBML 4N90D 4YFLI 4GT7A 2W0FB 4XNMB 3PL6D 1X6NA 4MNQE 5MEOB 5L2KA 1BD2B 1T1YA 3PWJA 4XXCC 3T0EB 4JLRA 4LPWA 4CRPA 5DK3A 1CG9B 3IDXH 1IGJB 4FTVD 4OCRL 4CDHA 4XNYL 2E7BA 2JIXD 3ECBB 4Y1AE 5SWZB 4JPKH 3DXAD 5GS2D 1JPGB 2X70B 2CKBH 1LO5B 4KROC 1D6EB 5CZKA 2C1PB 2D7TL 2AK4D 2VXTL 2Y7QB 4PTTA 3QIUA 1KFAH 4M1DH 2IH3A 3HNVL 4B53A 4XMLL 3LKPA 4JN1L 4GAYB 4JN2B 4F15B 2XNAB 4YFEA 5ANME 5FECA 2G75A 2ZUWA 3VXTB 1Q9OB 3EOAA 2JK5B 5HDBF 2EICA 2B7DT 5F9WC 2DQHL 3PL6B 3B43A 1BD2D 2NY5H 2LU4A 4NQDA 1CDHA 2WMPA 4FFYH 2Y72A 1G9MH 3ARZA 5JO5A 3MYJA 4UQ2A 3D25A 4KK5C 4HFUL 1AGCA 3D85D 4D9LH 1I7RA 1QFHA 3W0WB 1VESA 3PP3H 5D9SA 4RGMC 4AEEA 4NP4H 3IDJB 3KXFD 1EV2E 3QDMD 3ARRA 4PJCE 1X6LA 5FEBA 3V79C 4X4XA 4ORZC 4YHPB 2R0KH 4NN7C 5CEYB 4L9DA 4OIBA 1HHKB 3OZ9H 1S7RB 1ZVSB 2HJKA 3U36A 3F62A 4KHXL 4FQCL 1SBBA 2NW3B 3VDBA 5ACZB 2KKQA 3TBVA 3PWPA 1KN4L 4MJ5A 3QUXB 3ZE1F 1OAZL 3Q1SH 5FYJH 3UEZA 3VMNA 1CCZA 3EDJA 1ZTXL 4N0RA 4ZFOA 2YUVA 3LSOB 1DBAH 4NRYB 5I1CL 3CDCA 1E4KC 1FGNH 1DCLA 2QQQA 5GGQL 1P84J 1V5JA 5CD5C 1AI1H 2KUTA 5D7LD 1KJMA 2GEEA 2J6EA 1ERNA 3PDGA 5D1ZB 4ONGL 1X5YA 4R9HA 3SJVA 5ETUB 2PR4L 2XYCA 3LCYA 3IDNA 1UA6L 4LLQA 5I8CA 2VL4A 1P7QB 3ROOB 5FYKU 3O6FD 5CP7B 1VCAA 3PWJB 3HZYB 1KLGA 4K9EH 4YBQD 2H9GA 1SJEA 4UB0L 2CRZA 5GGUB 4NC1E 1NFDA 2DRUA 2VZSA 4K8RL 1OGTB 1QO3B 1WVZA 3IDMB 1CXKA 3QHFH 2EEBA 3OAYK 1YNLL 3CVHL 3BDXA 2QSVA 3CK0L 3ZTNH 4HWZA 2YMXH 5SWZA 5E4EC 1GC1L 3LN5A 3TC9A 4Z5RB 3QUXD 1CIDA 3VXTA 4HFWB 4P46C 4KKAD 4J3WA 3LRSB 2GJZB 1NGPH 2P44B 3GSUB 4JFYB 1PY9A 2PXYD 1MWAB 2YPLD 4H88L 3GK8H 5SX5H 5D1ZD 5DR5L 1IM3A 4PRHE 4OCYL 3ZSTA 4NC0B 4BQCA 3FFCE 4FZEH 1E4KA 4QTHA 1Q0XL 1F4WH 1FNGA 1P7QD 4MQSB 3BPOC 4AIZB 4LSPL 4JM2C 4A2MA 4NBYB 5HYQA 1BQLH 4OCXH 4M62H 5EU5B 3EO1A 1Z0MA 2MHAB 5GRVK 4JFFA 2F19H 5E2JA 2DTSA 5A2KH 4MHHI 2R1YB 5FHBH 5FOJA 1MLCA 2EKSA 4YAQA 1EXUB 5E08H 3GIZL 4G9FA 4DUWA 2VRAA 1JFQH 4MB5A 4XP9H 5A43C 1UM4L 2BNRB 1EJOH 4U0RC 1P9MC 2DTMH 1NCAH 2HVJA 3FN3A 5DQJA 1QHPA 2PXYB 1DEDA 5HDLA 3QFJB 3QUKB 1WZ1L 5IEKA 2FIKB 4J3SA 1FLTX 1KELH 4Y16A 3WMSA 3G6DH 3CDGA 4X7SL 1F4YL 1FZMA 3ZKNC 5MERB 4IS6A 4JFHD 4NUGH 2R4RL 2P8MA 3QUXA 5D7JA 2NY4D 3WNLA 1CE6B 1QRKA 1PG7H 2OYPA 1MFBH 4HUVB 2CK0H 2ICES 5H35B 2YRZA 4BFIB 5B39B 3CFKB 1M71B 5JORA 5T1DH 3L3OB 1CN4A 3FB5A 3U0TB 3VXOB 1OARH 4HKZA 1CIUA 4FQIL 4KKLC 4X6FB 3QIUC 3QQ3B 5I1EL 1ZGLA 1MNUH 1J88A 2ZCLH 1KJ2H 2CDEA 1Z9LA 2AJUH 5I1LB 3CXHK 1I3RA 2EDWA 4JKMA 3DX8B 4OZGF 3OXSB 2BX5A 1F6LL 3V5KB 4AK1A 1FE8H 4KY1L 5F3BB 4OZIE 5F9AC 4JFXA 4AQ1B 1TPXC 5CBEA 4U6XA 2H1PL 2ZOKB 2VLJB 5EUOF 2BSSA 1YC7A 2FX8H 3SQOH 1T6WA 2VLJE 5D1QD 4XBEL 5AYUH 1CGXA 2DM4A 4PR5B 1V3MA 3SO3B 2QKIA 5IM7B 4GKZB 2Z93A 4Z7OE 5BQ7A 1BEYL 1ND0B 4ZOAA 4LSVL 2EDXA 3FO9B 4Q9QL 1BQSA 1YEKL 4ZAKA 3PGFH 4Y7MA 4DAGH 3PE9A 4R4ND 2R8SH 3GJEA 5HTSA 4DGVH 4NQUA 5DJYB 5J0BA 3MLSH 1TVBA 5CIPB 1U8KA 1EO8L 4KJQD 3EAKA 1YEHH 4U7SA 1ZAGA 2VLKA 1RZFH 3HLAB 4H25A 4MXWH 4EI5C 3QUMB 2MQ3A 4ERSL 1CG9A 3IKCB 1F02I 2YXMA 2V7HB 1QOKA 1KEML 2XTJC 2DM3A 5E5UB 3MRHB 4JE4B 4OZHE 5CFHA 3WUWG 5AYUL 1EUUA 5EU3B 3AS2A 3BH9A 2QR0B 4PV9B 4I0CC 3L1OH 1ZLUK 4PJ7B 3SCMC 3T4AA 1AHWA 3H9YA 3MLUL 5INDB 3UPRA 2MKLC 1CXEA 4MLSA 5EO9B 4HMDA 2E8ZA 1BVZA 5KTEL 3KLHC 2BVQB 2QBWA 1JGDB 3TLRA 4RISL 1F8TH 1HHIA 5FECB 5CMAA 4X7EC 1A4KB 4XC3L 1DBKL 3TV3H 4CMHB 4P5KB 3QH3B 5E2VL 5ESAA 5AEAA 4YDIH 4HQQL 1QLFB 3U30B 3RWHB 2XN9E 5TFSL 1BZ7B 1ZLSL 4I18C 3ZT5A 5D7IF 5CJQL 3UO1H 1AD9A 1OTUD 3K7UA 4FQIH 4ZG1A 4L8DA 2AJ3B 3PV6B 2X1WL 3KPTA 3LQAL 3VFGL 3EDEA 2ZWLT 4NNPL 4X80H 3VWJD 1T0MA 4AY0A 4EJ1C 3OGCA 2FZ3A 1S7WA 3UZQA 5T3XH 5ADPH 1NGXA 4D0CA 5F3BA 2YZ1A 3S34H 4FQXC 5GZND 3H0TB 1IGIH 1R5WB 2FO4A 1FP5A 4AJ0A 4I0PC 2R1XB 4NZRL 2DYPB 2UVEA 3P4MA 5KVGH 4U31A 3HRZA 3QJHB 2CSPA 3PNWB 5F7EL 5F3HB 3U4EA 1WAAA 1KIRA 4E5XA 1N7ML 4OZGE 5GGSY 4FZ8L 5JXAH 2Y5TA 4N8VA 3F7VB 3IKKA 2NXYB 3MUJA 3T77B 4F33A 1A3QA 3ULUL 4P4RA 4YE4H 4M6NH 3TJEL 1XZ0B 4XHJC 4PRAA 5DHVH 2XNAA 2VITA 5F1IA 1UZ8A 5JMRA 2A9NH 2P8LB 3MRMA 4Z0XA 5HDQH 2X6MA 3OHXA 3KG5A 3IFPB 3UPRB 1X4XA 2AJXH 3QCTH 1VGKA 1XF2B 3RVWC 1G7MB 4WFHD 3E8UH 3C08L 1KGCD 4G7VL 1VACB 1T66D 4X6EB 1FYTE 5D96C 3W0WA 3I75B 3M8OL 1UXWB 1OAKL 1EAJA 4N0YL 3SBWA 1AH1A 4X6CA 4HSQA 1RJLB 5D2NA 4ODSL 4HKXA 3BWAB 3FOMA 5EC2B 2XKUA 4WO4C 1CT8B 5HGAB 2FWOA 4F7TA 4OUUB 1JNLH 2ZG1A 4PGJA 1JHLL 3V8OA 3IDIB 1YEFL 2R4SH 1TJHL 4JPVL 3L7EB 4WDIB 3VFSB 2V17L 5AG8A 2PTUA 2XZCL 3EYQC 4XMPH 1A7PL 5D1XC 1P4IH 1UG9A 1P84K 1E6JH 1AI1L 1S9XB 3HAEB 2GFBB 4MNHA 5JIHA 2GK0A 3GM0A 4OQ1A 5DT1H 1TQCB 5C08D 1OSZB 4PY8I 4OIIL 4RQQA 3EJYD 4F58L 2BNRA 4RZCB 3VFRA 2BVPB 2BSRA 5T1MA 2E7MA 5C08A 5BZDB 3RGVA 5K9JL 1TNNA 3IXTA 1KGCE 1SMOA 3O3EA 2Q7YA 4QT5A 1R3KA 2H9GB 5GGUA 4RMUA 3DI2B 4FQCH 3EUUA 3W5MA 4B7LA 4XNZC 1C16A 3X12A 5D2LF 4OFIA 1EFXD 4OKVA 5FYJU 4LKCA 5IBLD 35C8L 5IQ7H 1J05A 3BH8A 4DKFH 4EIZC 3C5JB 4AEHL 3U83A 3T0DA 1YN7A 4LLVB 2MFNA 2GK2A 3MNZA 1M7IB 1HE7A 1UZ8B 2NXZD 3DVFA 3I02A 4JHWH 2NZIA 4Z95L 3MYZA 4NNXB 1KOAA 4GG8A 2VWEC 3V5HA 3N85H 1T04B 3QNYA 4K7PX 1UWEL 4P23D 3FRUB 1DJSA 2QQKL 1Q94B 2NY2D 4N9OB 1BBJB 4K23L 1BQUA 1IC5H 5IHZB 4R26L 2VDRH 3HMXH 4RGOH 1MHHB 2ADIB 4N0UA 2Z8SA 4YXHL 3QI9A 4HC1A 4NQVA 1DQLL 5T3ZE 4JG1H 5KS9E 4V1DA 1EFXB 1WFUA 2W60A 4LPVA 3M1BB 4WCYH 2VXTH 4G9FB 5DQDL 3CFJB 4N0CC 1MQ8A 3WD5H 1U3YA 2GITB 4P4KA 2NXZB 4D9LL 5C07E 1A64A 1IQWL 1BQHG 2OL3B 4JVWA 3KPNA 5EC1A 1LO2L 4WEMB 1S5HB 2FWOB 1EEYB 4RIRA 1E28A 4Y8AA 4C56B 1NBZA 1KJ2B 1LEIA 2NY5L 4Y5YA 3VXSD 2VLRA 5D72L 1GGCL 4PJAB 2EDOA 3CFKA 1MCKA 5DD3L 1IGYA 4KU1A 2WQRA 3RY5A 5LWYH 4JFZH 1LNUB 1MAML 3KYNB 4I2XB 3QA3B 5GGRB 2AXFB 5IMOA 1QR1A 3ARGD 2J8UE 3GBNL 2D7TH 1A6AB 4PB9L 2AEPL 4X4ZA 5E8PA 4JREC 3DV6B 4HIJB 4K3JL 1I7UB 2Z8RA 1J1PL 1FFNB 2JE8A 1N0XH 2R9HD 2BC4B 1MHCB 4ODSH 4ZPVA 5DK2B 4L8SC 1U6AL 5DJ2B 3H42L 2A83B 1EZVX 1XGRA 2WWMC 1WV7T 1ZVHA 4UAOC 3RY4A 1YQ2A 1XCTB 1JGDA 4P4KD 1A7NL 4EBQL 4OD3L 2MQCA 3KWWA 3IDGA 5HHVL 2X4QB 4MNGE 4BA8A 2FNBA 1WZKA 3CH1B 4HAGA 4UT6H 1JMZA 1R3JB 4RDQG 5ERWA 3O6KH 4Z18A 1ZANH 2ITDB 2YA0A 5EOTA 5I73C 4JANB 4U1LB 3HR5A 4KV5E 2CRMA 3OMZA 3V95A 5C0BE 2G60H 2IAMC 4RFNB 4LCUB 4LIQL 2F8XC 1XR9A 2E7CA 4QRRB 4TULH 4LVHC 1F3JB 5DD1H 4PP2B 3QEUB 4H8WC 4DW2L 5E7FA 2E6JA 1TJHH 4X83A 3HN3A 4UOW0 5GPRA 4BSJA 4P4KB 3IU3B 3NFSL 1MUJB 5JW4N 3UTTD 2NYYC 4RMQA 4G5ZH 3U79A 4PJ7A 5FHAL 1NLBL 2FHBA 5EORL 2PCPA 5E8NA 3MOQA 2HT4D 4AYFA 2GKIA 1V3JA 2E9WA 4HCRH 1OLZA 4LGSB 4LLMB 3UC0L 1KJ3H 4Z9KB 4DN3H 1MFDL 3CZJA 1JL8A 5ADPL 1CFVH 4LLYB 1FYTB 4JO2H 1TJGH 4Y5YB 1X4YA 4OIAA 1I1AD 1SM3L 4HS3B 4KK6D 2VITB 1F3DH 5F1IB 5EFIA 3UBXG 2X4TA 3K80A 4Q0XL 4NT6B 5CSZB 1YEFH 2R4SL 3OXRB 4O5LH 3QA3A 3LN4B 5FUCE 3MCKA 3UTTB 5E8OA 3V7AG 2GUOB 4PUBH 3T1FA 5FM4A 2PTTA 1KYOK 3P4NA 5C0AA 5HI5D 4KTYA 3TNNB 4ODVH 1HEZA 3FFDA 3NACL 5TDNB 1WT5A 4LCWD 1CLZH 1CS6A 3JXAA 5ISZD 4MJID 3U0PA 4EEEA 3LQZB 5T3XL 4FXGB 2EDEA 2F53B 3KDMA 4JB9L 3NPSB 1V3KA 4L9LA 3K4ZA 3K46A 1CD1A 5F7KC 5T3ZL 1AGEA 1CD8A 5L2JA 3MGTB 3U7WL 4QCIA 1YPZA 4ZXBB 4F7TB 4L4TD 5FB8B 2FIKA 3PWUB 3BPNB 3O4LE 5JNYA 1ZLSH 5C0DA 4G80A 1C8PA 2VKXA 4BKLB 5T3XD 4HQQH 3LV3B 3QEUA 5CHNA 5EULV 3RIFF 3OKKA 1H3UA 4LLUA 1NMBL 1W0VA 5D7JB 4PG9A 2VR9A 3ULUH 5JXAL 4TRPL 1VADB 4UU9B 1K4DB 4LARH 2FO1A 4HUVA 4O51B 3Q5YA 3QCUL 4P46D 1JPFB 4UT9L 5DRNA 3OHXB 4XXCA 1H8NA 3CNKA 4JVPA 2DN7A 3TJHC 3S36H 4U1KA 4DAGL 5JHLH 2VERN 2BVPA 2VDOH 5I74B 5FIEA 1WTLA 5DQ9A 1T03H 4FQ1H 3DNKA 4HPOL 3LPGA 4HGKC 4MXVF 5D96B 4ZXBD 3GMLB 1REIA 2OSLA 4R97C 3D18B 1S78C 3I6LE 4S1SL 1TENA 4BQ6A 3EGSA 4EKXA 3TF7C 3S6CA 4JRYE 1C5DA 1KCSL 2XZZA 4GUPA 4JY5L 2F74A 1UWXK 5I18L 5LCVL 4XGZA 4MCZB 3MV7E 3LZFH 1UZ6E 1VPOL 5F71A 1FRGL 1IAOA 3ARSA 2AJUL 5SX5K 3W0WE 3B9KA 1FYTA 3ES6A 4GRLB 1HH6B 2YBRA 4KKCC 4KRNA 1G7HA 5E4IA 2DBLH 2W38A 2WUBL 3ZKXB 3QG6B 5IUSA 2DL2A 2ZSVB 4LBEA 1YC8A 1X5AA 4OFPA 2O61A 4O5LL 1CYGA 1U8LB 3OXRA 3BPOB 1XIWA 4Z7WF 3GJEB 5LGKA 2ADJB 3FT4B 3QPXL 2E9JA 2F53A 3KVQA 1AY1L 1L6ZA 5I66B 2CK0L 4X9GA 2YEZA 1MRCL 3EFFA 3O3AA 1EPFA 4LU5H 3MUGB 3AS3A 1IM9D 3C9NB 1T7YA 4U7MA 1MLBA 4MA8H 3QZWG 5JIPA 4XP6H 4JFEB 5IF0B 4TTDD 2UVFA 1NCCH 4XVUD 1CD1B 3RAJL 4QHNB 2B0SL 1WAAE 3KPSD 1BWMA 3THML 4C83A 4HUMB 4E42B 1NCAL 3T2NH 4I9WD 1EGJH 2XA3A 2WK2A 1DN0B 3D87B 4MDIA 3QFDA 3U7YH 5E8DH 1HSAA 1QKZL 2R2CA 4P5TA 4XAKD 3HRPA 3L3GB 3IJYB 1A1NA 3P30H 1OP3K 1IVLA 2XZAL 3D39B 1LP9F 1A3LH 5DD6A 3LDBB 3LAFA 1DQMH 2FX9H 3MLXH 4XPGL 3D48R 1BEYH 1CXFA 2DIJA 3S35X 4J4PA 1BWWA 1EBAA 1GL4B 5B21A 5E94B 3RZWA 5M95B 4DZBB 2Y25A 4XVJL 3P2TA 4OZFG 4J4PD 4W4OC 3QRGL 5HDBE 3QQNA 2VDLL 1K4CA 3T3MF 3WFBH 4Y4FD 3U82B 3NPSC 3QXDB 4FG6C 4H0HB 1RK0B 3KWWB 2VXVL 3D85A 1FIEA 3X13B 2IG2L 2F74B 5FHAH 1T1ZA 4FXKB 2X4OA 4KQ4H 3BN9C 4TVPE 2ED9A 2UWEA 3EW3B 3OB8A 4V2CB 1LEIB 3HMWL 3QEHB 4OZFH 4OZHA 5EUKA 1G0YR 2QHRL 3NCEB 2EDLA 4HX1B 1K8IB 1MCQA 4OCYH 3WIIL 4LCUA 4Q7DA 1ZS8A 1FNAA 3EFFB 1ZWIA 4GMSL 5FGBC 1B0RB 1UA6H 1F3JA 2O61B 4G6FB 4ZFFB 5T3ZD 4OCXL 2XA8H 4WI9A 1MRFL 1FO0L 2VLKE 1MAMH 4N9GA 4IEFB 4U0RB 3CVHA 1HZHL 3FQWA 3F8UB 8FABA 2HG5B 3BPLC 1PDKA 3GO1H 1IM9A 3IS0X 4HS8H 4WHYH 5C0JB 1ZANL 3TNMB 2FSEA 4EN3B 4X4MA 5DEFA 5H94B 1EO7A 2HJLA 3CK0H 3ZTNL 3TBSA 1C1EL 5CEZE 1NSNH 2XACC 3QULB 1F3RB 4PRHB 1CI5A 2NY7H 1F6AA 2JCCA 5F6HI 2PCPB 5IFAL 3SY0B 5GZOD 3KPQB 3DVNB 2XXMB 5I1DB 4OGAD 5JW4M 4RMRA 3MRBA 4CN4A 3BQUA 5IB3A 5GGSA 1A6TB 2DLFH 1I9IH 3CFBB 4IHOA 2DQEH 4MLIA 3H8NA 4ZTOH 1PKQB 5I8CB 3RY6C 3ILPB 3CUPA 2D0FA 4IRJB 2AK1H 4X6FA 1AQKL 3O6KL 4EN3D 3RNKA 2PTVA 2XQBL 4JJ5B 1BPVA 4HUKB 5SV4A 4ONHA 4PJCF 1OGAB 2DL9A 4WW2F 3GHEL 1QUNA 4TOYH 4PRHD 4MGXA 3FJTA 4J23A 4CVXA 2X4NB 3A6OA 5LKNA 4X6DA 1YY9D 4KXZI 3O4LD 1JGVL 2XWJA 5DFVD 4YPJA 3GSNL 4Q6IC 4MB3A 3ALWA 3WV0A 2J8OA 3KDMB 4JN1H 4R4FL 4ZSOE 4BUGA 5EU6E 1PSKH 1YEDA 1UFUA 4LIQE 4K7PH 4HUXA 3O6LL 1FPTH 2FJHA 5B38G 1CICB 4HFUH 2P1YA 3QUYC 4KI5F 3L9RB 4JFQA 5ADOL 1P5UA 4KDWA 1FN4B 3DX6A 4WV1B 2FEDC 1MFEH 5F1KC 1J05B 5E9DE 2ATKB 3AC0A 2WIMA 3ZTJG 3F7PC 2Y9RT 4CU7A 1N4XH 4IOFD 1G7IA 3R0MA 5DJCA 3I50L 1NKOA 1KPUA 2QQKH 3EOAB 5DMGC 1RU9H 4K94L 1U95B 4ODWA 4D0BA 1MY5A 4NJAL 3VFOA 3DTXA 5E8OB 2XKNA 3W5NA 4LSQL 5J9PB 4HS3A 5DJXA 2NZ9D 4MJIA 4HK0A 4MAUL 4JPVH 3MRIB 2HVJB 3GSXB 4PJ8D 2VKWA 5C0AD 3CXDL 3WFDL 3FZUD 4K7PL 1QYGL 5D6CB 4CMMB 2ARJA 4FXGA 4DKFL 4AENB 1KYOJ 3WHXA 4KVNL 2WANA 1ZKAA 3C2AL 2A6DB 5EO9A 5EU7E 3MLYH 4XBPA 3SY0A 2NW2B 3KJ4B 8CGTA 4ELME 1UEYA 3PL6C 4JZJB 5D1QA 4TUKL 4QHMB 2ENYA 5KVDH 3UYRH 3RNKB 3OBAA 2AEQL 4XCNB 1OCWL 3UYRL 3PABB 5BRZD 4F9PC 3EO0B 4L4VD 5J6HA 4FFWC 1ZSDA 5DJDB 4RGNE 5C09E 3OR6A 3QB7C 3L5XL 4QYOB 1XR8A 3DHMA 1BHGA 1T6VN 3H3KA 1QSEB 5I17A 1U92A 1U8PB 4PGCA 1MFAH 2HT2D 3KXFE 3QDME 3F7YB 3RHWK 3SPVA 3LEYL 4XVSL 1BZ7A 4BFGA 2VL5A 2MJWA 2D7NA 1J10A 5ISZA 3SJVE 3VFUB 2CLZA 5DJ8A 4WW1B 1NGXB 4TNWK 3WFCL 6FABL 1SYVB 2CUIA 1YYMH 3FB8B 3QFJE 1I9JL 4RFNC 4OFYA 1PAMA 3UJIL 1FFNA 1WFTA 1FGVL 4D8PB 4ZD3L 2WBKA 1GZPA 3QWOA 3HC3L 4X9BA 2DMCA 3MRCA 1CK0H 15C8L 2VSDA 4XNUL 5SWQA 3BN9D 4J3VA 3IETA 4JR9L 3MODL 1CBVL 2HN7A 2C3VB 4DFHA 2WW8A 1N5YH 4YO0B 3GHEH 4ZUTA 2ZUSA 2YD9A 1FCGA 3Q6FB 1QSVA 3IFOB 4PB0L 1VEPA 4HK0B 4HJ0C 1GH7A 3LQAH 4XHJD 2J4WL 5MI0C 5TPWH 3T65A 5IW6A 1K5NB 4PBVC 3KPRB 3DUHA 4JFFD 3FFCB 1DSFL 4HH8A 1CVSC 4L3CA 5IVXA 3P11L 5DUPH 2YEZB 2IAMD 4HBCL 5MENB 3DSNA 1U8MA 1U8NB 4ZSOA 2P5EB 5JW4Q 4NGHH 3E8UL 4KAQL 3PQYA 3O9WA 5ANMA 4HXAL 4NQSB 4WY7L 5D7KE 1TCRA 5I76A 3GM8A 1C1EH 1D3CA 2HFFA 5J12C 2AK4A 3GGWB 1TVDA 2PXYA 1NMCC 4KKCD 3NABH 3P9MA 3VI3F 1A1OB 2FYYB 3VWJC 1AD0B 3O9WC 5EWIL 1QLEH 4POZD 3V0AC 3H7BB 1GOFA 3FRPG 3CIQA 5GISL 1JNNL 4MJ5B 3QJFA 5ITBL 4MJIE 2JB6A 2YPVL 5EUOB 1QBML 1X5XA 1A9BB 1MCOH 2BOBA 1Y6NR 4DGYH 2AXGB 1CFQA 4HMEA 4LVNB 2IAMB 1A1MA 5MEND 3GIVA 3K8LA 1HIML 1SYVA 1KB5L 5CBAB 4HK3N 4LHUB 4YH6A 3S9DB 3I3BA 1HHGB 3SKNA 1L7IH 2NQCA 4OLVL 3MC0A 5I2IB 4GH7B 1WICA 4DVBA 5KSUB 1KF9B 1OAYH 3T0AA 4X4ME 5A40E 1I8KA 5I8OH 5GRXG 2VLMD 4UBDD 3ZDXF 4OV6F 3TCXA 2BMKB 4D8PA 2H3NA 4MS8D 2NY3C 4NDMA 4NNPH 3MJ9L 4XXDB 1Z5LB 3JV4B 2EYSB 2ZOKA 5IESH 1Y6KR 5I8EB 5E2UH 5IWLC 1IAIL 5DD5H 1N64L 3N06B 1YECH 4M1GL 2ILLA 1YMME 3RWFB 3QWQB 2B1HH 3EFDH 1PY4A 3UTOA 4M5ZL 4L3CB 1YEGH 3TT3L 4KUZL 5A2LH 2FEEI 3MUY1 2X09A 3FN9A 2KZ1B 4ZOCA 3GJFH 4WU5A 4EOWL 5JR1L 3QEHA 5HHME 5FK9B 2AXJA 2NY2C 4R2GD 2V2XA 1UJ3C 4OGYL 2NY0C 4MQTB 5E00A 4DGVL 3V6OE 5IB1B 3MJ9H 1G6RA 2BHZA 2A74A 3RHWF 1C08A 3TZVB 4OLXH 4X7FC 1GRWA 5IB2A 1N8ZB 4JKPH 1F97A 3PXJA 4KMTL 2YK1L 1JGEA 4PRPB 4KDVA 3LKOA 3QDJA 3LEVL 4UOJA 1DL7H 3HUJA 1ZT4B 4KJYA 4AZ8A 2NCMA 1KEMH 4YR6A 2V9QA 4HWBA 1S5HA 3HE6B 1CFNB 3PQYE 1SBSL 3ARBD 3NTCH 4D9RD 3AB0B 1QRNB 4M61B 5C09A 3G04B 5JPNA 4LHUA 3DJ9A 4YEEA 1NDMB 1FZJA 5LGJA 5C09D 3D3VE 2SEBB 1R3LB 4L3EA 3LEXB 3MV7D 1CFQB 2HVKB 1B3JA 1BJ1J 1HQ4B 4NHCH 1JI1A 2J88H 3U2SA 1BFVH 2W65A 3LPFA 4I0KA 1MJJB 4P2OC 5C0BB 4B5EA 1JIBA 1RJYB 5IR1A 4PJHE 2FECI 1GOHA 1YECL 4M1GH 2EDYA 2ADJA 3FT4A 1KCSH 4PJBE 4YFDB 3ULVH 5C0EA 3VXQA 1Z5LA 4Z78A 2FL5A 1A8JH 4HIHA 5D7IE 3EYSL 1TLKA 4WTXA 1X5ZA 3OGCB 5L0QB 4QWWC 1MLBB 1G7LA 1KELL 3OKLA 4QOKD 1JZ7A 3QDAA 1JBJA 4WU7B 4LASH 1I7ZA 5F72S 4JFQB 3ETBF 4MMZC 4YLQT 3EDDA 2X7LB 3CFEA 1YYML 3D2UA 1ITBB 4LSRL 4WV1A 3MBEC 4R7DB 1GGBL 3VXRB 3IDGB 2Z91B 4P2OB 3VXUA 2V2XB 4WFFD 2QTEA 5FKPB 4OBSA 3JV6B 5K9OB 2HMID 5LBSH 5E6ZA 4FQJH 2A38A 4P2RD 5FUCC 1OD7A 2DB8A 1NGWB 4H20L 4I2XE 3HCVB 1MCJA 5D5ME 1C5BL 4YX2L 4Y2DB 2ITCB 1H3GA 1BJ8A 4DEPC 1HI6A 1KB5A 5FM8A 1Y18A 5IW1B 5KSBF 4KPHL 5IB2B 3DYMA 5CEZD 3I9GH 4RAVA 4JGUA 1FVEA 5D2LE 1GHFH 1JZ3A 2YOCA 1EXUA 5TE7H 5K9QI 4ZTPH 3HUJB 5CZXC 3C09C 2H32B 3ORJA 3GSVA 1AQDA 3V8CA 3TYGH 3MLTA 1IGCH 3HE6A 1ZA3A 4NGHL 3DUSB 2BFVH 3WHXB 4KJPD 3BZ4A 2J12B 1XGPA 1T4KB 4K8RC 4RAUB 4OI9A 1MQKL 4YQXH 1INDH 2HJFB 3R8BB 2DIAA 3V52L 1P4LA 4MXQD 4R4NC 4FMFA 1QNZH 2R23B 4LLQB 1NC4D 5GGRA 4A2LA 2ZUQC 3MRFB 5JOFB 2I24N 3T65B 3V4PH 4G8IA 4XWOD 2J8HA 4PJ9D 3GK8L 4OBRA 5AG9A 1N6QH 1FCCA 3I85A 2R0WL 4KGJA 2HKHL 2H45A 5DURD 4WTZA 1B6UA 1ZHKA 5KS9F 3BKYL 1FHGA 1AXSA 2M2DA 1HXMA 5F9OL 1SY6L 5IWLA 3MZGB 5M94B 3MR9B 1FNHA 4IIQC 2L7JA 1FDLL 4UQ3B 1NC2D 4OM1H 3WHE0 3IXAB 3TBSB 2HMIC 3SBWC 3UJIH 1XH3B 4S1RH 1RZGB 4LCYB 4Y0GA 2OK0H 5CKGA 4JFXB 2W0LA 4KHTH 5GZOC 4YIQA 3ARFB 3MREB 1MPAH 4Z7VB 1MOEA 2BRRH 3M17A 3C6LD 1K2DB 4TULL 4PJAE 2AS5M 4X0KB 3KYOA 1E4XI 3M45A 4JO4L 2BNQD 2EDHA 4MD4A 3IF1B 1BD2E 3GIVB 2RB8A 1XAUA 1O7VA 1S8DB 4RMWA 5HHPB 4ODTL 1LO2H 2R2HB 2OXHA 1NUGA 3IDUA 4PGBB 4KKNA 4RRPG 4Z7UB 4JHWL 3N9GL 1FORL 5IEKB 4K8RD 4GG6B 4XAKE 4G7YL 1FSKB 3UAJC 2P4AB 2DQEL 1R3IL 5C0CA 2JJTA 4NZTH 2X70A 2N7AA 2HFFB 3SGDH 5MENA 5TDOB 2MPAL 3TBWA 4V1DB 3GMNB 4WUUD 4APQA 4D94A 3C8KB 3TO2A 2VABB 4IOIA 5JDJA 4QHLA 4ZXBC 1CFSB 4P99A 5HGAA 3SDCA 4PG2C 1MCEA 3UP1A 5L0QC 2WV3A 3DYOA 5GRWA 4GUPB 1AGCB 3I50H 1MIMH 2CR3A 1ADQH 1JNHB 1A6PA 4RGMB 1AO7D 1L9NA 2ZNWA 3B9KB 4I8DA 2W9DL 4WEBL 4YHNA 4JDTH 5ESAB 1ZLVH 1V05A 3G6JA 1WC7A 5EUOE 1KN2L 3O3DB 4LGRB 3PJSA 3T4YB 3HI1B 5C0ND 2ZPKL 3BO8B 3RNQA 2OTUA 1S9KC 4NO2B 1K85A 2Q86B 4MA7H 4OT1L 2ENSA 3UTTE 3B9KC 3NA4A 1GGIH 4OLYH 5ADOH 2KDGA 5FYKD 3TBYB 1IGJA 2RR3A 2OJEA 4WVRA 2PYED 2EDDA 1DUYA 4ZOEA 4JPKL 4ZPTA 5JZ7C 1Q1JH 3L3JA 4ZUVB 5DFTA 4GKZA 4X8JB 2VISB 3O3EB 1HYRC 3FO9A 2X9WA 2F53E 4YK4B 5HYIA 1QA9A 3IAPA 1MFCH 1IE5A 1YMMD 3RBGA 5IMLB 5EPMA 4K3DL 5GS0C 3EYVA 1OP3H 4OKVB 2VDLH 1ZA6A 4HC1H 4RCAA 5ETUA 1N6QL 1B4JL 1A6WH 1QR4A 1T5XB 5AWNL 5FF6B 3HS0B 4HXBH 4LQ1A 4GXUM 2IQAA 4H1LG 2XFXB 2YXFA 3BT2L 1U3ZA 4BELD 2WWKO 1OGTA 1QO3A 3QUMA 4YDLC 4YHLL 2G9HB 4ZTOL 4JO3H 5HHOD 3T77A 3OR6B 4M1CD 1YNTA 4MB4A 1MVFA 3ZE0F 5KJRH 1RURH 4BFBD 3QDGD 4P9HC 1QSEA 5I17B 2BY0A 5J13B 5DEGB 1V7NL 4PJAF 4PJFB 1OAKH 4N0YH 3V4VL 3VI3E 3GMNA 1QZ1A 2P8LA 1J8HA 3O6FA 4LF3A 4MAYC 4MQXD 4P2QA 4XVTH 3DURB 4KV5F 2VMFA 1INEH 5DTFB 4ONOA 5DS8B 2C3XA 2P24A 1WBYA 1WCBA 3TBWB 3QQ4A 3J8F7 2NMSA 1BF2A 5LAXB 4IOIB 3ARGC 3ARDB 2QLVB 1IC7H 2QSTA 4YGVA 2NY5C 1VKXB 3MV9A 2BVYA 3WXVH 3VJ6A 3TO4C 1JYXA 3CGTA 1TZGL 2EKJA 2GJ6E 1J7VR 1B9ZA 4NN5C 4AMKH 2F5AH 3OJ2C 5I9QC 1DTUA 2VZ1A 3SDAB 4EDXA 2HVKA 4WUKL 4OZGB 3NCJL 1J1OH 4OCSH 1YEJH 4S1RL 4L8BA 3SO3C 3ARBC 1MJJA 1L7TH 5HYSB 5KAQF 1IAMA 2CUMA 1AO7A 4JREB 3P73A 4LSRH 2IPTL 2HWZH 4JFEE 2V5MA 5E2VH 2IAND 2I27N 2FJGA 5C08E 1WF5A 4XC3H 1RK1A 2ICWA 5C3LD 5J06A 1RZ7H 5FYJD 3R4DA 1R3HB 1CE1H 3PGCB 3WKMH 3VI4E 3P77B 3RX8A 3QXVA 5IT2L 3VFGH 5FO8A 3BKJL 4JEGB 4KI1A 3MLWH 1TCRB 1DQDH 3OAUL 3TA3B 3EYVB 2BJML 1B0GB 3VE0A 4EUPG 5SWSA 4NKQB 4C59B 4H5SB 3IS1X 3O3BB 3QWRA 3MBXL 4LSTL 3O0RH 4PJIB 5EA0L 3ZKSD 4MZ3A 4X98B 5H37H 3STBA 2NY3B 1WITA 4IM8A 4U3HA 3MJ9A 1IEAA 5B22A 1PD6A 4TUJB 1F8TL 1KCVH 2B39A 1OQOA 3DROA 1Q72H 2VC2L 3BGMA 3GB7A 4PG9B 5IB4A 2DJUA 4YZFE 1I3GL 3MLVL 3HE7C 3S96A 3NIGE 4X7CC 1A7BA 4HZLB 3T0EC 4IRSA 3E6FA 4K07A 4PJ7E 5MEQA 3O4LA 4PTUB 4UILH 1D5MA 1WAAF 3T2PA 5DC0A 5JDSB 2AABL 3ECBA 4DGIH 2R29L 1N59B 3HB3D 1M1SA 1DBJL 1RQ5A 4Q97A 2R29H 1UQSB 4BZYA 4XPGH 5KG9B 1UM6L 2A9NL 4OD1L 2IFGA 3F6IA 5D71H 1WQVT 2VDOL 5BMFH 1Q9WA 1XGUB 1AC0A 1IKNA 4AH2A 1A14H 2IPUG 4Z7VA 1WIPA 4I13B 4OF0A 1OB1B 1W72B 1VEMA 4KDTA 3Q6GH 1TZIA 3LQMA 3S88L 5F8QC 3MV9D 2ICWI 4FFWD 2VLKB 2X40A 1NEZA 1E4XH 3QAZC 1CTNA 1NH6A 4H1LA 3DYPA 1AIFB 3NOIA 3MPCA 4G8IB 2COQA 3GSWA 5ICXB 3DBXA 4YC2B 2I9TB 1D5IL 3SDXE 3B5TA 2XKNB 5CCKL 1G9NC 4FQ2H 1I9EA 1UXSA 5FDWB 4PGBA 2OQJB 2B0SH 3QT2A 5EZIL 1YJDL 1BOYA 2M26A 1OL0A 3LS4H 4PYGA 3VXPA 4OLXL 1I7TB 1CL7H 4Q58C 5I8KH 2FJGB 3OKEA 1V8HA 4DN4H 1CL7L 4EI5D 2K1MA 4X6CE 5L2KD 4JAMB 4I48A 5E8PB 2WWMD 1CD0A 1CE1L 1LK3L 4P5KA 3PWNA 4ODVL 3RWCA 1F90L 3CU1A 2XZQL 1XIWD 4R2GC 4NO3A 2VYRE 5E99L 4PJFF 4OLVH 5D7LA 1D5IH 2K9UA 1C5CL 4QXTA 1YEJL 1UB6B 1L7TL 2GAZA 1S7QA 1JYWA 4ZDHB 2ZUQB 2VAAB 5IJVB 4MD5B 4FQLL 5ITBH 5T33L 2XWJB 1CQYA 1X5LA 4GMTH 3RVTD 1CFBA 4Y4FA 3VWJB 2NNAB 2NY0B 3HR5B 5IIEA 1G1YA 2EC9U 3STLA 1SJEB 2LAAA 3GMPA 5BO1L 1UH3A 4HZLA 1YEDB 4K3HA 3HPLB 3C09B 3BXNA 3VA2C 4JM2D 3OAUH 4LVEA 4M4RA 2P45B 1I1RA 1MHPL 5C0CB 2OL3A 4JQXC 4U1IB 4ACPA 3QWOB 5GGTH 2FX7H 5GRZA 1YA5A 4TQEH 5KG9A 5F21B 3SE9L 1JFQL 2FL5B 2P43B 4JO1H 1J1OL 4OCSL 5ENWB 1HHHB 3BMWA 4HBCH 3QUYB 1GXEA 3V9FA 4Y4HD 5GJTH 4WFEE 2I25N 3UROR 5DYOB 5ITFA 4M62L 1CXIA 1I7ZB 4JY4A 2D03L 2BHUA 5GS2H 3VH8A 1UEMA 3HNSH 4P2YA 4NSKA 4XP1L 3C8KA 3TO2B 4N1HB 4HK3J 1A6AA 5C0RH 5SWSD 1BM3H 4OJFL 2H2PC 4KRPC 3CCHA 3MRPA 4JM2B 3U9UB 4UT6L 3MLWL 2XN9A 5C86A 3SQOL 5DWUH 3KYKH 5TQ2H 4ELMF 1ZWIB 5C0CD 1HH9B 3NAAH 3ARWA 5IMKB 3RZCA 4ISVA 2AJZA 3JZ7A 3WUWA 2QSCH 5H8DA 4EUPH 4QRPB 2IPTH 3QUYD 2BNRE 4GRWH 3S4SB 4Y4HB 4ZD3H 1TIUA 4M6OL 4X8JA 3CVHH 4UB0H 5HGBA 1MCPL 1PX4A 5TE6L 1W8NA 4HUNB 4HUWA 3G6AA 5IVOA 4M48H 3QUZC 3FOMB 5EC2A 1T0NA 4ZPTB 3VXNA 4LLWB 4G6KH 1T1XB 2VDKL 1L0XA 1TZGH 1IC4L 2J6EH 3GGWA 5I71B 3X3GH 3WIFA 3MFFB 1NEZG 3KPMB 2F5AL 4DOHE 4N1CA 4M3KB 3ULVD 4MNHB 2YRPA 4K3DH 5GGQH 1CWVA 1DE4A 1R24A 3U4BL 4NUGL 1Q0XH 2OTWB 4ZFGL 3AREA 3BXNB 1UWEH 3R06B 5HGGS 4CNIA 5L8LB 1NDGB 3PGDB 4QY8A 2IC2A 3LKNA 3VFMB 4G6ML 3BE1H 5IP4A 4D9QD 2AXGA 3W9EA 2RBLA 4CVUA 5JW3H 4WO4D 4OF8A 4CL7A 4OZFA 2BVUA 1FJ1B 3QIWD 1H5BB 1BP3B 1YNTB 5E08L 4GBXD 4PJEA 3GSNA 3MRKB 5IBUB 2EDFA 2VLJA 4QHUA 4YHML 1Q8MA 3EO9H 2D7OA 4JN2A 3RX7A 2HFEA 4X9HA 3TH3T 4I0PA 3IGAA 2CDGB 4I3SL 3UDWA 2A0LC 1A9EA 5CJXC 5FYLD 2OZ4H 3FQXB 1ADQA 2MMXA 3LHPH 3MA9L 5E7BA 5IJKC 3FMGL 4U3CA 2GJ6D 5AWNH 3HNTH 4JFOB 5IKCA 2WNGA 4OUUA 2NXYC 2CMRL 5KBNC 1U3HB 1TMCB 4N90E 5CEZH 1PX3A 5KSAB 1IKFH 4P23B 3WN5B 4PGDA 3WHE1 4ETQB 2VOTA 5FM5O 2P46B 4X9FA 4JFHE 4JQVA 4X6BA 5ACLA 4N0FB 4OLWH 2PKDA 3CMOL 1GC1H 3TGXA 4K3EH 1PJ9A 1DP0A 2X4PB 2ZSVA 3IKCA 1CICC 3DXAB 1FFOB 4YXKL 2FD6H 2VXUH 5SWZE 4KDTC 1IC1A 3VWKC 3BUYB 1FZKB 3OWEA 3X14B 2AK4B 2CIKA 1IQWH 1T0PB 3O2DL 5EU3A 5GHWH 2YD3A 3OPZH 4R0LA 4CU6A 2PO6C 3FT3B 3FN0H 4JPWH 4S1DD 1VDGA 4FOMA 4LLWA 5FKAA 5HHOE 1QPPA 3VGFA 4ZFOB 4B0MM 3E6HA 4DCQB 1PSKL 1H8OA 2PW2A 3CC5B 5CEXA 2ORBH 2A73B 4K7PY 5KSAD 3TVMD 3RUGA 3PWPB 1A7QH 3VXSB 3B9VA 3HI5H 3L7FA 1DQTA 4XMKL 1DBAL 2ICEA 1ZK9A 3O81A 4QTIH 5DWUL 5TQ2L 25C8L 4TUOA 3IU4L 3OGOE 5GS1C 1S7XB 1KJMB 3QFDB 32C2B 4D9QE 3O4OC 2PUQT 4M61A 5F7YC 2OZ4A 2Z0BA 1GC1C 1QR1B 3TCLA 2OZ4L 4NZTL 4M6NL 1S9VB 3UYOD 1MI5A 2P5WA 3BP6B 3JV0A 2Q7NA 2DLHA 2OSLB 3FQNB 1M4KA 2ESVE 2J7LA 5HGDA 2EH7L 2BMKA 4WHCA 4M48L 3BD3A 5LG1A 3V6ZA 5JHDD 2WBJC 1AC6A 3TVMA 1NSNL 5J56B 3CH1A 5LXGL 3OKLB 5HY9A 1Q9WB 1XGUA 5H2BA 4ODTH 5JPMB 1BOGB 4NJ9H 1E6OH 4TVPH 4LSUH 4Q6YA 5CIPH 1MFNA 4P23A 1HKLL 2IADA 4K94C 4XB7A 3WFHB 1UQSA 5C2UB 1RK0A 3S5LB 4ZFGH 1C7TA 2QSCL 2CXKA 3VA6A 4OTXL 4I5BA 4K7FB 1HDMB 1PKOA 4WU5B 1ZV5A 4YDKH 4RSVA 3C5ZD 1U8HA 3RDTB 1QEWA 3MRGB 2V5YA 3FOLB 5L6YH 2YPKA 1TDQA 2XA8L 4ZO9A 3BRFA 3UTPE 4WGWB 1JGLH 1FFOA 3G6JE 4CDGC 4RFEA 5IVZB 2WZPD 3V0VB 2RJMA 5BOZG 2FBOJ 1NL0H 3VXUB 3SDXA 2J5LB 2AXFA 4Z76A 5K9OA 2R1YA 3DX7B 5E6IC 3RI5F 1FDLH 5C07B 5D7JC 1UXSB 4F7PA 1J5OH 3AROA 3DECA 4HZAA 5K93A 1FBIL 2NTFA 1GCFA 3MRDA 4JRXD 4TQEL 3MRLA 3ZE0E 1P7HL 1Z0NA 5F1NA 5JLZA 1ZHNA 3BKYH 4S10A 4Y16C 5SX4I 3ALXA 1FVCA 3BJLA 3O6FC 2HJFA 4MWFA 3VXSA 1WCBB 1EMTH 1QVOB 1MHPH 3V52H 1Q9KB 1NC4A 3VXUD 1CFTA 2E3VA 2J8UB 4LSSH 4NYLB 1XCQA 2X4SA 1M71A 5JORB 5TFSH 1NMAL 2VLME 5HGDB 3C5ZC 12E8L 3EOYG 2B4CL 5C07D 3ARED 1XR9B 3V0WL 5CAYB 4AEIL 1EZVY 3SE3C 3IDYB 3I9GL 3QI9D 5F9WB 2Q8AH 3S36X 2MCG1 3QEGL 4HH9B 5EBLB 5ISZB 3QIWC 2NY1D 2ERJC 1A14L 2C5DC 1DL7L 3WJJC 4X4YB 1FH5H 1CF8H 4O2CB 3VRJB 1FNSH 5BQ7B 2NTSP 2AQ3A 3GMQB 3BKMH 4NZUL 5FA3B 4Z77A 1F4XH 2EIZA 3DVIA 3RUGF 4E41A 4JCMA 4MNQD 4KVCL 4L4TB 1OAXL 3NN8B 1CU4H 1MHEA 1YPZB 4F15C 5FYLL 1A6ZA 2JTDA 4H1LH 3MXVH 1BVKA 3VCLB 5J6GA 1Q9LA 1JN6B 5GS1A 1KULA 1RUPL 1I8IA 5L2KE 1CICA 3IAGC 1CD9B 1KJVA 3BP5A 5EO0A 4X7DC 1II4E 3Q0HA 5D7KD 5E8EB 1EBPA 1KCUH 3UJJH 1VADA 4Z7UF 2ZCHH 4GKNA 4P46B 2NY1B 3FO0H 2WUBH 2ZCHL 4EN3A 3LEVH 3TP4A 2O93L 1JWMB 1WBXB 1JPTH 4GS7B 1XFPA 4Z7NF 5B4MD 4OLUH 1A6VH 3M07A 3P4NB 4D0DA 1U95A 1IBGH 3K4AA 3SDCC 2OR8A 3KPLB 1XF3A 5KAQG 5IK3B 3VFOB 3UZVB 2IMMA 3MV9E 1N5AA 3BWUC 3GMLA 2VDMH 1RZJC 4Y4HA 3QO0A 3WL9B 5IBTL 1H15B 4HFWA 1QACA 5ILTL 5EZJA 5T1LA 3T4AB 3BEVA 4IOSD 3QIBA 4HEPG 3IT8D 4ISVB 3WE6A 4ZYKA 4PJ7F 4TTDC 3SO5A 3KPNB 2NX5B 3KLDA 1ZVYA 2NLJA 4GKSA 4JFOA 5IKCB 1HHJB 4CN1A 4GRLD 4C57C 1KACB 2EXYC 2C4XA 4AIXA 2DWEA 3BVNA 4TRPH 3PWVA 1HOCA 4MJ6B 3WN5A 1GGYA 4NM8H 2ZOLA 2CIIB 4MJ2A 5DI8A 3NTCL 1FV1B 3OKMA 1VB9A 1PG7L 2DQCH 3HTLX 1CVRA 3MNVB 4R96B 3MLUH 4MS8C 2YR3A 5CGYC 4HIIB 1WLHA 2R1WB 3PGFL 5KSBE 5DSCB 5GRVL 1T0MB 4J7RA 4LSVH 3FQRB 1K6QH 2O5YL 3OAYH 1WWCA 3MBXH 5IVXF 1DUZA 4P57B 3RWJB 1EMTL 2HLAA 3FT3A 4NKIH 2G2RB 2E5EA 2HT4C 2DD8L 3O41A 2LVCA 3GI9L 3K3QA 5FDYA 2EEAA 4Q9BA 5IB5B 5B3JE 2DIBA 4P3CH 1DLHA 3OKNA 3P4MB 1JHKL 4UTBL 1MRDL 1MNUL 3F7QA 4M8QB 4M5YH 5FF6A 1QA9B 4HG4K 4R7NA 1XIWC 2X9YA 1KC5H 1YMHA 3PDOB 4JY6A 5CSGA 1ETZB 3F58H 1LK2A 4PJ5B 2C3HA 4YHLH 5JMOC 5GSVA 3MJ8B 1MCBA 4I18A 5T1KB 4DGYL 1Q38A 4UMGA 1T1WB 4KK9C 3TN0A 4JFPB 5HYFA 2AI0L 1FG9C 3LD8B 1T1YB 1P1ZB 3MCLH 4Z0XB 5LGHH 4I1NB 4HXAH 3MODH 1CBVH 4ZUUB 3ALPA 4GBXA 4N0CD 4PGEB 1NGWA 4KAQH 4D0DB 3HZKA 3ZZ1A 5IB1A 4G8GA 4Y4FB 2BK8A 5EH1A 3O11A 4LPUA 4TSCL 1BFTA 4U1NB 3LRGA 5B8CC 5HXMA 4H0IA 3L95A 5DZOA 3KPSA 5IM7A 1RJLA 4OZHB 4NFDA 5D5MF 2D9QB 4FFZH 3NFSH 1G6RH 3WSQH 4HUUA 1KSRA 4X7TB 3QEQE 1MCOL 3QXTA 1FG2B 4F8QA 2DJSA 4KZDH 5T1KD 4EI5A 4JZNB 4JM2F 3E6HB 4DCQA 3P11H 5DUPL 4P5MA 1BECA 5FGCE 8FABB 1K8IA 4AQOA 5DJ6A 1KTRL 4JR9H 4BSVA 1JJUA 3WS6A 4BUHA 1EHLH 6CGTA 2XG4A 2DQUL 4Y5VB 1MREH 5HYSA 4LCIL 4LSUL 1RFDH 3FONA 4P3DB 4NQDE 3ELAT 1W72H 5CP3A 3UAJD 5E2TH 3FQWB 1OD9A 1FNEA 4PLJC 1I1AC 1KIPA 4DZ8B 3DX8A 3MJ7B 2CRIA 4Y2DC 1A47A 2DS4A 5HYJB 1CR9L 1CDBA 3WNOA 1YMMA 2RFXA 3FTGB 4KKBC 2BSRB 3B9DA 4UDTA 4WI7A 3ZYJA 3WNPA 1SY6A 2BP3A 3MRCB 2MPAH 1ZLWK 3P73B 4NCDA 1CL7I 2VLLB 1ZVSA 2HJKB 4NCC1 5JLZB 3CZFA 1GYAA 1MIEH 1OSPH 4J3UA 5GS3A 1H0DB 3ZDZE 4HULB 2ICWB 4NNXA 3BIBX 4PY7A 3ARTA 4XC1L 2QKIB 1I8KB 4PGZA 3VW3H 4Z7OF 4XNYH 5CZXD 3LY6A 3HG1E 3MUZ1 1U8JB 1J1XL 5FO8B 4ONGH 25C8H 1BOGA 3VXNB 1P2CA 4YHYB 3QEQA 4JDTL 4CVXB 4YDKL 3QBTB 5J7CC 2BNQE 4AM0A 1T04A 4RFEB 15C8H 3CFCH 3UYPA 3IB4A 4XCEA 4N5UA 1R24B 2EZ0C 1CK0L 3AS1A 3C8DA 1KG0A 1H8SA 3FT2B 5DDHB 5D7SL 3DROB 5GZNC 5FUZL 1S7SB 2GQHA 4P49A 5EN2B 4LPTA 3W9EB 2Q87A 4D2NA 2ADFL 1CZ8L 3D18A 3LS5L 3RTQD 2EYRA 4L4TA 4JQIH 3SCMB 1ZHLB 2X05A 4OLWL 2XN9D 4PRDB 4XWOC 3BZEA 2W9DH 3K2UL 2FJHB 4WEBH 4QF1B 2ZUTA 3VG9C 1WUNT 2CH8A 3LRSA 4EN3C 1BVKB 3VCLA 4KKAC 2CJUH 4BZ2H 2APWA 2FHCA 3RIFK 2GTZB 3LKOB 1A6TA 4YWGH 5JW3L 4IRSC 5D72H 1U3JA 1OCWH 5DJZA 5TE4L 5B38B 4G6MH 1QLFA 2DLEA 1RZJL 2XPGA 4L4VA 3QDGA 2CKNA 3T08A 3EOBA 1RI8A 3CSBA 2DQUH 3CDYA 5FO7B 1KPUB 2AK1L 1U8LA 4LCIH 1EO5A 2X1QA 4EDWL 2ARJB 1G1CA 4PJDF 2BVOB 3ULVE 3C6LA 4XCFL 2W0PA 4G9FD 1IGTB 3EHBD 1XF4A 1J1XH 3W9DA 2AQ1A 2YSSA 2F15A 4PRIE 4PJ5E 4HBQA 4NP4L 1T66C 3HI6H 5EB9A 5TDPB 4MAUH 3QIWA 1FPTL 2A83A 2JJSC 2Z8WC 3KYMB 4KHTL 4QHMA 3GBLA 1RV6X 3N1PC 2UWEF 3WO3B 4R0LB 3O3BA 2VISA 4JFZL 4O2FB 2F54E 4E5XB 4M8VA 5F7MC 2VDNH 4LDEB 3SDYL 4P5TD 5TGBA 1U8JA 2ED8A 3A6CH 2YUWA 3NN8A 1HK6A 4HT1L 2H8PB 5KVMC 2BNUB 4GXUN 4PJBA 4NN6C 1QSED 1VFOA 1UB5B 4J6RL 3X3GL 1MCRA 3KR3L 4FNLL 5I1AA 4M1DL 3V4PL 5HHOA 1JHLH 3QQ3A 3WD5L 4BSWA 3RX5A 3MA9H 3HR6A 3U0TA 4X5WB 2L7UA 4L3EE 3TO4A 3EOTH 1RIVL 4FFVC 7CGTA 2UYLB 4KGLA 2YZ8A 4PS4L 2ZP0T 4ODXA 4IRSD 4KTEH 4F3FB 3VWKB 5IIEB 3OXSA 4IRJC 2BVEA 2VDPL 3KPPB 1RPQA 1IGCL 3SDXF 1SVZA 5GS0H 4QGYA 4QXGH 1FZMB 1AQKH 4YDLB 4LLMA 1MELA 3GMMB 1K6QL 1JMXA 3I2CH 2D7QA 1UH2A 1FYHB 5DA4A 4MQ7B 3Q6FA 3WLWC 1ED3A 1OAQH 1HZHH 1JUFB 3MROA 1CGWA 1D9KB 1T7VA 4ELMB 35C8H 1O5DT 1B0RA 4BH7B 3KPRD 2C26A 4HCRA 3ARGA 2PO6D 3P3YA 1HYSC 5CGTA 4PJXF 2BZDA 2IBGA 1JHKH 2LABA 1ZT1A 5EBWA 2Z31B 4P0DA 1CLYH 4JM4H 1U8KB 2JELL 3T4YA 5KVGL 4U1SB 1LO3H 5AUMB 2FX7L 3MGTA 5H37G 4BM7A 4MAYA 4XZUB 1FC2D 4QRUA 3UBXI 4S1QH 3OB0H 4TSBL 4QT5B 2Q7YB 4U1GB 1JCKA 1AHWB 3S34L 1DUYB 4QRSA 1NCCL 4JFDE 1FO0H 1DLFL 5LGHL 4GW1B 5IB3B 1HNGA 3G9AB 3ESVF 5BV7B 4LMQI 4GMTL 3BH8B 3S37H 2JB5L 4IMLB 5EPMB 1BM3L 3WNKA 2YC1A 4PPTA 1SQ2N 4IDLA 1MCIA 3EDKA 1QVOA 3HMWH 4JHAL 5EOCL 1B2WH 5DMGD 1NGZA 1F90H 2GHWB 4M8QA 2CLRB 2UYLA 1T80A 1OTUC 1FFPA 4XI5D 1EHXA 2UWEE 2DBLL 3S3PA 5BZWB 3TN0B 1OTTD 3C60C 4LCWB 3HZYA 5IW6B 4YXLL 5DRNB 1JPFA 1RMFH 2XV6B 5DRXB 4GW5B 1MCWM 2NY4C 1CGSL 4XVJH 1N6VA 1QQDA 1RULH 2AJXL 1XGRB 2P5EA 3GI9H 3S96B 3TO4D 5I19H 3CZFB 3VWKA 4FQXD 4OGZA 4ODHH 4WNQB 3KYAA 3IGAB 1PLGH 3ULUE 1BZQK 5C2BH 5D6DA 43CAB 5J12B 5HSFA 4UT7H 4OLZH 4TNVK 5BS0A 3JV4A 5BV7L 1PKQE 4JQVC 2FH6A 1U3HA 3CFIC 2R15A 3RFZC 2Q8AL 1AXIB 4K2UL 3WO4B 4D9RE 4L8CA 3FQTA 1P2CB 4HGWA 4QXUL 2R39A 1VKXA 1A9EB 4APQB 3BSZH 3T09A 1RMFL 4PG2A 2BXZA 1VSCA 3RL1B 1R5VA 2V2WA 5IVXE 3AM8A 4LBEB 2DQDL 1XGTB 3C87A 1XT5A 1Z9OA 2Y36H 2HKFH 5EU4A 5DRWA 5CJXA 5J1AA 5JOPE 3U7AA 4POUB 5CBAA 4QRPA 5C0FA 5DDHA 1J0HA 4ETQA 4XP6L 2AJVH 1ZT4A 4K9EC 4LLDB 4P48A 4BJLA 1FC1A 2VDML 3EHBC 1RUPH 4XCCL 4P3DA 4CN6A 3PP3K 3X11A 3IVKA 3P0YH 1LD9B 4Z7QF 3FO1B 3CDGB 3ZKND 3QCUH 1CLZL 3HE6D 2GTWB 3ROLA 2DQFB 1VACA 4C4KO 3ARBB 4WRLA 2B20A 4BQ8A 2R1XA 1QRNE 4XI5C 2GTZA 2OMBA 4C83B 2AEIT 2AGJL 4QOKE 4WI6A 4CW1A 1QRND 5BW7C 5F7HA 1HQRB 2V5RA 4Y16B 1U8OA 3DWTA 1LQSR 1DN0A 4ZYKB 3BWAA 4LVHB 5C09B 4KUZH 5BZWA 5D7LE 5D5MB 2APVA 3VXMA 4JHAH 5T1DL 4JM4L 4UIMA 4W81A 1BFOB 1MFBL 3OKDA 3WLBB 1NL0L 3V7MA 2C4FT 1OAUL 1AXTH 5AYQA 3NFPA 3K81A 4U05A 4DN3L 5I18H 2BVOA 4Y5XA 3MV7A 1FL3A 3PHQA 3DRTB 2IQAB 3O2DA 1RJYA 5IR1B 5I8OL 1U0QA 4M7JL 1YNKH 2IANE 3KJ4C 1PQZB 5BVPH 4EZMA 1LEKB 3LIZH 5CJOH 3MV8D 5FM5M 4XPFH 3QNXA 3CPLB 3RVVD 5EOQH 5F7DB 4QOKB 4RZCA 2EDKA 1CF8L 5C71A 4Y4KC 4R8WL 3BGFB 4LPXA 3IXTB 2KPNA 1X4ZA 3PQYD 4W68A 3B9AA 4LKCB 1T1ZB 3E1F1 3U48A 3QPQD 1ONQB 4I77H 1RZKC 3DRQB 3G5YB 3VXRD 3G5VB 4Z7WB 3W2DL 3D39D 4NQXA 3DV4A 3JVGA 1RURL 2YPKB 3SDCD 3TIEA 4Q9QH 4P2RB 3O0RL 5E6YA 4O51A 5LGJB 1YYLH 4NT6A 4YC2C 5BXFB 3SE8L 3I02B 1HI6B 4F8TA 2H6PA 3G5XA 1TQBB 1LDPH 3F65A 4S11A 3VFNB 1LD9A 4ZAKC 3MFGB 4DKAA 3TNNA 4WV1C 2FATH 1JRHH 1VHPA 2ZCKL 3JV5A 1KTLB 4WIQA 1NGPL 4X4XB 4ZOBA 4NOBA 3VD5A 2ORBL 2C3WA 1JF5A 2VUYA 3PQYB 3GJFB 1J5OL 5E2WL 5INDA 5T5NF 5GSRB 3IDJA 3NZHL 4MDJA 3ULSB 2QQNH 1NMCB 1D5XB 3L7FB 3H42H 3MV01 1KV3A 3SGKA 3K2UH 3BAEH 5KVEL 1KT2A 4KZEL 2ZG2A 5IOPB 3M1BA 2VQUA 3DUSA 1F11A 5ICYA 1O0VA 1NC4B 3CX5K 4TSAH 3VGDA 5ACZA 5L6YL 1IFHH 4HKZB 5GQBA 1NCTA 4UV7L 1SM3H 5IROA 3BW9B 4TPRH 4ZS7L 2ZUUA 3HPJB 3MRFA 1HINL 2GW5A 2E7LC 4GG6E 3A6CL 3KHQA 4DTGL 1LEKA 5L88L 1LNUA 2OTPA 1T2QH 3T0ED 3RTQC 3HNTL 1T7WA 3P4OB 4YNYB 3FONB 5KW9L 2CMRH 2L0DA 3WFCH 3J7HA 2R9HC 3QR2A 5HHVH 2IBBA 3V2AR 2P48B 2ZPKH 4XP4L 1A7NH 4OZFB 4EBQH 2HP4A 4HWEL 3SGEI 4MA7L 1KN2H 3DMMC 4IJ3B 4HKBA 4XC1H 2FZ3B 3O45B 4PJEE 1RZGA 4LCYA 1GGUA 3RKDD 4RGOL 3ARFD 3I6GB 1IC5L 4KQ3H 5INCA 4YIQB 2D4DA 2A77H 5F7WC 2YD8A 3GMOA 5T5FL 2G60L 3WS6C 4A6YB 5JQHC 2QQLL 1A1NB 2E27H 4RAUA 2XXCB 1R0AL 1I8MA 1WZLA 2N56A 4PRAB 3RVXD 3O6MH 5IW3A 5C0AE 2D31B 5JOEA 3CSYA 1D7FA 3DVGB 1FFPB 4K94H 1PZUB 3U6RA 3HE7B 1G7JA 2E8YA 1VFAA 2GCYA 3GFUA 3GJFA 1JWUA 3D5OF 4NO0D 3MROB 4FN0A 4WI5A 5KN5B 4OZIB 1A7QL 3W0WD 3BN3B 1G9NL 3MRNA 4J12A 2C1OB 3KXFB 3QDMB 5D7IB 2Y23A 3IFNL 1CZ8H 3QHFL 1QSEE 5D6CA 4CMMA 2Z31A 5BVJB 3BPCB 2AEPH 3I3EA 4AT6B 4S2SB 3H9SB 5GGVH 4NQCA 1F13A 3LB6D 2NX5E 1XF3B 4O9HH 5C92A 4FXKA 4XNQB 4S0SD 1U91A 1RU9L 4F7EA 1A4JB 2FD6L 2BY3A 3EO9L 4F58H 2WINA 1JHTB 1EA9C 4PJFE 3LDBC 2GYSA 1T22B 3CC5A 1CR9H 5E5MA 5K9KA 4XCNA 3GSNH 3GHBL 1BF8A 5EU6D 2FATL 1FV1A 3FB7A 4NO0B 1B4RA 4YHKL 4L3EB 3B3IA 5KZCD 5MP6L 2YD5A 5D7LB 1IKFL 1SMAA 2YWZA 3B2VH 3T1WA 2G5RA 4V2BA 1TQBC 2X4UB 4OF3A 3WJLA 4HH9A 2VN7A 3F5WB 4WHTA 5EBLA 2HG5A 1KTDA 1FL5A 3MA7A 3MNWB 3RJQB 1D5MB 2GUOA 3T1FB 3O3DA 2VXQH 5DD0H 4G8FA 2A77L 3AXLB 5E94A 5DRXA 1J0YA 1A22B 1Z9MA 2F54D 3U4AA 5TDNA 4U6TA 4OIIH 1KIQB 4E41B 2R56H 4KRPB 1MQKH 4YQXL 1AGFB 3VWJA 2KL6A 1DVFA 1F00I 4J2XA 4LOUC 5GJTL 2YPLA 2GTWA 1NCDL 4Y88A 1JK8B 1YN6B 4KK8D 4C55A 2C7UA 3L3HA 1MJUL 4JG0H 5DA0B 4IIQB 5I16B 3CX2A 5CSBA 1GZQA 1YQVH 1MCPH 3WFZA 5BRZB 2DD8H 2HTLD 4S1DC 1YY8A 3L3DA 2NZ9C 4L3ED 4XTRD 3NGBC 2C3VA 1AIFA 4Q6IB 1SEBA 5I1IH 3D1MC 5IB5A 3VXMB 5I1KL 1WJ3A 1EHLL 4RFOH 5DJYA 3TT1H 3NAAL 4CAGA 4QLRA 3MLZH 3X3FL 5DYOA 5ITFB 1U8MB 5JZ7D 4FP8L 3I84A 4U6VH 4HF5H 2VH5L 3LB6C 2DLFL 3HFML 4E41D 3D69A 4UU9A 2YN3A 4PRBB 3MMEB 4HWEH 4JVUA 4WEUD 2RQ8A 3QIBC 2OP4H 4LLDA 2V2WB 3T3PE 2RCSL 4PJFA 4PYHA 1GGBH 3SDXB 2GSGB 3BEVB 5CUSL 3QNXB 2VXSL 3QG7H 4IRZL 5ALBH 4EQ3A 5JIKA 5J1AB 4CVZA 5FOBA 1CDCA 4HUXB 2BNRD 5EOQL 3O9WB 3RU8L 5BVJA 3VMPA 4UTBH 3TIDB 4HS6A 2GITA 2EC8A 1P7KB 2AAVA 3JWDL 1Q0YL 5C07A 3QJFB 4M3JA 4DUXA 3O11B 1HCVA 4XRCA 1I9RH 4KWUA 1A1OA 4Q9CA 1DQQB 1TCMA 1KUMA 1K8DB 2QHRH 3BKCL 5I74C 2FEDD 3KYKL 3O3UN 1GIGL 4MD5A 4HDIA 4MCZA 3G6AB 2A2QT 3LD8C 1FL5B 1KC5L 4OB5L 5D70L 5SWSE 2ICEB 1EEQA 3BPLB 1WISA 3PV7A 1AD9B 1OW0A 5DJAA 5EIIB 4FRWA 1FG2A 1U8OB 1DBKH 4MA1B 4NRYA 3TV3L 4NHCL 2AVGA 4Q2ZB 1QBBA 2H41A 5B3JF 2XICA 3W2DH 3SKNB 3TCLB 3O9WD 5D2NE 1ORQA 3OF6A 4LEOB 4X5XB 1UACL 2X4RA 3LZFL 2DBJA 3ULVL 4MZ2A 1D6EA 1KEGL 2HAZA 4HEME 2J3SA 2NW2A 1ZHBA 3RL2A 3WJJA 1D5ZA 2FB4H 1H0DA 4NUJA 1I1FA 3QIUD 1RJZB 2NY6D 5IOPA 2BRQA 3WDIA 3TA3D 2FDBP 1VENA 4L8SA 1ES0A 1Y0LA 4KKBD 1T03L 5DVKA 3UJTL 2XZAH 4LNVA 5HI4D 5I8EA 2Y5TB 1B0GA 3RKPA 1FH5L 2GT9B 5ID0A 1K2DA 4HGMA 1MHEB 4QRQB 3RWFA 3PNWA 5JO5B 4F9PA 1E4XL 1Q72L 4LHUD 5J3HD 3NH7H 4GRMA 4XT1C 1HH9A 4FZ8H 5MHSE 4Z0BH 4PP2A 5E99H 2GSGA 1YEKH 3VFNA 3VFUA 2EZ0D 3E0GA 2BDNL 5DJXB 2R2HA 4L8BB 5DGQA 2D0GA 4BK5A 3P4OA 3O8XC 2AV1B 1IAIH 5DD5L 4ODHL 2YPLE 4JKPL 4W4NA 4N8CL 5EZOH 2JB5H 3OSKA 2A9MH 4PRNB 1U41A 4P4KC 3O8XB 4BYHA 3ZLQC 3RPKA 4JZJC 1UXWA 5LQBL 5IT2H 3R1GH 4KVCH 1NDMA 4Z7NE 2D3VA 2E7LA 1IQDB 4RX4D 2FLRT 3P0VH 5DUBA 4MDJB 3ULSA 3QI9C 3B2UD 3FRPA 2IH3B 4HV8B 2F58L 4U0QB 1UT9A 4FQ2L 3TYFA 4ELKB 3ULUF 1XF1A 1J0ZA 2H32H 2HWZL 2W1NA 3EYFB 4HWNA 5MEPA 1A0QL 1ZS8B 2I9LA 4HLJA 2EH8L 1VERA 3QISA 5CP3H 5KSAC 4L8CB 1AGDA 4MA3A 5D1XD 3KPRA 5C0EB 5EUKB 1CGUA 3MLSL 5F97E 5IEHB 5HJ3A 5IMMA 1KCVL 4ODUA 3SGKC 4BFIA 2CIIA 5DI8B 2VTFA 2VQ1A 4NIKB 5C0BA 3NIDE 1I9RL 2O26U 3BKML 4NZUH 3RWIB 2JJSA 2B5IB 5MEQB 4HIIA 1MH5B 2A6JA 3UTSD 4OZIF 2BJMH 2P5WB 1MI5B 4NQED 2FB4L 3IJHB 4U6YB 3IRZA 1DBJH 1D5ZB 3BKJH 5CS7A 1MCCA 4NJ9L 4F7MB 2XI9A 2P7TB 1ZXQA 4QO1A 3CD4A 2Y36L 2DYPD 1CGVA 2ERJB 3JV6A 2EE6A 1ES0B 4OD2B 2EXWD 2HRPH 2OCFD 2VC2H 1C16B 2DMKA 2EH7H 1UKQA 4LLUB 1TZIB 3BIKA 1OP5K 5C0BD 3B83A 3O2WH 4PUBL 3FB6B 4GAFB 1UYWL 2FGWL 3VGBA 2AV1A 5I1KH 5D1XA 3BQUC 1NLDH 3HE6C 1Q94A 3MGAA 3VGEA 3UTSB 1FVEB 1E4WH 3BKCH 4U3XA 4ZNCD 4Q9RL 1A6WL 4P9MH 2ITCA 2Q3AA 3NCCB 1HHHA 3RKDC 1XGYL 4QRTA 4NRXB 1S78D 4NC1C 1MEXL 3BHBB 4QF1A 4WO4A 3EGSB 4RGNB