1YMME

Tcr/hla-dr2b/mbp-peptide complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
246
structure length
246
Chain Sequence
GAVVSQHPSWVISKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSARDLTSGANNEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Unconventional topology of self peptide-major histocompatibility complex binding by a human autoimmune T cell receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymmE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ymmE02
7CGTA 3MJ7B 3U9PL 4C83A 4LIQL 1UA6H 3MYZA 1EAPB 4WTXA 5KN5A 3DGCR 2BX5A 5BQ7A 1BPVA 4AG4L 1AKJA 2VDNH 1DZBA 1NGWA 4RQQB 4YHOH 4F7TA 3C5SB 4I2XE 4NOBA 4GG8B 1BZ9B 5GGRA 2EKJA 3TA3A 1WBXA 2PUQT 1CLYH 5A2FA 1UC6A 2AJVL 3PWPE 2HKHH 1O5DT 3R1GL 1X44A 1BBDH 3KPPA 4XMLH 3O6FA 4Y2DD 3PP3H 1FZOA 5F3HA 1IC5H 1X6NA 3HE6B 1AR1C 2QL1A 1SEBB 3B2UD 1ND0B 3ARUA 2ICES 3GJFA 1OTSD 4DVBA 3MXWL 5I6XB 1CICC 1FFNA 1H8OA 1V3MA 4KUZL 4ODUB 4L9LC 1JV5A 4P9HL 4CW1B 2Q76B 1LP9A 3IFOB 2A6KA 1ZHNA 1NL0H 1EHAA 5SWZD 2CDEB 2IBGA 4LLUA 1YMMB 1K4DB 2EDYA 1A6WL 5EU7C 3W39B 4OCRH 3RA7H 2GI7A 3ABZA 3QDME 3D25B 5F44A 5HGBB 1ZA6A 1TVHB 4JO1H 1S78D 5CJQH 4CU7A 3W2DL 1TZIB 5MEOB 2HVJA 4UTAL 1EJOH 2AK1L 5B39A 3L7EA 4HIJB 1AI1L 4TUOB 5IKCA 1ZGLB 4RMVA 4F58L 2VXQL 1IC4H 1ZT7A 3DUSA 4M7LH 4N5EC 4XPGH 2QSVA 3LY6A 2W9DH 5F3BB 1UM6H 3GK8L 2DBJA 5FM5O 1PZUB 4S2SB 3IU4L 2YUZA 3S37X 1FG9C 2N4IA 2JIXB 2FHBA 4P5TC 2E6PA 1DDHA 5FYLE 3W82A 1R5VB 2WUCH 3W9DA 3FO1A 5EU6D 3NPSB 1P84J 3ZHKA 1U3HD 1J5OL 1UACL 3AM8A 4FMKA 3ILPA 2DLGA 5I1AB 5CLTA 1OGAA 5IMMB 3GHEL 2IPTH 5I8OL 4XCEA 1QR1B 3CH1A 2X41A 1YPZA 3DX6A 3S98A 3S36L 1TPXB 2EO1A 3AAZB 3WXWH 3CFBA 3N1PC 1G7HA 3OX8A 2IG2H 4M8VA 2VWEC 1RURH 4N9GB 3BUYA 1JI1A 3RWGB 1T1XA 1KTDB 4WUUB 3D5OF 3ZDZE 1IT9H 1A3QA 4LP4A 4KI5E 4HCRH 3KLHD 4ONGH 3K1DA 2XT1B 3IXAB 3WIFA 2DI9A 4PRPE 2CXGA 2NY7L 5CZKA 4UINL 3O4LB 5TDOA 4GAYA 5C09D 5C0GB 1U95B 4NFBA 3ZDXF 4FQCL 4XXCC 5I74B 2P43B 5BZWA 1YC8A 5C0DA 5GSVB 2VDKL 2JJWA 4DZBA 5IOPA 4FFWC 1EXUB 3SPVA 3RDTB 1IGYB 1NC4D 1VA9A 3A67L 3BEWB 3KYOB 4XWOC 5GRJH 5AD0B 1UWEL 1ZWIB 4RAVA 2R1XA 3VD9A 2XN9A 4Z18A 1OHQA 4D0BA 5C6TL 1AFVH 5I1JH 2FHFA 1J0YA 5I1HH 3WNKA 1WBYB 5E6ID 2WSKA 5GS0L 3HNTH 3S6CA 2NY2B 1R3HA 4KK5C 1ZANH 5D1ZA 5AAWA 1G7MA 4GAJL 2BVUA 4LLVB 4JY6B 5LG1A 3T2NH 1MY7A 2FJHB 3FO2B 3O0RL 1WZ1L 3E8UH 1IFHL 3O8XD 4Z7VE 1F58H 2GTWB 3TVMB 5DMIL 2A74A 4U7MA 3VFTA 5EZLA 5HHOE 4UILH 5EB9A 4UQ2B 4MD5B 4IBLT 2ZUQC 3BE1H 5C07E 4E42B 1UXSB 4K94H 3I50H 4YPGB 3RHWF 5I8CB 1OPGL 3QG6A 4XXDA 1YNLH 3CCHB 3KPRE 1OF2B 1CFSA 1A1MB 1I3GH 3W5NA 3FFCD 1GVIA 1JZ7A 2EIBA 4J3OC 5F9OH 1NKOA 2F54E 4QGYA 2HN7B 2NCMA 4WTZG 4OCYH 4HF5H 5CP7B 3IKCA 4X6BB 2X4SB 2UWEF 2BCKA 1PBYA 2J8UB 2F53E 4QRSA 3TT3H 1A47A 5J12C 5SWQA 3I9GL 5FGSA 2FJFA 5DDHA 4FS0A 2R9HD 4AL8L 2V2TA 3P0YH 2X42A 4JAMB 3QSKB 3PUCA 5E24E 5D7JB 2BSTB 1B9ZA 4O2FA 4PRIE 5DJ0A 3OHXB 1U8NB 3SDYL 1OLZA 4WO4B 3FOMA 4FQXB 3L6FB 4HIXL 3VXTA 3OMZA 4IS6B 1YEJL 1UEYA 1Z2KA 3B5TA 4IHOB 5DR5L 4LCCA 1F2XK 1IEHA 3CMOH 3ARZA 5HI3D 1DQLL 4HFUL 5INDB 4MXQD 4PV8B 1GYAA 4G9DB 4JM2F 2A9NL 2HTLC 4JG0H 3ZE1E 2CRZA 4HKBA 3GSNL 1X7QA 4X9FA 3VGHA 4DUXA 1QFOA 3H9SD 4HJGA 4Y16C 2MHAB 5DMJB 1EEYA 2EKSA 2UZIL 3HS0A 3MV7B 4I0CC 4OBSA 1I8IB 4XVSH 3OJ2C 3TN0B 3QCVL 1U8OB 1DE4A 5IB5A 3MMEB 5CSZA 2AP2A 5EC2A 5I16A 2P7TB 5EU3B 5JHDB 4TSCL 1SJEA 1S3KH 3QEQB 1K4CA 3R8BB 3RNQA 1XGTB 2FX8L 4L4TB 3K3QA 4F7CA 1G7PB 3H9HA 1HIML 4W4OA 1QOKA 4HIHA 32C2A 2VLKE 3U7WL 4IRJC 5GGRY 3L3JA 3MOBL 1N2RA 3AMKA 3FQNA 1P7QB 2UVFA 5TPWL 5K93A 2NZIA 5EOCH 4XNZC 4OIAA 3VGBA 3VMPA 3UPRA 4I77H 2CUMA 2DKUA 3DRQA 3PWUB 2NXZC 3LOWA 4FQQB 3JVGA 4JRYE 4DEPB 1UWGH 1F4WH 4KHXH 4P9HC 1NCWH 3BZ4A 3UAJD 3BGMA 3BZFB 1E27B 3C9NB 1BVKA 4HCRA 3EOTH 1J1OL 1GXEA 3VFOA 3DUUB 2W0LA 4WUKL 1AHWA 2BXYA 3BKYH 1N6VA 5E94B 3WKMH 2L0DA 5EN2B 1BOGB 1WCBB 5JUEL 2X89D 4X0KB 3VXUA 3MRMB 2XZAL 4RSVA 3TBWA 1PJ9A 4R7NB 1T2QL 5F7EH 2YUWA 2LAAA 5L2KB 3KPOA 3PABA 3SKNA 4WHYH 3WLBA 3T8XB 1CQKA 3DV6B 2O5XH 2RBLA 2MQ0A 5TGBB 1M6OA 2RAMA 4FFYH 1JPSH 1WAAE 3DUHA 4PBVC 4JDTH 1QFWL 3ILQC 4C4KT 5EZJA 4JANB 5J6GB 3DVIA 2GJ6B 5L9DH 3LRSB 4JFDA 5GGVH 5JW4M 2EDKA 4QRQB 4Y19E 3RWHB 4CL7A 4K3JH 5D1XC 3ZKMC 3KPSE 1UM4H 5DS8A 4N1CA 1RUAH 5F6IC 2ORBH 5DHYB 1U8JA 2HJLB 2IPKA 1AD9A 4QTHB 2YSSA 2Z8WC 4WI9A 4G6KH 1J05B 3QDGD 5EA0H 5HGDB 2MCPH 1IC7L 1N8ZA 3SGEH 2NY4D 3D39D 3IJYA 2V9RA 3QIWD 5EOCJ 5HHMD 4MNQB 1EMTL 1DJSA 1NLDL 4YEEA 5DVKA 4CN6A 3S96A 3GMQB 4NQEA 3IAPA 5JXAH 2RFXA 4HC1H 1I7UB 1C5CH 1CGWA 3DVGB 3L5HA 4GLRH 1Q8MA 2QSCH 3HPLA 1H3UA 1T4KB 3RPKA 25C8L 5E5UB 2YRLA 1FFPA 4TVPE 5IHUL 2YPLB 1UGNA 1SJHB 3BH8A 4Q9QL 2NR6D 5GRYA 1EEZB 2VN7A 3MV9B 5IR1B 5I0DA 5EIVA 1CE6B 2HLAB 2JCCA 3R8QA 5DJ2B 4X6EA 1Q1JL 2P49B 4AMKH 3PWLA 3CPLB 3C6SB 3T4AA 3UTSB 1DQQB 4MJIB 4Y89A 1NMCB 2N7AA 3MA7B 1CCZA 1JWSB 2DLIA 4WW2B 2DD8H 3U82B 4JQVC 3FT3B 1N59B 4TNWK 5LGJA 2VLJA 5HI5C 1AC0A 5D7KE 1EUUA 5EU5A 3TWCL 3FB6B 3MFFA 5DQ9A 3J8F7 3QHZL 5JA9A 1ZVSA 4JRXD 5GS0C 4LLQB 4BFIA 1RHFA 1W2KT 3VRIA 1AR1D 1TENA 2X4UA 3I6KA 1A7OH 3MLWL 3Q3GB 4MA8L 4LSPH 3QI9B 3TA3C 4MS8C 2OXHA 3DURA 4W81A 4WU7B 1K3IA 4HWNA 3SKOB 4OZIA 3O6FC 2BVPA 1HSAB 1DVFA 2QKIA 1SY6H 4S1QH 4EVNA 4YK4B 5LCVL 1MHEA 1PD6A 5C2UB 1LO2H 4XCCH 1KXQE 4NNPL 1U8HA 2Q8BH 4ODWA 3LS5H 2H6PB 1T5XA 2RR3A 1CLZL 3QEHA 5BCAA 5CMAA 4G8FA 4U6HB 1OM3H 2CIIA 3K8KA 4OZGB 3PHSA 1V3LA 3U83A 5BJTA 2VKWA 4WDIB 1VFMA 5FYJH 4LASH 2ESVD 5IMKB 4YHMH 4C56B 4LVNC 4QRUB 2HJFB 1E4KC 1FSKC 1T83C 4BM7A 1FVCA 3SE9H 3SKJL 1B6UA 1JZ3A 5HYQB 4OLUH 3MRIA 5I73B 5HYSB 2VKXA 5JORA 5JOFB 1H5BA 1AQDB 1MRDH 4HAGA 5H8DA 2DTSA 4XAKE 1RZGB 4N8CL 4PJHE 3X12B 3BVNB 1FYTD 2Q8AL 1OCWL 2G60L 3D0VB 4YXHL 2IQ9H 1IBGH 2XPGB 1K5NB 2VQTA 3HG1D 1QRKA 1YYMH 2EYSA 5DMKA 5DA4A 3R06B 2KH2B 1AIFB 3DMMB 4Y1AB 3T0EB 2GEEA 4NJ9H 4Z7VF 4CU6A 1WEJH 2N56A 1N7MH 3FQXA 1N5AA 1WICA 2H45A 1G9MH 3LN5A 1OTUC 1JF1A 1C5BH 1IGIL 4U1MA 2IEPA 2AKRB 1OGAE 2OTUA 4YDLC 1OY3B 1KPUB 4HT1L 2ZOKA 3O2VH 3CZFA 3KR3L 3BJ91 3T3PE 3QJHB 4WCYH 4DGVH 2FGWH 4XI5C 3RHWK 4OLZL 1ZV5A 2XA8L 3C6LB 1MJ7H 4OFVA 1XIWA 2EH7H 1CE1L 2AJXL 2LU4A 4JFFB 3VD4A 2HLFD 2HFFB 1HKFA 1U8IA 3K2MC 3QNZA 3E3QE 4JHWH 4IMLA 5D2NA 1MCHA 5DT1H 1MCWM 4JPWH 4P3CH 4P2RE 4XC1H 4PD4J 5SX4I 4KUCF 3LHPH 3NH7L 2QQKL 4G9FA 4FP8H 4M1GL 5E2VL 3QFJB 4HJ0D 1RMFH 2YRZA 1FLRL 4HC1A 4Y4KB 4PLNC 2Y72A 4UQ3A 4DAGH 1KIRB 3HFML 5K9QG 5IB1A 1N5YL 4WI5A 2DMBA 4U1JA 4MNGA 1W0YT 1ETZA 1F3JA 3ARDB 1MOEA 3L95A 1JCKA 2AJYH 4HQQL 3ZE1F 4M43H 2X4PB 1I1FB 2R0ZL 3F58L 4KK5D 4XCNA 2VLRE 1TJIL 3DOSA 2IBZX 5FCUL 3LQAL 1RIHL 1XF3A 3TBYA 4UNVA 1SJVA 3U7YL 4ELKB 3EZJB 4JDVA 5TQ0L 4JG1H 5D70L 4Z9KB 2QQNH 4DGIH 2QHRH 3HI6H 2GUOA 1OOAA 3SBWC 4WWKB 2ITDB 1S7VB 2C1OB 2CLZA 1KACB 4QYOA 3IGAA 3BP4A 1F4XH 1U91B 3V6OA 3GI9L 4HLJA 4ETQB 1CZ8H 5BS0A 5J11B 1JGUL 3UDWA 4LHUA 4JGUA 4OTXL 5IV2B 3HC4H 3E6FB 3MUZ1 2WWMD 1TTUA 5T1MB 1RZIA 3WFBH 3NCYS 4XB7A 4BQ6A 1NUGA 2R15A 2PXYB 1DSFH 1IGTB 1T7VA 4NN7B 4P0DA 4PRNB 1U8QA 2APXA 5IF0A 5J1AB 3OKEB 3MCG1 4Y4FB 1R3KB 2WQ8A 4Z7WA 4M6NL 2EDDA 3VGAC 3VWJA 2VXSL 4LLWB 5BW7A 4ZFFB 3X3GH 1FNHA 1G7IA 3U9PH 5IIEA 3IJSA 3I6LE 1CFNB 1X5HA 1ZGLM 3REWA 1FIGL 4OD2B 5DJZA 4PRAB 1R3JA 3ULVL 4OI7A 3OAUL 4YWGH 4OAWB 1DBJH 4PRHA 2WZPD 2FYYA 1KCRL 4OLXL 4JFPA 2H8PA 5EBLB 4XVJL 2BY2A 3P9MB 2VSDA 4RMWA 2D4FA 2WUBH 1FC2D 1BP3B 2X1QA 2PKDA 1I1YA 2HTLD 2YWYA 3EGSA 1P2CA 3G04B 4Y16D 5EZOL 1G84A 2VNCA 2E7LC 1QFPA 1MRFL 3MXWH 1KN4L 2Z35B 3I02B 4I4WA 5FHBL 1WAAF 4PFEA 4HDIB 4HWEH 1WZMA 1I1AA 5D96B 4J6RL 4NRZA 3ROOB 3UP1A 2PW1B 1OAUH 1YYLL 3RVVC 1ULVA 5D8JL 1WC7A 1WWWX 4HD9A 1ZHLB 3TP4A 3VE0B 4BH7A 1S7QB 3BGFB 5T1DL 3GMMB 3QWQB 3ZZ1A 4ZFOA 3JV6B 4KDTC 5IG7A 2BOCA 2D0GA 1B4RA 4NDMB 4NQCE 3G08B 5FKPA 4IRJD 2X1XR 3LKOA 5J0BA 4MJ5B 1U6AL 4OD1L 4F58H 3WLWD 2VXQH 2VISB 1TVBB 3V6BR 3BP6A 4P23B 3QUXB 2AJZA 2PTVA 15C8L 3VI4E 2A6DB 3MRPB 1H3TA 4ENEC 4ZAKC 2JJVA 3GK8H 3WFDH 2A77L 1AGCA 1RJCA 3EJJX 4WHCA 3WFHB 4PGZA 2KBGA 3EDDA 2ZSVA 1IM3B 2LV4A 2IGFL 2ZUUA 4RRPA 4RGNC 3DROA 1FDLL 1T1YA 3AGVA 3PL6B 1JP5A 1J5OH 5ICXB 4M5ZL 3IETB 5BRZE 4TYUA 4NQDD 4DWHA 4EQ3A 5I8OH 1CXIA 1OAZL 1RZKL 3RWIB 1U93B 4OGZA 4HS6A 5C0CB 1XCQA 3SKMB 1DR9A 1MWAB 1QRNB 1YY9C 1IKFL 3F65A 4U1LA 3VXMD 4I18A 3WFZA 3ALWA 4X4YA 5HGHA 1DN0A 2I26N 4CN4A 3F7YA 4YUEL 1P1ZA 3V7MA 3LB6D 4JFYB 4YR6B 3LDBC 3OG4B 5INCA 4HMDA 1YDPB 3EDFA 1SEQL 5D5ME 4PJAA 5C9KA 2GY7B 2DS4A 2IANE 5DD0L 1BX2A 2O5YH 4YDJA 1ZGLP 1PX4A 2BK8A 3IDNB 4E41B 2DLFH 4XP4L 1QSEA 4FQCH 5EPMA 4PJ7B 1HE7A 1MVUB 1YMHA 1JFQH 1WTGT 4XVTH 2VDKH 2XQBL 3L7FB 5B8CB 2HJKB 1LO5A 1R6VA 4HPYH 3NGBC 2DLHA 2W0PA 1Z3GL 2NNAA 5E95B 3EKCA 3U9UB 2HFGH 2APFA 2AJUL 3ARFC 2ZUVA 3CK0L 2PYEA 3SCMD 1YNTA 1TTGA 3U0WL 1P7KA 5KS9E 2UWEB 4GQ9L 5D71L 2NTSP 4M02A 3L5XH 1A7QH 2IAMC 3FRPA 3IFLH 3K2UL 3LIZL 2BVEA 1YEGL 4RA3A 3G5XA 2ARWA 2CKBB 4QXGL 5GS1B 5AZ2L 4YHIB 3S4SB 3P9LA 1WV7T 2VLLA 4FQLL 2IH3B 5E5RB 4GAJH 3RVTC 4IMKA 1PZ5A 3S35L 2UZXB 3MRDB 3T3ME 2J8OA 4PV9B 2A9ML 4YDVB 3WS6A 3WHE0 4DGYH 2F74B 3HR6A 3MRKA 4H0IA 2YHGA 3H9SE 1F6LL 2P42B 3HZYB 4PJBF 4WHTB 3U6RB 3HI1A 4JM2B 2X4RB 1SYVA 4S11A 5HD8C 1ZLUK 3UJJH 4GH7B 2DQDL 3EYSH 1IAII 5HI5D 2BOBA 5HDQH 1S7UA 1HILB 3T0DA 1I9JH 4ZSOA 1KUMA 1VPOL 2NX5B 5FXCH 1A6ZB 5IW6B 5IQ9B 1FPTH 2IFFH 3AB0B 1PDKA 2BRRH 3UO1L 3LCYA 3LQAC 4OF5A 1H8SA 5KZCD 1ZHKB 4Q6YA 5ALCL 3MRCA 5JDSA 2OJZL 1I85A 1QLEL 4ZO6A 3TA3D 1FVEA 4XBPA 1NCCL 3FJTA 3H7BA 4MS8D 4RDQG 3VG9C 1HOCA 5CILL 1Y0LB 3O6FD 4PGDA 1XGYL 3T3PF 3ROLB 1Q9KB 1L7TH 3TC9A 2JELL 2YBRB 4OSUL 3OJVC 2DIJA 5ESAB 3D3VA 3OV6A 5DHXB 3SE4A 3DRTB 5C7XH 5J56B 2HT3C 2CDGB 1QNZH 2LAGB 3KHQA 1DVFC 4I3SH 5AUMB 1EGJA 1DQLH 3RQ3A 4HFUH 1KNOB 3F12B 4EKXA 3U0PB 4LF3B 2W91A 2IADA 4YZFF 3UYOD 5E2TH 2Q87A 2D0HA 4HUUA 1SMAA 2VR9A 5A2KH 2D31A 1U8PB 1ORQB 1NFDE 1G1YA 2UZIH 3Q6GL 4IDJL 4OUOA 4Q9CA 4WNQA 5DFVD 5B38B 1IGJA 3ULUL 3E1F1 3GHBH 4OUUA 4NKIL 3GO1L 4EEEA 3FONA 4PS4L 4QHKI 3TCLA 3QCTH 5D7LB 1S7WB 3BT2H 4YE4L 4FRWA 2OL3B 2WQRA 3ULVC 5ICZB 1Y6MR 2X4QB 3GSXA 4PJGE 4M7LT 4MDIB 5JIHA 5IMLA 3BQUB 3TNNB 4DZ8A 1U2CA 4I2XB 3WXVL 4RX4A 4H8WL 3MOBH 2CDFA 3PWPB 5TPWH 4PJ8B 1OTUD 1QEWA 5D9SB 2C3WA 2K7QA 1UZ8A 4MAYA 3C08L 4R0LA 5E8PA 2A73B 3UBXB 2NY3C 4OB5H 5DEFA 3MNZB 3NFPA 4MJ6A 1D5IH 4OGXL 2FBJL 2JJTC 3GSQB 3D9AL 4XI5D 4ZUVA 3UTQB 4FTVD 4HK0B 1HCVA 12E8L 3TH2T 4NCDA 1KB9K 2CRYA 4RBPH 1UCTA 4DQOH 2GSGB 4LAQL 3EYFB 5IB4B 3K1KC 5DHVH 3BX7C 5F7UA 3QDMB 4NN6B 5J13C 2ERJB 3FQWA 1YQVL 1ZA3A 5I17B 4L29B 1XIWC 4PGEA 5K9JL 1DBBH 2ED8A 4PY8I 5DRNB 1IMHC 1NEZA 5L0QC 2DI7A 1F90H 1HNGA 1YECL 1PKQA 2FWOA 4ELMA 4RZCB 4PPTA 4HKZB 1AE6H 3ZT5A 3NZHH 3P2TA 4FQ2L 4EUPG 3G6AA 3JV0A 3QDJA 3O3DB 3W11C 4BH8B 5CGTA 2WINA 4DKFH 3EJYC 1QFUH 1KJMA 3PWNA 3VFRB 3GMOB 2Y5EA 1MIMH 4I3RL 5JHLL 3D18A 5GGSB 2XN9D 1CS6A 1J0KA 4G7VL 4MCYB 2PNDA 2Y5TA 5DK2B 1R3LA 4OV5B 2NXYD 4P4KA 1RZKC 4WW1A 5GS3A 3MCKA 1I4FA 3V52H 4HIIA 4PGCB 1WF5A 4AIOA 1AGFA 3G9VA 5LVEA 4OFPA 1ZLWH 1GZQA 4ODSL 1OAQH 2NY0D 4YHYB 4RMTA 1VEMA 2R0WL 2JKXA 4NT6B 4GG6A 4WV1A 3VG0L 3S5LB 5M7QA 3TIDB 3QH3A 3C8KA 5EOQH 2J12B 2DMCA 4X6FA 4UIMB 5GRUL 3OKDB 4UI2A 2AXGA 1FE8L 5EU7E 4AIZB 2PCPB 5IHUH 1V7MH 3BEVA 5ECJE 3V6OC 1LGVA 4N0UA 4D3CL 1N4XL 5I76B 4KVNL 2FNBA 3NOIA 1FCGA 4HWBH 5C0FA 3FOLA 2AEQL 3CX5J 3QXWA 2DQCL 4QHLA 4RGOL 3W0WE 1KELH 4HG4K 2IMNA 3DX8B 4O5LL 4PGBB 3VI4F 3SDCA 1T20B 4IOFC 5C8JA 1Q1JH 4R26L 3B2VL 3PQYE 1SYSB 3FT4B 3HMWL 3PGFH 4WGWB 4M61A 5IEHB 3WFEL 5JZ7D 4Z7WE 3OWEA 1VDGA 5CSGA 3MNVA 4RNRA 5ACLA 3B3IB 3F5WB 3RZCA 4OQTL 3VWJC 1JPGB 1MCOL 5TDNA 4JFEA 3MYJA 3O4OC 1F3DJ 1MFEL 2X6MA 1A6TA 3GSVB 4XMKH 1HI6B 1S7RB 3BO8A 2Y06H 3UJIH 5FYJE 3LH2H 1LK2B 1U8MB 4NM8L 3BPOC 5F7KC 1ACYH 3MACH 3LN4B 1E4WL 1JRHL 1MWAL 2OR8A 4M8QA 3FCTB 2DL9A 5FGBC 2VWEE 5IVZB 2VXUH 4AEFA 5D5MF 5F7YC 4Z7VB 3LN9A 5DK0B 4NNPH 4X83A 4CVZB 2HH0H 3INUH 1G7QB 4LRIA 4P59H 1AO7E 2BNQE 5KW9H 5J9PB 3IU3B 2ZSWA 5C07B 2J6EL 4ONOA 2R0LL 4S0TD 2FO4B 1J10A 2X09A 3CC5A 4U3HA 4UIKH 1S5HB 3KPRB 3ESVF 2AK4E 3PWVB 4KGJA 3RGVC 2EXWC 3QULA 1NGZB 1I9IL 2F54B 3HN3A 1QBAA 4ENED 4KY1L 4WVRA 4ZFZA 4U6XA 5KS9F 4PJEE 1N3NA 4N0YH 1FNEA 5E5MA 2Q8AH 2FZ3B 2OR9L 5T3XD 4JQXA 1DQML 3DXAE 4G8GE 4RGND 4GRLC 4DCQA 4DOHE 3T3MF 3OKLB 5IBUB 4PRIB 5DHVA 4HPOL 4N8PA 1YN7A 3OXSB 5B3JE 1QSVA 3BKJL 2CKBL 1NCAL 5KTEL 3VFNB 2J88H 1YY9D 2Z31B 3WIIL 1MCQA 1FNGB 1MCEA 3ET9F 2L7UA 1J18A 1CL7H 4B53A 2SEBA 3ULUC 3S88L 3CFKA 3VXUD 2DIBA 4O2CB 2XQYG 4J3TA 5D6DC 3KYKL 5EC1B 2ICWB 1EAPA 2VR4A 3L5JA 3ZTNL 5H35A 4R2GC 4UDUB 3T77B 1GJIA 3GSUB 3QA3A 3LS4H 5TE6L 4N68A 4XRCB 4RQQA 4TSBL 4GKZB 4GRWE 3C5SA 2HA1A 3O45A 1QSZA 4HKXB 2AJXH 4LLAA 1MCPH 3LKSB 5GPRA 5ERWA 2EDQA 4JPKL 4PJAE 3X13B 4NZTL 3A6CH 3HE6A 3G6DL 4YXLH 2CIKA 4H8WC 4Y7MA 1JMZA 1SEBA 5E7BA 4JFDD 1ND0A 3C8HA 4PTUB 2BDNL 1UENA 2V7NB 3DBXB 4ODUA 3NA9H 2R23B 3HLAB 2RQ8A 3TZVA 1JHKL 4Z6AT 2Q76A 2FJGB 1VERA 3IFOA 2A6IB 1H8NA 2DDQH 3HFMH 5C08D 1DBKL 2CDEA 5HYJB 1YMMA 1K4DA 4LSQL 3CFJB 1QVOB 3W39A 1TVDA 5IT2L 4JRYB 4G80B 3D25A 5HGBA 3F58H 1TVHA 3QNYB 4XP1L 1TJIH 1QKZH 4HWBA 1CT8B 1RIHH 4NQED 6CGTA 4U6VL 1TZIA 1DBAL 3RVTD 1NFDF 3TT1L 3TCXA 1UH3A 5MEOA 1A2YB 3S9DB 3U7YH 3VH8B 3K46A 5D70H 3T2QA 4TUOA 1ZGLA 2FCBA 3WSQL 4P5MB 3GKZA 4Y8DC 2IWGA 5LWYL 1CGUA 3C5JB 4PJ9B 5MHSD 2OTPA 3GI9H 1KFAH 3TH4T 1V5JA 5HD8D 2YPVL 4S2SA 1QBMH 3ARBB 5DLML 3D0LB 3PIQA 1EA9C 4LIQE 4PJGF 3ZKQD 1FH5H 3IS0X 2JIXA 1D9KB 1FV1B 2GW5A 4KJYB 1JUFB 3MBXH 3WNOA 3MGTB 1VFUA 4KRPC 4M7JL 2VLJD 2DJ4A 5IMMA 3F6LA 4Y19B 4JZJB 4M6NH 3RJQB 3RUGF 1QR1A 4KJPC 2NY1B 4JY4B 3KPSB 4YDIL 3SDAB 3TBVA 3AAZA 3FO0L 3HI5H 1P53A 4N9GA 4L5FH 1FIGH 1LHZA 3QIBB 4HH8A 5IHZA 3RWGA 4NGHL 2A83B 1I85C 1KTDA 2FIRT 3NCCB 4WUUA 4EDWH 5D1QA 4OZFB 4RFNB 4IRZL 1RUMH 2HT3D 1AY1L 1P84K 4HH9B 3WNMA 1DVFD 1YN6B 3B9AA 4P46B 3IXAA 1I8MB 2EEAA 1NBVL 1V7NL 1VFAB 3O4LA 5C92A 5CEZD 4JREC 5C0GA 2B20A 1U95A 3PP3K 1AXTL 4PP1C 1ZLVH 3TO4C 5I1KL 2YD5A 1ZT4B 2JTDA 1DQJB 5JPMB 5GSVA 1LDPH 2P5WE 1EXUA 3IB4A 5EFIB 2UYLA 2VZOA 3OBAA 4WI8A 1IGYA 1YYLH 2JE8A 3KYOA 4XPHL 4LMQI 5D8JH 5AD0A 1ZWIA 4NKMB 5E1AA 2WBJB 3UYPA 2YEZA 3CLEH 4NKDB 3L1OL 5T1DH 3OSKA 2VC2L 3BP5B 3OAZH 4GXUM 4LRNH 3DHMA 3PGDA 1I7ZB 1C08B 1ZE3C 5FUCC 5LAXB 3JSSA 3HHRB 2EICA 4F9PA 2IPUK 4CVXB 3Q48A 1MI5B 4LLVA 1U6AH 1MCSA 2PO6C 5C0BE 4G5ZL 1NDGB 4HEPG 1KCSH 3QRGL 2FJHA 1F6FB 5JMRA 1V3KA 15C8H 3B8SA 2GTWA 3TVMA 3WKNA 4BUGA 3WUWB 2XTJE 5DD1H 4KJWD 1VCAA 4UQ2A 5E2WL 3UTTB 4MD5A 4ZTOL 4LLYB 4M6AA 4E42A 3ZO0A 5HHPB 4YAQA 4PLJC 4P2OB 1BQHB 4G42B 4YPGA 3GMNB 3UZEA 3V8OA 3CCHA 1Q72L 1WWAX 2WP3T 1OF2A 1HHHB 1HYSC 1A1MA 2H3NB 3BIKA 4M5ZH 1BFVH 1ZTXH 2MKWA 1DLFL 4PJDF 1OAZH 4LHJB 3ZKND 5IB3B 2HN7A 3KPLA 5BVPL 4QT5B 5CP7A 1E4XL 1XIWD 3LRGA 4R4BB 4X6BA 4NUJB 4F8QA 2X4SA 1D5BB 4QRRB 4U1GC 2AW2A 1NBZB 3M17B 4WFGE 4WI2A 1UJ3B 4YUEH 2Z93B 3UTPE 4XP6L 1YEIH 5TJWK 1A7NL 2QSTA 3NFSL 4P9MH 3CMGA 4JAMA 3D85A 1GOHA 5JOEA 2VAAB 2H2SC 2VDRL 1DL7H 3BW9B 5D7JA 1LO4H 2BSTA 4JKPL 3OHXA 1MVFA 1U8NA 4WO4A 4GAGL 3W11D 4J3XA 5DD0H 5FDWB 2AI0L 3EJYD 3QZWG 2B1HL 2LFGA 4G9FD 4IS6A 2FIKB 4NQSB 2ARJQ 4PJBB 5F7WC 3B9EA 5GGQH 3QDJE 5INDA 4PV8A 4Q9RL 1FHGA 2C4XA 2LTQC 3N1FC 4E0RB 5KANG 1LEIB 3MV8D 1N6QL 1A4KB 4D8PB 2MHAA 5GISH 3EO1B 3V95A 1MJ8L 3FT2A 3MV7A 4YHPA 5HVHB 1I8IA 4LCWB 1U8OA 3CK0H 1MJJA 4NQXB 1F4YL 2FX9L 4P4KC 4QTIL 2P7TA 2Y9RT 5DJXB 4GQ9H 1QHPA 5EU3A 5K9KA 1ES0B 2BP3A 3K2UH 5IBTH 4GG6E 1KPVB 5F89B 1A9BB 3QEQA 4WV1C 1CXLA 1GSMA 3FTGB 4OQ1A 5BS0D 4FQLH 4M1DL 3V7AE 1UXWB 2Z8SA 5EWIL 5LKNA 1G7PA 3SGJA 2VDOH 4LHUD 4XZUB 4YFLF 4R7DA 4IOFD 1EK3A 2GJZB 2EZ0C 3C8DA 1NC2B 1P7QA 2F8XC 4WFFD 1IKNC 1CG9B 2VITB 4PJEF 2PR4L 1RU9L 1LQSR 4JO3H 2WWKO 2P5EA 3PWUA 3VFVA 2EDOA 4FQQA 4WFED 4RRPG 3N1QC 3WN5B 3SDCC 4P2RB 4K3GA 3TV3H 2H2PD 2MMXA 4HLZG 4QHNB 2B1AL 3VWJD 2YMXL 3BZFA 3LV3B 1E27A 3C9NA 1IM9B 4G3YL 4NQDB 4XC3L 1BM3H 4P2QE 5B3JF 3DUUA 1W0WB 3UO1H 1KIPB 5C0AE 5EN2A 1BOGA 1XGPB 1WCBA 1ZEAH 2C1PA 4OM0L 3MRMA 4Z7UF 1HK6A 3SGEI 4R7NA 4QOKA 5CILH 5L2KA 4ZO8A 3BDBA 4WEBL 1VKXB 4Y2DB 1NCTA 3CDGB 3DV6A 4ZXBA 3VCLA 1CYGA 5TGBA 1IZJA 4WI6A 1GGIL 2I9TB 2OP4L 4GRWF 1KTLA 3K8LA 1UKQA 4PB9L 2Y07H 4JANA 5J6GA 5BO1L 2GJ6A 3LRSA 5ILTL 4FTVE 5AWNL 1CF8H 2B4CH 3SJVD 4J1UB 4XX1E 4QRQA 4XNUL 1OP5H 2M1KA 3P4LA 5SWZB 4XCFL 4S1DD 3MODL 1EO8L 4YDKL 3RGVD 5DHYA 5C0EB 4Y8AA 4Y4HC 2HJLA 4GRMB 1HHGA 4QTHA 2XICA 1GH7A 1J05A 1QPPA 5HGDA 1FLTX 3GO1H 4PS4H 4HV8B 3HRZB 2DQUH 4Y88A 1KULA 3RX5A 4MNHA 3MLSH 5DVNA 5FB8B 2HAZA 2GT9B 3CUPB 1J88A 2ZCHL 1Z9LA 1I7UA 4GRLD 2RCSH 2VUOA 5TQ2H 3DVGA 3KYMB 4LSTH 3T0XA 1F4AA 3NAAH 1T4KA 3MGOB 1UCBL 4OJFL 2ADGB 4HS8H 4L8SB 2YPLA 1SJHA 1YEKL 3U46B 4AY0A 3LEXB 1EEZA 4JQXC 3MV9A 2YOCA 3ME0A 3SGKC 2HLAA 2Y1VA 2EEDA 3B8YA 2I25N 2EYTA 1DFBH 5EU6B 3C08H 3LPGA 5HHXL 1EBAA 3QIUB 3CPLA 3C6SA 4AEIL 4Z0BL 5DURB 1DQQA 3VGFA 2VDLH 5D4QA 5FA4B 1P6FA 3MA7A 1JWSA 4IM8A 4WW2A 3D9AH 2YR3A 4F2MB 2YD6A 2G5BB 1HQRB 4LAQH 1CGVA 1A3LL 3FB6A 2FR4B 3S34L 4LLQA 1N64H 2R4RL 1T22B 3MTRA 4KROB 1Z5LB 1YQVH 2M26A 1J1PL 5KANI 4X80L 3Q3GA 4ACPA 2W0FB 3RI5F 2H1PH 3QI9A 3UJTH 2AEIT 3FB8A 4WU7A 5C09B 2G2RB 1MFDL 1QSED 2P48B 5JLZB 3SKOA 3IFPB 4KZDL 1XZ0B 5FHAL 3MLXL 2H6PA 2BRQA 2LABA 3H3KA 3VFSB 1T2JA 3TZVC 4N90E 2W60B 4OZGA 4TOYL 5JHLH 2PYED 1YMME 4ODXA 4WDIA 1ZKAA 4APQA 5IMKA 2P45B 4C56A 4QRUA 3HC3H 1FBIL 5F21B 2XZCL 4FG6D 2HJFA 3KPNA 2KZWA 5L6YH 4E9LA 4IRSC 5HYQA 1K6QH 1MCLA 5BRZB 1K9TA 1WT5C 4ODSH 5HYSA 1AP2B 1HNFA 5JOFA 3VG0H 1AQKH 1PSKH 1JZ8A 4GBXA 1M7IB 4I9WE 2DIAA 3LRHA 2JB5H 3O8XB 3X12A 3EYUH 3BVNA 1J11A 3PWJB 3BYTA 5BV7L 3C09C 2GHWB 1SM3L 2D03L 5F9AC 3DETC 3GIZH 2XPGA 3H9ZA 3MJ8B 4M7ZB 1K5NA 4KVNH 3V79C 5JOPE 3QISA 5D5MB 5ITBH 1KB5A 4RGOH 1K85A 1AIFA 3DMMA 4Y1AA 2IANB 4H1LG 3MRJB 3T0EA 4R26H 4IIQB 3HMWH 3P30H 4X6CE 2QADB 4YHNB 1FO0B 3FFCB 4TSAL 1FL6B 1INQB 3PDOB 4N0CC 4X6DE 1KPUA 4PG9B 3BN9C 3PP4H 1LE5B 3DX7B 3LZFL 3PE9A 3BDYL 3QJHA 2C3GA 5T5NG 4C55A 1TETL 4QRPA 3L3HB 4YBLC 4RGNE 3CD4A 3T0VA 4S1RL 4JFFA 5KS9B 4OLWH 3DIFA 1OP9A 4HXBL 2HFFA 1MCIA 3D3VD 3H3PH 1BF2A 5D1QC 2OS7A 3G6JE 3TO4D 1UJTA 4F80A 4QEGA 1FAIH 4H26B 4IJ3B 4U0RC 3C5ZC 4V2CB 5JR1L 5ESVB 1RVFL 1MWAH 5TDPB 5FYKH 5IESL 4P99A 5T33H 3H9SB 2G9HA 3MJ9A 3ZTJH 2NTFB 1OP3H 4J8RB 2A1WL 1KIRA 1ACZA 1XH3B 3HNSL 1BREA 2VQUA 4HJJL 3QXUA 2X4PA 2IQAB 4RFOH 3WNPA 1W0VB 4QCIB 5DJCB 2C9AA 1XCTB 3JTSA 4ELKA 1UH4A 9CGTA 4PD4K 2BC4B 1I9IH 3GMLB 3M1BB 5I75B 1ZVHA 1A7PH 4TRPH 3KS0J 4I0PB 3T1WA 4PG2A 1FAKT 4WWKA 2ITDA 2C1OA 3HZKB 4HKJB 4ETQA 1HINL 1XF4B 2OR9H 1Q0YL 5T5FL 3BHBB 4MAYD 5IV2A 4JVUA 3E6FA 3BAEL 3LMJH 3WEXB 1NAMA 1LP9F 1WFOA 3UYRL 1HYSD 5T1MA 3BKCH 4ZTPL 1SBBA 5F9DC 2VL4A 43CAA 2PXYA 2CKBH 3A6BH 1MCJA 1F97A 2WIMA 2ZPKL 1YA5A 1IGTA 4PRNA 4GXVH 5J1AA 4PB0L 3OKEA 4DTGL 4Y4FA 4U1KB 1R3KA 3LKPB 4MA7L 4LLWA 1JHLH 4ZFFA 4OCSL 1NFDB 2ICEB 1CFNA 2VUYA 2H2SD 2J8UE 2CO7B 4OD2A 2BVYA 3VXNA 2ED7A 5TE6H 4JFHE 4PRAA 3IRPX 1YEEL 1IAIM 4OAWA 1JNLH 1PY4A 3STLB 2ZKHL 5I66B 5JXEA 3P9MA 3BKML 5GHWL 4R97C 5I2IB 4OLVH 4PJGB 4L4VD 1ITBB 4WO4C 1CLOL 3G04A 3TIEA 4POYA 2IC2A 4O58L 3MLTB 3I02A 2X4NB 1IAKB 4HDIA 2X2YA 2OTWA 4PLOB 1YPZF 4P4KD 4JRWA 5DUPL 4L8DB 5MERA 4X9BA 3RUGB 4LSQH 3V6ZB 4RDQF 3I3DA 1ZHLA 3VE0A 3RTQC 5HSFA 3QIWB 5HHMB 3GMMA 1ITCA 2W9EH 3KDMB 3JV6A 5F1IB 5JHDE 1MRCL 1MFCL 1P5VA 5J1SC 2V9QA 3SY0B 3QEQE 4JFZH 4L3EA 4MJ5A 3VXOA 1BEYH 4MMZC 4YBHA 4L4TE 1JNNL 4FQPA 4P23A 3QUXA 2A6DA 3MRPA 3RU8L 4XP9H 5IQ7H 3CSGA 4JPIB 4MQXC 3WJLA 3SDCD 4F9LC 5DLMH 4FNLL 4ZNEE 3WFHA 1EEQA 1HHKA 3I2CL 1BVZA 1VGEL 2R0KL 2OL3H 3ULVE 1IM3A 4G6FB 4DJMA 5KSAC 4NKOB 3PL6A 5ICXA 4X9HA 1YUHB 1CR9H 1A0QL 4OCLC 1NGXA 2YS4A 2NW3B 5DQDL 4Q2ZB 4JO4L 1PFCA 4JFED 4KHTH 3NCFB 3RWIA 4UT6L 5LBSH 3RX8A 1U93A 2Z91B 5C0CA 3O9WC 3SKMA 3FO0H 5ADPL 1ZS8B 4QXTB 1OW0C 5D72H 5EOTB 5J1TC 4OI9A 1SMOA 4NGHH 4NFCA 4JFYA 4YR6A 1JN6B 5L2KE 3IT8D 4G7YL 2MNUA 3EOBB 1D5MB 1YDPA 1CICB 1AY1H 4LNVA 5BV7C 1KCUH 3FQRB 2DL2A 4L9LB 1T04B 4EOWL 1LK3L 4ZXBC 2ZUYA 2OQJB 4G8IB 4I13B 4E41A 2Z0BA 4CRPA 4ZS7H 2AV1B 3OKMB 4ODVL 4Y4HD 5J6HB 5DO2C 4ODTH 1VADB 4UDTB 4TNVK 3RI5K 5B8CA 3EO9L 4XHQA 4JO2H 4KZEL 2HJKA 2DWDB 3W0WB 1ADQL 4KV5E 2Q7YB 2R4SH 2ESVB 2FX7H 3V5KB 4NZRL 4XPHH 4JN1H 4PJDB 2EIZB 4XPTH 3U9UA 1G0DA 5GXBB 1OTTC 3QWRA 3LSOB 2UWEA 1H3VA 4R8WL 4XBEL 3U1SH 3BN3B 3H8NA 4MNQE 1J1XL 1CGXA 3S8WA 4M62L 2BY0A 4CADA 3MOAL 4Z76A 2CKBA 5GS1A 4YHIA 2OM5A 1A6VL 2IH3A 2AXHA 2IJ0C 3OZ9L 3MRDA 2E27H 4P5TB 1RUQL 1YJDH 2ZJSL 1REIA 3VD3A 4YDVA 4LARL 3GEWB 2F74A 4NC1C 1QBLL 5DWUL 3F7RA 3HZYA 4YHZL 3DSFL 3VA6A 3D87B 4UT7H 2Y7QA 4WHTA 3U6RA 3WJJC 4JM2A 4ODBD 2X4RA 1A6UL 3GRWL 5FOBB 3RFZC 1A5FH 1IGCL 1IGML 3KLAB 5L7XL 5CWSB 2VAJA 3IDXL 3QRFM 4OI8A 3UTSE 4LSUH 1L9NA 3MGAA 1Q72H 4MJIE 5BMFL 2OSLB 3L3IB 2NX5A 4PR5B 1A6ZA 1DLFH 5IQ9A 1AO7B 2BNQB 4UNUA 3AXLA 3FB5B 1IVLA 1C1EH 5BVPH 1JTTA 4X6CF 3V4PH 1ZHKA 1E4XH 4MZ2A 3BH9B 4EZMA 4U6TA 4LPWA 3MRNA 4X6DF 4K55A 5JMOC 5T3ZD 2YD2A 1R5WB 4RMSA 1Y0LA 1S9XB 4LL9A 4DK3A 3NFSH 5IFHL 1PW3A 4TUKH 3HE6D 2B2XH 2GK0B 1Q9KA 3X3FL 1MHHA 2YBRA 1OAXL 1QD0A 4BQCA 5ESAA 3NVQA 4GAGH 1GPOL 5D7IE 2AI0H 3DRTA 2B1HH 3OR7A 4PJEB 4EI5A 5DMYA 4KKBC 4NBXB 3TZVD 2CDGA 3R0MA 4PJCE 4UOW1 3G6JF 3TFKC 5AUMA 4Q7DA 1KNOA 4Q9RH 3DXAB 3P9WB 3U0PA 5HYEA 4JVPA 4LF3A 4G8GB 3CFDB 1WITA 2JJUA 3GNMH 4DOHB 1N6QH 1L9MA 1ZLUH 4X9GA 3VI3E 3JUYA 3BMWA 2ZOLB 1U8PA 1ORQA 3BD4A 1FNAA 1MJ8H 4IRSD 2WIIA 4UV4L 5IJVB 3VGDA 1OQXA 4Y0GA 3O3EB 1A6PA 5J57B 5I1IH 1Y6NR 3CZJA 5FIEA 4APQC 2QHLA 3D6GA 5EO0B 3VFPB 1R24A 5ETUB 2XI9A 3V4UH 1F4YH 3LEVL 3SDDC 4Z7UB 1OB1B 5JNYA 5D7LA 3CFEA 1S7WA 4AJ0A 2OL3A 3VXPB 2CLVB 3PJSB 5ICZA 2V5TA 1D6VL 1W72L 2E9JA 3NA4A 2X4QA 2ZUQB 2J2ZA 2OX5A 1FIEA 3NIGE 4MDIA 4GBXC 1TZGL 3BQUA 2DBLL 2DM4A 3TNNA 5GS2H 3LQZB 4GRWB 4BK5A 4I2XA 1DQDH 1NJ9B 2JIXD 1VACA 4K3DH 1FGNL 3PWPA 4PJ8A 5I1GH 4Z8FL 4NHUA 5DJAB 1RU9H 2GAZB 5EBWB 5D9SA 3W9EB 4Y1AE 4N0CD 2XACC 3T0EE 3UBXA 2A73A 5M95B 1CK0L 1KV3A 2QSQA 2EO9A 1UVQB 4LHQB 1BBJB 5J12B 3CSYB 4XC3H 3GSQA 3UTQA 4HK0A 5CEYB 3OXRB 2XY2A 1HEZB 1KN2L 5J3HC 5E56A 4BZ1H 2GSGA 3C2AL 1BVLB 4NO3B 4WUUD 4XNMB 3PXHA 3EYFA 4QXUL 4Y5YC 5D1QD 5IB4A 3SE3C 3QDMA 2HWZH 4QKXB 4G6JL 3O2WL 1F6AB 5I17A 4L29A 2CGRL 3TPUB 1FL5B 3K4ZA 5DRNA 3Q1SL 4MCZB 3O4LD 3LQMA 3MA9L 4U3XA 5L8LB 3ULUE 4Q0XL 4RZCA 1S78C 1OAKL 2GSIB 3MLUH 4HKZA 4Y16B 5DD3L 1IGFH 1IQDB 3TYGH 2PYFB 5IW1B 5BO1H 1BD2E 2N1KA 2R29L 2FEEI 3O3DA 3QFJE 4NZUH 4FXGB 4LBEA 4WY7H 3VFRA 3EFFA 5GGSA 3VXSD 1EO8H 4NQTA 4R4FL 3MLRL 4MCYA 5DK2A 3BUTA 4OV5A 2NY5H 3O2DH 4PGCA 1KBGL 4KU1A 5IM7B 1AJ7L 2VDMH 4OLEA 1BQUA 4IRJB 1MELA 1CIUA 3BFOA 2XZQH 4NT6A 3S5LA 3EDEA 5I8KL 5DJDB 3TIDA 1I1RA 2ZCHH 4XNZB 5DTFB 2E9IA 4UIMA 3OKDA 1JHTB 1SVCP 2NXZB 3PXJA 4DN4H 4AIZA 2PCPA 4EBQH 4PJ5D 1NCBH 1TTFA 2VE6B 4O9HL 5I76A 4YHKH 3QUZC 5KSBE 2ATKB 4OT1L 3RNKB 3DX8A 3U79A 4PGBA 4PRPA 3QG7L 5TE7L 5FO7B 5EZIL 1SYSA 3FT4A 4LSVH 3GSWA 5ACZB 4ZFGL 3KLHC 3ZYZA 5IEHA 3RVUD 2BMKA 3UZQA 5CCKH 5MI0C 3BXNB 5FAAA 2DTML 3B3IA 3ULVF 1RZFH 3VXMB 5FUOH 3LKRB 1BQLL 1JPGA 2E7HA 1A3LH 4KTDH 3NIDE 3QXAB 3CX5K 3D85D 1E6JL 2A6JA 4N5UA 3C60A 5D7JD 2XNAB 2XWTA 1HI6A 4KVCL 1C5DA 1S7RA 4WO4D 4X80H 3MRHB 1A4JB 3MLVH 1BHGA 3BPLC 3EYOB 3MJGX 3WNLA 1LK2A 3VXRE 1U8MA 4OZHE 5JXEC 5JW3L 5D1XB 2Y36L 3RL2B 3HE7C 3LN4A 5GJTH 5B22A 5C0BB 2BXZA 3NCEB 5F6IB 5E6IC 1KB9J 2FECI 3MCLL 4Z7VA 4Z77B 5DK0A 5EO1B 5ISZE 1G7QA 3MV7D 1EHLL 1FNLA 4WGVB 4OZFH 3RTQD 4OFIA 5J9PA 3IU3A 4RFEB 5C07A 3S36X 3O6LH 1INEL 1JWMB 3KYNB 4LGSB 3WHXB 1RV6X 3GI8H 3DECA 2FO4A 1FN4B 1Z9MA 4XAWL 4MQSB 3P4MA 1FBIH 1CL7I 1S5HA 4O00A 3KPRA 5SWSE 5I1EH 1A14L 3LKQB 3PWVA 4HUMB 1NGZA 4TVPH 1DUZB 2F54A 5DRZA 2ADFH 3WUZA 1RSFA 1ZLWK 1UYWL 2HG5B 4Z78B 3FO9A 4AEHL 1C12B 3R4DA 5H37G 2EDNA 4FZ8H 1P7QD 5E9DE 4FQJH 1FORH 2FZ3A 1JPFB 2Z92B 3SEPA 1SM3H 2D03H 2P5ED 3NABH 3OPZH 5TF1H 4HUNB 2IALB 5B4MD 3OKLA 2MCG1 3MNWB 4PRIA 5FUCE 3UPCA 1GC1L 4KGLA 4FOMA 3SQBA 5EU4B 1MAKA 2DAVA 4KKCD 2P47B 3QO0B 4PBXA 4LDEB 1IQWL 1YZZA 3IDJB 4M48H 4Q6IC 5KN5B 2AJSL 1FNGA 3P73B 1IARB 4TULH 3UEZA 1Z0NA 3K7UA 5FYLL 4X5WB 4O2CA 3LZFH 5GGUB 5I1CH 1QRNE 5EC1A 2ICWA 4ZOAA 3GKWH 4QOKD 3TA3B 4EDXB 1NMAL 4OIIL 3B43A 1PG7L 2APTA 1F4HA 4UDUA 1S9VB 3GSUA 5DD5L 3KPPB 1T1WB 2DQFB 3GM8A 3O6FB 2Y23A 2F9BT 4GKZA 4KRMB 4P49A 5F3HB 4MJ2A 5EH1A 1PEWA 4S1RH 4ZXBD 5LQBH 3LEYL 1XGQB 1PLGH 3LKSA 5CJOL 1HH9A 1BFSA 3GJFB 4DW2L 4KQ4L 5F88A 4DVBB 3WD5L 3P0VH 3X13A 1Z9SA 2AEPL 3O2DA 3WO4C 3LVEA 4HW6A 1JV5B 3TGXA 5JR1H 2C26A 1LP9B 2EC8A 4PTUA 1JGLH 1AC6A 3PV6A 4BQBA 3JWDC 2GITB 4PJ7E 4LLUB 2RIKA 4LVNB 2R23A 4H88H 4A6YL 5ADOH 3HLAA 1FSKB 1QPXA 4FQIL 5D7IF 2FJGA 4HBCL 2A6IA 1OTTD 2FLRT 4WFHE 2A1WH 2DQJH 2F19L 4XNYL 5HYJA 4PJCF 1OARL 1LEKB 2P4AB 4F7EB 3CFJA 1JWUB 1QVOA 4CMMB 5IHBA 4JRYA 4HJJH 4G80A 1CBVH 1N0XH 2B8OT 3TNMB 1G1CA 2OK0L 5E08L 3ARXA 1JTPA 4KMLB 4LDOB 3O6MH 3UPAA 1FFOB 1A2YA 3WV0A 3MUGB 3VH8A 3AC0A 2XFXB 3QWOB 5C0AB 2F5AL 4P5MA 4GMSH 2YPLD 4NNXA 3ZDYF 3C5JA 1BIHA 1U41A 2DYPD 4PJ9A 4ZUUB 4FABL 1CGTA 3MV9D 4AH2B 3GSNB 4O4YH 1DBML 2VDPL 3IF1B 2YK1L 3P4OB 1RPQA 3D0LA 5T5FH 3NIGF 3HNVL 4YDLB 4P2CG 1KOAA 5CKAA 1D9KA 1FV1A 4KJYA 1JUFA 4ZTPH 1WAAA 4P4RA 1D6EB 1YPZB 1J0IA 3BSZH 3HPJB 5JA8B 2YA0A 4F15C 1JZ5A 2I07B 3CFBB 3MGTA 4FTVB 1G7HB 2ZZUT 1WZLA 4Y19A 4JZJA 3BUYB 4NUGL 3N1MC 4XB8A 1OSPL 4YEFA 4EXPX 1I75A 3KPSA 5GGSY 3SDAA 2J5LC 3AY4C 4MAUH 3EFDL 3QPXL 3GBMH 4MVBC 1GIGL 2NW2B 4CVUA 3QIBA 1KYOJ 4D9LL 3N06B 2A83A 1HZHL 1YEEH 4OZFA 3MO1A 4K3EL 2ZKHH 3RWCA 1IAOB 2R8SL 4KKBD 4YQXL 4HH9A 5E2UH 3Q2CA 1X3DA 1YN6A 4P46A 1KGCE 2ADJA 5C0DB 5KJRH 1Q94B 3TFKD 1I8MA 3BKMH 3DLQR 4OV6F 1IRAY 1G6RL 1VFAA 5IOPB 2R56L 2NY4C 3QHFL 4KQ3L 2VDQL 1CLOH 2GYSA 4EI5C 5JPMA 5LXGH 1MCBA 3ULUF 1G9NL 3JTTB 4MLSA 4B5EA 5EFIA 3K74B 1NCUA 3IDUA 4APQD 4PRDB 4C56D 1RJYB 4J4PA 1CGSH 3SDDD 1LNUB 1IL1A 2BHUA 4NRYB 4NKMA 2E6QA 1FCCA 1XGUB 3U36B 1NFIB 4NKDA 1EFQA 4LKCA 4GBXD 3ARVA 5GGTL 5MEQA 1I7ZA 1C08A 4OF7A 1MFCH 4FA8A 5LAXA 4PREB 4OCWL 3S3SA 2XQYK 1GOFA 2A74B 3VFTB 1YEFL 1RK1B 3EIFA 1NDGA 4BQ8A 1JNNH 3NIFF 1UG9A 2H9GA 1EERB 1O7VA 4KAQL 1A1OB 3WUWA 3DMMD 1WJ3A 4K8RH 4R90L 5HHVL 3WCYA 3QG6B 4FNLH 1XF2B 2ZUTA 1CFSB 5HHPA 2WK2A 3VGAB 4P2OA 1BQHA 4G42A 1OL0A 4J3WA 4ALAH 3GMPB 3GMNA 5IFJB 1NAKH 5J3HD 1CD8A 1HHHA 4LSRL 5KSBF 4FQHA 2H3NA 1A0QH 2BCKB 2CK0L 5DQDH 2EIDA 2HRPL 3DNKA 1FRGH 3OB8A 4JO4H 4XTRC 4JEGB 1TIUA 4QRPD 1JTOA 4R4BA 4FQ1H 4NUJA 5ADPH 1D5BA 4JFFD 2D7TH 2GY5A 1NBZA 3M17A 2JJSA 1BGXH 1HKLL 1CFTA 2VAAA 3BW9A 4EUPB 4CN1A 2VLME 3NIDF 3O81A 3RAJL 1OD7A 1QSFD 1IAIL 3BJLA 4EOWH 5FV2A 5FDWA 4DUVA 5KVGH 5HYFA 2FIKA 4NQSA 2EEBA 3VRJB 2VL5B 4QRTA 5CBEB 4LCIH 4PJHA 3ZSSA 3F6IA 4NQVB 4RMRA 3HS0B 4V2BA 1GC1C 3CXHK 4PJFE 3MRQB 4OZHF 5E1HB 3RY6A 4E0RA 1ZLVK 1LEIA 1DE4B 5IB5B 4K71C 1A4KA 3N9GL 4D8PA 5CSZB 1EO5A 5EC2B 2F58L 3EO1A 2J7LA 5EG6C 3QHTC 4NZRH 4MJ4A 1YJDC 4X6CB 2FBOJ 1I9RL 4GJTB 3RNQB 4NQXA 5DRWB 2QEJA 3QB7C 1CDYA 1L4IA 1ES0A 4KMTH 4X6DB 5I1DA 3H9HB 4ZAKB 2BHYA 1KPVA 4WWKD 3OAZK 3MOAH 1A9BA 1H9VA 2YKLL 3L3JB 4JY5L 4QHMB 1N2RB 1YEHH 2HTKC 3L9RB 2AGJH 1UXWA 2X40A 3KXFD 3OZ9H 3QUZD 1P4BL 1PG7W 5IEKB 3ARGA 4XZUA 3TJHC 1A3RL 1RZ8A 4RGNB 4LARH 2GJZA 2VZTA 1NC2A 1HQ4A 2OYPA 3DSFH 5BZDA 1CG9A 2VITA 3G6JB 3D69B 1HSBB 1VEOA 1BVKB 1UADC 3SE8L 3GRWH 4KI5C 4W70A 1IGMH 4MGXA 4Y4FD 2HLFC 1HXMB 1T03L 4FFVD 3WN5A 4P2RA 4QHNA 5B21A 3LV3A 1J7VR 4GW4A 1IM9A 2R2HB 1QO3B 4ERSL 3HKFA 3VXUB 4QF1B 4GOSA 4JQIL 2CRMA 4OCNC 3LDBB 5J7CC 1BLNB 1W0WA 3WIHH 5I15L 4NHCL 3NMEA 4M5YL 3PABB 1LE9B 3C2SA 1XGPA 1VSCA 3WLBB 4HJ0C 1QYGL 4KWUA 2CMRH 1NMBL 2ARJB 2VLRA 4YIQB 5JXED 3OKOB 1NSNL 3HE7D 1QTYT 1VKXA 3C60C 1FO0H 4Y2DA 5JTWA 1I8LC 3CDGA 3MRBB 5L88H 3NCJL 5JQ6L 2DQEL 4JFDB 1EBPA 3SO3C 2I9TA 2D9QB 4MA1C 3TM6A 4M6OH 7FABL 5AG9A 1X5GA 5HPOA 3NGBB 2BVOB 1J8KA 3MREB 3JWOL 3MSPA 5HJ3B 5DS8B 3W81A 2YXFA 3ARFB 3UCRA 4K23L 4JR9L 2YSSB 5SWZA 1T21B 5C08B 2P8LB 3H0TB 5T1KD 4KJQD 2IAMB 5E2JA 2YXMA 3GGWB 4PJ7F 3IJYB 5T5NF 1JPTL 1ZVYA 5C0EA 4UTBL 4JHAH 2B7DT 4NQEB 4FZEH 5DFWH 2WWMC 5CGMA 4JDZB 3T4YA 2MJWA 3ULSB 2V17L 3HRZA 4HV8A 4L3ED 5DA0B 5DJ8B 2GT9A 3HAEG 2DQHL 3CUPA 3BIAX 1FFPB 2UVEA 1TCRB 3DVFA 2Q6WB 3QUXD 3BH8B 4N0FA 3BMVA 2PETA 3IAQA 4K9EL 5CKGA 4KK6D 1VEPA 3KYMA 5GRVL 4Z95H 1TZGH 2DBLH 1L6XA 1INDL 4GAFB 4X4ZA 1Z6JT 2ADGA 1T89A 4XH2A 1TMCB 3PWLB 3U46A 4LU5H 1DP0A 1J8HD 2A0LC 2BSED 1WBZB 3UTOA 2FATL 3H42H 5E8NB 4V1DE 2YPKB 5CIPB 3PL6D 1RFDH 4ONHB 1G9NC 3QIUA 4DKAA 1JZ2A 2DQTH 2I60H 4M7KH 4LLDB 2I5YL 1MLBB 4GW5A 4XNXH 5FA4A 3MUJA 5EU5B 3VG9B 5C0CD 4F2MA 1OAYH 4OM1L 4Z0XB 3VXQB 1BZQK 2G5BA 4ZUTA 5FEBA 1CFVL 1H15B 1HQRA 4Z5RB 3K80A 4QXUH 4K2UL 3QR2A 4NJAH 3OJDB 4PJ5E 5BOPA 1Z5LA 2J8HA 4G6JH 3BISA 4OF6A 5DZNA 1MCNA 1DVFB 1B4JH 5EUOE 2W0FA 4DKEH 4EVNB 4LEXL 3MA9H 4JM4L 4NQCA 4XWGL 5C09A 4LEOB 5JLZA 4Q0XH 5AAMA 3PDGA 3EHBD 1T5XB 4PJIE 3IFPA 3QEHB 1RUKL 5CMAB 4Q97A 1QLFB 1XZ0A 1P9MC 5BJTB 3UC0L 5F7MC 1EFXB 3WLWC 4LDLB 3VFSA 3HMXH 1MJUL 1OP5K 5HYJE 4MYWB 1NGPH 2MPAL 1GZPB 3OGCB 3QWRD 4GMTH 2BNRD 1FNSL 1RHHA 4KKNA 1XF5B 4P3WA 3ESUF 4XT1C 5DGRA 5E4EC 3PHQB 4G6AC 3T0AA 2EDTA 5BRZA 2HKFL 1II4E 4UMGA 3ECBB 1KEGL 1AP2A 3B5HA 4GW1B 1M7IA 4LVEA 4FHBD 1GGCH 4TTDC 5CD3B 4G43B 4UOJA 5DEZA 1VFBA 1EEUA 3L3KA 4XCYB 2NY3B 4UB0H 4BSVB 1S5IH 3MJ8A 4JM2D 3WIHA 4W4NA 4Z7QE 1X5AA 3WS3B 5D5MA 5C0RH 4OT1H 1KJVA 3LB6C 2IANA 4KXZH 3MRJA 4NM4H 4DFIA 4NP4L 1RZJH 2NX5D 4IIQA 4XPAH 5MENE 4CNIB 4YHNA 1FO0A 4CDHA 4ZFGH 1UA6L 1BWWA 4K7FB 4OKVB 1B0GA 1INQA 4UBDC 3DVNA 5KVMC 2VDNL 4MVBD 4PG9A 5J13B 3DSNA 4D9QD 1I9EA 2DTMH 4YX2H 1XIWB 1LE5A 2VR5A 4YHOL 3DX7A 3P0GB 3B4NA 4JHBA 1BQLH 1CLYL 4WJ5B 5L0QB 3V0WH 2HKHL 2AEWA 2R2BB 4RISL 1BBDL 3L3HA 2ZWLT 5GZNC 3QCUH 5ID0A 5KBNC 4NC0B 2LU7A 1IC5L 5DC0A 2ATPB 4NNYA 1GGBH 5KS9A 4KDVA 4FN0A 2AQ3A 3S3JA 5I30H 1HHIA 3V0VB 4EI5D 1F3RB 4MD0B 3SCMC 4G9FB 4H26A 5KVDL 2Y36H 3BRDA 1UQSB 4HUVB 5ESVA 4YHLH 2P24A 4UQ3B 5IB1B 5TDPA 4F8TA 4U1JB 2ZCLH 3MV8B 1MLCB 2B0SH 3X11A 3H9SA 4OCRL 5MEPB 2CK2A 1QA9B 5CD5C 4JO1L 1KJ2B 3BZEA 5F8QC 2ZCKH 5MP6H 3TBYB 1INEH 2GTZB 1A6AB 1XH3A 2YZ1A 2YD4A 3CX2A 2V2WB 4PJFF 1XAUA 1GGTA 4D9RE 2WMPA 5D7LD 3THML 2EDLA 3E2HC 5A16A 1W0VA 1F42A 4M7LL 1IC4L 3TF7C 4XPGL 5DJCA 2KQMA 3MX0A 1XCTA 5HVWA 2BC4A 3GMLA 3M1BA 2HFTA 4RAUB 3BQUD 1AXSB 1UM6L 5GJSH 4C59B 4I0PA 5CZXD 1UYWH 1MI5E 3TJEH 1X5LA 3BYYA 4AEHH 2A38A 2E7MA 2YD9A 1K3ZA 1VFOA 2FL5A 3TH3T 3HZKA 3PWPD 4HKJA 4PJ8D 1NDMA 3QJFB 4PYHA 4LPTA 2WUCL 4YBQC 4PRBB 4W6YB 1MPAH 3UTTE 2F5BL 3MV01 3JWOC 1T1ZB 2XKUA 4MB3A 2BJMH 2BVQA 2IPTL 5D7IB 4XTRD 5DUBB 3VWJB 1U0QA 3L5WA 3GUTB 4WTZA 4PJCB 3WXWL 3O4OB 1BFTA 5T3XL 4U1KA 2IG2L 1RURL 3GB7B 3LKPA 1I7TB 1RQ5A 4XMPH 2XKSA 3QDMD 1NFDA 1YEDB 5IFAH 3FB7B 1IT9L 4POZD 4QRRE 3ZL4H 1MHCB 1A7BA 5T1LB 3S35X 4JGJA 3BPOB 4HCRL 4ONGL 2D7QA 1ZMYA 1MHPH 1WIOA 3QZWB 3IDYC 3HMXA 4K9EC 3V6FB 4AENB 2V9TA 5I66A 4ZOCA 5DFVC 3NCBB 4KQ4H 3TBSB 4EN3A 4CAGA 3CJJA 5I2IA 4N8VG 4NO2A 4PJGA 4D0CB 4PJBE 5EIIB 1H0DB 4NRZB 2XXMB 1QQDB 3P4NB 3SJVB 2VYRE 1MQKH 5GRJL 1WWCA 1RULH 3MLTA 1WC7B 4MB4A 2X4NA 1IAKA 5FYLD 1CDHA 3RGVB 4HBCH 1AFVL 5CJXA 3RUGA 3QO1A 1U3JA 4LCWE 1OP3K 2Q3ZA 3V6ZA 1ZANL 5FKPB 1UEMA 4OF0A 3QIWA 2HTKD 5E08H 4W68A 3T2NL 4L8BB 2NQCA 3AM8C 5F1IA 3TJHD 2K9UA 4ODHH 1F58L 4GRLB 1GAFH 3IDGA 3QQ3A 3O3AB 2KL6A 1S7TB 3CFIC 3UBXI 3AU1B 4XBGA 3BE1L 4HZLB 4K94L 1B2WH 3NACH 1F02I 5DXWA 1NUDA 3I50L 2UUDK 4KI5D 2VDPH 3PF2A 3ARGC 4JPIA 4YGVA 4M00A 5IB2B 4OF8A 4PRPD 5C86A 2VO5A 1BWMA 3WDHA 4JCMA 3MBEA 1KTRL 4GS7C 1I3GL 1MCCA 4GQPH 4YZFE 4F7MB 2CLRB 2ILLA 5F9OL 1CU4H 4H0GA 4NKOA 2KPNA 1H3WM 4HF5L 4R2GB 1XCQB 1BD2B 5DVOA 3QUKA 4NQDE 1L7IH 1R5IB 1ZHBB 2NW3A 4Q2ZA 4GRWH 3TT3L 4X7CC 2CH8A 3MLZH 1P69B 4CJ1A 2Z91A 3DV4B 2VXVL 3T1FB 1TJHL 5A2JH 3C60D 4S0SD 1QFWM 1IEAB 2X10A 1EUTA 3FMGH 4BK4A 4KKAD 5F8RC 4YJZL 1JN6A 1J87A 2ZP0T 3EOBA 3M8OH 5DUML 1D5MA 2R8SH 1CICA 3CMOL 4YQXH 3WMSA 2NXYC 5TE4H 5AEAA 3E6HB 4K7PL 1MEXH 3FQRA 4L9LA 4ZG1A 4JG0L 2WWKT 4LVOC 2OQJA 4G8IA 5D1ZC 3QHFH 2NY0C 5EUOF 5HHOD 2OZ4H 2AV1A 3OKMA 5C07D 1N6UA 2NNAB 5SWZE 1VADA 4UDTA 1CI5A 4R96B 5FYJU 5GS2D 2PYEB 4PJIF 5KSBB 4DUWA 2DWDA 3L5IA 1WSST 4MQ7A 3W0WA 3DHJA 2ESVA 3V5KA 5KAQG 3KPRD 4PJDA 5CEZL 1BZ7B 2EIZA 3PQYA 4WTWA 2F54D 3LSOA 4DVRL 4AT6B 4HUWA 1X5KA 5GSRB 2F53D 1SY6A 4WIQA 4CMHC 5EULV 4LIQH 5F7DB 5JZ7C 1CVSC 1T80A 4AG4H 2A0LD 5GIRB 4P5TA 2Y6SC 1KIQB 1LMKA 3HI1B 4KUCD 4I77L 1T7XA 2XWJB 4PRID 4RA0C 1AGDB 4LCYB 1UWGL 1F4WL 2AJVH 3R1GH 4KHXL 4KRPB 4R90H 3I6GB 2ITCB 3VXRB 3EOTL 4OZHB 5FOBA 5EU6E 5CWSA 4A2MA 1BAFL 2OI9C 1XR9A 3BKYL 4Y5VA 3JV5A 4Z7QF 5F96L 3QIUC 5ITFB 4LCCC 4LSRH 4XPBL 2OSLA 4KUZH 3L3IA 5ISZB 1J12A 1FVEB 1NBYB 3H7BB 3FFDB 3GIVB 4P9HH 1AO7A 2BNQA 1HXYB 2CXKA 3SKUD 1NPUA 2PTUA 3FB5A 5F7EL 5FK9A 3WHE1 2BVTA 2E7BA 2E3VA 5FGRA 5C6WH 1A6WH 3BH9A 1EV2E 2O5XL 3RRQA 1MY5A 4JREB 5SWSB 4UAOC 4FFZL 3KG5A 2AK4A 3W2DH 1JE6A 4JDTL 4XXCA 3TO4B 2GK0A 5DSCB 1HCFX 4UTAH 5JPNB 2AK1H 5C09E 5GGVL 4PJXE 3RAJH 1AI1H 2X4OB 3H2WA 4RAHA 4BFGA 1QZ1A 2VLKD 4PJEA 1I8KB 1UM4L 1RUAL 5E9DB 4YGAB 3FQTB 3GDBA 1ED3B 4W4OC 1A9EB 3DXAA 4G8GA 1IGJB 3IU4H 4G6KL 4OUUB 2N7BA 3N9GH 5I1LB 2VXTL 5EA0L 4JRYD 1EVUA 1C7SA 2ZOLA 2F58H 3DYPA 2WAHA 3B9DA 4G6AD 4OKDA 5IJVA 4OIBA 3O3EA 2QBWA 3VFPA 3JVGC 5JXAL 2PO6B 2WW8A 1UACH 1I9RH 4HC1L 1C5CL 4TTDD 1BJ8A 3UMTA 1OB1A 3EYVB 3GHEH 1NFKA 3JWNC 4NO0A 1TQBC 3S36H 3VXPA 2CLVA 4IEFB 3PJSA 4P3DB 2MWCA 4PJ9D 2CDFB 5D2LE 1AHWC 1KJ2L 2UY6A 5H94B 4P57B 4PUBL 2EE6A 2P8PB 3LQZA 3V0AC 4HIEA 4X5XB 4H1LB 4X4XB 1NJ9A 4AMKL 1SQ2N 5E8PB 3MZTA 4ZO9A 1D9KD 1DN2A 1HWHB 1AGBB 1CFBA 5JIIA 5DJAA 5EBWA 2GAZA 3W9EA 3CU7A 2ICWI 1GGUA 4UBDD 5E00B 1NGQL 2NY7H 2CPCA 4UINH 2DD8L 8CGTA 1UVQA 2D7OA 2G75B 4Y19D 1RAMA 3FFCE 4U1GB 2AJ3B 1M05B 2NY1D 1BBJA 3SDAD 4LOUD 4XGZA 1DLHB 4JE4B 1F2QA 5GZND 2X05A 5CEYA 3OXRA 1HEZA 1A7OL 3A67H 2OMNA 1BVLA 1S9YB 1WVZA 4NO3A 4QO1A 4XNMA 5I9QC 4LSPL 1SVZA 2OZ4A 1UWEH 3P11L 3L3DB 1JF6A 4U33A 4N1HB 4P46D 5C6TH 1BOYA 3H7LA 3TPUA 1FL5A 4S1QL 4MCZA 5GS0H 2LTQB 1T0PB 1LO2L 4K94C 4XCCL 5B39G 1AGEB 2Q8BL 4L4VB 4NYLB 3REVB 2GSIA 5FO8B 4HFWB 1E0OB 4Y16A 4TVPD 3PWNB 5CD5D 1OM3L 4ZDHA 2KKQA 4GKSB 3O0RH 1WZ1H 3D18B 1IFHH 1JNHB 3BWAA 4LQ1A 4M1CD 5DMIH 1T0MB 2EDWA 1I3RA 5CS7A 5ELIA 3B9KA 1A02N 4FXGA 3LKNB 4P4KB 4WW1B 1I4FB 3BPNC 1FYHB 3A6OA 3SE9L 3GJFH 1KG0B 2OJEB 2APWA 1H3PL 3ZT6A 2ZG2A 3WL9B 1OPGH 4WV1B 3ALXA 3TO2B 4TUJB 3IDMB 1Q9WB 5IBLD 5JIPA 4X6FB 1KLGA 5IM7A 2V17H 1E28B 5CGYC 5D7KD 3AS3A 1AKJD 1ZLSL 5DJDA 1IBGL 2XRAL 3BEVB 4YBQD 1S8DB 4QHKJ 3IFNL 4ZFOL 1C16B 2XWBB 5J06A 3I9GH 3DGGB 4NJ9L 3SDCB 5IVXF 1I7RA 3KWWA 3STZB 1WEJL 2I9LB 3OKNB 4UU9B 4AL8H 2DN7A 1N7ML 4P2OD 5FKAB 2ATKA 2X70B 1D7FA 3IKKA 3ES6B 3RNKA 3EOAB 3SDYH 4LSDA 3MNVB 2AAVA 4HIXH 3V5DB 4MX7B 1IEBB 3MRRA 1HH6B 3IXTB 1YEJH 3O2VL 4IOSD 5DR5H 5FO7A 1YQ2A 5IVNA 5ACZA 1DTUA 4WCYL 3KJ4C 2FGWL 4HHAB 3BXNA 2A9NH 4CJ0A 3KVQA 1YC7A 2P5WA 2Z4QA 3EYQC 3GSNH 1MJ7L 3RL1B 4OM1H 2EH7L 1RK0A 3VXMA 3D2UB 5DRXA 2LVCA 1CFVH 1UH2A 1Y18A 3ZE0F 3LPWA 3QDAA 4PY7B 3KNBA 3QXAA 3QCVH 1JGEB 4JHWL 2XNAA 5HGAA 5DT1L 3GJEB 4JPWL 4HUXB 1PKOA 3MRHA 4P3CL 4XC1L 2BNUA 4TSCH 5IROA 3U30C 4XAKD 3EYOA 2HVKB 4XWGH 5A40E 3BRFA 5D1XA 4EN3C 4WHDA 1RMFL 2FX8H 1H5BC 5C0BA 35C8L 5ALBL 1HIMH 1EO7A 3B5GA 4Y4HB 4Z77A 3U7WH 4U6YB 1TFHA 5EO1A 4XHJD 5ANME 3CC5B 1T3FB 3MQIA 4M43L 1MJUH 4RFEA 3VFWA 1JWMA 1MQ8A 3VD7A 3KYNA 3WHXA 1KPRA 4BKLB 3RUGE 3CNKA 1FN4A 5I71C 2PN5A 3QDGE 1OGAD 5DI8B 4KJWC 2YUXA 1FNSH 1U92B 4JG1L 4NFDA 3D39E 2QQNL 2R2CA 4U1HB 2QHRL 3HCVB 4NWUL 5EO9B 5HHME 2R69L 1MCFA 4M4PA 3BPCB 1J1OH 3ORJA 4PIRF 1K2DB 1DUZA 4G8EB 4WUKH 3SDXE 1BIIB 1CZ8L 4ZYKA 5HXMA 4HBQA 3ARGD 5HI4C 4Z78A 2AS5M 1C12A 5FO9B 5CINL 3HC4L 5JUEH 2XZAH 3ZKNC 1T2QH 1QR4A 3WFBL 2Z92A 1WQVT 5FGCB 3QXVA 2Q86B 1DSFL 4HMEA 2CSPA 5CBAB 3MNWA 5JIKA 4P2RD 4JQVA 3X14B 3AS0A 5FA3B 2J3SA 3MBEC 2Q7NA 5E8OB 4CKVX 4NP4H 1UFUA 1QFWH 5D2NC 1F3DH 3QO0A 3X3GL 1KLUB 2IPUG 3IDJA 4PJFB 5H35B 3P73A 2OMBA 2W07A 3MLPA 3QA3B 3I3BA 4FMFA 2MOVA 1R3IL 2FSEB 1LD9B 4X8JB 4YWGL 4ZO7A 4X5WA 3O45B 5JO5B 3IVKB 1CLCA 2GCYB 5GGUA 2UV3A 1DBJL 4TQEL 4JRXE 4EDXA 2VLRD 5ERWB 1S9VA 2Z8VC 4RISH 1T1WA 2DQFA 3ZE2E 2WUBL 5AYUL 2O5ZL 2CIKB 1IC7H 5FF6A 1XGQA 5D1ZD 4WRLA 3QUYB 1QLRB 4YFDB 1EMTH 1NKRA 1NLDH 1J0HA 4YC2C 5DJ6B 2HFEB 3U2SB 4P2YA 3TZVB 5KVDH 5CAYB 5CHNB 3KYAA 4HWEL 1EJ6A 2C7UB 1UWXH 5C0NC 1X4ZA 2GITA 1OAUL 25C8H 5TF0A 4ESKA 4W6WB 4PJXF 4Q9QH 1E4KA 2W65A 1D3CA 3CXDL 1T83A 4L1HA 3UDWC 4IRSB 1ZSDB 2ESVE 4EUPH 1OWRM 4NPYA 5GRXG 4K8RD 1LEKA 4F7EA 3SO5A 4PJDE 1JWUA 4J7RA 1EGJL 2VZ1A 4CMMA 2R1YB 3TNMA 3THMH 3N50A 1JGDB 3AREA 1ERNA 3C09B 1YY8A 1KTKE 1DUYB 1FFOA 3I6LD 4P2QA 2Y6SD 4Y5XA 3CH8A 3MUGA 2H2PC 3KLDA 2XFXA 3QWOA 3B6SB 3WFDL 5BW7C 5C0AA 4F7PA 1FYTE 1XFPA 1JVKA 3TWCH 4RGMC 3PIQB 3G5VB 3QHZH 4U2YA 4TNWF 4HGMA 4ZUUA 4AH2A 2DWEA 3HZVB 5FV1L 4HXAL 2YN3A 3HG1E 3GSNA 2C3XA 3IF1A 2H41A 4LVHC 3KHOA 3MLWH 3P4OA 5E4IA 5D2LF 4MA8H 2F5BH 3ETBF 3QIUD 1ZOXA 2PW2B 2H26B 5FDYA 1LVEA 3FRUA 5DURD 1S9WB 1D6EA 43C9A 3HPJA 3T2OA 5LCVH 3RPIB 3QDHA 1U36A 3TBVB 2I07A 5DVLA 2YC1B 4FTVA 5T3XH 4Y5VC 4YBLB 3RKDD 5IHZB 2D7MA 3P77A 1CLZH 5K59F 5D1QB 1I1AC 4KROD 4A2LA 1FP5A 2NW2A 3DO7B 4U0RB 1D5ZA 3C5ZB 4S1DC 2O5YL 4NQCD 3SKJH 3GSOB 1IAOA 2DLFL 2NY6C 3RWFA 5K9OA 1JFQL 1Q94A 3VDAA 4XVTL 3RVXD 5E6ZA 4N8CH 2UYLB 1IE5A 1G9MC 3D1MC 4HPYL 3V2AR 1OCWH 2G60H 4YXHH 1AH1A 2JLLA 3JTTA 5E1AB 2HFGL 1KYOK 3VXSB 4PRDA 2YEZB 4LKXA 1RJYA 4V1DB 1DANU 1EHNA 1LNUA 1G7JA 1KT2A 3PGDB 3IFLL 1A7QL 3L5XL 4NRYA 4KC3B 3O41B 3QAZC 1XGUA 4ONFL 5BRZD 3VWKA 2YA1A 1X5JA 3SBWA 3U36A 1NFIA 2EXYC 1IGIH 4Z7UE 4HT1H 3IYLW 3KR3H 4PREA 3DO3A 4DGYL 1OT2A 3MJ7A 1YNKL 1RK1A 2CR6A 5FOJA 1U9KA 2RJMA 1WWBX 4OLZH 2XA8H 1JYWA 4PJ5B 4I18C 1RD6A 4YAQB 4ISVB 3HUJF 1CE1H 4GG8A 1BZ9A 2DKMA 1A1OA 2C3VB 3UJJL 1V8HA 1U58B 2IAND 5EUOB 3EYSL 3FHAA 5CUSL 5HDQL 1XF2A 5L2JB 3FAXA 4HGWB 1EPFA 1I9JL 3QT2A 2QADD 3BIKB 1JPST 2MSPA 4O2EB 3DARA 3GMPA 4HS3B 4PJIB 1FPTL 1K8IB 2IFFL 5IFJA 2BRRL 4U1IB 5I18L 3KPLB 2COQA 3NH7H 2QQKH 2HMID 4M1GH 4KK9C 4U3CA 5E2VH 5HTSA 3C87A 4N0RA 5JQHC 4CW1A 1FLRH 1N5YH 3RVWC 4R9HA 2VXVH 3D85B 1TJHH 5KVEL 3N85L 1O7SA 4JKWA 5CIPH 1L7TL 5LJYH 4R97B 4RMQA 4HQQH 5GQBA 2R0ZH 5KG9B 5FCUH 3RP1A 3LQAH 4Z7NE 1I1CA 1A22B 2E8ZA 5C7XL 5DUMH 2E7LA 4EUPA 2CRIA 1QNZL 2YUVA 3G5ZB 1ZXQA 4I3SL 5TQ0H 2AXFB 2NMSA 5DJYB 4K7PH 4FG6C 4TPRL 4HIJA 4U7KA 1M71B 4KI1A 4ZUWB 5E2TL 8FABB 3VRJA 5CBEA 2VL5A 4L4JA 4NQVA 4OCXL 4IMKC 5F3BA 3FT2B 4YHPB 1JGUH 2E7CA 2QQLL 3MRQA 3RTQB 3WS6C 2GIYA 1GGYA 3GHBL 3CVIL 4HGKC 4OTXH 2J1KA 2D7PA 3B9KC 1MJJB 1Y6KR 3IS1X 4KDTA 4RIRB 5K9KB 4MSWB 4OFKA 2XA3A 3QCTL 1R5VA 5CGYD 3BT2L 2QQQA 5CEZH 3QP3A 4I5BB 2W92A 5DMGC 5MENB 4X6CA 3U4EB 5C0IB 5DYOB 4B7LA 4WHYG 3P3YA 2X7LB 5DRWA 4DVRH 5I1AA 5JW4N 2GK2A 4MWFB 4I0PD 5M94B 4X6DA 2ZNXA 4ZAKA 2VXSH 4R7DB 4GFTB 4QHMA 1HHJB 1LILA 3L9RA 2Q1EA 2NPLX 5IEKA 4MD4B 3ULVH 3OAUH 2P5EB 3HB3D 4F37F 3VU2A 5KSAB 1EZVY 3SDXF 3VFVB 4OB5L 1E4JA 1KCRH 4OLXH 3G6JA 4ZODA 4XVJH 3D69A 1HSBA 5E70A 1D5IL 3EUUA 3EYQD 2QR0B 3O9WB 1HXMA 1BAFH 4NSKB 3SE4C 5EZOH 3F7VB 4DQOL 2F8VA 5F96H 3VRLF 1MRFH 2R2HA 1KN4H 4XPBH 1QO3A 2C1PB 4QF1A 3KJ6L 5CFHA 5FHBH 4J6RH 4QOKB 4MA3B 1BLNA 3VXME 5HHNB 3RDTA 5F6HJ 3EO0B 4LNRB 3U7AA 3BEWA 1T66C 1LE9A 1DBBL 1OWWA 1JI2A 4U2ZA 2MQCA 5BV7B 4ZXBB 1KSRA 1F90L 3VCLB 4JJ5B 2APBA 2ARJA 3HZMB 4YIQA 1CDBA 3ZSTA 4FFZH 1AE6L 3OKOA 1KTLB 4EN3D 5D93C 1DEDA 3NZHL 2QTEA 3PHOB 1WBYA 3MRBA 4OZ4B 3DYOA 1W8NA 4POUB 3PNWB 5CJ8A 3ZE2F 5IROC 4DKFL 3ZYIA 1QFUL 4OD1H 4JY6A 2CD0A 4F33B 2BVOA 1FL3B 1MIML 3BP7B 3FO2A 3MREA 5HJ3A 3JV4B 1MFNA 5T3ZL 1Q0XL 1H3GA 3ARFA 3TYFB 1CDUA 1JYVA 4X98B 1HHGB 4LHUG 1T21A 4UUJB 5C08A 2A77H 2P8LA 3V52L 3H0TA 2XTJC 2VXTH 5F7FA 1UXSA 1DEEB 2IAMA 3VMOA 4X7SL 3GGWA 4YNYB 5IMOB 1OAQL 4RCAA 4XNQB 2IGFH 4MNHB 5I8CA 4ZS6C 4MAYC 4R0LC 1FDLH 4J3VA 5EOQL 5HI4D 4JDZA 4HWZB 3ULSA 1QUNA 2NYYD 1RZKH 5DJ8A 3RZWA 3V8CA 1FNFA 3MROB 4GUPB 1V7ML 1TCRA 2Q6WA 5IJKA 3CXHJ 1IKFH 1KJ2H 2DYPB 4HWBL 5CSBA 2J8UA 4JB9L 2FEEL 4PUBH 1KELL 3W5MA 1AR2A 2EYTB 1RIUL 3MBED 5C9JB 1SEQH 1WBZA 3PGFL 4G6FD 5E8NA 5CIPA 2YPKA 4FQXA 4ONHA 3L6FA 3S37L 1NGQH 1JZ4A 4IHOA 1WK0A 1P4LB 4XP4H 4F3FB 5D7SL 3JUZA 4LLDA 1MLBA 2O26U 4G9DA 3HTLX 2X4TB 2XQBH 2X1WL 2I27N 5I8EB 4XMKL 4Z0XA 2W0KA 3VXQA 3LAFA 1Q9OB 3G9AB 1H15A 4MLIA 1Z3GH 4Z5RA 2Y06L 3TN0A 3UJIL 3P11H 3OJDA 3LH2L 3ZKXC 5C2BL 2AJUH 3FB8B 4QNPE 3MMEA 1CICD 3U0WH 5F9WC 5H2BB 1ACYL 3EDJA 3MACL 5D71H 2P1YA 3HA0A 5JHDA 3ZDZF 3LIZH 5C0ND 3QXDB 1YEGH 2VXUL 3VFGL 4K3HA 2DMKA 4KI5F 5IVXB 4LEOA 1G7LB 5FM5M 1VB9A 2HH0L 4QXGH 2CUHA 5AZ2H 3INUL 1F11B 1XGTA 5DD6B 4L4TA 3S35H 1KXTB 1MUJB 4P59L 1U8KB 1LP9E 5KW9L 1OD9A 1RI8A 2A9MH 1MSPA 1QLFA 3OAYK 4ODXB 3W0WD 4M9OA 4APQB 1F8TL 4JFOB 1EFXA 2X9WA 4YO0B 1XT5A 4KXZI 4UIKL 2B5IC