4AYFA

Crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the tyr40ala mutation in the caf1m chaperone
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
225
structure length
186
Chain Sequence
SKEYGVTIGESRIIYPLDAAGVMVSVKNTQDAPVLIQSRIYDEPFVVTPPLFRLDAKQQNSLRIAQFPRDKESLKWLCVKGIPPVGVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDGKLIAENPSPFYMNIGELTFGGSIPSHYIPPKSTWAFDLPGARNVSWRIINDQGGLDRLYSKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/antigen
molecule keywords CHAPERONE PROTEIN CAF1M
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
total genus 30
structure length 186
sequence length 225
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ayfA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ayfA02
2K1MA 1CFQA 4RGNE 5CMAB 3VXNA 5I17A 1T22A 5I1HH 1A6WH 2C1OA 1RHFA 2Z8WC 1BREA 1D6VH 3GBNH 3UYRL 4JFDE 5C0BE 1AD9A 4X5WB 5E7FA 5TQ0H 2MCG1 1I9IH 2ZUVA 2PXYC 1A64A 1T0PB 4X6EA 1OAKH 2DLFL 4HBCH 4PIRF 4M7ZC 4HJJH 1A4JB 5DUBA 2LFGA 5DI8B 4PJ7B 4QF1B 4R6UA 2FEEL 2CO6B 3OGCA 1XF2B 1AXSB 3QFDB 5ITBH 4RX4D 4RRPG 1E4XH 1G7QB 5D4QA 3SJVD 2NX5A 4JKWA 1MCSA 4ODHH 4JRXB 1FFQA 1FFRA 4LVOC 1J1PH 4YZFE 1OTUC 2X09A 3TZVC 2PKDA 2QSVA 3GI8L 4P46D 1N2RA 3KPMB 2HTLC 4G80A 4XCEA 1UKQA 4I0PB 3QI9A 5IFHH 1FIGH 4Z7NF 3OKKB 1OWRM 4PTTB 3MLXH 1M7XA 1R3HB 4QRRB 5E08L 3RGVB 3IXAA 4HK3J 1Q94A 3MXVH 1NMCC 4JZJB 5IUSA 3UJIH 4AY0A 4X9FA 4G9FB 5IBUG 1BGXH 1CTOA 4ZUUB 4TULL 2XQYK 3MLZH 5E00A 4KFZC 4OD3L 4YFEA 4X7SL 5C07B 3DLQR 3IDGB 4YK4C 4UU9B 4D0CB 5KVFL 1L9MA 1MAML 1NMAL 1HIMH 1JPGB 4R7NB 5H2BB 2Y36L 1F4WH 1YNKL 1ONQA 2YD7A 5HGHA 5DD1L 4Y1AB 4CJ0A 5F7DB 2J4WL 1GCFA 4HH9A 2YD2A 4G6ML 1P5VA 3HE7D 4K2UL 4HDIA 1N0LA 1N8ZB 3K8LA 1BVLB 2ZOLB 1CU4H 4FA8A 5ETUB 4AIOA 4XMLL 2A0LD 5BS0B 4LEOA 1DTUA 1IC4L 1QP1A 2VKWA 3H3KA 1CFNB 3T2NH 4JO4H 1A3LL 2OTUB 5HGDA 3MRPB 3PE9A 2XY2A 1C5DA 3QWRD 3ZKXC 3U7WH 1MIML 2HVJA 1J0YA 1EHXA 4YXHL 4EXKA 4KWUA 3RUGB 1OCWL 1O7SA 3F65A 3CXHJ 2RJMA 4J3XA 2WIIA 2YD4A 4Z0BL 1XIWD 4LCWE 5I2IA 1A7QL 4X6DE 2VC2L 3INUH 4X6BB 5TE7H 2W65A 4XC1L 3VD5A 3Q6GH 1X5YA 2G60H 1MREH 2HRPH 4LSDA 2R2BA 4R8WL 3RL1B 3GB7A 3EKCA 1KF9B 5C0FB 4NKOB 3KYKH 1IM3A 1CR9L 2MJWA 4TSCH 4WFHD 2FJFA 2G2RB 5DJDA 2ZOKB 3GMNA 1M7IB 3QUYC 1BJ1H 5CSGA 1MF2H 2CH8A 2VXQL 2Q8BL 5E8EA 3PWUB 4MJ5B 4LNVA 2BX5A 2FO4B 1NLBH 4MQ7B 4EI6A 1LP9E 2ORBH 3FZUD 5IG7A 2V5TA 1NGZA 4JRWA 4J3WA 4KJYB 3TA3C 3WXVL 5I73C 3C60B 1DANT 3B9DA 4H25A 3MNWA 3T0EE 3OSKA 3E2HC 2FJGB 3HZMB 3V5KA 2OP4H 5IEHB 4NQDE 1H8NA 1J18A 3LPGA 4FQCH 2C3GA 3VGAB 2H6PB 4KDTA 3NAAL 2VITA 4UT9H 4ZNCD 4S0SD 1T0NA 3QQ3B 3TJHC 3BP5A 3LSOB 5GRWA 2CUHA 3CZFB 1VERA 4K7PX 2VDLH 1M6OA 4OV5B 5IQ7H 4EBQH 3V6ZB 2ESVE 1VEPA 4PGJA 4WTWA 4S1DC 2ZSWA 4M6OH 1KULA 5D1XD 43CAA 4I2XE 3T0VA 3QQ4B 4N90E 5C0JB 1UCBH 2Z0BA 1S9KC 1MUJB 1KPUA 2EDBA 3LS4H 4GSDH 2APBA 2WNGA 1YECH 4PLNC 2UZIL 1UEYA 1MWAB 1B4JL 2XOTA 2VXSL 2DJ4A 5C08E 2EIZA 5DS8A 4OGZA 1G7PB 2F74B 5IJKA 4GW5A 1FZKB 1MHHA 4NRZA 2XT1B 3VFGH 5J57B 2DQCH 5FYLH 1BF8A 1FYHB 3KLDA 3VWKC 4NM4H 2F54D 1LO5B 1YY8A 1N0XH 3IDUA 4M43L 4OGYL 3WL9B 4LGRB 4Q6IC 3NPSC 4ONGL 2BY3A 2DLHA 3BN9D 2QQNH 2E27H 2GJZB 1U8NA 5E8PB 4FQPA 3B5TA 4OF0A 4LGSB 4OLVL 3K4DA 1ZEAH 4PTUA 5A3IC 4F58L 1XZ0B 1UG9A 1FVEA 4WW2C 3LS5L 4LKCA 4H20L 5KN5A 4M4RA 1U2CA 4XNXL 1C7SA 1RURL 4POZC 2WSKA 3MRJA 5ALBH 5F1OB 3JTTB 3MV8A 3OZ9H 4JPVL 3RWIA 1KFAH 1XGTB 1EFXB 1BEYH 1T7VA 1BQLH 4R2GB 3VXQB 4F7TB 2V5RA 1KLFA 1QLFA 4BQ6A 5AD0A 1LEIB 4A2LA 3GJFB 4GRMA 4K71C 4L4VE 1CWVA 3EFDH 1HHHA 1IFHH 2WM0A 4FFYH 3OAZH 3TPKA 1CVSC 4OT1H 4XCCH 4EIGB 3WLBA 1S9VA 4KY1H 4GG6B 4O4YH 3VXSD 1AGFA 2YRZA 4P57B 2EIEA 1NGYB 1GC1L 5IMMB 1N26A 5DK2B 5K59E 4OZFA 2GUOA 4S2SA 5BMFH 3QPXL 4NZUH 3OBAA 1CXFA 5JW3L 3PDOA 1BZ7A 1G6RB 4LVEA 4U49A 4JHBA 1INDL 1SYSB 4TUKH 4RMUA 5JNYA 1OAUH 3NIDE 4L3EA 5F7EH 2VLKA 1FZMB 4IRSC 3U0PA 3RU8H 4H0HB 1W0YT 3KS0J 1HHKB 1SYVB 5LGJB 2V7NB 4MD4B 3KLHC 3C09C 2QTEA 3PV7A 2A6KA 1SJXA 5E5MA 1KB9J 3NH7H 4LASL 4ZXBA 2LABA 1GGUA 3ZYZA 2A6DA 2W0KA 4HUUA 2YMXL 4QXWA 1U6AL 3QO1A 3ZTNH 5BJTB 3IU4L 1WWCA 4LSRL 43C9B 3MJ7A 4JFOB 5I1KH 3WLWC 4LLWB 2NY6D 3B43A 1IC1A 5ADPH 2CPCA 2QEJA 1KN2H 2Z91A 1L6XA 3PL6D 1GHFL 2J8UF 1I7UA 3BJLA 1J1OH 4UT6H 3STZA 3UC0L 5JO5A 3VJ6A 3VGBA 4WFHE 1RUKH 1LO4L 1JZ7A 3D39B 3KHOA 5FOBB 4I77H 1OP5K 1NMBL 3S97C 4HS8H 1X44A 5KSUB 3X14A 5CJBA 3RWGB 5E56A 4YHKH 2IANB 3IAPA 1N59A 4RGOH 2RFXB 1OAQL 3GEWB 4CN6A 1IQWL 2V7HB 5C9KA 4KRPB 3OKDA 1N7ML 2R0WH 2VQ1B 1P7HL 2FYYB 5DJ2B 2GW5A 5ICYA 4YHIA 3L95A 3RTQC 3I84A 1NFIB 3IXTA 4GS7B 3ARRA 3S35X 2Q20A 3TCLA 2PTTA 1SQ2N 2VLJB 2YSSA 5INCA 3CCHB 3MRNB 3ULVF 1U3HC 5D96C 1GZQA 1BBDL 4IIQA 5L8LB 2AABH 2QR0A 1LWRA 1MQKL 5D9SB 3UPRA 3BVNA 5E6IC 1S7XA 3KPLA 5EUOF 3VW3L 2A6JB 1U3ZA 1VGEH 4MDIA 2Y06H 3CDFA 3OTTA 2Q87A 1YPZB 4XWOC 5FA4B 3GI8H 2E9WA 2YOCA 3P73A 3U36A 4ZS6D 1UJ3B 3C8KA 5CGMA 4XBEH 4XGZB 5E08H 1S7QA 2R4SL 3IFPB 3EYQC 1Y18B 4LRNL 5C0EA 5GS2H 4MA1B 1MCLA 4B7IA 2BSSB 2VQUA 1ORQB 4HHAA 1ZOXA 2D4DA 3RVTD 3SJVB 4TULH 3D85A 5J9PB 3B2UC 4P4KC 1G7LA 3DNKA 1JZ3A 1QQDA 1XGYL 4K9EL 4PJIF 3MUGB 4BSWB 2AJUL 3Q3GA 4OD3H 3SKNA 4X7SH 1NUGA 3QG6A 4MJID 5IMLB 3HPLB 1SY6A 1XGPA 4E41A 2ID5A 4OD2A 1ZT7B 5KVFH 2P5EA 1JGDA 1WBXB 5HD8D 1T5WA 1Z3GL 4OF6A 4Y5XC 4DTGL 1DUZB 4PRHE 2JJTA 3TYFA 2Y36H 3M8OL 1YNKH 2BSTA 4TUOB 4JY4A 5E9DA 3MTRA 5DMGC 4ZFFA 2UY7A 4GKNA 3G04A 3L3DA 4K2UH 4R0LA 3OX8B 3Q2CA 3VH8G 4JHWL 5EC2B 3P9MA 1X5IA 1SM3L 3AU1A 5DZNA 4Q2ZB 3ME0A 3E6HA 4XMLH 4PRDA 2X4QA 3X11B 3OXSB 2ENYA 1A9BA 4XBPB 1IC4H 4P99A 3DHJA 2VUOA 2C7UA 5E8NB 3SDDA 3CFKB 4JVUA 1QLEL 1U58A 3REVB 4ZODA 3BKMH 5CBEB 1E27A 1MIMH 4MD0A 2VDNH 3DSFL 4YXHH 3MLYL 1R24B 1OCWH 1MI5A 2FBOJ 5ID1A 1EHNA 3HE7B 4HKJB 4APQD 5E4EC 4PB0H 3BKCL 1WEJL 3AREC 4Z0BH 4N1CA 5I74B 3TPUB 2D03L 1U8OA 2Y07L 2HVKB 3MRHB 4X6CF 2WUCL 4EOWL 3ARFD 3ES6A 4POYA 1A7QH 1TTFA 1MEXL 2VC2H 4FTVA 4XC1H 3EO1B 2ZUQB 2V2TA 1CZ8H 2BVOB 1I1AA 5MP6H 3EJJX 4NO2A 3NABH 1NCTA 2M1KA 3IT8D 4R8WH 4JO1L 1NDGA 4JDZB 1UB6B 5KVEL 2F8XC 4QWWD 2CLRA 4MXVF 2CKNA 3GBML 3C5ZA 5GS0H 1AGDB 3CAFA 2XWTB 1JPFA 2XTJE 4LAJH 4PGDB 1TVBA 3DUUA 2Q8BH 5L2JA 4PBWD 4ZQKA 5IW1B 1KXVC 4WI5A 1UZ6F 1XIWB 5HDLA 2P8PB 5LVEA 4ZTPL 1MJJA 2NY4D 4PRBB 3ULSB 1ZWIA 4NQED 2Q76B 2A9ML 1WAAF 3VDBA 4QT5A 2R23A 5FYJD 2ZWLT 1MFDL 1JWUA 2EDRA 5D7LB 1NEZB 3W0WA 1EVUA 3BW9A 5H35A 3GI9L 1WICA 5IBTL 2W92A 1ETZA 1PG7W 1X5GA 4HQQL 4FQIL 3DGCR 1S7WA 3SDCA 4RISL 4PBVC 3BPCB 4F3FA 5EUKA 5CGYC 5J06A 1WWWX 3LKNA 3NAAH 3SBWC 3IDJA 2VQTA 1AIFA 5IIEB 3IRPX 4YX2H 5L88L 5EO0B 4AM0B 4XI5D 1LEGA 1BHGA 3VMPA 4Z7VF 1FAIH 3V2AR 5KSAD 1QHPA 3AS2A 3O3UN 3L3GB 2FWOB 5J8OA 4X8JA 5L6YL 1K5NA 3LZFL 2AS5M 2NLJA 4P59L 1MWAH 5FB8B 2WWMD 3HZKB 1A1OA 3WFHA 2DKUA 3QZWB 4LHJB 1H5BA 1OGAA 3ALXA 1P7KB 3VRJB 4XNQA 3DX9A 2KKQA 3IDMA 5FF6A 3MOAL 3BGFB 1S7UA 3O8XC 3QDGD 4M43H 1JPTL 4XVUD 1KCRL 2YUVA 4MZ3A 3ULUD 1HEZA 3MSPA 1EUTA 5D1XB 2H32A 5ACMA 4JREC 5KS9E 3F7QA 4XVJH 4OLVH 2J6EH 4F58H 2AEIT 3LS5H 5HGAA 4H20H 5T5NG 2XTLA 4XNXH 4QRQB 1RURH 3SY0A 3RI5F 4QHMA 3L1OL 1FE8L 5IMOB 4Y7MA 4JPVH 4PJFE 1H3WM 2XWBB 3E8UL 2F54B 1W72L 3GJFH 4WTZG 4CADA 5A16A 2EDLA 4NC2B 4LPYA 4PJ9D 5AWNL 4P2QE 3K7UA 2DL9A 3DO3A 5EN2B 4X5LA 3QULB 2C4FT 2HLAA 4MJIE 3PWNA 1S5IL 2D7OA 3G6JA 3OKLB 1EAPA 2M26A 3FFCB 4LVHB 5C0AE 2IAMB 5I8CB 3BJ91 4NDMB 1A1MB 3L3OB 3KDMA 3U48A 4LHUD 4ELMB 1S78C 3SE9H 4CDHA 5A2IH 2H8PB 2DLTA 3TIEB 5BW7C 1B6UA 1GC1H 1PYWA 4LK4A 3RHWK 4LL9A 1FQ9C 1G6RH 5I1JH 3NBNA 5DHVH 1OY3B 3ROOA 3NA4A 5FYLE 3SGDI 1IEAA 4YBQD 5SX5H 2IH3A 5JHLL 5JW3H 4ZUVB 2CSPA 1O5DT 3QUZA 5EPMA 1INDH 4DCQB 1GYAA 4QOKE 1J7VR 2IPKA 3WHE0 3CXDL 3VFWA 3DI3B 5DRZB 4MMXC 2O5YL 5MEQB 4U05A 3VD9A 4CVUA 5L2KE 4WI8A 2YWZA 3TESA 3VXSB 1QSZA 2DOCA 2J5LC 1QA9A 5I8KL 1U8HB 1DUYA 1AGBA 5DJYB 2EIBA 2GEEA 3QEGH 5IFJA 4J2XA 4Z95L 2YMXH 3G6DH 1OHQA 3L7EA 3LIZL 1U6AH 3IU4H 4LSRH 4KK9C 2FBJL 2EDTA 1K4CA 4CBPA 1KIPB 5JDSB 3L3IB 3HPJB 4YE4L 3FQRA 2GJ6A 1TJIL 2AERT 1S7SA 4NQVA 3MLSH 3KYNA 4IMKC 5DQ9B 5E94A 5IF0B 2C9AA 3QXDB 3IDXL 1BQHA 3UC0H 3BPNC 2PN5A 2VAJA 4MNQD 2B4CC 2GFBA 3ZKNC 1A0QL 1KELL 4OFPA 4WI2A 4F15C 2C3XA 2CKBL 3AS1A 1NMBH 3RIAK 3VXRA 1GRWA 4NN5B 1A4KA 4DVRL 1TPXC 1KYOJ 4C83B 3P9LB 4HAFA 4P2RA 4PJ8C 2QBWA 1FLTX 2Z31C 1DVFD 4HLZH 4P5MA 2RB8A 2NY6B 3HE6D 1MFBL 2YN3A 2D2OA 5GGSB 3HC4L 4EXPX 3EJZD 4NQEE 1C5CH 2AJXL 5ALCL 3NZ8B 1U8LA 3DXAA 4PV9A 5JHDD 3CFDA 3PL6B 4HS3A 1T7YA 4G8EB 1CL7I 1FSKC 2LU3A 3BEVB 5JMRA 2J8UB 4ZAKA 1ULVA 4O58L 3VFNA 2DQGL 2X70B 5GGUA 3BKYH 4KXZH 2FX7L 3MUJA 3B5GA 4XP4L 1XGUA 2PR4L 5ANMB 1DE4A 1F4AA 4HCRL 5JMOC 3BZEB 5E6ZA 4I1NB 4NHUB 1MQKH 2ARJQ 2RGSA 3OWEA 4LLYB 2ED9A 2ILLA 1J12A 1XH3A 3CX2A 3MA7B 4JFEE 2E7LA 1WZ1H 4OIIL 4PJDF 3QDMA 3PWJB 1I3UA 4R7DB 1LEKB 3ZSTA 1SBBA 4JGUA 4LF3A 1EJOL 5AYUL 4FQLL 5EZOL 4WGVB 5DSCA 3UBXB 2K3TA 1Y6NR 5MEND 5DMKA 2GSIB 2QQLH 3F5WB 4YHPB 1EO8L 3BPLB 4KK6C 3ULVL 3OKNA 4L4TA 2WMPA 4ODWB 3OQ3B 4LRNH 5C0RL 4NNYA 5ID0A 3JWNC 3OR6B 5BRZD 3SDXB 3V5DB 1OPGH 3ALWA 1Y0LB 5EIIB 1CT8A 3UTPD 4NRYB 2YEZA 1YY9C 4Y4KC 1FG2B 4EVNB 5TDOA 1KJ2B 1UADC 3GSVA 1WT5C 1XGYH 4K9EH 3QDGE 1NBVL 1XF5A 5SWSD 2YD8A 2GI7A 1OSPH 5FDWB 1RUAL 3QIUA 2DI9A 1TQCB 1R5VB 1AI1H 1YMMD 4KTEL 5C0IB 4GKOA 2APFA 3M8OH 4LGPB 5SWZE 2OR8A 4PJCA 5HHPB 2XWJA 4JM2D 3SE4C 4ELKB 1D9KA 1OTSC 1MY7A 2IQ9L 1KN4L 2EDXA 1N6QH 2AXFA 4U6HB 5CKGA 3FHAA 4JHWH 1V7ML 5JPNB 3CVIL 1SM3H 1K4DB 4TVPD 1HYSC 4XC3L 4PJEE 2DQEL 1AQDA 4LLVA 1UC6A 3WD5L 4PJIB 5IWLA 2DQDL 1JPST 2H2SC 3G5YA 1SY6L 1KCLA 3LEXB 4L8SC 4NSKB 1DLHB 1QLEH 4PJXA 5C09A 4JY6A 1KTRL 3MLYH 4OIAA 1ZGLB 4PJXF 3LB6D 3T2OA 5ADOL 3N1GC 3S96A 3ZE1E 5GS1C 4K55A 4X4ZA 5EWIL 3BKCH 5T3XD 4LSUH 5D5ME 5LXGL 4LPTA 2WUCH 1NJ9B 2EC9T 3KJ4B 1MEXH 5KG9A 3FO0H 4YDIH 4G8GD 3OG6B 4N0CD 4ZSOB 4JE4B 3OGOE 1G1YA 3JV5A 4JKKA 5AZ2L 3L5XH 4PB9L 5KVEH 4OGXL 5D70L 3GBMH 2BHUA 3MA9L 2ICES 2NYYD 3PP3K 3PQYB 5CEXA 5D6DA 5EOQH 4I0PC 4APQB 1F11A 4P5TD 1KXTB 3FMGH 4OZGE 5IEKB 1F6FB 2HJFA 3S4SA 4F9LC 1MFCL 4ZTPH 3I3DA 1YN7A 3E1F1 2A9MH 4URTB 3VXUD 3RKDC 1TCRB 3EFFB 4Y5VB 1MFDH 4K3JL 4KKLD 3TBYB 3GI9H 4OUUA 1I1RA 3Q1SL 4ONFL 1NGPL 4JN2A 5D1QD 4I18C 4IOFD 4FQIH 5J11B 4DOHB 2AJSL 1IEBA 1FDLL 1NEUA 1GGTA 4F37K 3FT2A 2LTQB 3GMLB 3MFFB 1MH5A 4TSAH 4G43A 1S9XB 1NC2D 2V9TA 4DVBB 3VWJC 4W6XB 3RL2B 1AR1C 1BD2A 4MNQE 4WUUE 2E7CA 5FCUL 4PGEB 2NY4B 4KVCL 5DVMA 2AVGA 1HQ4A 3QEHB 4Y5YC 3KPNB 3JV6A 1H0DA 2P8MA 2IC2A 4WV1C 3CPLA 4U33A 4DGVL 5K9KA 2Q3AA 1ZXQA 5JOPD 3FQUB 3QZWG 4UQ3A 3RX5A 5DDHA 4JFQB 5E24E 3P4OB 3KWWA 1ZSDB 1OGTB 4HGMA 4PJHA 2E8ZA 1X6NA 5JHDE 3WS6C 1TIUA 2X9WA 3WHXB 3CMOL 4KQ3H 4LSTL 4U1HA 3PHQA 3CFIC 1D5MB 5SX4H 4I0CC 4Z7WB 3QIWD 5C0CE 1JWMB 5DQJB 4EUPB 1KG0B 2Q7YB 3MOAH 6CGTA 1KBGL 4U1KA 4MA3A 5IHZB 4M7LL 1JPTH 4HIXH 2ZUSA 4K7PY 1KCRH 4R97C 1QSFD 3DECA 4LHQB 1RFDL 2BNUB 4KJWD 1Q72L 5I75B 2Q6WA 1EBPA 2VZ1A 4PJGF 5FK9B 3C6LA 1X5LA 4Y19A 4KHXL 4M61A 1UZ8B 4QTHB 2Y23A 4AQ1B 3RVVD 5GHWL 3RZCA 2I5YL 3ZKMC 3MLVL 1R3IL 3L1OH 4RMVA 2VN4A 1FE8H 3LKQA 3NGBC 3ZDYF 2VDRH 3VXTB 1RZ8B 3RY4A 12E8L 5IFAL 3WJLA 1I7TA 1W72H 4EQ3A 1HNGA 2AP2A 4Q6YA 3KS0H 2YHGA 4QHNA 1VFAA 1NGXA 2FECL 3IJYB 1CD0A 3C08L 5AWNH 2VDQL 2EDFA 3AB0C 2ZCLL 1A2YA 3PWPE 3HCVB 3SE3C 3V52L 1Q9LA 2YPKB 1WIOA 1P2CB 3RNQB 5GGRA 1S5IH 1HKLL 2G5RA 1YEKL 1BWWA 2GT9B 5IVXB 2DQJH 2EE3A 3QQ9C 3NA9L 1YMME 2MNUA 5JZ7C 1RMFL 3IDYB 3DUHA 3BH9B 2PW1A 5JIIA 4TTDD 2GITA 4QYOA 4WU7A 3VCLA 2UVFA 5JHLH 2NX5D 4FQQA 5CP7B 1T89A 5HPMA 5ESVB 4RGNC 5GSRB 3Q6FA 5CGTA 1KPVB 2FX9L 2JJVA 4UDTA 3H42L 2O5YH 2R39A 3O3EB 4YQXH 4HIEB 4CL7A 3QI9D 4JPKL 1JK8A 3KYAA 2YK1L 3AC0A 4LHUB 2BMKA 5DTFB 1LDPL 5I8KH 4WWKC 3IDNA 3TO4A 2JCCA 4O00A 4J4PD 4Z95H 2GY7B 2J12B 2WUBL 3LIZH 3W39A 5JW4M 4NFCA 5T3XE 2FBJH 2JCCF 4KJQD 3L3KA 2AW2A 5BQ7A 3PUCA 4G42A 3X17A 2XNAB 4KKCD 5DLML 4YE4H 4QNPE 1TJIH 1EH9A 3JWDL 1QFWL 2NXZB 3GRWH 2NY1C 3BMWA 1HQRB 4EEEA 4CU7A 1GZPB 4ZPTB 3IDXH 3DV6A 4JANB 4EJ1C 4U1GB 1TQBB 3CFJA 4W4OA 4HUNB 2YD5A 3CVHL 1S5HB 1KELH 1P1ZA 2P24A 1QZ1A 3PV6B 3MV7A 2CKBH 5ISZE 3VFTB 2ADFL 3HB3D 3LPFA 5FO8A 5JUEL 1OTTC 4DVRH 1T20B 3PGDA 3BP7B 1FFNB 3HI1B 3RPKA 2NMSA 1RZJC 4CAGA 3HC4H 1NUNB 4O2FB 4OZIA 2R2CA 2E7BA 5ALCH 5E8DL 3UMTA 1I8MA 2XICA 4E42A 1EGJA 1FV1A 4OZIF 4ZFZB 4FRWA 1IKFL 5H8DA 3D2UA 1JP5A 4O58H 2DQGH 2FX7H 1X4XA 4Y2DA 1MHCA 4XP4H 5IB1B 2PR4H 2ARWA 4MX7A 1IAMA 5AUMA 4HCRH 3LQAL 5F3BB 3TBWB 4XHQA 3MQIA 1DVFB 2LU4A 3KHQA 3HE6B 1T1ZA 3NIGE 4OIIH 3V4UL 5T1KA 1RZ7H 1FNGB 1L0YA 3RBGA 5JHDB 5JLZB 5DMJB 1WFTA 1EJOH 5AYUH 4FQLH 4U6XA 4H5SA 3U0TB 3SOBH 1FORL 4ODUB 3NPZB 3ULVH 1KJ2H 5C0RH 5JQHC 2CK0L 4UI2A 2FIKB 1NCNA 3R4DA 4LLQB 3AAZA 3K2UH 4NO3B 3SCMA 4U0RB 1IAII 5IHUH 1CF8H 1CE6A 5FCSH 2G9HA 1NBVH 4P9HC 3KPRA 1SBSH 5HHNB 4P4RA 1RUAH 4ORZC 3GUTA 1YC7A 3HNTL 3O45B 5T33H 2BVUA 1YN6B 2VIRB 1D5BA 5MENB 1TTGA 4KTEH 5IHLB 1HHGB 2EXYD 1LD9B 4F33A 1J9CT 5INDA 3SQOH 4MJ4A 4KMLB 4LLDB 2IQ9H 3V5HB 3D3VB 1BIIB 4IS6B 2Q86B 1QNZL 1AP2B 4IMLB 4PV8A 5C0NC 3QUXB 5ENWA 5BRZB 2HMID 5F9WB 2XRAL 4Y16C 4ZUSB 1EK3A 1V7MH 3CVIH 2HFEA 2FLRT 1EDQA 4XNMA 3CFBB 1O0VA 3BYTA 4X9BA 4XC3H 2NW2A 2DQEH 5SWSB 4M48L 4K8RD 5CCKL 5KSBF 3WD5H 2GKIA 4KGJA 2AK4A 3T0EC 3IU3B 2JB6B 3MRFB 3VXMB 2MQ0A 2P5WE 2AEPL 3M45A 1UVQA 2FSEA 4KRPC 4JM2B 3EYOB 3TBTA 1KNOB 1B0GB 5C2UB 4LCUB 1ZHNA 5EWIH 2NY5L 4PP2B 2A74B 2H26B 1OT1A 1D5XB 1PEWA 4EN3C 4GS7C 3S37L 2W1NA 5F1NA 3PG2A 3MMEB 1NFDF 5HHXL 3IVKA 1C8PA 1G1CA 4K3DH 3FQTA 1NGWB 1KTLA 1I4FB 3K8KA 4XTRD 2NX5E 5ABDE 2APVA 2GSGB 2R2HB 3W9EB 2DIJA 3PNWA 4OGXH 5D70H 4Z7NE 1E6OL 2M2DA 1BLNA 2UZXB 3OG4B 3P11L 1LHZA 2RBLA 5E2JA 4D9RE 1NL0L 4WEBH 5EO1A 5FHBL 4LCCA 3MV8D 5HYJA 1JHLL 1U91A 5SX5K 2YBRB 5IOPA 4LQFL 3HG1D 5EU3A 2IH1B 4WDIA 3TBVB 5EIVA 5D6CB 4G8GB 3BRFA 1T0MA 5H94A 2BVTA 4NQCA 1M7DA 1ZHKA 4K3JH 4XMPL 4AEIH 4E0RB 3Q1SH 4ONFH 1NGPH 3IDIA 4XPTL 1M05B 2VSCA 4G8IB 5HVHC 2AJSH 1CCZA 1MSPA 4HJ0D 5TDNA 4AZ8A 5MERA 4Z7UA 1D5ZA 4P46C 1UWXK 1MCQA 1Z9MA 1G7JB 3O4OB 1ED3A 1NPUA 2W0FA 5T1DL 4P5TB 4NQXA 5F7KC 4DZ8A 4JFYB 3T0BA 1CFBA 2JLLA 1FC1A 5FYJH 3LQMA 2VABB 1R5IB 4KVCH 4IJ3B 4PJBB 1L7IH 3N0PB 4HFWB 3VXUB 1T21B 3IJSB 3O3AB 1XGQA 1U8MB 4DGVH 5F6IB 1JI1A 4YDJB 2D7QA 4KK5D 2EDDA 5ACZA 4CVZA 3E6FA 3L5WA 2OS7A 4D9QD 2IEPA 4MJ6B 5D1QB 5C0BA 4OF7A 1C5BH 2ICWJ 3MBEA 3TH4T 3M1BA 4M5ZL 5DJZB 3CMOH 1BECA 1NC2B 4LSTH 4I4WB 5JPMA 1OQOA 1X4ZA 4I48A 4DN3L 3BWAA 3SKMA 4HPOL 3EW3B 5DJCA 3MREB 1J8HD 4H1LG 3BFOA 1KBGH 3AS0A 2CDGA 4DWHA 3ARYA 4K7FB 5IKCA 4RFEB 1N5YH 1HCFX 4MD5A 2VL4A 4JRYA 3SO3B 1E4KA 3QFJB 2IFGA 5L8KB 4P2OA 4HIJB 3I02B 4LCIH 1T5XB 4Q9RH 4KHXH 2BVQB 2EYTB 3JWOC 5L8JB 1XR9A 5E2TL 2BOBA 1VENA 3KPSA 1MRDH 5GHWH 1DLFH 1S7RB 3QDJE 3MLVH 3QIWB 4TNVF 3WNKA 1FG9C 5A1AA 3RA7L 5HHOD 3S3SA 5FO7A 3MROA 1EEYB 1QFHA 5IFAH 3I2CH 2FD6L 2UWEA 4LKXA 4K94C 1BPVA 2YUWA 4MAUL 4G6JH 1XIWC 1QSFB 3C08H 2OCFD 2FX8L 2UWEF 2VDQH 2Z8RA 2ZCLH 5CINH 5C3LD 1CFVL 4J12A 4N0FA 2Q1EA 4RAUA 5CIPB 2NQCA 5TGBB 2BFVL 4HIHA 2HA1A 2P47B 1ES0A 1I9EA 2ZKHL 4ZUWB 4GW1B 4L1DA 3NA9H 3FT3B 3FT4B 1ZVSA 3WJJA 2P42B 2NCMA 3MRCA 3TBSA 1OW0C 4GMTL 3CUPB 5D2NA 1II4E 2XA8L 4YAQB 4R4BA 4UIMB 2IBBA 4X9GA 3LHPL 5J13C 3VFSA 3CXHK 4BZ1L 1IAOA 3BQUB 3CFEA 3DO7B 2CIIB 3ZTJG 4Z8FL 4A6YB 1E0OB 2FX9H 2Q8AL 3H42H 3BD4A 1IGML 1AD9B 1AHWA 1K2DA 5HY9A 5EB9A 1NBQA 4JPKH 4CN1A 4J6RL 4QHKI 2YK1H 4JFFA 4L8DA 3QUYD 2Y72A 3U4EA 2BXZA 5DUBB 4LQ1A 1QBLL 3OF6A 3OGCB 4RQQB 3D9AL 5HDQH 4DUXA 4OCWL 3MRLA 2I26N 4LCWA 2NX5B 2MHAB 4X6DA 1ZHBB 1SVCP 1U0QA 3R0MA 1NUFA 5DLMH 4JLRA 4E41D 2C3WA 3JWDH 1HSBB 1KIQA 4XCFH 4ZOCA 3SHSA 1JTPA 3HC3L 5F1IB 5D1XC 3ARDA 1RI8A 3CFCH 3DPBA 3EBAA 1FNSL 3QI9B 4HK3N 3UTSA 2DWDB 4CMHB 1IGYB 4JDTH 5I76A 5E9DD 4IHOA 4HWBA 3CVHH 1FVCB 3B8YA 3RVXC 1NKOA 3TJHD 5DZLA 3GMPB 3E0GA 5F21B 2R1YB 2VZVA 2EZ0D 2EXWC 5JUEH 5F89B 4BK4A 3BIKB 1RUPL 3FQXA 5FECA 3TN0A 4ZNEA 5E00B 3MC0A 4YGAB 4S1DD 5HJ3B 2B0SH 5ERWB 1ERNA 4MNGA 4NC1E 3SDDD 4OCLC 5CD3B 1XF1A 4WWID 4UOW0 4ZD3L 1J11A 1IKFH 3B6SA 3GFUA 3UTTD 4XPBL 4PRNB 4MDJA 1JYNA 5HGHB 1P9MC 2BCKB 1WIPA 3JUZA 3QDAA 5I1LB 1U92A 5T1LB 1FL5B 1MI5D 5MI0B 4QCIA 3I6GB 32C2B 4HDIB 1GIGL 1F90L 2ITDB 3LQAH 1A6VL 4UTAL 1T6VN 3VXPB 2YC1B 4M7JH 5JXAL 4FXGA 4FTVD 4LEOB 5HYSA 3ZT5A 3VXOA 3D18A 1NCAL 4HV8A 4WW2F 5KSVB 3BN3B 4JAMA 5HGDB 2G75A 1Q9KA 1NANI 5A3ID 3KPQB 4L3EE 1V3KA 3V6FA 1EGJL 4U7KA 2VLKE 2F8OA 4D9QE 1CXHA 3C5ZD 3PXJA 1RVFH 3T1WA 4W70A 1GGIH 3FOMB 4POZD 4X7TB 1VGKA 2WIIB 1CDYA 4KKAC 2CK0H 5DJ8A 5FYKD 2X4UA 3MLWL 4F7PA 1P69B 1TJGL 1KTKE 5MHSD 4M6NL 1EZVX 4F57L 4YHZL 4X98A 4HXBL 1QFWM 1HOCB 4GW4B 4D9LL 4QY8B 4O2CA 4BZ2L 4UILL 3DVNA 3W0WD 3HNTH 4HC1A 4U2ZA 4N5ED 2ED7A 3AM8A 4X5XB 4QTIL 2FJFB 3SDCD 1CG9A 1F6AB 2QL1A 4PREA 5CS7A 5DWUL 4BSJA 4OQTL 1TZIA 5B8CB 2XTJC 3PJSA 5KAQF 2DN7A 4QHLA 1T4KA 4NWUL 1QNZH 3BP4A 1I9RL 4XPAL 5F3HA 2XRAH 2VXTL 3MOBL 4AENA 5CJXA 5IG7B 1NGZB 3L5JA 2OK0L 2OMBA 5MEOB 1ZVYA 4M48H 1CD9B 2FZ3A 4FMKA 4X6FB 4L4VA 2XZQL 4YHNA 1XAUA 1SJEB 4IRSD 2NY6C 2M8XA 3ARBA 5FKAA 2F9BT 3S3PA 4XP9L 4R3SA 5F7YC 3KLHD 3PL6C 2B1HH 1OGAD 4YR6A 4EQ2A 2HRLA 3C2AL 1DDHA 1T0NB 5EG6C 2HJKA 3CGTA 2NY5H 4HJGA 5I1AA 5IB4B 2DDQL 4YXKL 3M17A 2I9TB 5IVOA 5JOFA 3O6FA 1M6OB 5HHXH 2Z8SA 1IQDA 1KB9K 2EYSB 4WJ5A 5LJYH 2X7LA 3WLWD 3QISA 3HRPA 1RJZA 3BP6A 1FFOB 2IJ0C 3L6FA 1FVDB 2R1XB 4IRJA 3KAAA 1UA6L 3FB6B 5KSBB 4Y4HA 2AK1L 5I19H 1F2XK 2XIDA 3GBLA 3ZT7A 3GMRB 2CIKA 2HFFA 2YUXA 2GIYA 4X4YA 4P3WA 1E6OH 2FHFA 2EYRB 4M5YL 3P11H 1L4IA 1LK2A 5EZLA 5FGBC 5FHBH 2CRYA 1UACL 1FAKT 1JHLH 2EH7L 3WS3A 5D2LF 3GGWA 4UT7L 1MCPL 3MCLL 3SO5A 4DKEH 3GSRA 4NQSA 1HH6A 3ILPA 4MB5A 1NFDB 4M6MH 4HAGA 1FYTA 3MLUL 5EBLA 3BGAA 2EH8L 4LCYA 4PTUB 5TQ2L 1TMCB 3EO0A 4LKCB 4E41E 2NZ9D 4JHZA 2P5EE 3U83A 4N8VG 1RJCA 5T1DH 3M07A 2DMCA 3MGOA 3MV8B 1PDKA 2FJHA 2OL3A 1U3HD 4OM1H 5GGVY 5E9DE 3HG1B 1GAFL 3J8F7 3WE6A 4H8WC 1I8LA 4R96B 4MXWL 3BPOC 1KB5A 3T3PF 5E6ID 5AD0B 1WZMA 5BOZG 4GRMB 4GAJL 3ARGC 2BVEA 2QHRL 3PHSA 4V1DB 1A7PH 4PJAA 1WBZB 5DJXB 1HHHB 2R1WA 2ITCB 3OXRA 4HKZB 4WO4A 3CJJA 2G5BA 2PXYB 2PTUA 2CK2A 5BVJB 3K74B 4M5ZH 1JRHI 4M7ZB 3LMJL 5BV7B 2BSED 1JHKL 4P2CG 4HPOH 2R2EA 4FFWC 3WFZA 1MI5E 2HFTA 1M71B 4OZHA 4X6CE 3DRQB 2H3NA 1PJ9A 1S9YA 3B2UD 4KHTH 1C08A 3WN5A 3WEXA 2I24N 1JYXA 1DFBL 2X4PB 5E5UB 3SGEH 3U4BL 4OSUL 3CC5B 4PRIA 4HEPG 5GRUL 3VFVA 4FTVE 1CDGA 2GJ6D 1XR8A 2Y7QB 3AVEA 1ZT1B 2WBWB 4XNUL 2ENSA 5EU6D 3V6BR 5E5MB 2YD6A 5EA0L 1H8SA 5E2TH 3O2DA 3RKPA 4XMKL 1Y6MR 5DJAA 5DMGD 3X3FL 1NMCB 2DICA 3JZ7A 4RSVA 4A2MA 3JXAA 3RA7H 5KJRL 3BXNA 1J8HB 3K4AA 4HUUB 5B38G 4UV4H 3VXRD 2FD6H 1DANU 1AO7E 1NDMB 1QEWB 4OCRH 4MAUH 3KR3H 4P2RD 3SEPA 5FYKE 3U0WL 1CLYH 1MCKA 2FX8H 5MHSE 1HSAA 3ARFC 1RIHL 5CSZB 5A43C 4YFLI 5CEZD 4N8CH 2XZCL 2NXYD 1UFUA 3FN0L 3DXAD 4JJ5B 4ZOEA 4P23C 4NO0A 3WDIA 2ZKHH 3PWLA 1PKQB 1A5FL 1XF3A 4QWWC 5J11C 1HZHH 3LN5B 4LARH 5E0QA 1YEHL 5HHOB 3QUKB 4GMTH 3ARED 1W0VA 3X14B 2EKSA 3LHPH 1FL3B 3GIVA 3TFKC 4LLMA 4A6YH 4Z7VE 3FJTA 4BZ1H 4MNHA 1QSEA 1T2JA 2HP4A 3QDMD 4OKVB 5DUPL 4OD1L 5IVZB 4XAWL 2Q8AH 3D6GA 4DN4H 5I0DA 1EAJA 5D7IA 2VLRD 3JV4B 4KI1A 3ZKXB 2BDNL 5D7JC 2HT3C 4J6RH 5T1MB 1CBVL 1P5UA 4BQ9A 3TCLB 2PTTB 5JQ6H 2VKXA 5LGHH 5EZIL 1N4XL 4OF8A 3IFNL 2VISA 4C56D 4L5FL 1QBLH 1GZQB 5DEGA 1OGAE 4WUKL 5DVLA 3D9AH 4NKDA 1REIA 4OCWH 1MFAH 5TF1H 4JFXB 4EKXA 1RY7B 1PD6A 1J0ZA 1FO0B 3UPRB 2XY1A 5F7UA 3KPLB 4NQUA 1QOKA 3NFSL 4MDIB 5E1AB 3WV0A 4U31A 2RCSL 1UB5B 3RJDA 5C9JB 2MOVA 5IK3A 5IB2B 3CSGA 5KSAC 2Z4QB 3O6ML 25C8H 4Z76A 4YGVA 1FNSH 4IOIB 2WWMC 2AJYL 3ILQD 4WY7L 4MA7L 3QUYB 3H9HB 5AYQA 1D9KD 1S7QB 2DQFB 3R8QA 4M62L 4FQ1L 2XN9A 4O9HL 5JW4Q 5DEFB 4PJ5A 4IOSD 1F2QA 1VADA 4KU1A 3REWA 2GK0B 3P0YL 2OTWA 1DN0A 1RUPH 1GGBL 5C7XL 3VI3E 3TA3B 3O4LA 3Q3GB 3SKNB 5J1AB 3L7FA 1YEFL 2A73A 4Y88A 3O6LL 5AAWA 1HINL 1XGPB 3ULUC 4PGBA 5DYOA 1A47A 3F7VA 4YWGL 1I7RB 1ROWA 4ZD3H 2BNQA 1CD8A 5I1DA 2PW2A 3FHQA 5C09D 4BH7A 4PG2C 3VRIB 2BSTB 4FFVC 2Z93B 5IM7B 4JY4B 1Q0XL 3G6JE 4QRPB 4NPYB 3G04B 4KTDL 4HWBL 1E4WL 1FN4A 5DK0A 1F90H 3P9MB 3DYPA 5GRZA 1A6VH 4UTAH 3D0LA 1T1YA 3F7PC 3E6HB 4PRDB 5JXAH 1NCBL 2MKWA 1CFTA 2OR7A 2D7TL 2PO6A 3G5XA 3FL7A 4AEEA 4PJ9C 2O93L 5DO2D 2C7UB 1K8DA 5F9OH 3SDDB 3U82B 2DYPA 5F6HI 1U58B 1E27B 5I15L 5I30H 2C4XA 3UTTB 1QFUL 3DMMA 4HW6A 4YC2C 1YDPA 3C8DA 2VAAB 3K80A 5EBMB 2P1YA 5I8EA 4N0YL 2DQTH 4NO5A 4I3RL 2EE9A 4DEPC 4X9IA 3MLWH 1NBYA 3QPQC 4FQ2L 4HS6A 1UWGH 4M6NH 2FGWL 2LAAA 3ES6B 4F57H 3WNLA 4ISVA 3UDWC 3PGCA 3GNML 5I0ZA 2MWCA 3HZYB 4RGMC 4X7FC 3VE0B 3RGHA 3MXWH 2V2XA 4N1HB 4WW2B 2GJ6E 2FATL 1E28A 3C5ZB 1FBIL 4OQTH 1KT2B 1EFQA 4PYHA 3PIQA 1VDGA 3MV9A 1JZ8A 3IYLW 3RWDB 5L2JB 4ZQKB 2VOTA 5DRWB 4XPAH 1BD2D 1TQBC 4JKLA 2X4RA 2VXTH 3HI6L 3MOBH 1MJJB 1ZTXL 4N9GA 1TJHL 5J89A 3QJHB 1DCLA 5DA0B 1ZWIB 3VXRE 1JWUB 4P2QA 1KIRB 4ZO9A 1JHTB 3G08A 3IJHA 2HKHH 4K71B 3W0WB 1BOYA 2VDML 5H35B 1BOGB 3KPTA 2XZQH 5I71C 3ZE2F 4HWZA 4P49A 5ESQB 4HC1L 2DKMA 4N0UA 1GOGA 2JJUA 1SHMA 4XP9H 1BFOA 3RWEB 3SDCB 4C58B 1F3JB 1ZLWH 3DXAE 2DJUA 3HLAA 4F3FB 5C8JB 5EUKB 2B1AL 3C2AH 1J0IA 5IJVA 1AIFB 2H1PL 5D1ZA 5DT1L 3RAJH 4BKLA 1MCEA 5EOTB 5CSBA 4GRWF 4YXKH 4K8RH 3QJFB 4U1MA 2CD0A 1D6EB 1VPOH 4ZDHB 3VFPB 1OP3H 4JKPL 3SGKA 3GK8L 5EO9A 3HRZA 3QEUB 1UA6H 4IRSB 3QDME 2ZCKL 3C6LD 2AK1H 3RI5K 3DX7B 2I25N 4LPUA 4M00A 4EDXA 4Z77A 2X1QA 3TNNB 4OV6F 1H5BB 1I7ZB 4XAKE 2HT4C 4M5YH 3RZCD 1UWEL 1U8IA 3RIFF 2EH7H 3S36L 1PBYA 5FF6B 1I3RA 4UIKH 1K3ZA 2BOCA 4UT7H 4L4TE 1MCPH 3QUMB 4ODXA 3NZHH 1BBJB 3MCLH 5FM5M 3W11C 1U8PB 3MGAA 4PJ8D 2VL5B 1WC7A 1W0WA 1KYOK 2EH8H 3MYZA 2VE6B 5TQ2H 5HGAB 3G5VA 4M1DL 3K1KC 3X13A 2Y5TA 3OKYA 4NN6B 4JO3L 1J1XH 1QRNA 1T7XA 1UM5H 4OFKA 4QHMB 4L9LC 4QRTA 5D7SH 2O61A 5D7KD 4X7CC 4PBXA 5FDYA 4PJCE 4XXDA 5EBWA 3UTZA 3IFLL 3GSXA 3H3PL 1IKNC 5A16B 4CADB 5LBSL 3TNMA 4MXWH 3T8XA 5D2LB 2VXUL 3L3HA 4GAJH 3CSBA 3MRKB 2QHRH 2V2WA 5IB5A 1ND0B 4MAYA 5JXEC 2ZJSL 2AV1A 4TYUA 1KJMA 1JNNL 2KZ1B 3U9PL 3T1FB 4OZFG 3GJEB 4PR5A 3KDMB 3VRLF 4PJXE 3T0AA 4UUJA 3LMJH 3VU2A 1JHKH 5C09E 3STLB 2ZSVA 1U3HB 4JM2C 5D96B 2AXHA 2J8OA 2OL3L 5IQ9A 4WI3A 4Y4KD 1WWAX 5FKPA 3SPVA 3CH1B 5E6IB 4O51A 5EPMB 3K1DA 3SDYL 1KB5L 4JO2L 1HHIA 4JQVC 4MMZC 4OSUH 5GRUH 5KVMC 4LPCA 1MFEL 4HWEL 1HXYB 3DX6A 1UQSA 4MSWB 1PZ5B 3GSNB 5AZEL 4RFOH 5C0DB 4HGWB 4LNRB 2W9EL 5EA0H 3RY6A 1H15B 5F88A 1ZA6B 1S9WA 3UEZA 2HG5B 1QG3A 3KNBA 3X3FH 1YEGL 4F9PA 5KJRH 1KENL 3MFGB 2ZZUT 3PP4L 5KANG 3T65B 3L7EB 2NTFB 4UV7L 5CMAA 4TRPL 5SV4A 2E9JA 2ERJC 5CZVL 1KLGB 1RIHH 1V3JA 3FQRB 2GJ6B 2XZCH 4OZ4B 1C1EH 2H2SD 4X5WA 3FN0H 4HXAH 3KYNB 5DC0A 3K81A 1H3XA 4GG8B 5EU6B 5DVOA 4HKXB 5SWZA 2UV3A 3D2UD 3H9ZA 1A4JA 5DI8A 2GFBB 4QF1A 4Y2DD 5ILTL 1KOAA 1XF2A 3QFDA 4FP8L 3V4VH 2CRIA 2NYYC 1G7QA 4PJ7F 2NY0D 4F7CA 4IBLT 4JRXA 4P2RB 4ZFGH 1BD2E 1LO3L 4GMSL 5KW9L 1RUML 3HS0A 4IJ3C 5T1KD 3QCTH 3KPMA 4OD1H 1G9ML 1X4YA 1MHPL 3DXAB 4IRZL 4PV9B 4ZO6A 4HS3B 5F6IC 1IGJB 3V6OA 3OKKA 2A9NH 2B8OT 3N50A 4KKLC 4PY8J 4QRRA 1R3HA 2BDNH 4WFFD 1FL6B 4YBLB 4J1UB 3RGVA 4KDWA 4JZJA 4IOFC 3GMQA 4PJHE 1I9IL 1MPAL 1XGUB 1N4XH 5HGBB 3IFNH 4G9FA 5E4EB 1DE4B 1H8OA 2VZOA 3AREB 4L5FH 2P4AB 5HHVH 4KMTH 4HBCL 4XP5L 4UNTA 3T4YB 1GVIA 4J3VA 5C07A 4G8FB 5C70A 1ZV5A 3QG7H 3RKDD 3QDMB 5ITBL 5JORB 4UU9A 3KPRD 5C71A 1E4XL 3NCEB 2RCSH 1CLOH 5E7BA 4CU8A 5B39A 4YDVB 1IAKB 1JPGA 3O6MH 4ODHL 1IRAY 2VLRB 4R7NA 5H2BA 3SO3C 1J1PL 1QBAA 2VNCA 3FQWB 4LIQE 3O2WL 4CW1B 5DMKB 2JJSA 2BNRD 2AJYH 4WY7H 3UTOA 1S7VB 3EJYD 4KQ4L 2D0FA 4Y19E 5K93A 4M62H 3QEQB 4FQ1H 1BVLA 5BCAA 2ZOLA 4C56B 1AR1D 3MLXL 5CWSB 4KUCF 2NZIA 5ETUA 3MODH 1XCQB 1PG7L 5BS0A 3P0YH 3MXVL 4I3SH 3TIDA 1NCUA 1RK1B 1DQDH 2GTWB 1GOFA 1CFNA 2C4FU 1YEFH 1BGXL 2OTUA 3I85A 3QXAA 1HINH 4XXCA 2AK4D 1QBMH 3MRDA 3BESR 2DLEA 5IBUB 1EEZB 3BD5A 3RUGA 3NCJL 1JWSB 2XWJB 2IGFL 3PXHA 1D9KB 2WAHA 1PQZA 4FQXC 5HTSA 4WUUA 4HIIB 1OB1B 1TETH 1KJ3L 4Y4FC 2W9DL 5FA3A 1AKJA 1AQDB 4WHYG 3A6BL 3RL1A 2FDBP 5F97E 4XBGA 5C0FA 3I9GL 1WWBX 1NC4A 1TNMA 3DBXB 2G2RA 4WNQA 4P5KA 4DZBB 5I15H 3DROA 4UDUB 5C09B 1QFUH 2N7BA 3W2DL 3ROLA 1DJSA 4MJ5A 5DR5H 2WBKA 1SVZA 3U7WL 1KGCE 4N0YH 4I3RH 5E70A 1CDIA 5C0CA 3O3BA 5HYJD 4GBXA 4BM7A 4HUMB 4MQ7A 4FQ2H 1WFOA 4RFNC 1I1YB 4PG9A 1JVKA 3C60A 1EJ6A 1MAJA 3S37X 2JCCE 2D4FA 3CK0L 4TTDC 4XRCA 5DURD 4NQCD 3U4AA 1HI6A 5GRXG 1WIUA 4JREB 4GUPA 4ZYKB 2FJGA 4MLIA 3HZMA 2ZP0T 5LCVL 1YNLL 3HHRB 3A0OA 3QH3B 4XB8A 1G9NL 5IEHA 4DQOH 3EOAB 4WFEE 4EZMA 2NTSP 2R0LL 1EEUA 2FATH 2ZPKH 4ZFOB 3QQ9D 1UXWB 5CEXB 3LSOA 4TSCL 1R3KA 1XF4B 3QI9C 4Y8DC 4JPWL 4G6AC 3CZFA 3T4AB 1V5JA 1YEIH 4JPIB 3U6RB 4OV5A 2HJFB 3V6ZA 1ZTXH 1TJHH 1YN7B 1F97A 1EZVY 3MV7E 4HK0A 2ZCHH 3HUJA 3QQ4A 5C0JA 3WKML 3PWPA 2DQUH 2VDMH 3RWHB 4OUUB 1Z6JT 4UNVA 4F80A 4WENB 1MWAA 5C0BD 4OZIE 3MBED 3S3JA 1G7PA 2F74A 3NACH 1MH5B 2B1AH 2H1PH 3BEWB 4WWKD 2OR9H 4ZTOL 4FQCL 1BD2B 3MJ6A 1ZK9A 3WL9A 1KUMA 5ICZB 2HKFL 1WTGT 1BF2A 2BSRB 3MZTA 5TJWK 4YZFF 1HKFA 3A67H 5K9KB 3HB3C 4M1GH 1WQVT 2GJZA 4JRYD 5E8PA 5IW6A 5T5FL 2VDLL 4XCYB 1AGEB 3ZDZF 4EBQL 4JKPH 4QRUB 2PETA 3GK8H 1NBZA 4P9ML 1AJ7L 3DUSB 3WSQH 3KWWB 2NY1D 2QSCL 2C3VA 3FO2B 4NFBA 2UZYB 4PJHB 2J6EA 1UCBL 4MQTB 2APTA 3TWCL 3C6SB 4DGYL 3LS4L 4GSDL 3JTTA 2J5LB 4U1HB 5I1CL 1UWEH 3QUMH 1EFXA 2JELL 2CLVA 1QTYT 2Q7NA 3O2VL 3VXQA 4F7TA 4DFHA 1OTTD 4JB9H 2QHLA 4S11A 1LEIA 1WVZA 4H0GA 3WUWA 3GJFA 4Q0XL 3DVGB 2OSLB 2P45B 2BVPB 1MVUB 1N0XL 2Y5EA 5I16A 1BJ8A 5E1HB 2Q6WB 2CO7B 3MZGB 3C6LB 3AXLB 3KPRE 3EYVA 2B4CL 4M9PA 3RZWA 2QQNL 1V7NL 4JY5L 4P3CL 4P57A 4RAVB 1NGYA 4GG6F 3RQ3A 5IMMA 3BPNB 1ZEAL 2L7JA 5DK2A 3RZCB 3ZKQD 1JGLL 4XNYL 4OF3A 4AEFA 5EU5A 3HMXL 4F15B 2GK2A 3BISA 3H7BB 3ARPA 3IFLH 1G6RA 1TPXB 5LBSH 5DHVA 1SYSA 4PJ8B 1NGXB 1A22B 3OKOB 1DQTA 4XWGH 5CLTA 1Q1JL 2X4NA 2XQBL 2YPLA 5GGRB 3MRQA 1SYVA 5LGJA 4MD4A 4OFVA 4OLUH 1JNNH 3DX8B 2J7LA 2XZAL 2AK4E 1GOHA 1KIUA 2CRMA 1FSKB 4C4KT 3EFDL 4NJ9H 4FFYL 4OT1L 3RVWD 1C16B 3CLFH 1HK6A 1VSCA 1I3GL 4W6WB 3MCKB 2EC9U 2CMRL 3HAEH 5BJTA 5DMYA 1P4BL 1IEHA 4KDTC 2OL3H 3VCLB 2PNDA 4JFOA 5DJ0B 4LCWD 5I1EH 3G6AB 4LLWA 3C5SB 2DL2A 2HMIC 1J10A 1GL4B 3IKCA 3LEVL 3K46A 3OKEB 5BMFL 3FAXA 3TJEL 4JO2H 4NOFA 4JDVB 2EDEA 3GSNH 1MFEH 4UDTB 1JNHB 4RWYL 4O5LL 35C8L 5KTEL 2ADJB 3TT3L 5FUCC 3ARDD 2PCPA 3QNYB 5F7EL 5AZEH 4NRXB 5HI5D 4BJLA 2BMKB 2EC8A 2V17L 5M95B 2A2QT 1I8IB 3D39A 5ESAA 1YEGH 4Q9QH 5KSUA 5C0ND 3KPOB 1KENH 3FB7A 4YO0A 3RWGA 4Y16D 3PP4H 5IJKC 2IANA 1WBYB 4Y4KB 5HYJE 2RFXA 1IGIH 3VA6A 4UV7H 4TRPH 3EDEA 3TN0D 5BQ7B 2V7HA 2X9XA 5CZVH 2YD1A 2R8SL 1QBBA 2NY2C 2VQ1A 3ZTNL 4WI7A 1BQHG 2FYYA 4OBSA 5DJ2A 3MRGB 3T0ED 1CFSB 4NQCE 4XTRC 1KCVH 3GSQA 1KN2L 2VB5A 3EDFA 3QYCA 4WFGE 7FABL 2VLJA 2ZNXA 4ZO8A 1KSRA 4Z7UE 5ILTH 5J3HD 4FP8H 1UT9A 3VDCA 5BZDB 2AEWA 4UT6L 5D9SA 5FO8B 4EN3D 5BXFB 3PGDB 5T3ZL 2A6JA 3ZE0F 3MNZB 4I77L 2ESVD 3HR6A 2KDGA 1JJUA 1YPZA 4HS8L 1YUHA 1RK0B 4N90D 4D0BB 3SDAA 1MHPH 4IRZH 1YPZF 4NC1C 4RGOL 1UJ3A 3DETD 3KPPB 4L8SB 1FV1B 3F62A 5FHAL 2P5WA 2H9GB 1CGUA 4FXKB 1JUFB 2R0WL 3D2UB 3VG0L 2FRGP 5C08D 4HJ0C 4Y2DB 1MHCB 4CMMB 1MPAH 5GS1B 2BSSA 3LPWA 5EIQA 3FOLB 3T0WA 1ORQA 4NUGH 4RCAA 2NY0B 3SJVA 4XP5H 3UZQA 5BV7C 4MCZB 4BSWA 3HPLA 1T1ZB 4OIBA 4OF5A 2AABL 4HLJA 4FOMA 5F7HA 3CSYB 1DUZA 1WISA 4XVTL 5C6WH 3GIZL 4JRYE 3N85L 4U6XB 4E5XB 1VGEL 4LEXL 3O2WH 3EHBD 2Y06L 1DP0A 4KK5C 4TUOA 2PYEE 3F12A 3P4MA 3Q5YA 4KQ4H 4HWNA 4X7EC 2H45A 5EZJB 5EC2A 4G3YL 4XBEL 3S88L 2DB8A 2Q3ZA 3KPSE 4Q2ZA 1PG7H 3VGGA 4ZXBC 3X11A 3OXSA 3AAZB 3OJ2C 4XBPA 4W6YB 3GO1L 2XV6B 4O2EB 2G9HB 2UWEE 4U1SA 5E8NA 2E9BA 3GUTB 4HSQA 4L4VD 4MWFA 3REVA 4OI8A 4S1RH 5CBEA 1EX0A 1A7NH 3U9UB 1RIUH 4I18B 3ARBD 5F7LB 2BNRB 1R24A 3NCJH 3LKOB 2IGFH 4HKJA 3HE7A 5K59F 2UUDK 1IL1B 2NY7H 2YR3A 3TPUA 5GZOC 4PV8B 3VWJB 5ENWB 3TLRA 4DAGH 4PLOB 1WZKA 5KBNC 5JOEA 4NWTL 1KJ3H 4Y5YB 2W9DH 1JGEB 3B2VH 2BVOA 4WV1B 5D2NE 2VDPL 3OB0H 3A6BH 1IVLA 4MS8C 3MJ8B 4JDZA 1UB6A 3QWRA 4IRJD 4KI5D 1PX3A 3I9GH 2E3VA 3VH8B 5I8OL 1UVQB 2XWTA 1MFNA 1KACB 3W2DH 5FYKU 1JMXA 5IW1A 3BKML 1F8TH 2VDNL 3FTGB 1LQSR 4JFFE 3ULSA 1NCDL 1YJDC 5HI4C 4Y2OA 5F1NB 2B5IC 2Q76A 4AIZA 4ZPVB 4PB0L 4R97B 4IIQC 5D7LA 3NFPB 2YRLA 1WV7T 3CK0H 4X8XA 1NEZA 1X5XA 2YA1A 2P48B 4ORGB 5LCVH 3U79A 1YNLH 5J56B 1G9NH 2EO9A 1CZ8L 1LE9B 5MP6L 2YKLH 2J2ZA 2R0LH 3NABL 3KLAB 3F6IA 3LKSB 3S4SG 3MV01 3CNKA 4K7PL 5EO0A 5BZWB 1CIUA 4KJPC 5FV1L 3BO8B 3QDJA 3UTSE 4AM0A 4JPWH 1MLBB 5HYJB 1MJUL 3NGBB 5GS0L 4OBRA 4OLZL 1HDMA 1CDCA 2FWOA 1K6QL 4GAGH 1T0MB 3FRPA 5DURB 3AB0B 3WKMH 3BZFA 4NQCB 1ZHKB 5FB8A 5GRJH 4LBEA 1TENA 4PY7B 4ZNEE 4KUZH 2A6IB 4WO4D 3S6CA 1B4RA 3WIIL 4MNGE 3KYOB 4OCYL 3QIBA 1P7KA 2JJTC 3VRJA 2N56A 2W0FB 4NQXB 4ZTOH 3DVFA 1ITBB 1L6ZA 2HKFH 1X9QA 1B3JA 2L7UA 4YX2L 1NAMB 4AIXA 4PUBH 4KKNA 4R0LC 4Q7DA 2EZ0C 4X7DC 1K8IA 4RGNB 5T5FH 1DQML 5GGTL 4YLQT 4GQ9L 1MCRA 4L4JA 4U0QB 4C57C 4PRID 1ACZA 1FAIL 4P9MH 1AJ7H 5C2BL 5KVGL 4JFDB 2QSCH 5C0BB 1U8QB 3I6LE 2J1KA 4TNVK 1MWAL 2VXVL 4QRQA 3TWCH 3SDDC 4DGYH 4BFEA 5I1CH 1Q0YL 5IMOA 3U1SH 1AD0B 3NN8A 2EE2A 4WWKB 2JELH 1G0YR 4I48B 3RVXD 4GRWH 4MJ2A 3BWAB 2F54A 1GXEA 3O2VH 4B5EA 2QSQA 2IWGA 2EXWD 3P30L 2KPNA 3DYOA 1KEMH 2X2YA 3FO9B 1P6AB 1W72A 4Q0XH 4YHOL 2F5AL 3TEUA 4JRYB 3U30C 1IT9L 3QULA 1IM9A 3UYPA 4W68A 5I66A 3OKLA 5K9QI 3FFCA 5I8CA 2NY1B 2IAMA 3DTXB 1I1AC 2B4CH 1A1MA 4NO0D 4PRHD 5FGRA 1V7NH 1QR1A 4JY5H 3OL2A 4P3CH 4ELMA 2H8PA 4RA3A 4XVJL 3TIEA 2BOBB 1AQKL 1NLDL 2J6EL 1EMTL 1JGLH 2X89D 1QPPA 2P44B 3LVEA 4XNYH 3IETB 3RNKB 4ELMF 3HMXH 3C5ZC 5FO7B 3MROB 1MJ7H 5DD0L 4DCQA 3ARQA 4AT6A 1QSED 2B7DT 3RWCB 4GLRH 1Q1JH 3NFNB 2XQBH 4IDJH 4R90L 4HIHB 2BRRL 1P7QD 3VXSA 2XZAH 3OPZH 1U8HA 4N5EC 1ZVSB 5FIEA 5DJYA 3SDCC 3MRCB 1I3GH 4KKAD 2CMRH 4PGZA 5C86A 3FB8B 5E2VL 3SE9L 1P4BH 3H9SA 2DIAA 4R4BB 2WIMA 3Q5OA 1KIPA 1G6RL 5JDSA 3LEVH 5I1JL 3L3IA 1RZKC 2X44D 3TJEH 2IFFL 3SE8L 5DQ9A 1HILA 2VSDA 4FHBD 1B0RB 1CN4A 4RWYH 4PPTA 4O5LH 35C8H 5KTEH 1KCSL 3TT3H 3C5JB 5DRXB 4M3JA 2F5BL 3GRWA 4KI5E 5HVGB 4L8DB 2V17H 1I85A 2XTJD 2CRZA 3U4EB 3JTSB 1CXIA 4YIQA 1CGSH 1OARL 1H5BC 3R1GL 2X1WL 3H9YA 4P9HL 2CKBA 2L4OA 2X9YA 4LCWB 1ZGLP 2SEBB 15C8H 2X4OB 4X6DB 5GGSA 4AL8L 4G9DB 3O4LD 3QEGL 1H9VA 2R8SH 3G6DL 2RAMA 3EGSA 3T77A 5DGQA 4JLRB 4S10A 4GOSA 3S35L 4G8EA 4KC3B 4GFTB 3BEVA 1FYTE 2J8UA 3GSUB 2X70A 2XFXB 3WHE1 7FABH 3MLSL 1OAZH 1TLKA 5ANMA 1J05B 5GXBB 3BZEA 4Y16B 4NN6C 3MA7A 4GH7B 1LP9B 2X1PA 4HCRA 4FNLH 4QHUB 5T3ZH 3PWJA 1ZLUH 3RDTA 3TN0B 3T3PE 3KG5A 5F1SA 2PO6D 5JDJA 2BP3A 3WNPA 3T0EB 4MNGB 3UBXA 3CX5J 3BRGC 2DYPD 4LLUA 4UNUA 2GSIA 5FHAH 1OF2B 4G7VL 1C5CL 4NQDB 4PJAE 4F7MA 2B2XH 3BH8A 4JEGB 3VG0H 3DMMD 1T03H 4NZTH 2DTSA 4MCYB 2NZ9C 3V5DA 4XVSH 3SDXA 5FFLA 2DM4A 5CJOH 3ZHDA 1Y0LA 4M93C 2YRPA 2QQQA 4NRYA 3IGAA 1FG2A 4HGKC 4EN3B 1KJ2A 4RAHA 4EVNA 3SDXF 3BKYL 3LKPB 1XMWA 4FFZH 1WF5A 1UM6L 4G7YH 4DKFL 4RMSA 2ESVB 3MACL 5HYSB 5KS9F 3NOIA 1RHHB 4OZHE 5FDWA 4NYLB 5EUOA 4I2XB 4HV8B 2NR6D 3DURB 3WO3B 1R5VA 5HYQB 3P0VL 1G84A 3QUZC 4XVTH 5C0IA 1WZ1L 1R5WB 3GIZH 5EU7C 3N85H 1X6LA 3QWOB 2EDQA 4LEXH 5HHPA 4PRIE 4LAQL 4ELKA 1MCNA 5HPOA 3IS1X 5C08B 1YQVL 4U6HA 1VGKB 5J6GB 4G3YH 5JPNA 1VFUA 2QQLL 4I0KA 1X7QB 3S88H 4W81A 1K4DA 4F7PB 3D0VA 3DIFB 4I5BB 1F42A 4X98B 5HDBF 2E9IA 1IGTB 2X4SA 1MCWW 3GO1H 3MRMA 4XNZC 1OPGL 4PJIA 4LFHD 4P2QD 5SV3A 3LEXA 4Z5RB 4NSKA 4LP5A 3ARGD 3DVNB 1DLHA 5C1MB 4YHMH 2GAZB 1RZIB 2X41A 4JQXA 3QNZA 5HVHB 4R26L 5CHNB 1OSPL 1FNEA 1ZGLA 5C0AD 5M7QA 5I18H 4P46B 4JN1H 1TZIB 1UXSB 3PJSB 1AI1L 4QHLB 5D1ZD 4LOUC 2MQ3A 4NKIL 1FIEA 4FFWD 4AENB 4NWTH 2E6JA 5FYLD 3GZKA 2XQYG 4ZUTA 1N6QL 3VI4F 2FH8A 2VDPH 1JZ5A 4ZSOA 1ITCA 1JGVH 4U1LB 4YDLB 4RIRB 4QOKD 2FZ3B 5HGGS 4PLJD 4L4VB 2VLLB 1QSEE 4L3AA 3UJJL 5I8OH 1EERB 3WFCH 5HHMD 4OB5H 2NXYC 4R3SB 3PQYA 5L2KD 2IBGA 5D7IE 3LV3B 4APQA 5L0QC 2HJLA 5IEKA 1DDHB 4YBLC 1VB9A 5J7CC 5I1AB 2ATPB 4NCC1 4ZAKC 1NCDH 2J3SA 3VFRB 3W82A 4GXUM 4GKZB 1LE5B 1AGCB 1TCRA 4X6CA 2IG2L 3TVMA 1IQDB 1VKXB 3EFFA 4Y5VA 4WJ5B 4IM8A 4OFDA 4LSUL 1L0XA 4LRIA 4XT1C 3RY5A 3TBYA 1RJZB 3BP6B 3RP1A 5ECJE 5JW5B 3L6FB 2LVEA 3JWOL 1FRGH 1OAYL 3FO0L 4IRJB 5IVNA 2E7LC 4YDIL 1DEDA 3GMLA 4P23D 2PYFA 3MFFA 4G6KL 2ADGB 1TCMA 3CMGA 3QHTC 1S9XA 2CIKB 3VFMB 4DVBA 4K7PH 4NCDA 3L5XL 3RL2A 1I1FB 3A6OA 5GSVB 3EZ8A 1QRND 4MQSB 5JIPA 4PLKD 4PGEA 1MJUH 1U8KA 4QEGA 3GGWB 1H3GA 4OLZH 3WKNA 3KPNA 5EOQL 4XHJD 2CDFB 2NNAB 2W07A 5E99H 1AO7A 2XN9E 1QLRA 1A7RH 3FMGL 4PJ5E 2JKXA 3TFKD 1K6QH 1V3MA 3GSRB 1JL8A 3FQUA 3O11B 2AQ2A 1WAAA 4JZNB 2HLFD 1INQA 1EXUA 2HWZL 4JFQA 5IT2H 3P4OA 3O4LE 1OGTA 3SN6N 1GPOH 1A6AB 4MAYD 4LCYB 1H3VA 3WDJA 1LNUA 3WHXA 3QIUC 3WIIH 5DGRA 2ARJB 1S3KH 5D7JD 1D5MA 2HT3D 4OCYH 3I3EA 1BX2B 5JR1L 2BNQE 3GHEL 5DQJA 5E2WL 2ZG1A 4X4XB 1GGYA 4CVWA 4EUPA 1KG0A 1NAMH 3ILQC 2Q7YA 1CDBA 4Z7WF 1MCOL 5IHZA 4TSAL 1D9KC 5C6TH 3WE6B 1CGWA 2NY5C 2IALA 4U6YB 5GRYA 1PY4A 4BFIA 4CUCA 4MHHI 5J13B 5HHQB 2BNUA 4RMTA 4Z7VA 4JFED 6FABL 5CFHA 5J6HB 1DQMH 5GGTH 4GQ9H 5E5RB 5C2BH 2R1WB 5KVGH 1UZ8A 4WO4B 2JIXD 5IWLC 5H37G 3T2QA 3WNMA 2VXVH 2FHCA 4Z0XB 1Q0YH 1CGTA 5TH2B 1A8JH 3VXTA 1RZ8A 2AEQH 1RQ5A 3AY4A 1BFVH 3J7HA 3QO0B 4KQ3L 3P30H 3DV4A 5FM5O 3V95A 4JFPB 3LN4A 3HCVA 4YHOH 3WN5B 3WEXB 2F5AH 3ULUF 1F4HA 2YPKA 1IT9H 4U1JA 1SJHB 4HIXL 1XR8B 4PP1C 5FGCE 2GT9A 5IVXA 1A6ZB 2D0HA 2YPVL 5B3JE 1C12B 5DO2C 1EVTC 5SWZD 5EU4B 3HZVB 1CICA 1AQKH 5IVXF 1NLDH 1HXMB 1EMTH 1M1SA 4FFVD 1Y6KR 2R0ZH 4X99A 3EYFB 2OQJA 2DD8L 3BH9A 2A1WL 4EI5A 3BXNB 3BDBA 5EORL 3MV9E 5D6DC 1RZJH 3I3BA 5GRVL 5CP7A 4PJEF 1VEOA 5DD0H 1Z0MA 3D69A 5ESVA 4KZEL 2XKUA 2VDRL 5GSRA 2QADC 5DD3L 2QJDA 1P4LB 5ELIA 3O3EA 4R90H 4U3XA 5DQDH 3ZE2E 2BRRH 4NO0B 4PRHB 4LHUA 1XF3B 2UYLA 4N0UE 1WFNA 5CUSL 2DQJL 3MRIA 1TITA 5E2VH 1CDJA 3QPQD 5GS2D 4RNRA 1L7TH 5TDPB 5B4MD 5C07D 4BYHA 2OZ4H 5IV2B 4MNHB 1QSEB 5ACLA 2IFFH 1TZHA 3SE8H 3SGJA 4I3GA 1NCCL 2AJZB 5D7IB 1P7QB 3GM8A 1KCSH 1GZPA 2NPLX 4I8DA 4ZPTA 3HMWH 2F5BH 3AMKA 4Y8AA 3U2SB 2IADA 4YQXL 5HHME 3PV6A 3VFTA 1OARH 5IROA 1F6LL 1T20A 2AKRB 3CVHA 3HN3A 3R1GH 4NBXB 4EIZC 3BP7A 4P9HH 5BS0D 2BVYA 4Z7QF 4QGYA 4AL8H 2EEAA 1OSZA 3LRSB 3EOTL 4O2FA 4BFBD 2WZPD 1JTTA 2EECA 3BAEL 1TZGL 5IK3B 2X42A 1Q9OA 1U8JB 3S35H 1KJVB 4Z76B 4YGVB 1CLZL 1JMZA 2VR5A 1QACA 4PFEA 3CLEL 3GRWL 3WIFB 3C6LC 1NUDA 2XTJB 5GGRY 2D9QB 1XGRB 5F3BA 1Q9WA 2XXCB 3TBWA 4D0DA 4X0KA 1UCTA 4BZYA 5TPWH 4WUUD 3RZCC 1VADB 1DVFA 1KTDB 1QRNE 2VDOL 5KOVC 4MXQC 3HE6A 1T66D 4R4ND 3T3MF 3P0GB 1AKJD 1FCCA 1Q38A 1B90A 1FNGA 4ZOBA 3WJLC 1F00I 3BWUC 3X3GL 2A73B 5I9QB 4PGBB 3PHOB 3F7VB 1NC4D 3U0TA 1NCWL 2DRUA 3VFUB 4G7VH 4ODUA 4BH7B 4XZUB 1X5ZA 1YNTB 3VRLE 3DOSA 2HT4D 3ELAT 3FQNB 5E95B 1MLCA 4FQHB 5C0CD 4GBXD 5HYSG 2VZUA 1P4IL 4LLQA 3OHXB 3GMMA 4YPGB 3B4NA 3C60D 4DKFH 1UM6H 3W11D 4PY8I 5CZXC 3MACH 3OJVC 5HHNA 2GY5A 4PJDA 5FM8A 4PGCB 1YN6A 3P0VH 4MA8L 1T89C 2DYPB 1S7TB 3P2TA 1LD9A 1RZ7L 2F53A 5LQBL 4LAQH 4LLDA 3AROA 1BQSA 3D3VA 3DMMB 3GMOA 1YDPB 1YQVH 2Q86A 4IS6A 1AP2A 4U1NB 4LPWA 3QUXA 5C0GB 1ZA3B 4NO5B 4ZUSA 4OLWL 4KK8D 3SOBL 5K9QG 1NBYB 1T83A 5ITFB 3QR2A 3CFBA 4HS6B 3VGDA 5GISL 1KJ2L 3B3IA 5SWSA 4M7KH 3TO4C 5DHYB 1A7OL 3IU3A 3PWPD 3MRFA 3CU7A 3VXMA 1E6JL 4ESKA 3K2UL 5KS9B 5IHUL 1CF8L 1QVOB 4WU5B 1YMHB 3BUYA 4TUJA 1SBSL 5JXED 4R26H 1AXIB 3EYOA 1XFPA 1U93B 1BJMA 1B0GA 1KNOA 3LKRA 4KKBC 4LCUA 5BOPA 5T33L 1F3DJ 2HN7A 3PIQB 4PP2A 4JM2F 2A74A 3L5HA 2H26A 1NKRA 4U3HA 3VMOA 2YA2A 3SQOL 4NKIH 4PJFB 1MRCL 3MMEA 4W4OC 4PJ7E 1NGWA 1I4FA 1KLUB 3BPOB 3GSWB 2EDWA 2VUYA 2V5SA 4P2QB 2JTDA 2FEEI 3IJHB 4JRXE 1DBBL 3ARGB 5JW4R 2GSGA 1CQKA 2OBGA 2R2HA 3LQZA 3W9EA 1G7IB 3FRUB 4MJIB 3UJJH 2GQHA 3RIFK 2Z92B 5C0AB 3QHFH 3B9KA 1WFUA 5J0BA 4ODSL 3V6OE 3HLAB 4QRRE 2I27N 4NKMA 5IJVB 2VWEE 3ARXA 5D1ZB 1A6UH 3TBVA 4BKLB 2IH1A 1N3NB 5D6CA 3IKKA 3H0TB 4R2GD 3BD3A 2WANA 3O3DB 4Y2DC 4N9OB 4G8GA 2IG2H 4GAYB 4G9FE 2X1XR 1YEEL 2NY0C 4BH8B 4OQ1A 3MO1B 4E0RA 3AGVA 2EDHA 4QOKB 3ESUF 5C07E 1M05A 3JWOH 1OAYH 5EO9B 3HRZB 1ZLSL 4K3DL 1WGOA 3JV0A 3TV3L 3EYSL 4HMEA 5HHMB 4KPHL 4G6KH 3RPIA 4EDXB 1G7JA 4OI9A 5L2KB 3NIFF 3OAZK 3QNXA 4P5TA 5DD5L 4JFYA 4K94H 4QXGH 4Y1AE 1CYGA 2VABA 1R5IA 2OTPA 4LDEB 4PJBA 5ISZD 4HFWA 1T21A 3IJSA 3O3AA 1F4XL 1U8MA 3CD4A 4WEBL 5BVPL 3IF1A 4PJBF 3HNSL 1MCFA 4YDJA 4KRNA 1CTNA 3DGGA 4M8QB 3S98A 5BS0E 2J88H 3ARFB 2HWZH 1WC7B 1OWWA 4MJ6A 5D1QA 2GCYB 3BZ4B 4LMQE 1A1NA 2YPLD 4LMQI 4QGTA 3SCMC 1W0WB 4C59B 4MB4A 2I9LB 1TVHB 3KYMB 2AJVL 4GKSA 4CNIB 4P23B 2BHZA 4PD4K 4AEIL 5DXWA 1NC2A 2C1PB 2Y5TB 4I4WA 1X5HA 2EE6A 5JR1H 3GHEH 5E2WH 2O61B 2WBJA 3MREA 2NY3D 3RUGE 1IILE 2Z35B 3TC9A 3EJYC 1MCOH 1YEDA 4ALAH 4K7FA 3UTZB 3GSXB 4WI9A 4YNYA 1IC5L 1J5OH 1N5AB 3AUVA 3T8XB 1FNHA 4LSSL 1G7MB 5FYJL 3QFJA 3ZMRA 6FABH 2ICEA 1L7IL 2V2WB 4HIJA 4NQEB 4MAYB 2BVQA 2V9QA 4YXLL 4YHYC 5D7JB 1MELA 4O02L 2VYRE 3QIWA 1R3JA 1UH3A 3D39D 1C5BL 1EEYA 1FZJB 3EDKA 1EUUA 4XP1L 3MBXH 1ZLUK 3GKZA 1DN2A 3MV11 1QSFA 3O0RH 5FKPB 3TO2A 3SPVB 4JFEB 3HR5B 1A6TB 1I3VA 3L9RA 5EFIA 4ZO7A 4TPRH 8FABA 1HHIB 3WBDA 1N5YL 5TGBA 5KSAB 5IGXL 3DX6B 4PJGA 4H1LB 3G5ZA 2YPVH 4ZUWA 2JIXB 4GW1A 4ONHB 3FT4A 4WW1B 4N8PA 5F88B 4LCIL 4Q9RL 3CUPA 3WDHA 2DD8H 4XPHL 1MCIA 2A1WH 4FQXD 4UIMA 5EORH 1QO3B 4OKDA 1MRDL 1DLFL 4LCCC 5DC4B 1DQQB 4KZEH 3ULUL 4Y4FD 1ZHLB 3BQUA 4CKVX 3DO7A 2CIIA 3QDGB 3I2CL 4LSPH 4A6YA 5DD3H 2R4RL 4QXUL 1RZFL 4G6JL 4QXTB 3SDAD 3HUJE 5CINL 2P5WD 3F58H 4FXLA 5F7NC 5SWZB 2ADIA 4JFZL 3U7YL 2XZZA 4RQQA 5CUSH 3B8SA 5IB3A 4NUJA 3S5LA 2YZ8A 1ORSB 2XG4A 2MHAA 1ZHBA 4F7CB 5A2LH 2HYMA 3RVUC 1WSST 4DGIH 4PJEB 1QUNA 3HS0B 1HSBA 3V8CA 2C5DC 4OJFH 5F1IA 3ZDZE 4JG1H 4PJ9B 1NCCH 5EH1A 1RJYA 1H3TA 2DWDA 1M4KA 2QQKH 2CDEB 1IGYA 5F9DC 1FVCA 2D31B 4YC2B 3F6LA 2I07B 3GMQB 5HI3D 2FB4L 5D8JL 3GMPA 1QR4A 2R1YA 3FO1B 1MCJA 3MBEC 3R06B 4J4PA 1LDSA 4D9RD 4DEPB 3MRBB 4G6AD 5F89A 3BIKA 4OCMC 3H6JA 3SKOB 5GJSL 5D5MB 4AMKL 2KQNA 5B21A 4WHTB 5HJ3A 4ODVL 2AJ3B 5LAXB 3EOTH 5HDQL 4RGMB 5ERWA 5ICXA 3BAEH 5CD3A 1TZGH 3B9AA 4Q9BA 5B39B 5I6XB 3X12B 4HUWA 1E4KC 1CLZH 4PRNA 1T2XA 2BCKA 5I1LA 4JGMA 5T1LA 1FL5A 3CLEH 2D0GA 4XCFL 4P2OC 4E9LA 4GG6E 3CFCL 3DVIA 3I6GA 2JE8A 32C2A 5IBLC 2ITDA 3MLRH 4OZGB 3DRTB 4JDTL 3VXPA 2YC1A 4NHCL 1RIVH 1MNUH 3TIDB 2VDOH 1AFVL 4M7LT 3GHBL 4WGWB 2QKIB 2A83B 4HX1A 1IC7H 5GJTL 3TP4A 4M03A 2KUTA 1KEGH 2VH5L 3CH8A 3X3GH 3TYGL 5KSVA 3QXAB 2DQHL 1T1WB 3KPQA 5I71B 3MLPA 4GXUN 3MRDB 1NCWH 4BQ8A 4AYFA 2B0SL 4MHHG 2YPLE 3FOMA 4X7TA 1FFPB 2X4TA 5AEAA 1PQZB 1FZOA 5K9OB 1UKTA 4MNQB 4V2BA 1P4IH 4WUUB 3WJJC 2EDOA 5HSFA 1A9EB 1RULL 3I75B 1JN6A 5GQBA 4RDQF 1HOCA 3TF7C 2CR6A 2WQRA 5FA3B 1AKJB 4GW4A 2MCPH 4QY8A 2GHWB 5D2NC 5D7LD 2COQA 3JVGA 1EHAA 4XBGB 4M7JL 1R3LB 4MA8H 3PWVB 4X5XA 1NC4B 4HUXB 1ADQH 4L8CB 3HI5L 4WNQB 5SWQB 1F6AA 4GXVL 4KRLB 1VACB 4P5KB 2XKNB 3MUHL 5LQBH 3DROB 2OX5A 3BDYL 1J0KA 5B8CA 2ZG2A 3ROLB 4MB3A 2DKSA 4RA0C 1AHWC 1B6DA 3QDJD 4UOW1 4OQTA 5C0CB 1DBKL 3O3BB 4OLWH 4GBXB 3F7YB 1RVFL 2MKLC 3D39E 5TE4H 1FPTL 1GGIL 4NBYB 2VO5A 3RVWC 4PG9B 5GISH 3R8BB 5MEOA 1MOEA 2CXKA 4D8PB 1A7OH 1RZGA 4P3DA 4XRCB 2IANE 4X6FA 1HI6B 4KROC 1SJEA 4GUPB 1E6JH 4GJTB 5I1GH 3BT2H 5C92A 2EDJA 3UO1L 4CN4A 4HBQA 3S8WA 4H88H 3ARDC 4H26B 1I8KA 3QIBD 4GRLA 1R3KB 4H8WH 5IB4A 2P7TB 1JFQL 4L9LB 2I9TA 2R15A 3MGTA 5HI5C 1FJ1A 4LFHG 2VLJE 1INEH 1MRCH 1V3LA 4MVBC 2EYSA 2R69L 1HNFA 3I6KB 4HK0B 4HG4J 4KXZI 3ZE0E 3HUJB 1FFOA 1IJ9A 1FVDA 2R1XA 2VN7A 2GTZA 3PWPB 3FB6A 1DBBH 1K3IA 3BE1L 5KSBA 4JZOA 4HKBB 3TN0C 2BERA 1YPZE 3GMRA 3O9WA 5GGVH 1QD0A 4UINH 4RBPH 4NNXA 2EYRA 4ODSH 3BGMA 1A6PA 3FFDB 3SGDH 1YMMB 1T1XB 4Z78B 1X5KA 3ABZA 4HF5L 2B1HL 4LSVL 4TVPL 2D7PA 5J3HC 1NFDA 1YEEH 3GJFK 3SJVE 4XPFH 2ICWA 5IW6B 1IM9D 2CUIA 2WWKO 4YFDB 2NY2D 1NBZB 1LO0L 1ZLSH 1XCTA 3FFCD 1LILA 3TV3H 2IAMD 3EYSH 4TTGA 2C3VB 3QBTB 4NBZB 4KPHH 3O41B 5CKAA 3DETC 3MLTA 4WRLA 4NM8H 5DD5H 4JJHA 5I19L 2APXA 1ZKAA 3HG1A 3FCTB 1T04B 2CLVB 3QA3B 5T3XL 4R96A 4HH8A 4L8BB 1F4XH 3QRGL 1H3UA 1SEBB 3D25B 5BVPH 3HNSH 3WUWB 4BQBA 1EO5A 4HZLB 4V1DA 2ERJB 2AXGB 1ZS8B 5J4MA 1WBZA 5DJXA 3SQBA 5I16B 4AH2A 2ITCA 2R56L 2OJEB 5F9JB 3QSKB 4HKZA 4DKEL 5D72H 2AJVH 4KAQH 2PXYA 1KCUH 3EYVB 5FO9B 4M6ML 5BVJA 3EZJB 1FGNL 1DSFH 2ZUWA 1A21A 1BAFH 3PP3H 3S34L 3AM8C 3EHBC 3TGXA 4V2CB 3N1MC 5EU5B 1MHEB 1M71A 3P77B 4QHKJ 2RR3A 5DK3A 2ZUXA 4XH2B 5ISZB 3DRQA 3H9SD 1IC5H 1B88A 4XCNA 5DHVB 5A2FA 4KZDL 4LSSH 2X4PA 3VGEA 1Z5LB 2MQCA 4OM1L 3CC5A 1WUNT 4L29B 4N8VB 5CJXC 4M02A 3TZVA 3HC0A 2X4NB 2Y7QA 1G0DA 1CL7H 1D5IL 2EDYA 2YPLB 3VGFA 1ZT1A 3MRQB 4F7EA 1ZGLM 4JFHD 4W4NA 4YDLC 4YXLH 4J3TA 2FR4A 4L3ED 1KPRB 1A7PL 5F44A 1AC0A 2VLKD 4O02H 4K3EL 5IMKA 3GDBA 3ARBC 5AAMA 2NY3B 1J8HA 4EUPH 1QEWA 1NDMA 3WFDH 4XP1H 5GIRB 1DEEA 3N06B 2F58H 5E8OA 4ZXBD 2DQIH 1F5WA 3TCXA 5CSZA 3IKCB 1BZ9A 5DD6A 4H1LH 3O6FC 4GT7A 4AJ0A 4JJ5A 4NP4L 4OAWB 1AE6H 3H8NA 5D7LE 4ETQB 5IGXH 4KHTL 2P8LB 4M1CD 1PKQA 3FB5B 1JF1B 2PCPB 4PRAB 4C4KO 4IRJC 4KI5C 2PYEA 4LPVA 4U1IA 3LN5A 4Y4HC 5ESAB 5HHOA 5DFVD 3QUKA 5DJ6B 4XPHH 5GZOD 5FXCH 4QRSB 1IAIL 1MIEL 3FB7B 3QT2A 1P6FA 4YO0B 1IZJA 1FL3A 1FC2D 1ZT4A 1AXTL 3ULUH 3RDTD 3WO4C 4HUVA 4OKVA 4J3UA 4UV4L 5IVZA 3MR9B 3UYRH 4OCRL 2R4RH 4MS8D 4QXUH 3KR3L 1RZFH 3JV4A 3OR7B 1CLYL 5B38B 1I1CA 3W9DB 4N8CL 2DLFH 5T1MA 3GSQB 4JFZH 1QFPA 1T3FB 3U7YH 1JZ4A 1MCHA 2WQ8A 5DVKA