2DQJH

Crystal structure of hyhel-10 fv (wild-type) complexed with hen egg lysozyme at 1.8a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqjH00
1XH3B 4E41A 1FFRA 3BXNB 4ZXBB 1BWWA 5HPMA 1C7SA 3WHE1 1TZGH 1HQRB 1DLHB 3L3JB 2VXTL 4O4YH 1YY8A 1TENA 1PAMA 2R4RL 2X09A 1TJHL 3W11D 2X7LB 4CW1B 1MCCA 5CD5C 3GJEA 3ZDYE 1XAUA 2R0KH 5IHLB 3LDBC 4I48B 4TNVK 5HHXH 3CK0L 1NMAH 3L3KA 3EGSB 1JHLH 4NQEE 2CLRA 5FM5O 5F44A 2C7UB 3QXVA 1NCBL 4HKZB 5DT1L 5ELIA 3IS1X 5FOBA 3IF1B 4I3RH 3MNWB 5IJVB 5F88B 5E94B 2BRRL 3N1GC 3T2OA 4OZHA 1KXVC 4MD4A 3MV7B 1RFDH 2L7JA 3TO4A 5DC9B 3GJFB 2QADD 1AGBA 3ARDA 1JN6A 1I1YB 4ZAKC 5IB3B 4BM7A 1J8HD 2BNRE 2V7NA 4XP4H 1REIA 1W8NA 4OTXH 4RMWA 3RNQA 2VDOL 3UTZA 3HR6A 2VISB 4KC3B 4B5EA 4N5UA 2H3NA 3GSQA 4FTVD 4WY7H 2GJ6D 4FNLH 1WGOA 3PWLA 4NWUH 2OQJA 2R0WL 5AZEH 4WFED 3WKMH 3CX5K 3GBNH 1HKLH 4Y2DC 1RJCA 2YC1A 4XP6H 1QR4A 4HIHB 1YEGH 4M7LL 4OLYH 3BN9C 3GMMA 1KLUB 5CIPA 4PTTA 2EC9U 3HRPA 1HSBA 2P1YA 2HVJA 3BDYH 4NNPH 4Q97A 5AYUH 2VDNL 4EUPA 5GJTL 2UUDK 3DROA 1HHJA 4BH7B 3QHFH 2HJKB 1K6QH 4H0HB 4C56B 3CH8A 3HE7B 1E28A 4LDOB 1YY9C 2VXVL 2ZG3A 4D9RE 2EDTA 1MHPL 3BAEH 2Q7YA 4ODUB 2NY4D 4JDVA 2NYYD 3BQUD 3NVQA 1BGXL 1OAYL 4WO4B 1S9WA 4LCIL 1I8MB 3NTCH 1KLGB 1PW3A 4Y1AE 1UXWB 1QRNE 4HD9A 2XN9E 3KYAA 2HVKA 3KPSA 1JZ7A 2V7HB 4PRID 1F97A 1CT8B 3CXDL 5D5MB 4ZODA 1ZHKA 4KGLA 1W72H 4NFDA 4XP5L 3N9GH 2CIIB 4YDLC 3TA3B 2VSDA 5DO2D 3MJ9L 1J5OL 3EYSH 4JO4H 1CWVA 3G6AB 1EJOH 3IDMB 1T1WA 3WO4C 2GTWA 1D7FA 1U3YA 3WFCH 1BZ9A 4CVXB 5D1QB 3QFJB 2A73B 2C26A 4HBCH 4XAWL 3P77B 1I9RL 4O2CB 3QUZA 3V4PH 5T1LD 2V5SA 1FJ1B 3RWFB 5EZLA 4RMTA 5L2JB 2GCYB 3MXVH 1P6AB 1RZ8B 4OUUA 4MJIA 5CEZL 5D9SB 1F4YH 3L7EB 3T65B 3N1MC 3A6CL 4X0KB 3V6OE 1EMTH 2MQCA 5DRWB 5JOEA 3C2AH 4MDIB 2AK4E 2PYEE 4LPTA 4NZRH 4J8RB 1GGCL 2NW2A 1A7PL 4FFZL 5FF6B 3CSPA 4X9IA 2HFTA 4HXBL 1ND0B 2BOCB 1IC5H 4ZOBA 3ULSA 3UTQA 4XCCH 3I6LE 2E7LC 2ZNXA 3B9AA 4KI5E 3RVTD 3LQAL 4LLQB 4G8EB 5JA9A 3GIVB 3PNWB 1GRWA 4ELME 3K2UH 3MGTA 5CCKL 5JW4Q 4GAYA 1M6OB 1N6VA 1DVFC 4NUGH 2P8MB 1UGNA 4XRCA 2DYPA 3MV9B 1MOEA 2QKIA 2VLJA 3OSKA 4RDQF 4U7KA 4Y4KA 1S7QB 3B3IA 5SX4H 2FATH 4JJ5B 4CMHC 1RUKH 4KHXL 1QPXA 4GLRI 3CJJA 2AXJA 3N0PB 4PJHE 1TQCB 1NUGA 3GRWH 3TH3T 2G60L 2YPVH 1DEEB 3FQXA 3F6LA 5HVFB 4QEGA 3BJ91 4HT1L 2W59A 2FJGB 4U1MA 4ZFGL 5EOQL 1NUDA 4KV5E 3VA2C 3LS4L 1RJZA 3O3EB 3AM8A 1HZHH 4JFDA 3ULVE 3GMOB 4KDTC 1IAKB 1WITA 1JHKH 1D5MA 3SDXB 3E6HA 3VMOA 5IWLC 4JDZB 3VDBA 4U33A 4PJBA 1XMWA 1U91A 1S7WA 3GSNH 5I0ZA 3NIFF 4QRSB 5C92A 3QXDB 4TTGA 4APQC 1AGDB 4OI9A 5JO5B 4F7CA 3LS5H 1UCBL 2R2EA 1MI5D 3QIUA 1NMBH 3VFMB 5DK2A 1YEEH 3JWOH 1AXSA 4I3SL 5ADOH 3UBXA 3QIBA 5J1TC 3IRPX 4P46A 4LAQH 3MMEB 1T5WA 3VE0B 1N7ML 2B0SH 3PQYA 1NCAL 4JHZA 1KTRL 2NW3A 1U8MB 2GEEA 1U8HB 3EAKA 5EH1A 3VI3E 5IESL 5IGXL 4TSCH 2D31B 1DDHB 1OPGH 3RU8H 2YD9A 1JRHL 5CJXA 5SWZB 5IFJA 2ICEA 3UTTA 4ZPTA 4MA3A 3W0WA 1N0XH 4LSDA 4LFHD 1S7UB 2G5RA 4GKSA 1CGWA 4XXDA 4ZUUA 2Y23A 3O6FB 1IGML 1T4KB 2DLGA 1J8KA 3D18A 4MLSA 4OV6F 4NRZA 3QR2A 4QO1A 5CILL 2EE2A 3O0RH 5B3JE 4LU5L 1NAML 4K23L 4L5FH 3OR6A 2I24N 3FOLB 4IRZH 1Q72L 2KQMA 3TV3H 3KPSD 1MCSA 1KNOA 1UH4A 1R0AH 1S9VB 4ZO8A 5I1AB 2AP2A 4MNQB 2UZIL 3EYOA 4PB9H 1BZ7A 1FC2D 2MNUA 2D03L 2IBGA 4LVEA 4AH2A 5F9JB 3OKLB 1UZ8B 2X1PA 1EHLH 4Y5YB 4NQEA 5IROA 2R9HC 1I1RA 4K3DL 3X3GH 3MJGX 1UQSA 4M43H 1ZANL 3UC0L 3L95B 2BXYA 2MTPA 3NH7H 4KGJA 4TQEH 3SDDC 2C3XA 4JFQA 3ARFC 5MEPB 1ZLUH 2XKNB 4WW2C 2UVEA 4P2OC 4M6OL 4NC1C 1FNEB 1P7QB 4EOWH 1FVEB 1ZA6A 4MQSB 2RB8A 5TE7L 3S35H 4MCZA 5FGBA 1SVZA 2AVGA 3MLYL 4Z7UF 4MJID 3JV4B 4HV8B 4MD0A 2P7TA 3DGCR 2W65A 5E8EA 3S98A 1JIBA 3V95A 5L9DL 4IRSB 4QRRA 4LCUB 3WEXB 3SY0B 3C6SA 1V7NL 3H9SA 1MJ8L 4OM0H 2Q8AL 4XAKE 1GYAA 3B6SB 1MQKH 4WV1A 1TVHB 3CFEA 3CU1A 5EUKB 5IFAL 3T2NL 3TYGH 2GSIB 4ETQA 1XGRA 3TZVB 4OT1L 2JE8A 3GHBL 3FB8A 4H25A 4X7TA 5EBMB 3TPUA 2F58L 4JFHE 2VXUL 5I1KL 3CCHB 1YA5A 1ZHLA 2V17L 3FN0H 3QIWB 5C0AB 3ZE2F 2B1AH 1OSZB 4I77H 5CINL 4S1DC 4UU9B 3KPOB 1P4LB 4BH8B 1CLYH 4R97B 2HFFB 2FR4A 2DYPD 1HNGA 2P46B 4XZUA 2VLJD 4Y4KD 1CDJA 1ZLSL 2LTQB 1L7TL 1MIEL 4UIMB 2XRAH 5BCAA 1AR2A 4JFYB 5BZDA 1IM3A 4Z76A 3BRFA 3C5ZB 1Z9MA 5IG7B 1NAKL 1KELL 1F8TH 4GXUM 4XPBH 5TGBB 3KPRE 5EO9A 5HHNA 4NFBA 4Y1AA 1A6TB 5BQ7A 2B5IB 1FGVL 4H5SB 1QRNA 3T4YB 1CGUA 2XN9A 2BVOB 4QXTB 2FECI 4O4YL 4P4KA 4LLWA 2QR0B 1CK0L 5EZJB 5B4MC 3HMXA 4G6FB 3GMNB 4QY8A 4V1DA 1N5AA 2VOTA 4NGHH 4OSUH 1ZS8B 1YEIL 1WZKA 3GJFH 2CGRH 3OZ9L 1OGAB 4S0SD 4G42B 2ZZUT 3I9GH 1IAII 4R9HA 4Z7VF 5DQDH 1VKXB 2R23A 1CD0A 2Z8VC 1FL6B 1MREH 1ZT1A 1QKZL 4JAMA 1EGJH 1G7MB 2A6JA 4M48H 4ERSH 4FXGA 3I3DA 4TUKL 1PKOA 2IAND 4NP4L 4ONGH 2XTJB 3QIUD 2MFNA 4HZLB 5D96B 5I76B 5ICYA 2AQ3A 4K2UL 2EEAA 5GSRA 4HXAL 4UI2A 1MHEA 2FO1A 1D5ZA 1PSKL 1IGYB 1TZHB 5F8RC 4JPWL 1K8DA 5FEBA 4U31A 5E9DA 1U8LB 3PQYD 1SVCP 2VABB 3HE7C 1FFPB 2F8VA 4NQCA 4BZ1L 1XZ0A 2WBWB 1Z9LA 2AK4A 2PYEA 1QPPA 1KYOK 3G6JF 3FOMB 2FH6A 4RAVA 5EIVA 5AZEL 4GXUN 1X5IA 2DL9A 3UTTD 1HKLL 1GOFA 1AGEA 3UPCA 2V5YA 4RGNB 1F90L 5EC2B 3AFLA 5TDOB 2DWEB 4HC1A 5ALBH 2IALB 4BYHA 5JDJA 5GGTH 3MLSL 4ELMA 1NC2A 1R3HA 5L7XH 1V05A 1RIUL 2JLLA 5DWUH 2BP3A 3Q2CA 4RDQG 3VWJA 4M1GH 1KC5H 3CMGA 5F1NA 3QHFL 2P47B 4HW6A 2Z93A 3LPWA 4I3GA 4IMLB 3T0ED 1KV3A 2X89A 4P57B 4OD2A 3GMPB 5DFTA 3UBXI 4PJHA 3GMQB 1LP9E 3OMZA 4NO0A 2A2QT 2ARJA 2BVPA 5CUSL 3KYMA 3ALPA 4G6ML 4NQED 4OFVA 1XGTA 3BW9A 4GRMB 4YX2H 5A2KH 1HKFA 3NAAH 3C5JA 4M7ZB 2X05A 4XB8A 3KDMA 2AEPH 1DTUA 4MDJA 3SGKA 3MRLB 1J10A 4D2NA 4MJ4A 4NKIL 3SGJA 5A2FA 4NRYA 4F7MA 4KAQL 4NO5A 3DJ9A 1EIBA 4J1UB 3EYSL 4IJ3C 1DE4B 2IPTL 1Q0YH 1G7JA 3H9HB 4X9FA 5DQ9A 4QRRD 5J0BA 2PXYC 1T1YB 1EHAA 3QEQB 4I8DA 4OLZH 3H9SD 4DTGL 4HJGA 4UQ3A 3VG0H 3FO0H 3HUJE 5DJ8A 1UACH 1KTLB 3O4OC 1PEWA 2XICA 3I75B 3J8F7 3KG5A 4OM1L 3VFOA 5LJYH 3WJJA 2AS5M 1JNHB 3BZDA 4HBCL 2N1KA 4LPVA 1UJTA 1S9YA 4X6CF 1PY4A 4RISH 2V2WA 3FO2B 2LU3A 3MA9H 1CFNB 1P1ZA 3G08A 4PY8J 3KLAB 4UQ2A 1F4YL 4MWFB 3BEWB 5TE4H 1KJMA 4DGIH 4F80A 3CFBB 3MBEB 4NZRL 4PJXB 3RWDA 4YHZH 1JWMB 1I7TA 1U8IA 2BC4B 4ZUVA 3ZT6A 2OM5A 1W0YT 1N4XH 4OCLC 5FCUH 2DQUL 1CDIA 3OAZK 4WHDA 4YXLL 5C6PB 5IIEA 3L5JA 4YR6A 3WL9B 3Q48A 4NCDA 1A21A 4D9RD 3QHTC 4NYLA 1RIVL 4NSKA 4HF5H 5E6IB 4OAWA 4DGVL 5LGJA 3VFSB 3QCVL 3KXFE 4K7PY 3QQ3A 3WNOA 1X44A 3NBNA 1RJYA 5BJTA 1QRND 2XN9D 1HSAA 1JPFA 3IJSA 4P4KD 5DJCB 5FB8A 3FT3A 4ZFFB 3BP7A 1Z3GL 1BM3H 1BD2D 4V1DD 5FYKH 2UVFA 5GS3A 1Y18B 3GRWL 4P59H 3GI8L 4OGYH 4ZQKB 1J1OH 4M7JL 2NTSP 2AV7B 2IBZY 3BWAA 4Z7UB 3FQTA 4UB0L 5D1XA 5CJOH 1CFSB 1T1XB 1U8NB 4XXCC 3MRHB 1RD6A 1RUML 2E8YA 1JHKL 5DI8A 5IK3A 4JG0H 2VAAA 3B9DA 5D72L 1J86A 3UX9B 4PD4K 2MHAB 3U1SL 2A0LD 4LMQE 2AXHA 2DLFL 3I85A 4XPGH 4HK3N 2R2HA 5I19H 3DI2B 5E9DD 4D0BA 3F7YB 3RX8A 1CD8A 4NQCD 1KPVB 4YWGH 1H3VA 1GGIL 2MCPH 2BDNH 3OL2A 5JQ6L 1RULH 4P5KA 2ZKHH 2AK4D 3PHQB 1I7ZB 5AAMA 4OZFG 5C0CD 3LS5L 1MCWW 4QXGH 4R2GB 3O6FC 4WFGE 4OF3A 4HUUA 4TPRH 4FQCL 1QR1A 2F5BL 2E6PA 2J8UB 3D0VB 2CIKB 3I6LD 4ELKA 1LE5A 3WFHB 2G9HB 4X8XA 3AROA 3HC4L 4DEPC 3FCTB 5JORB 1VCAA 4LPCA 3AREB 3DLQR 3G5XA 2IADA 3TCLB 1G84A 4M5YH 3DSFH 4WFFE 3LY6A 3MRMA 1IL1A 2DMKA 4P23C 4OCSL 3VWJD 1MFAH 4PRAA 5DUBB 4K7PL 2WUBH 5EBLB 3BHBA 4Y5VC 4Y5YC 1F3DH 2VITB 4O5LL 4OI8A 4GW1B 3QPXH 1FL5A 5HYSB 2VIRB 3MRIA 1A9EB 1ZWIB 4JO3H 4NO0D 1ZTXL 4OIAA 4P4RA 5CZXD 3U7WH 4M93B 4GW5A 4M1CD 3LZFH 4J3TA 5FA3B 2WBJB 3KPRA 2ID5A 5HYSG 5K9OA 4O2FB 2EDEA 2AQ2A 5I8CA 1FNFA 1FIEA 4L5FL 1Y6MR 5BS0D 1F02I 4Z7VB 4QT5A 3WS3B 1JTTA 4LLDB 1TITA 1DBKH 4GMSL 3ULVD 5KAQF 5C0EA 5HPOA 1XGPA 3MZTA 2DM7A 2VE6A 4HIJB 1MCKA 4I0KA 2I07B 1QQDB 1GHFH 4XCEA 5L88L 3KPPA 3BPCA 5F3HB 1N5YH 4PUBH 3VG9C 3FQWB 2G5BB 4UUJA 4TQEL 4N1CA 2VQ1A 5J6GB 2DL2A 2YZ1A 1BLNA 4RQQB 1B0RA 3HZVA 1KBGL 4HWUA 5GHWL 5IP4A 1XF2B 4HFUH 2A83B 3GHEH 2DBLH 3MREB 3S35L 5IB2A 1RK0A 1VGEL 1LK2A 3DV6B 4IIQA 3O3AA 1IE5A 2NR6C 3VXQA 5CLWA 5J06A 2LTQC 5F7WC 3VXSE 2LFGA 4MJ6A 1RZ7H 1WAAF 5IB5A 2FIKB 4OM0L 1TMCB 2PCPA 4K3JL 1FN4A 3Q5YA 1IAIM 3CLFL 2R69H 1MCOH 4AQOA 4MYWB 5EU4B 2FBJH 2O26U 2VLRB 2OTUB 2B5IC 4ACPA 2VDPH 1AR1D 4XNMB 3L5IA 3NCBB 4E42A 3DVGA 1JWUB 4XBGB 1V8HA 3MODL 1ED3B 3T2PA 5F96H 2WINB 4KZDH 4O2EA 4PGEB 5HVHB 1I3VA 4P5TA 5JLZA 5J8OA 5H35B 5MENB 1KB5A 3MROB 4UV4L 5CJ8A 4FZEL 3O4LE 5JA8B 2XRAL 1AO7B 2ZJSL 3QEHA 3OXSA 5TQ0L 3BH9B 5A43C 4QHMB 2HFEB 3QUXC 2JIXD 43C9A 5K59E 1LP9A 2NNAA 1YMME 3O3BA 4PV8A 1JVKA 3IDXH 5C0IA 4NBYB 3TWCH 4EDXB 4KKAD 1CU4L 1GZQA 4FQXD 4OFIA 3VMPA 4BKLB 4KQ3H 3RBGA 2JJTC 4I0PA 2ERJB 4IDJH 5EUOF 4OSUL 4QRTA 1T04B 4XWOC 3VWKA 2RBLA 1UH3A 3CH1B 3BE1H 4TUOB 1MHHA 4Z77A 2BFVH 5JW5A 2J2ZA 3DGGA 4LL9A 1KCSL 2BY3A 3O2WL 3EFDL 3RDTA 5DQDL 1FG2A 3BUYA 4HLZG 4XAKD 3HUJA 2EZ0C 4LSTH 3CVHA 3SKOA 3ZKMC 2CLZA 3Q6FA 4K8RH 2Y07H 4PJ9A 4P2QD 4QF1B 4JKPH 4U6YA 3PP4L 1CDBA 4JANA 4ODSL 3EO0A 3MJ8B 1PJ9A 4QWWC 3TNMA 5L0QC 5HSFA 4WGVB 1EAPA 4JFHD 4BQ8A 1A3QA 2DM4A 1HIMH 1RJLA 5CSBA 4X7DC 4WEUD 2EXWD 5C09B 4L3EB 1AHWA 4EJ1C 4OB5L 3W39A 3MLUH 1F4WH 4AIZA 3L3OB 5HYIA 5HHVH 5JDSA 4W4OA 3FN9A 2HLFD 4MGXA 2EE3A 1CXFA 3BH8A 3SJVE 4IRJB 1YEDB 1BOGA 5HYQB 1MHCB 3PDDA 1NEZG 5FYJU 2HFGH 1C16A 5ABDE 4U4BA 4F3FA 4RNRA 4YHNA 2I9LA 2XFXB 5C3LD 1T7VA 4ZFOB 2RR3A 3HI6H 5KBNC 3AAZA 4OJFL 3PGFH 5FO8B 1TTUA 4JY6A 4OLXH 5L7XL 5DWUL 4KROC 2HWZH 5D7LB 3NA4A 3CDGB 2P5ED 1BECA 1OQXA 1A1NA 3OAUL 1CFVH 3I6GA 3LRSB 4NO3A 4Q0XH 3P9MA 5J4MA 2YD3A 5BOPA 5INCA 5CJBA 4X7SH 5F9AC 4X99A 1YDPB 3OKNA 4M00A 4OFYA 4X5WA 1RZKC 3P0GB 2HRPL 2XV6B 5F9WB 2IFGA 1EUUA 4F9LA 4LLAA 4WW1B 1I9JH 1MCPL 2NY0D 5F7NC 2WNGA 4JVWA 2V5RA 4KKCD 1PKQE 4J3SA 3AMLA 5DFVC 4ZOCA 4NC1E 1CIDA 1ZSDA 1RZKH 1E6JH 3EJYC 3QISA 3TH2T 2VLKE 3TVMC 2W0LA 3NAAL 3AXLA 1UVQA 5IF0B 1BJMA 4EI6B 3ES6B 4EZMA 4ZAKA 3NIGE 2AGJL 2KPNA 3MBEC 3S5LA 3V5HA 2K3TA 5EFIB 3QQ4A 4XWGL 3IDJA 4I5BA 3RHWF 4UOW0 2Q20A 4S2SB 3WUZA 3ARTA 3Q3GB 5E6IC 1CZ8H 5ID0A 3AMKA 1YJDH 2PO6C 4XPHL 3ZE0F 3TN0B 3INUL 3W9EA 3QWOB 4L3AA 4XX1G 4R26L 1M05B 4HCRH 1DN0B 4X4ME 2XXCB 2J3SA 1XIWD 2E8ZA 1VA9A 3WUWB 4HUNB 3DPBA 3GZKA 3NA9H 4HFWB 1MWAB 3WIIH 5DRNA 5EOTA 3LKRA 4JFPA 4YZFE 5DHVB 1N59A 4P5TD 4BSVB 4JKKA 3KS0J 2D7MA 1NH6A 5C0NC 5KSAA 1GJIA 4I4WA 1HEZB 4NNXA 3B9KD 3VXUB 2CDGB 1JRHI 1W72A 1CBVH 3QA3A 1F6FB 5TF1L 4Y16A 1WTLA 2OJEA 3MV7E 5GGRB 1A1MA 3S96B 3T3MF 2FSEB 2UZYB 3T8XB 3IDNA 3SGDH 3P4NB 4M6NH 4XMLL 5KAQG 4NQVA 3DTXB 3S37H 4PJAA 4BFBD 3QXTA 4Y5XB 3L7FB 4XH2B 4F57H 4MJ5B 4I0PD 5CSZB 2Q3ZA 1RK1A 2IQ9L 3C09C 3VWKD 1TCRA 3LQZA 1OB1B 1YEHL 5DMYA 1RZGB 1KB9K 2CR3A 2Z8SA 3ROLA 2DRUA 4ZO6A 4FQHA 3ET9F 2GK0A 4ZUTA 1I9EA 4ZOAA 1J0HA 5CJOL 5ERWA 4P0DA 4WNQB 4RIRA 1OAUH 5E8NB 3CX2A 5DSCB 3VGGA 3AC0A 3AREC 2EKSA 1X5KA 5EN2A 3MLPA 5C0JA 4GFTB 4C56E 1K2DA 3ZKXB 1U6AL 5ADPL 1NC4D 1LO4L 3M17B 4M5ZH 4HS3B 5I19L 3ILQC 1XCTA 3B8SA 1VFAB 4KK9C 4YFDB 4YWGL 3VXSA 4EVNB 2ZKHL 4LIQH 3U46B 3WHXA 2HJFB 2E7LA 1NGZA 5JPMA 3MV8E 1ZLVH 3NCEB 1GXEA 1NCTA 3RVWC 4U6TA 2W60B 2WBJC 3CXHK 3I02A 2CK0H 1G9NC 4O58L 1QLRB 3GSWB 3MOBH 4XCNB 1DVFA 3MRDA 3GRWA 3FT4B 3EBAA 4HKXB 1S7TB 3HLAB 3JWDC 1G1YA 5ANMB 1FNLA 3DSFL 1CGXA 3T0VA 1FGNL 2YPKB 1PFCA 1FZJB 3LEXA 1MFAL 2VC2H 4GAJH 2ED7A 4TTDD 5JPNB 5IR1B 1G7IA 4U1GC 3QFJE 3O4LA 5D7SH 5DYOA 4OFYD 5E99L 1F00I 4EI5A 3CMOH 4H88H 3OB0H 1WEJH 1MFCH 3VXRB 3ZE1F 4AENB 5EUOB 3SGEH 1BBDH 2OZ4L 4Y2OA 2VUOA 3LKQA 3GSXA 4KDTA 3DX6A 4XNQA 3TJHC 3KPLB 3GSNA 3FL7A 2HMIC 2D9CA 4HUVB 4X7CC 2MCG1 3SCMC 4C4KO 5M94B 2YPLA 3D87B 5DEGB 5DJDA 4OLVL 1A7OH 1KSRA 1VEPA 2PYFB 1QEWA 3IDIB 4PR5A 5KN5A 4ZYKB 1GHFL 4WHTB 4OZHF 3UTPD 4NKMB 4YHLH 4M8VA 4LK4A 5BW7A 4APQA 3QDMB 3O8XA 2Y72A 1N5YL 2APFA 1OSPL 5E1AA 4YNYB 1NLBL 3VGAB 4XNUL 1F11B 4UNVA 3V52H 2H1PL 3NACH 3QUML 1KCUH 2WBKA 1N64L 3L5XL 3MCKA 2ED9A 2A6IA 5ITBH 4ESKA 3LQMA 4Q74A 3HC0B 2XWJA 4WFGD 3MV9E 4L4TB 2DBLL 2DI8A 1F4AA 5I1DB 2V9QA 4TYUA 1EPFA 1OTTC 1NUFA 3ALWA 3PL6B 3OB8A 1F13A 5KG9B 2BJML 4WFFD 3UZVB 4Q6IB 5I30L 4ISVB 2NTFB 4PJ5B 3JVGC 5CKGA 4DFIA 4G9DA 3NABH 1CGSH 3SJVA 5JXED 1YNTB 4Y4HC 5ETUA 5CEYB 3BGAA 4LPXA 5KSAD 2FBJL 1BOYA 1QSEB 3MLWL 3SDXE 1E4KC 1H3PH 3F58L 4Y16D 5FYKE 4J23A 5J6HA 1GC1H 4WWKB 2IGFL 3RIAK 3ULUF 1BIHA 4AQ1B 4BK4A 4QTIL 1UYWL 1LILA 2LQRA 4F33B 1D5IH 3O2DH 3BT2H 1KCRL 1KPUB 4XCFH 4G8FA 1ROWA 1T6VN 3EYQC 3GIZH 3T2QA 3X11B 5MP6L 4XBPA 5D6DC 3QCTH 3TH4T 4WFHE 1FZKB 4K3HA 5I75B 1C08B 4X4XB 4F9PC 5B39B 1Q9LB 3F12A 1FYTB 4G3YH 5EIIB 3ZDXE 4DN3L 2VR9A 4QCIB 3HG1B 2H2PD 1LO2H 3IETB 3ARFA 3CFCL 1M7DA 1PKQA 4GBXB 4WW2A 3UO1H 2AV1B 3BP6A 5B39G 4PJDB 3T4AB 1MRFL 3OHXA 2OR7A 1LNUB 2VLKA 1YEJL 4Z9KB 1JZ5A 5BVJA 4G8GB 2X70B 4KMQA 4TUJB 4Y19A 5DD6A 3SDAA 1LDPL 2GHWB 2W92A 5SWZE 2GT9B 4M03A 5EWIH 1NDGB 2F54B 5ENWA 2BFVL 2NY5H 3G9AB 3OKOA 3WIHH 2QSCH 2EEBA 3VCLB 4Z8FL 3QJHB 3DIFA 2YUZA 4JM2C 3VXSD 5TE6L 1OM3H 1SM3H 3VXTA 4LSTL 4PRBB 1XH3A 3V4VH 2GI7A 3BXNA 4ZXBA 2Y07L 1H3UA 2O61B 4NN6C 1JGLH 2EDQA 1KENH 1HQRA 4DVBB 1DLHA 4HPOL 3SO5A 3L3JA 4GMTH 2APBA 1PG7W 1ZT4B 1HIML 4ODWB 4X4MA 2X7LA 3K2MC 2XPGB 1RUPH 1AJ7H 5HI3D 1PEZA 4I48A 1KEGL 3ILPB 4RFOH 5EORL 3EGSA 1FLRH 2C4FT 2C7UA 4NCC2 5F9WC 5E5RB 4TSAH 5BRZB 3IF1A 3GKZA 3H3KA 2CJUL 5I2IB 5IJVA 5F88A 5E94A 3O4LD 2BNQB 3EOYG 1KGCE 4EI5D 4KUZH 5E2TL 1I4FB 3MV7A 5T5NF 4PJCB 3GJFA 5TF0A 1I1YA 5IV2B 5HHMB 1FBIL 3QDJB 5BO1H 2EIDA 4FFVD 3SE8H 3QG7L 3RWGB 3DHJA 1CFVL 3AS1A 3RWJB 2W0PA 2VISA 2YPLD 4IEFB 4CUCA 5D70H 4X7SL 2WLYA 5SX4I 4CJ1A 1MRCL 4X6FB 2M2DA 1EHXA 4XP9H 4TNVF 1I9JL 2V5TA 4APQD 1GPOL 4PJBF 3O8XD 2FWOB 3KJ4B 5C0AE 3SN6N 3U30C 5BVPH 1RZKL 1KLUA 1RQ5A 2R39A 1MVUB 4Z7OF 3W9DA 5I18L 3MLTA 1X7QB 5FM8A 1OGTB 2ZSVB 1JNNL 3K8LA 1R3LB 2HJKA 4PP2B 1MH5B 3VGFA 4C56A 3HE7A 2DMCA 1LO3L 3FO9B 3LH2H 4KJPC 2R4SH 4QRPB 2AJUH 4BQCA 3IFNL 3LPGA 3AU1A 4UTBL 1MWAH 3ARWA 2HKHL 4WO4A 2OYPA 3EOTH 4YFLF 2DQIH 2VLLB 1I8MA 4Q6YA 1KLGA 3VXOB 3DWTA 1OTUC 5DHVH 3SJVD 1A1OA 4UILL 4E41B 5HPMB 4AEHH 2PF6A 2V7HA 4S10A 3P0YL 3RKDC 1CT8A 3KYKL 3CFJB 3U0PB 5AWNH 4J6RH 4JO1L 2CIIA 4RMSA 3QCUL 4E9LA 2HG5B 3KJ6L 4JGMA 1OGAE 3G6AA 3IDMA 4Z78B 3WIIL 4S1QH 4UAOB 4Y8DC 1A5FL 1QFWL 2EECA 3HAEB 5DD3H 2CLRB 4R4BA 5I16B 1CDCA 1G0XA 3OV6A 4XC1H 4YXHH 4H8WC 3QFJA 1I8KB 2XTJE 2OMBA 3P77A 4O2CA 1I3GL 2R9HD 1QFHA 1DQLH 1QFWM 3ZTNH 4UT6L 3RWFA 5L2JA 1UA6H 2GCYA 3ZDYF 1RZ8A 4MAYC 1JI2A 4H8WH 3TO4B 4FS0A 1NCDH 5D9SA 1AGBB 3L7EA 3T65A 3O6LH 4UDTB 1PY9A 4X0KA 3OGOE 5DRWA 1JF6A 4OLUH 1WUNT 2VLKD 4MDIA 4L9LC 4HAFA 4J8RA 4Y19D 5CFHA 3SDAD 4XNYH 4PRPD 5FF6A 3FO1B 1ND0A 1EK3A 2BOCA 2K7QA 15C8L 1R3IH 1D6VH 3TJEL 1U3HD 4RGNE 4ZO9A 3CGTA 4BSWB 2OL3B 2E27H 1N6QL 1BEYL 2E3VA 2YC1B 4LSSH 4G8EA 5DVLA 3GIVA 3VMNA 3PNWA 4YHKH 1NANH 1DQJB 5EPMB 1M6OA 1NLDH 1WWAX 4ZXBD 5F1IB 2WK2A 4LHJB 2P8MA 3DV4B 4IDLA 5IKCB 3MV9A 5I1HL 4ZTOL 1S7QA 4JJ5A 4LSVL 5DJAB 1T3FB 4M5ZL 3HZMB 4XTRC 5GS0C 5CGMA 1DEEA 1FP5A 5K9KB 4NQXB 4DZ8B 5GGSY 5DVMA 4EUPG 2FJGA 2IMMA 4LIQL 5KS9B 4ONFH 4UMGA 3GUTA 4KRMB 3O3EA 1PG7H 3KLHC 1K3IA 5AZ2H 4D9LH 4MNGE 1IAKA 2E6QA 2PR4L 2HVKB 3SDXA 3MOBL 1T83C 2VDRL 4JDZA 3MJ7B 4P3CL 5F7EL 2IFFH 1F42A 2JJWA 4YQXH 1JPSH 1G9NL 1DFBH 3QEQE 2VC2L 4QRSA 5DS8A 4NCC1 3QXDA 8FABB 1AGDA 5JO5A 4WTXA 3JWDL 5KVMC 3VFMA 3DOSA 2HKFH 1MFCL 2VL5B 5HGBB 2C4XA 3RX7A 5DXWA 3MMEA 4NDMB 4PB0H 2XTLA 3S3JA 3HC3L 1IQWH 4N0RA 1U8MA 3ORJA 1U95B 4CN4A 1U8HA 4PJXE 3VFGH 3K46A 5JOPE 2DKMA 1MEXH 1DDHA 2D31A 3LHPH 3IAGC 1D9KC 3ESVF 5SWZA 2Y06H 3RPKA 1A02N 3DYMA 5I1EL 1S7UA 5C2BL 1ONQA 3IRZA 3P9LB 1RZJC 5DMIH 3O6FA 4NPYA 4WO4D 1T4KA 3V52L 3EYUH 5GISL 3MRJB 4LEXL 1P84K 5ITBL 4JY4B 2KZWA 2HTLD 2W38A 2R0LH 1IGIL 3CVIH 5HHOB 3HE6C 1XGYL 2BVYA 1R6VA 1S9VA 5I1AA 3PV6B 5DD0H 4MNQA 4YPJA 3TA3D 2DD8L 4KI5F 5F9JA 2AXGB 2NZ9C 3OKLA 1UZ8A 5I75C 4Y5YA 1U8PB 1YEFL 4Z7UE 2D7TL 2OZ4A 4ELMF 4Q9QL 1CGSL 3HZYA 3L95A 4JCMA 4U1NB 3V5KB 2YUVA 2DQEH 4WUKL 5MEPA 2C1OB 4YHIA 2XKNA 4J3XA 5D1QD 1HHHB 3WE6B 1JZ3A 5IFHL 1J1XL 1MLCA 4HPYL 5T5NG 1FNEA 1P7QA 3VGEA 4MA7H 4XPAL 1I8LC 5KSVB 1RSFA 3LOWA 3BN3B 2K1MA 1Q9KB 3JV4A 2XZAH 4FQIH 1T89A 4HV8A 2WUCH 3UTSD 1IM9A 1UG9A 5CHNB 3GM0A 4IRSA 4LCUA 3WEXA 3SY0A 4ORGB 1U91B 4AMKL 4KV5F 4S1SH 3B6SA 1E4XL 4GKZB 3ULVF 1BVLB 5EUKA 1IEAB 2W1NA 4G6KL 4MA8H 2GSIA 4U3HA 5GGQH 1OW0C 2AJVL 1WVZA 2Y9RT 4G3YL 3TZVA 1I7UB 4LBEB 2R2EB 1KF9B 2C3VB 4FQJL 4FXKB 2J8UE 5E4EC 5EBMA 4MXQD 4Z7NE 1LO2L 4C55A 5D7JB 3CCHA 1CXLA 1FZOB 4P46B 4Y89A 2Y6SD 3QIWA 5C0AA 4GG6B 3D9AL 2V5MA 3K8KA 4UU9A 5B38B 3WNLA 4PREB 3KPOA 1P4LA 4BH8A 1AFVL 1IFHH 3B9VA 4LIQE 4U1KB 2EYTB 3MV9D 3UBXG 3X17A 1O7SA 4N9GB 3ZHDA 4MJ2A 4K94H 4S1RH 3OKDB 4UIMA 4R96B 5B38G 4JFYA 1JGDB 2QSCL 4RA0C 5I9QB 4MA3B 4RWHA 3C5ZA 5IG7A 1WWWX 2Z4QB 5D2NB 5FYJH 1OM3L 5TGBA 2KL6A 1J11A 3IFPB 3V4VL 5CS7A 1KCVH 4OF0A 3VI3F 1A6TA 3EO9L 1JGLL 5HYFA 4H5SA 4M4PA 4Z7VE 3T4YA 5EBWA 5J1AB 1OT1A 2BVOA 4QXTA 1GGBL 3WYRA 3HNSH 4F7TB 2QR0A 3ZL4L 5EZJA 1GOHA 3SO3C 3VXPB 1KNOB 3GMNA 2XXMB 3RZCC 1AJ7L 1ZS8A 5FYKD 1JZ4A 1OQOA 1OGAA 4G42A 1FLRL 1FPTL 4D0CB 1N26A 1VKXA 3FQUB 5IVXE 1QA9B 5B3JF 1D6EA 2CMRL 4TSAL 2YS4A 1FL6A 3OQ3B 3ZKNC 1G7MA 2A9ML 4WFHD 3NZ8A 5KVGH 4GAFB 4CVWA 5I76A 5E56A 4EBQL 3B5TA 3E0GA 4YDIH 1NSNH 1IGJA 1ZA6B 3HZKA 1IGYA 1TZHA 5FCSH 5D2LB 3VFTB 4LCCC 1U8LA 1JPTH 3MLRH 5HI5D 4D3CL 1FFPA 3MLVH 5GRUH 1N2RB 5ALCL 2BNRB 1CLOH 1J1PL 2OP4L 4OBRA 1IC7L 4I18C 3QAZC 2R56L 4LCWE 3FOMA 3CFEB 1L9NA 5SWZD 3HR5B 1BZQK 3BD3A 2VLRE 5JW4N 3P73A 4X7TB 5EC2A 1WTGT 4JPVH 5TDOA 2DWEA 1M7IB 2IALA 1FVDB 1MJ7L 3EYVA 3T1FB 2Q6WB 4KJQC 2CXGA 4Q2ZB 4QTHB 1T66D 2JTDA 1GZPB 2QQQA 5MENE 4IMLA 1CCZA 4GAGL 4UAOC 4GOSA 4P57A 4LP5A 1AO7E 1RU9L 3GMPA 3MPCA 4MNQD 4Z7WE 4C58B 2R4SL 3GMQA 1IGCH 3HKFA 3DX9B 2E9IA 4P99A 5C7XL 1T0PB 5L8JB 3EOTL 1G7HB 1IRAY 1YEKH 3HAEH 3RWEB 5HYJE 4GRMA 3Q1SH 2Z31C 1EHNA 3KR3H 4RMUA 4CNIB 3PG2A 4MNGA 1P7QD 1UWEL 2DM2A 3MRLA 2XZQL 2X9YA 4TOYH 2XKUA 5HJ3B 7FABH 3MRRB 4J1UA 1F58L 1DE4A 3X3FH 2E7HA 3RGVB 4IHOB 3H9HA 4IRSD 4L8DB 3BWUC 5DD3L 4LSUH 1T1YA 4ODBD 3QEQA 4KVNH 4WGWB 2DIAA 2VJXA 3DYPA 4BK5A 5JUEH 1KTLA 4YXHL 3I75A 4U1JA 1JNHA 5FGCB 3NCFB 3TZVD 1YQVL 1FORH 3FO2A 3DO7B 3QDGD 4H8WL 2OL3H 3E3QC 4GXVL 1CFNA 5C09E 4L3EE 4ONHB 1ZHNB 3KLAA 3QIWD 5C0AD 3QWRD 3IDUA 4MWFA 1NGPH 3BEWA 3QG6B 1UM5H 1NL0L 3V0WH 4YE4H 1I75A 1YMHB 3CFBA 1JNLH 2B39A 2VYRE 3MBEA 4PJXA 2Z92B 4XNYL 1XZ0B 2BC4A 2NR6D 1GVIA 1NJ9A 1IZJA 1Q1JL 4QOKB 5LWYH 1GGYA 3WL9A 5IMLB 1D6VL 4OKVA 4HCRA 2ZOLB 5D93C 5E6IA 4HIEA 2W0FB 5H94A 2ZUQC 3C5ZD 2VUYA 3VFSA 1PX3A 3ULUH 4U1SB 2OK0L 5FHBH 1R3HB 2QHLA 4NM8H 2AI0H 4DZBB 4KY1H 5DJCA 2DQJH 3BPLC 4OUOA 5I1LB 4G6FD 1AQKL 3L5WB 1Z6JT 4KKNA 3O3UN 1FCGA 1Y18A 5EIQA 2RCSH 2VXSL 4PGDB 4JFZL 1OGAD 1CE6B 2AV7A 2CRMA 3PWNB 4Z7UA 1HNFA 5GRJH 2ARJB 3W2DH 2A6DB 5D8JH 2XQBL 1CFSA 4EXKA 3MRHA 5C9KA 1I1AC 4OCRL 4RWYL 5GS0L 1TJIL 2EXYC 1C1EH 1S7XB 4CRPA 3A6BL 3S36X 2XTJD 1UM6H 3RTQB 1RHHB 3H8NA 4HHAB 5CGTA 2FYYB 5C9JB 4GRLB 2MHAA 1QVOB 1LP9F 1MIML 4DWHA 5JW3H 1OAKL 4IM8A 2C1PB 4F7MB 3RVXD 1FRGL 4YLQT 4YQXL 4G6AC 4P2CG 4WI8A 1CQYA 1KPVA 2R8SH 1CGTA 2C5DC 3PHQA 1I7ZA 1TETH 3HB3D 1OP3H 1VERA 4HJGB 4UQ3B 3BKYL 3O6MH 4K8RD 3V7AE 3AGVA 3WS6C 3O9WB 4QKXB 2J8UA 3D0VA 2CIKA 5IBUG 4OD1H 3PWPD 4CKVX 3WFHA 4RGND 3FCTA 3HFMH 4PB0L 4PRHB 5JORA 4JFXA 5FV2A 3AREA 1PZ5A 4L8SB 1IQWL 1ZVYA 2F19H 2NY1B 3TCLA 3C5SB 3MR9B 3HUJF 1GH7A 1KJMB 5KVDH 4NC2B 4Y4FC 3LHPL 3JUZA 5TH2B 4UINH 5EBLA 2VITA 4MQXC 3RVVC 1NBVL 1AE6H 3DRQB 4GW1A 5F9OL 3GSVA 5TDPB 2Y06L 3VXUE 2DF3A 2VIRA 1A9EA 5IIEB 1XGUB 1JYXA 4NZDA 1IAOB 1ZWIA 2A38A 2UWEF 1WIUA 5A1AA 1EEYB 3EYUL 5FA3A 4LVHC 4JO2H 2WBJA 4GS7B 4PYGA 4O2FA 1MF2L 2P8LB 3RWHB 4KK5C 1K4CA 4Z7VA 4OLWL 3WS3A 4LLDA 1TLKA 1RJYB 4U3XA 1L6XA 1U3ZA 4Z5RB 3U7YH 1RZJL 3BSZL 1F4XL 3C9NA 2HT4C 2I07A 1QQDA 3KNBB 2SEBB 5FYLH 2O5ZL 4TNWK 3QH3B 2DQCL 4HIXL 4MNHA 4QHKI 5F3HA 2BHZA 3QEQD 1SY6L 1G0DA 2BMKA 3QO1B 3FQWA 2G5BA 5J6GA 1MFDL 4LSRH 5D7JC 1C8PA 3IJHB 4RQQA 2G75B 1XF2A 3CLEL 1IILE 2FEEL 4OQTL 3G5ZB 2R2BB 5E1HB 3NCJH 4AL8L 4ZDHB 3MREA 3TIEB 2DQHH 4EN3B 3K74B 3DV6A 3OG4B 3MX0A 5C2UB 1Z0NA 2IEPA 3H42L 1JMXA 4NT6B 3QJFA 5JR1H 1H5BB 4FZ8L 2R2HB 3W81A 3H3BC 4D0BB 2FIKA 3ZHLA 2EIBA 3WFEL 5T1KB 5JOPD 4MA8L 1P6FA 5D2NC 4LSQL 2M1KA 4UNTA 5EU4A 5ISZB 2VLRA 3RVUC 2OTUA 5E6ID 2BHYA 1BPVA 3GMLB 4XNMA 5DJ6B 1CS6A 3VXMB 2ICWI 4O51B 1JWUA 5ANME 4HWBL 4XBGA 3D25A 1ED3A 4QNPF 4XHJD 2WINA 1NBZB 4PGEA 3WNNA 4P5MB 3TESA 3WMSA 3WNKA 4DKAA 1UB5B 5H35A 5MENA 3MROA 1KT2B 3QXAB 1X5ZA 1AO7A 3BH9A 3S4SB 4QHMA 5CGYC 2HFEA 3VXRE 5F6IB 3WFBH 5EUOE 1RIHH 4LRNL 5I73B 2F5AH 32C2B 5J56B 3B83A 2VXQL 3BZ4A 2GY7B 4EDXA 4GW5B 2XI9A 3N85L 5HYJA 3O2DA 4DVRH 1DQDL 5HDOA 3MYJB 1EO7A 2I5YL 4BKLA 4BJLA 3B5GA 3UJJH 3HNSL 5AD0B 1IC4H 1T04A 2VZ3A 4TUOA 5JZ7C 3NFNB 5H37G 1ACZA 3JBG7 4D0DB 3K0WA 5A16B 3QDME 5D6DA 2LU4A 2LVEA 4AK1A 3ZTJH 3WFDL 4CADB 5LXGH 3MRKA 4R2GD 3LRGA 4P9ML 4OZIB 4QF1A 4H26B 3KHOA 4L4TE 2QL1A 3TGXA 1OHQA 2FX8H 2XACC 2Y1VA 3MJ8A 2A1WL 2QHRH 4WI9A 1NSNL 4TULL 1KXTB 5IMKB 2XY1A 3QNZB 3H7BB 1CQKA 1MNUH 2AK1H 5C09A 4L3EA 1P4BH 3MACH 1U2CA 3ARED 4IIQB 3SGDI 4R4NC 3O3AB 3MLVL 4AEIH 3L3OA 4MA1B 5E08H 4H1LB 4PJ5E 1ITBB 1INEH 1B4RA 4IRJA 1MAML 3D85B 1YEDA 5HYQA 1FN4B 1MHCA 3OKYA 1OOAA 2ITDB 5LQBH 1U58B 1UH2A 5T1DL 1CVSC 1NAMB 4W6WB 1QSEE 2XFXA 3PWVB 3GK8H 1WBXB 3KPMB 5F8QC 4ZFOA 4GT7A 3EZJB 3C60B 5FO8A 5GRYA 3JV0A 3RVWD 35C8L 4FQ1H 2VDLL 1A4KA 4YHML 4G8IB 4CL7A 3CDGA 4MB3A 2D0HA 3P0VH 4GSDL 2DQGL 3LRSA 1A7NH 1AP2B 4OGAD 1YDPA 4JN1H 1FYTE 3MSPA 3HMXH 1OAZH 3BP4B 3HG1E 5C0GA 4WW1A 1ERNA 4AIXA 1E27B 4JQIH 2HH0H 2YSSB 1LP9B 5T3ZL 5IB1B 4PJDE 4JCLA 3KR3L 1S5IL 3CDFA 1A6PA 3ARSA 4G8GE 4GJTB 3U79A 5IF0A 3STLB 4EI6A 3ES6A 4LLUB 3KGRA 3SE9H 4PP1D 4AJ0A 3LAFA 2EYRB 2WWKT 2F54E 4IS6B 4X5XB 1MELA 5TFSH 1IT9L 1YYML 5DA4A 5EFIA 4LSUL 3OJ2C 1JTOA 2ARWA 3MGOB 4X4YB 3RDTB 4JJHA 4S2SA 3Q3GA 4DW2H 1HINL 1Z2KA 3VFRB 1S7RB 1X5GA 3TN0A 5D1ZB 5DJXB 3EHBC 3QWOA 2VNCA 1M05A 3GGWB 1DN0A 2VLRD 4WU5A 3EO0B 2VXTH 2OL3L 3SGEI 1URLA 3S6CA 3C2SA 1JK8B 2R4RH 1TJHH 2PW1B 1RJLB 3WV0A 3WUWA 5A2IH 2UWEB 5FYJE 4F15C 1JWSB 4HFWA 1MWAA 1CLCA 3CK0H 2CRYA 1U9KA 12E8L 1CGYA 4KTDL 5DHVA 5BRZE 5I74B 4PLOB 4BSVA 1NCBH 5MEND 1ZKAA 4ORZC 3OJDB 3M8OL 2BNQE 3VXUA 1AO7D 3L1OL 3C8HA 4HUWB 3KLDA 1G9MC 4C83B 4F3FB 2H6PB 4PJCE 2FSEA 5GZNC 2FLBT 3T8XA 2ZNWA 5HHME 3S7GA 3NZHL 3P4NA 3QDJE 1UKSA 5E8OB 1MCNA 1J8HB 3DTXA 1Q0XH 3ARBB 3KXFB 4LARL 3SPVB 1CDHA 2AI0L 4Y5XA 1V3KA 1KFAL 4DGYL 3L7FA 4XH2A 3UEZA 2H26B 4MJ5A 4DN4L 1PX4A 4NBZB 5IJKC 3P9MB 3D3VB 1WQVT 2J88L 5HDLA 4NOBA 4EEEA 4ZS6C 1OB1A 3S8WA 1RZGA 3O2VL 1VPOL 3QULA 4GO6B 1ODAA 2ATPB 2R0WH 1QBLL 5GRJL 1XF3B 4NNYB 5I1IL 2ZUSA 1HOCB 4PJGF 4WNQA 4LKCB 2K7PA 5KVEL 4M7LH 1L0YA 4R7NA 4P3DB 1HH6A 2W9DL 4KVCL 3AY4C 4PGZA 3MJ6A 3SDCC 2VDNH 5GJTH 3M17A 5JW3L 4ODTL 4HS3A 4L3ED 4QRPE 1JP5A 2VXVH 1VFAA 5K93A 1MHPH 4WW2F 1BREA 4EVNA 3PP3H 3TFKD 4PY7B 5E2JA 1DN2A 1BGXH 3FQNB 4MVBC 2ADFL 3MLZL 1OAYH 4G9FE 3U46A 2HJFA 3O6ML 4IRJD 4LCIH 4N0YL 4UOJA 1MCWM 3S5LG 4KKBD 2W60A 4Y2DB 4X6DB 3NIGF 4OD1L 4KJWC 3QEGH 1QLRA 3GSWA 5B8CC 3CXDH 4XCNA 3MNVB 3AUVA 4J4PD 3ARGD 3FT4A 4HKXA 1S7TA 3HLAA 5ANMA 4FG6C 1RMFL 2X4UB 4N8CL 3MJ9H 5T33H 1LD9A 2YPKA 5D7LD 1FZJA 3GNML 3WD5L 1ZT7B 4M6ML 5JPNA 5IR1A 4YGAB 5C08B 4JZOB 1A7RL 4JRYB 3EIFA 4YDJA 2NXZC 4LQFL 4Q9RL 3VXRA 4NNXB 1ES0A 4FFYL 5EUOA 3KS0H 4XAWH 2VN4A 1I9RH 3QA3B 4OLEA 5IT2L 2MSPA 4LGPB 5HVGB 3P4OA 1OAXL 4K9EC 5CEZH 3A0OA 4EN3C 4YZFF 2DS4A 3C8KB 2MPAL 1T83A 3MOQA 3D2UB 3U7YL 3A6CH 1FL3A 5DEGA 2LVCA 4W6YB 4YDLB 3WSQL 3IDIA 2YKLL 1GGCH 2R1WB 1A7PH 4FFZH 4ALAH 2RGSA 4NKMA 3JUYA 4MMZC 2AJSL 3QEUB 2H2SD 3QDMA 3BKCL 2MQ0A 1QFOA 4YNYA 3G5YB 5F6HJ 4ZTPL 1F11A 3BPOC 4ZUTB 4HZAA 2LABA 4LVOB 2X4NB 3H9ZA 4JHAH 2WIIB 4JRWA 4LPUA 3E3QE 3HC0A 3VD4A 2ZOKB 4L4TA 4N90D 3TN0D 5J13C 1JBJA 2AKRB 5CMAB 2JJSC 2N7BA 3WN5C 3WJLA 4XVSL 5I1DA 5F7KC 3PL6A 4KHXH 4R3SB 3BPNC 5M95B 1XCTB 1P53A 3QZWB 4Q6IA 3ULUE 4ISVA 2NTFA 4PJ5A 2G60H 2DQDL 4PJ7E 5F6IC 5KS9E 1EXUB 1SEQL 5GJSH 4HT1H 2VRAA 5EOQH 5CEYA 3VXUD 3C8DA 3LS4H 3QUYC 1KEML 1QSEA 5DK3A 4WHYG 3OKEA 5E2UL 3U9UB 3KWWB 1CL7L 1BFVL 5J11C 1B4JL 1CXHA 4JKMA 4WWKA 4ENEC 5ICZB 5FIEA 3VFWB 3S34L 3RKDD 4F33A 1WT5C 3W82A 4OF6A 1KPUA 4WUUD 4JFFE 4P2RE 4CMHB 5CZVL 5TPWL 1ZGLP 3X11A 4B7IA 1I1CA 1WJ3A 3OKMB 3NCYS 1FZKA 1H8OA 1C08A 4X4XA 3QO0B 1MI5B 5B39A 3CC5B 4OQTA 1HYSC 1FYTA 4IOFC 4JFED 5EIIA 1UCBH 1RIHL 4QCIA 3HG1A 5F7HA 4FHBD 2EDYA 4MXWL 3IETA 4GBXA 1S8DB 1YMMB 4DVRL 5BZWA 2AV1A 1Y0LB 4PJDA 3T4AA 1JYNA 1I8LA 3FFDB 1LNUA 1N7MH 4U1HB 1NCAH 3FFCB 3UJJL 4G8GA 2X70A 4TUJA 3PHOB 5EA0L 1BQUA 4YHPA 5IGXH 5IESH 2DKUA 2GT9A 2EDBA 1M71B 1QEWB 1NDGA 2F54A 4PR5B 3RIAF 1ZGLM 2DI9A 5HI4D 4TVPL 4W81A 2GKIA 4HS8H 5M7QA 3VCLA 2NXYC 3QJHA 1FZMB 1TZIA 1QP1A 4Z95L 1OWRM 5MHSD 2X1WL 1WSST 1OW0A 4HH9A 2HA1A 4XNZB 4PRBA 4HWBA 3KPNB 2A9NL 5D6CB 1IGMH 4EQ3A 4KRPB 2O61A 5CJQL 2Y4SA 2NY6C 3MCKB 5CILH 5HHOE 4DVBA 1NAMH 4K23H 2XWJB 2ORBL 1CD1B 1Q72H 1T2QL 1ZT4A 4F37K 4ODWA 4R8WH 2XPGA 2R15A 5F70A 1QZ1A 2UZIH 3G04B 3QNXB 4LOUD 2BVQB 4NN7C 1INEL 2MKWA 3QQ9D 3C08L 5BRZA 2WANA 1PZUB 2L4OA 4GKNB 3REWB 5LQBL 1AIFB 3UC0H 5I2IA 1ZANH 3C6LD 2BNQA 2APVA 5KTEL 1X5FA 1XCQB 3VXRD 5FYLE 1I4FA 3DMMC 4PJCA 3DNKA 1HXMA 5TE7H 3RX5A 5IV2A 5GZOD 3QDJA 4WDIB 3RWGA 1NANI 3G9VA 4LNVA 2IAMC 5L9DH 2JK5B 5HGAB 3RWJA 4PJGB 5HHQB 1V7NH 4U05A 4AG4L 2Q8AH 2IQAB 4DAGL 1QBML 3SDXF 1MFNA 5IFAH 4X6FA 2A74B 3F12B 2EO9A 4OT1H 3GHBH 3QDMD 2HH0L 2OBGA 2FWOA 5H2BB 3SDDB 1AKJB 5JHLL 4GG6E 2EO1A 2VXUH 4NUJB 5I1KH 4L29B 2V17H 3P4LA 3BZEB 4WW2B 1PKQB 4P2OB 3W11C 4I9WE 4JB9L 1MVUA 2B2XL 1UXSA 3A67H 5CINH 2OI9C 2XYCA 1X7QA 4L4TD 4HUXB 2AJ3B 5DRZB 1OGTA 2ZSVA 5IMOB 4POZD 3OWEA 5KOMC 4PP2A 1IMHC 2Y7QB 3ZDXF 2MKLC 1MRDL 1QNZL 4X5LA 1ZLSH 4H20H 3PL6D 4QRPA 4DKFL 1OF2B 4RGMB 5D2NE 2JF1A 4KH2A 4PJ5D 4E0RB 1T22B 1J88A 2VLLA 1HHGA 1NAKH 3VXOA 1KELH 3UPRB 4G9FA 2DLEA 3IT8D 3LD8C 4BELD 2QADC 2CDEB 1XR8B 5EULV 2ZG1A 2JJVA 1FGVH 4M8QB 3CFJA 2EH8L 1QSED 3U0PA 3ARBC 4RGOL 3U6RB 4ETYA 2HG5A 1CK0H 3LN5B 4WWKD 3N50A 3T08A 3BJLA 4ZG1A 1CXIA 1YEIH 2AJZB 4LF3B 1MJUL 4Z78A 3BD4A 3UZQA 1N8ZB 3OZ9H 3HAEA 1EERB 3X13B 3U4BH 3TO2B 5I16A 2DJSA 4XVUC 1MLBB 4CDGC 3RAJL 5E00B 4JG1L 3QRGL 5LBSL 5EC1B 1QKZH 1I8KA 5EU7E 4Z0XB 1I9IL 4TUKH 4N68A 4NP4H 1TPXC 3GFUA 3MLXL 5D7IB 3HG1D 1R5IB 1FO0L 4K2UH 4HXAH 1LE9B 4TVPE 5D2LE 4GBXD 1PSKH 3QHZL 1G9ML 1Q0XL 4UDTA 1KJ2L 4JPWH 1F3RB 2XQYK 1RPQA 1C5CH 2D3VA 5GS1B 2NY4C 4G8GD 4OFPA 4ZUWB 1INDL 2NYYC 1SJVA 4LDEB 3BQUC 2QQNL 4BZ1H 2FH8A 3FO1A 3BISA 4NO2A 2F54D 3HHRB 1OWWA 4R90L 2JB5L 1TNMA 2CKBB 5IB4B 3LVEA 4K7FB 4HGKC 1D5BB 4BSWA 2OL3A 4XPFL 5F1SA 3ZHKA 1J0YA 2FGWL 1F90H 2GAZA 4FN0A 3DX8A 1SYVB 2FO4B 2BK8A 1DQJA 5EPMA 4G6JL 5F1IA 3MLSH 1G6RL 5KJRH 1RIUH 3DV4A 5IKCA 1A14H 4GQ9L 1VADB 4TSBL 3W9DB 3MLTB 1YPZB 3T0EB 4X80L 5DJAA 3VRJB 2FIRT 2JCCF 5FHAL 4WHCA 1T3FA 2OMNA 3HZMA 4N0FB 4J3VA 2Y5TB 5K9KA 4NQXA 5FYJD 5EO0A 2CXKA 2CUHA 2LV4A 4DZ8A 3AU1B 4PJ7A 5CUSH 5A2JH 3WLWD 5KS9A 1NDMB 4G6MH 2X10A 4CVZB 4JHWL 2IG2L 5BRZD 4D94A 5T1MB 1NCWL 1A1OB 3MV8B 5DJZB 2BNQD 3QEGL 1A3LL 4GLRH 4HJJL 4LPYA 2QSVA 4M7KL 2C4FU 4YHYC 5TQ2L 3MJ7A 1WV7T 3FZUD 1LK3H 2UY7A 1FFNB 4PLJD 5HHMD 5F97E 4UNUA 4NKIH 3QDJD 4KAQH 5T33L 2IPTH 3VFUA 2UZXB 3UJIH 4P2RA 2X42A 8FABA 4R4BB 1BIIB 1BBJA 4DTGH 1YZZA 3F62A 5IHUL 3RVTC 4M9PA 1KN2L 5FGCE 1GOGA 4OM1H 2VL5A 1UEMA 4LVOC 3BIBX 4M1DL 5HGBA 3U4AA 3MRNB 4NZUL 3ZKND 3CUPB 1GL4B 2FD6H 4NDMA 1TVBB 1HN1A 3M1BB 5SWQB 5B21A 3H0TB 1U95A 4KMLB 3KVQA 3B4NA 2WWMD 1BAFH 1EDQA 5BV7L 2CK2A 4K9EL 4N8VB 2A77L 4QOKE 4IJ3B 4ALAL 3V5DB 5D4QA 3L6FA 2DQUH 2PXYB 1VENA 4YXLH 1K4DB 1XR9B 1RIVH 3SQBA 3P9LA 3O4OB 4WHYH 5T3XL 5I6XC 4DGVH 3MRJA 4JHAL 3MCLH 3QCVH 4JY4A 4E41D 1T20A 2EDDA 4HX1B 5EZOH 1CF8L 5HHOA 1HCVA 1EVTC 3PV6A 1BD2B 1OARL 1Z3GH 2AXGA 4MSWB 1B6UA 1M7XA 2Y36L 5J12C 3NCYP 3U9PH 1U8PA 3GI8H 3QXUA 4M7JH 4X98B 1DANT 4M02A 4MXVF 1X6LA 5GJSL 4U1NA 3V5KA 4HMDA 4UB0H 2J4WH 2C1OA 1F6AB 4NQUA 3GUTB 1HHHA 3WE6A 1RUMH 3QXWA 2PTTB 5C0FB 3B2VL 2AW2A 3NMEA 5KSVA 1PD6A 3T04D 3CPLB 2F74B 4EQ2A 2CD0A 5L6YL 1K9TA 1Q9KA 5D72H 1FG9C 2WLZA 2A6KB 3TO4D 4QLRA 4G7VL 1PYWB 2J8OA 3U1SH 5CHNA 2DLFH 2WM0A 2WW8A 4YH6A 3ARDD 4ORGA 4LPWA 4QYOB 1HWGB 2EDKA 5FUZL 2YMXL 3QFDB 4KJYB 4GKZA 4FQ2L 5DS8B 1BVLA 3EUUA 1GGIH 1IEAA 5JQ6H 2I26N 4TRPL 3LB6D 4N0CD 4E5XB 1KIPB 1NMCC 1U0QA 2VZVA 1I7UA 4XNZC 4BFIB 4LBEA 4N5ED 2C3VA 1N3NB 4FXKA 2RAMA 4RRPA 1A6ZB 4KRPC 1WZMA 4FQCH 5D7JA 2F5BH 2E9JA 2P48B 4OGXL 5J89A 4PRHE 1P7KB 1FZOA 4MZ3A 4GG6A 3PXJA 4FOMA 3HC4H 5DGQA 1DBML 1PVHA 1B90A 2JELL 5B38A 4PREA 1P4IL 2I60H 4U1KA 2EYTA 1G7LB 3BP5B 2ZCKL 4PGCB 4N9GA 4OCSH 3MFGB 4MLIA 1CTNA 3OKDA 5IEHB 1R5VB 5FGSA 4K7PH 5EDXA 4R96A 4O5LH 3HMWL 1VEMA 3WNPA 4BZYA 4HS8L 5JQHC 1JGDA 4KK8D 4LQ1A 1L6ZA 1HHKB 5D2NA 2Z4QA 1YN7B 2YK1L 3QI9B 3ULUD 4RFEB 1ONQB 3LMJL 3IFPA 1ZTXH 2GJZB 4NIKB 5DTFB 4NPYB 5EOCL 3ECBB 4PJXF 5D71L 5BS0B 1LDSA 5SWSB 4PG9B 5J1AA 1A47A 4DEPB 5EBGA 3HI5L 1OAQL 1GGUA 4F7TA 4GMSH 4LHUB 4CMMB 3VXPA 4R8WL 1BQSA 3BIKB 1ADQL 1UWGL 5FA4B 4ZSOB 2VR4A 4P23B 2OTWB 2BSSB 4HIIB 4D0CA 5L88H 4LEOB 3FQUA 4Y5VB 1QA9A 3TC9A 5CEZE 3QSKB 4NJ9L 3HZYB 4UZGA 2J6EL 1J0KA 4YHIB 3ZYJA 5GHWH 1KBGH 5FK9B 1MLCB 2D4FA 4PRNB 4OF7A 3QUZD 1X6NA 2C9AA 1OCWL 3TIDB 2YHGA 5D2LA 1VGEH 4Y4KC 3VFTA 1UFUA 3P40A 4QGYA 2F8OA 4LGSB 1IM9B 1LGVA 4HK0B 1P9MA 1N2RA 1QO3B 3T0BA 5KVFH 2BNRA 4KRLB 3HCVB 3PP3K 5IVNA 4RGMC 4K3JH 2BRQA 3QUMB 3HR5A 4JGJA 4XHQA 3CLFH 1QTYT 5ISZE 4U1IB 3TT1L 4RX4A 1K8IB 1KOAA 5FO9B 1II4E 1GIGH 3VG9B 2JCCB 4JM4L 1M7IA 5IBLC 1FVDA 5F93C 3VXME 3T1FA 2Q6WA 4ZUSB 4Q2ZA 2H9GB 3A67L 3ZDZF 1PLGL 3MODH 4QTHA 3R06B 2HT3D 1GZPA 1ITCA 2YA1A 5HHOD 1MFEH 3GBML 3JSSA 4FP8H 1QSFB 25C8L 2EYSB 2J8UF 3RA7L 4Z7NF 4UV4H 2BY0A 3DX9A 4FZEH 4H20L 1B2WL 2RJMA 2ZJSH 5TQ0H 1A0QL 4FFWC 4AM0B 5LCVH 3QIUC 1G7HA 2G2RB 2ZCHL 3RWEA 3IVKA 1CLZL 2PN5A 3DUSB 3EYFB 4JDTH 2YD5A 1CU4H 4NM4H 5FDYA 4CNIA 4CJ0A 4JFDD 5EBWB 1SBSH 4GG8B 5FYLD 5HBBA 5GS1C 3NPSC 2YN5A 4KK5D 5HJ3A 3MRRA 2P5WB 4YDKL 3BGMB 3RGVA 4IHOA 2FJFB 1WZ1H 4L8DA 5CJXC 1T80A 5L8KB 2HT4D 3U4BL 1KCSH 2UYLB 1H0DB 3O2WH 3EFDH 4PY8I 1I85C 3WLBB 1BFSA 1RVFL 1D6EB 4OZIE 5TJWK 5AEAA 3QUXB 5LGHL 1SMAA 1BQHB 4ZNCD 3NZ8B 1EEZB 5GRWA 3UDWA 5FM5M 3QPQD 4ONOA 5LGKA 5DD5L 2CKBH 5F7YC 3KPQB 3PP4H 3MZGB 4ODSH 5D7JD 1MCDA 3QIBD 3DO7A 4P46D 4ONHA 1ZHNA 1IGJB 3T0EC 4OCWL 3HZKB 2ICES 3QG6A 4U6VL 3SKUD 5IVXF 1C5CL 3FHAA 5EB9A 4I9WD 1YMHA 4OB5H 3E8UL 3V6OA 4MAUL 3GSUA 3OAYK 2Z92A 1AI1L 5FAAA 1CFQB 2GIYA 3HTLX 5IROC 4QOKA 5IMLA 2X9WA 4WENB 4JREB 2ZOLA 4NJAH 3WDJA 2OXGA 3BKJH 2W0FA 3W0WD 1RZIB 3P73B 2FDBP 4U1SA 2WAHA 2F9BT 1T5XA 3EO1B 3REVB 3RJQB 4OJFH 2H8PB 1KPRB 3EYVB 2F53B 3LN4B 5KJRL 2P5EB 3EDJA 4DZBA 1VFBA 1A14L 5L0QB 4XP1L 1DQML 3FRPA 1CDUA 3OF6A 5C0DB 4MZ2A 3OAUH 5I1LA 3L5WA 5DR5L 1SMOA 1MUJA 3VU2A 5FDWB 1WICA 4PTUB 4PGDA 1QYGL 1CE6A 4I1NB 4YBQD 2HRPH 3SE4A 3PWNA 1KJ3L 1MCPH 2A6DA 5ACLA 4R0LB 4LLMA 4PJFB 2H45A 4YFLI 3Q6GL 5HD8D 1S7XA 1DR9A 3RTQA 1EJ6A 4GRWB 1Z5LB 3T09A 2NMSA 3MV11 3FN3A 1RHHA 4Z7WF 2HT2D 4MNGB 4HHAA 2FYYA 5C9JA 4GRLA 3K1DA 4QHKJ 5E8DL 1QVOA 2ENYA 1LK3L 4KROB 2AGJH 2C1PA 5E24E 3P2TA 4YPGB 1BJ1J 1XF5B 3UJIL 2VKWA 4XWGH 3RUGB 3WDHA 4PG2A 2BNRD 5DD1L 5JZ7D 3MCG1 2I25N 1AD0B 3ELAT 2YBRB 3O9WA 4U1JB 5CAYB 4XPHH 3INUH 3PIQB 1X5HA 3TBTB 1S3KL 1V3JA 2FD6L 2MMXA 3D6GA 1XIWB 4R26H 4PRHA 2FRGP 5E8PB 3TVMB 4L8SA 2UWEE 3C5SA 5KW9H 3MR9A 3K8MA 4HQQH 4ZD3L 1NGYA 4RZCB 1BAFL 2X4SB 5TH2A 2HTKD 3DRQA 4KPHL 5TDPA 1NJ9B 3B9KB 4JQVC 2Y25A 2ICWJ 1XGUA 2IBBA 4YUEL 4OKVB 1IAOA 2EDLA 2GQHA 4OZGB 1UJ3B 4XMPL 5CJ5A 2QBWA 3S88L 5TF1H 1EEYA 4HIEB 5H94B 5DDHB 2PO6B 2PNDA 1J8HE 3MJ9A 3MCLL 3THML 4U6HB 2P8LA 3RWHA 5E5MB 5GGUA 2A0LC 3LEVL 3V4UL 4XMLH 5EZOL 4M6AA 4Y1AD 4Z5RA 2AEQL 2V9RA 4HJ0D 2HYMA 2FEDD 4JM2F 1TTFA 1DBJH 3D3VE 3KNBA 5I1GL 2DAVA 2SEBA 1V7ML 4WFEE 3E2HC 5IMMB 2IQ9H 5GSVB 1EUTA 3QH3A 1ZLWK 3KYOA 3U9PL 3FMGL 1QBAA 3RGVD 1YEHH 4NN5C 2GUOB 5I8KL 2B20A 4JN2B 3QO1A 4JR9L 4JQXA 2XWTB 2J4WL 3IJHA 2G75A 1CIUA 3UCRA 2DIJA 3G5ZA 5FFLA 2R2BA 4YBLC 4KK6D 1JCKA 2ESVB 4ZDHA 4LCYB 3TIEA 3RWIB 1H3TA 3H6JA 5E2VL 4EN3A 4LAJH 4NT6A 1U6AH 3I50H 5ADPH 1LO4H 3U0WL 5JTWA 1H5BA 1EO5A 1F45A 3HI1B 3DETD 2HRLA 1KIUA 5T1KA 4YO0B 1KN4L 3C09B 5CZXC 4QNPE 2PYED 4M1CC 3QI9C 4QOKD 2N4IA 4PRIE 4X6DE 1JJUA 3GO1L 9CGTA 5ISZA 1B88A 4TNWF 1FH5L 4U2YA 3R8BB 2DB8A 1XGQB 3V8CA 3SKJL 4B41A 3GMLA 3ULVC 1AXIB 4KI5D 4O58H 5DJ6A 3VXMA 4FMFA 4O51A 4JFXB 3EHBD 1DEDA 3LV3B 3SGKC 1PZ5B 3SGJC 1NC2D 1NBZA 2I60L 4PBWD 4P5MA 1FGNH 1FIGL 4HG4J 3Q0HA 3HS0B 1UB5A 3RL1B 1KT2A 2X40A 3QXAA 5DMGD 5C08E 4ZS7L 4JRYE 2OTPA 3S4SA 2X89D 2Z35B 3GSVB 1MJJB 4R7DB 4X83A 5BXFB 5E99H 1UM4L 3WJJC 32C2A 3D48R 4PJ8B 3UYRL 4LVNC 3UAJD 5HVWA 2LAAA 2OZ4H 3MYJA 2EKJA 4OBSA 2WZPD 3SKMB 5CBEB 4DUWA 1K4CB 3BUTA 5J3HD 3RTQD 5AD0A 4KZEL 3C9NB 1WT5A 4GRLD 5BMFL 4OLVH 2D7PA 4G7YL 4V2CB 1CG9B 1DP0A 3NFNA 4L8CB 5I17B 4D0DA 5A16A 5C07B 2W07A 1ZVSB 1FDLL 1U92B 2B8OT 4XBEL 4U1GB 4MNHB 2NX5B 4LKXA 4CADA 1OSPH 4I0CC 5IVXB 1NLBH 2BMKB 4XNUH 2FECL 1AR1C 4OZIA 2H1PH 3QUMH 3O9WD 4H26A 3L5XH 2BCKB 1N64H 1VGKB 3MRPB 6FABL 5C70A 1S78C 4WCYL 1IGTB 3O45B 5IMKA 5MEQB 3QNZA 4BSJA 3H7BA 4PRHD 3V8OA 1IAIL 2NY1D 3SCMB 4OIIL 3V6BR 5E2WL 4WWID 2J5LC 2DBJA 3QJFB 5KVFL 4H1LA 1SJEA 1DUYB 3NOIA 2BJMH 3EDDA 3FONB 5I30H 3D85A 3NFPB 1U8JB 3V0VB 2ITDA 2GTZB 1U58A 4LCWB 1NAMA 3DXAB 4FQXC 3PWVA 1GIGL 3UYPA 5GGSB 3CFKB 1WBXA 3KPMA 3FJTA 4KDVA 5EG6C 3MLWH 4OCXL 3C60A 2O5XL 3F58H 3W5NA 2W9LA 4NHUB 2IGFH 4KUCD 3O6KH 1CTOA 2IH3B 2UV3A 4QTIH 1UYWH 3D25B 4G8IA 2YWYA 1CR9L 1S9XA 1MFEL 7CGTA 1KCRH 4FP8L 4UV7L 1Q94B 3S36L 1AP2A 1PQZB 2J6EA 5MP6H 4FG6D 1MI5E 3VD9A 3EJZD 4DKEL 3BDBA 4PS4L 3L9RB 3BP4A 4Z7WB 3FTGB 1YNLL 2CUIA 1E27A 5LCVL 4Z0BL 4JEGB 1EO8L 3V6ZB 4DN3H 3FB5B 2FB4L 2YSSA 3IS0X 4BUGA 4Y4HB 2BSED 2YXFA 3BZ4B 1RUAL 5JIIA 5IB1A 5CEZD 4JDTL 1NFKA 4FXLA 3CFCH 5HYJB 5D1XD 3FFCE 4NM4L 2X1XR 2EXWC 1J7VR 1MRFH 3STLA 1SBSL 1YEJH 4LLUA 1ORQB 5EU5B 3VH8B 3P30L 3QP3A 2V2XB 2EYRA 4IS6A 2HLFC 4X5XA 1LDPH 4XGZA 1YYLH 4FQQB 3MGAA 1WZ1L 3B2UD 4G43B 3MGOA 4Z8FH 4X4YA 1KTDB 4JREC 5I66B 5T1KD 3MXWH 5TE6H 2EEDA 3VFRA 1S7RA 3MRKB 1G7PB 4DQOH 5D1ZA 5DJXA 2W9EL 5ISZD 3PJSB 4DOHB 1WF5A 2CKBL 3GGWA 4HPOH 1NQBA 5C8JB 1UB6A 4C57C 1JK8A 1AC0A 1KIRB 2PW1A 3VXMD 1FFQA 2UWEA 4AZ8A 1IGFL 1JWSA 2XWBB 1KEGH 2APWA 5EORH 1GSMA 4OCNC 2NY0C 3R8QA 2DTML 1JPGA 4KKCC 3OJDA 5F3BB 1FLTX 4HUWA 4NJAL 2CJUH 4R0LC 4JM2B 3OG6B 4C83A 1SEBB 4OI7A 3BKJL 1HCFX 2H6PA 1FVCB 2DLHA 1FSKC 4B50A 5E2TH 2E7CA 1QLFB 4Q7DA 4NN6B 4AY0A 5E8OA 1J8HA 4I13B 1K85A 2FX7L 1YUHB 3ARBA 3KPRD 3KXFA 3SPVA 1A2YA 1FBIH 5FUOL 1A4KB 3QG7H 2H26A 4PJGE 5IQ7L 1OP5H 2P49B 4GRWH 5GRVL 1T7YA 3D3VA 4XC3L 4GQPH 2WIMA 2NY7L 5I71C 3S3SA 4UBDD 1R5WB 1MRCH 2ATPA 3VFNB 4WTWA 2AJXL 2F15A 1LEGB 5C0GB 1XF3A 4NNYA 1E6OL 2C3WA 1GPOH 1HOCA 1HYSD 3S37X 2OR9L 5K9JH 1AXTL 4LKCA 1IBGL 4F7PB 1KIQB 1XIWC 4P3DA 4YGVB 5EZIL 5I18H 4HULB 1MFBL 5DURB 1JNNH 3T3PE 4P5TC 4MD5A 3DVIA 3BESR 1TVDA 3VD5A 1NPUA 1CFTB 1LO3H 3B9KC 2D7NA 1DSFL 4YC2C 4PJDF 3IFNH 4PY7A 1T03L 3FQNA 4UTBH 2BNUB 2HKHH 1UJ3C 3D85D 2V2TB 2AERT 3K81A 3DUUB 2IWGA 3K80A 4Y2DA 4KWUA 4LASL 4X6DA 4UILH 5ECJE 5T5FL 4PJEB 3CZFB 3U30B 3P0YH 1JGVL 2YWZA 5F72S 3KYKH 3MNVA 1IKNC 4WU5B 2WSKA 1DBAH 1RURL 2NY3D 3C60D 2ZCLL 4I0PC 4JO1H 4KKLD 1Q9OB 3QCUH 4U49A 1WCBB 1BWMA 5KW9L 2X4UA 5L2KB 3KJ6H 3V7AG 2I9TB 3VWKC 4HQQL 1DBBL 4BFEA 1ZT7A 2XG5A 1A5FH 1QFWH 4PLKD 3NFSH 1TJGL 4L4VB 3VXNB 2IANE 5C08A 4JZOA 4XPTL 4JRYA 4JHBA 4M3JA 5IVZB 3STBA 3L3HB 3WUWG 3NIDE 1O7VA 2Z8RA 5D7IE 3ARZA 1I3GH 5ESAB 2ILLA 4UT6H 1I7RB 1FQ9C 3QUKA 1A3RH 1JTPA 4JPKL 3UJTL 1ACYL 3C8KA 3L3IB 3TYFB 3D2UA 1AHWC 2QQKL 4XCYB 1A6AB 3D0LB 4XNXL 5DRXB 1DBJL 2R1WA 4UIKL 3UTTE 1CE1L 4PJCF 4YAQB 1U3HB 3QEUA 4QHLB 1RZFL 15C8H 1A6VL 4RAHA 3QULB 1C5BL 3TJEH 5LG1A 3G5YA 5ESQB 3RDTD 4KMTH 1N6QH 1BEYH 2X4NA 3B9EA 3MYZA 4PRDB 2WIIA 5E6YA 1K5NA 2ZOKA 4MB5A 3IU3B 5D1ZD 4R7NB 1HH6B 2AKRA 1YPZE 4MAYB 4PJ9D 5CMAA 3T0EE 3BZFB 5I1HH 4ZTOH 1W8OA 2H32B 3M07A 4TTDC 4RFNC 3O41B 4HC1L 1KACB 2R1YB 3I50L 5DLML 4LSVH 3NCCB 4NQSA 1U8KA 3VD3A 4L9LB 4R3SA 4RCAA 3QZWA 2XA8L 5JHDB 1JI1A 4MCYB 1ORSB 1EXUA 4F9LC 1MY5A 3DRTB 4PJ8C 4U1LB 4MS8D 3ZYOA 1SBBA 3U9UA 3KWWA 2PR4H 5DUPH 5ICZA 4PJIB 3VFWA 4M7LT 2VDRH 3H3PL 4QRRE 4P3CH 5F7EH 3ARBD 3KXFD 1WBYB 3H9SE 3ULVL 1LD9B 1G9NH 1A64A 1A6UL 3OKMA 5CD5D 3U4EB 3D3VD 4LLYB 3QO0A 1MI5A 1BF2A 4L8BB 3JWDH 3CC5A 5C6TL 4XVUD 1HHIB 4YDJB 5HGDB 5DMKB 4HWEL 1ES0B 3CSBA 4MX7B 5IW6B 1A7QL 2Q86B 3IXTB 1S8DA 2GSGA 1YMMA 2MOVA 3GB7B 4OD3H 1P5UA 1QLEL 1Y0LA 3FFDA 3P4OB 4U1HA 1QBBA 3FFCA 3HC3H 2GITB 2X4OB 5TDNB 3IU4L 3V6FB 3PHOA 5IWLA 4O02L 1OLLA 1FL3B 2DIBA 5JNYB 1M71A 4ZAKD 2R0ZL 4ODVL 3L3DA 3I3EA 5JXEC 2OCFD 1S7VB 3VFVB 3WXWL 1T0MB 1FZMA 5K33A 5I1EH 1AQDB 5KSAC 3O81A 5IW1B 3N1FC 5C2BH 5EOCJ 1G0YR 4ZPVA 5F7UA 3KPNA 4Y16C 4ZMAT 2ENSA 5D6CA 5GISH 3VA6A 4JKLA 3LSOB 1SJHB 3OX8B 2X44D 4LEXH 4Y2DD 2DJ4A 1J05B 1CD1A 1IGIH 5C71A 1FNAA 5LKNA 1BD2E 4V1DE 1XGYH 5IBTL 2BVEA 3BN9D 3ROOB 5GRVK 1T6WA 4NWTL 1U3JA 3KYNB 3G04A 2DD8H 3T77B 3QNXA 2BVQA 2DI7A 1TQBB 3DYOA 2QQLL 1D9KB 1YEFH 2D7TH 5EU6B 2H2PC 4Q9QH 1YY9D 4GKNA 3REWA 1AIFA 3MNZB 1I1FB 5C08D 2YD8A 4WUKH 4JRYD 2HLAA 1YECL 1AD9B 1XCQA 5IFHH 1J1XH 3HNTL 4HPYH 3OKEB 4LMQI 4XPAH 1T1ZB 3UTSB 5E9DE 3O6KL 4OCYH 3UP1A 2QJDA 4G80B 4NQCE 4PJ7F 5DEFB 4WDIA 3HE6B 5KS9F 2CDFB 4JLRB 2QSTA 3L3GB 3D2UD 2JK5A 3EOBB 5HGAA 5C0CE 4PJGA 4R4FL 5HHQA 4AMKH 4O00A 1H8SA 3S3PA 4G5ZL 4F37F 2P24B 2IQAA 1E4XH 2VERN 1YNKL 4J3OC 4G6KH 3PGCB 2A74A 4KDWA 3D69A 2AJVH 1OT2A 4FQJH 4M62H 5H2BA 3SDDA 1AKJA 4NUJA 4YEFA 4L29A 5DJ2B 3BZEA 4P2OA 4RA3A 2BSRB 5BZWB 4N8PA 3D9AH 2EC8A 5HI3C 3PDOA 2MQ3A 4HUXA 2AJ3A 5DRZA 1UZ6E 1AFVH 5IMOA 5K9QG 2Y7QA 4YHPB 1YYLL 3IDYB 4JFOB 2V9TA 1DJSA 1X4YA 3GI9L 1WISA 3N1QC 5CWSB 4PV9B 1OF2A 1AGFA 3QNYB 5IEKB 1TZIB 4E0RA 4EI5C 3LIZL 1T22A 3MXWL 2X6MA 1A4JB 3F7VB 3UPRA 3GKWL 4HH9B 5BS0E 3E1F1 1I8IB 5SWSE 5E4EB 4DQOL 1GGTA 2CDEA 1XR8A 5DK0A 3EO9H 2X4QB 3E6FB 3K7UA 4M8QA 1FV1B 4FFVC 5FUCC 3O3DB 1GGBH 3MO1B 3U6RA 3ZL4H 3BRDA 3LN5A 4URTB 2FLRT 4YK4B 1UT9A 4F58L 4ZSOE 1DVFD 1Z0MA 2AJZA 2BOBB 2OJZL 4LF3A 5I8OL 3MRGB 1N8ZA 5ACMA 1WWBX 1HI6B 1W0VB 3JWOC 3X13A 3TO2A 3BX7C 1FPTH 5BW7C 1MLBA 5E00A 2O93L 4LP4A 3O8XC 2CMRH 4ODHL 5EC1A 2IANA 4X6EB 2A9MH 5IM7A 4JVPA 4Z0XA 2B1HH 2CO6B 2HP4A 3RY6C 5D7IA 2E6JA 1R5IA 1I3RA 3HA0A 4XB7A 4EBQH 1LEKB 1M1SA 5GPRA 5HYEA 4KQ4L 1LE9A 1QUNA 2EDOA 1YMMD 1HXMB 1EFXB 3FT2B 1QFUL 3SOBL 4HDIA 2WV3A 4B0MM 2NY2B 5GS1A 3FFCD 2E9BA 3AB0C 4HWNA 3SO3B 4D3CH 4ZUWA 3RZCB 5BOZG 5ALCH 4Z6AT 1WLHA 1J1PH 2OP4H 2BZDA 2XA3A 1IC7H 2Y5EA 2R56H 3N1PC 1AGCB 2EDJA 2CKBA 4CU6A 5IB4A 1I85A 4K7FA 5GGVY 1D5BA 1YN6B 2JCCE 2VH5L 4KTYA 3RPIB 1NCCL 1BFTA 3SQOL 1SYVA 1JFQH 2FO4A 5E0QA 5K9JL 2IPUK 1BX2B 4NFCA 3BFOA 1MJ7H 3TBSB 4KRPD 3JZ7A 1JUFB 1R3JA 1VADA 1UXSB 1R3KB 1HWHB 1YPZA 3OPZL 4KHTL 3T0EA 1IEHA 1QSFE 1Q38A 4WI3A 4LCCB 3VRJA 1EX0A 4GAGH 4UTAL 4NZTL 2PKDA 3SKNB 1IJ9A 4N0FA 1RU9H 3WXVH 5E4IA 2ADGA 4WJ5B 2Y5TA 4GG6F 5C7XH 4I18B 4U3CA 3QAZB 5C1MB 1MAKA 1NDMA 2CPCA 5C0RL 4CVZA 5AG8A 1DUZA 1KJVB 1KB5L 1HHGB 2FX9H 5T1MA 5LVEA 4G9FB 4HS6A 2DOCA 3MV8A 5AYQA 5DJZA 3VFPB 2GW5A 5KSBF 1H9VA 4XVTH 4PLNC 3JWNC 2IPKB 5F7FA 4XMKH 1CXEA 1DBAL 3F5WB 2ZWLT 1UWEH 3B8YA 3HNVL 4FQLL 2P5WE 3SDAC 4IMKC 2I27N 2XZQH 1FFNA 1NEUA 3R1GL 2AJYH 4AEEA 4YHOH 1F58H 2D2OA 4HKBB 3ARPA 5IHZA 1ZVHA 3LKOA 5CD3B 5HDQL 5I1JH 1U3HC 3NFSL 1PG7X 1BIIA 4P2QE 1EA9C 3EW3B 3LKNB 2LAGB 4ZXBC 2Z91B 3MRNA 4HK3J 3CUPA 1YQVH 3HAEG 3QDGB 1U8QB 5DJ0B 1TVBA 2Z31B 1AKJD 3SDDD 4OKDA 1A3RL 1G7QB 1P2CB 3ARFD 3QQNA 3MOAL 3M1BA 4GXVH 5SWQA 3CVHL 2VZUA 5GGVL 4P2OD 3H0TA 1NL0H 3AVEA 1E4JA 1QACA 3PUCA 4YXKH 2ZPKL 2EDNA 3EDFA 4N8VA 1L0QA 4L4JA 5EU3A 2XZCL 1JZ8A 4EDWL 4JZJB 5B3NA 2H32H 3MRQA 3V5DA 2N56A 2PXYA 4JZNB 1K4DA 1Q1JH 4NO2B 3RIFK 4W6XB 2YRPA 2VDML 1A6WL 1XR9A 3MBXL 5D2LF 5GXBB 5EO1B 3U2SB 4KMTL 4O9HH 2GAZB 3DX8B 2F53E 2P5EE 2OK0H 1TZGL 4HX1A 4X8JB 4MXVE 5IBLD 1JHTB 5GS2H 3ARYA 1R24B 1BD2A 2NLJB 1OD7A 2R0KL 4F2MB 4S1DD 1AQKH 4MSWA 5HHXL 1NMAL 1JHLL 1NFIB 2VXSH 4JFZH 4X98A 4JQVA 5EO0B 1KG0B 4PJFE 4I3RL 4YIQB 4PJ7B 5FKPB 2XQBH 8CGTA 4EIZC 4FFWD 1F6AA 3RNKB 5D93B 1NFDF 2CRIA 4OCRH 4RWYH 4HMEA 5GS0H 1TJIH 4GRWE 2ZUQB 2PTTA 5C0FA 1RFDL 3A6BH 3CPLA 5DUPL 2CUMA 2F74A 3ZKSD 3H9YA 2A6KA 3MV7D 2VZTA 1PYWA 3F7RA 5DJYB 1MIMH 4XP4L 3PE9A 1OAKH 1TIUA 2QTEA 4OTXL 1FRGH 4QYOA 3RUGE 3BPLB 5B4MD 3U36B 3QFDA 4KJYA 3I3BA 3VFUB 4C4KT 4JFFB 5C0CA 4WY7L 3JXAA 4P2RB