2DQJH

Crystal structure of hyhel-10 fv (wild-type) complexed with hen egg lysozyme at 1.8a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqjH00
4GBXD 1XGTB 4DGVH 1WJ3A 2K3TA 1U8OA 1C7SA 1TTFA 1LQSR 3EYQC 3BZEB 1CYGA 3QIWA 3VFMA 4ZSOE 4LSRH 4I0PA 1JK8B 4YHIA 4AMKH 2BY0A 4MAYA 2NLJA 2DTSA 5ACZA 3KPMB 3V5DB 4P4RB 5D9SA 5MEOB 4H8WC 4R7DB 2AQ1A 1KEML 1PAMA 4TTGA 4PJIB 1YEFL 3LKOA 3ROOB 5HPOA 5JO5A 3H2WA 5TE6L 3H9YA 5D7JB 1RZJC 1F4XL 4L8CA 4FTVB 1JTTA 2HP4A 4C54A 4NT6B 3DMMD 3AS0A 4N90E 1ZGLP 3UTTA 2FX7L 1KEMH 1YEFH 1NFIB 2JIXA 3GSQA 3TC9A 4DWHA 5I15L 2EKSA 4OD2B 1XF2A 5TE6H 1F4XH 4N9GA 3QG6B 4YWGL 1QQDA 4XVSL 4Y4FD 1GOHA 4DTGL 4L29B 3LPWA 1CF8L 1YQ2A 3KLSA 2EE2A 1D5IL 3NIFE 1ODAA 3QAZB 3KHQA 5GGQL 4PJXB 1S9VA 2FX7H 3FAXA 3QO1B 4NZUL 4QT5A 5I15H 4GRLA 4Z77B 3KPOB 4YWGH 4XVSH 3NABL 1FL6B 1S9YB 4DTGH 2I9TB 5DJ2B 2OSLB 3M17B 1PEWA 1OM3L 1CF8H 2UZYB 5K9KB 2NW2B 3IFLL 4LLUA 1D5IH 2CJUL 3CSYA 3HZMA 3IB4A 2Z4QB 1IFHL 5GGQH 4NN7C 1JGVL 3P4MA 2A6DA 3VD7A 4ZUVA 2EYTA 4NZUH 5LKNA 4C57C 1A7BA 2X7LA 1HI6B 2DI7A 3NABH 5JW3L 3H0TB 4JDTL 1OM3H 4JHAL 3VFOB 1FNFA 1IKFL 3IFLH 2CJUH 2CH8A 4O51A 1IFHH 3QH3A 1JGVH 5FYKU 3CFDB 4CW1B 1TPXB 3E6HB 2LFGA 3QEHB 4R4BB 5HD8C 3H3BC 3TBTA 1ORSA 4RIRB 4ZOEA 3T0EE 4G5ZL 2F5BL 4GW1A 4KJPC 4NWUL 4CJ1A 4XAWL 5JW3H 3O4LA 3CXHK 4JDTH 4JHAH 4X5XA 1IKFH 2DLGA 4X6CB 3DO7B 3CDCA 4FQQA 4D9QE 5BW7A 1YMMA 3ZE0F 2NNAB 4PJ5E 4G5ZH 2F5BH 1FZJB 1HQ4B 4K07A 3ES6A 3QDMA 4NWUH 1O7VA 2BK8A 1TCMA 2YPLB 2IADB 3AVEA 3MYJB 1FL3B 1WAAF 4XAWH 1MCRA 3QIBD 1G1CA 3MLYL 1KENL 2BNQE 4MNHA 2EIZA 3SJVD 1WBXB 3VI3F 5BV7B 3VH8B 1KPRA 3T2OA 4BM7A 1NUFA 4WIQA 1JJUA 2AQ3A 2GSIA 3ARPA 2PN5A 5HVGB 5FB8B 3MA7A 1JF1A 5F89A 5IIEB 1I7ZB 3UTSD 4U3XA 1UB6A 2QQLL 5SWZD 4I5BB 5LAXA 5GGTA 1RK0B 3MLYH 1KENH 1ITCA 1MFBL 3PP4L 1G9NC 4G8EB 4XBGB 4KJYB 2UWEE 3BESR 2W0LA 3KLHD 1X5ZA 3LKSB 1G6VK 3ULUD 1IGJA 1S78C 4XXCA 1EHXA 5J6HB 4YNYB 4AIOA 2QQLH 1C5CL 2Z31A 2B7DT 3B5TA 3VXQB 3WNNA 3SE3C 1MFBH 3PP4H 4K71B 5CD5C 1BBDL 1S7SB 3F7QA 1WCQA 3ULVF 3NCYP 4Z18A 4N0UE 5M7QA 4LFHD 3GSUB 4NKOB 3MGAA 1C5CH 2ADIA 2GTWA 4K9EC 3QULA 2HT2D 1BBDH 1I8MA 4PGZA 1GC1L 2DIAA 3HAEA 4KVNL 1CGXA 3KPLA 4CMMB 4HV8A 1X4YA 3CU7A 1U8IA 3PIQA 4LMQE 1QLRB 4UV7L 1X5IA 3KPRB 4WNQA 3NPSC 1J8HE 1DBBL 4JY4B 4G8GE 5EBLA 4JKMA 1GC1H 2VLKB 3RY4A 5GIRB 1CLZL 3MRHB 5KSUB 4KVNH 2CRIA 2IANA 4L3CA 2UYLA 4UV7H 2V17L 3RPIA 2PTTA 3PHQA 1NKOA 3MNWA 4NNXB 1PDKA 1DBBH 5DUPL 4OZHB 1U2CA 1WBYB 5HYSB 5L7XL 1OL0A 3VXNB 1CLZH 1BOGA 4LLYA 4CVXB 3T3ME 3SDXB 4HC1L 3GJFH 4GG6B 5FECA 4NQSA 3MRPA 2V17H 1EH9A 3BN3B 2NY6C 3RUGE 4XNXL 1BHGA 2CR6A 1A7RL 1QZ1A 4ZPTA 5DUPH 3BP6A 5EPMB 5BRZA 3QUXA 5GGUB 4U6TA 4NRYA 3MFFA 1BREA 5L7XH 1D7FA 2GITB 2PXYD 3BEWA 1RQ5A 3FB7B 4HC1H 3HUJB 5EU5B 5I1AA 1A14L 2LQRA 5CWSA 4EI6B 4OGXL 1T20B 2APTA 3WJLC 1KCKA 1B0WA 3WL9B 4XNXH 3NPSB 2R9HC 3D87B 4KI5C 1A7RH 2AJYL 2C3HA 4HAGA 4LEXL 2WLYA 4DZ8A 1I3GL 2HT3C 1N8ZB 1QFWI 3RGVA 3V4PL 3LV3A 1FVCB 3KPSD 4PPTA 3L5JA 1A14H 5M94B 2NTFA 2EEAA 4OGXH 4NQXA 3IDNB 3OJ2C 4X6BA 1Z0NA 5JORB 4QRQA 1S7UA 4WEMB 5L9DL 4ELMA 4QRPD 5DF0A 1ONQB 1LEIB 1EBAA 2BZDA 4IOFC 2AJYH 4LEXH 5DRWA 3RTQC 5B8CC 4Y5VB 1I3GH 3FQTA 4OZ4B 2DQDL 2FIKA 3V4PH 3WS6A 3KXFA 5J1TC 1U8JA 2GJ6D 4HT1L 3DYMA 4GMSL 5A3ID 2CDFA 3MCG1 4HD9A 1RIVL 3SE9L 2DKUA 3VXUB 5L9DH 4MCZB 4H5SA 2B8OT 1NAML 3Q48A 2WANA 3HRZA 2KKQA 5DHVH 3SPVB 2DQDH 1HYSC 1UXSA 1HHKA 2OR9L 5F7DB 2OTUA 4HT1H 2LAAA 3FRPA 4GMSH 5IM7A 2ZSWA 4YDJB 1RIVH 2XNAA 5K9JL 4G9FE 3SE9H 4M7LT 5JMOC 1NAMH 5FYJE 3C8KB 5I18L 3LKRB 3O8XB 4JEGB 4P2RD 1KSRA 2VZ1A 4LF3B 3MRIB 2OR9H 3VFVA 4OGAD 3DX8A 2V2XB 1QACA 4X7FC 2YRPA 3RNQB 2MFNA 2WUBL 3I75A 4POZD 4LLQB 5K9JH 4KPHH 3IFOB 4PR5B 5I18H 3RTQB 1WIUA 5D6DC 4I2XB 4LDLB 5DGQA 1MCLA 3FB5B 5H2BB 2DL9A 3F7VA 1RY7B 3UJJL 2H45A 4V2CB 4GUPA 4X8JA 2VLRE 4LEOB 2WUBH 3DV6B 4UAOC 5JQ6L 5MEPA 1VPOL 2EYRA 3DX6A 3CK0L 2OCFD 5JHDB 3PNWA 4YO0B 5IV2A 32C2A 1OTTC 4U31A 3UJJH 3KYOB 4HKJB 3TV3L 3PL6C 1IGFL 5BCAA 4NNYB 5JQ6H 5L8JB 1PQZB 1VPOH 4DKDC 3OR7A 4ZS7L 2V7HB 3CK0H 4PRHB 5HSFA 4JM2C 5IK3B 4J4PC 4P5KB 3SQOL 5DURD 4N5ED 3TV3H 1OSZB 3N85L 3VG0L 3V7AE 4TNVK 2IPTL 1IGFH 4UDUB 4KI5E 4D0DA 1E28A 1WFTA 1MAML 4IRSC 1S7QA 3AXLB 3MNVA 2A6IA 1NGXA 4ZS7H 1CICC 1ND0B 3AREC 4YGVA 3ZE0E 5DQ9B 3V7AG 4BYHA 3SQOH 2BNUA 3WUZA 3MV7A 2OL3L 2FZ3B 1DCLA 3QFJD 3TNMA 3GO1L 3IDUA 3N85H 2WIIB 3VG0H 1WAAE 5E8NB 5CBEB 2IPTH 4AT6B 1UZ8B 3VJ6B 5J56B 3BIKB 3VI3E 5EOCJ 3DX7B 5TE4L 1S7WA 1MAMH 4M3KB 3BZ4B 3MJGX 2X4TB 1DBML 4JJHA 1FO0B 1B0GB 5EBMB 3FT2A 3GIVA 5JOFB 1BLNB 2OL3H 3GO1H 5IMLA 1IL1B 3SGJA 4WI9A 4DEPC 1HXYA 5TE4H 1NC4A 1VEMA 4PRPE 3WE6A 3V5HA 1DBMH 3PWVB 4ZOCA 1AQKL 1WT5A 5FFLA 1UH3A 2J6EL 2VR9A 3EOYG 1FCCA 2PO6D 4JFEE 4APQD 1H3UA 3LN4A 2P47B 1HOCA 5I1LA 4XPAL 2I25N 4XXDA 3AS1A 5HGHA 1IVLA 4IRSB 5GGRY 4PJ9D 5IWLA 1Q9WB 4KWUA 3ULVE 4DUVA 4GKNA 3OHXA 1OLLA 3K74B 1WFUA 1CICB 1AQKH 1PKQA 2LVCA 4ZXBA 1C7TA 4UDTA 1WTGT 2J6EH 4P57A 4EBQL 4QOKA 3SE4A 4U1MA 3RDTD 2XKSA 4DN3L 1QRND 2HWZL 5C6TL 5CP7A 1MSPA 3FJTA 4XPAH 4PGDB 1K3IA 1YY8A 1OT2A 1GGBL 2GT9A 3SO3B 4WU5A 2Q76B 2VC2L 1AGEA 2O61B 5D1QA 5B39G 4Z7VF 4N8VA 1YNKL 4EBQH 3BI9X 3LRSA 2QSTA 2GCYB 4PP1C 1DEEA 2AXHA 3NA4A 4DN3H 4XVTL 2HWZH 5C6TH 3TLRA 1LK3L 5ICZA 3GMOA 4QRTA 4XBEL 1GGBH 1JHTB 2HFFB 4JRWA 2ZG2A 3L7EA 3MYZA 1VSCA 5E4IA 3FHAA 3BN9D 5LWYL 2VC2H 2ZUQB 5C2BL 4KGJA 2DQFA 1GSMA 1YNKH 4WWKA 4FXGB 2VQ1A 5EIIA 4D0BB 4XVTH 4LCCB 1LK3H 4XBEH 2FSEB 1B4RA 2EDXA 2AQ2A 2YUXA 5EU6D 4ODWA 2KH2B 5LWYH 4GKZB 1I3UA 2HMID 5CJXC 1XF5B 1F00I 3FCTA 5C2BH 5FGSA 3GJFA 4HZLB 4GFTB 4G6FD 3N1FC 1T2XA 1E4KC 5KVDL 3MV8A 4P23A 1D5BA 1S7RA 1C5BL 5T1LD 1RJZB 5E1HB 2CRZA 5ELIA 4LQ1A 4Y16A 1XF4A 2WIMA 1B4JL 5D7KD 3FQNA 1M6OB 4N1EA 2BC4B 1U6AL 4X8XA 2VUOA 2GKIA 1SEBB 1KJVA 3TYFB 5KVDH 3WFDL 4Y19E 2HVKA 3P77A 1I8LA 1C5BH 4JQXA 3SCMA 1U8MA 3UTPD 3VMOA 2P8PB 3OAZK 1BQSA 1YYML 3MO1A 1WEJL 4EN3D 3KJ6L 2XG4A 4Y88A 5JIIA 1B4JH 3VE0A 4PJHB 1GGCL 1U6AH 3EOBA 3FQXB 3H9SA 4WFED 3C60D 2BSRA 4PTUA 5A1AA 4XNQA 4GRWH 4OZGA 3WFDH 4M7ZC 3L9RA 1VKXB 3VCLA 5AYQA 1A1NB 5I16B 1DSFL 3R8QA 2DICA 1YYMH 3MCLL 1WEJH 2Y36L 4YHPB 3KJ6H 4K8RL 1W72L 4WHYG 3LS5L 1KLUA 4PJAE 1RHHB 2XN9D 4P3DA 1GGCH 1J0KA 1AD0A 3VXME 5D7IB 2GAZB 1XT5A 3I6KA 1KPVA 4ZAKC 2ZUVA 1OOAA 4NSKB 4EDXB 3RHWF 1DSFH 5GS1A 5IQ9B 2X41A 3IDJB 1AIFA 4R0LC 3V5KA 4HCRL 4QTHB 3MCLH 1EEYA 2Y36H 5EFIA 2VDNL 4IHOB 4K8RH 1W72H 3LS5H 1GZQB 2ZUUA 1FLRL 3P4OB 5JTWA 3BO8A 1Z5LB 3WNOA 5SWSB 4GKSA 4XVUC 4RGOL 1G7IA 1N0XL 4NYLB 2NR6C 5GS3A 5KSAA 1HDMA 1NAMA 1UGNA 4I18C 3UPRB 2CK0L 4XH2B 1YDPA 2P42B 1MY5A 2FGZA 3QIWD 4HCRH 5D2NB 4I0PD 2VDNH 2X42A 2E7CA 2EXYC 4MAYD 2XWJB 5CJOL 1FLRH 1FN4A 4PRAA 1MCQA 4GAGL 2BOBA 2Q3AA 2QKIB 4EQ2A 4QHUA 3UP1A 1P7HL 5EZJA 1S7TA 3HNTL 4RGOH 1FZMB 1N0XH 4TULL 2ARWA 1FV1B 3BGMB 2CK0H 2X40A 3MUJA 3KHOA 3MJ9L 3GMPA 4HDIA 2CKBL 2B2XL 4NUJA 3PHSA 5CJOH 1WICA 1CQYA 4GAGH 5FYKD 3UTTD 2J8UA 2LU7A 4ZAKB 2JIXD 1WV7T 3JV4A 4MCYB 3HNTH 1U8KB 1K2DA 2UUDK 4TULH 1PYWA 2BXZA 3QIUB 3ZT7A 4MNGB 3VD5A 3MJ9H 1DBKL 2CKBH 2B2XH 4H1LG 4MVBC 2CUHA 2VZVA 3JXAA 3T8XB 2Z8RA 3EYFA 1K5NA 2P24B 5HVWA 3RZCC 4ENEC 3PV6A 2BCKA 2R56L 4UU9A 5DLML 1I7RA 1BGXL 3U0TB 4XAKD 3TA3A 4GRLD 3L5IA 1H3TA 4WRLA 1V05A 5EZLA 1FFOA 4TUOB 5E03A 3D39A 3DX9A 3TH4T 1DBKH 2I60L 3VFTB 1AGCA 2A0LC 4OV5A 1FYHB 3F12B 3QEQB 1XGRB 4P46C 2R56H 5LBSL 5DLMH 1BGXH 4HLZG 5HHXL 3ZTJG 1UQSB 4RGMB 4X7DC 1Q72L 3O6FA 5HI3D 5C86A 4XCNA 2ICWA 1FIEA 4P2OC 4QRSB 4KKLD 4WTXA 4FZ8L 2I60H 3NCMA 4GBXC 3ARFC 3HB3C 4K3HA 2QADD 4WVRA 5LBSH 1EA9C 4HXBL 1V7NL 5HHXH 1AKJA 3FRUB 1RUQL 3WO3B 1HN1A 1NGZA 1KG0A 1Q72H 1AY1L 4J3TA 4NQCB 1Z3GL 1U9KA 1RZ7L 3O4LD 1RPQA 4F7MB 4NO2B 4FZ8H 4X7SL 3VFUB 3PXJA 5JA9A 2OL3A 3HZVB 1F90L 1RJLA 1W0WB 4QF1B 4GAYB 2AK1L 3MJ8A 4OD1L 3QXUA 4HXBH 5ANMB 2C3GA 3FN0L 1V7NH 4Y4KD 4Z78B 1RUQH 4Q9QL 1YMMD 4JGJA 2NY3D 2Q1EA 4JE4B 1AY1H 1TZIB 3EHBD 1Z3GH 1G7JA 3DMMC 5CGYC 3VA2C 1JWUA 3QDMD 1RZ7H 4LCUB 4X7SH 1UWEL 1S9XA 1P2CB 1U3HB 1F90H 3QRGL 5DSCA 1LK2A 4MB3A 4X9IA 4CGTA 2AK1H 1MUJB 1OGTB 4OD1H 4P46B 5E1AA 4P2CG 4M9OA 2DQIL 3FN0H 2ESVE 2DM7A 4OLUL 4Y4FC 4YFDB 4Q9QH 1CZ8L 2VDLL 1UENA 1MI5A 3QDJE 3TVMA 3KYNA 1I7TB 3GSXA 3PE9A 3AU1B 1R5IA 1JGUL 4K3GA 1RURL 2LTQB 4YIQB 2OM5A 2DWDA 4P2OB 2DMCA 3FO2A 1UWEH 3F5WA 4K55A 4GBXB 4K3EL 3BH8A 3BJ91 1MJJB 2D2OA 4EVNA 3Q6GL 3QRGH 4OTXL 2I24N 4MNQA 3U2SB 4JFQA 1KJ3L 1QR1B 4LVEA 2DQIH 1J7VR 3W5NA 4OLUH 1CZ8H 2VDLH 5KS9F 1HHJB 1L7TL 1JGUH 4P3WA 4Z7VE 1RURH 1X5XA 3MRGA 5IKCB 5GS0L 2ZZUT 2Z31D 4K3EH 3G5YB 4GT7A 3Q6GH 4OTXH 4YJZL 1KJ3H 5CHNA 1X7QB 4WDIB 1EX0A 1ZLUH 4J3XA 5E8EB 4LOUC 1VFOA 4LLWA 1L7TH 2QSVA 3B9EA 3DBXB 3MRRA 3DMMB 1OAUL 5SX4H 5GS0H 5IF0B 2E27L 4P9HL 1GGIL 5EC1A 5IBUB 1HH6B 1O0VA 5DZOA 2VISB 3GFUA 3FQWB 1CQKA 1UCBL 5C09B 2BVOB 3WDJA 4IMLB 1NGQL 4Y4FB 2A74B 4QY8A 5E7FA 2H2PC 4OUUB 4L4TE 1OAUH 2ERJB 3EDDA 2E27H 3TBSA 4LCWE 3FN3A 1GGIH 3MRJB 4LRIA 1WWAX 4P9HH 3V9FA 4WI3A 5CAYB 1LNUB 4ETQA 4F33B 1X44A 1K4CB 1UCBH 4UOW1 3EDEA 2CK2A 4OFIA 5T3ZE 2FBJL 5E2VL 3VW3L 4LK4A 2IAND 1NGQH 1C8PA 4Y1AA 3VXSA 3MR9B 1SQ2N 2OJZL 5J6GA 3A6OA 3NH7L 3QIBC 4NRXB 3T08A 2VSCA 4U2YA 4JZOA 1JYNA 1ZVSA 2R0LL 3OKNA 2XRAL 3ARYA 3PP3K 3RPKA 3TBYB 1WQVT 4AQOA 4ODSL 3VGBA 5I1JL 2FBJH 5E2VH 3UBXB 3VW3H 5FAAA 1RMFL 4NHUA 1LEKA 5M95B 2J8UF 2OJZH 3G5XB 4JQIL 3NH7H 2MMXA 2XY1A 3SKUD 2E6JA 4NQEE 1JZ3A 2IBZY 2JK5A 4JDZA 1GOFA 5BQ7A 5BRZD 2R0LH 5IVXB 4ZD3L 2XRAH 3QUXD 1WC7B 5IB1A 3PWPA 3ULUC 4ODSH 5I1JH 5L2JB 1HSBA 1A6TB 1RMFH 5DJYA 4JZJB 4HUWA 4XWOC 5BS0E 2C4XA 2QJDA 4JQIH 5ETUA 2IG2L 4WI6A 5C92A 5F1OB 1N2RB 5D1ZA 5F70A 4MD0B 4PGBA 5FA3B 4I1NB 4JCMA 3SHSA 5IB2B 4ZD3H 4MLSA 1U58A 2EDQA 5CZXD 1I1YB 4OLXL 3BXNA 5DHYA 5FV2A 1MCFA 4JHBA 3RGVD 1NJ9B 1SVZA 3DUUA 5BV7L 4XP1L 4FQLL 2IG2H 5HYJA 5INDB 3JUYA 1W72A 4RGND 2PYFA 3SDCC 3MNZB 5DK2B 4QHMA 1JNLL 3MRBA 5TQ0L 3L3HA 1EMTL 1HCFX 5C0FB 4OLXH 2NCMA 3ZKMC 1EFQA 1IQDB 4CVZB 3KLAB 2BSSA 5BV7H 5CEYA 3UTSB 4XP1H 1AFVL 3VFWA 3OKKB 5SWZB 4FQLH 1JN6A 4M03A 4HCRA 4J3UA 1R3HB 5LQBL 1CDHA 4ORGB 2D03L 2SEBB 1FG2B 4HKBA 1JNLH 5TQ0H 1EMTH 1FFPA 4LHUG 3R4DA 1CXLA 4YBLC 1CFVL 1DVFA 3HNSL 3DGGB 3U9PL 1A6WL 1AFVH 3MFGB 3HC0A 2R29L 4HW6A 4Q6YA 43CAA 5HDBE 5CD3B 4HIIB 5TE7L 2F19L 4YH6A 2JELL 3T2QA 5LQBH 1IJ9A 2D03H 2Y5TB 1MJ8L 3R0NA 1TNNA 5KVEL 2YBRB 4PY7B 1EEZB 4QNPE 1YPZA 1CFVH 1IAKA 3HNSH 5KSVB 3IYLW 4U1JA 3U9PH 1A6WH 5AUMB 3RVUC 3O3DB 3W39A 2R29H 2X70B 2FEEI 4LAJH 3ZYOA 1D6EB 2HJKA 2R0WL 1UWXK 1F4YL 2OTWA 5TE7H 2F19H 4CADA 2JELH 2CKBA 5JW4M 2JB6B 1MJ8H 5KVEH 2N7BA 2PR4L 1AC6A 2HJFB 5EOTB 5HY9B 2A73A 2Z91A 3RWJB 1T2QL 1P69B 3DSFL 3MLXL 2EDNA 1UKTA 5IJKA 4YDKL 2R0WH 1H3PL 3UROR 3O4OC 1F4YH 4DUWA 1HHGB 3SKOB 3EO1A 4BJLA 4R7NA 5I8EA 2PR4H 1FZOB 5B38B 2AK4A 3IFPA 4YBLB 1T2QH 3DSFH 3QNYB 3MLXH 2FLRT 4GLRI 1DLHA 1JIBA 1A6ZB 4YDKH 3LQMA 1G7MB 1H3PH 4JFYB 2LVEA 3BYYA 5H35A 1XGQA 1QO3A 1N6QL 5IEHB 3DROB 3EIFA 4PBWD 5C3LD 1GOGA 3MV9A 5A3IC 3CH1B 3PWLB 5EU7E 3AGVA 5FIEA 1BQHA 2GTZB 3FT4A 4PJ5B 1MF2L 5ICXA 3STZA 3RAJL 4H20L 3HS0A 5TGBB 4KUCF 3EOAA 2PXYB 1N6QH 5MERB 4O5LL 2YWZA 3L3OA 5IW6B 4IRJA 3T1FB 4HKXB 3MV7D 1LO4L 2V6HA 5FHBL 1L0YA 2RB8A 5LVEA 4LLVA 2BX5A 5GGRA 1II4E 4QRUA 4JANB 1MF2H 1BVKB 3RAJH 2F54B 1MCWW 4H20H 4PTTA 5T5NG 2HFEB 3DHJA 1VGKA 4YHLL 2HJLA 2VLJA 1W0YT 4OGAC 4O5LH 3LEXB 2VLMD 3U9UB 3M07A 2X09A 2NPLX 1LO4H 5FHBH 4POZC 4C55A 2I9LB 4OLVL 1KTDB 2QL1A 1CD1B 2J8OA 3VRLE 1RK1A 1NC4D 4NRZA 3MMEA 4YHLH 4JFFE 3K4ZA 4JPIA 3QA3A 3L5HA 1JUFA 1I1FA 5KS9E 4HG4J 2A6KA 1DUYB 4HIEA 2VLLA 3WLBB 5HI5D 1MHCA 2MTPA 1X3DA 3RY6C 3BPLC 1DE4A 5INCB 3U82B 4OLVH 3G5VB 2YEZA 3U46B 3EYSL 1NBVL 2YWYA 1MLBB 2YC1A 3GSWA 1U92B 4WTZA 4PJBF 2X1XR 1KIQB 4U0QB 5DC0A 1TQBB 4ZXBD 5DK0B 1QD0A 1XGPA 1LVEA 4R7DA 5DD0L 1NFDB 3GI8L 4QOKD 3L3KA 3K1DA 4PJIA 3WUWA 4U1HA 4I0CC 3EYSH 2X4RA 1NBVH 4R2GD 2LV4A 1X4XA 1DQQA 4FTVA 1J8HB 2VAAB 3WIFB 2BY3A 2WLZA 1I85C 4B7LA 4G8GB 4B0MM 3DVGB 5D1QD 4PB9L 5D8JL 3K8LA 4FXLA 4Y5YC 5DD0H 3GI8H 3LN5A 3F6IA 3D85A 5EIVA 4LIQL 5I74C 1VFAB 3KPSE 2IC2A 3D48R 4L29A 4CL7A 5FK9A 1MCPL 5H8DA 2XG5A 1JMXA 3C8HA 3QUYC 3S36L 4F8QA 4JFDE 3CFKB 1JF6A 4PB9H 3RX8A 5D8JH 4WWKD 1TQCB 2AV7B 4PJXA 5I19L 5A43C 2ZUWA 4LIQH 3L5XL 1P4BL 4ETYA 3KPOA 3CPLA 3P73B 3X11A 3RIFF 1FL6A 1S9YA 3B2UD 2H6PA 2CDEB 4X4MA 3RVXC 1MCPH 3C8DA 4HUNB 3S36H 1TJGL 2D9CA 3CXDL 1YPZF 4Z0XA 5I19H 2ICEB 4KQ3L 4U1IB 1EJ6A 4YQXL 3WIHL 3L3DB 2X4OA 3Q2CA 3L5XH 3MV8D 4P23D 1P4BH 1HI6A 3B6SB 4PJ7E 5DURB 5EN2B 4GXUM 4UILL 3RVVD 1P1ZA 4U1GC 4Y16D 1TJGH 4KXZH 3CXDH 2MCG1 4KQ3H 4Y5YB 5DR5L 3QEHA 4YQXH 2M8XA 3WIHH 4PJ9C 4UTBL 3R1GL 4EUPG 1N59A 4RIRA 4CN6A 1RVFL 2GK0B 2NXZC 3SCMD 3QFJB 5GXBB 2AKRB 3PGCB 4UILH 1OSPL 3RDTC 1FO0L 3DO7A 4CVUA 3D0LB 1ORQA 3LSOA 3H9SD 5DR5H 5FO9A 5F9JB 4UTBH 3R1GH 1FRGL 3MREA 3C5JB 1Z9SA 1J05A 1RVFH 4C83A 5I66B 3MRMA 5IROA 3ZZ1A 4HPYL 3M8OL 3T0VA 5DO2D 1K4DB 2ZKHH 2W65A 1OSPH 5D5MF 4OFKA 1FO0H 3JSSA 1WBXA 2E6PA 2VRAA 3F8UB 4KH2A 4F15C 1UM4L 1FRGH 1MPAL 5HGGS 4CN4A 5DD6A 3BN9C 1IM9A 3BH9B 3ZHKA 1OQOA 1HEZB 3OGCB 2EE6A 1I7ZA 3MODL 4JFHE 5C3TA 4HPYH 4MJ6A 3M8OH 2WAHA 2E7HA 5C0CA 2OQJA 4I5BA 1RJYB 4PJEF 3EYVB 1RK0A 2PO6B 2N56A 4HBQA 4MA3B 2PYEA 4Z9KB 4OCSL 4APQB 4RFEA 4U1GB 2GFBA 4XBGA 1UJ3A 4KJYA 5DJ8B 1UM4H 1MPAH 4RFNC 3GSRB 3E6FA 2AXFA 4NO5A 3LKSA 3TH2T 1INEL 3RWGB 3MODH 5J6HA 2D0GA 5KSAD 5HJ3B 4OCWL 3VXQA 2DBJA 4KK9D 4ZO7A 2VR5A 4OCSH 1S7SA 5ID1B 4J3VA 5F6IC 1QRNB 2FYYB 4OF5A 3I85A 3L95A 4JY6B 2DL2A 2WBJA 3RNKA 1ZEAL 1NQBA 1INEH 1OTSD 2G75B 1F02I 2RBLA 4OCWH 1JWMA 1XFPA 1JPGA 3TZVB 5EZOL 1PX4A 3GMLA 1JRHI 2JJSA 4PRDA 1CGSL 3PGDB 2VZ3A 4XNZC 1ZEAH 4QHKJ 3KJ4C 3BISA 2V9QA 5JDSB 3TJHD 3HG1E 2Y72A 1QSFA 2XWTA 1F2XK 3C60C 1AO7E 1YEDB 2YKLL 2R1WA 4L1DA 3SKNA 4HXAL 5EZOH 3QUZA 2VABB 1CGSH 5KW9L 3ZKND 4RFNB 5EU6B 5DQJB 1I75A 3TA3D 1WSST 3IU4L 5T3XL 4TNWK 4OZHA 2YKLH 4G6FB 4HXAH 1GJIA 5HYSA 5F6IB 4LLMB 2K7QA 3SDXA 5KW9H 1T7VA 1QUNA 2BRRL 3LOWA 3OXSB 4U3HA 3O6FD 2F53A 2X4UB 1XR9B 4NO3B 3IU4H 1EAJA 5T3XH 2NX5E 3F7YB 4JAMA 3CFJB 2Q7YB 1HQRB 2EXWC 4ZPVB 1B90A 3FB7A 5EU5A 3CDYA 1AKJD 3G6JF 3BHBB 3QIWC 2BRRH 4XNZB 5C1MB 1CT8B 4JVWA 3KJ4B 3VWJA 1NH6A 1SM3L 4EN3B 4HF5L 2VIRA 3G5ZB 1NLBL 1NLDL 4KRPB 2PCPA 1D5ZB 2WQRA 4PRPB 3QHFL 1DN0B 4KROC 3X13A 4Y7MA 4TVPD 2K9UA 1V3LA 1RFDL 1FVCA 3QNZB 4JFEB 1FNHA 2Q7NA 2WWKT 1SM3H 4RA0C 4HF5H 3C5SB 1NLBH 1NLDH 1RJCA 2FO4B 3QHFH 1KXTB 1WWCA 3RKPA 1U0QA 5HHMD 5KANG 4Y5VA 2DLEA 4KFZC 4OZ4A 4X7TB 1A4KB 1RFDH 4UT6L 2AEPL 3CC5A 2EE3A 1MI5D 3TVMD 4HWZB 1HXMA 5J06A 2XZAL 4LVHC 2D7NA 3Q5OA 5E8DL 3TM6A 4CU7A 3QT2A 1IEBA 3ARVA 2A83B 1U8NB 2GYSA 3MACL 1MCOL 4GXVL 1J0IA 1IKNA 3RJQB 2FIRT 4UOW0 4NC2B 1NCDL 5DYOB 4MNQD 5JA8B 4UT6H 2JJTA 2AEPH 1U8OB 3ZYIA 3QIWB 2R2CA 4YDJA 4I0PB 4YHIB 2XZAH 4MAYB 2NLJB 3WS3B 4C4KT 5E8DH 4PJCF 1KLGA 3GRWL 1CL7L 5ACZB 3C8KA 4LVNC 3MACH 3HE6C 3MBEA 1MCOH 4GXVH 2H3NB 1G9EA 3O8XA 3LKOB 1NCDH 3GNML 3NAAL 5JO5B 3ARDD 4EKXA 4URTB 5DJCA 4L8CB 4LCYA 2V2XA 4MZ2A 5B21A 4PLJD 4KKLC 5C0DB 3V6OC 4LLQA 2JCCF 3MZTA 5DMGD 4JRXA 1B9ZA 4XWGL 3GRWH 1CL7H 4PR5A 4MAUL 2CMRL 4I2XA 1UH4A 5F1IA 3GNMH 3NAAH 3KWWA 1FFNA 1QA9A 1GAFL 3QZWG 4R3SA 1QQDB 3BPNC 1OGAB 1DLFL 1PY4A 5CEXA 4LVHB 4KUCD 4XWGH 4YUEL 4MAUH 2CMRH 3S97C 5JHDA 1S9VB 3Q6FB 1TDQA 5BW7C 1NGPL 4OZFG 2B1AL 4QT5B 2NY3C 4X4YB 4GRLB 3S5LG 1GAFH 4HKJA 4X6EA 3X17A 4NKDA 4Y1AD 2B20A 1DLFH 5J0BA 1P4LA 1NCCL 4ZNEA 5C0AE 5E95B 4LLUB 3CSYB 4YUEH 2FDBP 3ARUA 3BX7C 3DETD 3U4AA 2YOCA 2W9EL 4PLOB 5C08A 1NGPH 4ZUVB 2EYTB 2B1AH 3TBWB 1J1XL 2C26A 2EE9A 2X7LB 3WIHA 4FFWD 3UYPA 4ZUUA 5D2LA 2EKJA 4UDUA 5IHZB 2APVA 4HIHA 1NCCH 2VZOA 4LLAA 3AXLA 3CDGB 2W91A 2NZIA 2QADB 1PZ5B 2W9EH 5KZCD 4ODUB 1ORSB 1J1XH 3WXVL 2FZ3A 4XXCC 4MYWB 1H15A 3N06B 4GW1B 4NUGL 3VXMB 5F21B 4AT6A 4WWID 2QR0B 3BIKA 4YDIL 2Z31C 3F6LA 2P8MA 2XY2A 4X5XB 3DX7A 2JF1A 1X5LA 3BZ4A 5D1ZD 2D4FA 1JNHB 1B0GA 2B1HL 2NY0D 3BKCL 2ZUSA 4JKKA 4PRIE 4Y4KB 5EBMA 5KSBA 4Q9CA 1YMMB 5JOFA 4NDMB 3WXVH 1A3LL 3BRGC 2NY3B 3BRDA 1IAIL 2VUYA 4NUGH 4PJEE 4HS8L 3QDMB 5DGRA 4YDIH 1BJMA 2P48B 5HYJD 1PBYA 3KGRA 1G7LA 2EIZB 2OS7A 3QDGE 5JW4Q 4K8RD 1X5FA 3C6LC 1KPRB 3BKCH 2B1HH 4QHKI 2ATPA 2VZSA 4BQ9A 3SGKA 5C0GB 4E42B 1A3LH 3AS2A 1IAIH 4BZ1L 1G9MC 4HS8H 4JB9L 5LAXB 4OAWA 2AEIT 1A3QA 1OTUD 5E70A 5LCVL 2UZIL 1ZLVH 4M48L 5FM5O 1Q9WA 1L6ZA 4DGYL 4IEFB 3S37L 5IR1A 2B4CL 3V6OE 3D18A 1DVFD 1IGJB 5CGTA 4BZ1H 1T66C 2DM2A 3QYCA 3LQAL 1XIWB 4JB9H 4OIAA 5E08L 4YBQC 2Z31B 5DVKA 4WO4B 4H25B 5JOEA 5LCVH 2UZIH 4M48H 1A3RL 1IC7L 1CDIA 4Z95L 4DGYH 2Q76A 5DMKA 3S37H 2O61A 2B4CH 3QEUB 4P5MB 3HLAB 3LQAH 5DEGA 5E08H 1F13A 3QHZL 2ADIB 2GTWB 3QUXC 2HFFA 5EULV 5K9OA 1A3RH 2Z92B 1I8MB 2CRMA 1IC7H 2L7UA 4Z95H 2FNBA 4YR6A 1A1MA 3KPLB 4GQ9L 1U8IB 2JJUA 3FFCE 3PIQB 4FXGA 1HHIA 2AGJL 4WNQB 1QP1A 3DUHA 3QHZH 4LCCA 5HVFB 4S2SA 5D7LB 4V2BA 2FSEA 5CZXC 1E6JL 4F9LA 2V5MA 4L3EA 1CG9B 5FO8B 4TSAL 4OI7A 4GKZA 2IANB 4GQ9H 5DD1L 2UYLB 2MPAL 4ZQKA 2X9YA 2AK4D 3OXRA 1SMOA 4HZLA 3RPIB 2AGJH 2PTTB 3PHQB 4YHZL 3MNWB 4D9RE 2YD9A 4RGNC 4C58B 5CMAB 4P3CL 3PGFL 1E6JH 2ZSVB 4TSAH 3WS6C 3LD8B 1BOGB 3G6JE 4LLYB 4X6DF 3GBML 4HK3J 5DD1H 2FECL 2MPAH 5FECB 3MRPB 3MV9D 4NIKB 2BC4A 4YHML 1NAKL 5EBWA 4YHZH 1EXUA 3I50L 5BRZB 4P3CH 4ZPTB 3BP6B 3PGFH 4M7JL 4NRYB 3MFFB 3VXRE 4ZOBA 5JZ7D 5C0BE 3BEWB 2D7TL 3GBMH 3K3QA 1JE6A 4IRJD 1CDYA 5CWSB 2M1KA 1J11A 3JV6A 3KPPA 4YHMH 5EWIL 1NAKH 4NJAL 3REVA 1MFAL 2ESVB 3I50H 1NSNL 4ZUWB 3BP4A 4YDLC 4M7JH 5I1DA 1IMHC 4RISL 2F8OA 1YA5A 1TLKA 4R90L 3RGVB 2VLJD 2D7TH 3ZYZA 1GIGL 5CJBA 3MGTA 1RHHA 3HAEG 5MP6L 4AYFA 4RCAA 5EWIH 4NJAH 3TIDA 2GAZA 5HGAB 1MFAH 2VDOL 2YPKA 5BZWA 1YN6B 1S7UB 4ELMB 1NSNH 5D2LF 1KJMA 4EDXA 5DRWB 3BPOC 1KACB 4GSDL 1IZKA 1ZS8B 5IT2L 4Z7VB 3FQTB 2FIKB 4RISH 3OB8A 4R90H 3RX5A 1HCVA 4QTHA 4NZDA 4U6VL 1GIGH 1GZQA 5MP6H 1ROWA 5TPWL 3MRFA 2KDGA 5GS2H 2VDOH 5HXMA 3U0PA 4OI8A 1SYSA 1Y6KR 4H5SB 1T7ZA 1EJOL 2X6MA 3HRZB 4JFOB 4X6FB 4GSDH 5IT2H 3UPRA 1UXSB 5D2NA 2VNCA 1UZ6F 1HHKB 4U6VH 3A0OA 1RUML 3NN8A 2XWJA 4R97B 1TFHA 2OTUB 5DUML 2ZCHL 5TPWH 3ZDXF 2I07A 5E7BA 5HYEA 2XNAB 3MOQA 1ETZA 3DECA 4WCYL 3DO3A 1EJOH 1FZMA 4NC1E 1FV1A 3S4SB 3BGMA 3FZUD 4Z7NF 4FTVD 5DVLA 3ZL4L 4TYUA 3VFVB 4QXGL 1RUMH 4M6ML 3SDAC 4QRRA 3DX8B 3LMJL 4NQTA 5DUMH 1KT2A 2ZCHH 5F7EL 4BQCA 4WCYH 4Q9BA 4PFEA 1UKQA 4FFVD 3V0AC 4AJ0A 3D85D 2FECI 3O45B 1JYVA 3BPOB 4JDVB 2Z35A 3QIUA 3ZL4H 1NC2A 3F7VB 1HKFA 4BFGA 4QXGH 3PDGA 4M6MH 4GUPB 3LMJH 3V79C 2P24A 5F7EH 3P9MB 4X8JB 1M7IB 4WI2A 4HSQA 3IJHA 3NGBC 3CH8A 3MBXL 5T1DL 3K7UA 3DX6B 3KXFE 2E9BA 2IH1A 2ADJA 4NQEB 4KV5E 32C2B 5CS7A 3F58L 5F7YC 3VFTA 1PEZA 2FJGA 1MCBA 3P9LA 1FNEB 3GEWB 4JPVL 3MBXH 5T1DH 1KYOK 3CX5J 1ZVYA 3OR7B 2K1MA 5I1CL 1PG7W 4HK0A 1WT5C 4QRSA 3F58H 4AM0B 5DFTA 4E41E 2PKDA 1UC6A 3CCHB 4D0DB 4PYGA 2IFFL 2EH8L 4JPVH 1E28B 5ID0A 1S7QB 3IS0X 3IJSA 3MNVB 5IWLC 2A6IB 3B8SA 4PJDA 4YGVB 2CUMA 1EFXB 5GRZA 5I1CH 5E2TL 2BNUB 4ZXBC 4XB7A 2HT4D 3CFIC 3TNMB 4NO2A 4YHYB 1CFQA 4TPRL 3SE4C 2DF3A 4OFDA 3BKML 1W0VA 1Z6JT 1W0WA 2IFFH 2EH8H 4R2GC 3NGBB 3JTSA 1C08B 1S7WB 3KYMA 4Z78A 3VGGA 1TZIA 1I9EA 4U1NA 5E2TH 3GIVB 2E3VA 5D1QC 3ZE2E 1QFUL 2V5TA 4G42A 1KB5B 4LCUA 25C8L 3TH3T 5IMLB 3DRQB 1P2CA 4TPRH 5JNYA 1U3HA 1T3FA 1J0JA 3BKMH 4U1LB 2X44D 1VDGA 1MUJA 1HXYB 3U30B 2IFGA 2AERT 1NC4B 5GRVL 1OAXL 1IM9D 1YEGL 1GC1C 4U6HA 1X9QA 3MGOB 2C3WA 4M61B 1QFUH 2XOTA 4HJGA 5C0CD 25C8H 3CSPA 3IKCA 3SGEH 3EGSA 1A7PL 2PYED 3U2SA 5EZIL 1QR1A 4XXDB 5HGHB 2QEJA 3B2UC 3X3GL 1OAXH 1HHJA 1I7UA 4GKNB 5FUCE 3OHXB 4QLRA 1YEGH 4LSPL 2WQ8A 1PKQB 3H9HB 3KS0H 4P9ML 5C0EB 2HFTA 1J9CT 3RX7A 1CIUA 4P57B 4Y0GA 5AG8A 4QOKB 4S11A 1A7PH 3PDOA 4F7PB 1BZ9B 5EZIH 1X7QA 3OF6A 5CP7B 1EEUA 2F8XC 4R2GB 1AGBB 1YY8B 3K0WA 5E8EA 3QPQD 4UMGA 2GT9B 2WBJD 3X3GH 1Q0XL 1ZT4A 2D4DA 4LSPH 3IGAB 4Y4HA 4Y16C 1AGEB 4P9MH 4BKLB 3HPJA 5D1QB 4N8VB 3LRSB 2VISA 5C09A 2BVOA 4OT1L 3SCMC 3GMOB 4IMLA 4ZG1A 4IRZL 1CXKA 4KHTL 3MXWL 1Q0XH 2DWEA 3L7EB 3OWEA 3WSQL 5C07E 2G9HB 2DQFB 5DDHA 5IESL 3RWEA 4WWKB 3FOMA 2HG5A 2VQ1B 1QSFD 5HVHC 4F33A 4Z0BL 2KPNA 5EIIB 2W0PA 1R24A 1K4CA 3QUZD 3UX9B 5ISZA 4MB5A 5E9DE 1N64L 4OT1H 4IRZH 4Z7QE 4KHTH 3MXWH 4X6DE 3NVQA 4IM8A 5CINL 3WSQH 4YC2B 3FCTB 3NCJL 2VQUA 5IESH 2ZNWA 3GJFB 4ONGL 2DM4A 4Z0BH 3DGCR 2YN5A 3MV8B 4P23B 1D5BB 3HA0A 4NQDA 1N64H 1S7RB 5E6IA 3IDYB 3UBXA 1FE8L 5GS1C 4OZIA 1XF3B 3ZDZF 3BGFB 4XVJL 1VB9A 5CINH 3BWAB 3OMZA 3NCJH 4Y16B 1GH7A 2F53D 1ZLUK 3FQNB 1JZ4A 4XNMA 2IBZX 3CLEL 4ONGH 3BRFA 1KJVB 4LASL 4JQVA 4YPGB 5HI4D 5L2JA 3P77B 2C1OA 1FE8H 4JZJA 1H3GA 3S36X 4XVJH 4GAJL 3EFFB 3HRPA 3VWJD 3IDIB 4MJIA 4NN6B 3KAAA 1IQWL 4MD0A 3VE0B 1JWSA 3VGAC 4RRPA 3H9SB 3DWTA 2XTJD 5HVHB 5I1GL 4LASH 2BSRB 4PTUB 3ARTA 4XNQB 3JV0A 4OKVA 5CKGA 1S5HA 3L9RB 1KCUL 2G5BB 3VCLB 4M93B 3O9WB 4GAJH 4OJFL 5CJ8A 1W2KT 4U7SA 3G04A 1KXQE 1ZOXA 1UEYA 3QUKB 1IQWH 3IJYA 5J57B 4M5YL 3QNXA 5E0QA 1OHQA 2F9BT 1AD0B 3MNZA 5I1GH 4ZSOA 3HPLB 5C0FA 1IM3A 5D6CB 1IQDA 4CVZA 2X9WA 1KCUH 4AEHL 3TJHC 4HQQL 3OV6A 1AIFB 2OYPA 3V5KB 4OJFH 4XTRC 1EEYB 5EFIB 4JVPA 4PJDF 1KCSL 3ZDXE 3IVKB 1FYTE 1R3HA 4M5YH 4WI7A 3L7FA 3BO8B 1FG2A 2XXMB 3AFLA 4NM8L 4Q7DA 3ZKNC 2DLFL 4GKSB 4K7PY 4BZ2L 4AEHH 1S9KC 4EI5A 4PG2A 1CTNA 1EZVY 1A9BB 2JTDA 4HQQH 1QRKA 5KSAB 1HDMB 3KPQA 1MIML 1YDPB 3BUYB 4PG9A 4KGLA 5GSRA 1MJUL 3NA9L 5CD3A 1KCSH 4HIIA 3QB7C 3OTTA 4PRAB 3VGAB 2YBRA 3MBED 2BOBB 4NM8H 2DLFH 1EEZA 3O8XD 4BZ2H 4QHUB 5IMOA 4J8RA 5EZJB 5C0JA 1S7TB 4W70A 4POUB 2NXYD 3O6FC 4JFZL 1MIMH 2X70A 4WHDA 3NIGF 4HDIB 3MTRA 4NUJB 5FA4A 3NA9H 1L0QA 5EUOF 4JRXD 4OZGE 2JB6A 4PLNC 4ZFZA 4FS0A 4BSJA 2J8UB 4IDJL 5EOTA 2UV3A 5HY9A 2IBGA 5ALBL 1UA6L 3JV4B 2Q8AL 1U8QB 4YZFF 4JFZH 2NY1C 1PYWB 4YX2L 4KI1A 5T1MA 2BNRE 3OKYA 3ZDYF 1UM6L 1AD9A 1BVLB 1HHGA 3SKOA 2W38A 1K5NB 5HHPB 5FDWA 3ZKXC 6FABL 4LKXA 4NFDA 3PV6B 2BCKB 4UU9B 4X7EC 1I7RB 4IDJH 3BP5B 5F1SA 5ICYB 5ALBH 1OAZH 1UA6H 2Q8AH 4RMSA 3TA3B 4YX2H 5EZLB 1FFOB 1A6ZA 2WUCL 5F1NB 1F3RB 3BGAA 1UM6H 1G7MA 3K2UL 4WW1A 3T0EA 4JFYA 4A6YB 1AGCB 4OV5B 4PJ8D 4E0RB 1X6LA 6FABH 4HGWB 1V3MA 1LGVA 2HVJA 1JYWA 5C08D 1HHHB 1A1OA 5DRNA 3TVMC 1ZHBB 1LP9E 4YHKL 5KAQG 2IALB 3O6FB 3CSGA 4XCNB 5J9PA 3GJEB 2FGWL 2WUCH 4L9LA 4LBEB 3O2WL 4Y89A 2GTZA 4AL8L 3K2UH 1JMZA 1S8DB 4JG0L 4PJ5A 4Z7WF 4UTAL 5TGBA 3C87A 2AJSL 1I1AC 4EEEA 5EO1A 4K3JL 3L3JA 2BNQA 4OQTL 4HWNA 4HKXA 1NGZB 4YHKH 2XZZA 1CDCA 2WWKO 4J23A 1QLEL 2FGWH 3AY4A 4MMZC 3O2WH 4AL8H 4JG0H 3DXAE 3HTLX 2F54A 2OL3B 4UTAH 2HFEA 3FN9A 1X5JA 2AJSH 1RJLB 3ABZA 5FDYA 5CZVL 3T1WA 3ZKXB 2X4PB 4H0GA 5DMJB 3TO4A 4K3JH 3TCLA 4PLJC 3P3YA 3ULVL 4OQTH 2ENSA 5DMGC 4FQ2L 2R2EB 1G7JB 2UWEA 4YFEA 1TNMA 1QLEH 1JWUB 4OZIF 1CD1A 5HHMB 1S9XB 1CXHA 2VOTA 1LDSA 1Q8MA 4KTDL 1LK2B 5DSCB 5CZVH 2GIYA 4RAVA 4L8SB 3DLQR 1KFAL 4HS3A 1KIRB 3D39E 3F7RA 3MV11 3WJJA 3ULVH 4KZEL 1KIPA 3TVMB 3KYNB 3GSXB 4U3CA 4N5UA 4ZFOB 4FQ2H 1BD2E 3QBTB 4NN5B 5INCA 3G5VA 3QQ4A 3KYAA 4LRIC 3BW9A 4KJWD 3UCRA 3BH8B 4N0UA 4EVNB 4KTDH 1MLBA 4JFQB 1KFAH 1U92A 4ONHB 3T0WA 4HIJA 3PQYE 3GHBL 4KZEH 3T09A 3MX0A 3ISWA 1IILE 3OR6B 1J0HA 1RZKL 4X98A 5AZEL 3I2CL 3MRGB 1BFTA 3DETC 4L8BB 5JW5B 1DTUA 3V4VL 3GMNA 5C7XL 2FL5A 2E9JA 4JJ5A 3ARDB 1J8HA 1ZT1B 2EIDA 2VAAA 4OQ1A 2YRZA 5CHNB 4FFWC 3GSVA 3HG1B 3GHBH 4G8GA 3VMNA 1ZVHA 1TVHB 1JPTL 1RZKH 1JHLL 5AZEH 3I2CH 1I8KA 4IIQA 4R4FL 2KUTA 4RMWA 3V4VH 3IS1X 5EC1B 5C7XH 1YJDL 3X3FL 4MB4A 3VDCA 1G6RB 5JHLL 1OAQL 5MEQB 4BFBD 5FM4A 5GHWL 4FQHA 4JLRA 1JPTH 2P1YA 1JHLH 4QY8B 5DA0B 5DD5L 5DRZB 5C0IA 4R4FH 5D1ZC 3VFNA 3TBSB 1BF8A 1YJDH 2NY0C 3X3FH 2JJVA 1B6UA 3P73A 4ETQB 4IOIB 1H5BC 4L3ED 1OAQH 3RUGA 5JHLH 2CDEA 3ZDZE 5GHWH 2EDOA 2YUVA 2VN4A 5JOPD 5J6GB 1JP5A 5DD5H 1LDPL 2ICEA 3SGDI 3TBVA 3NIFF 3L3DA 4JZOB 4NBYB 2IGFL 4K8RC 4WV1B 1ZVSB 3OKNB 3HKFA 5E4EC 3CXHJ 1LEGA 1DANT 4X99B 3VFGL 1LEKB 1U42A 3AUVA 1FG9C 2BVQB 3RIAF 1PY9A 1D5MB 4ESKA 1LDPH 1OTUC 3P0GB 1RHFA 2HYMA 3B5GA 2JK5B 4JDZB 4J12A 3QEGL 1VHPA 2IGFH 2R2HA 3O2VL 4PJGF 2GK0A 1FQ9C 2IWGA 4F80A 3GBNL 5IB1B 2P5EE 2AKRA 3VFGH 4K7PL 1KGCE 4WENB 3GMRA 4HUWB 2VWEE 1T0MB 4PRBB 5ETUB 4W6YB 3LVEA 1RD6A 2KBGA 5MENE 3QEGH 3C5JA 3UJTL 4PJBB 2DYPA 4PGBB 3ARGA 2DM3A 3WYRA 3O2VH 4OFVA 4FMFA 4I0KA 2NY0B 1UCTA 1U58B 3GBNH 1OP9A 3MRNB 4MJ2A 5DHYB 1T1YB 4M6AA 4K7PH 4H0HB 3DUUB 5BVPL 4HEME 4G8IA 4A2LA 3AAZA 5C0ND 1VFMA 2AW2A 5HYJB 4O2CA 3S34L 3UJTH 5ILTL 3BH9A 1JI2A 2PYFB 1HEZA 1T2JA 4QHMB 4Y1AE 3MRBB 3VXSE 3L3HB 4G9FA 2VB5A 1RJYA 5A2LH 2BSSB 4ZYKB 5E6ZA 2PO6A 5CEYB 5BVPH 4APQA 5IJKC 1EGJL 2F5AL 1JN6B 2AJZA 2MWCA 5DJ8A 5I17B 4GRMA 1L9NA 1Y18A 2GJJA 2ITCB 4HZAA 3S34H 2P43B 1RZGA 2NQCA 1A8JH 5ILTH 4HKBB 3RWGA 1ZGLM 3MLWL 1FFPB 1DVFB 5AYUL 1T7WA 3HC0B 5ID1A 1EGJH 1WFNA 2F5AH 2ILLA 4U49A 5BVJB 3S96B 1GHFL 4JY6A 5DJXB 3PWPE 1AXSA 5IOPA 4WI4A 5DFVC 1OF2B 1HH9B 3SKJL 4GRWE 2VLRA 3MLWH 4YZFE 1YPZB 3LKQA 5AYUH 4U1JB 4KC3B 3W39B 3TZVA 4QRRD 1T7YA 3L1OL 2HJKB 1GHFH 2J12B 4V1DB 3PGDA 2XPGA 4CADB 1D5XA 2CKBB 5JZ7C 3BE1L 3SKJH 5FUZL 3ILQD 1TVBA 4FFYL 4IRJC 2R8SL 1BEYL 1NC2D 4X6CF 1AHWB 5FYJU 2FHFA 4HLZH 5A16A 4OSUL 2MJWA 4X5WA 3L1OH 3S37X 1ZA3A 1U8LA 1QKZL 1K3ZA 4C56D 3BE1H 3EO9L 5FUZH 4FFYH 4R7NB 1MELA 2NY4D 2C9AA 4UT9L 3FOLA 2R8SH 2AK4B 3IFPB 1BEYH 1YEJL 4K94L 5GZND 2CLZA 4OSUH 4Z7WE 3DURB 2N1KA 1A7OL 1FPTL 5I8CA 2ZNXA 5ITFA 3JBG7 1QKZH 1WAAA 3TO2A 5H35B 3EO9H 3FTGA 1XGQB 1QO3B 3W5MA 5D5MB 4CMHB 4UT9H 3GSOB 3MV9B 1YEJH 2VAJA 4K94H 4MDJB 2HLAA 5CEZD 4PRIB 1BQHB 2Q7YA 3FT4B 2V5YA 1A7OH 1A02N 1FPTH 2AJUL 3V8OA 5ICXB 3I3BA 3H3PL 5BXFB 3HS0B 3T3MF 3EOAB 1Q0YL 4EN3A 1N5AB 3L3OB 4IRJB 4D0CA 4P2QE 4PRPA 1DN0A 3QDGB 4OQTA 2AEWA 1P4IL 4AEFA 2P46B 1HSAA 4IOSD 5D7JC 5GS0C 2AJUH 4MD4B 3H3PH 3QNZA 4PTTB 1NUDA 1VGKB 3ET9F 4JFEA 2AVGA 2VLJB 1Q0YH 2DMKA 1ZA6B 4W6XB 3C5SA 4RBPH 2FO4A 3UYRL 2FJHB 2J5LB 4OKDA 1P4IH 1U3HD 2Q86A 4M1CD 3T0AA 2A9ML 2J88L 3IDMA 1RK1B 4P9HC 4NRZB 2XFXA 4JPIB 3QA3B 1OB1B 1I1FB 4LSRL 4M43L 5FKAA 3W0WB 5B39A 2A6KB 5EB9A 1CXFA 3UYRH 1IZJA 4HIEB 2VLLB 4LP4A 3UC0L 1ZTXL 1MHCB 4MXQD 3RWIA 1U93A 2QHRL 1DE4B 3BMVA 1F3DJ 5SX5H 5DYOA 2A9MH 2BVTA 2FRGP 2YEZB 2J88H 1XCQA 1U2HA 1IGTA 4OGZA 2DRUA 4KTYA 1MOEA 1CCZA 4XI5D 2YC1B 3GSWB 4WFHD 4BA8A 4M43H 4I9WE 4DK3A 1U36A 5L88L 3WS3A 4WUUE 2X9XA 3MRDB 3UTQA 1XGPB 3UC0H 1ZTXH 1J1PL 4ERSL 2H3NA 2QHRH 3L3KB 2MQ3A 3WUWB 4U1HB 5IJVB 4GG6F 3OF6D 2X4RB 1ZXQA 3AROA 1NMBL 5DC4B 1DQQB 4J1UA 4PJFE 5C0DA 3H7BB 2PUQT 5L88H 4Y4HD 4JM2A 1R5VA 3C6SB 4UQ2B 4G8FA 4WFFE 1J1PH 1TPXC 1KXVC 4ERSH 1N6VA 1GYAA 3VMPA 3GDBA 3LN5B 3D85B 3FO9A 2DIJA 5C09D 2W1NA 1A47A 3LAFA 1OY3B 1QBLL 1NMBH 4GMTL 1OWWA 4M00A 3VI4E 1OGAA 4L9DA 1LD9A 5FK9B 2VKWA 1DUZA 3TNNA 3Q6FA 3ZSTA 4S1DD 1QPXA 3BAEL 4X4YA 3G9AB 5ISZD 1QFWM 1QBLH 5IROC 4GMTH 3CPLB 4MJ4A 3X11B 2H6PB 4TRPL 15C8L 2E9WA 5DEFA 2GW5A 3VD3A 5GRYA 3A67L 5BV7C 4Z0XB 2DKSA 3CAFA 3QI9B 1BWMA 1MAJA 5FGRA 1RZFL 4PJGE 3TBWA 2X4OB 1S9WA 3BAEH 2RR3A 4NQDD 4L1HA 3WDIA 5E6ID 1OP5H 4O02L 5IHZA 5A2KH 4TRPH 15C8H 1DQML 2P44B 1P1ZB 3CDGA 3A67H 1F4WL 5L2KB 3ILPB 3QO0B 3MRQA 2P8LB 1QBML 4LU5L 5I6XB 1UG9A 1PZ5A 1UJ3C 2AXGB 4OUOA 4KK6D 1RZFH 4ODUA 5J11B 1N59B 3M1BA 4PJAA 3RBGA 2PW2A 3K80A 4K7FA 3VXMA 1IGML 4O02H 2QR0A 1DQMH 3ORJA 1ERNA 4KI5F 4MJID 4K71C 3O81A 4DFIA 3TFKD 1F4WH 2BJML 4JM4L 4LU5H 1QBMH 2HA1A 1ORQB 3LSOB 4N8PA 1JNHA 3QPQC 1GXEA 4Y4KA 1KB5L 5FO9B 2WBJC 3MREB 4NDMA 1J05B 2GJZA 3BT2L 4C83B 3T2PA 3MRMB 4PJCB 2H32B 1IGMH 7CGTA 2VDQL 5LJYH 1AH1A 4PJXE 3MJ7A 2W65B 2BHUA 2BJMH 4JM4H 3V6ZA 2P4AB 2JJSC 4RFOL 2ARJQ 3GHEL 1KB5H 2P5WE 5T1KA 5C0GA 4E42A 5DD6B 3BT2H 2JCCB 1IM9B 5GS2D 5JMRA 5FKPA 1IAMA 1P7KA 4MJ6B 1QFHA 4LSSL 2VDQH 5C0CB 2OQJB 2VZTA 3TJEL 1AQDA 2PYEB 2ZOLA 4RFEB 3QUZC 1ZSDA 2GFBB 4RFOH 1UJ3B 3GHEH 1EGJA 5DT1L 1GGYA 1C1EL 4Y2DA 5K59E 2J2ZA 4KMLB 1QFWL 1QSEE 2AXFB 3E6FB 4NO5B 4N90D 4EI5D 1FL5A 4WFGE 4H1LA 1F58L 1XIWA 4LSSH 3SDDD 1T1XB 3TJEH 1N4XL 4WO4A 4H25A 3U7WL 1NEUA 2Y9RT 3L95B 5DT1H 3TPUA 2WBJB 1C1EH 3RNKB 2VDRL 1QFWH 1IAOB 5I73C 3QEUA 3V6BR 4P5MA 3HLAA 5F93C 4X6CE 1F58H 1FFRA 1DQDL 3JWDL 4BH7A 1C5DA 2P7TB 3BEVB 1JWMB 1N4XH 3U7WH 1JPGB 5HI4C 2Z92A 3GMLB 5EG6C 5CILL 4DAGL 4YXHL 4PRDB 3KPNB 2YPLE 4AEEA 2VDRH 1M05B 3VWJC 1JPST 3LEYL 1DQDH 3JWDH 3AB0B 1P53A 1QSFB 2XWTB 5D7LA 4OF8A 1GGUA 2R1WB 3SKNB 1CG9A 5FO8A 4MZ3A 3QUZB 1ITBB 1S7VA 5CILH 4DAGH 4YXHH 5KBNC 3S35L 1VGEL 2DB8A 1NBZB 3VH8G 3PWJA 1IGCL 4E41B 4HEPG 2V9TA 1HIML 1ZLVK 3LEYH 1Z9LA 4YLQT 1OPGL 1A22B 5CMAA 1VFUA 4UQ3B 4Y5VC 3T0ED 5CSZB 5FCSH 2ZCKL 2ZSVA 3B83A 4HWBL 4M7LL 4JM2F 1BFOA 1IC1A 3O41B 4XCFL 3PHOA 1ACZA 3S35H 1VGEH 3J8F7 5GZOD 3QJFA 4NQUA 2DJSA 1IGCH 5I73B 1YNTA 3ETBF 1HIMH 5I8OL 4D9QD 2F53B 4BK4A 4OFYA 1OPGH 1JGDB 3MZGB 1XF1A 4PJ5D 2ZCKH 3V7MA 1IKNC 3H3KA 4HWBH 5E8OB 4JAMB 4M7LH 2OI9C 4XCFH 2JJTC 1CK0L 5EIQA 4C59B 2EDKA 1I4FA 2BNQD 1CN4A 4LCIL 3VWJB 4G9DB 4UZGA 5I8OH 4L4JA 1ZGLA 2VIRB 2C4FT 4XMPL 2ESVA 3EYQD 2XV6B 2PCPB 1JGEB 4ZUWA 3VA6A 1M7DB 2XTJB 2X10A 5KVMC 2DJUA 3X13B 2F54D 3O8XC 5CP3H 4FQXA 1X5HA 3VFPB 1CK0H 2NXYC 3KPRE 1T5XA 3TO4D 4F37K 2CRYA 2CIKA 3OKOB 3M45A 3BZDA 5GRWA 4LCIH 5HGAA 2VLKE 1YN6A 4XMPH 2W59A 2YRLA 1ZS8A 3EFDL 4Z7VA 2APFA 2W07A 1R3KB 2IMMA 1G0YR 1A7NL 3CC5B 5IHUL 2C3VB 3J7HA 2DD8L 4OZHE 5L0QB 4JRYE 1HXMB 3O3AB 1IARB 3X14A 4HIXL 4PJAF 2GY7B 4LGRB 1UXWA 1WZMA 4JY5L 3NOIA 1IEBB 4OCNC 3SDXE 4JFOA 4X6FA 4PYHA 4GG6E 3EFDH 3T4YB 4BSVA 2FHBA 1SEQL 2OI9B 2CXKA 3V0VB 1A7NH 4NWTL 5HYSG 5IHUH 4RX4A 2DD8H 2DQJL 4HIXH 1MFCL 4KPHL 1EO5A 3MXVL 1RU9L 1KLGB 5TF1L 4JY5H 5E8PA 4MA7L 4OIBA 3HUJE 3MBEB 4FOMA 2GK2A 4X7CC 1WZ1L 3S4SA 3ALPA 4L4TA 3U4BL 1SEQH 1J8HD 1NMCB 2NXYB 4NWTH 4LCWA 5DJCB 1P9MA 4LCYB 4PIRF 4G8GD 2DQJH 1JZ2A 4I4WB 3DI3B 1GZPA 1MFCH 4JRXB 4CVWA 4OCXL 4NBZB 3MXVH 1AGFA 1RU9H 5TF1H 1ACYL 1HYRC 3L3IA 4MA7H 3O45A 1X5GA 4POYA 5J13C 4JDVA 1WZ1H 5F1IB 3U4BH 3VWKA 3KWWB 1FFNB 3WNLA 5TFSL 1T83C 1QA9B 3HN3A 1T04A 4PJHF 4RWHA 4R3SB 4XCYA 3P9MA 4KRMB 5DRXA 1KNOA 1M7IA 3D69B 4AK1A 3GK8L 3H7LA 3NFNA 3GBLA 4OCXH 1CDJA 5CEXB 1ACYH 4U0RC 4DGIL 4NZJA 1T0NA 1U8PB 1KPUB 3HC3L 4A6YL 4NQEA 5TFSH 1MCWM 1T6VN 3VXUE 4JKWA 2NZ9C 4X6EB 4NKDB 2HKHL 2X1QA 4ONFL 2C1PA 2ZWLT 4RMRA 1FNEA 2J7LA 1P4LB 5TDPA 3GK8H 5H94A 4PJ8B 1FJ1B 2N7AA 4LHJB 2XKUA 2COQA 3P4NB 4DGIH 5E00B 3W9EA 3WFBL 2KZWA 3HC3H 4IMKA 5BS0A 3OAZH 5C08B 3SGKC 4A6YH 5ENWB 4AM0A 4ZUUB 2HKHH 5D2LB 3CGTA 4ONFH 3CCHA 4MD5B 2QQKL 4HIHB 5ESAA 4KJWC 4DVRL 2FEDC 1AGDA 4L4VB 4ISVB 3LDBB 4NM4L 5SWQA 3WFBH 1YECL 3L6FB 4KK8C 5J13B 1EFXA 4KKCC 4LPXA 3QSKB 4TVPL 1BF2A 1Q9KA 1H15B 5HHOE 5JDJA 2OMBA 3QXVA 2QQKH 4I2XE 4YAQB 2P8MB 2QV2A 4DVRH 5GGVY 1UWGL 1S78D 1C08A 4NM4H 4JFPA 3DOSA 1MWAA 4U0RB 3SO3C 1YECH 4LHUA 2DYPD 5C6WH 2GSGA 3ARGD 3P40A 3RWCB 3GI9L 3HI6L 5KSBB 2A9NL 1B0RA 2ED7A 3HR5A 5CD5D 1KB5A 2A77L 4TVPH 3BP7A 3DRQA 3RL1A 4EZMA 2ZUTA 4U1LA 4MQXD 4LPCA 3TP4A 5JHDE 1Y6MR 4X9GA 1UWGH 2Q20A 1TTUA 5T33L 4QXTA 3RI5K 4ZFOL 1G7LB 4P48A 35C8L 4NHCL 1P7QA 2ITDB 3GI9H 3HI6H 2ZUQC 2ATPB 3MGOA 2A9NH 4M61A 3ZT6A 1ZMYA 4G9FD 2A77H 1SBBA 2X4NB 1NEZB 5FYJD 2YZ8A 1VADA 3STBA 3EYOA 4PRHE 4LCCC 5D71L 1RULL 4OAWB 1CFTB 2R39A 2PNDA 5F7NC 5T33H 4F9LC 1EHLL 35C8H 4NHCH 3GKZA 1NFKA 3LZFL 3OX8B 5F3BA 1YC7A 4QHNA 5C0RL 4NJ9H 1ES0B 3H9HA 5IR1B 5C0EA 1TVDA 3EOTL 3D18B 4LARL 4QEGA 2ADGB 5D71H 4F7PA 1BZ9A 1RULH 2GEEA 3QFDA 1A5FL 1CU4L 1AGBA 1SYVA 1U95B 1EHLH 2BVYA 2UUDH 3LZFH 4HLJA 4BQBA 1Q1JL 3IGAA 5C0RH 4OD3L 2VLRD 5DMKB 3RWDA 1V7ML 5JPNB 4BKLA 4NPYA 3EOTH 3MLVL 1ED3A 1G6RL 4LARH 4XP4L 4AIZB 1T4KB 1CWVA 3TZVD 5DEGB 3MQIA 1A5FH 1CU4H 2MQCA 4FA8A 4ZODA 4F7CB 2NY6D 5K9OB 1G7QA 1Q1JH 4YR6B 4OD3H 1A1MB 4AENA 1V7MH 3HZKB 1PSKL 1QTYT 2G9HA 3MLVH 1G6RH 4XP4H 5D93C 4CBPA 4KY1L 1HHIB 2GUOA 4JPWL 4S2SB 3NACL 2A6JB 4L3EB 2YD6A 3E3QC 3EZJB 2CD0A 3DPBA 3UAJD 4M4PA 1MH5A 4AG4L 1PSKH 5C0NC 4ZQKB 3OXRB 5MI0B 3E2HB 4KY1H 4JPWH 3BMWA 3PDDA 1T03L 3QUMA 1AR2A 3NACH 2N4IA 1XF3A 4HWBA 3BWAA 4AG4H 2D9QB 5I1IL 5EBWB 4JFXA 5E56A 1WGOA 1EXUB 1WIOA 1T03H 4YPGA 5E24E 5EOCL 3AMLA 2BP3A 1QYGL 3TGXA 2IMNA 4GG8A 5D2NC 3OB0H 2G60L 2ZUXA 3EFFA 5CP3A 3IDIA 5FGCE 2PTUA 1H0DB 4KRPD 4HWEL 5IVZB 4NFBA 1HYSD 4PRPD 3JV6B 2Q8BL 3KPPB 5I1IH 5D93B 4JFFA 5D1XB 3REVB 1NMAL 5KS9A 1L6XA 3TYGL 5EOCH 2G5BA 3BP4B 2IQ9L 1QYGH 5I1DB 5GGSY 3O3BA 3O9WA 3TIEA 1JZ7A 4IS6A 4JKLA 4JFED 4WUKL 2G60H 1DP0A 3K2MC 3QUKA 3MGTB 3CLFL 4HWEH 4UIKL 3K1KC 1KOAA 2Q8BH 4OB5L 4Z7OF 3TIDB 3ULVD 2FX8L 1NMAH 2AEQL 2YPKB 3D9AL 5BZWB 3HPLA 3SOBL 5FM5M 5D6CA 3TYGH 1ZHKA 3ILQC 1KJMB 5F72S 2IQ9H 1RUAL 3QIUC 3MPCA 5J7CC 5HHQB 3D3VE 4WUKH 5JIPA 1QHPA 3IVKA 3IDXL 1UADC 3CLFH 1U8HA 1Y0LA 3LIZL 4UIKH 2E9IA 4GS7C 4M8QA 4OB5H 3MRFB 5FYLE 2FX8H 2R0ZL 2AEQH 3D9AH 5T3XE 3U0PB 1SYSB 3SOBH 4IJ3B 1RUAH 4K7PX 1A9BA 5IB4A 4DK6A 3N50A 1T80A 3QG7L 1EZVX 4W4OA 3BUYA 4FXKA 5GZNC 4D3CL 3D6GA 3IDXH 1FC2D 2DQGL 3NN8B 2W0FA 3LIZH 2I07B 2R0ZH 1ETZB 1OTTD 1XCTA 1CE1L 4RGMC 5IBTL 4JFDA 1C12B 2OJEA 4H0IA 3QG7H 3EJJX 4PJHE 4LRNL 5D96B 4D3CH 1KV3A 2DQGH 2GHWB 4MA1B 4QRRB 5IVXF 4JM2D 1EHAA 1TTGA 1KT2B 5HDBF 1KN2L 2YD7A 2IAMB 3WNMA 4KK5D 4L8DB 5KANI 1CE1H 5DZLA 5IBTH 3VXOA 4GW4A 1U8QA 4NGHL 4QNPF 2Q6WB 1GCFA 4B53A 2Z35B 3CJJA 4LRNH 1OGAD 1NC2B 3Q5TA 5CJ5A 5D7IE 1BVLA 2DLTA 4Q74A 5HHPA 4EUPA 1KN2H 2VR4A 1KTLB 3IXAA 3PP3H 4GS7B 3IJHB 4PJ7A 5I71B 2FR4B 2Y6SD 1LO0L 3BP5A 1IC4L 3QRFM 5ICYA 2AV1A 5GGVL 4C56B 1G1YA 3DIFB 4W81A 4NGHH 2CDGA 2NY4B 3GUTA 4FG6D 2IH1B 4PD4K 2ADJB 5F1NA 5SWSE 2ORBL 4EDWL 4Y19D 1CGTA 1U3HC 1EDQA 4M1CC 4A6YA 4E0RA 2V2TA 2FJGB 3P9LB 2FD6L 4HGWA 5E2UL 1LO0H 1IC4H 4LPWA 1HHHA 1T1WA 5GGVH 5D2NE 4E5XB 1ZHBA 2IALA 3MRLB 3OKMB 2LTQC 5HPMA 3GJEA 4LBEA 4OGYL 4HK0B 2ORBH 4EDWH 3VXPA 4P4KA 1S8DA 1RZ8A 3WEXA 4M1GL 3GB7B 1NGYA 4BUHA 2FD6H 2EO9A 1U41A 5E2UH 3ULUF 5ID0B 3B9KB 1S7XB 3IJSB 4XI5C 3FQRA 4TNVF 5JUEL 4M02A 3U4EA 4HUXB 4PJDB 5J1AA 3VXMD 5I75C 4OGYH 4Z76A 2X2YA 5E6YA 1A2YA 2B4CC 1CFQB 5IMMA 4MS8D 3V6FA 4M1GH 1W0VB 1AXTL 5DUBA 1XGYL 1A7QL 4LAQL 4F2MA 2X4PA 3LQAC 1FGNL 3JTSB 2E7BA 3P4LA 4MNGE 3EZ8A 4RDQF 4ZTPL 5HDOA 3KYMB 5JUEH 3T77A 3G6AB 1EIBA 1AP2B 5T5NF 3QCUL 4Y4HC 2R2EA 1BMGA 4U1NB 1G7PB 1MCCA 1CFSA 1QPPA 5E99L 8FABB 4DQOL 3W11D 4P0DA 4G42B 5A40E 2X4QA 5SV3A 2XIDA 5JNYB 1T3FB 5E2JA 1I85A 1FNLA 1U3ZA 1AXTH 4L8SA 1XGYH 1A7QH 3I6GA 4LAQH 1FGNH 3U36A 1KIRA 5C9JA 1FFQA 1JF5A 4ZTPH 1B6DA 4JCLA 1G0DA 5T1KD 3ZKSD 4ZFOA 1D6VL 2VZUA 3QCUH 5EUOB 1KBGL 1YC8A 2VMFA 4PUBL 4U6HB 3QEQE 5E99H 5FOBB 2ERJC 4DQOH 5IW1A 4HJGB 1L7IL 4X80L 3IKCB 1F3JB 3EGSB 3VRLF 2ZJSL 1E4JA 3QUYA 5EO9A 1P84K 2R2BA 4ONHA 5AD0A 1Z2KA 3CFEA 5J12C 4DN4L 5F7MC 2BVPB 1A9EA 3WCYA 4Y2DD 3OR6A 3SBWA 1I7UB 4ZFGL 1D6VH 1KBGH 1QG3A 3EYUL 4FNLL 4PUBH 4R9HA 5I75B 1XIWD 4L8BA 4OM0L 5JW5A 1L7IH 4X80H 3WLWD 5CIPH 4U1SA 4WO4D 4JPKL 2VXUL 2ZJSH 3BSZL 3D2UA 3ARDA 3OKLB 3PDOB 5EC2B 1ZT1A 1FGVL 4NQCE 5E6IC 4DN4H 4LVOC 3HG1A 5J4MA 3I6LE 1AO7A 1KC5L 2YD5A 1TVHA 1ZT4B 4ZFGH 4R96A 4FNLH 3EYUH 5K9QG 3LB6D 4Y4HB 3HCVB 5DHXB 3U79A 1MCIA 2AABL 2HAZA 3HPJB 5DJ6A 4OM0H 1KB9K 1QEWB 2C7UB 5ANME 1N3NA 4JPKH 1G6RA 4JQVC 2VXUH 2X89A 3BSZH 5FGBC 5MEQA 1FGVH 4JZJC 2OLDA 1KC5H 3GSNL 2DWEB 2Y06L 4Z7WB 2CLRB 2ZG1A 3W9DA 1YN7A 3TFKC 5DRZA 3QQNA 5GJSL 2AABH 5DDHB 2BVEA 3T2NL 4YGAB 3RWEB 1NPUA 3FOMB 2HG5B 5D7LD 4IOIA 1R24B 5ISZB 2IF7A 3DARA 4OF6A 5J12B 4LNRA 4HHAB 3B4NA 3GSNH 2NX5A 2VKXA 2Y06H 4KDVA 4XPBL 1T89A 1FSKB 1P6AB 4CDGC 1NANI 2RQ8A 5GJSH 3H9ZA 3T2NH 4WV1A 2FEEL 1UH2A 3QHTC 4XC3L 3DTXA 3BKJL 4XB8A 4NQDB 4OV6F 4X99A 2AXJA 4P2QB 5E6IB 4LVOB 4FABL 4OZIB 5FCUL 4B7IA 1MCJA 2BVQA 4BH8A 1X5YA 1D5MA 4XPBH 1UB5B 3ULSA 1F8TL 4OFYD 2NY2D 4XNMB 1PLGL 3EJZD 1FORL 1MEXL 4XC3H 3KLHC 2LABA 3HI1A 3BKJH 4HGKC 4EI5C 2C1OB 4FABH 4PJ7F 3JWOL 5FCUH 1T0MA 4PRBA 4XVUD 1EBPA 4PV8B 2NYYD 1BM3L 4MJIB 1F8TH 1IE5A 5ABDE 4Z7OE 2ESVD 2JKXA 5IVOA 4PJBA 3VG9C 2FH6A 4FQCH 1JWSB 1PLGH 3QDJD 1FORH 1MEXH 3CUPB 3IF1A 3MRNA 4OKVB 5IBUG 1T1YA 1EAPB 1S5HB 3KG5A 4FQXD 1CTOA 1OAYL 3NIDE 4D2NA 1OW0C 3JWOH 5IW3A 4NKIL 3BD5A 2OK0L 4KRLB 2YD8A 3X12A 3T04D 1BM3H 2HT2C 3G04B 4DW2L 3IJYB 4GLRH 2C3XA 2QHLA 3QNXB 2H32H 3I3EA 4U7MA 5LGHL 2MHAA 4ZSOB 2D7OA 1IM3B 4WUUB 1OLZA 2W60B 4ZYKA 1OAYH 2YUWA 2KL6A 3HMWL 4NKIH 5E5UB 1FVDB 1AC0A 2OK0H 1H8OA 1VEOA 2VERN 4WHCA 1MVUB 2BRQA 3LKPB 4EJ1C 5I17A 2ITCA 4DW2H 4MX7B 5D72L 3IDGA 4PGCB 3L7FB 3T65A 1W8NA 5LGHH 5I1KL 4MVBD 1P5VA 4K2UL 3S6CA 4EI5B 4U05A 3RZCD 1NCAL 1CD8A 3HMWH 3RGHA 3KPQB 4LPUA 3BZFA 1R3IL 4RX4D 3SDDB 4PG9B 5IVXE 3S96A 3UBXG 5DJZB 2MKLC 5GSRB 5BVJA 5LGKA 2EDLA 1BIHA 5D72H 5DJXA 3VRIA 3VG9B 1OF2A 1HH9A 4OZFA 3MUZ1 5GZOC 5I1KH 4AH2A 3S5LA 4ZS6D 3UJIL 2A0LD 4K2UH 4L4TD 3MUGB 5IMOB 4J8RB 5C0JB 2RAMA 1NCAH 1OD9A 3ZMRA 4LCWD 1I3RB 3QXDA 4N1HB 4L9LC 1R3IH 5FA4B 4V1DA 1J88A 3QDHA 5T3ZD 1NDGA 2PXYC 4HUKB 4ZFZB 4BFIA 4YHNA 3UJIH 5DTFA 5C0AA 3OZ9L 2M26A 4OFPA 3VWKD 4RRPG 4FRWA 3ARFD 3HB3D 1AHWA 4F7TB 2O26U 3SJVE 4EIGB 3AY4C 5T1MB 3S3SA 3B9DA 1PJ9A 4PJGB 1Q9OB 1AD9B 1J12A 1Q94A 3RVTD 1IGYA 2EDJA 3ARWA 5FDWB 1K8DB 4LKXB 3EDJA 3UTSE 3TO4C 5DJAA 1CFBA 5SWZE 3T0XA 1IT9L 3FO1A 3OZ9H 4QGYA 2APBA 4Z7UF 4NQED 3QJHA 1SJHB 2RFXA 1SJXA 1U91A 3DURA 4PBXA 1N7ML 4WW1B 3T0EB 2YN3A 3DJ9A 4UUJB 4ZUTA 3ULUE 3PWNA 2VL5A 5CGYD 3WKML 5BS0D 5D5MA 5AEAA 4KMQA 2HVJB 3K8KA 3WJJC 5DMIL 1IT9H 3GSOA 1A1OB 5DRNB 1PZUB 3RRQA 8CGTA 4DCQB 2H1PL 4KDTC 4MDJA 5J9PB 4PRIA 4L9LB 3B2VL 3G9VA 1N7MH 3HMXA 3LEVL 5BXFA 2EIBA 5TH2A 4OLYL 4PJEA 2WSKA 3MA9L 3WKMH 1K6QL 1TJIL 1DFBL 4PLKD 5EO1B 4JGMA 1EFXD 4ZTOL 1N5AA 5DMIH 5BJTB 1TQBC 3L3JB 2BNQB 5DK3A 2H1PH 3QDGA 1DEDA 4LQFL 1FBIL 2XKNB 3B2VH 4RDQG 2P5WB 3U6RB 1SY6A 4LFHG 5I2IA 4MD4A 3S35X 5KOVC 3LEVH 5IBLD 1BZ7A 3WFHA 4OLYH 4ORZC 5F7KC 3INUL 3MA9H 4LHUD 1K6QH 1TJIH 1DFBH 4X4ZA 1ZA6A 3TO4B 3HE6A 3TEUA 4ZTOH 3TCLB 1VACB 2D0HA 4E9LA 5JXAL 2FJHA 3DNKA 2R1XA 4WGVB 4LQFH 2CO7B 1FBIH 2UWEB 4IIQC 2Q3ZA 4LOUD 3QWQB 1RZIB 1QSEB 3V6OA 3VRJA 4U2ZA 1TETL 2OX5A 4RAVB 2D0FA 1P7QD 3INUH 1OB1A 2IH3A 4HS3B 3W0WA 3PJSB 4P5TA 1KIPB 5JXAH 1TQCC 4NQVB 5B38G 2RJMA 1JPFB 3QQ4B 3BW9B 4N0UB 2H2PD 4PGEA 1TETH 5CIPA 5BZDA 3IETA 4HIJB 1ZHNB 3MRDA 1RSFA 1WWBX 4X98B 4RQQA 1QBBA 1KJ2A 5ALCL 5LXGL 1MREL 4UI2A 5IJVA 2W0KA 3OQ3B 4HKZA 2EDBA 5C2UB 4TUKL 1KF9B 3FFCA 3GMNB 2FL5B 4PGJA 5C8JA 5ESQA 4JJ5B 1V8HA 4N5EC 3H7BA 3OKEB 1AXIB 4JVUA 3GSVB 4NN7B 5FF6A 1V5JA 1Q38A 3C6SA 4UQ2A 5F9AC 3C08L 4WGWB 1SHMA 1PVHA 2F54E 3H42L 5ALCH 2XWBA 5LXGH 1I8KB 1MREH 5IP4A 4IIQB 1XAUA 4TUKH 5IVNA 4XP5L 2EDWA 2B5IC 4RBPK 3ZKQD 4G43A 3RA7L 3IXTA 4QRPE 4FQHB 5F44A 4JLRB 3NTCL 3G08A 4KQ4L 3C08H 3GSNA 3G6JA 3H42H 5C0IB 2VE6B 3VFNB 3ARGC 4XWOD 4XP5H 2GJ6E 2A2QT 1MCNA 4WTWA 3RUGB 3RA7H 5ECJE 5SX5K 1QR4A 3NTCH 4MLIA 4MQXC 2FHCA 4XPFL 4KQ4H 3OG6B 3VXRA 2J1KA 4N0YL 3QI9A 5C0BA 3TBVB 5GGSA 1DBJL 2C5DC 3P0VL 2RCSL 4BSWA 2IPKA 1JRHL 1LEGB 1IRAY 1YMHA 4J3OC 1NFDE 2PO6C 3C6LA 3SDCD 4APQC 1I8IB 4XPFH 3ZHDA 5L2KA 3ILPA 3QO0A 4ODXB 4TUJA 2P8LA 5HYIA 3ZKMD 4N0YH 4ALAL 2AXGA 1CE6B 3CZFA 4P2RE 3VDBA 1DBJH 3P0VH 2RCSH 4XNUL 2R2HB 2B5IB 1JRHH 1NCUA 4Y2OA 2CO6B 4CU8A 1M71A 3U1SL 2ZKHL 4L5FL 3GMRB 1BFSA 4UV4L 2QBWA 5HGBA 4ALAH 4DVBA 1M7XA 4JFFD 4XNYL 3LRHA 2DYPB 4XNUH 3ARGB 1KUMA 3DRTB 2PETA 3KR3L 2QSCL 4JRYB 3H8NA 4LDOB 4MMXC 3GKWL 2EDHA 2H32A 4PJCA 3CZJA 3IU3A 3O9WD 3U1SH 3O3EA 5ESVB 4L5FH 1VERA 4UV4H 3TZVC 4G8IB 4YFLI 3AAZB 2NY5L 1NBYA 1PG7L 3MV01 5FO7B 4MDIB 2Z9TA 4O2CB 4XNYH 3RVUD 3UZVB 2JCCA 1CGYA 2JLLA 5CBAA 3KR3H 2EDFA 2QSCH 3GKWH 3QXWA 2ICWJ 2BOCA 4G9FB 2IQAA 3OKDA 4G80A 5H37G 2NY5H 2AJZB 1OP5K 1PG7H 3T4AB 3UTZA 1MHEB 5HTSA 3CVHL 4YHOL 4GRMB 1Y18B 1RZGB 4QXWA 3UAJC 1E0OB 2HMIC 3FFDA 1EEQA 4PRNA 2MSPA 3I3DA 2KZ1B 1T1XA 4F9PA 1QLFB 3RHWK 1R5WA 2MQ0A 2ZP0T 3CVHH 4YHOH 2Y7QB 1T22A 3D25B 3EAKA 5L8KB 4GW5A 1AXSB 3QFJE 5IOPB 2WBWB 1IAOA 3ZSSA 4MXWL 1DL7L 1JGLL 1YQVL 4JFDD 2VLRB 3N1GC 5F9WC 3MLZL 4B5EA 2P7TA 3BEVA 3LKQB 1YY9D 4LSVL 1MLCA 3DYPA 4HUMB 4TTDD 1QVOB 4WU7A 4LKCA 1ZHLB 4UB0L 5EU3A 4NOBA 1KEGL 3KPNA 4AY0A 2NY6B 2XPGB 1D5XB 3HI5L 1M05A 4DOHE 3E0GA 1DL7H 1JGLH 4MXWH 1EO7A 1YQVH 5I0ZA 1QBAA 1TVBB 1HE7A 4Z7UE 3C2AL 4EN3C 1MQ8A 4MJ5A 4KRPC 5AWNL 3MLZH 5FV1L 3WIIL 1BQUA 4LSVH 5CFHA 2XTLA 2Y23A 4XGZB 5A16B 4BK5A 3NFPB 3WN5A 3DUSB 3MLRL 1XZ0A 4X5WB 2VN7A 4UB0H 2ICES 1NBZA 1KEGH 1ZA3B 1U8LB 3HI5H 2W9DL 5ERWA 2E6QA 4E41A 4OCMC 2FJFB 3C2AH 43C9A 4RAUA 5AWNH 3FOLB 3WIIH 4UQ3A 3O6KL 3ULVC 5CSZA 2CLZB 3BD3A 3MLRH 3O41A 5I8CB 5ITFB 5DS8B 2BDNL 2W9DH 3TO2B 2YXFA 1A0QL 5HHOB 3FTGB 4RMUA 5B8CB 4U6YB 1H8SA 1QRNE 2J3SA 5F9WB 1JGDA 1FC1A 1TCRA 2YUZA 3O6KH 1ZKAA 4P4KD 2HLAB 4FHBD 1F6AA 5E8OA 3UPAA 1WZKA 2LU3A 1OT1A 4UNUA 1AI1L 2BDNH 1A0QH 2WK2A 3RU8L