3GQFA

Structural and biophysical properties of the pathogenic sod1 variant h46r/h48q
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFRVQEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural and biophysical properties of the pathogenic SOD1 variant H46R/H48Q.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3gqfA00
2AQQA 1UXMA 3KBEA 4L05A 1SDAB 3CQPA 2JCWA 1IBHA 3QQDA 2WWOA 3MKGA 1S4IA 2E47A 1IBBA 1YAIA 1BZOA 1B4LA 2ZKYA 1PTZA 4A7UA 1E9OB 2C9UA 1TO5A 3GQFA 1E9QB 2WZ5A 1SPDA 2AQPA 2AQNA 3GTTA 1JK9B 3HFFA 1RK7A 2K4WA 4FF9A 2NNXA 1F18A 4N3UA 1OALA 2E46A 4U4IA 1AZVA 2R27A 3ECWA 1SXZA 3KM2A 1F1DA 3KBFA 4B3EA 5CU9A 3SODB 1PU0A 2VR6A 3KH3A 4A7VA 2APSA 4N3TA 1IB5A 1P1VA 1E9OA 4BCYA 2ZKXA 1F1GA 1DSWA 2VR7A 3MNDA 1SRDA 2AF2A 4A7GF 1SXAA 3KM1A 2ZKWA 3K91A 3CE1A 1YSOA 1TO4A 1OZUA 3S0PA 1SOSA 3ECUA 2LU5A 2WKOF 1FUNA 1EJ8A 2Z7YA 1DO5A 5KBMA 1L3NA 3CQQA 5KBLA 3F7LA 3HW7A 1Z9NA 3LTVA 1COBA 3T5WA 2GBUA 4A7TA 2XJKA 4BD4A 1OZTG 2C9VA 1F1AA 3GZQA 4A7GA 2GBVA 2JLPA 1XTLA 1E9PB 2AEOA 4MCMA 1E9QA 3L9EA 3HOGA 1JK9A 1OAJA 3H2QA 2WKOA 3H2PA 2WZ6A 1EQWA 2WYZA 1BA9A 2C9SA 1ESOA 1Z9PA 3ECVA 1OEZW 2Z7UA 1Q0EA 1HL4A 1SXBA 2XJLA 2V0AA 1XTMA 1U3NA 2ZOWA 1IBDA 1XSOA 3PU7A 3RE0A 1SXSA 1JCVA 1KMGA 1SXNA 1HL5A 1MFMA 2Q2LA 2AQTA 2VR8A 3GZPA 1E9PA 1IBFA 2Z7WA 4A7QA 2AQSA 1UXLA 1SXCA 1CB4A 1QUPA 3QQDB 1PZSA 1CBJA 4BCZA 4OH2A 1B4TA 3KH4A 5KBKA 3F7KA 2Z7ZA 3GZOA 4OJAA 2GBTA 2WWNA 4A7SA 2AQRA 1N19A 3L9YA 1SDYA 2SODB 3GTVA 1YAZA 1N18A 2WYTA 2WZ0A 4MCNA
chains in the Genus database with same CATH superfamily
1XSIA 3TX4A 1AS7A 4JLRB 3B5HA 4JPWL 5EF2A 3RZWA 3WXVL 1TVHA 1GTNA 4HUXB 1IBBA 2GK0A 3FB7A 3S97C 3IS0X 3K8KA 4BZ2L 3Q01A 4ZPVA 2EDXA 5FM4A 1J18A 2PNDA 3OKNA 5E6YA 5KYUA 5A3IC 4L5FL 4Q9BA 1WBXB 4CSPA 3L6FB 1JVOA 5JXED 3QEQD 3ROOA 1ZT1B 3EFDH 2H4EA 1CN4A 4QF1A 1MFVA 4ONFL 3QUXD 4OCLC 1D7CA 1HYRC 5CD3B 4NM4L 4HCGA 3TBSB 1PVHA 3EBGA 3CCHA 3CLFH 1NINA 1E9OA 2DKUA 4KRPB 1E7UA 4N28A 1NIAA 4OUOA 4F8PA 4XNZC 3WFBH 4GAGH 1PG7W 5C2BL 4AQEB 1SNRA 4BQ6A 3MV7E 4V33A 3F7RA 4NHUA 3KXFD 4HIXH 3WIHH 4ETYA 2OXHA 5I1CH 2W9DH 2WN2A 5CZXD 1U3JA 3KPRB 3MC0A 4AEHH 2YEZB 1L7IH 3GSOA 3MJ8B 1IV8A 2YPVH 3G5YA 1OHZA 2BOLA 3CSTA 2R1XB 1A1NB 3FN3A 4P5TD 3AWFA 5C0JA 2F53A 5DMKB 3CVHA 4MJ6B 1K8DB 2W38A 4FMVA 4I2XE 4C8XA 2KBGA 5GS2H 4YGVA 2ITDB 4NC1E 4XXCC 1JNNH 1P5VB 1G7JB 3CK0H 3ZYIA 4XRCA 4XO9A 4LLMB 3I84A 3D3VE 4JBSA 4JVPA 2CLRB 4G9DB 5FIEA 4NQXB 4JY5H 2XQYG 1AO7D 4R4NC 1BVLB 5DI8A 1H15B 3EJQA 1H3TA 1Q0EA 4ZD3H 1OCRB 4M9PA 2CK0H 4DKFH 1OW0A 1J5HA 1IGFL 4P9ML 5T1MA 1X5XA 2DH3A 2ID5A 2VDLL 3KPNB 4TSBH 3TF4A 4WFFD 4BSVA 1SYSA 2P8LB 4OFPA 4S1DD 5CD5C 4LEXH 4ZW7A 5CP3A 1MFMA 1JXJA 2ADGB 4IYKA 4R9HA 3Q2CA 3S3PA 4GBXC 1P9MA 1MQKH 3MLZL 4LRNL 3ZKND 3BVUA 1OTUC 3T65B 4HCRH 4J5VA 2DICA 2WSDA 1A8ZA 2EYTB 2CO7B 3MLXH 4IJTA 1FJ1B 1G7QB 3HE6D 3KLKA 3PJSB 2BJML 3AM8A 3L9YA 3UTZA 1KENH 3P4NB 1TG8A 3GXPA 3PGFL 4PJXB 4WDIB 3HPJB 5CJQL 3DIFB 4NO0B 3PAUA 5J56B 4QXGL 1KB5B 2EKSA 1XGPA 4OD1H 3KPSD 1P4LB 1VA9A 4QAWA 3UDWC 3LKPA 1I75A 2BSCA 1MVUA 4K0OA 5E4EB 2IQ9L 4HIHB 5GS3A 1JXGA 1QLEH 2C9UA 3EH5B 3TBTB 3VFNB 3I9IA 3REWA 4HUWB 4TLUA 3G5ZB 4JG0L 2AQPA 3BH8A 3MBED 2P42B 2AQNA 2YN3A 1F13A 3EJJX 5DSCB 1UHVA 3GK8L 4UMSA 3A24A 4NUQA 5AVYB 4L8CB 3WEAA 2ZOLA 3IPEA 2LQRA 5BZZA 5CILH 1E3XA 4I13B 1BWWA 3S6CA 2VCOA 3CBJB 1TETL 2PKDA 3D25A 1DVFD 1E90A 2W81C 1YPZB 2ATKB 2N1KA 1M1XA 4JO2L 5KBNC 3ME0B 3QDMB 2FZ3B 1OM3L 3GHBH 2JCCE 5I2IA 3PWLA 1JWUB 5C0IB 2V2XB 1H3PL 3FJTA 3G08B 1IGYB 3QUZA 2QL1A 4KDVA 5I1KL 4KRPC 1GY2A 1DO6A 1U93B 3FTSA 1CF8L 4NKDB 1WAAE 4P2QA 4IBUA 3D50A 1BX2A 3SIKA 4AYSA 4X9GA 2WQWA 3AQDA 3O45A 2WBJD 5L2JA 3EJTA 3SOBL 4YH6A 4L3EB 4HKXB 1JZ4A 2COQA 2EXYC 2EUZA 4A1RA 4PJAE 3NA4A 1BD2B 5GGRB 4Y5VA 2G5RA 3QWRD 3HAEH 2R2EA 5LCVH 5AUMB 1REIA 2Y1VA 2AVFA 1N5AB 4L2LA 3O6KL 2VISB 3BWZA 4DCQA 3RILA 1FQ9C 1AS8A 4MD0A 4X7SL 4RX4A 4B5ZA 1ZHBA 2C8NA 2VN5A 2LV4A 3ARGB 3WMQA 4TRPH 5JIPA 4J3OG 3VB9A 4X2UA 2XTJE 4EI5A 4J2XA 4AKOA 3OKOB 3P9MB 4K3EL 4BFOA 1PCXA 3IMSA 4DTGH 3GUFA 3HHSB 3K6FA 4HAFA 5DLMH 2QMKA 2V7NA 2HFEA 4BIKA 3L4VA 2ZJSL 2CJ3A 3CSGA 3GBNL 4KI1A 2N7BA 3MJWA 3DRQB 4DZ8A 3K6IA 4PRPB 1WFMA 4OQ1A 3O6FA 4N9GB 3TT3L 1E4XH 3U83A 5D1ZD 2YN5A 1MJ7L 3H9ZA 4RAVB 2DQEH 1NKGA 5TPWH 3RWFA 2X1QA 2AK4A 2JK5A 1LP9E 2K3HA 4Y4HB 1AZZC 4FCAA 1IM9D 5J1SC 3ZMEA 3ZE2F 5DJYA 1XH1A 3LIZA 4LCYA 4LLVA 3WLBB 7TAAA 5IB5A 1FNSL 4RSYA 4OCMC 3FUJA 3KW8A 3NZUA 3DECA 4DGUA 4PTTA 3TNMB 5HHPB 4FNRA 5K39B 2M8XA 1H6EA 2H32B 2YRZA 2UY7B 4KXZI 5KYWA 1ZDQA 1TNMA 5DJ2A 3QFDA 1X7QB 3M8OH 2VITA 2EDBA 2WC7A 4HG4J 3DJSA 3GEWB 4IOIB 3FN9A 3ETBJ 3LEXA 1RPUA 1DCEA 4GW5B 2NY6D 3EGSB 4OZIB 4LCWE 4MJ2A 3DX9A 3G9AB 4OCWH 1GYCA 3OWRA 4DGIH 2VAJA 4QRPD 5E4EC 4I48B 4BJLA 4Z7WB 3T0DA 1RSFA 3P4LA 2Y07H 1KLUA 3MU3A 5C0RL 3C6LC 2R9HC 4FF9A 1KF9B 1MY7A 4NZRH 2Y7LA 5TH2B 1WAEA 3M1BB 5CGBA 1QFWH 1T1XA 1EEYA 3BAJA 2VDRL 2EIMB 2Q3XA 3WENA 3P4OB 4G9FA 4DO5A 3FU8A 4PJ7B 3U2SB 4N68A 3ATEA 4YHLH 1OARH 1QBAA 2OMVB 1JZ8A 4M7KH 1P4UA 2FECI 2GSGB 4WNSA 5A43C 1LO0L 4BSWB 3FB5A 3N85H 5I71B 3FMGH 4PRIA 5ERWB 1J8HE 1ZS8B 4MA8L 3N44F 3OD3A 4KNTA 4A7GF 3MRJA 2HRPH 2QTVA 4PRAB 1FV1B 2ZP9A 3O8XD 5DHVB 3UZEA 4BFIB 1T4KB 3SDAD 4AEFA 4ZFQA 4K2UL 3SDDD 2PO6D 4HJ0D 2MJWA 4JO8A 3KWTA 3HS8A 4ZUSA 3D09A 3P02A 3ZDZE 1U8QA 3F7YA 12E8L 1K4DB 1YYMH 5TF0A 4PS7A 2HKHH 3MLRL 2E9BA 1JMZA 1HH6A 3WDIA 4LCUA 1RHHA 2NR6A 2BVPA 4NCC1 4DGVL 3SQBB 2RIKA 4YN3A 1UZGA 1J11A 1H3XA 2UV3A 2YKLL 3MLPA 4PWKA 2PF6A 3FB7B 5FHAH 3UPCA 3TJHD 2AC0A 1YEKL 1JBJA 1H8OA 1I4FB 2DD8H 2FBJH 4XMPL 3T6ZA 4WHYH 5IQ7H 1V7ML 3ARGC 5KYUB 1KIQA 3ZMNA 1T1ZA 1XL4A 1P7KB 5B4MC 4FFZH 1E8XA 4AVHA 4BINA 3MBXH 3QUMB 4MCZA 2IQAA 3MOBH 4AL8H 4PJ8D 5F96L 4J6IA 3M17A 3U9UA 2NY2C 3X12A 2YSTA 4L9LB 1JNHB 1NCUA 5JOEA 5HSFA 4AYBA 2YRBA 3CD4A 2X5PA 4HUUB 3DXAB 4XNMB 2P24A 5B22A 1CDHA 5E2WH 4HGMA 1OB1B 1UENA 1XCWA 5DRZB 4ZS6C 5I28A 1VIWA 1S6NA 3JTTB 4FNLL 4I3SH 2C3VA 2RFXA 1NBZA 4V1DE 4F9PC 1J9CT 4EIUA 2OXHB 2NMSA 4Y4HC 1K4CB 2DIEA 5LQBH 2G2RB 3VCLB 3HG1D 3VYOA 1T80A 1AD0A 4XAKE 3U48A 4O4YL 1DZBA 5C0JB 5HGDB 1ZA6B 1AZRA 5GZOC 2BHYA 4GAYA 3JVGA 2X7LA 2IH3A 4PWJA 4YGVB 2X4QA 5SX5K 2E75C 3LRSB 1T2QH 3C9NA 3RZCA 4UYPA 4A7UA 1FORL 4XRCB 3I6GB 4Z77B 4JQXA 4XMVA 3SE3C 4WENB 5D55A 5IBUG 5KSBF 1OGTA 2JI1A 3CQFA 2CSPA 2YMTA 2Q8AL 1P7BA 3QO0B 2APXA 3L4UA 4IDJL 2ZUTA 3TVMB 4PGCA 2F58L 5GJSH 4AJ0A 5C0CD 5FYKE 1KGUA 2F7OA 5MEPB 1IQWH 1NDTA 5C0AE 3F65A 5T1MB 4AG4H 1JUFA 4FRWA 5SWSE 4EQ3A 3B34A 4BK4A 4BSVB 3QPXL 1PX3A 4D9RE 4KAQH 2IOIA 2P44B 3CPLA 4UCFA 2CG9X 4MD5A 3PPSA 4G5ZH 2VZUA 5G55A 4BZ1A 3K2UH 3O2WL 4UTAL 5AZEH 1IEHA 2LVEA 4MASA 1IC4H 2C34A 3NJGA 3ZZSA 5BQDA 3VI3A 3BD3A 1SDDA 2K6WA 4G6AD 1G7HA 3VE0B 1ZT7B 4H26A 3RIFF 5BUPA 3GLEA 5I71C 5IV2A 4XO3A 2PPFA 3B3IA 4PJDA 3KLDA 2YMXL 2G2NA 3SZKC 3KPLA 4HPOH 4AQZA 2ADYA 1R3KB 2NYYC 1S2EA 4X98A 4Z7VB 1SJMA 1KXHA 4UBDC 4XE0A 1O7DE 4UQCA 1T3FB 4LFHG 1ZOXA 2W9EL 1DQQA 3UJIH 1PZ2A 1A6UL 4NO2A 5B8CA 2GBVA 1D6EA 4Y16D 1SJVA 2EXWC 3G5XB 1MVUB 1R0AH 1NLDH 1DFBH 3F6LA 5F7YC 2EE0A 2AZAA 4XP5H 2BFVL 2WQSA 4OCSH 3V0FA 3REWB 2H1XA 1S9XA 2MRYA 3DPDA 1YCSA 4FA8A 2ZZUT 3N2JA 2WZPD 2DYSB 1U3NA 3RPBA 5CIPA 1SJXA 2C1OA 1MEXH 3EYUH 1N8ZB 4N90E 5E5UB 1M1XB 4HLEA 4L9LC 4U1GB 3JV6A 2ZSWB 2Z35A 5HHVH 5I2IB 3JV5A 4LPTA 3WNJA 3FZUC 2WVVA 5ICXB 2P1YA 3CHSA 3OAZH 5D4QA 4DO4A 4Z8FL 1BF5A 2AS5M 3WS3A 3NCJH 4P2QB 4PRDB 1I85A 1AY1L 4M4PA 4DKEL 2B08A 1M9SA 2ED7A 4N6QA 3O45B 2MIZA 2P52A 2FT8A 4Y5VB 1JFQH 4FYQA 1CYWA 5AAMA 1QRKA 3P30H 1ZVSA 3HPLA 2QFPA 1MCDA 4PB9L 1DVSA 3NA9L 3QDGB 1S4IA 1TJIL 3CVBA 1TLMA 3QQ9C 4FFYL 3VI4A 1CFMA 1MRDH 4MD0B 4UOJA 4PTUA 3K1KC 1L5GA 2JB6A 4FQHA 4ZFFA 3VD0A 1PKQA 2QGBA 3MV7D 2Q76A 1C1EL 1YN7A 3IFLL 3OKKA 3ULAB 3NEXA 4EI5B 4PLNC 5KSVB 1SN2A 4WO4D 4M1DL 1EHXA 5I17B 4JHZA 4U7MA 4APQD 5F8RC 5E1AA 2V7NB 3GD1C 1I8IB 4AT6A 5T5FA 2CHDA 2YA1A 4DGYL 3ARBA 2GJZA 4PLOB 1MXDA 1P1VA 3GJEA 3Q2LA 1OW0C 2A83A 3O6FB 5INDB 4G7YH 5T3XH 1G5AA 3D3VD 4JQIL 2AK4B 1EBAA 2YA2A 1TQUA 4G7VH 1RQ5A 5BCAA 3M1OA 1ADQH 4OBSA 3E3QE 4PLKD 5DJYB 2X9XA 3VMNA 2VZVA 4OZGB 4QHNA 1EANA 3PJNA 4G83A 1FVCB 1FZOA 4HXAL 3MLYL 2H1PL 2X41A 4O9HL 4FTVE 5MEOB 3QHZL 1E28A 5KYWB 4BD4A 5KZCD 4UIKL 3CVCA 4UOW1 4B53A 2VH5L 2FVNA 2WTPA 2ZX9A 5C97A 3LEXB 2A73B 3HOGA 2C7FA 4L8BA 1HYSD 1A0QL 1T7XA 3D0VB 1NCOA 3DX9B 2IGFL 3B2VH 1I1RA 3H3PH 3M6DA 1KLUB 3QHFL 1KGCE 4KK6D 5AKRA 3O9WB 4NUGL 3IE9A 3BH4A 1MRFL 2G2PA 4PBXA 5KSAA 4JDTL 5JHLL 1T1XB 4ZMZA 4R0LB 4PJCE 4ADIA 4OW6A 5DZOA 3D87B 4YX2H 5HYEA 4JAMA 1K72A 4H8VA 3CFQA 3JTBA 1XGUA 1FLRH 1I7TA 2XG5B 3X2QB 1QASA 1E43A 1PZSA 4MRBA 3FB5B 3MTRA 5B1CA 4J3OD 1HXKA 3EGDA 2ESVE 4U1GC 1B9KA 4WJ5A 3VFRA 4OJAA 1F2QA 2LTQC 1LEIA 4AOFA 2LT9A 4YK4B 4Y1AA 1IAII 3FT2A 3MRJB 3JWDH 3QUZC 3LJ3A 2XPZA 4TQPA 2QVFB 3TZVB 1DEDA 5I6XC 1TZGL 1IJNA 3P69A 4MQXC 2PPAA 4ZUSB 2XG4A 1LK2A 1U8QB 1D5IH 3F7YB 1QSFB 1UT2A 1KCVL 4MLIA 5DMGD 3F58H 3O2DH 4D8PA 3AROA 4Y5VC 1SLXA 1AZNA 2EYSB 1SMDA 3ZHNA 1GY1A 4Z7NB 2UXGA 3J27A 3LVTA 1J5OH 3HAEG 5AOIA 4JY6B 4NGHH 5LGKA 1KBGL 4KUCD 4NJ9H 5DYOA 3WTYA 2E46A 2IV9A 4H0IA 1D5MA 1KIQB 2WVSA 4KMQA 1T1ZB 1CDCA 4I0CC 1QUNB 2QZ5A 3SN6N 4EI5C 1M6OB 5MP6H 1SJHB 4OFYA 1PU0A 3QXAB 4F8NA 1QBBA 1K5NB 4HWEL 4WTXA 3TM6A 3PF2A 1BFTA 3U9UB 3M17B 3HB3D 2D2OA 4QDGA 1OGSA 4BCYA 4F7MA 2BX5A 3RWEB 2YOAA 2QSVA 4P0DA 2E7MA 3OAYH 4PUBL 3VRIB 5IW6A 1GVIA 1NIFA 2P24B 1OGAE 3O6FC 2XTJD 2XYCA 3N0AA 2J20A 1O7SA 2Y36H 4PJIF 2M83A 3V5DB 1JYVA 3MOAH 4H44C 3SPHA 4Y2LA 2C3VB 1NBZB 3VVWA 4FE9A 5JTWA 2YD7A 2ZKHL 3C5JA 5C8JB 1C12B 3D8MA 2GCYB 5C0ND 5E23A 5CWSB 2ATAA 1G6RB 1UB5A 3VB8A 4J3XA 3H85A 2AV1A 1SOXA 3QNZB 4PPTA 1JD7A 3RWCB 5B3JF 1KYOK 2GHWB 2JF1A 3I9GH 4ILDA 4PCTA 4S10A 4YGAB 3GI9H 4AQAA 2YEVB 3FBKA 3C09B 4PJGE 2IH3B 3HNVL 3RZCB 3C9NB 2F1BA 2X4NA 1H8SA 1UVQB 3AMLA 2EXTA 4EN3A 2OQJB 1ZTXH 4U6HA 5FB8A 1UASA 1WBZB 2Y1YA 3L2NA 3W9DA 3O6MH 2D3JA 4H5SB 2OZ4A 1AJ7H 2J8UA 4UT6A 3B2PA 5DWUH 1NC2A 2ZCLL 1FWXA 2EZ0D 3LQMA 4Z7OE 1EUTA 3QUKA 3BKJL 3ZDYE 5E51A 1EX0A 5BOZG 3BLBA 4G42A 3BWUF 1JUFB 2BSRA 4N20A 3N42B 3VGFA 1U58B 1Z0MA 3AQZA 3CPLB 4R0LC 1MI5A 5HHOB 1N59A 2UXTA 3KYKL 3MRLA 3PCYA 3DETD 1XSKA 1QTYT 2IALA 3EO9H 2XN1A 5EUOB 4M8UA 1SDDB 3MGOA 1HXYA 1RZ7L 3D4GA 1LK3L 2ETWA 3D08A 3PNWA 1FN4B 5F7BA 2D31B 1E4WL 3OC5A 4FKKA 2MTAA 4CKVX 3KPLB 3UTSA 1A4KA 4YK4C 2ZG1A 3WOVA 3NGBB 4X98B 1GS7A 4JG9A 2XRAH 4OY9A 3RHWF 5CCJA 5FO2A 3ABZA 1W72H 3OMNB 1U8JB 3OKDA 2E47A 1ZANL 2Z31D 3W11D 2ZE0A 3AY4A 1CXLA 1P4IH 1UZ6E 4NO2B 3S35X 5B8CB 1MREH 3GSUA 2WMPA 3CFJB 5J13B 2BY3A 2W5PA 4K9EH 5IVOA 1O6TA 4M1CC 5CEZL 4JM0A 2NR6C 4KMTH 1J8HD 1CVSC 3S3BB 1DUYA 1T5KA 2V7HB 3Q5OA 1CYXA 1S9XB 1NBVH 1ZHLA 1OPGH 4NNYB 4XXDA 2AXGA 1ZHNA 3ARDB 3ARQA 4FABL 2IANB 4TQEH 1MFDH 4FEIA 3UTTE 3KBFA 5DK0B 2YXWA 2RCSH 3F62A 1ED3A 1KXTA 2C1OB 2AJ3B 2BW4A 4YPGB 3S88L 1CGUA 4LHUA 2BCKA 2ORBL 4PJ9B 2YPLE 1H6FA 3RNQA 4WV1A 3PHSA 5EULV 5KUMA 4KH2A 4YHNB 5D93B 1U91A 2P49B 5HYJE 1KWGA 1Q9OA 3MXWH 1JYWA 1DDHA 1YQVH 5GS1A 1H5BB 3IJEA 3DV4B 2VLRE 4Y89A 2XN9E 3DOHA 1WHPA 1ZVSB 4PM1A 2WYIA 1JGEA 2XZAH 4MZRA 3L3IA 1I7UB 1I1FA 1LO2H 5F7WC 4AM0A 5ITFB 5EZIL 3VI4B 4HUNB 2VERA 2MSPA 1MN4A 2DLTA 2FQEA 3NIFF 3C09C 3FB6B 4XBPA 5PAZA 2WNKA 3VRJA 4ZFFB 4F2MB 2Q76B 3RZCC 2FDBP 3G6JB 1UXWA 1YN7B 3OKKB 4V1DD 2XX0A 4OJFH 5C07A 3DNKA 4JQXC 4OLVH 3IF1B 4HPYL 4U3CA 3GMLA 3BUTA 5KN5A 3GGWA 5F9WB 5C9JA 4XAKD 5H8DA 3ZX1A 5F7MC 4S1RH 4LFHD 5CGYC 4F20A 5E9NA 2MQGA 4DN4L 4OJDH 4LQFL 3SBRA 2FATL 1H19A 3BISA 4WI5A 2A38A 4BH7A 2QGEA 2B4CH 4RETB 5I18L 2HFGL 3ML9A 3E7JA 2VMJA 5LWYH 1IFRA 1L6XA 1N2RA 2EDNA 3THMH 3KJ6L 1MWAB 3D4YA 2XZQH 5IFHL 4F15B 1NPNA 4U1IA 5BVPH 4X6DB 1GC1H 1I82A 1G1OA 5FYKD 2BRRH 4RBPH 1FZOB 4Z3JA 1T66C 5C0AD 4AE0A 2J43A 1F4YH 3LN5A 5SWSD 1D7DA 5DRWB 4M7LT 4D9RD 5ILTL 1FBIH 1UOKA 1GGTA 4PV9B 3NGBC 3ZUNC 3QDJB 4EUPH 5KSBA 3WTSA 2LAGB 5E6IA 1WSST 2ZYIA 5FEBA 3NSXA 2YEQA 4WFHE 4OI9A 3JTSB 1INDH 5D70H 5INCA 2ROXA 5KJ7E 1X4XA 4TQHA 3NIDE 4L8BB 3TT1L 4PCSA 5B8CC 2B1HL 3FQTA 4XMLH 5J13C 1AHWA 4K94H 4F3FB 3BIAX 4GNKB 4ELKA 3TO4A 3IDXH 4HX1A 3Q6FA 3S34H 1WFNA 4KNUA 1GCFA 2W91A 5D96B 4O51B 3ARDC 4ZMQA 3BD4A 4JB9H 4XVSH 2E9GA 5DFTA 5ESQB 5CXPA 4KHTL 3QA3B 1HJCA 1JV2B 3IDGB 2F61A 1YN6A 4G3YL 3C5ZD 1BOGA 3MCLH 5GS0C 1YY8A 2AF2A 3BD5A 3JWNC 3OLGA 1RXLA 5JO5A 3EGDB 4WJ5B 2NY5L 5FYKU 3VFRB 4G6ML 1X9QA 3RAJL 5GIRA 4LSQH 4YSAA 1ZTMA 2E9WA 4Y1AB 3VWJB 2FHCA 1TJGL 2OMZA 5T3XE 5D93C 4X9BA 4BFBD 3BLKA 1KPVB 3T5WA 2QGCA 3VFSB 3DO3A 5K9QG 4GSQA 2PWDA 4HUVA 1J87A 1H5BC 4P3CL 4N90D 1T4WA 4D8PB 3MRHB 4B60A 2XY2A 4LSTH 3RP1A 1RZKH 5AAMC 5F1NB 1C16A 2WXOA 4JN2A 4DAGL 1HIMH 4KI5E 1JPGA 1PEWA 4BZ2A 3DSFL 3PV7A 3GF8A 4EMZA 1F6FB 1JP5A 2DL9A 3TOPA 2YGNA 1ZA3B 1URIA 3VQ2C 4ZFOA 4H88H 5DYOB 1YEHH 1FL6B 5D2NE 2R56L 1D5MB 3V5HA 1SQ2N 4XVUC 5KYNA 1RIHL 1BV8A 4M1GH 3T6WA 2J71A 4G1MB 2CIKB 5JDSA 3ZTNL 2EUWA 2CHXA 3S35H 4B9JA 2X4UA 3B7TA 3AB0B 5DS1A 4P3DA 5KJRH 25C8L 2HX7A 3ARBC 4YXLH 1OP3H 2VR9A 2DM2A 1ZLUK 3VW3L 3FT4B 3QWOA 3VWKD 1D9KB 3ZIYA 15C8L 4ZMOA 5IW6B 2VW4A 3FUMA 1F90H 3L1GA 1ECZA 4LIQL 1LVEA 4XZUB 3V6FA 5AKTA 3U7YL 2A9NL 3VRLE 3VGGA 1T04A 5TF1L 4DK5A 3WBDA 4F15C 4L9DA 3VD9A 4HSQA 3K1DA 4X4KA 1KPRB 4FQPA 4XMZA 2AV1B 4FZEL 3F12A 3IGLA 2QR0A 4OZFH 4XP9L 4C58B 5DD3H 3MXVL 4MS6A 1BZEA 1X5FA 2E59A 2NSMA 3GQFA 4H0HB 4NNPL 3VD7A 3W82A 2WIIA 2L3BA 4ZMVA 5CJ8A 5PCYA 4W9FC 4CN6A 3K81A 4XH2A 4I89A 1XMWA 1IEAB 1QFWM 2XSKA 4EN3B 4U6HB 3RLSA 2R0ZL 3OLIA 4ODBD 1TYEB 2VLKE 3T2LA 1A7QH 1BBDH 4XPBL 5FHBL 5AOJA 4FTVD 4GLRH 1NC4B 3GMRB 2BZCA 5BZWB 3BX7C 3Q9PA 4G42B 3GB7B 3AC0A 5D96C 4DVRH 2CMRH 1MI5B 1MFCL 1N59B 2F1EA 3MRLB 5KTEH 1AXIB 1GGCH 4FN0A 4Q0XH 2CLZB 3L3OA 2R69A 1HXYB 4P23A 2OYKA 3UG4A 3PNWB 1A6PA 3ZTCC 3SBPA 5FYKL 3VA2C 2IH1B 4OQTL 4WUUB 2Y1ZA 3ZTJH 3QH3A 3ECBA 4N8PA 2EDMA 1T20A 4ZW3A 4KZDL 1A4KB 4HF5L 5E7FA 3VWJC 4H7VA 5ICYA 4BFKA 3BUBA 1U8LB 3OXSB 5DURD 1A4CA 4XWGH 3LHPL 2F19L 1FVEA 2X2JA 3K5RA 2WM0A 3GSUB 5AL8A 2DQJH 3IRCA 4W4OA 5AW8B 3HR6A 1BVOA 5DJDA 3IMVA 4NJAL 3IN0A 1OAKL 1J8KA 4N9OB 1JERA 4WU7A 3BWSA 1D2OA 5I19H 3D33A 3GHEH 4PB0L 3PWPE 4GAGL 1QG3A 2PMZA 2F08A 4UAOB 4XXDB 4DZBA 1ZHNB 3KGSA 2JXMB 3GXMA 4TSCH 4DKDC 4XPTH 1ZTXE 4HJUA 4A55A 4KK8C 4M00A 4XMUA 4TTDD 5AFAA 2P5WB 5GRJH 4J1UB 4RNRA 3T2QA 4AEHL 1PW3A 5CLYA 5E5LA 4L18A 4ES8A 4AVIA 5I1IH 4OH2A 1NZRA 3JWOC 3AB0C 4YBQC 1Z9OA 2BCKB 3O3DA 1SGKA 2PXYD 4AJWA 4LXFA 4Y19A 1NTDA 4ZMWA 3RNQB 1XL6A 4WV1B 1G7IA 1YAZA 1JZHA 1L0YA 3ZOAA 1DQJA 1ZWIA 2WXQA 2ZYSA 1Q9OB 1BIHA 2IADA 3L1EA 1JTTA 5LXGL 5GS1B 2AJVH 3IJEB 2G4EA 3T1WA 1IBHA 2EDJA 1EDHA 3CN0A 3KEHA 1AVAA 4KTDL 4J23A 3VSTA 2CK0L 1SEQL 5KVDH 1WCBA 5I76A 4E9LA 3PG2A 3W1ZA 1DQML 4JY4A 2H2PC 4XWOC 1OGAD 4LEXL 4H8WC 2NNXA 2MKLC 3CC5B 4K7PY 3DX6B 1OWRM 2J88H 1UXWB 5JXEA 3QEQA 4Q4EA 1DANT 3UC0L 1MQKL 2BXZA 4EN3C 3QUXA 1KB5H 1NUGA 3EOYG 1AZUA 3GGWB 1EEZA 4LOFA 1DL7H 4JN1L 1ASPA 4PJIA 1H8LA 3GSRA 2E4TA 2Q3ZA 2XXCB 2HT4C 1M56B 2A0LC 4LZKA 2VYRE 3ZR6A 2A5UA 1NGWB 3VVVA 3MLVL 3HE7D 2BNUB 1UT1A 3RTQD 3RVUC 1ULVA 4K5MA 1F4AA 3KXFA 4OD1L 4KY1H 1J9SA 4ENZA 5DT1H 5JLZB 1N2RB 1FIGL 2X05A 3NH7H 2JKWA 5I9QC 5L4IA 1EHLL 3V52H 1MHCA 3G9VA 4AQ1A 4KO7A 5CP7A 4U3HA 4P5TA 4C56E 5ALCH 4XCNA 2JB5H 5KVMC 3LN5B 4GT0A 3G3LA 1E9PB 5FYLH 3D9AH 4UDTA 5C3TA 1JRHL 4U6XB 3TCLA 4CVZA 2CUHA 3QJSB 1PNCA 2Q8BH 5E9AA 3VXUB 3L4YA 1EDYA 4OZHE 1F4WH 2O5YH 1GRWA 2DQHH 3BAEH 4ELMF 1AO7A 1MCJA 2GJPA 4JHWH 2B8OT 4CNIA 1QR1B 5L4JA 2JMRA 3AXHA 5KW9H 3L3KA 3OJMB 4XNAA 5DJ8A 2DQIL 3BVTA 2CIIB 4MAUL 3Q6FB 4GT7A 2VDML 1PGRB 1CICD 2B3IA 2CJUH 2OTPA 4LLYA 4UAOC 4WTZG 5HHMB 1PMYA 1RZIA 4YHML 1HE7A 4JMNA 2X4SB 3DPBB 2FYVA 2JTYA 2G30A 2EO9A 2VUYA 1K85A 5DS8B 5D7IF 1HHKA 3OG6B 5E4AA 3BW9A 4FD0A 1UH2A 3NESA 1KNOA 2CHNA 2R0WH 4OT1H 3SJVE 4Y4KD 3ZQ9A 5IMOB 3IWUA 4GQ9L 4Y7OC 4ANXA 4DUWA 1AGEA 2YXMA 4XMKL 5CR8A 4WV1C 4QRRE 2OMZB 3EDEA 3FO2A 5IKCA 2PPEA 3X1FA 1B4JH 2WGXA 5EOTA 1DBBH 2G4GA 3VXNB 4PMEA 1S7SA 1FF5A 3KPSA 5GS1C 2AGJL 4OFVA 5EUKB 3FL7A 3A4EA 1Z9SA 2PCPB 3MFFB 2EJ1A 1JZ5A 2ITEA 2BP3A 5I82A 4JN2B 2YPLD 1KDIA 1ZT4A 3MBEA 4F7EA 3ZL1A 3AS1A 1G7LA 1PYWB 5HYJD 2J6WA 2C3GA 2JCCF 3CVDA 3WUZA 1YJDC 2GK2A 1MRCL 3IKCB 4PU2A 4X4ME 2NTFB 4ZFOB 3ZE0B 4F8TA 3BSHA 4R3SA 2WNXA 1DVFA 5JDSB 2VLRD 3RWGB 2Q3AA 1WA0X 3WKNA 4HGKC 1V54B 4ZO9A 2XN9D 2IMNA 3NT0A 4MNGE 5F3HA 3V8CA 4LU5H 1XV8A 1OCWH 3H3BC 1DBKH 4L29A 1IGIH 3S2CA 5D2LF 2X1WL 2OV0A 3KS0J 2X28A 3ZHLA 5J0BA 4MNQB 2WJ5A 2WB1A 4FQXB 3V6FB 3DHPA 4XR8C 1EHNA 3BPNB 2WBJA 3QQ3B 2JELH 1CE1L 4F58H 1WWCA 3NQKA 5CEXB 1T04B 5GRVL 5H35B 5K93A 1A14H 1XFPA 1NAML 3QWRA 4KQ4H 4GYBA 1VGEL 3LRLA 3T4YB 9PCYA 3FHQA 3N9GL 5AAWC 3S37X 3GRWA 2AJSH 2YHGA 1R3JB 3BKCH 2GAZA 3LXCA 4AK1A 1J1OH 1MJUH 3MLSH 3HNSL 4HZLA 3WFZA 2LU4A 3ILQD 1M53A 3SDYL 3I85A 1YRKA 2ZOUA 4XNDA 5E6IC 3C12A 2FB4L 3GIZH 4N0UE 4NX0A 1OAQL 4GO6B 2LFGA 3SE6A 5D1ZI 1N0LA 1Q9KA 3K72A 3KBPA 2Q20A 1ODUA 2LFEA 4ZW6A 4G6FD 1FZJA 1AHWC 1I1AB 1AQKH 4L0ZA 5ETUB 2D3VA 5B1JA 4EZJA 2AXWA 1CGSH 3VYNA 2VDLB 3R18A 3TO4C 3TYFA 3LNFA 2ZOKA 3GXUB 4FG6D 3ZT5A 3BAYA 1G7MB 4UTAA 5D1ZA 3ZYOA 1HDMA 1QBMH 4WFHD 5EDSA 3HMXH 1LEKA 3VU2A 1IM9A 5TQ2H 3Q48A 4I1RA 1TYRA 3WHE0 2H47C 4OF7A 3TBVA 1BGXH 3W9EA 2XFGB 4P23B 5I8EA 3QUMH 4DPBX 2AQQA 3H9SE 3R7QA 3M86A 2D8KA 4GXVH 4L4TB 5DD5L 5EBWA 5E95B 4K3JH 5D7SL 1V05A 1CDGA 3O0RL 1JV5A 3OHXA 3QH3B 3A4AA 2QVKA 4U05A 3MSPA 1NICA 1PTZA 3LQAC 1ZSDA 2VR5A 2Y6TE 3P9LA 4WGVB 1DDTA 4BK8A 5L4FA 2HVJA 4QOKE 5ACZA 4TUJA 5IUSA 1EGJH 2C3XA 4KROB 3RFRA 4HKZA 4PGBB 2OP4L 1UFGA 4XO5A 4CVXA 1FVEB 1JSYA 3FUNA 4QRPA 1NPJA 3MRPB 3UYPA 3GI8L 1FRGL 2WCGA 5I1DA 3OR7B 1QP1A 3A4DA 3BPOC 3OVUB 2EINB 4WU7B 4WK0B 1GMIA 5T3XD 4MDRA 2GHZA 4PVNA 4I3SL 3FT0A 4RLDA 3NN8A 3ESNA 4YWGL 3ZYJA 3J8F7 1BZ7B 2BSBA 4XOBA 4Z7UF 3QQXA 3T8MA 5FDWA 5KYYB 5K1JA 1QSVA 5JPNA 4PREA 2P47B 2Z93A 4FQQA 4QTIH 3BFOA 5DD1L 4ESKA 4KI5D 1SXAA 4H8HA 3WU1A 4X80L 1IKNA 4KZCA 3WFCL 1E5BA 3HN8A 4Y19B 2XPYA 2WKOF 3EJZD 5E2VH 2DEYX 2VLJE 5AZUA 5E8PA 1G7IB 1FLTX 4HMCA 3O8XA 4PJBF 4QI3A 1ZWIB 4IOSD 3SDAA 1K6QL 3SDDA 2K8QA 2PO6A 2WWKO 2YD4A 5FKPA 2FSEA 3C2AL 2W60B 5BRZE 4U31A 2CM6A 3KVDD 3C5SA 3PWUA 1IFGA 3D18A 4M03A 2AQ2A 5T5NF 4S1QH 4HA1A 3VSUA 1Q0YL 3BUPA 3MACL 4FFYA 5LN4A 4QYAA 3I02A 4Z0XA 4AW7A 3GC3A 2Q1EA 3MGTA 1U8KA 1SVBA 5D8JH 4AIOA 1BVKB 3J2PA 1RK1B 1N10A 5AW4B 4OZFG 4IBLT 4N1EA 2VJ0A 5BOPA 1H9VA 2HVKB 1ZDSA 4N5EC 3ZO9A 4JPIA 4DKTA 4PJ8A 3HC3H 4B9GA 3KPRE 1EEZB 1GHFH 2VTFA 5FO8A 2DTMH 1ZIAA 4L2YA 1MAML 1XR8A 3QULB 4O02A 4EVNB 4DUXA 5JHAA 2G9HA 3GSRB 4GRMB 3FTXA 2RA1A 5J06A 1E40A 5F9JB 5BQ7A 1KJ2L 2WLLB 4E5XG 2WJ7A 3KLAA 4IHOA 4QCIA 4ZJ9A 2GABA 1NMAH 2IPTL 4KKRA 3UPAA 3VXSE 4YXHL 4PVLA 4FA7B 2CNYA 5TDOA 2QKSA 5HD8C 1BJ1J 1Q1JH 3KWWA 4QKXB 1BYNA 2NXYB 3HG1A 4CMMB 4WI3A 2WCSA 4OM0L 2VLKD 1JZ7A 1M4KA 3L3OC 1KLGA 4P23C 5CP7B 3O4OC 1CXFA 1PDKB 1EXGA 1Z3GH 1OLLA 4KZ0A 3RWJB 1LD9B 1M6UA 1WVZA 3KLHD 4NKIL 4QT5A 2A7BA 1I9JL 1YDPB 4UDTB 1I8UA 3TCLB 3DVGB 3FQYA 3ZTJG 1FC1A 4CVZB 3FC8A 4OLEA 1VEOA 1KFAL 5FOBB 4KROC 1E4KA 3IDUA 5TFSL 4KKAC 2WXKA 4F92B 3OHMB 4IKJA 4KKPA 2GIMA 4LPWA 1U33A 2MCPH 5DZJA 1AO7B 3HZMB 3UJTL 4CNIB 2GSIA 5E2TL 4W4OC 3O0LA 5C0CA 5KVDE 4Z76A 1ACZA 3ABLB 4A68A 1UEYA 3OAUH 3L3KB 4JQVC 1F3JA 4NZDA 4XOAA 1LO3L 1DSFH 2ED8A 1MCPH 3BVNB 2VDRB 5T33H 4HC1L 3FTUA 2N3JA 3GBEA 4KFMA 1RZIB 3K8MA 3MR9A 3OKLA 5I73B 2XWZA 4PGJA 5B3SB 3JV0A 3KPPA 3JYCA 3TEZA 3P30L 4W9HC 5A6MA 3B9DA 5F7DA 1GZQA 1UQSA 5F8QC 2P3YA 3APCA 3HE6B 2DQTH 3L45A 1KNOB 4K23H 1CFQA 5IOPB 2BVQB 4LSRL 5GGQL 1ZGLB 3KPQA 3DKHA 1PF3A 3S8GB 1A65A 1E27A 2F15A 3MREA 1O0VA 2I60L 1XGRB 3ESVF 2E6PA 2AEOA 2ZX8A 5EOTB 3T3ME 3TP4A 1P6WA 4L8SA 1JXKA 5IB3A 5EOCL 4PCYA 4Y16A 1BFOA 3APNA 3CLEL 1BZQK 1N0XH 3RUGA 1UH3A 1I8LC 2VO8A 3C8KA 4NUMA 5L2KB 3QDME 3B7UX 1ZT4B 3SDXF 3MBEB 1OSZA 5FYLE 2WZPA 1ML0A 4GAAA 4ZUWB 1A6VL 4E9RA 2GB2A 3PUUA 5CGMA 1QFUH 3JQOB 4KJQC 3GJFB 2CLVB 5IIEB 3U4BL 4LBAA 5JXEC 3CXHK 4R3SB 4I77H 4L3EE 1DVFB 1WICA 5LBVA 5C70A 5J1AA 2AEPL 3QUXC 1Q9LA 2QKIB 3G6AA 3V4UL 3ZK0A 1R24A 4PY8J 2DS4A 4NQEE 3VD5A 1SF5A 4L1HA 2HJLA 2OTWB 1RUML 4NQVA 5CNHA 3C87A 5GRVK 1I9RL 2AKRA 4JFFE 3V4PL 4TNFA 2XQYA 2FHFA 4AENA 2Y9RT 3SGKA 4JHAH 3KBEA 5IESL 5ECGA 2AJUH 1Q9WA 5EEZA 2VOTA 4YNYB 1KXQE 4U3SB 1E42A 4JPQA 4UM9A 3NIGE 4NRZA 5EF3A 2VQ4A 5C6PB 1BF2A 4AQ1C 1ZV5A 3B7YA 2FWOA 4KQ0A 4HK3N 5JORB 2FLBT 1TITA 5IB4B 1YEIL 3UC2A 3VFMB 2GAZB 3MV7A 4PJEE 3TIDA 3FU7B 3C6SA 1WISA 2NY4D 1WP6A 3GKWL 4YIQA 5JHBA 1O5PA 3U6RB 4WO4A 1R1CA 5J11C 3QIWD 2F7IA 3CFDB 2BWIA 4APQA 2GUOB 1J7VR 3K72B 3K0WA 4XNXH 4C56D 2J3SA 5JHDE 5EOQH 1T2XA 1SN0A 4I2XA 4BQCA 4G6JL 4LBEA 1SVZA 1JDCA 1BFVH 1JGLL 4PD4J 3MJ6A 4W81A 3TYFB 4XI5C 2FNBA 1J1PH 5G5DB 3R0MA 4S1DC 3V0JA 4NCDA 1HDMB 1VGKB 4AXWB 4WEUD 3ZY7A 3D3VA 4HHAA 1CC3A 1LEKB 3F58L 5I73C 1IM9B 3QJOA 2W92A 3FRPG 3UADA 2FGWL 4QWWC 3IT8D 4DH2A 2ENJA 4OZIE 3QEUA 3QJFA 3W9EB 3FDWA 3Q13A 1QVOA 3BT2H 1S7UA 4Z7WE 4I3RL 5DC0A 5EWIH 2V5YA 4PP2A 2YIHA 2NUTA 3HE6C 3SE8H 1NCWH 5DZAA 1U4EA 4FA6A 3M7OA 4J3SA 1T03H 3GSVB 4MCMA 4JFXA 2W8CA 4GQZA 5JMRA 1IBGH 3OQRA 4AEIL 2ZD0A 4KUZL 1BM3H 2ED9A 1IC7H 2MPVA 4HKZB 2B9AA 2BO0A 1R3IL 5HGHB 4IRJD 4QRPB 4EBQH 3MJGX 5EEWA 1S3RA 2CXGA 3ARED 4NQCE 3SJVD 1IGMH 1XF3A 3B9KD 4AGMA 1G6RH 3IPFA 1HILB 1CU4L 3KYMB 2AXFB 2NX5A 5AYUL 1HK6A 3VJ6B 3MBEC 3OXRA 4QRRD 3U25A 4X9FA 1NCDH 3BZFA 3ETBF 1EJOH 3MOAL 4ODUA 4B7LA 4MJ5A 5L6YH 4G8GB 1KJ3H 3MV9B 4AYDC 5DEGB 2VABA 3ATAA 1DVFC 2JNZA 2P43B 3V5KA 2QQNH 4HWBL 4GRWB 5H4ZA 2NUPB 2DPKA 3TJEL 2HFFA 4NZFA 3P4MA 5FKAA 5M7QA 1QSEE 4MB5A 2JV6A 2WAHA 4JJ5A 3NK4A 4QHLA 1AC0A 1RIUL 1XCTB 2CGRL 3CU1A 4OLWH 4ZUVA 3HUJF 4MXVF 3O8XB 1TEGA 2DQDH 3CXDH 1LGVA 4UB0L 3SDDB 2WBJC 3BEVA 1G0DA 4XPFL 1JDDA 4LP8A 4DEWA 43CAA 3PLYA 5FOJA 3C5SB 4M6ML 3D18B 4KMLB 5IVNA 2JCCA 5ABZA 2VQ1A 4FLSA 1THCA 3O2VL 4JE0A 4F7PB 1GIGL 2W0KA 2R1YA 3IDJB 5I5JA 4XC3H 3I02B 1U8HA 4RSVA 2ERJC 1JD9A 3V0VA 3P77B 3MGTB 3DXAE 3MRMB 1WH0A 5CFHA 4KXAA 2PYEB 3MZTA 4LPXA 3MRFB 2UZYB 4Y8AA 5DVNA 4BQBA 4PJAA 5AVZB 5I15L 4J4PD 4LAJH 1XR9A 1VAHA 2A9BA 3INOA 4TS6A 3WKMH 1B90A 4JFQA 4JPIB 4KHXH 3I3BA 1YC7A 1QLFA 5IFAL 5F44A 5HBBA 3B43A 3L54A 3IJHA 1VDGA 5B1JC 5I1HL 3K91A 3CE1A 3L95B 5IK3B 1CIDA 2LGNA 5BQ7B 4N26A 3RX9A 4PG2C 4GKLA 5IG7A 3QZMA 4IHOB 3LKRA 1U8PB 1U8CA 4QCIB 3DX3A 4PYGA 1NOLA 1MLBB 2ZQKA 1OD7A 4XCCH 5TDOB 1GAFL 3UAJD 1MREL 4DERA 4PJ5E 1QEWB 2OL3H 4R8WH 4LSVL 4PIRF 3ALPA 3BI9X 1KLGB 2RB8A 2VB5A 5GS0H 3MTXA 1EVUA 3JWNH 3CN2A 2JLPA 5A16A 2Z0BA 4WWPA 1NBVL 1YZZA 3KWVA 4Y2DB 4QT5B 2WXLA 3P0GB 4R7DA 4FKHA 1NOAA 1HZHL 3TWYA 1LP9A 5EC2A 4C54A 4EZLA 2XA8L 1A6TA 3C5XA 3HCVB 3OAZK 2NY6C 1VADB 5K9KA 4IJ3B 2TAAA 1AQMA 3MRCB 4EF3A 5F88B 2GSIB 5IJVA 1DVUA 1UCTA 4R26L 4R83A 4Z76B 1JGIA 2VXQH 1J86A 2WXNA 3U0WL 4GSDH 5F71A 4ES9A 1ZE3H 1F3JB 5ECJE 3D2UB 4RMWA 3QISA 4Z7VE 3PL6D 5HDQL 4QOKD 2EKJA 3VFPA 1KCSL 2AANA 2UY6B 3IBOA 3FQRA 3TIEB 3RPIA 4HFWB 1FL3B 1RV6X 3CZFA 4X4ZA 1A7PL 5I1EH 3FBQA 3UMNA 4MZIA 4ECNA 1XH0A 1D5ZA 4AYFA 2GT9A 1LO2L 1UZ6F 3BAXA 5F7DB 1GZQB 3L5IA 4KPHH 4ZUTB 1IKNC 4TUKL 3CQPA 2PWEA 5I26A 2AJYH 2WWOA 5HYIA 1HU8A 2BNRE 5ALBL 3QCVL 1QPKA 3O8XC 1WBYA 4OJFL 3SDDC 3MREB 2PO6C 4HJ0C 2CJTA 1ZS2A 2Z31A 3F05A 1E5ZA 1NDMA 3UYRH 2DIJA 4B50A 4CMHC 3T4AB 3EXLA 2YQBA 4FXLA 4U1LB 3CFEA 4QAMB 1S5IH 3LS4H 4Y16B 4ZPTA 7CGTA 1BFOB 1MWAH 5JW4N 1A66A 1HHIB 5C71A 3APDA 5IY5B 1LE5A 1YMHB 5DRNA 2VLJD 3FOMB 4TNWF 3ULVE 2FL5A 4FNTA 3CSPA 2K9FB 2KZWA 4Z78A 3TJHC 4HW6A 1VLXA 3D12B 5SX4H 4JZJB 3CN1A 2J1WA 3FAWA 5BRZD 5DJZA 1CUOA 3NOIA 4WW1B 4L4JA 5IQOA 2IV8A 5IJBC 4TF4A 4OU3A 4QIRA 1Q9LB 3G6AB 4PJ8C 2BRRL 1NGYB 4PJBA 1K2DA 4NT6A 4EEEA 1A9VA 1F4YL 3QDGE 2HJLB 3TBCA 1FBIL 4KRPD 1IBYA 4O5LH 2B2XH 5LB1A 4JPVL 3F64A 3RI5K 1BW8A 2DB8A 5DEFB 4GP4B 4UWQB 3U0TA 2R23B 1RKRA 3DTUB 1RERA 3HNTL 3ZRSA 3MPCA 5AOZA 3KPRD 5AKSA 2FQDA 1RJZA 4XN4A 3LKOB 1UM6L 1H3GA 4YHKH 2XNAA 5AW9B 3QCTL 1WZKA 4ONHA 4AJYV 1E65A 4E9SA 1S7WB 2IGLA 4BH8A 2XWRA 4JW3A 5GSRB 3WN5A 2ZAHA 4ZZFA 1MJ8L 4KJYA 3ZE1F 4U1HA 3RGBA 1S5HA 5EU7E 1WEJL 2ADFH 3JZ7A 4NWTH 5L4MA 3MV7B 3WEOA 3TIDB 3RVXD 2NW2A 4V1DA 1N6QL 3VXSD 1FVDA 4PG9A 5DMIL 4UNVA 4AKPA 4A2FA 4D0BB 1J0JA 3K6NA 1R19A 1V27A 1IBFA 4BFGA 1E4KC 4XHJC 5BUAA 5FLUA 3JT0A 4TOYH 5DZPA 1KJVA 2BRQA 4HWUA 3NFSH 3PWVA 3SPJA 5DDHA 2Z8VC 2IDUA 3WY2A 2NSQA 4I2XB 3TV3H 4LBEB 3LH2H 2H6OA 4N4YB 4GW4A 1GXEA 1KY7A 2BIOA 4FG4A 3BP5A 3N04A 1E6JH 3DBSA 1XGZA 4M8QA 5KS9F 1MPAL 5E8OB 5E1QA 3WE1A 1RUQL 4YDZA 2VXVL 4G6AC 3X14A 3FQ4A 3B9AA 2EH7L 4FLRA 1U3YA 3QJFB 5EZJA 2CO4A 3N91A 4HKJB 1S7UB 3JWOH 1XD1A 2HB0A 5C0AA 4NO5B 4PV8B 2YK1L 5SWSA 4NRYA 3FCUB 3LZQA 3GTNA 1V5JA 4XC1H 5EIIG 4GMTL 1SVCP 5KZCB 2CKBL 4NO0D 5H94B 5DK3A 4Z7QF 4R2GD 3GSWA 4LARL 3OAYK 4Y8DC 3S35L 4L8SC 1MY5A 2H3NA 2YR3A 4UT7L 1GPOH 4XBGB 2L0DA 4Y16C 3DK2A 3SYQA 5CU9A 5K1NA 1CLYH 2Q5BA 1PPIA 4B7IA 4YXLL 4XMTA 5AOMA 4FNQA 3QCUH 1XF3B 3IM1A 4XVJL 4NZTL 4HLZG 1KPUB 3MJ7B 4MDIA 4PJFB 4AH2A 4Q9RH 4RESB 3WIHA 3BZFB 1MVYA 2AV7B 4LKXA 4ODUB 1NH6A 3RDTB 1A3LL 1IT9L 3LQZA 1BQLH 1HQRB 5FUOL 2HCZX 4YZFE 3MA9H 1ES0B 2YPVA 1QATA 4EO5A 3IFNL 3C5ZA 1RMFL 3M45A 3WJLA 1P84K 1UB6A 1D6VL 4WNJA 2XDHA 2WD0A 3HA0A 3QPQD 1FNEA 3QDMD 3LEYL 3KL3A 4HQQL 2HFFB 1MELA 5CO1A 2H41A 4XAWL 5DD3L 4FP8H 4S2SB 5ADOL 5FYLD 4QHLB 4F9LA 2BIPA 3R0NA 4ZUVB 4WJG3 4RFOH 2P5EB 5IREA 3HBGA 1RUKL 3SO3B 2R8SL 1WZ1H 1QO3A 4L3ED 1KC5L 1BSIA 2BVYA 3IRPX 4C59B 4JGJA 2OJ1A 5J4MA 1SMAA 4F57L 43CAB 4CJ1A 2IOOA 4PRNA 4NQED 2Y06H 3ISWA 2VQ1B 5GJTH 3HS0A 1MFAL 4A2DA 2FJFB 2IG2L 3UEZA 4ATWA 5ADPL 2X10A 1J0ZA 1CO1A 3WFHB 2DH2A 2FWLB 5E08H 1NBCA 1FAKT 1IBDA 4ZX5A 3U7WH 5LGJB 1JIBA 3ULUF 3GZPA 5AB9A 4FQJL 4Q0XL 5C6TH 2VXTL 1W0VB 4WO4C 4HCRA 2HJKA 3OM3B 4H20H 1UD3A 5KG9B 3BPCB 4JFQB 5HY9A 2IEPA 3REVB 3HB3B 4OZ4A 3BP6A 1QLFB 2GJJA 2GEEA 4DK3A 5T1JA 2ZICA 2OYLA 4XO4A 4M61A 2O5NA 2VXSL 1JPFA 4BRJA 4NC1C 1JXFA 4ZS6D 1CL7L 1GGUA 4W9JC 4X6CF 5JIKA 5E00A 3T1FA 5ID1B 3W37A 2ZOTA 4ZS7H 3QB7C 5L8LB 4FYTA 4X7TA 4Y4HD 3GUTB 2J8OA 2WLIB 1MIEH 4POZC 2XIIA 5FCUH 1L7TH 1AOHA 2UZXA 1XMEB 3QO1B 1D3CA 1E3FA 4ZTPH 5JHDD 2OSLB 3LNGA 5HVHB 4RGOH 5A16B 1WC7A 1LDSA 3H8NA 2AK1L 4JDVA 5AEAA 1CD1A 5E24E 4M56A 3U36B 2PCXA 4JRWA 3DVFA 5HHOE 2X6AA 3UZQA 3ASOB 3BP4A 1BEYH 1QYGH 5CSGA 3T2NH 3ESOA 3X3GL 2XKNB 1EAPA 3PWNA 1J0IA 1RL1A 1HYSC 1WQVT 1F4HA 2F54E 1MCLA 4ZXBD 4NP4L 2ICWB 3EKCA 3GXNA 4HSCX 4KX7A 4D9QE 3HI1B 1FAIH 5IJVB 4FTVA 4KK6C 3WJMB 3BRGC 3PYCA 4M5SA 4X4XB 2EP6A 2AJZA 3CTTA 3NSDA 5IZ7A 4HHGA 1SLUA 2VN7A 4Z7IA 1YJDH 3RVWD 2ADIA 3RDTC 3HAEA 5LCVA 5I30H 4DQAA 4LCWB 4TLSA 5FX3A 3RPIB 4ZMNA 2OMWB 1CFNA 3HVNA 5IEHB 1NCCH 4NQCD 1A1MA 4XCFL 3A6CL 4QNPE 3EXJA 2GT9B 4J3OC 4ZFZA 3I6KB 4OM1H 3DROB 4JZNB 1IARB 1NFDE 2O6EA 2PABA 1GJIA 2KDGA 5M95B 1EHKB 4MJJA 3CSBA 2NYYD 3VQ1C 4M4RA 2BFGA 4LAQL 1RZ8A 4OLYL 1LQSR 3NJHA 3L7EB 1E4XI 3L7FA 3Q2VA 4MJHA 3SO3C 3WIIL 3QPKA 6FABH 3U9PL 4GXUM 2F74A 2ZX6A 5DU7A 5DMGC 4W9IC 3CFEB 1N5YL 5F7HA 3UJJH 4UQAA 3JWNE 5A2IH 4HBCH 1QSED 1J8HB 1LE5B 3HZ3A 1DHKA 3FYIB 5E94B 1PG7L 4N24A 2BIHA 5CLXA 5DRNB 5EZOL 5AW0B 3VQLA 3GXIA 3CBKB 4WSKA 1Y6NR 1NOFA 4PW3A 4P46B 1JGVH 4NYLB 5JXAH 4HIIB 2ZXQA 1YEFH 3FO1B 2F8IA 3QQDB 5SV4A 4OV6F 2V9RA 3NH7L 4RBPK 1DQLL 5GRUH 4X42A 3VAEA 3CFBB 4UOQA 4XGZB 4FQ2H 2UUDH 3TV8A 3CSYB 2VDPL 4NHCH 2BOBA 5IEKA 5DD0H 1JHKL 1AOZA 1K2DB 2AP2A 3HB3C 4NT6B 5ITBL 1FO0L 2PXYA 4KKBD 3AG1B 5F7NC 5IBUB 3AZUA 3L08A 2AJXL 3DXAD 3GMQA 5CUSL 4FQ1H 5IF0A 3VMOA 1G9NL 3MYZA 2A6DB 2Q8BL 3US1A 1BLIA 3CDZB 1QFWI 1O7VA 4YDIL 4YVUA 5EO9A 4F2ME 3G6JE 3R19A 3BZEB 1QRNE 4GI6A 4IK6A 4N2BA 3QG7H 5HGBA 4YDJB 3S3CB 4ZAKB 1RJZB 3NYKA 1A9BA 4XNUH 1J5CA 1B0RA 5HVHC 3W38A 1UYWL 1ACYL 1YNTF 4YHPB 2OMYA 1OGAA 3H4HA 2XICA 4H8UA 4OD2B 4U1HB 4YDKL 5F93C 3VU1A 3JWNG 4ERSH 4QJ5B 1KEGL 5GGVY 3EGXA 3RWIB 1DLHB 2G3NA 3SYAA 3US9A 1BQ5A 4V1DB 4YJZL 2GI0A 2APSA 5F1OB 1RZGB 3BO8A 4MBOA 2YMOA 4PJ5D 4J3VA 3HR5B 2JLLA 5E6RB 2OR8A 1AXTL 2ZKXA 1UWGL 4LL4A 1V7NL 3ZL4L 5HJ3A 3TVMD 1WFOA 4X6DE 4GQQA 4JPWH 1JVLA 4LLQB 2EZ0C 1GYAA 4I9XA 1I9IL 2AI0L 4N0CC 3WXVH 3PWVB 4P57A 2WOYA 4N8VG 5FECA 5TDNB 4PJGA 4HIJA 1L9MA 3VSQA 1JWMA 4B97A 3HE7A 4BZ2H 4Z3FA 3RTQA 3ECUA 1U9KA 4F8LA 3QDJE 2XZZA 3P11L 1XB8A 4L5FH 2J1YA 1THAA 3VFGL 3DETC 1AYOA 4O2EB 3TTSA 2VRKA 3NZ8B 4WUKL 3NZSA 2Z64C 3P3YA 4ONFH 2HAZA 2FNWA 1CTNA 3X14B 5EZJB 2NY5C 3DX1A 1GJWA 4NM4H 3IXTA 5C0AB 1F6AA 4LCCA 4OR1A 4PN6A 4OF8A 1I3RA 4NRYB 4QMEA 2PUQT 4FFZA 1UXSB 3I9AA 4DEPB 4Y5XB 5FGSA 4FQLL 5C2BH 1PL3A 3QFGA 1E8YA 2HUEA 3CFNA 4NS0A 4HFUL 2OMTA 4HZ1A 3W11C 1OP3K 4P2RE 5EA0H 1SXSA 3MCKA 5D6CA 2VSMB 4P2OD 2NY1B 2YJQA 5AVRB 3NUKA 4RAUB 4MA1C 2D03L 1E67A 2WQVA 2BNRD 1CICA 4FJ6A 5AZ2L 4X6BA 4P46C 1WFUA 4AH2B 4FXKA 5IMLA 3UTPE 1RVFH 3GSXB 4IU2B 5KYXB 1XT5A 5ES4B 1FFPB 3LQZB 1FNGA 1A5FL 4X0KA 3X1BA 5GGUB 1R5VB 2FQGA 4DPCX 3MO1B 1FNEB 4YDVB 4Y4KA 2C7UB 1RJYA 1AI1L 1JJUA 1ITCA 4NRXA 1GOGA 4QRBA 5J6HB 1YEDA 4MJIE 2JCWA 3BUYA 4P9MH 1MNNA 1PSKL 2VDNL 2VDLH 3HHMA 2UWEF 3ARTA 5D1XB 3WAJA 4IRSD 1U8IB 1WPCA 4MQXD 4MQ7A 4OFKA 3DLQR 1BDYA 2K0RA 5DRXB 2VZTA 4L3FA 4L23A 5GISL 5FCSH 1MFEL 1MCOL 5EIVA 3MLZH 3ES6A 3EO1A 4LRNH 4OGYL 4ZAKC 4XX5A 2YPLA 5DUBA 3QDGD 3HS0B 2Q6WA 2FX8L 3D0LA 4LVHB 5BV7L 5EZLB 1ACXA 2BM3A 1WLHA 1A4JB 2BJMH 3WN5C 1X44A 1DJIA 5HYJA 4K4KA 4J7RA 1QBML 2CU9A 3UIZA 3PGFH 1AR1B 3TEUA 5CJQH 1XSJA 2VLRA 2YD6A 4QXGH 2D0GA 2HJKB 3QNYB 2XN9A 1N26A 1JZFA 1VCBC 2YOCA 5F7KC 3UPRA 4CSZA 2E0PA 1GW0A 3L1FA 4HJJL 4N2GA 2SEBB 2IQ9H 1UA7A 2VWEE 4OZ4B 3BP6B 3OJDA 4U33A 4UNIA 5IV2B 4AE1A 4KK5C 4MMYB 3VWKB 2CALA 4JG0H 2NNFA 3LEVH 2OS7A 1SN5A 3KAAA 3Q6GL 4NI3A 1IC1A 2QVIA 3GK8H 1L0PA 4G80B 4ICXA 5FK9B 1F3DH 2B0SL 5E00B 3T08A 5IHLB 3F00A 5BZXA 1OCZB 5I6NA 3AU1A 4PMFA 1TETH 1UADC 2JIXD 5E6UB 1F41A 1DN0A 2EE2A 2ZUQB 4Z23A 4JO2H 4D0CB 3H2QA 4F2FA 3CFUA 1OM3H 1SEBB 1VEPA 1RH8A 2A9ML 4TV3A 5LAXA 1H3PH 2Z7UA 5I1KH 3K2KA 3O3BA 1CF8H 3NVQA 1C5DB 3ZDXB 3V6OE 4N6RB 1T0NA 2IDQA 1MCRA 4K3GA 5K9QI 5AAPA 3UZQB 5GXBB 3SOBH 2WUCL 4QTIL 1J1XL 1NBQA 1EAPB 3PWNB 3R1GL 4P9HL 1Q38A 2DYRB 1F3DJ 4MQSB 2NY1C 3LPWA 3FNKA 3O9WD 3O6KH 1QBLL 5IVXE 3STZA 4OGAC 4WHTB 4WUUE 4YL9A 4B9KC 3L3JA 4AUJA 2H3KA 1KIUB 2VDMB 4I5BA 3LRHA 1BECA 3OR6B 3R8BB 5K9OA 4IBWA 1O7DC 2J57A 2WIMA 1HSAA 4N87A 1IMHC 3TLRA 1NGXB 4QR7A 4XN8A 2EUVA 2WZ0A 3KEDA 3QWNA 1Z6JT 4K3EH 4IDLA 5A2KH 1UGNA 3KG5A 1UJ3B 2JKRM 3CFMA 3WJLC 4G8FA 4KGLA 5ANHA 3E2HB 1A1MB 1KTDA 2PCFA 5B1KA 2ZJSH 4WU5B 3GBNH 1DFXA 1QQDA 4M4RB 4MGXA 1AIFA 3ZYZA 4PJCB 3FTYA 5F0JB 4GKZB 1RZ8B 4PI2A 3TT3H 5D1XC 3IYLW 3L4XA 1BFSA 3TZVD 2XWTA 3P40A 4MSWA 1QSFD 3ISRA 4G43A 2P5WE 1PFOA 3WMPA 2YSSB 4NKQB 1H9DA 2PLTA 2OZNA 3NMEA 3WSQL 2ESVB 2QLYA 4CN1A 4GOSA 3HS0C 1Z0NA 3IGFA 1FNSH 2XWCA 1IRAY 2FWUA 4Y9FA 3QAZB 4N0FA 1RZJL 3P3RA 2BIQA 4E41A 4OCRH 4LLUA 1SLWA 1QMUA 2E7LA 1E0OB 2NY3D 1YEJL 1WWWX 1ADQA 1Q1JL 3JUYA 3OF6D 4KKLD 1QHOA 2ZKWA 1YY9D 3PP4L 3B37A 1IC5L 4NC2B 2ADJA 4FNUA 5F97E 3VH8B 4KK9C 4LSUH 2Y23A 2PXYB 5C0RH 3EFOA 2DBJA 3ULVL 3D69B 4PSPA 4MMXB 5DVOA 3FQXB 5HHQA 3QFJB 3SE9L 3VWKC 3ZLQC 4IOSA 2VAAA 5D2NA 4RMVA 1OTSD 2EIZA 3GBLA 3KW7A 2VDRH 2Z9TA 4ACPA 4DIXA 3NP3A 1NAMB 4HEMA 3U6XS 5T8IA 2MCPL 3RL1A 3UBGA 2ZCKL 1LO0H 3F7QA 2ZUQC 1EEQA 3S37L 1ESOA 4R7NB 3OAUL 4N2MA 3ILPA 2N0MA 5E2JA 5J1TC 1J88A 1KBVA 3HZYB 2CGZA 1MCPL 1ZK9A 1M05B 4A2MA 4MA8H 4Y5YA 1MCEA 2NXZB 3BXNA 4URTB 2E8YA 5I1GL 3L3DB 4LRIA 1LO5A 1CMOA 4JCMA 3EYOB 5LUMA 12E8H 4JFUA 2WY3B 3E3QC 2FO8A 2UX6A 3MLRH 2VLME 4TLTA 5HJ3B 3RQ3A 3DIVA 1DQTA 3PIQA 4DGVH 3RPKA 1F00I 5IW1B 3BE1L 1FG2A 1R3LB 4PJGB 1W6WA 2O6DA 1JWMB 3ATFA 3RTQB 1JVKA 4J8QA 1U8OA 4K9JA 4XMPH 5HHOD 1V7MH 3O2DA 4L8DB 1TJHL 1XCQA 3CZKA 3GJFH 4PJHF 3VXUE 4R7LA 2BIMA 5IWLA 2F54D 5DF0A 2NLJB 4YSDA 2VLKA 4G8EB 2QBWA 3HN5A 3P3UA 4BKTC 4OVUA 1UJ3C 5F96H 4D9QD 3WNNA 4F37K 4Z7OB 3E2HC 3PDGA 3ZDYB 3K8LA 1M7IB 4GUOA 4X8GA 4LCCB 1XZ0B 1I3RB 1EV2E 4JRXE 2XVKA 4KRLB 1QFUL 1D5BA 5I24A 1M2OA 4M7JL 4P5MA 4KJWD 4BGDA 3KL5A 2GPZA 4FNLH 3UBXG 2OMTB 2EADA 4PJXF 4KFZC 3SODB 3II1A 3PREA 4UUJB 4HUCA 2E86A 3QIBD 1RZQA 3BT0A 3CH8A 2QMJA 2W07A 4LOEA 3OMIB 5HHNB 3SY0A 4WKXA 3NDZE 2X88A 2QELA 5AQ0A 5IVZB 2DWEA 2XFXB 4YO0B 4CVUA 3QAZC 1EFQA 4IU3A 1CICB 2ZNXA 1MJJA 1J0KA 1UA6L 1IJ9A 3O4LE 2AJUL 4NFDA 5FF6B 1WWAX 3VO0A 3QYMA 1LE9A 3BAWA 1FORH 3ELAT 3RX8A 3UYOD 5CINL 4U1KB 1JCKA 4TTDC 2VXUL 4HWBA 1PY4A 5GS0D 1OHQA 2Y7OA 4X7FC 1T21B 2CUAA 1SHWA 2MWCA 4IDJH 5GGSA 2D9CA 4PJ9D 2PXYC 2F58H 3P54A 4Y4KB 2RGSA 1RJYB 1YPZF 3OGOE 4MXWL 3GZQA 4GMSL 3UTTB 4BHUI 3ABKB 1L9RA 4YXKL 2XTLA 3JSSA 1NFKA 3PJLA 4Q6IA 4XE5B 3ARPA 3ZE0E 3O2WH 2C4XA 1BIIB 3FTGA 5I1LA 1ZSHA 2CWRA 1KV7A 3STLA 1JHTA 1GS8A 2HZHA 2N4IA 3EO1B 4BHUA 1KYOJ 2FTAA 2CO6B 2YPLB 5DUBB 2IH8A 3KCPA 3PU7A 2AEIT 4OCYH 4F33A 4GKSA 2AXHA 4MWFA 3AQXA 4MNQE 2ITCA 1UM5L 1YQ2A 4HT1L 5JOFB 1HZKA 1KGYE 3NCEB 2W9EH 3KD4A 5LHDA 2CDEB 4M93B 2QADB 3H1ZA 1S9WA 1TMQA 5MERA 5F2FA 4A7SA 3CFTA 3DX7A 2BP5M 3ABGA 5TE6L 3BZ5A 4X9YA 4TN9A 3EFFA 2BFVH 5ELIA 3BFQG 3K2MC 5E4IA 3RFZA 1T03L 3B2MA 1MHEB 4XZ4A 1KJ2B 4OGZA 1W72A 3H9HB 5ISZB 1IBGL 1H8NA 1F0LA 2NNCA 2HMIC 2IXQA 3RTQC 1AR2A 2R4RL 4Y9EA 3QZNA 3AU1B 3AGVA 4YDMA 1YNTA 3DI3B 3DJ9A 4BZYA 1FFNA 4WTZA 4O2CA 1CD9B 3L3GB 1IGML 3GSNL 2J5LB 5CR1A 2HPOA 1PY9A 3CH1A 2EE9A 4GRWH 2H0PA 1J9TA 1NCDL 4LCCC 5E70A 3BAIA 4Z8FH 5DVLA 1U6AL 3QDJD 4P06A 1KJ3L 2DWDA 4IOFD 2J6EL 1AY1H 3ZT7A 4DKEH 5JNYA 2PPDA 1T0NB 1E6OL 3QIWA 2B15A 4AL8C 1DJGA 1ETA1 5T1DL 1NWPA 3C8HA 1ONQB 4LQ1A 2HTLD 5F6IB 5AKVA 3LS5L 1CDYA 4C56A 4G6FB 3BVDB 3WNLA 3HBZA 4KDWA 4L4TE 1H0DA 2FWSA 1TJIH 3A6OA 2PYFA 3HZKA 3TA3D 2DQDL 2FJGA 4Z7WF 2P4AB 1T89C 1CICC 1OAUL 4FXKC 2ZCHH 4WTWA 1C1EH 4OZHA 6CGTA 4P2RD 3NIDB 4GP8B 1B0WA 5KSUB 4M1DH 1JK8A 1UACL 4PJ7F 3S98A 1R4XA 3QXUA 4IKIA 1HHJA 4QHMA 4RQQA 1ZAGA 2DJUA 2PCFB 2HN7A 4CDGC 1NCAL 1ROWA 3IJYA 4Y4KC 2L04A 4UQIM 4N0RA 4NBZB 2GTZB 1JPTL 4GW1A 2I85A 3IMTA 5J9PA 2YPKB 3W56A 5TK2A 3UG5A 4GEJA 5DUJA 4F7CA 3WKML 4JQIH 1YYCA 4YS4A 4LLWB 4QXWA 4IRJA 4K71B 3MLUL 3AREA 3SJVA 4ABUA 1UUNA 4URKA 3B9KA 1AQDA 1ZPUA 1BZ9B 5L9DL 4MJID 4ALAL 1H6TA 3HTLX 3MLYH 4HXAH 5IB2A 2H1PH 1OAZL 1OT1A 2Q0ZX 3AAZA 4O9HH 4FTDA 4QRRA 3RGVD 1A47A 4LLUB 1J10A 4GO8A 2EUXA 3KYNA 1Q94B 4UIKH 1FH5L 5IR1A 1BCIA 1I1CA 2XQ0A 2OL3L 1HQ4B 2EDRA 3LAFA 2QADC 1EO5A 8FABA 5BOJA 3V9EA 1V3LA 2O72A 2IGFH 2UWEA 3TC9A 3UG3A 4DW2L 4IBVA 3QHFH 2Q7AA 3W39A 4UIMA 1D9KD 3V4PB 2FBRA 4HKBA 4AQ8A 4X4MA 5CSZB 1OOWA 2VAAB 2VMFA 3QC6X 5JHLH 4MMZA 2Y5TB 1JWSA 5E03A 4RGMB 3M7FB 4MNGA 4NZUL 4JKPH 3ZUCA 5F1SA 2VMDA 3E80A 4PBWD 3KVPA 4N3UA 5F21B 4TLKA 2J5LC 2ZPKL 3B6SA 1JN6A 3KM2A 4L1BA 3T09A 2H2PD 3M07A 1JDAA 4HBQA 4Y5YB 3VXQA 2DMBA 2DWTA 5JW5A 4X99A 3ILQC 3MRDA 4J4PA 4WI0A 5BS0B 1TZGH 2E8ZA 3BN9D 1WFJA 1KCVH 1BM7A 5F6IC 4D9LL 5FO9A 5E6ZA 1KCUL 2X70A 5F0PB 1EZLA 2HWZL 3F8UB 4NC0B 1EXUA 1R3HB 2ZWZA 2A0LD 2V8LA 2HG5A 4W9DC 2DJ4A 1LXMA 4FG6C 5I6OA 3ZRCC 1KBGH 4J27A 3RVUD 3VNZA 5DMJB 5HDBF 4N0UA 3IDNA 3ZU8A 3M46A 5G4MA 3UAJA 5JIIA 3HBQA 4OFDA 2X53A 3DVNA 3QGVA 3UBFA 4HWEH 2O5XL 3CG8A 4Q52A 2GJ6B 2ROYA 3NIFB 4I4WB 1PLCA 5CEYA 3BZ4A 3UGUA 1DQKA 5LG1A 1HNFA 4WUUD 4L0YA 3ULUL 2FEEL 4M7ZB 2WSKA 1DYZA 3VFTB 1ORQA 2OXGA 4PUBH 4XXCA 1IILE 3LB6D 1A6ZB 2ZAGA 3PS6A 3SBWC 3X13A 4GG6E 2YAHA 2BC4B 1RLBA 1IL1A 4JRYE 1YMME 5EU4B 4M5YL 1X4ZA 3QZOA 3QK0A 1ZLUH 4Z7VF 2G75B 3OBAA 1HL5A 4UTCA 2JE8A 2HSIA 1AYRA 2YQ2A 5KAQF 1IGCL 2ZKHH 4K71C 3DTXB 5A40E 3BGFC 5MHSE 1QUPA 4N2OA 4OLUL 3NEOA 4HH9A 2A6KA 5EFIA 1RJLB 3SY0B 4JZOA 5EBGA 3CDYA 2P9RA 4LSSL 4IU3B 2CQVA 3BPLB 3NRPA 3MCYA 4NQUA 1MDAA 4QOKA 3QEGL 3HNVH 5HI5C 4NQSA 4HK0B 4A6YL 1LE9B 2P5WD 3A3YB 3FW6A 2BSSA 2JJWA 4KQ3L 1DQDL 2H9GB 3FKUS 4JM2B 4FERA 5IQ9A 4IGBB 3LH9A 4H2AA 2OCCB 4KI5C 4OZFA 2E9JA 3X17A 2XWDA 1FFQA 5GGSB 2ZCLH 3WELA 2C9QA 5L2KE 1WCQA 3PWPB 4HS6B 3V0HA 1S9VA 3BKJH 5IBLC 1UOLA 3A6BH 4BGLA 3EJZC 1KELL 4ZNEE 3EJPA 4CJ0A 2GC7C 3B56A 1AZBA 4GLRI 3MYJA 5IMKB 3L5WA 4CU6A 5D2NC 4OKDA 4NCC2 1AKJB 1XB6A 4Q6IB 4N5UA 1OANA 3KYKH 4RGMC 4E5XA 2AITA 3STLB 1QFPA 1RZ7H 4WFED 1LK3H 3E8VA 3EOBB 5GGRY 1E4WH 4F33B 1OE3A 1AGDB 3EBHA 3NACL 3CMOL 4IBSA 4UT9H 4JFEB 4YE4L 4Y5YC 1Z9MA 2OLDA 3SGJC 1WBXA 3L6FA 2EC9T 3FQUB 2Z91B 4NPJA 1T22B 5BRZA 4Q58C 1ZT1A 4LRIC 4U7KA 1MLCB 5AD0A 2I07B 1ZANH 2DBLL 1CGWA 3S3SA 3HRPA 1D5XB 4JKKA 5CD3A 3TBSA 3K4DA 5CEZH 5H37H 3PRZA 3P0VH 4FJYA 3T0AA 3EFFB 3LZFL 2P45B 3JWDC 3PQYB 3RFZB 4EZMA 1EZVY 1SY6H 4FABH 1N4XL 4ODVL 1OM9A 4Q2ZB 1B88A 2Y24A 5DZVA 3KPRA 3QHTC 4K8RL 2QPEB 2VLMD 1FFNB 3S88H 3CDFA 2R1XA 4WW2B 5BO0D 1A1NA 2Q86B 2BK8A 2Q87A 5B7FA 3SQRA 2R0KL 5DHDA 2ORBH 3UX9B 3KWXA 1K8DA 4AVKA 1KCWA 3VXPB 2ITDA 1ZLSL 1S9YA 4OZGF 3KLHC 1HSBA 1G7JA 3EH2A 5ENWB 1AFVL 2KT6A 2Q2LA 3TPUB 2NY4B 3T6QC 3DVIA 5KJ4A 3VXSA 4TMPA 4LLMA 2F18A 3ETSA 5JNYB 1AZCA 3MA9L 3VXUD 1SXCA 2P46B 5JW3L 2LE9A 2H3XC 4NQXA 1L9QA 1KEML 2GQHA 1BVLA 3SCMB 1H15A 2LAAA 3F7KA 1U36A 4XCEA 2FE0A 4LPVA 3OJVC 4XP1L 3KPNA 2AEQL 4JRXD 4JX0A 1UA3A 2PYFB 2YWZA 3IDMB 4RFOL 2WYTA 5EZIH 3PGCB 2ADGA 3BPLC 1WZ1L 1OAYL 4RVBA 2IAMB 4N1HB 4OZHB 4LF3A 5ESAA 5CMAB 1AANA 4BEIA 5D5ME 1X5IA 4MKTA 2J4WL 3T65A 4BELD 1JK8B 1QZ1A 4HPYH 4JM2C 2CO7A 2PW1B 4RQQB 1FJ1A 1G7QA 1V3KA 3PJSA 3A0OA 3AABA 4QO1B 3LPFA 3SB3A 4DN4H 3P4NA 4LQFH 4FYSA 5LBSL 3HFFA 2FATH 4PJXA 3G7TA 3O4LD 3KR3L 4WDIA 3HPJA 4IK7A 2QQKL 3DIFA 4NO0A 5JIHA 5DC9B 4YHZL 4KKQA 5I18H 1KB5A 2HFGH 3NJJA 3BN3B 3MV9E 1KYFA 4Q6IC 1RPQA 1CDJA 2J5WA 3KJ6H 5IFHH 3BHBA 3EW3B 4OIFA 3A67L 3EO0B 4U6YA 4EAEA 1YNLL 3VFNA 2X40A 3TBTA 4HUWA 5DSCA 3H3KA 3V4VL 4KV5F 3QT2A 4X5WB 3AAZB 4QRRB 4N0YH 5A2BA 1WWBX 4L8CA 1RU9L 2JH2A 2ZYRA 4Z7NF 2X42A 5ILTH 3AS0A 4XOEA 1NMCB 5GHWL 3V0DA 3KYNB 2I24N 1TQVA 5TGBB 4GG8B 4QRUB 2GYSA 3B5GA 4FS0A 2CCLA 3NQIA 3TT1H 3ME0A 2VDQL 4F7TB 4UDUB 2OMUB 3QDMA 2FZ3A 3QI9D 2B1HH 4JFYA 5CSBA 5FFGA 1D5RA 1JWUA 5C0IA 4CN4A 3G08A 2CUMA 3W39B 3ZIMA 3IVKA 2DKMA 1DVQA 4NKDA 3RFZC 4MNQD 3MNMA 4ZW5A 4FQXD 1TCMA 4Z3EA 3UMTA 2V6HA 1NLBH 1BVNT 1HAUA 2W80C 2X4RA 4L3EA 3T2NL 2DLFL 1S3KL 1QHPA 4KHTH 4WEBL 5GGRA 4MNGB 4DF9A 1JL8A 2IWEA 4NM8L 4NQEA 1N5AA 4G3YH 3FU6A 4IBYA 3MUHL 2IBGA 2QHRL 2VISA 4WW2C 4NWUL 4ZDHB 2NY5H 1JN6B 1VACB 4G6MH 5FLVA 1E5YA 1JZEA 3E6FA 3RAJH 3FRPA 5I8KL 2I32A 2H0EA 1BQKA 2PWFA 3NZHL 2XLLA 5C0EA 2NY4C 3P9MA 1XQ4A 3VUAA 1I53A 3MRDB 2JJUA 3PDDA 3IJSB 4HUMB 4TL5A 4WI0B 1R5IB 3HHSA 4N5ED 2BPBA 4HULB 1CJYA 3F7PC 1BVZA 1KT2B 3FFOA 4P3CH 4B9FA 1UZ8B 1SDYA 3WKPA 4RAHA 5FO9B 3V0WL 2X38A 1I1AD 4X8XA 3SCMC 4AW4A 4R4BA 4H25B 4DAGH 5I6PA 1MCSA 4N9GA 3DDGA 4NSKA 3DSFH 4X5RA 2NPLX 3LN4B 4RAVA 1Z1WA 1CD0A 1J12A 2XVLA 4IS6B 4PBDA 3AUWB 2R56H 2IAMC 4Y4HA 1RIHH 1N70A 1ZHKB 1X5GA 2B77A 5FWRA 1ZV9A 4AVJA 3HFML 5JHDA 5IMMA 3LOWA 3WLBA 2GBAA 1BYOA 4IRZL 2AABH 3EYQD 4L4TD 2OR7A 3VI3F 2N56A 1LDPL 5EUOF 1IFHL 3TNMA 2ZG2A 4DP5X 5BXFB 5HHPA 1EO8L 1MDTA 25C8H 1K8IB 5K39A 3VW3H 2UY7A 15C8H 2CKBB 1PZCA 1X7QA 5EHFA 4ANVA 4PJDF 4LIQH 2X2YA 4IOIA 3LPOA 3U7YH 2A9NH 2APWA 4FQ2L 4KROD 1IB5A 4GS7C 2L7QA 2NY0B 5TF1H 4OZIA 3TU6A 4Q97A 4ZXBA 4LASL 1NDGA 3H9SB 4I48A 1UD8A 4Z7WA 4TNVF 3L9RA 4LVOB 1SFHA 3KPMB 3AREC 3MRGB 4LOUD 4QXUL 4A04A 1ROCA 4NO3A 4BFFA 4FZEH 4E9QA 5DQJB 1SQMA 2WVUA 4XP9H 1N3NA 4NNXB 3T3PE 3FH7A 3MXVH 3VX0A 3PL6B 1BMZA 4NNPH 4FLHA 3U2SA 3FPYA 1NMCC 3L81A 1V10A 5IOKA 2GSGA 5E2UL 5E5RB 4TULL 4BSWA 2WP3O 1TJXA 4U2ZA 2R0ZH 1N7ML 4NQCA 5ERWA 1DVYA 5EO0B 3QIUB 1ZS8A 2H6PA 1UURA 3ULSA 5FHBH 5A2JH 4APXA 1U2CA 3EZ8A 3ESMA 4PRBB 1EQWA 4ELMB 1ECYA 2EECA 1E8ZA 3CN4A 1Z9PA 3KBHE 4XODA 3UTOA 3KZ8A 1K4DA 4OUUA 1MFCH 2PP7A 4GPVA 3EYSL 2CJSA 1QACA 3H56A 5D7LB 4P5SA 1ZGLM 4K94C 2F9BT 4E5XB 3NBNA 3SQBA 1QSEA 3J07A 1Z32X 3BDXA 4ZYKB 1MCKA 5FYKH 2VLJB 2YUXA 3DHJA 4OQTH 5I0DA 1I4FA 4KZDH 3HMXA 1NMBL 5BZDA 2X6BA 4HF5H 4KJQD 3T2OA 1W15A 1PD6A 4GFTB 1P7KA 3APMA 2V5MA 3VI4F 4OKVA 5BRZB 1D2PA 3ERXA 4KZEL 4J4PC 5AD0B 3QUMA 1L3WA 2MEJB 3LHPH 4YSQA 1NM9A 4L9LA 1JNHA 3S2AA 2F19H 3CBRA 1M57B 2MCG1 3SQOL 2PP8A 4NJAH 1O6VA 1OAKH 1HWGB 4HUUA 3DXAA 3LV3B 1W16A 4XNMA 5DJCA 1OB1A 4PB0H 5DRZA 2WCPA 3LSOB 1EGJA 2ZCZA 3NP4A 3JTTA 3GT6A 5EB9A 2ZUWA 3OKYA 5EA0L 1K4CA 2VN3A 1RZKC 2DDQL 2NXYD 2G2RA 3EUUA 3H42L 2RTTA 4LHQB 3UAJC 2ZIDA 3H54A 5D72L 3VCLA 4K55A 1WGVA 3VA6A 2J25A 1C5BL 5HGDA 1CWVA 1ZA6A 4JDZB 3U4EB 3TXAA 2CPCA 1TR7A 1S9YB 1RVFL 3LRSA 1HSBB 3FUKA 2DOCA 1VFUA 5IJKA 3VXSB 3BJLA 3I6GA 4GJTB 4Z77A 1L4IA 1EEUA 2C4FT 2XZCL 1CR9L 4PJ5A 4JGNA 5LXGH 2HTKD 3QRGL 3FQNA 3QO0A 4Q6YA 3TYGH 3TVMA 4DGWC 4LDEB 1R46A 4KTDH 5MEPA 1U41A 4XCEB 1UD6A 4CW1B 1RURL 1SEQH 4PIBA 3SYOA 4XI5D 1DQMH 1N6UA 2YZ1A 4W6WB 6PAZA 2CDGB 5IGXL 2R0LL 3PL6C 4JRYD 1YMMD 4PAZA 4I1NB 3Q3GB