3GQFA

Structural and biophysical properties of the pathogenic sod1 variant h46r/h48q
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFRVQEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural and biophysical properties of the pathogenic SOD1 variant H46R/H48Q.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 36
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3gqfA00
4MCNA 1BZOA 3ECUA 4FF9A 3GTTA 1E9PA 2Z7UA 3HFFA 1SDYA 5KBLA 1EJ8A 1Z9PA 3H2QA 1UXMA 2WKOF 1F18A 4A7GA 2C9SA 3ECWA 3PU7A 1SXCA 1KMGA 1Z9NA 1Q0EA 1YSOA 2Z7YA 1FUNA 2GBVA 1IBBA 1BA9A 3CQPA 3KH4A 2NNXA 2WWNA 2LU5A 2AQSA 2WYTA 1OZTG 2VR7A 2ZKYA 3GZQA 2K4WA 3KBFA 2AQPA 1U3NA 3KM2A 4A7VA 1DO5A 1B4TA 2SODB 1SXZA 1ESOA 2V0AA 2AEOA 1XSOA 1SOSA 2JLPA 4A7TA 1S4IA 1XTMA 1E9QB 3CE1A 3GTVA 4B3EA 3CQQA 3MKGA 2AQQA 1RK7A 1JK9B 1F1GA 1PU0A 3F7LA 1HL5A 2XJLA 2C9UA 1PZSA 4BD4A 1SXAA 4A7UA 1SXBA 1IBHA 2AQNA 3SODB 3T5WA 4N3TA 1YAIA 2APSA 2VR6A 2Z7WA 2AQRA 4A7GF 1QUPA 2ZKWA 3LTVA 1OAJA 2WWOA 5CU9A 1CBJA 2R27A 2AQTA 2E47A 1HL4A 1SDAB 1E9PB 3QQDB 1OZUA 3H2PA 3GZOA 1SXNA 3ECVA 4BCYA 3K91A 1E9OA 1OEZW 2ZKXA 1L3NA 4L05A 4OJAA 5KBMA 3KBEA 3L9EA 1B4LA 3F7KA 1TO4A 1N19A 1SRDA 1F1AA 1SPDA 1XTLA 3HOGA 3KH3A 2WKOA 3GZPA 4A7QA 5KBKA 1IBFA 2E46A 4N3UA 4A7SA 1UXLA 1AZVA 1YAZA 3S0PA 3QQDA 3RE0A 1CB4A 1P1VA 2C9VA 1COBA 3KM1A 1N18A 3GQFA 1TO5A 1IB5A 1PTZA 2GBTA 2ZOWA 4U4IA 1E9QA 1E9OB 2Q2LA 4BCZA 2VR8A 1IBDA 1EQWA 1JK9A 2GBUA 2Z7ZA 2AF2A 4MCMA 2WZ6A 2XJKA 1JCVA 1SXSA 2WZ5A 3L9YA 2JCWA 1DSWA 4OH2A 1F1DA 3MNDA 1OALA 2WZ0A 3HW7A 1MFMA 2WYZA
chains in the Genus database with same CATH superfamily
1AZZC 1W15A 3ARFA 3WKQA 3B83A 3CCHA 3LS5H 1Q72L 2VLLA 4QRRA 1MW1A 5LBSA 4MB4A 2ZICA 3ZRSA 2BWIA 5J89A 5GGRY 3W9EA 1YEIL 2HJLA 3ELAT 4M61A 1YEKL 3WFDL 5AL0A 3BVWA 4K7FA 3H7LA 1T6VN 3DXAA 4NERA 1N0LA 4D8OA 3BUTA 1UM6L 4PR5B 2DYPD 3DSNB 3O6FD 3GZQA 3S37X 3H9ZA 2BDNL 3MCLH 2WB7A 2YD7A 3H0TB 1ZLSH 2IPUG 1SVBA 3DTXB 4LLQB 1NBVL 3UBHA 2V0AA 5T3XL 4HUUA 2PTTA 5AOZA 2EDBA 4IQHA 2VITA 3BVUA 5C9JB 3LIZH 1W0VA 3UTSE 3V4PH 3KGUA 5F9OL 1CGXA 3BESR 2L7QA 2RD0A 2WSKA 5SWZD 5A2CA 5BO1H 5JORA 4P07A 4HH9A 1MY7A 1OCWH 2YLKA 1BOGB 1CJYA 3D87B 3SDXB 1PZ5A 2WXKA 1YAIA 2APSA 4YHIA 4PRAB 2PTUA 3G6JE 5T1KB 4BSWA 4EEEA 3U6XS 5HSFA 3V10A 3VNZA 2W07A 1VADA 4KRMB 3QUMH 5KSAB 3JTSB 4F8QA 1MHPH 4K9JA 3TN0C 1CLYL 1NEUA 4UT9A 2E6PA 3LH2L 2HVKA 1KN4L 3FT3B 4JY4B 1MWAL 1KBKA 2YPVA 1JF1B 1NCUA 2MOVA 4Y4FD 2DQGL 3WO4C 3EOTH 5D7KE 1QFWM 4KRPC 5SWQB 2VXQA 1F1AA 3TJHC 4CMHC 2YGOA 3QG7H 2ALAA 3MZTA 3ZTEA 4HCRL 5F7MC 4Y4KB 1CE1L 4M5YL 4XMVA 4PP1D 2BHFA 1U8OB 3JWNC 4IYKA 4NQDA 3AXHA 2UWEA 5FA4A 2X4TA 3V4VH 2XXCB 3JZYA 1UJ3A 1AYOA 3L1FA 4TSBH 2XI9A 2ZOWA 2N01B 3WSQH 1XDTT 3BIKB 3K6NA 1QWNA 3QQ3A 2O5XL 2BNQD 2DW5A 2QLYA 4LCIL 1W0WB 5BO0D 3H54A 2IBGA 1NCIA 1F3JA 3AY4C 3C12A 4LBEA 3MLSL 3QJUB 3TU6A 1XEDA 2J43A 3ZKND 3WELA 4HU8A 4XNMA 3CIAA 2QPUA 2NY5H 2JQMA 1EH9A 4XAKE 4X6BA 4KJWD 1YPZA 2X2YA 3NA9L 5I1HH 4DGVH 1LWHA 1XXFC 5H2BB 3ZDXE 4OJFH 5FO9B 5LHDA 3WKML 2CUHA 4PWFA 4BGDA 3QWRD 1EWHA 1YEHH 3FT0A 5DMGD 1U3HD 1ZK5A 4H8VA 2V17L 3IF1A 4LSTL 3SKOA 2VJ0A 1PKQA 3SN6N 3F62A 4DF9A 3QHZL 4UQ2A 1O7SA 1JDAA 2EECA 2HLEB 1GAFL 3CDGA 5E9DE 4JUSA 3SDDD 2X6VA 4HIJB 1WFJA 2YD1A 3ZR6A 5AAPA 5CJXC 5DD1H 2AMGA 3HKFA 1YYLL 1JXFA 4FTVB 4PJEE 2HAZA 4R7VA 4X0KB 3RTLA 3W39A 3CN2A 3MLRH 2UXFA 2FQDA 1FJ1B 4M48H 2VRAA 4YHOH 3ZE2F 4GUCA 4TLSA 1XF5A 2NXYB 1KLUA 4KKQA 3HRZC 5I18H 5IB1B 2ATAA 1HEJC 5EU7C 1DQJA 1MAMH 2XN9E 3CSFA 1CPUA 4S1RH 4QLRA 3UEZA 4Y9EA 1E8XA 2WO4A 1HZKA 5E6RB 3UG4A 4I87A 1KN2L 5DMJB 3D30A 3T5WA 3W1ZA 2ODHA 2WGXA 2GBAA 1KOAA 1B0GA 1RJYA 3QZBA 3MBWA 2XTLA 1FFNA 1NZRA 1EPFA 3DKHA 5D7SL 2FZ3A 3S98A 3ZIMA 1QP1A 1QFWL 4ENED 5E1AB 5IIEB 3K4AA 2YMOA 4AT6B 5ALCL 2JQZA 3EOYG 1A5FH 4QRUA 1MFCL 5FYKL 2VQTA 5FYKD 5DRZB 1UD3A 4WNSA 5FUZH 3ZHNA 3K2UH 2WVSA 2X4UA 1AAJA 2CRMA 4NQED 3APFA 4OZFG 3UBXG 3MDJA 2DH2A 4ZDHA 1A22B 3BQUB 4Q6IC 2XETA 4KI5C 4JPWH 5K1NA 3MRKA 1FFOB 4MB5A 4PUBL 1L9TA 3IEAA 4I0KA 5BJTA 3MYZA 4NIYE 3MLZL 5LXVA 1AGCA 4JREB 4QHMB 3A23A 3BVNA 3NT0A 4L4TA 5D72L 1CD8A 2AK1H 3LZFL 4BZ1A 1E90A 4G9DB 3VSUA 2H8PB 4KBPA 4V1DB 1DEEB 2K78A 3NCBB 3QR2A 2OI9B 4XXCA 2LU3A 2HRGA 1TZHA 1G9NL 1BIHA 1KCLA 2AXGB 4JRXE 4NOBA 5AVSB 5JQ6L 1E27A 5JR1H 3BJ91 1DVQA 1GSKA 5IQ9A 4P2QE 3II3A 1TCMA 2AVGA 2V3EA 3NVQA 2IIJA 1UASA 1RUAH 2NY3C 4FQXB 3BVVA 3QEUA 5TPWL 3FB8A 2FATH 2EEXA 2VW7A 2F5BL 3MV7D 2MTPA 5L4FA 5C92A 1NKOA 3BKCL 1NTDA 2XTJE 3EJZD 5D1QA 2Q8BH 5J11B 4J3UA 4GSXA 1HDMA 2X41A 3KPSE 5G5DB 1FAIH 1V54B 1QOKA 5IQMA 4QJ4B 1Z7JA 4YH6A 3C6EA 1YA5A 5KW9L 3EJCA 2G9HB 1FVEA 1YJDH 2O6FA 2F54A 2HJFB 3IS1X 3KCPB 3LNGA 5IHLB 3GSXA 3TN0A 4WI5A 2F1BA 2SODB 3UZQB 4B60A 1RUPH 1R3KB 4B97A 5FM4A 2VUYA 5J9PB 3MUY1 2VDOL 3HI6H 2D4DA 1XCXA 2XIBA 3CE1A 2VABA 1CR9L 2JF1A 3U36A 5I16A 4K9EH 5EC1A 4AM0Q 1T7YA 3RJDA 4FFZA 2HFFB 1DVXA 2OTUA 3GK8L 3DRTB 1RH8A 3LSOA 3H9HB 3FTXA 2MSPA 4ZUWA 2NTSP 2VISB 3QDME 3MA7A 4ZMOA 2UUDK 1E67A 1KIPA 2CUIA 3HZKA 4RSYA 4G6FB 3ZTJH 4PS3A 4D7BA 5MI0B 3ZDYE 2IOMA 1T3FA 2A9DA 2WINB 3GO1H 2R8SH 3BD5A 3MNVB 1RHHB 4BCYA 3UZVA 2G2RB 5CJOH 3D25B 3ZXAC 4OZIA 3GXPA 3IJSA 4HS3B 3ARDA 4O4YH 3IDMB 2ENJA 3ULVE 1Q1JL 4GRMB 4WJ5B 5HD8D 3GHBH 4KZ0A 1ROCA 2IG2H 3KH3A 2EXTA 5GS1C 5ISZD 1PAZA 2FECI 5L4MA 2G5BA 3T6QC 1J86A 1LO2L 4QRFA 3HPJB 5T5FH 3BKYH 3MSPA 4B6ZA 2FL5B 3DWTA 4W93A 5C07A 4JFQB 5CLZA 3RWFB 4QHKI 3E1F1 3HS0B 4R7DB 3VFOB 3QJFA 1L0QA 2P24A 3DX3A 4QRSA 32C2A 4AM0A 4AGOA 4Q14A 3II2A 4FNUA 4JKWA 2XZCH 3TVMB 3D39D 3GMLB 4Y2DB 2QGBA 4JM2B 4HD5A 2DI7A 3KNBB 4N87A 2DIJA 2P5PA 2VKXA 5LQBL 3K8KA 1AO7D 3Q43A 1QI4A 4GXVL 5IVXF 4JN2B 3RL1A 4B27A 2HKHH 3T0EC 1JGVH 1IBGL 2BOCB 4MAUL 4NRXA 3EGSB 1YNTA 3HE6B 4WDIB 1A1OA 4GI9A 1UB6A 5D2LE 4EQ3A 4YQXL 1WP6A 2YARA 4HFUH 4LK4A 3FUDA 4OCLC 5CS7A 3C6LC 2EYTB 2B59A 3HRZA 2BVOB 5E6IB 1CDIA 5JPNA 3O11A 1BQHG 1EFXD 1UWEH 2G4GA 1G7MB 2BY3A 5I1KH 1MDTA 3QQ9C 1EUTA 1QYGH 4BFIB 1I1RA 2H7WA 1UM4L 4NDMA 2Z3FA 5TFSL 3N9GH 2VDPL 1HAUA 2FNWA 5I26A 4I3SH 4KZCA 4LOVA 3VWJA 4UT9H 3TWCL 2UXGA 2NQCA 3JWOC 3FFCB 2NY2D 3HG1D 4HWBL 4I1PA 4QXTA 1U8IB 3Q2NA 3M1BB 4GSRA 5EU6E 4DCQB 4YPJA 3EW3B 4R26L 1FFRA 2E7CA 2VZUA 4PW9A 3EUDA 3KR3H 4G8EA 5I1EL 1RAMA 5MERB 3QR1A 1JE6A 4LPCA 5H94B 3KPLB 3NFPB 5KSBB 3T3PE 3BJLA 3SBRA 3RZCD 2XG4A 2FJHA 3WFHA 4IMKC 2Y6TE 4Q6IA 1NJ9B 1MLCA 3EYUL 4WUUB 4F2MB 4FDWA 4MZ2A 3OPUA 5DDHA 5KYWA 3OKNA 2GCYB 4Z5RB 5IBLD 2WTRA 2EACA 2VMEA 5IB4B 1F90H 1Q8MA 5E2VL 3EFOB 4XMZA 1IU1A 2N1KA 4XP4L 1TMQA 4N8CL 5ALBH 3RNQB 3CSYB 4P23D 4ZD3H 2WN3A 3FO1A 1RJZB 4QGTA 4KK6D 4PV1C 3WU1A 4FQ1L 5HGAB 2WLIA 2PPAA 5D1ZB 1JGUL 2WD0A 3DUSA 3QS3A 3G3LA 1ACCA 3RI5F 4GRWE 4LQFL 3IXTB 1Y1DA 3K2MC 3OB0K 4ZO8A 2J55A 3CFBA 5I66B 1YYML 2K6ZA 4BHUI 1SMAA 4JVPA 4PGDB 4GRLB 3ZKQD 4O9HH 4CVZB 4PS4L 4ODVH 2OTPA 2XPZA 3PAYA 2WWMD 4JY6A 5ESQB 4S1QH 4PJCE 3C2AH 5I0VA 3SPJA 3T0BA 3RHWF 4B9KC 2OQJA 3KS0H 4LPTA 1E5CA 3IRZA 3B3BA 1W9XA 5GRUL 4NNPH 4TUJA 2CO4A 1JTOA 2F74A 4UTCA 3FUIA 2WZ5A 1HU8A 3BP4A 4IK7A 5FW7A 4AYEC 1DBJH 2ATKB 4NWUL 3DJ9A 3O8XB 3LRMA 4AE0A 2F53D 2R39A 5ELIA 1XH2A 3ZL4H 4IW4C 3CFMA 3JSSA 2IALB 4WEBL 1LILA 3LPOA 3G9AB 1FFTB 3IJYB 4JVUA 5C86A 1BEYL 3BAJA 1LQBC 2BHZA 1U95B 2XXMB 3U0PB 4FI6A 5D7HA 4M9OA 1CXIA 1TZAA 3PGFL 4N9OB 4AEIL 4GKNB 3P77B 5EZJA 1H9VA 1RY7B 1MCKA 1Y0LA 4ALAC 2X7LA 2A83B 4UYPA 2NY4C 1KCVH 4ZX4A 3RVUC 5KSUB 4BEIA 1XGRA 3IDJB 3QUXD 4BSJA 4AQEB 4NHCL 1L0PA 2IQAA 4YX2L 1VACA 3VE0B 1A7OH 2VXSH 1SN5A 3BGFC 2XZAL 3UGEA 4HJUA 3FQWA 1F3DJ 3FU5A 5F7KC 2DM3A 3OKDB 4ZZFA 4WEEA 1AKJA 3KHQA 1HHKB 4DQOL 1V3LA 1B4JH 4GBXA 2IAMC 4FQHA 5GS1A 5T33L 2B14A 4YSUA 3I02A 4QHKJ 1MJ7L 1N68A 1BD2A 1E43A 1MJ8L 2FBJL 2R29L 3NSFA 3FUFA 3Q6GL 4XN5A 1BV8A 1NC4D 4HS8H 4JZOB 3W57A 2BP0A 1NFDB 4FD0A 2R9HD 3GBEA 3WL9A 4LSSH 1TKWA 4FQLH 2YA1A 4OZFA 1WBXB 3ML9A 3TZVA 2F5AH 4G80B 4UT7L 1JPTL 3DX7A 1V5JA 1BXAA 2KZWA 4ZS7H 4JFDA 3NN8B 2NDFA 3GSVA 3HC4L 1GHFH 3QJHA 2BLFA 4R6UA 3QHFL 4JQIA 1KTCA 5KN5B 4GQPH 3T08A 4WIQA 1ZY9A 3MRJB 3GB7B 2FSEA 3T0EA 3L9EA 3EO1A 3LZQA 4QHPA 5IMKA 3M1CA 4BE6A 1VPOL 4J6RL 1SVZA 4PRHB 3BEWA 2W0FA 4R8WH 1F3RB 2FYVA 5AFAA 5I71B 3TF7C 4XAWH 5AVYB 3QUYD 3STLB 1J1OH 5C08B 5LGJB 5EZPA 4LSPL 1GZPA 2CKBA 3V6FA 2Z0UA 2Z91A 2ZXGA 4RGMC 1QRKA 4XCCL 3D0AA 1JZ3A 1RL1A 3F7VB 4HKZB 3DURB 1QACA 2UZYB 1KXQE 3REWA 2CCLA 4LVHC 2Z7ZA 4RWYH 2XIDA 1UWXK 4HIHB 2PLTA 4NZRL 4A68A 3QW9A 4F8TA 2DQTL 4L4VD 1VFAA 4MBRA 1MIMH 2Q76B 2OW7A 3BN3B 3WHXB 5EF1A 3RTQC 4U1MA 5SV3A 1TEYA 4OZGA 4E9QA 2G2NA 4W9LC 1TTCA 1OGAA 4XMPH 3II1A 3PPEA 2WXRA 2LE9A 1PZAA 2B1HH 4QYOB 2P8MB 2FB4H 2XQYG 5CKAA 1QPPA 4X4YA 4H25B 1QA9B 3EGDB 2VZVA 1T22B 2YRPA 1XQ4A 5FHAH 4OF5A 3BRDA 1ZS8B 3ETBJ 1QBMH 3TXAA 3HG5A 3AFLA 3AQYA 3WEMA 2XUWA 3PP4H 2UWEF 1S5IL 3V0AC 4HKJA 2YXWA 3D18A 5KVFH 1FDLH 3KL5A 4NKDB 1UADC 1KTBA 2YSSB 2WZPA 5DWUL 3ULUL 1CCZA 4AEHL 2IH1A 4EI0A 4O2EA 5C1MB 4YPGB 1XH1A 3TT1H 1RLWA 4PJFA 5L6YL 3MCYA 4M62H 4B0MM 5CGMA 4AQAB 2W0LA 4OUUA 3RGVC 2R15A 3JTTB 4JKMA 4R97B 4UI2A 5IQ7L 2BJMH 4NO5A 5AW8B 5DJAB 5IMOB 4QO1A 4WI4A 1JRHI 1DFBL 4LPYA 4QHUB 4ONGL 1YPZF 1X9QA 1HL5A 5DJ6A 2EKSB 1EXGA 1U8QA 1H6UA 2Y7LA 4X6DB 1K4CB 1VEOA 3IBOA 3CFKB 3APCA 1U8MA 4G9FD 3ZL1A 1RLBA 3ZGHA 2R0WL 2EINB 5BS0B 2VLRD 5LCVA 4MJHA 3QXAB 1UA6H 1FZKB 3WEXA 3EIFA 4HPYH 2NLJB 1INEH 2XFXA 3IETA 4O02B 4F8LA 4O2CA 3QFJA 1MHHA 4BYHA 4KHTH 1CFTB 1IQWH 1FFPA 2VH5L 2WQ8A 1HOEA 3LRSB 2WIIA 3FL7A 4KOBA 2WMPA 1PMYA 2P5EB 4JZJC 3C2SA 1AGFB 2FD6H 3O6FC 4MZIA 1F58L 1KGYE 5GZOC 1J8SA 2KYIA 3BUDA 1WISA 1KWGA 2ORBL 1K8IB 1VA9A 2MWCA 4WO4C 2UY7A 2VDLL 3DX2A 3WNNA 3GFUA 1A7RH 4Q7DA 1ND0A 3O2VH 4J3TA 1E9QA 4AMWA 2FX9H 1FHGA 5ICYA 3T4AC 4LRNH 5FDWA 3HZYA 4LOEA 5SV4A 1B2WH 3IE9A 4LEBA 5EU3A 2AANA 3TV3H 4D7PA 4AI7A 2UX6A 4N2HA 2HWZL 2BNQE 4KMTH 5EU4B 4UV4H 4CA4A 1UGNA 3FF7A 3SOTA 3THMH 3VXRA 1KDIA 2AV7B 4IBQA 4N2AA 3T2NL 1QSED 4Z7UA 4BE5A 4PG9B 1UYWL 2GJ6B 2WWKO 1RZ7H 4DVRH 4TLTA 3AAZA 4X5WB 4I5BB 2AI0H 2IAMA 3MFGB 3CZUB 3DUUA 4GW1B 3Q5OA 1IARB 2WVTA 4YHNA 1SJMA 4FFWC 1BMZA 3O45A 3S8FB 3ZTNH 4HDIA 4OZ4A 4P04A 5F0PB 3PV6B 3L4ZA 1QO3B 4NQQA 4XBEL 5C2BH 4ZSOE 3MJ9A 1QSZA 3L7FB 5EBMA 4JPSA 1HOCA 3G5VB 4U1GB 5C0CB 2PO6B 5HHOA 5I76A 1GZQB 1GGCH 1M3JA 3QEHB 5DSCB 5ITFA 3HC3H 1MREH 2E27L 3ZT5A 3OJVC 5K9JL 5E23A 5I1CH 4WCYL 4F3FA 1M42A 5C0AE 1PLAA 4KRLB 4MA1C 4EZMA 5I6PA 3LEXB 3OMAB 6PCYA 1HSBA 5HDLA 4C4BA 3OHXC 5JMOC 4HV8A 3PDGA 4ZPVB 4ODSL 2W60A 2VJ8A 3U46B 1CF8H 1EAPB 2R2CA 2VB5A 3ZKNC 1SNRA 2WHVA 2VR6A 1I1AC 2VDRB 1LO0H 1BAFL 5BV7C 4APQC 1GS8A 4U6YA 3BUIA 2J44A 4YDLC 1OK0A 5DJXA 5T5NF 5TE6L 3U6RA 2PR4L 2BERA 4XVSH 2IGLA 4PLOB 2EIBA 3D69B 3SDCB 1E8WA 2HUEA 3SZ6A 1BLNA 3C87A 5DMGC 4BH7A 3X3GL 2HJKA 5FYKE 5CBEB 3GI8H 2A2QT 2JWYA 4H88L 3SDDC 3PNRB 4NQEE 3RTQA 5DO2C 5CD3B 4OCMC 1UM5H 3VXQA 1RZFL 4QWWD 2EIJB 2QSVA 4XP1H 4EBQL 2IPTL 3QNXA 4HWZA 4P9HL 1JN6A 2DEXX 3R4DA 1QLRB 3RBGA 1Q94B 2HT3C 3MXVL 3QWOB 5E8NB 4ZUUB 4L23A 1DJSA 1SEQL 4NO3B 4PGJA 2W1NA 3BP6A 4NENB 2EZ0D 5EH1A 2IWKA 1A6ZB 1DQVA 3FTUA 4R2GB 2R4SL 4JDEA 4A39A 3X13B 3VXMD 3KL3A 1DCEA 1UB5B 1BXVA 3V0IA 4GFTB 2ZE0A 3HMXH 1HH9B 2XKUA 2ZJSH 3UPRA 4UDTB 4GG6A 3M7FB 4NRYA 3UAJD 5CJBA 3FSWA 4FQQA 2FO4A 2DF3A 3RGVA 4OZIF 3GIVA 1JZ4A 4W4OC 3UH8A 2D2OA 1F11B 3C8HA 4H2CA 1IC7L 4NBYB 4BQ6A 1MRFL 2IOOA 2YUZA 2HA1A 5B1JC 5LXGL 2FGZA 1NCCL 2P8PB 2CBMA 1INQB 4FNSA 5KVDL 1SOKA 4NQUA 4LESA 4AUJA 3ESMA 3GBMH 5D8JL 2YRZA 4O58L 1GGIH 5F0MB 2YRBA 1C8PA 4LKCA 4QHLA 3FYEB 4JDZA 4XOBA 3MNWB 1U93B 2FJFA 4G5ZL 1K4DA 1X5XA 2WLLB 4JN1L 4YIQB 3J27A 5I2IA 5J6GB 3L3GA 4A7VA 5JW4N 2YGVA 1Z32X 4M8QA 2ADYA 4L8SB 4FXKB 1KB5H 1AR1D 3EXLA 1JPEA 4H13C 1UA7A 4IMLB 4K3JL 4F24A 5DI8B 5I6KA 3RL2A 4C55A 2VC2L 1T6WA 3SE8L 3VYOA 1YNTF 4BK8A 2DMCA 5E70A 4PFEA 2WM0A 1USQA 1KZQA 1UUNA 4NEHB 1X7TA 4JZJA 2VM9A 1PG7L 1FIGH 5BZDB 3E80A 5LDUA 5IV2A 1YVLA 2G3ZA 1MLBA 3MAWA 5GZOA 3L3OC 5TQ2L 4F9PA 1P5UB 4LCWD 4P2OD 1K9TA 2B1OA 4WO4A 5JOPD 4WV1B 3H7BA 3JWOH 4U1NB 5C0GB 1R34A 5EA0L 1ORSB 5B4MD 4EUPG 1INDL 3F5WA 1EBAA 1EK3A 2A38A 2WNKA 3T4AA 3VG9B 2XKSA 3SKJL 1E3XA 5D7LB 5KVGL 2DWDB 3ZHKA 1KCWA 4R0LC 3MOBH 5KAQG 3MJ8B 4FQPA 2CK0H 2JJVA 3FONA 5IVZA 4NQCA 1G6VK 4RRPG 3R8BB 1KXHA 1A3RH 2QZQA 2C9AA 4QNPF 4WHTA 3MLXH 1T2JA 4G70B 3TEWA 4D0BB 4F8PA 3I85A 4YGVB 3VXSD 2DICA 2W94A 3I6GB 4OLUL 5AB9A 3EBAA 4KI5F 5EDXA 4DERA 4G6MH 1IGIH 2AZAA 1YNKH 1C7TA 5F7EL 2QADB 1TO5A 3CXFA 4ES8A 7TAAA 3MRIB 2Z8RA 4NZUH 3IVKB 3KPNB 1NGQL 3KPOA 1AHMA 4HLZG 2ZTBA 3APNA 3MR9A 3L4TA 3HR5A 1A7PL 4P59L 1V3JA 3D39E 4ZAKC 5F7WC 2QVKA 1MWOA 5B3NA 5IOKA 5KJRH 3KYOB 4UTAA 5E8PA 2YD9A 1OHZA 3PQYA 1AO7E 2CKNA 4IEFA 4MQTB 4PB9H 5CIPH 4HEPG 4RIRB 3ZMEA 4ZYKA 4APXA 1DJHA 1XCTA 3G9VA 3JV6B 1IVLA 2NY7H 2OJZH 2VLKB 3Q9QA 4MA8L 4N1EA 3OHXA 2NUTB 2HFGH 1IFHL 4YWGL 3B2PA 4PJ7A 4B96A 1CQKA 3RB5A 1EDQA 4JFFA 4TUKL 3IU4L 1Q0EA 1YSOA 2YEZB 5FGBC 1N7ML 3WKPA 1WZ1H 4EMZA 1OAKL 1I1AA 3M17A 2DTML 2W9EL 3UXFA 4APQA 2Q3AA 2FEDD 4ZT1A 4N8VB 4HYTB 3L7EA 4UB0L 4X2UA 3ZLQC 4IBUA 3CVHB 2QSCH 5DEFB 3EO0A 2V4LA 4PJAE 2Q6WA 1HYRC 3IGAA 3KLKA 4HK0B 3NFSL 4S0SD 2DD8H 5EB9A 4K71B 4GLRI 2J8UE 1CLVA 1QVOB 1SHXA 4LCUA 1NBZA 1EGJL 3IGFA 2B4CH 5JA8B 4HHAB 4C57C 3SDDA 1RK7A 4GRWH 4YMPA 5JW4M 2Q9OA 5K9OB 2VZOA 1J8KA 4JDTL 2C9UA 3N1QC 3TURA 1KG0B 3OR6A 4A66A 4GMTH 4D2NA 4N5ED 4K94L 2IFFL 1LEIB 4OLXH 1SGKA 1QWUA 4MS8D 1YC7A 4RNRA 1YY9C 1MOEA 3TNMA 1VGKB 1FYTB 3VFGL 4HKBA 3B9KB 5EFIA 4W68A 3CVCA 5DT1H 3QDJD 1A7QH 3PGDB 5DUBA 1MW3A 1MCCA 1WA2X 3Q13A 4X9FA 3B2XA 3P11H 3UACA 3GHPA 1IGML 5C09B 1FLRL 4LNRA 1ET5A 3QEGL 4JG9A 3VJ6B 1XZ0B 4KQ4L 1XEUA 2DQCH 2K3TA 1G6RL 4XC1H 5D9SA 3S0PA 4JO1H 4QY8B 1KBVA 5B1JA 5EOTB 2D3LA 4MMYB 3HS9A 3EOAA 2WOYA 4BDVB 2GBTA 3MJ9H 3QIWB 3RZCC 4NC1C 4RAUA 4G82A 1K8DA 1FZJA 1LTXA 5IKCA 3PWVA 1AQ8A 1KPVA 1AP2A 1R3IH 2BSCA 1A4JA 3MRMA 4PEEA 4MB3A 5IBLC 4DPCX 2Q7AA 1I3UA 3GSOB 1F45A 3D6GA 3ARGB 4HZAA 1WQVT 2IH3A 3CK0H 2BC4A 4RZCB 2MJWA 4UZSA 2GY5A 1D6VL 3LKOA 3QDGA 5DHYA 5F9WC 1NDMB 3B3IB 1S2EA 4G43B 4LEEA 4NN6C 2CO7B 4NNXA 3LH8A 2YPKB 4GMSL 3C9NA 3GPEA 1LLAA 4MZRA 5T1LA 2PCFA 1C1EH 3L3OA 4EZJA 5CWSA 5BRZB 1RURH 3SE9L 5IOPA 2COVD 4G7VH 5FDYA 4ZODA 3V4VB 1HKFA 2H26B 4BFEA 3MUGB 4GSQA 2G60L 4HIXH 4PHXA 5B1KA 1EXUA 1G7HB 3S36L 2E9IA 4PGBA 1QG3A 1KZYA 2X4QB 4WTQA 3WMSA 2DLFH 1CLOH 2XPGA 4E5XB 4R0LA 4AXWA 3K71B 3L4UA 4Y4KD 1TFHA 3ARBD 1HINH 3BSZA 3S4SB 1S7TA 5DD5H 5BUPA 3DETD 5MENA 1NEZG 1SFDA 4E41A 4XMTA 1JZIA 2VNCA 5DFAA 3C8KB 4OZGF 3HRPA 4Z0XA 5LG1A 4NI3A 4MJ4A 4Z7VB 2YAMA 4LSVH 3KJ6L 1KXTB 3F12B 2VAAB 4U1IA 3TPUB 4M7LH 4YUEL 2B2XL 1BFOB 2MNUA 2VXVH 3MREA 4LO9A 4DN4L 5HVFB 4K5NA 1SM3H 5JHMA 5DYOB 5C0BD 4GKSA 1I7UB 4AV0A 1PKQE 4I9WD 2UY6A 3MRRA 4WO0A 2GFBB 1ZEAL 4PM1A 2Y6SD 2WAQA 1HHIB 1G4RA 4JKPL 4ODTH 3UL4A 1M1XB 5I74B 1DYZA 1DBBL 1GW0A 4KGJA 4ZAKA 2ALWA 3TTYA 1ZOXA 3HE7B 4PJFF 3UO1H 3DROB 4TQIA 2PN5A 1Q90A 3VDAA 3F2LA 4AG4L 5DD6B 5IB2B 5CILH 1QSFB 3FU7B 2VDQB 2GTWA 2H3XC 2NW2A 2NZ9D 2BVYA 2NTFA 3D3VB 5CM1A 2OJEA 4FI8A 4XVJL 4HIIB 1GC1C 4NZTH 4FTVD 4Q9RL 4ODXB 1COBA 2X9WA 4IKKA 1EFQA 4JO5A 1QUNA 5ESAB 1IM3B 5FGBA 3DBXB 1AMYA 3MV01 4MHHG 1Q72H 1UJTA 5GGUB 3UTPE 2ZX6A 4WHDA 2NXYD 1JSYA 1YEIH 4H4NA 1XF1A 4C83B 3S9DB 4NKQB 4PJHA 4MBOA 3EOBA 4R4ND 1YEKH 2VN5A 3WFDH 2YXFA 1QWHA 4LGSB 1T4WA 4ZS6D 3BH8A 4P57A 1KF9B 4PJDE 1UM6H 3NJXA 3RWDA 4JHZA 3QULB 1KENL 2Y7MA 2IDQA 3LNHA 1Y6MR 2BDNH 1IL1A 4S10A 3CSBA 3ZJAA 3NPZB 1NBVH 1HEZA 3B1UA 5T3XH 2WW8A 4L29A 5DJ2A 1T0PB 3FTSA 3UADA 1HZHL 1L5GB 2YGPA 3NCWA 5GIRA 1A9VA 3AVEA 5F9OH 3RI5K 1FCGA 3GBNL 1X4ZA 4IRSD 4P48A 2GUOB 2WYTA 4HFWB 1BFTA 4G42B 5EU5B 2I26N 3WLBB 5C0EA 4HUCA 3QZMA 5HYJB 2YBRA 1B4TA 1VIWA 2LU7A 1CI3M 4DKEL 3D0LB 4KZEH 1YMMB 3A6BL 2VJXA 5FGCB 1ZGLM 2F7RA 3WKNA 5I8KL 4ZI8A 4PGZA 3B4NA 1CLYH 3ME0A 4ZNEE 1U8NB 2C8NA 1ET8A 4HK3J 5DZJA 2AC0A 4Z7UF 4GEIA 3BQVA 4XXWC 3LH2H 3Q3GA 1KN4H 1S3KL 1MWAH 2VLJA 4PREA 2DQGH 1HIML 4U33A 3G08B 4C56A 3ZTDC 2MHAB 1JF6A 1KNOB 4HS6B 2BW5A 2R27A 2FX8L 5F89B 2I9LB 5D1QE 4TNGA 5TDNA 5EDSA 1RUML 2VLRE 4HCRH 4K23L 2P5WA 1SMDA 4UOJA 3O3UN 2DMHA 1CE1H 1XGZA 4M5YH 4X9BA 4QDGA 1WZLA 4FQXD 3TO2A 4QRTB 3LN4A 3BP7B 4H8HA 5DURB 3VFTA 3ZBMA 4OCNC 2NY6B 5HI5D 2O5XH 4AGPA 4LCIH 1WYJA 1KLFA 3L9RA 3MCG1 3NPSC 1IBFA 5GGQL 4F37F 5SWSB 1SQMA 4UTBA 3QUHA 4YK4C 1RP8A 5HYQB 4DOHB 1YEWA 3BD4A 2D9CA 1HI6A 3BZEB 5E8DL 5EIIG 4NO0A 3ZDZB 1OSEA 2DN7A 3NA9H 3FCSB 1QTSA 1TJMA 4GIOA 3WKMH 4K3EL 4BA0A 1A7NL 3JWNE 1PZDA 3T77A 3LS4L 4HEPA 4UUJA 5IEKB 5ACLA 1XGPA 4CADA 3EZJB 4MXVF 4AQ1B 2QVIA 1NCTA 3CFQA 2V17H 1NGWB 4PJIF 4LSTH 4W9DC 3UGUA 2N0KA 3UG3A 3DDGA 3QHZH 1M4KA 1B0RB 3WJMB 4Z3IA 1GAFH 1O7DC 5CEZD 2KPWA 5BNXD 2EO7A 3QBTB 2X05A 4LASL 4TVPL 1AIFB 2AXHA 4TVPD 3K74B 3GTTA 3QG6A 2O72A 1NCGA 1Z9MA 1I85A 2DL9A 1S7XB 4YAQA 2J2ZB 3MGAA 4RGNC 1QSEE 4EPSA 5C7XL 2WSPA 1P4UA 3MRQA 5D5MA 3SY0A 4PRIB 1PD0A 1EV2E 4G6FD 4Z1PA 4Z0BL 3OKEB 2VSDA 6FABL 3A3YB 5JIKA 2BS9A 4XNYL 2OMYA 5C07E 1K5WA 3VTAA 4OGYL 4F58L 4Y19B 3LXBA 1TEFA 4DTGL 2ED9A 2ZOUA 4R9HA 2FECL 3K6FA 1H3XA 2VR7A 1ETJA 1JG9A 1TZIB 3LN5A 3ZHFA 1DUZB 1JAEA 1KN2H 3T09A 3VD5A 4MSWA 1X6LA 5ERWA 5B8CB 3QDAA 5KANG 5GRVL 4BCXA 3FQ4A 3I3DA 3I9IA 1M2VB 5D7SH 3L95B 4F92B 3P02A 3TO4D 1TSHA 2QVMA 1R9FA 3AXLB 4GG6F 4PVMA 4P3DA 2EE6A 2UX7A 4ONFL 5C3TA 3ZQWA 1ROWA 1SQ2N 1OY3B 5ALCH 5FYKH 1MFCH 1TCRB 1SZNA 2QTVA 3MX0B 5A2BA 5FYLL 5FYLD 5JIMA 3G5ZA 3ALWA 3MU3A 3HI1B 3L3HA 4ELMA 4YHLL 5LDSA 5TDOA 3PAZA 3PREA 4JM2D 1TTBA 1LQSR 1LGVA 1IT9L 2WWOA 4XZUA 1E2VA 4PUBH 1I4FA 3MLZH 3VUAA 3F64A 3HE6D 5ETUB 3ZE1F 3WEOA 5IHZA 1MSPA 4JHWL 5D72H 2YZ1A 1EO7A 1QATA 2X4OB 3LZFH 2BIHA 2R29A 5E6ID 1EZVY 3R18A 3ZQXA 4R7XA 1GTFA 1RJCA 2XHNA 4X7SL 3OWEA 3QZWA 1MRDL 1PG7W 1S7RB 3LPFA 2XV3A 4UM9B 2XICA 1G9NH 3K5SA 2Q20A 5F1OB 2EDXA 2VE6A 3GMOA 4RAHA 5JQ6H 2KI6A 3U30C 1T7VA 4XO8A 2A74A 5LB1A 3UYOD 5DHMC 3NP3A 4Z77A 1F4WL 2E4FA 4DH2A 2ERJB 2J21A 3FRPG 4UANA 5IJBC 1X5ZA 1KIUA 4X8JB 5M94B 3RVXC 4P2RD 1M05B 5TPWH 5E08H 2EXYD 2O6EA 2M1KA 1ZLWH 2F5BH 4IKJA 3V2AR 1A6TA 4FKEA 5EEYA 3BKCH 3G5YA 1K2DA 1RI8A 4GUPB 2A7BA 2VW6A 1PFOA 4IOSA 4XCNB 3TA3D 4WI0B 1ZDSA 2G3MA 4IGBA 3BE1L 4PSPA 5EOCL 2PP9A 5KW9H 1DVTA 1ZK9A 3CLFL 3EBIA 1RZJL 4ZZKA 1WS8A 3BW9A 5KYXA 3TNNB 4W9GC 5AENA 1JGDB 1E40A 2YD8A 4HMEA 5HJ3A 1PX3A 4BWTA 4XXWA 1IVTA 4R7LA 5CF3A 1T66D 1HXMA 4I48B 1E30A 2VDOH 4KVPA 2FWUA 1DDHA 4PCYA 4HWEL 4NC0B 5D1ZD 1CR9H 4FKHA 5KVDE 1IAKB 2HLAB 4G6AC 4NUQA 3UERA 2IXQA 4O5LL 1R19A 1RSYA 3GK8H 3TJEH 2JV6A 4YE4L 3KBFA 3O9WC 4QWWC 5AKVA 3LZRA 3KM2A 5LG6A 4JKKA 2WLKA 2CHXA 4M93C 1TZ8A 4PG2C 4ZUVB 4DP9X 4GRLD 3C5ZC 1NSNL 1NUDA 3CIQA 4G5AA 2JCCE 2OYPA 4ZX6A 1U58B 5KYYA 2IF7A 4IOFD 1EJOL 1IE4A 4ZXBC 1PAMA 5B1BB 5B7MA 5LNGA 1OB0A 5I9QB 3DYMA 4F8NA 4E9SA 3KPRB 2GC7C 3CDFA 4KKZA 1JXDA 3GLDA 4PRPB 2J12B 2NXZB 1WBYA 2EH8L 1Q1JH 3BKML 3DARA 3GWJA 4JJ5B 1DZ0A 1J87A 4Y2OA 1X5LA 3P9LB 4G6JL 2A4ZA 3EJTA 2MCAA 1LO2H 4LCWE 5A6MA 2W38A 2Z4QB 1LD9B 5KEZA 5EO1A 4AH2B 3UYPA 4P2CG 5A3ID 3O8XD 2VMFA 3PWNA 4ZUSA 2RQ8A 1MDAA 1EEYB 5GGSA 2H3KA 1T7XA 4YC2C 5CBAA 2JKNA 3EDDA 3WFCH 1EO8L 5JO5B 4NKOB 2NUPA 1SOXA 1XCQB 4HZ1A 3BAEL 4HMCA 4M1DL 2N56A 5AOJA 1N3NB 4CDGC 2X09A 2X4NB 3TP4A 2AP2A 4M9PA 1FL3B 3DVGA 3P9MB 1TOXA 5LQBH 2OMUB 5E6YA 4GXVH 3GJFA 2Y5TB 4XMUA 3QJQB 4MAUH 8FABA 4N90D 4K3HA 5FYJU 3G5XA 3HHMA 3BI9X 2CHWA 4YQXH 1IRAY 2HX8A 1E4XI 1BD2E 3VFWA 4LL1A 4S1SL 1N9PA 5G2NA 2J56A 1PJWA 2D0GA 3OC5A 5KS9B 4HU2A 2YK1L 4NPYA 4OFKA 3KW7A 2J1ZA 5DU7A 4FHBD 1UM4H 1A6PA 5TFSH 2P48B 4ATTA 2WSDA 2VDPH 3RX8A 3MRGA 3VI3A 5F1SA 3SE4C 5DVLA 3SDAB 3T6VA 1R5WB 3TWCH 3QEQB 5E5LA 3VM7A 2ZXWB 4HWBH 4PTTB 5B39G 4QF1B 1LE9B 2Z7UA 3T0EE 3IM1A 2ZG3A 3H6AA 4N2OA 1HHHB 2Z93B 2Z31B 3CHXA 3DPBA 4FJYA 3VQ2C 4Z7IA 4R26H 5I1EH 2ZX7A 4HG4K 1VESA 4D9LL 3DOSB 1JZEA 1OAQL 3VGAC 3F85A 1H0DB 1NIFA 3PHOB 5F1KC 5CSZB 3BPOC 3EYUH 3RG1C 4YSCA 1VKXB 3RGHA 5IM7A 5I1GL 1LP9E 2EIMB 4ZUTB 1U3NA 5D70L 1WGOA 3MFFB 2B39A 3QIBB 4KNQA 4NS0A 4WNQB 5E2VH 3FKUS 5C0IA 4YNYA 4XP4H 2W91A 4N8CH 1JWUA 1RU9L 3HAEG 5G4MA 1IEBB 1BVLA 3CG8A 5IJDC 4F7KA 3FTYA 1D5ZA 4FQ1H 5FO7B 2GY7B 2YOCA 3FQXB 1UVQB 4Q9QL 1JGUH 3LQZB 3BCDA 2H6OA 1NIBA 3OJMB 4LQFH 3PLYA 3UTSB 2Z6FA 3BPLB 2AQRA 1I8AA 2P42B 4ZMTA 2V2TA 4X9YA 2X6AA 1YYMH 1NC2B 1CBJA 5EZIL 1MCSA 4DAGL 4QRPA 3MLPA 3OLIA 1AZRA 1H5BB 2EDDA 3I75B 3GZOA 4PS4H 4BXSV 4B7LA 3G6JB 5JLZB 5AOLA 1SYSA 4PGEA 5IF0B 3QDJE 1ED3A 3L3KA 3LDBB 4MDJA 3B7UX 2OMVB 3MRPA 4TNFA 5EIIA 4N2FA 1NDGB 5DK2B 5F1IB 4Z7AA 2FT7A 2WKOA 5GRUH 2IDFA 1JD7A 2EE0A 2I69A 5EO9A 1WDAA 2E9WA 4NN5B 5TF1L 4EIUA 2DWEA 2FIKA 1FNGA 2BK8A 3W2DL 4TS6A 1AOHA 1RHFA 4F7TA 1H3TA 1WIPA 4NWUH 5E2TL 1LO4L 2Y72A 2MPAL 3MV11 3NQIA 3HLAB 5D55A 1MJJB 5DZAA 3SEPA 5I15L 4RESB 4WEBH 1JPSL 4IBZA 1V55B 2GT9A 2B9BA 1U3YA 1IM9B 4JFPB 1R3JA 2ILLA 4OCWL 1BEYH 3TBWA 1P4BL 2ZUUA 4K3DL 3EYVB 4N5EC 1A8ZA 2IJ0C 5ESVB 3O9WA 3QFJE 1FSKB 3KS0J 3IKCB 1UZ8B 5ACZB 3PGFH 1U9KA 1TLKA 2OJ1A 4XNZC 4AEIH 4PG2A 3SGKC 2OX5B 3C5ZA 4AYBA 1FGVH 4EDXB 2X5PA 3AT8A 4NAMA 2AXWA 4MJ5B 4Z7QE 5BS0D 5I0DA 4G1EB 4XBGA 5EN2A 4ATWA 2EC9T 1QZNA 1OQXA 4ZXBA 3ULUD 4NHCH 4YX2H 1J05A 3KJ4B 4O02L 3AS2A 1N67A 2XZAH 2J8OA 2R23A 1E0OB 3LXAA 1OOWA 1I3RA 4J3OC 3ZDXB 1WZKA 5FPIA 2XWXA 4KHXL 2OULB 4DQOH 2ZUYA 4PJBA 2BSTB 1DJGA 1YDPA 5DC9B 5T33H 4X6EB 3ARSA 1MJ7H 1L9NA 1MJ8H 2R29H 1WUNT 2FBJH 3QI9D 2D7QA 3Q6GH 2P5ED 3TFKD 4FERA 2E6QA 1EEZA 2OR9L 2DQIL 3U7WL 5E9DB 3UDWC 2H2SD 1TSRA 1D9KB 2F19L 3RZWA 2K6YA 2BIOA 3M6DA 5DHVB 3MJGX 3M07A 2AJVL 5T1DL 4PJEB 1JPTH 4UT7H 3UTTD 1ZCRA 3TV8A 1N10A 3HC4H 1RK0B 3ATDA 3ARZA 3CZFB 2J1WA 2ZUQB 4GKZB 4DP4X 3QHFH 2D0HA 3ARQA 3Q1EA 3U83A 3K6IA 4UQCA 2XN9B 5HYSG 2W65A 3BLBA 3W5MA 4KQ0A 4WKZA 1Z0NA 1VPOH 3WTWA 1MPAL 3BZDA 1AGBB 2P44B 2VZ3A 4J6RH 3GXIA 4ZMNA 3OKMB 3EYQC 1MHCB 1E6OL 3GS4A 3E6FB 1AQDB 4GP8B 2E6JA 2JB6A 3DPDA 3GMQB 4X7EC 5C0BE 1U41A 2JMRA 4NQSB 3NIDF 2ZCZA 4E9XA 2BSSB 5KSAC 3OKOB 3SB3A 4LSPH 5KG9B 4XCCH 1X6NA 5F0JB 2BZCA 2VQUA 2BP5M 2IANA 5HHOE 4FJZA 2FH8A 2BINA 1ZSDB 5ILTL 2JJTC 3FRPA 3O2WL 1OM3L 1DVUA 5B3SB 1AFVL 3CXHK 3QO0A 4JRYA 2DQTH 1FG2B 5DZ9A 5KVEE 2EEAA 3N40F 1S7UA 1MVUB 1FLTX 1ZJAA 1T5XB 1DVFD 3BWAB 2WWKT 3LVTA 5DFVC 3SCMB 4Y4KC 5C0CD 2HFEB 2UZXA 4ZMZA 2PO6D 2RCSL 4N0YL 4NUPA 3NQKA 3RWEA 2Q2LA 5E00B 3T6ZA 3AXIA 1IIKA 1KPRB 4J8RA 1VB9A 4XCEB 1AHWB 2KH2B 4NSKA 5BQDA 2GPZA 5FGRA 1JZGA 3LX9A 2CHZA 1NFAA 5DQ9A 1Z3RA 4YDIL 1U8CA 1S5IH 1CUOA 2K9FB 2HVJB 2ZP9A 4OM1H 4LF3B 4JRXB 4PLNC 5FLVA 5DWUH 2DWXA 4I88A 2VDRL 4AEHH 3KG5A 1P69B 3GPSA 2K8QA 3S3DB 3EJRA 5L6YH 1MQKL 4P2QB 3S48A 1SLUA 3LKQB 5I1IL 3SDCD 4RSVA 4I2XA 1ZDQA 2PF6A 1HNGA 3NAAL 5IQ7H 5B3JF 2ICWB 1ONQB 3EG9A 4M6ML 5M95B 1JTPA 1DFBH 1IJNA 4ONGH 2ROYA 3DRQB 4LVOB 4AEEA 1TTGA 2XTJB 2NZ9C 5IUCA 4I18B 4A2MA 2AMUA 2R0WH 1TVHA 2ROXA 2V2XB 3KPSB 3U82B 1P9MC 2IWEA 4L8DA 4CU6A 4GUOA 3BMWA 3CC1A 1JK8B 3DYPA 5CO1A 2KLSA 5GZNC 5C6PB 3VQ1C 1XIWD 1IIIA 3W0WA 1RV6X 5T1MA 4RLDA 5FECB 1X5HA 3CZEA 2YD4A 4MZ3A 3FCGA 4I0PB 1GOGA 1MAKA 4ODHL 5JQIB 1YEGL 2YAEA 4R4NC 2I9TB 1J5HA 4R2GD 4N0UA 2VH5H 3R7QA 4P4KD 4N3TA 1BBJA 1A2YA 2HMIC 2BRQA 2VQ1A 4WJG3 4ZS6C 3D7PA 1BPVA 3BXNA 2VR4A 5EZLA 3QQXA 4QPEA 2E47A 1F58H 1EGJA 2FJGA 2BVQA 3NUKA 4JFVA 2ORBH 1I7ZA 3KL0A 5I73C 2VDLH 1HE8A 4WY7L 1KJ2H 5KBMA 2BS71 3FQRB 4Z7NF 5DUML 5I8CA 3ZDYB 3ZT6A 2Z65C 3O0RL 1SJVA 3IB4A 1FVDA 4EVNA 3SGKA 4YVNA 1ZHNA 3ECBA 4MFHA 3LHPL 4MXQD 1QSVA 4QYAA 4WFFD 3BQUC 2HWZH 2YGNA 3VFRB 1UCBL 1DQTA 5E2WL 2CRYA 2VL5B 2GEQA 5E1IA 4ZO6A 2DV6A 4JREC 2UVFA 4GJTB 5D96B 3T2NH 3WTUA 1CFSB 4HSAC 1UYWH 2AJ3B 5BRPA 3DGCR 2V7HB 4PCTA 4EOWL 5FLUA 4NFDA 4H1LB 3E3QE 1WICA 1UWFA 3BFWA 5C9KA 5K93A 2BY0A 3NIFF 3Q1SL 3L3DB 3P9WB 2OI9C 3P4MB 1H15B 5CJQL 4PR5A 4RX4A 8PAZA 3UDWA 3FQTB 5IHBA 5JW4Q 4XBEH 3H0TA 1JZFA 4LLWB 4LLQA 3DTXA 2N7AA 2PCPB 1JDCA 5CEZE 2Z0BA 1RPKA 1YRKA 3H2QA 5MEQA 4MCZB 5C9JA 1MUJB 2E27H 4G8GA 5K9JH 5D2LB 4FMKA 4GOSA 4WCYH 5I1LA 3L3JB 4BQBA 3RIAF 4IBTA 2J6EL 5D7LD 5F7LB 3CQPA 2DDQL 5J11C 1T4KA 3CFCL 4ODSH 5T1KA 4AUYA 3BH9A 2DQEL 4PWGA 1MRCL 4NFCA 4EDWL 2ZSVB 4MNGA 4MMZA 4I9XA 2R56L 3EYSL 1ZLVK 2BP8A 2JKTM 3AC0A 4ZW5A 2DWYA 3SO3C 1ESOA 1BAFH 3Q44A 1C16B 5KSAA 4QJ3B 3NESA 1KBGL 3EH3B 1L4IA 3F7PC 4HUXA 2PR4H 3HC2A 1JP5A 5CCJA 5EU6B 4UIKL 4TQEL 4F8OA 3FT3A 4JY4A 1MW2A 2JJTA 1JF1A 3IGKA 4R84A 3WTVA 4BD4A 3JZ7A 4ZMYA 4WI3A 3X3GH 5KYUB 5JQHC 2AQNA 2BSRB 5EUOA 4H88H 4K7PY 1BX2B 4XRCB 3CXHJ 1NBQA 5DJ8B 3T3PB 3WI9A 1N2RA 4G1MB 2C7UB 4BFFA 2XKNA 4RQQB 5GHWL 1PDKB 4F7PA 4OFQA 4Y4KA 4UQBA 4PJ7E 1I8MB 5C0NC 1BSIA 2K8MA 3A6CL 4F27A 4JFFE 4R7NB 4UMSA 1RZFH 3C60B 1OGTB 4EBQH 2IPTH 1PZBA 4P9HH 3VAEA 2AV1A 1F86A 1EEUA 5MI0C 1AXTH 4HUVB 3MXVH 2OXGA 5CD5D 1G7LB 1QW9A 2DIBA 3WKYA 5I6NA 1SEQH 3FN0L 4OQTA 1ZA6A 5IFAL 1W0WA 3GSUA 3ROOA 3U0WL 2G5UA 4ISVA 5FW6A 3NJVA 2R4SH 4YSOA 2XA3A 1G9EA 4NAJA 1I7TA 5HHQA 1U8LA 4LFHG 1Q9LB 4GRWB 2JSFA 3FCTA 2XWBB 5HHME 1WCBA 4S0HA 4JCWA 3OF6A 3N0PB 1H3WM 1MCNA 5FO9A 2GW5A 1PF3A 4YSPA 3CVHL 3HS0C 4N0RA 4LLAA 2AAAA 1SN2A 1IC7H 1QFPA 1JK9A 1MRFH 1X5YA 5LXGH 1KLGB 1ZXKA 4ZMPA 1NCCH 4WWOA 4P2RE 5DFWH 2VO8A 4PJCB 4Y2DC 3TVMC 1DN0B 5KVDH 4JM2C 1TDQA 5DUPL 4HIJA 2XWJA 4E9LA 1ML0A 3GNML 5D8JH 4J12A 2V5YA 4O58H 1PFCA 1P9MA 3WNPA 2J8HA 4RFNB 2ZKMX 4UM8A 3EADA 5GZNA 1XF3B 1MH5A 3INUL 7CGTA 4G5ZH 4HJ0D 1OK8A 2PWFA 2HG5A 1YO4A 4JN1H 1NWPA 1PLGL 1OOAA 1EHNA 5C8JB 1FYTD 3ILPB 5C0RL 1LXMA 2YBGA 4RMRA 2ZYSA 3HG3A 5IB1A 4NN7B 4NKIL 1MCWM 2XWCA 5JOFB 2X4SA 4K3JH 4G11A 3D2UB 4KITB 2X1XR 2VC2H 2GBVA 2DM2A 3APMA 3SE8H 3KH4A 1NGXB 3ZHDA 3V4LA 1PG7H 2AGJL 1CF1A 3ULSB 5C09D 3V0DA 4JLRB 3CDZA 5TQ2H 1CDBA 1BPLB 5K59F 3VD1A 3GXDA 4EE2A 2IVFC 3WTXA 4F37K 5JHBA 3HZMB 1FNEB 1DQKA 3QUKB 4JCMA 5JA9A 2ZUVA 4L3CA 4Y0GA 5EA0H 3VI3F 1INDH 1TMCB 5DRWB 5DRZA 3S7GA 2F68X 3WE6B 5HYSA 4N6RA 1TVBB 2EE9A 4TULL 3KGRA 5J3HD 3KBPA 4HH8A 4PLKC 5KVGH 2IGTA 3QIWD 3GGWA 3KLQA 3S8WA 1PPIA 1QLFB 2WLNA 3BQUA 3I50L 1AI1L 3A24A 1ZRUA 4BH8A 4K5PA 1QUPA 4YHYB 1LK3H 1ZHLA 1F5WA 1UD6A 2ZQKA 1A64A 4QHMA 2JIXB 2W9LA 1RZJC 1E9PB 3KAAA 3ARGD 4RAVB 4O2FB 4QJ5B 4OLUH 4FP8L 4MMXB 4JFXB 4V1DA 2AEQL 2CRZA 1DEEA 1IBZA 4B9GA 5F7EH 3US9A 4YSRA 2GSGB 4G71B 1JPGB 1NGQH 1D5MA 2HKFL 3WTTA 5BRZD 1LM8V 1SJHB 2BX5A 1A7PH 4P49A 4P59H 2RB8A 2DQ6A 4H8WL 1TF4A 5ICXB 2OXHA 1CFBA 4OLYL 4KTDL 2HN7B 5IW1A 1TPXB 2QPDB 2VUKA 4GRLC 5CZKA 3IJ7A 3FCUB 3TBVB 4GG8B 2NNAA 3CVIL 1WWWX 2CA3A 3DNKA 1EX0A 3MRLB 3UCQA 3WS3B 4PMFA 4FRWA 4MA8H 1G7JB 3PG2A 4YWGH 2ZOTA 4XPHL 3WEAA 3BZFB 1JNHB 1FV1B 5E24E 4TUKH 4I13B 1BG1A 1N7MH 2FO8A 3IAQA 2G9HA 1OAKH 1G5GA 2Z35A 2HJFA 2DTMH 4WI6A 4Q4IA 4YDKL 1RZQA 1XD0A 2W9EH 1YEFL 3KW8A 3QQDB 3QRGL 4H26A 4OAWA 3UZQA 2YWYA 5A3IC 3O8XC 4UB0H 1MAJA 1JGIA 2WKOF 5J9PA 1R0AL 2KMWA 1AXSA 5JW3L 1Z5HA 2E0PA 3NFSH 3FUEA 4HW6A 1EGJH 1KYDA 2HFFA 1TR7A 3DRTA 1NCBL 1N5YL 3N1MC 3H9HA 2PYEE 4JDTH 1W8EA 4I4WA 1PBYA 4HBCL 1L9QA 1PYWB 2YIHA 3K6SB 1WFIA 2VISA 4K94H 5F3FA 4U6XA 5H37G 3QUZA 3BZ4B 3CBKB 3O6ML 4MNQD 5CINL 5MEPB 2VDQL 5K39B 2D0FA 4FQIL 3OWRA 5F7FA 5JXED 2NW3B 3R8QA 2WINA 3VFGH 4PJHE 3AT0A 3ATBA 4JG1L 4HPOL 4HWNA 4XN4A 3TIEB 3MNVA 1RHHA 2BH0A 3GTVA 4P46A 2G2RA 3D25A 3HI5L 4JEGB 2E86A 3FK3A 3IE4A 1ZGLA 1HHGA 2DBLL 4JVWA 4HS3A 1PZSA 1WHPA 2OP4L 1IM3D 2NY0D 3IDMA 3MGOB 4UMGA 4WJ5A 3L8QA 3HJEA 5DQJB 2GK2A 1IGMH 3JV4B 1AG6A 2XX0A 4K73A 4J3OH 4YGAB 2FLMA 1FLRH 1JOIA 3VD0A 5MEOA 3B34A 3QEGH 3RA7L 4KQ4H 1OARL 3D12B 1QPKA 4JFQA 2HT4D 3HS0A 4R7DA 1G6RH 3E1ZA 3QCVL 3G6AB 1NH6A 4PJBF 3L5WB 3KVQA 1CQYA 4KNSA 2CUMA 4TL5A 4PD4K 2FWOA 3K2IA 2R1YA 3GMLA 4XH2B 3FQUB 4Y2DA 5DWPA 3T1FB 3TVMA 5FA3B 1GMEA 1RZIB 4ZOCA 1GPOL 2FQGA 2IBZY 4JN2A 4OGAC 4NJ9L 2JK5B 1M7IB 5DK0B 2DI8A 2Z92B 4TSAL 5AALA 5J12B 2BOCA 5HGDB 2WY3B 1ACZA 1KJVB 3EGSA 4TL4A 3BD3A 2F0CA 4WDIA 1M9SA 3DHPA 2HXAA 4RMBA 2WB1A 3C08L 4M5SA 2Q86B 3ATAA 3MRBB 3VXOA 4DEUA 2Q8AL 2OK0L 2EYTA 2XFGB 4HJSA 3OKKB 5CP7A 1ZHKB 4NP9A 5H4YA 3LKRB 3MUJA 1F13A 3L81A 4FMFA 4Y4FB 5I71C 3FT2A 1D6VH 1JD9A 2VN3A 4QTHA 1BQ5A 1G7MA 1OF0A 2VLJE 3UP6A 4C56E 1UCTA 5HPMB 4M1CD 2DMKA 4GMSH 2ITDB 1W16A 3LZLA 4D0CB 4CGTA 1N5AB 1WF5A 1W8OA 2GSIB 2E3VA 2P5WE 1UENA 4L37B 2C9PA 4UT6L 3FFCA 1HH6B 2VIRB 3DO4A 3SE9H 3SQBA 4BFOA 2ZZUT 5HI3D 1U8IA 3WN6A 1GXEA 4F9LC 3DI2B 1BHGA 1CFNA 5BVPL 4TQPA 4N2GA 3PL6B 3HUJE 1CG9B 2G60H 2BNQB 4DGYL 3RNKB 3DHUA 3S36H 4UOZA 2X89D 1WITA 3LXCA 5H94A 3KPLA 2BNRA 3AQZA 5KSBA 3CU7A 5DC4B 3ULUE 1C12B 2FYYA 3DV6A 1NJ9A 1WPCA 2Z7YA 4WUUA 2DLHA 4FGMA 5CGBA 4F2MA 4JJHA 3D33A 3DIFB 2GHWB 5KTEL 2VAJA 5IMLB 5K1JA 4Z5RA 2GCYA 4PBWD 1TQUA 3KJ6H 1S7WA 1X7QB 2UYLB 3R4RA 3EFOA 3GSRB 4KKCD 1T20B 4YUEH 2B2XH 2XVLA 4DN4H 1U3HB 5SWSD 4IOIA 1AQKL 1RJZA 1F56A 4ZSOB 4OLVL 5DHXB 5HGAA 2QFRA 2X3BA 3CHRA 4B3EA 2ZXEB 1ZEAH 2LGNA 3JYBA 3FC8A 3RVTD 3FTWA 4R97C 4JKPH 3V55A 3N41B 4BHUA 5DHEA 3IXTA 3UTTE 1DBBH 4XMWA 3D4CA 1B3IA 5C0AB 2DPKA 3OVUB 1EDHA 3H9SA 4IIQA 1I8UA 4AG4H 5D5ME 5A6IA 3TM6A 3ZHLA 4GRLA 4WQOA 4CVZA 2OMXB 1S9KC 3EBHA 3DO3A 1PX8A 5EEXA 2NOYA 2QQLL 2ISDA 2WNWA 5ESQA 1QTPA 4XVJH 2ZWYA 2Y2TA 1F00I 4Q9RH 1H8SA 5DEJA 3DV4B 3RY5A 3TLRA 4FN0A 5E5MA 3HZVB 2K6WA 1E5UI 4U49A 3X12A 4YDVA 1V3MA 2A6IB 3IMTA 4DFHA 2Y69B 3LRLA 4Z7OF 4JFOA 3L16A 3VRIB 4DUWA 1B90A 1JNJA 4LNVA 5JW5A 3TCTA 1AGEB 1X5KA 5TE7L 4CKVX 5JHDA 4M1GL 2DY2A 1IGCL 1SYVA 4JFZL 1Z5LA 1P1VA 4S2SB 2X0WA 1CGVA 4KMQA 1WAAF 4ELME 1P84J 2DLEA 3IJYA 4KTGA 3VDCA 4DPBX 1GTNA 2F15A 5E99L 2W95A 4F57L 3ET9F 4RA0C 1G9MC 1U95A 3IDGA 4JO8A 1ZPUA 4PRNB 5BZWA 3GD1C 3U0PA 4M3HA 3LQAC 3TFBA 4TV3A 2X12A 5TF0A 4GKNA 3P77A 4K5OA 3WCYA 1DQQB 1HZHH 2HX7A 1XSKA 3FB7B 1SDDA 2E4TA 1QHOA 1JBJA 3VG0L 3GBNH 1NLBL 4A2EA 1SEBA 3IDJA 1ILUA 4MCNA 3WLWD 1U6AL 1WFNA 2EXWD 5EBWA 3X1EA 4U1LB 3WIAA 2OLDA 5IJCC 2C3WA 1N59A 5KYNA 3OKDA 4DKEH 3IGLA 1XT5A 1EUUA 1FZOA 4JGMA 3A6BH 4M7ZB 2Y1ZA 4DEWA 5BMFL 5I8KH 4NO2A 3OJDB 1JWMB 1NUGA 4N2EA 2DEYX 4ES9A 3W38A 4QRQA 1J48A 2HTLC 4XNQB 1GGYA 1S3KH 2FE0A 4J3OF 2R83A 5DVKA 1HIMH 3RWJB 1EMTL 4UM9D 4OQ1A 1QX1A 4Q9CA 3D08A 2EDOA 3NJJA 4G80A 4UNTA 4YO0A 3RIKA 4U1GC 2FX8H 4KQ3L 2PO6C 4LSQL 4U2YA 4YR6B 1P5VA 5HYFA 2YQBA 1RUMH 4MKMA 4XI5D 1A1MA 4K23H 3VDBA 3O2DL 4U0RB 4QGYA 5CCGE 4L1HA 1KTRL 4PD4J 3CC5A 5KN5A 1CI5A 3HVDA 4P5TB 1GCFA 3MRJA 1NWOA 3GB7A 3CU1A 3QJSB 1F90L 2X9YA 4PRHA 4JFUA 3IKKA 3LV3B 1P6FA 1S5HB 5LAXB 3LKPB 1T7ZA 3NSJA 5GGQH 4JANB 3STLA 5C08A 5J7CC 5LGJA 4WHYG 5GSVB 2X6CA 5AYQA 2VL4A 1EJFA 1RZKL 5E8DH 3SDXF 1UKSA 1W91A 3F7VA 1OEZW 3DURA 1QRNA 2UZYA 3KYNA 4K3EH 4HIHA 4RMUA 1A7NH 4AVJA 1XAKA 1QD0A 3KLAB 3LS4H 4F33B 4F9LA 2DB8A 2JKIS 4S1QL 1HILB 1HL9A 2XG5A 4F7CB 4RMTA 4K15A 4MD4A 1W72A 3DJRA 2VW4A 1NGZB 4QYOA 5I5IA 5INDB 4LASH 4TVPH 4OLWL 5EUOF 2EDQA 4DZBA 4OV5B 4X8XA 3EGDA 4UWQB 1ZS8A 1A1NB 2YWZA 3FJTA 1K5NB 1GL4B 4IRJB 4QTIL 5C7XH 1J18A 3EH1A 4U3SA 5TQ0L 4CILA 4Z0BH 6FABH 2EDLA 4R2GC 4BKLB 4E0RA 2YQGA 1UOVA 4OGYH 3ZL4L 4F58H 1G7IB 4DTGH 5JZ7C 1A3QA 3BHBB 5F8RC 2WZ0A 2EEBA 1R5IB 4PRPD 3UG5A 1ORQA 1EZVX 3EDEA 3QT2A 4CSPA 4DP7X 1VENA 2NXZD 2FQFA 3D39B 1U8HB 4FAAB 5F6IB 1AO7B 3IDNB 2D31B 3QJZA 5IMOA 3NGBC 4DP8X 4DO4A 4NFBA 3EBGA 4LB8A 1NMAL 4HSQA 5CZVL 3HPLB 3HBGA 2EKSA 4ONFH 1V7NL 5E8EB 4X6DA 2WWNA 2CDFB 1HC1A 1Q9KA 4NLAA 5FYLH 1OZTG 1WEJL 1WD9A 5BS0A 3DX0A 2ZXAA 4YHLH 3MNZB 1EFXB 1DSYA 3IXAB 4LLYB 2WVVB 2JJSC 1FC1A 2F7PA 2JXMA 5B38B 4DK3A 1IT9H 2NLJA 4FA7B 4O02A 4XNUL 5JYMA 3SHSA 1E4XL 3MXWL 5F0LB 1SOSA 4A7TA 1CFTA 2A0LC 2P26A 3NIGE 4FXKC 4HQQL 3M1OA 1OE3A 2WXNA 4JHWH 3AREB 5A7BA 1AQHA 2NY2B 3QNZB 1ZT1B 5IB3B 1N0XL 4PJAB 2H6UA 1H3UA 3LRSA 4X6FB 2J8UB 1O0VA 1AGFA 5DTFB 4X7SH 2J5WA 3V0EA 5E8OB 1MRDH 2VT0A 1P5UC 1JNNL 1BGXL 4Z18A 1Y6NR 3OHMB 1K8IA 1D5IL 2QSQA 2QKIC 3M46A 3SDAD 4WV1C 1LDSA 1IQDA 3QEQD 1EHLL 2OZNA 1H3GA 4L5FL 1F4WH 3DJTA 2E9BA 3N1GC 3QJTB 3VG9C 3MBED 3UZEC 5H35A 2NR6C 2Z31D 4PP2B 4FEIA 4N85A 1JWSB 2BHUA 4JG5A 1FFQA 4K7FB 5GGVL 5A2FA 1D2OA 2FRGP 3CZGA 4QI3A 5EU4A 3AUWB 3C09B 2ZCLL 4P23B 3SO5A 3DHJA 2VZ1A 3RDTD 4A2HA 3RPIB 3BE1H 3TASA 3IMUA 3TA4D 4Y16B 1MI5D 2GJ6A 3F04A 5EOCH 5GS0L 4UINL 2JNZA 3CLFH 3GI9L 4X5WA 5DZLA 1J9RA 2AFNA 2H2PC 2Y3NA 1RZJH 3QIBD 1W0VB 4WFHD 4WI8A 5CZRA 1NIDA 4X0NA 2C3VB 2QADC 5JW4R 1CE6B 4Y1SA 4FCAA 5JORB 5IBUG 1M7XA 2ZUWA 4QRPE 3D85A 5F1NB 3MOAL 3PV6A 3KYKL 1PZ5B 2B0SL 1QO3A 4YHIB 4HWEH 2OZ4A 4W9HC 3TTSA 1CLZL 1UZGA 3L7FA 5DRXB 3JT0A 1I9JL 4AIEA 3A67L 4JZNB 4O5LH 1GZQA 5FUCE 1NCAL 1VADB 3EJYD 3RUGE 5DSCA 3IFPA 3QXTA 4QRAA 4YE4H 2OYKA 3BX7C 3DUHA 3PY9A 3B5HA 4OFIA 3T2OA 4PQXA 3QO1B 3NJFA 3WUWB 1CK0L 2GVYA 4LIQL 1NSNH 4HXBL 1FYTE 1CBVL 2DOCA 3VD7A 4UU9A 1ETB1 4Y9BA 2ZIDA 4L4JA 3U46A 1J0HA 1EJOH 3TYFB 3VMNA 1TTAA 1EAPA 4DKFL 5AB1A 2H41A 3CHPA 1KGCD 1Y6KR 1M1SA 5C97A 2EC8A 5AB0A 1ACYL 2A9NH 4PIRF 1DO5A 3CSPA 2EH8H 3BKMH 2D3VA 3PXLA 5FA4B 1P6AB 1AKPA 3RKPA 3D69A 2X4TB 4G6JH 2R2HA 5BXFB 4P5MB 5D7KD 1U2HA 1DJIA 2A6DB 1OAZL 4K71C 1ADQA 1SF5A 1MFBL 1G5AA 2DAVA 1EO8H 4IBWA 2MQ0A 4MAYC 5CCKL 2X2IA 1IM9D 2PR9A 3BAEH 4M1DH 2HH0L 2MPVA 3OD3A 5CD3A 3R06A 4XNMB 4K5LA 1WA1X 4W9EC 2EYRA 4G7QB 2AQTA 2O4EA 4PI0A 3FQYA 1JYNA 4FE9A 2C1PA 1OB1B 1Q94A 1XR8B 3S3PA 4ZUUA 5E8NA 4PJBE 3B9KC 4NO3A 3V0VB 3P73A 3QUGA 4NENA 3VFNA 2YAPA 1NC4B 5ID1B 3IF1B 4P5KB 4S1SH 3X13A 1LEGA 1ZVYA 1PKQB 3TBSB 4XAKD 2VSCA 4UQ2B 4KPHL 1HH9A 1GY2A 4UDTA 4GSDL 2YK1H 1AD9B 4PJ8D 5BZXA 4LT7A 4R5TA 1FNAA 4BV1A 3QIUD 3NZUA 5EORL 1QNIA 5IMMA 4PRDA 1PCXA 2WO2B 1SMOA 4NUJB 1XFPA 1F11A 1IEAB 1P53A 1DQJB 1INQA 2QT6A 4OCYL 4CDHA 4OW6A 1D9KD 3E9UA 4J3SA 1S7VA 1I8IB 3HEIB 4POUB 3OAZH 1BF8A 4M5ZL 3PAUA 5HGGS 4D9LH 5EF2A 3QUYB 3QWNA 5J1AB 1YMHB 3BCFA 5D2NE 2JKSA 2X9ZA 3MBWB 3VXUD 3A21A 2WLLA 2EADA 4QMEA 5J6GA 2FZ3B 5FM8A 4S1DC 4JM2F 2XN9D 4Z7VE 1KCKA 3ARGC 4PRBB 1DJZA 5I1GH 5HDWA 3HFFA 2IANE 3P0VL 5D70H 5IW6B 2EKJA 2AVFA 1SHMA 3RKDC 5DI8A 5DO8A 2PUQT 4PJDB 4JRYE 3X3FL 1XZWA 4IHOB 1RU9H 3AB0B 3CH1A 4ZDHB 5BZDA 15C8L 4ODBD 1WFTA 4Q9QH 1P5UA 2JI1A 3MRKB 4LE8A 5BJTB 3CFEA 2EICA 3L3IB 3MLYL 4L3ED 5L2KA 2QKIA 2KERA 4JJOA 2ID5A 4WV1A 1CDGA 2AXFA 2MFNA 4IJ3B 4U1NA 5C0GA 2VWEC 4DPAX 1ORSA 3P3RA 4EQ2A 4XBMA 3ZYZA 3KLHC 1UWXH 3JV5A 5EZIH 5EG6C 3UZEA 4MNQE 2NR6A 4HOZA 4DAGH 4R4BB 2J6EA 3VH8G 2DWDA 4WK4B 3W82A 1NPNA 1T7WA 3QQ4B 3GYRA 2NY5C 4TQ8A 1TZHB 1N4XL 2ADFL 5DVNA 1HEHC 4HKXB 4KNTA 2A77L 5IJVB 2E5EA 5KSBF 3OXSB 5FF6A 1S7SA 3I9GL 4YGVA 3S5LB 4D0BA 3UPRB 3VXPA 3V5HB 5TF1H 3V52L 2CWRA 3GSWB 3W2DH 4HGKC 1YQVL 3BAIA 3VW3L 2YFNA 4EUPH 1BEXA 3ETBF 3FHEA 3MUUA 5I28A 2LABA 3HKZA 3DO7A 3KXFA 4JRXD 5E2TH 1LO4H 4EXKA 3UGXA 5DJ0B 2MPAH 4Z76B 3IVKA 5D1QB 3FOLB 5EUKB 2E9GA 2VLRB 1JPSH 5I74C 4IDJL 4JMNA 3ARWA 4U6TA 5I0WA 1MIEL 4OCWH 3GZPA 1P4BH 3KYOA 1OD7A 3HE7C 2CE6A 4K3DH 4N20A 3ALXA 1FVEB 3W0WE 1FI8C 4Z7WE 3GSXB 4AQ8C 3TN0B 2E8ZA 4RIRA 3ZTJG 1VLXA 3OAYH 2XTJD 3B7YA 2Q7YA 5JXEC 3MZGB 1YZZA 3HB3C 3IAPA 2XCMC 3JV6A 3GLAA 5EOQL 1CMOA 4NP4L 2VLKA 4N0UE 1WZMA 4DN3L 4YL9A 2I27N 2R69L 3WO4B 3HMXL 3NJNA 5B22A 5I16B 4C4KO 4HIEA 4O02H 4YZFF 5EC1B 3WS6C 3GRWA 2XJKA 4HLZH 4J3BA 5TK2A 4UQEA 3Q5TA 1BMGA 5F88A 2FGWL 4I0PD 2VR5A 4UILL 1J0IA 4ZBJA 3BDBA 4KHXH 4OZHE 4ANKA 2PABA 3WFBL 2BSED 3MA7B 1KJ2B 3TH3T 1VF5C 2GI0A 1JS4A 2HT4C 3CVHA 1FO0B 4GQQA 4JK0D 4CSSA 4HK0A 2CD0A 4LOUC 3DVNA 1RULL 4U0QB 2OR9H 1QVOA 1YUHB 2DQIH 3U7WH 3AQXA 2KDGA 3ZU8A 5JXAL 2XPYA 4HHAA 2F19H 3A22A 3PXJA 4MAYA 5LBVA 2FUTA 2AJVH 5T1DH 3S3CB 5HYEA 3IJSB 4FADA 1TITA 1SUHA 3ARDB 4PCSA 3BGMB 1KG0A 1QSEB 3SOBL 3SPHA 2M83A 3DI3B 4E9TA 1I8LC 1UZ6F 4FI7A 1NCJA 2YQ2A 4JHUA 2CHDA 3NBNA 1VGKA 4B9IA 5C07B 1D7CA 3NACL 3GMRB 3LVEA 3B9KA 1PEZA 2ZNWA 2G3XA 1MPAH 4X83A 2FHCA 3QJFB 4QRSB 4UQIM 3UBFA 4EKJA 32C2B 3ULVL 3PGDA 1KBBA 1TEGA 4MA3A 3ULVD 1IV8A 4MD5B 3GEWB 2APFA 3KPPB 5DZOA 1E6OH 2AQ3A 1U8KB 3MODL 4AJYV 1YN6A 5BOPA 3BO8B 2PW2B 3OL2A 3F58L 4XHJD 4JL2A 2IMNA 4QOKD 4PJGE 3GF8A 1RZGB 3VJ6A 2IPKB 1OQOA 4PJXA 1XZ0A 2DQFA 5JNYB 5KZCB 4NRXB 4ECNA 5ILTH 2LR4A 3AM8C 2M26A 3O2WH 1OM3H 3WDJA 1AFVH 1UB6B 1AXIB 4JGUA 4QY8A 1OPOA 4NWTH 3WNOA 1NPJA 4MMYA 1E4WL 4URTB 4DGWC 5JPNB 4HA1A 1ZLUK 1NFDF 1ECYA 4WWKA 1S8DB 2IPUK 4LCYA 4N0YH 2RCSH 4NDMB 5EBGA 4ZW3A 4AITA 4MNGE 4OM0L 3SYAA 5HDQL 1ETZA 1EHAA 3VWJB 1VFUA 4U1KA 3S34L 5FUOH 3GSOA 2NY6C 4KVNL 3FTVA 4NGHL 1A21A 4LGRB 1DHKA 2KKQA 2X70B 3IRPX 4RZCA 4WUKL 4YDIH 2E7HA 2H32B 4L1LA 2O5ZL 5F7NC 2AKRB 4G43A 4G8EB 4K9EC 2WXFA 5E7FA 2NX5D 1GS7A 1PTZA 1I53A 1WGVA 3C6SB 5AW1B 1L6PA 4ZFZA 4U4IA 4NAQA 5EUOE 2VDRH 3MMEB 4XMLL 4ZPTA 1YEDB 3WFHB 1MQKH 4NM8L 4Q6IB 1JGEB 2XYCA 3Q8FA 4POZC 1MLCB 2WQVA 5BRZA 5EU6D 1KTLA 3RBSA 4NUMA 3V4VA 3NAAH 4XR8C 1O7VA 5DDHB 2HKAA 3BISA 4GQ9L 4M6MH 1CD1B 2DI9A 4XWOD 4OSUL 1GW6A 3N42B 1A9EA 1DE4A 2WTRB 1EVTC 4JG0L 3WGVB 3RLSA 1G7HA 1HWHB 1B6UA 5JIDA 4E5XA 1WWCA 5CMAB 2V5MA 4NBXB 1GRWA 1BVKB 3X14A 2QQNL 3PP3H 3S4SA 1W8NA 4ETYA 3C60D 2D7PA 2YA2A 3ML8A 3C8KA 2O6CA 2CIIB 2YRLA 3AJ7A 3QQNA 3CFBB 1KXTA 4ODHH 2VAAA 2AABL 1YEGH 1OT4A 3MV8A 4K2UL 2X53A 4FNRA 3WIFA 2CSPA 5GRYA 4ZOBA 4HAKA 3OX8A 3ABMB 2XZQL 1DANT 3EJJX 1I7UA 4MVBC 4JY6B 4H5SA 2DWTA 2GFBA 5D7JD 4MQXD 1HHIA 5AD0A 4AV5A 4TUUA 2XNAB 4XNBA 4TNWF 1N8OE 1S9XB 2ICCA 1IC1A 3WENA 4TUJB 3HE7A 2E7MA 3DROA 4U6HA 2F74B 4WY7H 2DMBA 2R2EB 2EAEA 4KK9D 2JCCB 1T83C 4I8DA 4NQTA 5DD6A 3T0WA 5DUMH 1QSFA 1ZHBB 4AQ8A 3EHBD 3O4LA 2X4RA 3POHA 4PB0L 3O0RH 1RMFL 4NQVA 1P7QA 3T04D 4FOMA 4PJ9B 3D3VA 1MELA 3LHPH 2EXWC 4HIIA 4P2YA 3ISRA 3OGCB 3BUYB 1UCBH 3LZOA 4ICXA 4ODXA 2AJZA 1C5CH 4X6DF 3Q2CA 5F72S 2D7NA 5LGKA 2FDBP 1NGYB 1D5XA 5D1XE 5E2WH 5ESAA 3VB8A 7FABL 1JV5B 1YY8B 5EO0B 4MDIA 3WS6A 1TU2A 2BVUA 3DBXA 5GGUA 4XNXL 4LCWB 4LHQB 1CFVL 4LCVA 2YO3A 4JFED 4NT6A 4C83A 4EOWH 3F7KA 4KKBD 4J4PA 1ZA3A 2WUBL 3S35L 3JYCA 5EZJB 4G6KL 4ZFQA 3KPMA 3D2UD 4YHPA 1LDPL 5F7DB 1YYCA 3BDXA 2IQ9L 3Q1SH 2WN2A 1USZA 3N85L 3FTGB 5CJQH 3QZPA 5ANHA 5EPMA 3A0OA 2TRHA 4HLEA 1BQUA 1ES0B 1KULA 1RIHL 2DS4A 1NAKL 2A6KA 1JXKA 2ERJC 4JFYA 1M6OA 4DESA 1AKJB 1WFMA 2C1OA 1CICD 4GBXB 1IAOB 4FQHB 5GS1B 2WZ6A 3S2AA 3ECQA 2OBGA 1I8LA 1BD2B 2BCMA 3QYCA 2EC9U 1TUPA 5DS2A 4L18A 1F6AA 2J6EH 3B2MA 4ELKA 4HFWA 2DDQH 3FFOA 2ZF8A 4G42A 5EU5A 3VMOA 3PHAA 3WLBA 4E9WA 3CFCH 4JAMA 3ARPA 4GO6B 1HTYA 4OZFB 3TZVB 5HYJA 2OA9A 4WEUD 2DQEH 3UBXB 1MRCH 2WGNB 4EDWH 3DX7B 4FX5A 4OJCA 2R56H 3EYSH 4Z6AT 1YMMA 4JFDB 1RZKC 3VFUB 3OV6A 4A7GA 1NICA 4OIFA 2JIXD 4YHZL 3QJVB 3QXVA 3UBXI 4GS7B 3D52A 3RWCB 1KBGH 1WWAX 3BN9C 2MKLC 1G94A 1ZLEA 4W9CC 2FSEB 4UIKH 3T0EB 2N7SA 1MCDA 4TQEH 2NNXA 4ESKA 5IMKB 2GTQA 3AM8A 5J57B 4M00A 3VXNB 3AS3A 4XBPA 1QNZL 3BEWB 3FAXA 1ACXA 4RFEB 5K69A 3VH8A 1KNOA 2AQPA 4LEOA 1LK2A 4CN1A 5F89A 1QEWB 4D9RE 2D3NA 4HISA 5GHWH 3V6OE 5FS5A 3QFGA 4LVNB 1GZPB 3A6CH 2J57A 2CKBB 3V6FB 5FAAA 1LP9B 4MX7B 3B2UC 3NEEA 1NLDL 3CQQA 4QRTA 2AK4D 2CLRA 4L9DA 5F8QC 3BT2L 4LAQL 4GIPD 4WK0B 1IAII 25C8L 3PGCB 3JT2A 3MPCA 5DZVA 3G7TA 3I9PA 6TAAA 2QMKA 3FN0H 5I9QC 1VFAB 5IFAH 1ZVSB 1QFUL 3U0WH 4JO3L 2CJUH 5C2UB 1Z9SB 2J4WL 4UAOB 1BMWA 4N9GB 4U1MB 3P2TA 2NXZC 4JO4L 3US1A 1NL0L 1Y18B 5IBTH 3OQ3B 4LKXA 3RWIB 1S78D 4X98A 3ZYJA 1PEWA 4K5MA 4ICWA 3V8CA 4C58B 4X4YB 4AV4A 4GLRH 5CEXA 3CVHH 3QVAA 2ENPA 5IEKA 4OJAA 1CXLA 3W9DB 3QDHA 3P2BA 3HOGA 5I24A 4HKJB 3B8YA 3B43A 4AJVA 1YEEL 3WJMA 1B0RA 1X9UA 4GXUM 5DUPH 4OD1L 2E74C 1K72A 4O2EB 3GNMH 3UP1A 1AIFA 5LN8A 1Q38A 3PNWB 1S7XA 3KM1A 2H4EA 4X7FC 3INUH 3LNIA 4Q4EA 4K3GA 4PRIA 1MI5E 2CAKA 4N68A 1PLGH 4QO1B 5T5FA 5C6TL 4KK5C 2EUWA 3OKEA 4ZTPL 5C0RH 1I9IL 4MYPA 1UXSB 1PGRB 1G6RB 4HUWB 1U8QB 1P1ZB 4NKIH 2FQEA 4UV7L 4WFHE 4Y19A 4AKPA 3G6DL 1UWGL 5CP3H 2A9ML 4A38A 2WO3B 2CO1A 1U8MB 1IE5A 1DSWA 2CDEB 5I6MA 2ITEA 5IB5A 2HX9A 3MRCA 1Z3GL 2GC4C 3HIZA 4DWHA 4HJJL 1ASQA 1AHKA 3QYMA 2DQDH 4YN3A 2AGJH 5BUAA 1F02I 4Y9CA 4GQRA 3IDUA 4AYMC 2AS5M 3SDAC 2H3NB 2XFXB 3IETB 4V2CB 1M2VA 1IGJA 2BXZA 3L95A 3QFJB 4QHNB 4OFYD 3AXLA 4L1BA 3KGSA 2LQRA 4FNQA 3FSAA 5D4QA 1DCLA 4Z7QB 1TCRA 2EIEA 3MX0A 1E5YA 1T83A 1BAWA 4TUOA 3EZ8A 3QFDA 3HI1A 2FBRA 4LIQE 4TULH 3LCYA 4FC3E 2F7IA 5ICUA 2YEQA 4KZEL 1IKOP 3I50H 1AI1H 4XO3A 1J9SA 1KGCE 5HY9A 1U2CA 3WY4A 5GS0C 3MV9D 1ZTXE 2AW2A 3PF2A 2CCWA 4JY5L 3CZJA 5LGYA 3E2HC 1ND0B 4AIZB 1E9QB 4J1UB 1AVAA 3U48A 4JFTA 3ZKMD 5ICYB 3C8DA 1WH0A 4FP8H 5FDWB 3U7YL 2PP7A 3F7LA 2AEQH 1S9YB 1SJXA 2IAAC 3K3QA 3H56A 4F15B 1S7RA 3Q5YA 1BQHB 1EERB 1OTSC 2Y06L 4EI5A 4WEMB 3D9AL 2K4AA 2BNRE 3NZ8A 4FFYL 4X6CE 4DP5X 3ARBB 5D71L 4NZ8A 2HKFH 4AYDC 3O3BA 2OMNA 5G4NA 2VDMB 4H8WH 3O2DA 2NY1D 3SKNB 2PWEA 4NLHA 4OLYH 3AAZB 4D0DB 2FAUA 4KTDH 4RDQF 4X8JA 1WT5C 3PL6D 3F6JA 2IAMB 1JZHA 2X1OA 1H5BC 1M05A 1MEXL 4OF6A 3DUUB 4X4ME 1NOAA 1VHPA 4YHNB 2TSAA 1LMKA 3CVIH 3O45B 3E8UL 2HFTA 5JHLL 4HDIB 2GEEA 4GUPA 5C0BB 3LDBC 1JMXA 3DDFA 4KZDL 3OLDA 4KVCL 1QW8A 4XPHH 3CNKA 4WI0A 5FW8A 1OV8A 4HUKB 5EBMB 5A2AA 5KOVC 4A67A 2V7NA