1RULH

Crystal structure (d) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 5.6 with a data set collected at ssrl beamline 11-1.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
221
Chain Sequence
RVQLQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
molecule keywords immunoglobulin igg2a, light chain
total genus 45
structure length 221
sequence length 222
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rulH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rulH01
4XH2B 4JPIB 5EWIL 2WNGA 3QO1A 1QQDB 1F58L 3SDAC 1WAAE 2VDQL 5D5MB 1D5XA 4LU5H 4R7NB 4HUNB 1G7QA 3W39A 4L4VD 5CWSA 2PN5A 5B21A 3VA6A 2OTUA 2CLRA 4O02L 1A3LH 1Q0XH 2W0PA 3DPBA 2MJWA 4PD4J 1EAPB 5F7NC 5DHXB 4DQOH 5F6HI 3SE9L 2IQAA 4JPVL 4HF5H 4CVXA 1ZGLA 1HYRC 3RP1A 1H3TA 2BFVL 3C09B 1X6LA 4UAOB 3V6ZA 5EU3B 1MHPH 2Z35A 5HTSA 3UJIH 1CE1L 1KBGL 3KLHD 5TPWL 4AMKL 4PJ7B 1Q1JH 4WW2C 2GEEA 1QZ1A 5L2KD 1ZLWK 4BH8B 2X2YA 4TULH 4U6VH 1RMFH 1BIIB 2B7DT 2YA2A 2I9TB 3D0LA 4HK0A 1RZ8A 3TYFB 1NSNH 4RNRB 2LTQB 4OZGA 1CFVL 4GRLB 1A7OH 3ARBB 4FFYH 1RI8A 4U6HB 4MJ4A 3T65B 3TCLA 1UH3A 4P3CH 4Y4FA 2LABA 4MNHA 5H94A 5FKPA 2GTWA 4RBPH 3D85B 1XGPB 3BZDA 2FEEI 1JUFA 3B9EA 2PYEA 3WJJC 5FEBA 4XVUC 5CBAA 5DJXA 5K9OA 3ZTJH 4PJ9C 5H8DA 1QSEA 2VQ1B 3OR6B 5LAXB 5HHPA 1E4XL 5LXGL 5FCUH 4F80A 3OJDB 1RUPH 3E2HC 4NHUB 2J7LA 1LO4L 1A6UL 3UTTE 4XAKD 1X4ZA 3OAUH 4OAWB 4FQ2L 5F93C 3SN6N 1RJZA 4JCLA 4LHUA 4QHKI 1EMTL 2XI9A 4NC0B 1IC7H 3H42L 1T7XA 3MOBH 3GB7B 2H26B 4RZCA 1KB5H 3O3AA 1VHPA 3OKYA 5FM5O 1D5BB 2Y06L 4JZOA 3IRZA 4K9EH 3RRQA 4Z7OE 2ARJA 4N8CH 4S1RH 1VENA 4WCYH 1BJMA 1BBDL 4YFLI 4M5YH 1I3RB 4WWKA 4Z7VA 3THMH 4JO4H 3REWA 2D03H 5CWSB 3TZVD 2ZUTA 5L8KB 1ZLWH 3V6OE 4R7NA 1RJLB 4K3JL 3WYRA 1WIUA 3GMRB 3MUGB 4YNYA 2W91A 2M8XA 2HTLD 5E1AA 2HJKB 1DR9A 5JIKA 3OG6B 4DKAA 2ZKHH 5GRJH 3VWKC 3QIBA 4R2GC 1FGVL 1Z3GH 1IAKB 3VXOB 4LNRB 4WDIB 2G5BA 1IKFH 2AI0H 4D0DA 1WT5A 2APFA 1AO7A 2XKNA 1IC7L 3MOBL 4G6KL 5DXWA 1SY6H 1CGWA 3WIIH 4NZJA 5D7IA 4HKZB 5DJCA 1RZKL 1HXMA 4GXUN 5F7YC 5J8OA 1U3HB 3IVKB 2EDEA 1P2CA 4PP1D 1QBAA 5HXMA 3RKDC 1XF4A 5IWLC 3VW3L 5A2IH 4FQHB 3IAPA 1M4KA 5EG6C 4PTUB 3VD5A 5JOPD 1K5NA 1L7TH 1NFDF 5CEXB 5J7CC 4G8GE 3D3VE 2XFXA 5IMKB 3TESA 4UTBH 5F7MC 1IGIL 4LF3A 4LDEB 3D85D 3ETBF 5I6XB 4H20L 5IVXB 2ATKB 1LE5A 1FQ9C 1IGCL 2GJJA 1GZQA 5ID0A 5DUPH 4C56A 5SX5H 1JI1A 1KTKE 3V9FA 2MNUA 3BKMH 3VWJC 3I3EA 3ARBD 4ZS7L 3V52H 4OFPA 3Q5YA 3LEYL 3NFNA 2NY6C 4FA8A 1INDL 1FFQA 3ROOB 4YEFA 4YHNA 1NUNB 4XNQB 1V5JA 3AB0C 5IVXA 1KPVA 5CJOH 1QLEH 5ESQB 3KG5A 1K8DB 2R1WA 4O58L 5I9QC 1G7LB 3UPRA 1F4WH 1OP5K 2GQHA 5F8RC 4X6DB 1OL0A 1NMAL 4PTUA 3BE1H 2DMCA 4GW1A 4L3EB 1AGDA 4E9LA 3QEUA 2ADJA 2AXGA 3IYLW 2X7LB 1U3HA 3LN4B 3B2VL 1HILB 1IGML 1FZJA 1AR2A 4IMKA 4TUJB 4I0PA 1SBSH 2MCG1 5BVJA 2EEDA 4XBGB 4PRDA 2FWOB 2G5BB 4IJ3B 2IJ0C 4ZNCD 4L3CB 3LKNB 1KIPB 5CS7A 5GJTH 2ADIB 1GPOL 1HINL 4PJIA 3MR9A 3C5SA 4ZXBD 2YD9A 5J12B 3DSFL 1GAFH 5L9DH 4OD3H 3NTCH 2NY5H 3H8NA 3UO1L 2SEBB 4P46C 1TLKA 4TSCH 1FFRA 1J0IA 2JK5A 1WFOA 2NW2B 3VXNA 1E4KA 3IU4L 3KVQA 2Y07L 3X13A 3RL2A 2UWEA 1HOCB 5JZ7D 1MJ8H 3TJHD 4GH7B 3BKCH 5I1GH 1J0YA 2HVKA 3BSZH 5JHDD 5JDSB 2P8MA 5DFVD 2P5WD 4P5MB 4L8BB 1P1ZB 2OL3A 3ILQC 2AGJH 1JNLL 1EEUA 5LWYH 1RZIA 4NT6B 1LEKA 4DCQB 1TPXC 3PP4L 5D8JL 1FNHA 4LCUA 5IF0A 1JJUA 4U31A 4D9RE 1U8HA 2J3SA 5ISZD 2CIKA 1BQUA 1N8ZB 4LRIA 1FFOB 3WS6C 1DBBH 4Z77B 1EVUA 3OGCB 3QIUD 4CMHC 3HI1A 1GIGH 2VC2L 3D48R 4POYA 4KZDH 1XGPA 2GTWB 4NNYA 3ARDB 5I8KH 1YN6B 5DJ0B 2FSEA 5JOPE 3PWLA 4EIZC 1ZLSL 3PL6A 3RWIA 5C08D 4L8DB 4UIKH 1OF2B 1OAYL 3HMWL 4K3EH 5IMMA 3FB7B 1JPGA 4BKLB 4WUUA 2JCCE 1QSFB 5J57B 1XCTA 3ILPB 3WJJA 1IQDB 3X14A 2DLEA 3WNNA 5GS2D 5FGBC 1YZZA 1UA6L 4IM8A 1YEIH 4WHCA 3BPLB 1I1AB 4XNYL 3QEQB 2OJEA 5IMLA 3MA9H 5HYSA 3HZVA 1U8PA 4LLYB 3HRZB 1QO3A 3EO1B 4O51B 3H7BB 2P5WA 4JFZH 4WO4A 3GSOB 2BNRA 5T1DH 5C92A 2QKIA 1ES0A 1JPFB 1GOGA 4JZJC 3S6CA 1RZ8B 1MPAH 3ZTNL 4OZFA 5CUSH 3GGWB 2GJZB 4I0KA 5L6YL 4Q9RL 4KJPD 1T2QH 1EFXD 4OUOA 3FO2B 5B4MC 1UVQA 5I66A 3EOBB 3MGTA 5INDA 5F3BB 3B2UD 3T1WA 4G8GD 1JL8A 1F2QA 3SDXA 1I1FA 5HGHA 4MNGE 5DYOA 4K2UL 5IB5B 1OARL 5EZJA 1CIDA 2P47B 4OD2A 4S11A 3GMMB 4RBPK 5C08E 3EZ8A 1FFPA 5CCKL 2JJVA 2DQHL 1T1XB 1WWWX 3QDMB 2MQCA 3W0WD 4XX1G 1RUMH 2MOVA 5KW9L 2LTQC 2X4UA 4R8WL 4RAUB 2WWKT 2UV3A 1VGKA 3QIWB 2UUDH 1G7MB 3MGAA 1UM4H 3T2OA 1Z9LA 5I8OL 4R7DB 1YDPB 4LBEA 4XMKL 2F5AH 1QBLH 4BSJA 3BVNB 3G5VA 5DVLA 3IDXL 3BJLA 5MEPB 1JF5A 3EW3B 4JKPL 5ESVA 3DETD 2YUXA 3NFPB 4HAFA 3C9NA 4I0PB 4EI5D 4LSUH 2W0FA 4RX4D 5HI5D 2YPLB 3JWDL 3UYOD 5A3IC 4R0LC 1HILA 3CH1B 5E8DH 1P53A 4PGDB 1IQWL 4ZSOA 5E5RB 1KXQE 3VXRE 2IEPA 3MJ8B 1RJYB 1P84K 2P24B 4WUKH 4Y8AA 2DD8L 1NEZA 4UINL 1A7RH 5TDOA 1XT5A 2VDOH 4BK5A 1J0KA 4HJJL 4AIZB 4MNQA 1FNFA 1PG7H 4RISH 3U46A 4M7LL 1F13A 1A9BA 4PREA 5HI4C 4ZFOL 3CUPA 3GKWH 3DO7B 5DJDA 4Q6IA 1T7ZA 2BC4A 4TRPL 2LV4A 3X3GL 4AQOA 1U8LB 1EEYA 4UDTB 4B7LA 1T1WB 4OFYD 2GAZB 3N50A 4PJXE 4BFIA 1KEGH 4X5LA 1I8LA 1C16B 4Y8DC 2EDQA 1HHJA 1JMXA 5AYUH 4LSRH 1HWGB 3KYOB 1HZHH 4DVRL 3TO2A 4PYGA 1OWRM 1T1ZB 3UYRL 4ZS6D 4ZO6A 5DD1L 5F9AC 3RAJL 1BVKB 5CEXA 3CCHA 4Z9KB 3HS0A 4AM0A 2ADGB 3UTZA 2FHCA 1TETH 2NPLX 4NN5B 1OT1A 1YNTB 4NKOB 3TT1H 3T0AA 5E56A 2OZ4A 4LCWB 3EYOB 4KDTC 1YEFL 1QP1A 4JO3L 5HYEA 1ZKAA 5I18H 1IC4H 3IETA 1UEMA 3B43A 3MRKA 3RVUC 1K9TA 15C8H 5FK9B 1F3JB 4CADB 4OB5L 1KG0B 2CRZA 3DLQR 1JGUL 3BIKB 3IU3B 1A7QL 1E4KC 4APQC 5EN2B 2AJ3B 4L8CA 1NGQL 5BRZE 2P45B 5ALBH 5FGRA 1TVDA 2VDML 2Q87A 4H1LA 1UKSA 3IT8D 1ROWA 1KCVH 3S34L 2VO5A 3F7QA 2WWMD 2XKSA 1MF2H 4JGUA 3FOMA 5ICZA 2G2RA 3A6OA 1PD6A 4GQ9H 2DL9A 4U49A 1F6FB 5F9JB 3VD9A 5JTWA 3BDXA 2ARJB 2JB5L 2CRMA 3GMQA 1D5BA 1YJDC 4PB0L 3P4OA 5GGQL 4WU5B 5C08A 1WZ1L 1NBVH 2G9HB 3GK8L 4QRRD 1N5YL 4YDIL 3SE3A 5F1KC 1EUTA 2IH3A 4PJXA 2O61B 2Y72A 4XCEB 4N0FB 1RZGB 1D3CA 2LU4A 4ORGB 4CVWA 1T04B 3CSGA 3CFEB 5H37H 2DM7A 4XPGH 1JGVL 4OZIE 2XN9D 1GGYA 3DOSA 4MA8L 1SBSL 4NN5C 3PF2A 1EVTC 3EYVB 2X9XA 1P4BH 3CSYB 5ICYA 2VLRB 2DKSA 4JRWA 4NN6C 4YHKL 3T4AA 1CBVH 3BIBX 4K23L 4GFTB 4HUVA 5JW4Q 5CMAB 4HKBA 1B4JL 3BUTA 1S7SA 1MI5D 2NY5L 4P2OC 1G1CA 2FIRT 3P4MB 1AC6A 3FB6A 1CFVH 3BWUC 4X0KA 4X8XA 1DN2A 4X7EC 4U1IA 5T3XL 4NBZB 3CIQA 3G6AA 3I6KA 3G5YB 3F7YA 4Y2DB 3Q3GB 1IBGL 3QA3B 4I18A 1CGXA 4NNXA 4PJAB 3MGOB 1QVOA 5IVNA 3WD5L 3BSZL 2BJML 4PGDA 4XPGL 4JG0H 4ZTOL 4OIIL 5FO8B 2EICA 1LO2H 3ULUL 3RY4A 3ARGC 1UXSA 3P4MA 4X0KB 3ZT6A 4NQED 1AJ7L 4YHIA 1BGXL 1A6WH 3HKFA 2A6IA 1S7RB 5GHWL 3L5WB 1IVLA 4V1DE 2F58H 3QULB 5DJ6A 4NQVB 2DQHH 2I07B 5JQ6H 1KB5B 3QHFL 5TQ0L 2XWBB 1UWEL 1DVFC 2DQJL 2F53A 5IBLD 4Q7DA 1WVZA 4F15C 1KELH 3EAKA 5IUSA 5CP3A 3QCTH 1J87A 1N64L 3ES6A 4P2QD 3OZ9H 1K4CB 4NKQB 5D1XD 4MD4A 3MLUL 4X5XB 5GIRA 5GZOC 5FGSA 5E24E 1T04A 1IM9A 1JV5B 3NACL 3U48A 1RHHA 4ZTOH 3L6FA 3WO4B 2XWBA 3K8LA 2FB4H 2X70A 5LGJB 3I6LE 1U8QB 1ZLVK 2OXHA 3CVHB 5HGAA 5I66B 5DRXB 1MCFA 1A6ZB 2VKXA 4KUCD 3ISWA 3SDXF 5IOPB 4GT7A 1T20B 4ODTH 3LZFL 3O6MH 1FV1B 5TH2B 3S96A 4PLOB 2FATH 1S7VA 4JFZL 1U91B 4RISL 4LVEA 3SQBA 3VXQA 3QHFH 1RFDL 4BQCA 1HH6A 1B90A 3PWPE 2XRAL 4N8CL 2NY3B 2R2HA 4LL9A 5B39B 1AXTH 1BHGA 4E41B 1JBJA 3LS4L 1FHGA 4XTRC 3QCTL 1U6AH 1X5FA 5IMLB 4I18B 4PRHB 1R5WA 4I0PD 4IRSD 4OBRA 4EI5B 1NQBA 1T21B 8FABB 4ZYKB 3MACL 1DUZB 1YPZA 4Z7WE 3EIFA 4PV8B 4KVNL 2OX5A 1T22B 4DVRH 2CLVA 1OQOA 2OL3H 4ALAL 2YUVA 3MV8E 1MFDH 3WFCH 3V4VL 3DI2B 2APBA 3IGAA 5DUPL 3GIZL 3O3BB 1I1AC 2J8UA 2AJSL 3T4AB 4KJWC 4NQDB 2MKWA 5ICYB 4NFCA 4HAGA 1RU9H 4HV8A 1NC2B 5AG8A 2J8OA 1PSKH 5M95B 5IB4A 1T5XA 3I75B 1CE6B 1J11A 2ICEA 2HP4A 2A9MH 5D71H 2W92A 1RZGA 3BEVA 2CK0H 2LVEA 4PY8J 1IT9L 2P8PA 2BSTB 2JJUA 3T8XA 4BZ1H 1ACZA 1KT2B 4L9LA 1LD9B 1J1XL 2BOCB 1RD6A 5I1GL 3PNWB 2DIAA 4MNGA 5HHVH 2DRUA 1FNSH 2Z8RA 1FG2A 1ADQH 4GSDH 5CKAA 5TE4L 3WNKA 3WL9B 3GMQB 2PO6B 2NXYD 1A1MB 4HWNA 4FABH 3QXVA 3WSQH 5HD8C 5JORA 1KCRL 3FHAA 3SJVA 1N7MH 4ELKA 4HK3J 4G8GB 1RIUH 4NCC1 4MAYB 5BMFH 2CDGA 1I7UB 3W9EB 4Q9QH 4JHAL 2A9ML 1F58H 5IG7A 1VEOA 2AJ3A 3RWEB 4X9FA 4C4KO 3KS0H 1QKZH 4Q6YA 3DHMA 5IKCB 1WK0A 1DQDL 1DQMH 3RA7L 1T03L 1U95B 2DMBA 2VLJA 1CQYA 2CIIA 3IS0X 3MROA 3TO4B 4WU7B 3C9NB 2GK2A 3QUYC 4MXQC 1O5DT 5MEPA 4UTAH 5M7QA 2V9TA 5HJ3B 3EYOA 1EBAA 1PKQA 1PG7X 3ZT7A 1NBQA 4NQDA 1E28B 1VKXA 3PP4H 4B50A 1R24A 2OJZL 2VDLL 5AYQA 1QSFD 2R0KH 1BM3H 5EO1A 5HBBA 4HUXB 2VZOA 2GI7A 1YYLH 1GGUA 2ZP0T 4B5EA 5CJOL 4U6VL 4PJBE 4PRBB 4S1QH 5HDBE 1T1ZA 4MMZC 4KAQH 5ESQA 5TDPA 4LCCC 5GGSB 3L1OL 4HHAA 3TH2T 4NYLA 1P6AB 5DR5L 4Y4FC 3A0OA 5LGKA 1UM6L 4EUPG 2D31A 4G5ZL 4Q58C 1LQSR 4BELD 4E41A 4YDLC 4FZEH 1FZOA 4DVBA 3VFUB 1WISA 2C3HA 2R0WL 3U0PA 4G6AC 1D5MB 4KRNA 1S7VB 1BBJA 1CXIA 3QDGB 1UKTA 3U9UA 1NMBL 3F7RA 2NQCA 5K9QI 3BP6A 4CRPA 2VAJA 2P5WB 4HJGB 3K2MC 5D2LE 1VERA 2AQ1A 1KF9B 3MJ8A 3GBMH 1B2WH 4OZIF 4L8SC 5I1KH 3C5ZD 1FC1A 3SKOA 4GAGL 3IDMB 5T1DL 2DQEH 2F54B 8CGTA 5JQHC 1ZANL 2Y36H 3MLSL 3MBEC 3IAGC 1ZA3B 1MWAL 3C8KB 1MH5B 2DWDB 4BZ2H 4KKCD 2P43B 3CFCL 2EKSA 2DF3A 2B1AH 1IEBB 3RNQA 1QG3A 2D9QB 2FYYB 2WBWB 1RY7B 2J2ZA 2AK1L 3HE6B 5D4QA 2A74B 1QRND 3H9SE 4FQ1H 2EIBA 2QSCH 1RUKH 1JIBA 5HHNA 1Z2KA 1CXEA 1IAMA 4OQTL 5FHAH 4D3CL 1NCBL 2BNRE 5IB1B 1NLDL 1MWAB 3NCYP 2DQDH 3DNKA 3GMOA 4JKWA 4BSWB 1JGEA 2DD8H 3FONA 1TVBB 5CILH 1JRHH 5IJKC 1CG9B 4AEEA 3OL2A 5KSAB 4KJWD 2HVJA 3UMTA 1QTYT 2YUWA 4JHBA 3J7HA 3P30L 2DLGA 1TQCB 3UTQB 3MRBA 5DMGC 3QEQA 4KJQC 5IVZA 1CFQB 3VW3H 1UM5H 3HLAB 5FA3A 3GFUA 3X12B 2PYEE 5IHZB 1HH9A 2QSQA 3SO3C 5INCA 2CUIA 4OTXH 3B3IB 4HS6B 4D9LH 4IRSC 5GGTL 4KI5E 3PHQB 2FH8A 2QQNL 3BGMA 2YD5A 4GMTH 3VFRA 3VE0A 1LO4H 3DXAD 4G9DB 2DB8A 1ZLVH 1BF2A 4Z0BH 1K2DA 3DMMD 3UC0H 1F90H 3K4AA 4QRUA 1QSVA 3WDIA 5EZLB 1I7RA 1IGFL 2EDWA 4PJFF 3KPOB 2ICCA 4NN6B 3GI9L 4QY8B 4W6YB 3ESUF 1WT5C 2QQLL 4LPYA 4Z77A 3BGMB 5HYJA 2C5DC 2WUBL 2VXSL 2ZCKL 2AV7A 5F9WC 4OLUH 3RGVC 4OV6F 4LVNB 4H8WL 4GG8B 4YBLB 1U8KB 4LHQB 2A6JB 3RWIB 1CFQA 4QRRE 2D2OA 3OR7A 5GPRA 5J89A 3ARFB 4KVCH 1U3HC 3L7FA 5KVEH 2IFFL 3TVMD 3QPXL 5C0EA 5D1XC 1JHTB 3FOLB 3FQNB 1NFDB 1CDBA 1VB9A 3MRRA 1ZGLB 3BP7A 2GUOA 2XY2A 3C8DA 3R0MA 4KTEH 1JGEB 1A6TA 3SHSA 1QFHA 3GHEH 1MWAA 5DJYA 1L0YA 3S37X 3SGJC 3MMEB 4LKXA 1MIEH 1T89C 3IB4A 1P6FA 4WW1B 4HUUA 1MRDL 1XR9A 1Q9LB 3ULUC 3EHBD 2P5WE 2VYRE 4Y1AB 5FGBA 1MI5E 3UTSD 3ARGD 1ND0B 1RUQH 3O2DA 3X13B 1ZVSA 1R5IA 1KEMH 3EZJB 3I9GL 1KPRA 4RRPA 4D9RD 3GNML 3OKMA 5HHOB 4G6FD 5HYFA 3UTTA 2IC2A 1HN1A 4UNUA 5IJKA 4NO2A 2AJYH 3GSWB 4R4BA 1FL5B 5EOCH 2B8OT 2BNRD 5ALBL 5J06A 3QBTB 1D9KD 3QEUB 4LEOA 3QUXC 4P2OD 3IVKA 5KVDL 4PJIB 5SWSB 3MRHB 3O3EB 1K3ZA 4J1UB 2L7UA 2RB8A 4JO1L 1NDMA 1J05B 3V0WH 1VADA 4NQEE 1NEZG 5HHMD 1DFBH 3WDJA 4OLVH 4XC1H 1AO7B 2XKNB 4JLRB 4YDLB 1J10A 1Q9OB 1QLEL 1UKQA 1AGCB 2F74A 3LQAL 2HYMA 4M43L 5IBUG 3QJHA 4N1HB 3FQRA 5DS8B 3EYUH 3ZLQC 2UZIL 4Y2DD 5DD6B 2VMFA 1R3JB 5DEFB 2ERJB 1H5BC 1W0WB 5BO1H 3GMLB 3MRQA 4YXLL 1Y6NR 3WXWL 4ODBD 1OAXH 4L4TA 2AEPH 5C0AA 2P1YA 1DCLA 4HC1A 5E7FA 4DKFL 2EEBA 4TYUA 3TBYB 3F5WB 2R69H 1G0XA 4PBXA 5C9JA 2NLJA 5JIHA 4ZUVA 5CSZA 3SQOL 2V2TA 5J11C 3HNTL 3S5LA 4XNXH 1JMZA 1S9WB 3STBA 1KJVA 3Q6FA 4MWFA 4PGJA 4PTTA 3MA9L 2QR0B 4RCAA 2AP2A 3L5JA 3L3IA 3ZO0A 3UBXG 2XZQH 2QQQA 1OAUL 3K2UL 4G8FB 2ATPB 5LGHH 4LEXH 1QUNA 1GCFA 4U1JB 2WWMC 2LE9A 1FVDB 2AJXL 4ODWB 2DQJH 5T3XH 3CX5J 4DAGL 4M1GH 2B1HH 2VISB 2Y4SA 4APQD 3H9YA 1XIWD 4D0CB 4PS4L 1MOEA 1YC7A 5I17B 4MA7H 4JFDB 5EPMA 1I7UA 4UQ2A 2N1KA 3W0WE 3VMOA 5HPMA 2VB5A 3VXME 3S34H 4KMTH 4K2UH 3VFMA 4JFOB 3OXRB 1FFPB 3UTTB 1F02I 3AFLA 4Z7UE 2XQYG 3TT3H 1X5JA 3AS0A 2NNAB 32C2B 1XMWA 4YIQB 1OTTD 2NZIA 2FJFA 2HA1A 4LNRA 4GLRI 1HYSC 1L0XA 2XQBH 1HH9B 5JLZB 5FF6A 4EUPA 3O6KH 2R1XA 4JM2B 4IRSB 2ZPKL 1Y0LA 4WEUD 3RGVA 3R0NA 4ZS6C 4PJIF 3RWCA 3WUWG 1KJMA 1BJ8A 3NAAH 4GOSA 4RGMC 4BFBD 3MO1B 2AK4E 2LFGA 3MXVL 1CU4H 3T09A 3T2NL 5I0DA 1TJHH 4MA7L 2VR4A 2BJMH 4ISVB 2XPGA 5E9DA 2FL5A 2RBLA 3BYTA 2Y5EA 5BS0A 3GSOA 2OK0H 2QQKL 3NABL 4KMTL 4U3HA 5LWYL 1G7QB 3W39B 4KJYB 1W2KT 4LLYA 4O51A 2EDDA 2AEWA 1LGVA 3KPRE 4MX7B 4PJ8B 5HI4D 1QSFE 3STLB 1AQDA 1WC7A 1BX2A 1SBBA 3ARBA 1BOGB 4QYOB 4CU7A 5EO9A 3DECA 4W70A 3GDBA 3NFSH 5SX4I 3RWGA 3MNWA 5HHPB 5LAXA 4CBPA 3JZ7A 5GJSH 3GKWL 3VJ6B 4XZUB 2DAVA 1MCBA 3HC3L 2XNAB 1AQDB 1WC7B 4JG1L 3U4BH 3MBEB 3QIUA 4QHUA 5HI5C 4EI5C 4IDLA 2ZUUA 5JA9A 4XHQA 3D39A 3T65A 4KGJA 5B39G 1NBZA 1B0GB 2VSCA 3RNKA 3X17A 4HMEA 3T0XA 1K4DB 4DW2L 1EK3A 3PHQA 2OTUB 4PJHB 1D5MA 3LS5L 2Y7QB 4HWBL 4WY7H 2DWEB 2I27N 4O9HL 3VFUA 5IF0B 3MV9B 1H3XA 5FYKD 3V52L 5E8NA 2JJTC 3RUGF 5JUEL 1U8QA 3S4SA 4GRWE 4EUPB 1O7VA 3V6ZB 3VD4A 4MWFB 2GSGB 2X4OA 1VEPA 4HIIA 4C59B 4NUGL 2C7UA 3KPRD 1MPAL 4JPKH 3ZTNH 1A47A 1WBXB 1UM4L 1KELL 4HFWB 4P3CL 5I75B 4FN0A 1Z6JT 2FO4B 3V6BR 3HZMA 4HG4K 2CLRB 3THML 3CMOH 3H9ZA 4X99B 5CSBA 5ISZA 5DQDH 3MRMA 5JNYB 4NWUL 4RGOL 5B4MD 1QFWI 3WE6B 1A7QH 1DANU 2ZOLB 4KJPC 5T5FH 5D7JA 3FB5B 3G9AB 1E28A 1VKXB 1MFEH 2ZCLH 2VDKL 3C5SB 2FYYA 2YRLA 1TVHA 3M1BA 5DS8A 2IANE 4FFVC 4HWUA 1UJ3B 3O6ML 1RULL 2HJFA 4OF8A 3BN9D 3B9DA 3DV6B 1B3JA 2EECA 4DKEL 3H9HB 4MA3B 4POUB 1FO0H 5DC4B 4Q9CA 5K33A 4Z7WF 3SKMB 5T1MA 3ARXA 3QUZA 5I9QB 3UYPA 2ZUWA 5TE7L 5MEQB 2PYED 2EDHA 4Y2DA 1EXUA 4H88H 3RHWK 1KCSH 5F88A 3BIAX 3G5YA 1PEWA 3GO1L 3H7LA 1DQDH 4R26H 3RA7H 3SCMA 5C9JB 1T03H 3RX7A 2VLKB 5DC0A 3SGKA 4KRLB 1FRGL 3L95A 2EDTA 4HBCL 4HQQL 1KPUA 1S9YA 3HN3A 2PXYD 2EH7L 4UNTA 2D7OA 4PRPB 2JIXA 3QIUC 4JN2B 4RX4A 5DD6A 3V95A 5IP4A 1INDH 4HH8A 3ARZA 2OJZH 3OKKA 3TN0B 4XPFH 1PG7L 3FFCB 3T8XB 2XWTB 3U7AA 2EDFA 5JHDE 3H0TB 3O3UN 4I2XB 4ORGA 1LDPH 3MCKA 4KZDL 1EDQA 4TPRL 3BPCB 3QEGL 1KCSL 2VIRA 1SMOA 4G6ML 1MUJB 4UT6L 5IFJB 4HV8B 3PXHA 3G08B 4GAJH 4ENED 3P9LA 3RZCB 1ZHNA 5I76B 1FRGH 3WD5H 2VUYA 3WHXB 3U6RB 3IFNH 4O2FA 4MCYB 4KRPD 4LCYB 3TNNA 1EHLL 4QCIB 4PP2B 1JGVH 2C1PB 3OMZA 4P46D 1OW0A 4ZO8A 4KKLC 4MS8C 5C8JA 1E4JA 4OZFG 3UJJH 5CAYB 2VLLB 1KTLB 2ARJQ 1IAKA 1P4BL 1BGXH 3LHPL 4ZXBC 4LPCA 3RKPA 1KCLA 3TPUB 4FNLH 1H0DA 3SBWA 1SY6A 2FNBA 3LQZA 5GSVA 5EZLA 1J1PH 4OM1L 4JN2A 1S7WB 4EDWL 4J3UA 1XGUA 3P30H 3WEXB 5D2NE 2VL4A 4QOKE 2Z8WC 1I8KA 4KUCF 5IV2A 4XAKE 5H35A 4HXAH 3VH8A 4TQEH 4PIRF 3NPZB 3V5KA 4PJ5B 5IW1A 2FEDC 2JELL 4JY4B 3BP7B 5ACLA 3DUHA 3GKZA 1YEDB 4RWYH 4ZO7A 4OLYH 3W5MA 3OBAA 3Q2CA 1A6ZA 5IEHA 2H26A 4HC1H 4RZCB 4OIIH 2XWJB 1HDMB 3L7EB 4QHNA 5HYSG 5FOBA 4EBQL 1ZK9A 1A1NA 4LLMA 5D9SB 3LRGA 1JTOA 1PJ9A 3N9GL 3GHBH 1QBML 2NY1B 4KMLB 1C7SA 2P7TB 1NCCH 1BFVH 4LNVA 1T6VN 2R4SH 3PL6C 2NY6D 4YHYB 3K2UH 4M00A 4CNIA 3ARBC 1U93A 5E2UL 5K59F 3KXFE 3VWJD 4I48A 3MRIB 4N8PA 4Z8FH 1INQA 1JNNH 5I8KL 2GITA 4DUXA 3AY4C 3JWOH 2FRGP 1ED3B 1C5DB 4JG1H 2OI9B 4ZFFB 2EIEA 1UWXK 2VN4A 4OM0H 5BV7L 2HRPL 5HHQA 2RR3A 4K3EL 2COQA 1S7RA 4E42A 5EB9A 4AEIL 3DV4B 3D0LB 3LH2H 1CXHA 3NN8B 1R0AL 1C5BH 3QCVH 4ODHL 3QP3A 2P48B 2FGWL 3X12A 3T0EE 2PW1B 5B8CB 4B53A 4U0RC 2FH6A 2F8OA 1W0VB 4JM2F 3W2DL 3QUYA 2PXYA 4HS8L 3QA3A 3B5TA 4PRHD 1NGXB 2E3VA 4KH2A 3O6KL 2EZ0C 4X6CE 4KI5C 5IW6A 1QACA 4TVSa 1NANH 3PG2A 1RK0A 3TO4C 2H9GA 3RIAF 3H9SA 4IIQB 5E99L 5IIEA 5TH2A 4JDTH 1W72A 1BQSA 1UYWL 2YRZA 2HRPH 4ZPTA 5EZOL 1TVHB 3M1BB 4L9LC 3OQ3B 2ZUYA 5ANMB 1NL0L 5JOFB 4UILH 1W8OA 1B0RA 1UH4A 1R3LA 4ONGL 1INQB 1NLBH 1CD9B 3KPQB 3E0GA 1LHZA 3D39D 1R5VA 1MNUL 3DUSA 4WRLA 4UMGA 1LO0L 4XCFL 3T0EC 2WWKO 2WP3O 3Q5TA 3TEUA 3WKNA 3L5IA 4KHTH 5HGBA 1R3LB 1XF3B 4ZD3L 2KKQA 4R8WH 3CVIL 5EBGA 3STLA 3DRTA 2I07A 4G8EA 4YHMH 4PGEA 1ZHLB 1RQ5A 1CTNA 3D3VB 3NVQA 5HVGB 1NAKL 1F4WL 4I77H 4PJ9D 3HAEA 5B3JE 4MMXC 4O2EB 1QBLL 1DQJB 4XXCC 4XVUD 1F4XH 4C56E 2LAAA 4DGIL 4XMPH 1FZKB 3MPCA 3WDHA 1S9KC 4YDKH 43C9B 3U0PB 5DJAA 2G2RB 4ODXB 5C0CA 1B0GA 5B8CC 4DZBA 1DANT 4Y4HB 1KJ2H 5D72L 5E4EB 1NUGA 5DD3H 4PJFB 4JR9H 3BUYB 3CXHJ 3O45B 4KY1L 5CJQL 1FL6B 1MAJA 2OJEB 3MTRA 4HGKC 3KNBB 5JXED 5FF6B 4HIXH 1VACB 4MAYA 3G6AB 5F8QC 3U2SB 5E2VH 2J6EA 1NGZB 3MNWB 2H3NB 3O41A 2B0SH 2OZ4L 1HCFX 3RPIA 4NQDE 4Y2OA 1SYSB 1RFDH 3HUJB 3QQ3B 5ITBL 3CVHH 2CJUH 1X5IA 3CH8A 3N1MC 1LO5A 1CQKA 2YPKB 4LCYA 3TNNB 5C0FA 3HUJE 2YRPA 1ERNA 4G9FD 4UQ2B 4NWUH 4YGVB 1YNTA 5TFSL 3MACH 1VFBB 2BNQE 4XPBH 1MQKH 2X4NA 2P8PB 3JWDH 1D5IL 1WIPA 2ZSVA 4WW2F 5F9OH 2DQFA 4ALAH 3E6HA 3SDAD 3TO4A 2F19H 4WHYG 3I75A 4X4ZA 4UINH 1KB9K 1XAUA 5FUCE 1KCRH 4G8FA 3RWCB 3QZWG 4CVZA 5JW3L 4FZ8H 4IRSA 4MZ2A 4M6ML 5HHOE 1BFSA 5L2KE 5GGTA 3RU8L 2YEZA 1WUNT 4ZXBA 1P1ZA 2OL3B 3STZB 4PJGB 3QAZB 1ZT7A 2AABH 1OAUH 1T4KA 3F6LA 2M2DA 3V4UH 1VPOH 3ARFD 5CLTA 3ULSA 4IS6B 5KN5B 4LEXL 4P4KB 4KKBD 4NFDA 4XP1H 3KXFD 1KPUB 5JORB 1A02N 3NCBB 4GMSL 4NKIH 4JY5L 3KJ4B 3RPIB 3BJ91 1BZ7B 1GGIL 3CX2A 5KANG 1GOFA 4DZ8B 4MYWB 5F96H 3O81A 3BI9X 3MRGB 2HLFC 3U82B 5DLMH 4L3AA 4M7ZB 3WFBL 4I3RH 1CXFA 2VWEE 3ESVF 2VDMH 3KLAB 4PY7A 3O6FA 4NZUH 3LB6D 4G42B 1BQLL 5DFTA 4WI2A 2YPLA 1WITA 3DGCR 1YQ2A 4XXCA 2EDXA 2CR6A 4PLKC 3LRHA 3P0GB 4GBXA 4TN9A 1AGFA 4GRLD 1MFBH 2HJFB 3FO9B 1UADC 5F9WB 4GXVH 4U1HB 1G6RA 1I8IB 4JO3H 3HAEB 5I18L 1X5ZA 5I15L 2W60A 3HNVL 2MQ3A 2R23A 3FQUB 4ODSH 1CDHA 3EDKA 1YNKH 1LEGA 4GW1B 2NCMA 5JMOC 4HXBH 1UT9A 4PB9H 4YBQC 1EFQA 5KTEL 2IG2L 4X6DA 2DIJA 5HDQL 1F8TL 4ZUSA 3AC0A 1TJHL 1VCAA 5KS9E 3HUJF 3KPTA 2FO4A 2IBZX 3KPRB 3L3JA 3ZE2F 1CICA 3H0TA 3TO2B 4MA8H 3QEQE 1DUZA 1YPZB 3GSUB 4OD1L 1I1RA 4XPHL 5FKAA 3MRQB 3AMKA 3DURB 3PWPA 3ROOA 4I4WB 4OQTH 1NMCB 2GSGA 3I6GB 4PJCF 3HC4H 3IDJA 1S5HB 2IAND 4N5ED 2W9LA 3IFOB 4CMMB 3LZFH 4XCNB 4C56B 5M94B 1XR9B 1YMMB 2WBJB 1I3GL 2LAGB 2I9LA 3FHQA 1Q9OA 1GOHA 2A0LC 5IK3A 5FO9A 5DD5H 3V6FA 5ADOL 4HUKB 2FCBA 5SWQA 1ORSB 3QRGH 2PTUA 3QXUA 5TGBB 1NBZB 4OCSL 2DDQL 1E4WH 3HRZA 2IH1B 4URTB 4BQ9A 1KTDA 3CXHK 2L4OA 4R3SA 3V8OA 2R0WH 5GRZA 3IXTB 4JCMA 5B8CA 3TBSA 2GCYA 3VGHA 4CN4A 4Z7NE 5DZNA 5ESAA 3F7YB 2LQRA 2R56L 4EBQH 3IKCA 4MA3A 3Q48A 4Q9BA 2GSIB 2D7MA 4MD4B 4X5XA 1NAMA 3N9GH 1EJOH 4LLDB 1HI6B 1BF8A 4OLEA 3ES6B 1Q1JL 5HYJB 1GXEA 3CFJB 4P5KB 3U0TA 5GRXG 2AK4B 5JW4N 2ADFL 3VXUD 4NHCH 4UDUB 1N59B 3PDOA 4WFFD 3W5NA 3HPJA 3LMJH 5HYIA 3OV6A 4OCRL 2VLRA 3P2TA 4X6FB 1A7BA 5T33H 4WI4A 3QIBC 3L5WA 3WE6A 1Q9KB 1OTUC 3EGSA 1GHFH 3I3DA 4HW6A 2WMPA 4G9DA 1Q0YL 3HI1B 4LSTH 4KROD 1RUQL 4MQTB 3HTLX 3RJQB 1EUUA 3VWJB 4RFEB 2Q3ZA 2B4CL 4JN1H 4N1CA 1G9NH 2R2BB 35C8H 3V7AG 4M7JH 4YHZL 2X4OB 4WTXA 1QVOB 1TIUA 3MGOA 3U0WH 1U8NB 3OR7B 1MFEL 2ZCLL 4F7CB 2HFEB 4CN6A 1BIHA 3OAUL 5DGRA 2IMMA 4LGPB 1F90L 2A6JA 4YBQD 5J1AA 4AYFA 1F4YH 3OG4B 5BOZG 5BJTB 4Q2ZB 4PBWD 5GXBB 4YIQA 3T4YA 1R3HA 1WAAF 5DRZB 4J6RL 1AXIB 1NJ9A 2AXFA 3V8CA 1ZGLM 4Q74A 3O4LD 4RA3A 2WK2A 2WBKA 4J8RB 2P49B 3PQYA 4H1LH 4QY8A 1YEFH 5TE7H 1Q9KA 3AAZA 4GRLC 1PAMA 1U8PB 4PLKD 4CGTA 3TJEL 1RK1B 4F9PA 2YD1A 4TSBL 3DYMA 1HNGA 5I17A 2DM4A 2HTKD 3N1PC 4PR5B 2VXVL 1I8MA 2I60L 1N6QH 1OAQH 3H3PH 4JPWL 5KVGL 4MQXD 3ILPA 2F15A 3A6CH 3D0VB 4NZRH 3VXTB 3JTSA 4D8PB 4FXGA 3MV7E 2FZ3B 1NGPH 2QADB 3BPOC 4U1JA 3D18B 3FT4A 4XX1E 1CGSL 2AI0L 1S78C 2J4WL 2OTWA 3P11L 5C08B 4JRYD 4HS3B 2R15A 4J3SA 2FIKA 2D9CA 2ADJB 3MUZ1 1T3FB 2Q8AL 3ARFC 4ZD3H 1MUJA 3CCHB 4NGHH 2OCFD 4M6AA 2D7QA 1T1YB 2EDOA 2HT4C 2Y1VA 4L4TB 1K8DA 2R1WB 2VDQH 3SDYH 4KDVA 4NKIL 3ULUF 4QF1B 3V7AE 4NQUA 5ERWA 1I9JH 2X1OA 2ESVB 1SQ2N 7FABL 3G5XA 4PBVC 3IDJB 2R8SL 1NGPL 2ZUSA 3QB7C 3D39E 4NYLB 1VGEL 4LSVL 4OI9A 1LE5B 1V7NH 1NBYB 2VDRH 3WSQL 5TDPB 3VXUE 2W07A 1DFBL 1XGQB 2EC8A 4LARH 3U46B 1OLLA 3Q1SL 3VI4F 1NDMB 3Q0HA 3HR5A 2CGRL 3SO3B 4OZIB 4P23A 4PRHE 3O2VH 3RX8A 1KN4L 1PQZA 4LEOB 5D96B 3DXAB 2JJSA 1AE6H 4L5FH 5GISL 5IHLB 3RVXC 2NY5C 2XZAL 2CK2A 3HS0B 1NAMH 1Z5LB 5JXEC 2V2WA 4L3CA 2IAMA 1N5AA 3MLWH 2BVOB 3EJZC 3H9HA 4XPTL 1HHGA 4HG4J 5GRUH 4DQOL 1SHMA 4KQ3H 4DFHA 4QEGA 5T3ZE 3NGBC 5IKCA 1FZJB 2H41A 4DOHE 3QIBB 3L3IB 1HE7A 2X41A 4M7ZC 3WFHB 5C0DA 1UZ6E 1A7PH 2X4UB 4RAUA 4RMWA 4OGYH 4L3EA 2DYPB 5JW3H 5CINH 2E7LA 4AMKH 3MRGA 4C83B 5KVFL 1MLBA 3MMEA 4GUPA 5EU6D 3TBYA 2VABA 1AQKH 1CGYA 2VR9A 3WJLC 3U30B 4JQVA 1H3GA 3ZMRA 2CRYA 4X6DF 3IDGA 2X4RB 1OQXA 3WKML 4Q9QL 3KPLB 1WBXA 2KPNA 1TFHA 4NKMA 2Z4QA 3HC0A 4NM8L 5IB5A 4NQTA 1SVZA 2DM3A 1PZUB 2PW2A 3T0ED 5C0DB 5L88L 1U8MA 3BO8A 4KWUA 5E8OA 2WLZA 5I30L 2BNQD 2NY4D 3HZYA 3VXMA 3VGAC 1FSKC 2ZJSL 3W0WA 3ULUE 5EU4B 4RGMB 1IJ9A 2ED7A 2EO9A 1MCLA 3FTGA 3D1MC 3WV0A 4WHDA 2A38A 4XCYA 1OM3H 4KV5E 2CIIB 2MWCA 2VLJB 4LMQE 1QBMH 4WHYH 2Q7NA 3D69A 3H3KA 3MBXH 3V5DB 2BVEA 3LS5H 2VDLH 4WUUD 3W11D 5DEZA 5CBAB 3O3EA 4ZO9A 1DL7L 4EI6B 3FFDB 1NC2A 3K1KC 3TO4D 2WUCH 3CD4A 5H94B 5DDHA 2PF6A 3OGOE 1JZ7A 1BEYH 1RIHH 4C4KT 5T3ZH 4FQIH 5EC2A 5I1HL 4KI5D 4U1SB 5T3ZD 1Y6KR 7CGTA 2BVTA 2EZ0D 2DLIA 4R90L 3ARQA 1WWCA 2YBRB 1XGQA 2NY3D 1RURH 1OPGH 1T22A 4GKNA 3WXVH 2PCPA 5E08L 1ND0A 2JTDA 4M9PA 4WFHD 4FZEL 2AVGA 2YPVL 1F4XL 3N1GC 5BJTA 1MHHB 1KN2L 3RI5F 1BOGA 4QYOA 4PJ8C 3ARDD 1K6QH 4S1SL 4JQXC 3DYPA 4WFEE 5C0JA 1CFNA 4GLRH 3T0BA 4HUUB 2VDKH 2NZ9C 3MV7D 3ZYZA 1XF2A 4LAQL 5D7LA 5I2IB 2VQTA 4J8RA 3NGBB 3GIZH 3K1DA 1QLRA 1C8PA 1INEL 5I1LB 3IJSB 1BLNB 4NO0D 1AI1L 1JWMB 5F71A 4JZNB 5HHME 1GC1H 5CP7B 5D2NB 3MRRB 5I1CL 1DSFH 1GC1C 1K8IA 3JUYA 4K7PL 5ADOH 1ADQA 3MJ9H 3PL6D 2L7JA 1A3QA 2O5YH 1L4IA 3GSNL 5E2TH 3DROA 5HGAB 4NUGH 3QXDB 3QO1B 1U8NA 2IALA 4G7YL 3CDFA 5A1AA 4XVTL 4I77L 3UTPD 4PJCE 1CFTB 1XF3A 4WENB 4GW5B 3TA3B 2CXGA 3BWAB 2PETA 3GNMH 5CJ8A 4S1SH 2F8VA 2VXVH 3P9WB 3B9KC 3UTOA 4YR6A 1OD9A 4B0MM 3EDFA 1P4IH 3AB0B 3I84A 4U3XA 1D5IH 1UCBH 1BD2A 5ESAB 5E2WH 4YXHH 2FEDD 1NC4A 4LAQH 4OUUA 4Z0BL 2XZCL 3MLYH 1MCQA 3ZL4H 1YY9C 4PRHA 2I25N 1J0ZA 3IDIB 2EH7H 4WTWA 4R3SB 4LIQE 1U8OA 3S7GA 2OBGA 2IH1A 4PJEB 1FDLL 5F3HA 4BA8A 4J3WA 3UPAA 5IM7A 1D9KB 5IQ7H 3VE0B 3PDOB 4ONHB 3D69B 3V5DA 3KWWB 3CFJA 4UI2A 2R2CA 5IT2L 3T4YB 2ZWLT 1P7QD 1FVDA 3G6DH 4S1RL 5IK3B 5FYLH 4LLDA 3EYFB 5D2NC 1ZT1B 1JE6A 4QWWD 1KFAL 5EU4A 5CEZL 1ZE3C 3KYMA 2YD4A 1B88A 3HZYB 4MS8D 3IU4H 2XTJE 2B4CH 4JN1L 4KKLD 3CLEH 1M05B 5J11B 4KDTA 4ZFGH 5GS0H 3IS1X 4KRPC 3IFLL 1A22B 5TGBA 2C1OA 3VWJA 3S3PA 4ENEC 4YDVB 4QRRA 3UPRB 1CICB 3VXRB 1MVFA 1S7SB 2GKIA 4H25B 3UJJL 4WFFE 5CMAA 1H5BB 4X6BB 1I1YB 5FM8A 2R0KL 4M7LH 3RIAK 1F6LL 3UZEA 4NQVA 5E4EC 3INUL 4M7KH 2GITB 2QL1A 3I85A 4QRQA 3X3GH 3GI8L 3MNVA 1TTUA 5F6IB 4X8JB 5KSBB 1FL3B 1HNFA 2DWDA 3GO1H 4PRDB 1XF5A 4KC3B 4NJ9H 1GGIH 5J56B 2PXYC 4XVSL 3EOTH 5I1JL 1OAQL 3H3PL 4JPWH 1ULVA 3AM8C 5IMOB 3HG1B 2IQ9H 1F3DJ 1K5NB 3OAZH 2VLME 4Y5YA 3LKRB 3FT3B 5I1EL 4HC1L 4LLMB 1XF4B 4NOFA 4WU5A 1MAMH 3BP6B 2Z8SA 4OZGE 1RULH 4NQXA 2APXA 5FO7B 1BZ7A 1NCDL 4H0GA 2Q8AH 1TQBC 5DHVB 1HIML 1IZJA 4OLZH 2NY1C 3WFEH 3RFZC 5F9DC 2XQBL 4K8RD 4IRZL 5C0ND 3LKSB 5CBEB 4P46A 4YH6A 3WL9A 4YHNB 2BOBA 3VXMD 3NFNB 4PJGA 3O6FB 3BN9C 5E95B 3CSYA 1EZVY 3UBXI 4JFFA 5D5MF 5JR1L 2H45A 1F3RB 1OAZH 4K71B 2EDRA 1G7PA 1Q9LA 3FMGH 3GMRA 4FFVD 3R4DA 2IG2H 1ZHBB 1V7ML 2DDQH 4HWEH 3WN5B 4P48A 2NTSP 5DLML 4WFHE 3BIKA 3IU3A 3TBWB 5EU6B 1N6VA 1UB6B 1A6TB 2EIZB 2NY0C 5BQ7B 5HDLA 4W4OA 1CS6A 2W9EH 1A7NL 3NIGE 5ELIA 3TZVB 1MJ7L 3UBXB 3DIFB 3AUVA 3UZQA 2W9DH 1UACH 1FYTA 1VFBA 4QTIH 2IADA 4ETYA 5JPMB 2YD3A 1MEXH 3WHXA 2FIKB 4OF6A 4UB0L 4KXZI 2J12B 5IFJA 2OSLB 1MRCL 4XP6L 2DM2A 1X5KA 3QYCA 1JZ4A 1G84A 3BKYL 1F5WA 1BVKA 5E2UH 3TZVA 5E7BA 3WN5C 1JHLH 5FV2A 1IKNA 1PBYA 4MLIA 4GBXB 1GZPB 2X4TB 3TIEB 5CD3A 3GJFH 4GRWH 3VDBA 5DJXB 3WXVL 4ZYKA 5K9OB 2DLHA 4ZQKA 3KPSB 3BKCL 5T1KB 2UY6A 5FYKL 2GY7B 1OAXL 5JOEA 1U36A 1AFVL 4DJMA 2DTML 5EN2A 1JGDA 1EZVX 3LH2L 4NSKB 4PY8I 2BNQA 2FD6H 4U6HA 1C5BL 4HIJB 4YFDB 3SJVB 1A7PL 2HMIC 1N6UA 4XNXL 4PJHF 5JO5A 1EO7A 5CINL 2KUTA 3LAFA 2C4FT 4M6NH 3MYZA 2ZG1A 2OP4L 3D25A 4PRAB 1CDYA 2VXQH 1DBBL 3VG9B 3BESR 5ENWB 4B41A 1T4KB 3RUGB 1MY5A 4YDJB 1UZ8B 2BERA 1B4JH 1RSFA 3L3HA 1U2CA 4ZMAT 2Q6WB 4PGEB 1MVUA 1DLHA 5MEQA 4N9GA 4L9LB 5DT1H 2Z35B 1G9MH 1KTRL 1LVEA 4OAWA 1MCDA 1CU4L 5FM5M 5A2JH 1MY7A 3BEVB 3CMOL 1PKQE 1T0NA 1UYWH 2XG4A 3MC0A 3FFCD 3CNKA 3FONB 1FAIH 1CK0H 2ZSVB 3GSQA 2HAZA 1J5OL 4I1NB 3F12B 3HPLA 1R5VB 4Y16A 3KPMA 4HWZB 2X9WA 3K74B 2WIMA 4F7MB 5ILTH 4K3DH 3DYOA 2VLJE 1A3RL 5HGGS 4JANB 3QIWA 4QGYA 3WFCL 4KKAD 4U33A 1IFHL 1OB1A 1P5UA 4Y5VC 2NY0B 4RDQG 1A0QH 1IE5A 2VOTA 4HGWB 1IEBA 4I3SL 4TULL 1P69B 3FKUS 1GVIA 4XC3L 2OYPA 4EN3C 3C60B 4PV8A 2V7NB 1WFUA 1HYSD 4LSSL 5TDOB 3QUML 4OCWH 3FN3A 3IDMA 3LDBB 4X6CB 1F11B 1OTTC 2NXZD 1NFDE 2K7QA 3T2NH 4KI5F 4OM0L 5BV7H 1C08B 2DJ4A 4IBLT 3EOBA 2DLTA 3MGTB 4R0LA 5HHOD 3O0RL 1CZ8H 2Z9TA 4DW2H 1U91A 3AMLA 1Q72L 3QQ9D 4FFZL 5DA4A 1MNUH 4NNPH 2YHGA 4J4PA 1M71B 3RWHB 1OGAB 1XIWC 2ZCHH 4A2LA 4P5TC 1CGSH 3DX9A 1QSZA 3U83A 1MCEA 3AGVA 5DJZA 1CR9H 2Q7YB 5DA0B 1NANI 4CDGC 1BECA 4Y1AE 1D6EA 5HYSB 2V5RA 3ZE0F 2QQLH 4XPAH 5T33L 5E00B 1YJDL 3QDMA 1NC4B 4OUUB 2CLZA 5E2TL 1AXTL 1XCQA 1YC8A 3LV3B 3VI4E 4JM2D 1LDPL 1CDCA 4LSTL 5E9DD 4Z5RA 4RFNB 4TSBH 3R1GH 2YWYA 4IIQC 3AS2A 3DUSB 1M7DB 1OAKH 3CZJA 5A2LH 2NX5A 3N06B 3FQTB 3LEXA 4HUXA 2V5SA 1IGIH 5ID1A 5FA4B 1R24B 3B2VH 3HMXA 4RIRB 5DSCB 3DROB 2R0LH 1PX3A 1BMGA 4NZTH 1V05A 2F19L 3CK0L 4TUKH 3ET9F 4TTDD 3M8OL 2PYFA 5IVXE 3QWOB 3D25B 4YHIB 3LKQA 4M5ZL 3SKUD 3NCFB 4E41D 1H8SA 4Y2DC 5DUBB 5FHBH 4LVHC 4CW1A 2QKIB 4G6KH 4MVBC 1URLA 1QLRB 5I16A 3HE6D 3VH8G 3ZE1F 2XZQL 2YMXH 1MQ8A 5CGMA 5IT2H 2CGRH 4LLQA 2VZSA 3SGKC 4G42A 4M9OA 3QUYB 1GIGL 2VC2H 1E4XI 4YBLC 5FAAA 5LQBH 4M1DH 1Y0LB 2RJMA 4NT6A 3BRGC 2GYSA 4U1GC 3CJJA 1JPST 4BJLA 4BZ1L 2V17L 3QUXD 2ICES 1M7IB 1D9KC 1BFOA 3CX5K 4O02H 4ODUA 1XIWB 1JPSH 4OFDA 3AREB 1MIML 4GKNB 5GS3A 5JDJA 1IZKA 4XWGH 2VLJD 4QRTA 2IGFH 1Q9WA 2N56A 4U7SA 1HXYB 3NPSB 2ZZUT 1ZVHA 3LKOB 4JO1H 5ITFA 2DMKA 4PJBF 4J3OC 3RZCA 1NKOA 3H3BC 5GSVB 5C0GB 4OV5B 1BD2D 4JFDA 2GIYA 2A83B 3IJHA 4P57B 5IBTH 5IROC 6FABH 4PRIA 3HI6L 3RU8H 3EDJA 5E94A 1RIUL 3ULVF 5AUMA 4MXWL 3LQAH 3EHBC 3ULUD 2GJ6A 2P46B 4X9HA 2QHRH 2EKJA 3CFEA 4R4FL 2EDNA 3K80A 1V3LA 3OX8B 4PUBH 4Q97A 5SWZD 3PGFH 5I71C 1T5XB 5I0ZA 4HIHA 4TSCL 1ZANH 2Y36L 3MLSH 3W0WB 1U2HA 4D2NA 1AGEA 4P57A 3SJVD 2H8PB 5A2KH 5J3HC 3T0DA 2HRLA 4HZLB 1AHWC 5C0FB 5SX4H 3SE9H 1G9EA 3O3BA 1CLOH 4G80A 2RFXB 3VRIA 1DLFL 4YGAB 3DTXA 4ZDHB 3TVMC 4PJ5A 1U3HD 1A6AA 4NQCA 3SDCA 1PX4A 2BMKB 4KMQA 4OI8A 1I9RL 1O0VA 3LEVL 4KQ4H 5DWUL 4F9PC 3JVGA 4NQEB 3DHJA 3RGVD 2NY2C 1VACA 4XBEL 5BVPL 4NP4L 4F33B 2F58L 3TPUA 4HKXA 1WZ1H 3QUZB 4LLQB 5TQ0H 1T5WB 5DT1L 1MFCL 4JY5H 3MRCA 3RY6C 2X4SA 1F3JA 3LKSA 1ZSDA 3PDGA 1OTSC 2B5IB 3MLWL 4XXDA 1BBDH 4LVOC 5D7SL 3DMMC 4I13B 2IPUG 4O4YL 4OCSH 2ZSWB 4I5BB 3VA2C 2BVOA 4C56D 1UJ3A 3ARGA 3N85H 4Z7WB 5IFHL 3RHWF 1BZQK 4G3YH 4Y88A 3MOAH 3BKJH 4K3JH 2DTSA 5SWSA 1MCPL 1CGTA 2BP3A 4RIRA 1MHPL 3KXFA 4ORZC 3LKRA 4JDZB 4KJQD 1H15B 3F62A 4LLUB 1IILE 5DMGD 5JPNA 3ZKSD 3QXWA 3RVVC 4AZ8A 4I2XA 3HCVB 2I24N 4PJAE 3BAEH 4PPTA 4JY6A 3TLRA 4ELMA 1ZVSB 1AD0A 4JFHD 3LN5A 2HG5B 3BPNC 2KQMA 3CXDH 5KW9H 3HMXH 1ETZA 3BT2H 3DRQA 1T1WA 4FMFA 1JWSA 1AO7E 3TNMA 1FZMB 5E1AB 2LU3A 3VFSB 5E9DE 1R3KA 1HHIB 3TBVB 3SGEI 1N4XH 1S9YB 4HPOH 3C2AL 3SE8L 2A6IB 3CLEL 2AERT 4P23C 4XPHH 5IVOA 3MNZB 4OZFB 1L9NA 5FGCE 3VXPA 1OP5H 2HJLA 3OPZH 4MNQB 1PEZA 3PABA 5A16B 2CO7B 1IGTB 4KKCC 5ALCL 2C7UB 4G6FB 2DQDL 2NXZB 5K9QG 4KTEL 2A77L 1Z3GL 4KK5C 4FQHA 3MBED 1U92B 4ZS7H 5EU7C 2AV1B 3SKNB 1C5CL 2PW1A 1KLFA 4XRCA 2J6EH 4UBDC 3C5ZC 2W0FB 4OSUH 3HMXL 2J1KA 2Y7QA 3SDCC 1AKJA 1DVFA 2FX9H 5J6HA 4J7RA 3VXOA 3MQIA 4PG2C 2YPVH 4H26A 4YEEA 1A4JA 3OB0K 5SWZA 1G7MA 1D9KA 3QH3B 5EU7E 4R26L 5MEOA 3PL6B 3RDTD 4F9LC 4M62H 3ZKNC 4G6AD 1QSEE 5AZEL 2AEIT 2FECL 1YUHB 3EYVA 1CLCA 2BX5A 3QIUB 7FABH 4S2SA 4X6EB 1IQWH 4IMLA 3PUCA 4XZUA 1AO7D 3FAWA 4HH9A 1YY8A 1J9CT 3K4ZA 3HZMB 3MV9D 1AIFA 1J88A 4Y4FD 1RIVH 2RQ8A 2NW3B 4M5ZH 1Q8MA 5JUEH 1I4FB 4BK4A 4LARL 5CGTA 5J1AB 3LD8B 3TT1L 1AXSA 4K7FB 4Y89A 5D70H 3UX9B 1P9MA 5IWLA 3DBXB 1GHFL 3QUXA 3UTQA 4JM2A 4OLWH 4MQSB 2UYLA 5ENWA 1XGTB 3O2DL 3ECBB 5DR5H 2D03L 4KXZH 3D87B 3MLVL 4FQQB 2UWEB 4JKPH 1T7WA 3BPLC 3PGDB 4NQSB 2NY2B 3QDAA 3WIHA 4GAJL 4PRPE 3PV7A 4QXTA 3VFMB 5L8JB 1VA9A 1YNLL 5IB3A 4WI5A 1XF2B 3QUYD 4MXQD 1WQVT 4M93B 1LO0H 1J18A 5LBSH 4BM7A 5F1IB 1VFUA 4HIXL 2W9DL 3FFDA 1I1AA 2D4DA 3RWDA 1N0XH 3PWVB 1WBZB 2DI8A 3FQXA 5CD3B 3U7YL 4P5KA 3UROR 5I74B 3C87A 3V79C 5EWIH 2EYRA 2C1PA 3KGRA 4KFZC 3EYSH 4HWBA 3X11B 5HD8D 3PWLB 4OF7A 4CMHB 3MJ7A 2QR0A 1ORQA 1KTDB 1MWAH 2BZDA 2NR6C 1SYVB 2NXYC 5E03A 1KJVB 1VFOA 3Q6FB 4OCXL 5K9JL 3JXAA 3K8KA 4UT7L 4M1CD 3KPNB 3BPCA 3LKPA 3C6SA 3P0VL 1KSRA 4HD9A 5E9DB 4RWYL 4LOUC 3MCKB 2WBJC 4HLJA 4LLWA 3X3FH 5I19L 2Z92B 2C26A 3IJYA 2IPKA 3FJTA 4ZUTB 3C08L 1AD9B 3DARA 1E27B 3FZUC 3MLRL 4TTGA 3KPPA 2XN9A 1N0XL 1RZIB 2E7LC 3O4LE 4P9ML 4Z0XA 1U8MB 2D31B 1IAOA 4P5MA 4PTTB 3EUUA 3TPKA 4Y19E 2P8MB 2E8ZA 2YSSA 4YX2H 1QEWA 4EUPH 1NBVL 3MREA 4TPRH 4JRXA 4XGZA 5DJDB 3DO7A 1AGCA 2NNAA 4AH2B 4JLRA 3TFKD 5DEGB 1I1AD 2DBJA 1D5ZA 1S8DB 4YZFF 2AQ2A 5E6YA 1J8KA 2SEBA 1F4HA 4O4YH 1CYGA 1Z5LA 4JDZA 3DSNA 5F9OL 4BSVB 4ONFH 5C0AE 4GS7B 4PJBB 3CGTA 1WICA 4K07A 4UAOC 4I0PC 3CH1A 4LQFL 1FN4B 1KLUA 4NO2B 2ED9A 4JFEE 2R9HD 1BPVA 4OFYA 4XTRD 3Q1SH 3DUUB 2ORBL 1OSZB 1ZSDB 2FJHA 5GRVK 1VPOL 4O5LL 3ZTJG 4LMQI 5T3XE 3UO1H 1YNKL 3P73A 2DI9A 5D6CB 3IDYC 3ULVC 4FFWC 1GL4B 3FB5A 3MUGA 1S9WA 1PQZB 2F5BL 1U6AL 2XN9B 2W59A 1RZFL 4L4JA 1CLYL 4X4MA 4QF1A 2DQTL 3GSWA 3B9KA 4MXVE 3MRLA 5FFLA 3LN9A 3O9WB 3SPVA 2EH8L 1NGYA 1D6VL 4RWHA 5EZJB 3S9DB 1RZ7H 4JQXA 2PO6A 1U8JA 4BYHA 3OPZL 1YEIL 5GZOD 1AJ7H 4G43B 2XY1A 4OGYL 1OARH 1X4XA 3TIDA 4PGCA 3AVEA 4DFIA 1A6WL 2YEZB 3MODL 5F7FA 1IFHH 3SDXB 4AENA 1T66D 5IBLC 3TM6A 2MMXA 3KYMB 1DVFD 2XTJD 1UVQB 3NZ8A 1FC2D 4JRYE 1UQSB 2V7HB 3CU7A 1H3PH 2IPKB 1BQHA 5CIPH 4NHUA 2W0KA 2ICEB 4V1DB 2UUDK 3BDYL 4GKZA 4QOKB 5EO0B 1U9KA 3QIWD 2FX9L 4D9QD 2K1MA 5D71L 3OZ9L 4LIQL 2JJTA 1H8NA 3BZFB 4PJGF 2IFFH 5CLWA 4LLAA 4FRWA 1YEGH 4ZFGL 3L3GA 3QQ4A 1EEZB 5LCVH 5FCUL 4YBHA 4QXTB 4GRLA 3R06B 1KJ2L 5D72H 1KIUA 4MD5B 4YPGA 2AXFB 5C70A 1FYTD 2VQUA 3MLTB 4WI7A 4ERSH 3KLDA 4YR6B 5DD1H 2H3NA 1SM3L 2CRIA 3FB7A 3ECBA 4I3SH 4BH8A 4POZC 4EI5A 4RFOL 3RDTB 4JAMB 2HFEA 3QXTA 1I7RB 2IAMD 4PJEF 4R96B 4PJFA 2VLMD 2Y5TA 3OKEA 2VITB 5EC1A 5SV3A 5IB3B 1CVSC 2R2BA 3OKNB 1MCOL 1KFAH 4DN4H 4WW2A 1E4WL 4H88L 4L29B 1MJUL 1OAKL 1R3HB 4E41E 5I1LA 1G9NL 5GZND 4OZHF 4XI5C 5C3TA 3WHE1 4NJAH 2Z31A 3WXWH 1U8HB 3MZTA 1G7JB 2E6JA 2BNUA 2XZZA 3DGGA 3OKEB 5EC1B 4LCUB 3GRWL 3D3VA 2VR5A 5GRJL 2IGFL 3QUXB 4XBPB 1DE4A 3UTSB 4OCNC 1SJHA 2WINA 5MEOB 2DKUA 1F42A 5LBSL 4TVPL 4UV4H 1U8KA 5D1ZB 5K93A 2NX5B 1KACB 4YXKL 4P49A 1M7XA 4ZTPH 5KSAA 5FHBL 3A67H 3VG0L 3RL2B 4FZ8L 3PWJA 4F57H 1RUML 4XC1L 2NW2A 3U7YH 1YY8B 3R06A 3MJ9L 4YLQT 4NPYA 2F53B 5FYJH 4QT5B 4PUBL 3KPOA 4S2SB 4JHAH 3FN0L 2YD6A 1AE6L 4L5FL 5GISH 1A4KB 3EYUL 5I8OH 3EYSL 3D2UB 3QDGE 5CKGA 1D6EB 3B9AA 5JR1H 3TCLB 3K3QA 4E0RB 3Q6GL 1FIGL 2A6KA 2KL6A 3BQUC 1A4JB 5SWZB 4NQCD 4ZPTB 4DUWA 1KIPA 4UTBL 3SGDI 4LSUL 1LNUA 5KVGH 1P4IL 1G6RH 3IFLH 3QDGA 3VXPB 1MREL 4Z7VF 2OL3L 4GSDL 1ADQL 1BBJB 3P0VH 4EKXA 5SWZE 3CLFL 1S3KL 5INCB 3REVB 4X7DC 4LPWA 5EIQA 4ZPVB 1YMMA 2WBJA 4R0LB 3BP5A 4EQ2A 1MF2L 4HDIA 3LN4A 3MLRH 2D7TH 5SX5K 1U3JA 2AV1A 5KAQF 1A6VH 1QFPA 5E0QA 3BO8B 3RVUD 2EC9T 3L3KB 2HVJB 4EJ1C 2W65B 4HKJA 3FRPA 1OY3B 5BS0D 4DGVL 3KJ4C 4XAWL 3GSUA 3PHOA 4U1IB 1EAPA 4HJ0C 2UWEF 3SPVB 3KPRA 3L3JB 3SDYL 4MJIE 4RQQB 4J3TA 1IAIL 1XEDA 3ARYA 3Q6GH 1EEQA 4OB5H 4YUEH 1KPVB 1BAFL 3VFWA 3SBWC 3PIQB 4AJ0A 4QXWA 3CFCH 1N3NB 1U8IB 5FIEA 5EH1A 3VFSA 3WFHA 3T0VA 1OD7A 3RWFB 5ADPL 3VRLE 4Z76A 4E5XB 4HWZA 3CZFA 3MRIA 3ZDZF 1YECH 1AP2B 1DN0B 2C4FU 2HG5A 1TMCB 1UA6H 4JY6B 1HKFA 1LDSA 1G7HB 4Z78A 4OZHB 1YEKH 2BSED 5FXCH 2KQNA 4ZUSB 4LPUA 5FUZL 5JW4M 3DX8A 3T2PA 5I6XC 1RIHL 1BEYL 1J1OH 2D0GA 2ITDA 4I2XE 4O5LH 4RMTA 2HKFL 2OQJB 1L7IL 1HDMA 3L7EA 4NWTL 1BJ1H 1E6JH 4IEFB 3O2WH 4JFYA 2B5IC 5D7IB 4NQEA 3U9UB 1YPZE 2VLRD 4Z7WA 1G6RB 3TH4T 1N0LA 2NXYB 5KSAC 2H6PB 2CUHA 2BMKA 2QSTA 3GMPA 3I2CH 2Z91B 3F6IA 3F8UB 4JRXB 4R97B 1U0QA 2EYTB 5A3ID 5BS0E 3VXSA 1YMHB 2RGSA 4NO5B 3WJLA 3MX0A 2CDEB 1PLGH 2CKBA 2W0LA 3U1SH 3DETC 5DMJB 4C55A 3N1FC 2X44D 3HNTH 4G8IA 3RL1A 4UZGA 2OMNA 2VN7A 3JV5A 5JW5B 2H8PA 4YHLH 5HYQB 1T2XA 1FO0B 3MV9E 4F7PB 3KPPB 5F7EH 4ELKB 4P2OA 4X5WB 1DQQA 4Y7MA 3KR3L 5HGDB 2GJ6B 4MJ2A 2DBLL 4X4YA 1QYGL 3VFPB 3IETB 5C7XL 5KN5A 5GGRB 4PRIB 1OLZA 4HXBL 4OCWL 3PHSA 4XMLH 2IPUK 3BP4A 2VXTL 1MCIA 2HT3C 4XVTH 1V7MH 4NQCE 4XMKH 4OFKA 4PJ5E 3MJ7B 4WVRA 4XVJH 4JPVH 1A6PA 2ADGA 4M62L 4OT1H 1I7TA 4X4YB 5IGXH 3N0PB 2C9AA 2FD6L 3KYNA 4K94C 3B2UC 3JV4B 1TPXB 2CPCA 1UCBL 2B39A 3FB8B 5D1QB 3L9RB 4WNQA 1YEJH 3UDWA 1I9RH 4UOW1 3FQXB 4PFEA 5ALCH 1RVFH 2Q76B 3D9AL 1T21A 8FABA 2A77H 4N1EA 4XCCL 4MA1C 2VDPH 1QOKA 3MV01 3G04A 4MNHB 5I1KL 4IRJB 5FYJE 2Y9RT 1CD0A 1HSBB 4PGZA 2CKBB 5JIIA 1UWEH 2YZ8A 2UY7A 3VFGL 3IGAB 4P46B 4YK4B 4FTVB 5L2KB 3L95B 3OB0H 4NQSA 4Q9RH 3SDDB 2B2XH 3MXVH 1A1MA 1CLYH 4OFIA 4ODUB 3JUZA 4AIZA 1SJVA 3LVEA 1FV1A 4PGBB 5IOPA 5AWNL 2MCPL 3NABH 4RAVA 3WNPA 4G8EB 3EDDA 5KBNC 4GS7C 2Z31C 3FT3A 5DD3L 2N7AA 5B39A 1X7QA 4IOIB 4LP5A 4MD0A 1JK8B 1GGBH 1G7HA 4Z78B 2IQAB 1XGRB 3V0WL 1AI1H 5GGSY 4CW1B 4RMQA 3NFPA 5DMIH 3A67L 3VG0H 4YWGL 4ETQB 4A2MA 3WO3B 3S96B 4LFHD 1I1CA 3QFJA 4N8VA 3BXNB 2A6DB 1TITA 3PP3H 5D7JB 1S7UA 5GS1A 4EQ3A 4JPIA 5EU5A 2H32B 5DJZB 5CHNA 4H0HB 1OGAA 4NJ9L 3MRNB 3QEQD 4X80L 5GS0C 5I1JH 1KLGB 5F1OB 1U58B 3ILQD 4GMTL 5DFVC 4QRRB 4GRWF 2VKWA 12E8H 2BXZA 2QSVA 5E2WL 4YXHL 3TJHC 5JZ7C 2CLZB 2UVFA 1R5WB 3QAZC 2E9WA 3GSRA 3BISA 5E00A 1C08A 5HYJE 1CT8B 5L7XL 3SEPA 3ARRA 2ZOKB 4PV9B 1A9EA 1A1OB 5IR1A 4ZODA 1FE8L 2Q7YA 4OGAC 1IGTA 3I50L 1HIMH 2APTA 4LPXA 2XOTA 2HJLB 3V6FB 2R29H 2R2EA 2O5YL 4YO0A 1P7HL 5F21B 1UWGL 4BQ6A 1MFAL 1ES0B 5IESL 2MQ0A 2I9LB 3QEHB 4GAFB 4IHOB 1P84J 5IW6B 4WO4B 2FDBP 4GMSH 5IFAL 3I9GH 4JFEA 5EU5B 1A9EB 5IR1B 3D39B 1FZOB 2J5LC 1R3KB 4KK8D 3D2UA 4UT9H 3BXNA 4PRNA 5EU6E 1EGJL 4NZRL 1J8HE 3HAEG 3KPMB 5EBMA 3GUTB 5C6TL 1XGRA 3DV4A 3LIZH 3UPCA 3PE9A 5JPNB 1JK8A 4KQ4L 3S36L 3RPKA 2XACC 2WW8A 3IDNB 4JVPA 1TCMA 1DE4B 3UTSA 4ZFFA 1ZT4B 2IALB 2CMRH 4HCRL 1OP3H 4NP4H 4GXVL 3AM8A 2A6DA 4Y19A 2MHAB 5FYLL 3WKMH 1VESA 3QFJB 2AKRA 1DDHB 2ZPKH 2Y25A 4HFUL 3RQ3A 1YEDA 4DEPB 4L8SB 1FLRL 4UIMA 2FL5B 1X5HA 1JGUH 4N5UA 3O3DB 4HLZH 1TZIA 5K9JH 4FTVA 1JHKH 1J1XH 2CIKB 1S7QB 2JELH 3WHE0 1IGMH 3C60D 3SDDC 5FO8A 1X7QB 2IANB 4MD0B 5E8EB 3C5ZA 2FX8H 1AHWA 4PJXF 5FUOH 4LSVH 1BP3B 4KI1A 2AJUH 3LQZB 4RAVB 4TUKL 4IOSD 2DS4A 2X1QA 4DZ8A 2V5YA 3MRJB 3WMSA 3RKDD 5BV7C 4PP1C 2JB6B 4F9LA 1AR1C 1BFVL 5IW1B 3WFEL 4YE4L 2NY7H 5J4MA 5DC9B 1A6AB 2F54E 3SDCB 1RMFL 5B3JF 1NGWB 2FECI 1I7TB 3KR3H 4MQ7A 4OD3L 3FOMB 3NFSL 4G80B 2HFFB 3MLZL 4QCIA 1PGRB 1Z9MA 4MJIB 4WFGE 3BZFA 4P0DA 2V9RA 2X6MA 1XFPA 2DYPD 1JHKL 4R2GD 3MR9B 4N68A 3VWKD 5J9PB 4HULB 4FXLA 4EDXB 1KC5L 1YN7A 2HKHL 4NRYB 5HY9A 2HTLC 4BFGA 1FAIL 3QZWB 3CSBA 2X4TA 3TIEA 3H6JA 1UJ3C 2DKMA 4HUWB 3SOBH 1JTPA 2DQFB 4MAUH 5HHXL 2V7HA 4DK6A 1WAAA 3TZVC 3WN5A 3LEVH 4WJ5B 2BHUA 1R6VA 3GBNL 1PVHA 3UTPE 4MXVF 4LCWA 5H2BA 3GJFA 1OHQA 2F9BT 2ORBH 2BXYA 1QD0A 3WIHL 1J1OL 2BC4B 3UTZB 3CFIC 1CFSB 4Q6IB 4ZAKC 1G9MC 4PREB 4F37K 1G7LA 5D7LD 1UM6H 3V7MA 1G7IB 4RMUA 3ULVH 2VABB 4X6CF 5HVWA 3HR6A 1F97A 4F3FB 1B0WA 1UM5L 4C83A 3KYOA 4PJ7E 1C16A 1FO0A 5HHMB 3JV6B 1YEEL 2AEQH 2C4XA 2OQJA 2GAZA 4AEFA 1Z0MA 4EOWH 4UQ3B 4L8CB 3AS3A 4U1NA 4OCYL 3OB8A 3QHZL 4NO5A 4JKLA 4CVUA 5KSBF 3WNOA 2XA8L 2E7HA 5I16B 5KSUB 3F7VA 4WV1C 1MFDL 3IF1B 1XZ0A 3CC5A 3MLYL 1G1YA 1HHGB 4ERSL 1CL7I 1X6NA 1GGBL 1P4LB 4Q0XH 5DI8A 2A73B 5KSBA 3T1FA 1KLUB 4FQIL 3RY5A 5I1HH 1ONQA 3DVNB 1QFOA 1I9EA 3ARPA 5IHUH 1FNEB 5EOTA 1QYGH 4M3JA 3BZEB 3VXUA 3VFNB 1F3DH 4N0CC 3IFPB 4OJFL 3BZ4A 4R4ND 3BT2L 2EDKA 5IB2A 2KDGA 1W0YT 3PIQA 4M4PA 4OZIA 1QLFA 4P9HL 4HZAA 3QDJB 4K3GA 5IBUB 5IMOA 3KLHC 1MCOH 2Q8BL 1KN2H 3BW9A 4U6TA 1L6ZA 3T3ME 4ONOA 5IGXL 4PJCB 4JDVB 1FH5L 3RTQB 4EN3A 1WFNA 3FO0L 4DWHA 1B0RB 4O2CA 1VGKB 5B22A 3EFDL 3D9AH 1FNGA 4M6NL 1CGUA 3L3OA 1JRHL 1EA9C 5EUKA 3P11H 3FQWB 1TETL 5C71A 2VDNH 2F53E 4PG9B 3KPSD 5T1KD 3REWB 3V0AC 2YPLD 4HX1B 3MJ9A 2ZUQC 5E8PA 1OSPH 4YDVA 4JFXB 4WFGD 2BNRB 3P0YL 4NN7B 4ZOCA 2P24A 4AG4L 1QO3B 3EO1A 3FRUA 4PJEA 3OAYK 1SYVA 3CDGA 1CT8A 2HLAA 3C2AH 2OTWB 3RVWD 1EHAA 2XNAA 4QT5A 4OCXH 4YFLF 1VFAB 1C1EL 4QHKJ 4ZOEA 1CF8H 3REVA 5FDWA 4XNZB 5SWSE 2C3VA 3HB3C 2GK0A 1XCTB 5IEKA 1EIBA 1HEZA 1CD1B 2BRRL 3S5LG 1JPGB 4BKLA 1WBZA 4UV4L 4OLXL 5CHNB 5DJ8A 4F7EA 1HHHA 2NY6B 5F1NB 4E0RA 1C5CH 4FQPA 4KTDL 3MUY1 4QXUL 4QRUB 4WEBL 2Y6SC 3UAJD 1T1XA 1XH3B 5C0AD 4OLUL 5I15H 3HE7C 2ICWA 2BDNL 4NZDA 3ABZA 3B83A 1JWMA 1LWRA 3PV6A 4DN4L 5TQ2L 2YD2A 3RTQD 1OAZL 2A9NL 5D6DA 4WI6A 3QPQC 4N0FA 3W81A 3MV8A 2X4PB 2Y07H 2NX5E 4P2CG 1BD2E 2ARWA 2UYLB 1CLZH 1T7YA 5HGHB 5D9SA 5T5NF 2VTFA 5C0JB 4N0UA 5E5MA 5MI0B 4QHNB 5INDB 1I75A 5MEND 2QBWA 1NH6A 5DRNB 1R3IL 2ILLA 3P4OB 3RAJH 5FB8B 1LO3L 4NNYB 1G7JA 4WHTB 1Y6MR 3QDME 4EEEA 5JMRA 2MTPA 1AH1A 3UJIL 1MCHA 4PRAA 3V4PH 2FJFB 2YOCA 2VLRE 4KK9C 1JPFA 3EO9H 3VDAA 25C8L 4FG6D 1BLNA 3SGEH 5H35B 3VU2A 3DVIA 2CUMA 2YKLL 2R29L 5FYJL 2GJ6E 4NIKB 4A6YB 3ULVE 4KV5F 1BZ9B 5L2JA 3BQUB 3VWKA 1LEKB 4GAYA 2N4IA 3HE6A 1LP9A 4G6MH 1M1SA 2IBGA 2RIKA 4XMLL 1XGYH 3P77A 1WBYA 1ITBB 2CXKA 1DQLL 2VLLA 3FB8A 2ESVE 2QTEA 3DJ9A 1EHLH 32C2A 4GKSA 2HKHH 2OR9H 1SJXA 2YXFA 5TF1L 3MRKB 2EDBA 3RY6A 4NZTL 1EEZA 3JTTB 2YK1L 4WFED 3WFDH 4IRJD 1B4RA 1EO8L 4YQXL 3S98A 1G6VK 3GHBL 5DJ0A 5IBTL 1MCWW 5GGUA 1FVCA 1JWUA 1SJEA 4W81A 3S5LB 2APVA 3DVGA 4AM0B 4ZFZB 3D5OF 1BJ1J 3ZT5A 3LRSB 5SWQB 5E8PB 3U7WH 2BY3A 3E2HB 4V1DA 3CFBB 3ARUA 1FFOA 4MAYD 1FSKB 1IEAB 2DBLH 4YHOH 4ZAKA 5T1LA 1IGJB 4HXAL 5F7WC 4YDIH 4WWKC 1FYTE 2RAMA 1HHJB 5DD0H 1HQRB 1GSMA 1IAIM 3MCG1 3LOWA 2VXTH 1MJ8L 1XR8A 2GW5A 2R0ZL 4G8IB 5BZWB 3RL1B 2ITCA 4KUZL 3QFDA 2GY5A 3DVFA 2AXGB 5C09D 4Z7VE 1O7SA 3OKLA 1AGDB 5ADPH 2J8UF 4JFHE 4LASL 2EIDA 3QNYA 3S35H 1JZ3A 4W6XB 3DUUA 4Q6IC 4ZAKB 5T1LB 4MJID 4APQB 2ZKHL 2VZVA 5C0AB 3MRLB 4HWBH 4UB0H 2HT2D 1S9VB 4XCFH 3ZKXC 1JPTL 1MFBL 4J2XA 1Y18A 4LSDA 1IKFL 1OOAA 5C07B 1HHKA 5CCKH 1QFWL 1V3KA 5BXFA 3AU1A 3BEWA 4MDIB 3TA3D 4KK6C 3GEWB 1L7IH 4X7SL 3HR5B 3LKNA 4LSSH 2FJHB 1T83C 4MHHG 4G9FB 4G7YH 1KJ3L 1IBGH 2DL2A 4FQXD 3W9DB 5HSFA 4TNVF 1K85A 4LF3B 1ITCA 5IJVB 2AXHA 4LCWD 1KC5H 4DGIH 3TN0D 1FL3A 4KVCL 4XB8A 4ZG1A 1T5WA 1D6VH 4Z76B 3OKLB 1IC5H 2M1KA 3KLAA 4PY7B 5KAQG 3GSVB 2CDGB 1HQRA 5KZCB 1HXMB 4LKXB 5HI3D 1YQVL 4RGNB 3DI3B 1S9VA 1HQ4B 4NFBA 2F54D 2C3GA 4YXKH 5HHOA 1T1YA 2YS4A 4ZFZA 4X7SH 4P4KA 1F45A 4RGNE 3CVHL 1MFCH 3NAAL 2HH0L 1IAOB 1RHFA 3PNWA 5IESH 4TRPH 1W72L 3GJFB 3HHRB 3MLXL 4JHWL 4KRMB 3FO1A 3IDYB 2UWEE 1RJZB 4LRIC 5GGTH 1NCNA 3G9VA 5MP6H 4NKDB 1E27A 5EUOA 1OGAE 1A5FL 2GJZA 5BRZA 2FB4L 3C8HA 4JFFE 2A2QT 5T5FL 1E4XH 5LXGH 1NLBL 3E6HB 3C6LD 2EDLA 2H2SD 3RIFF 1FGVH 3HRPA 4YPJA 1WTGT 5FYJU 2A6KB 4RDQF 2WSKA 1JHTA 3FOLA 3FQNA 3I02A 5HDBF 1KNOB 1RK1A 2VDPL 3WS3B 1AC0A 1A4KA 1IC1A 4MNQD 3H42H 4H1LG 5D7KD 3C09C 5KSVA 4P2RD 5IHUL 4MSWB 1DSFL 2RHEA 4XWOC 4DTGH 1LO5B 2G5RA 3VFRB 3LSOA 2YXMA 2EYRB 5BMFL 4Y19D 4M61B 4RNRA 2CLVB 4GKSB 4D0DB 2ZUXA 3SKJL 4Z7OF 3IXAB 1EAJA 4K8RH 4WDIA 2VLKE 5EO9B 3GJFK 3U9PL 2WIIA 3QPXH 1EO5A 5A43C 5IVZB 2MCPH 3QXDA 5DMKB 3PXJA 1EX0A 5LCVL 2V9QA 3IFNL 5FECB 1TQBB 1UEYA 3GSXA 3V4VH 1UG9A 3PQYB 4JZJA 3OF6D 5BS0B 4Z7VB 1V7NL 4CUCA 3SQOH 5C6TH 3AXLA 2YZ1A 2Q1EA 1JCKA 1KULA 4Q2ZA 3P3YA 5I2IA 5GGVL 1HCVA 1YEKL 5MHSD 1T20A 2AKRB 4JFFD 5D5MA 5FECA 2D4FA 1U3YA 2Z93B 2VXUH 1FNGB 3GIVB 3DRTB 43CAA 5J0BA 4JAMA 4O2CB 2YWZA 3TJEH 1N59A 2H1PL 3RWJA 3EFFB 3CDCA 4L1HA 1A14L 3L6FB 5D7LE 4DAGH 3T3PF 4LP4A 4S0TD 1UCTA 4RFEA 3QR2A 4X7TA 5E6ID 2PCPB 3BH8B 1ZA3A 3C8KA 5J6HB 1DVFB 3PV6B 1CWVA 3FT2B 2GSIA 1REIA 2O93L 1CF8L 5EOCL 4BSWA 2ICWB 5E6ZA 4HBCH 2PYEB 4FQXA 2BCKA 4P2YA 5F7UA 2E7BA 4U1LA 3RBSA 1PLGL 4PRNB 3S88L 1F2XK 1ACYL 1MHEA 4PLJC 4OKDA 5CZXD 1HHHB 4N90E 5D2LB 1U41A 3LHPH 4QOKA 5EO0A 2ICWI 4JRYA 4LVNC 2DJSA 3TYFA 4YE4H 5FO9B 1NUDA 1PYWB 2WV3A 3WS6A 3B9VA 4NM4H 4UUJB 2F54A 4GRMA 3HE7B 1VSCA 1JNNL 5C7XH 4P2QB 1H3VA 1IGYA 1RURL 3B6SA 3ZE2E 4PV9A 2UVEA 5F7LB 1NPUA 4CMMA 3SCMD 1FZMA 1TNMA 4UQ3A 5L6YH 1S5HA 3EOTL 3I6GA 4G43A 3ZDXE 4NKMB 2FHFA 3KJ6L 4JE4B 5AZ2H 1IL1B 2VE6A 4HIEB 5GGSA 3PABB 3C6LA 3S88H 5HVHC 3CLFH 3S35L 2X9YA 3EDEA 3QI9B 4KKNA 1ACYH 4U6XB 4WWID 1FNAA 3PJSB 3K0WA 1IAII 3MBXL 5CJBA 4HGWA 2DQUH 4KPHL 5HHQB 4XNYH 3MODH 4P2RE 1ZXQA 2CKNA 4BQBA 1N2RA 3IFPA 4MXWH 1MCSA 1TQCC 1FNEA 1GH7A 5EOTB 5ABDE 3NBNA 1JWSB 5JQ6L 3PWPB 2YPLE 2WAHA 5L0QB 3EJJX 2AAVA 1DBAL 4HHAB 2EE6A 4Z6AT 4M1GL 3FRPG 3BW9B 2XFXB 5KSUA 3NCJL 2VRAA 4JRXD 5EIIA 1QHOA 4UOW0 5IG7B 1CLOL 5C0IB 4N9GB 2X4QB 1J0JA 2GTZA 1MELA 4MJIA 3RUGA 5DMYA 1RZJL 1A21A 2P8LB 4G8GA 2IMNA 1KENH 5DWUH 4PJ7F 3ARGB 5HJ3A 4BUHA 4YAQA 1G7IA 1IM3A 4PJEE 4I5BA 2GT9B 4XWOD 3LPFA 3MA7B 3ZSTA 5MHSE 1A7RL 2OMBA 5ACMA 3V0VA 5JO5B 5TJWK 4OKVB 1QFUH 3F7VB 4TUOA 2IPTH 3ULSB 3MRJA 2DQIL 1JGDB 4L9DA 2YD7A 2WM0A 1YMME 2DQEL 5FV1L 3HZKA 2H2SC 3VFGH 3S35X 1WF5A 3QG6A 4P4KC 4YNYB 4PJDE 4CKVX 3FN9A 3O11A 1RJLA 1ZLSH