1RULH

Crystal structure (d) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 5.6 with a data set collected at ssrl beamline 11-1.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
221
Chain Sequence
RVQLQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin igg2a, light chain
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 221
sequence length 222
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rulH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rulH01
5IW6B 1F45A 1XAUA 5IB5A 3WKNA 1OTSD 1X7QA 3OKNB 5D7KD 5GRZA 3ULUD 3IVKB 3SGJC 5ACZA 3T1FA 4XH2A 2C4XA 1V3KA 4LCCA 1F58L 2IAMA 4UT9H 4NWTL 5HI5C 3X13A 2EYTB 1IFHH 2J8UF 3Q6GH 4XGZB 2NY0B 5EBGA 8FABA 4PGDB 2AQ1A 3JUZA 3OKLA 4G9FD 1JPSH 5JDJA 1YN6A 4S1SL 3MCG1 5LGHH 4JVPA 4ZYKA 1GC1H 4NNPH 3B2UC 3H3KA 3QJHB 1B0RA 3BRGC 2OJEB 3C60C 5GPRA 4Y0GA 1YNTA 2ZUYA 1KENH 4AH2A 3CZFA 3MLUL 4LLQA 4C4KT 3PJSA 1CDJA 3O4LE 2J88L 2VXUH 3BEVB 3ZE1F 3ARBA 2DLEA 2WV3A 5EORH 4WW2F 4EIZC 1F42A 2CKBB 3SY0A 5FF6A 5GS0H 4DVRH 2BVPB 4WTZA 4QHKJ 4XAKD 2F54E 5ID0B 3LY6A 4L4TB 2BSSA 4OQTL 3VXUA 1FV1A 4OGAD 1IGTB 4H8WH 1ORSB 4FMKA 4RWYL 3HCVB 43C9B 3U46B 2EDEA 2UWEE 4JO3L 4P2RD 3PGFH 2FJGA 1UB5A 3O9WA 4LARL 3WXWH 4L8SC 1FL5B 1U3JA 3U83A 3NFNA 3UZEA 2PXYC 4C4KO 2IH3A 3D39B 1C16A 2ED8A 2E27L 4APQB 4B50A 2IH1B 1LNUA 5EU3B 4XXDA 5ITFB 2AERT 3FFCA 1L4IA 1CICB 1KG0A 3FOMB 5IIEB 1UADC 1WZ1L 3LRSA 2XKUA 4O2EA 5IJKA 4S2SA 3IJHA 2O5ZL 3DIFB 4BZ1L 4EOWL 5CBEA 1E6OL 5J7CC 4NN5C 1S9YB 2FGZA 2JJVA 5EC2A 1RIVL 4PG2C 4CMMA 5E6YA 5ITBH 1CLZH 4JKPH 5BJTA 1EPFA 3T2PA 1CE6B 2P48B 1XGRB 4M5YH 5EZLB 2CMRH 4AIZA 4J1UB 3FAWA 3Q3GA 3RZCA 3MGTA 3GHBH 2Z93A 3QNZA 4NRXA 3GNML 4MA1C 1TTUA 1J0JA 1WAAA 2VXSL 3KLAA 3OPZH 4J12A 4HSQA 6CGTA 3P2TA 1DQTA 1KPUB 1J0HA 2DQGH 5DJ6B 4P5TD 2VH5H 4OT1L 4PY7A 1WEJL 1KOAA 3RY4A 3O6MH 1KN2L 1QBAA 1T5XA 4LEOB 5EFIA 2NY3C 4RAUA 3BAEH 2EEBA 2GY7B 1TTFA 3WO4B 4G5ZH 3FO1B 3RWGB 5C3LD 2R2HA 2MSPA 1JRHI 1RUML 4P5KB 1M7DB 4MZ2A 4KWUA 2NY2C 1T6WA 4U1MA 2Z31D 4FTVD 4MLIA 4Y1AE 1CDBA 1CCZA 2AK1H 2I5YL 3V5KB 1QKZH 1ZHKB 2AV7A 1F6FB 3FZUD 5CP3A 5HVHC 2VIRA 5FKPA 3HZVA 4NO3A 1JNLL 4OLUH 4JRXE 4MAUL 3C6LB 2NZ9C 4NPYB 2CUHA 5C0BD 4JJ5A 3U1SH 3SDXB 5F9DC 1MJUL 4XVSL 3V4VL 2YD6A 3QEGH 4PJHB 1ZLUH 3C5ZA 1NCWL 5J13B 4ODWA 1D9KB 4KTDL 1HK6A 3SHSA 3PWUA 2DQDL 4NJ9L 3T04D 4Z6AT 2I07A 5K93A 4LLYB 3P73A 4OCSL 5ICXB 1A1NA 1R3LA 3I85A 4EKXA 3EOYG 5CEXA 5DMYA 4HJ0C 5C1MB 2IGFL 2B2XH 4M7ZC 1HQ4A 1WBZA 2YRZA 4IMLA 2YUZA 4MB5A 4GOSA 4D9RD 5CJOH 2FECI 1YECH 3STZB 4E41A 4J23A 3GJFB 1XCQB 3PWVA 4WIQA 5ICZB 3JBG7 4WUKH 2X05A 4GW5A 3W2DL 3B9EA 4GUPA 4N9GA 4KI1A 2EC9U 4YPGA 1KLGA 2VLLA 3ZKMD 1P2CA 4JZJA 3G5VB 4JKKA 4OIIH 1DLHA 1W72H 3TIDB 5DMIL 4GS7C 4OM0H 3LEVH 4KKBD 1KJ2B 1S5HA 3CH8A 1JPTL 1IAOA 3QHFH 4HWZB 1ZHBA 1NC2D 5JA9A 1UH2A 5DUMH 2AEPH 5KSBA 3TVMD 5I17B 1MELA 3CFJB 1AC6A 2CIIB 3ES6A 3NFPA 4OZGA 3MR9A 1H0DA 2ZSVA 5DMJB 4OZIA 4CNIA 4OLVH 4R0LA 4F8TA 4X4ZA 5INDA 4PY8J 4XPAH 1LO3H 1HOCB 2C9AA 2YPVH 3E3QC 1LEKA 5T33H 3ZDXE 2IPKA 1MLBA 4M9PA 3B83A 5E94A 1HYRC 3KG5A 5D7JA 3UJJL 3RJQB 2FX9H 4LVEA 2YPLD 5JW4R 3ZSTA 1UA6L 1N59B 2YKLH 5DJDB 4NUGL 5MP6H 2FB4H 5JTWA 1CDYA 2H45A 3BN9D 4QHMB 3GFUA 4WHTA 3ZTNL 1N2RA 4Y5YB 3GSXB 4XCCH 4V2BA 5F88B 2BVOB 1CT8B 1JGDA 4PGEB 4QXTB 2QHRH 1A64A 3RA7L 2B1AH 1TPXC 4ZSOB 2VDPL 1HE7A 1JNNL 5AWNL 2AJSH 3MJ9L 3MLTA 4HUMB 4DKDC 3ZKND 4P2OA 1INQA 3FQTB 5D2NE 5JHLL 3TNNB 1R0AH 2FEEL 2FO4A 4IRSB 1XGUA 2F54B 1DVFD 4FXKA 1IEHA 1DZBA 5EU6A 5HGGS 3V9FA 2P1YA 4ZO6A 4F15C 2YD8A 2UWEB 2CGRL 3LKSB 5SV4A 5EZIH 4OJFH 4UTAH 5IROA 4HQQH 3NGBC 1EAPB 4R7DB 4PLOB 5KSAB 1U8PA 4HMCA 5C0GA 3FT3B 3FB5A 1ACZA 3H3PL 4KUZH 3ALWA 3IDGA 1CGWA 4G6KH 1CDUA 5C70A 1NGPL 1VKXB 5L88H 4P9HC 3PV6B 3UYOD 4CJ1A 5F9WC 2EDRA 3QDJA 3V52L 4O5LH 1U3HD 4DN3L 1AIFB 4QRRE 4X98A 4O51A 3MA9L 4OF8A 1MEXL 4JANA 5F1IA 3IDJB 2SEBA 4Y5VC 2XQYK 1QBLL 1DN0B 4KTYA 4PLJD 1I85C 4HBCH 1OTTC 3A6OA 2VERN 4OCRL 3F12A 3GK8L 4Y2DD 2OSLA 5E0QA 2NW3A 4NP4L 2EC8A 2VLJA 5D1ZB 2BNUA 5GGTL 3T2OA 4N8VG 2HLAA 4JCLA 3HMXL 4JLRA 4C58B 4JQVA 4ZXBB 1A1OA 1D5ZB 4R7NB 1UWGH 1F8TH 1W0WB 2HFEB 4FZ8L 5FGCE 3R1GH 2IPUK 5J1SC 4MJ5A 1IQWL 5IEHA 4QNPF 4PB0L 3TBTB 1H3PH 3HC0B 2W1NA 4ODUA 3C8KB 2GFBB 1PEZA 2V2XA 3MV7E 4P46C 3GMMA 1J5OH 5EBLB 1XZ0B 2X2YA 4O00A 4JN1H 4LKXA 5KSVB 2ADJB 5JXAH 4LCIH 4YHOH 3BSZH 1QBML 3GI9L 1S7SB 4OGYH 5EWIL 35C8L 4Y1AB 4HK0A 4X8JB 1GGIH 1LK2A 4TVPL 3WBDA 4NKOA 4DCQB 3K2UH 4I18B 3VCLB 4XNUH 4UTBH 5MI0B 4BSVA 1N64L 4JRXB 1YN7A 1YZZA 1F4XL 3MV9D 3VWKC 2AXHA 1DJSA 3MLWH 3UP1A 4H8WC 2UZIL 2ERJC 5BW7C 2BSRB 4EQ2A 3PQYD 3Q5YA 3QRGH 3ZHLA 43CAB 4PFEA 2JK5A 1CF8L 3BKCL 5T1LA 1ZWIA 4O58L 1TDQA 1J0ZA 4Z7UE 1H15A 4WHYG 5E8OB 1ZA3A 1OL0A 2VDNL 3HZMA 3WLWC 2I26N 4FRWA 1FNGB 4OCXH 2PYEE 4JG1L 2VQTA 4MJIA 4LSVL 1VHPA 5FKAA 2VLRD 5JLZA 5IBTL 4OFDA 3VH8B 2P8MA 1U8MA 4CN1A 2IBZX 4M61A 3PWJA 5KANG 4OZHF 3DBXB 2XKSA 1N5AB 2FWOB 1FSKC 5EC1B 4I3RL 4BFIA 1BPVA 3I9GL 4ZNEE 1I9IH 4RMUA 2V7NA 4Y4HD 1S9WA 3EJZD 3RL2B 5ENWA 4DGIL 3BGMB 3SO3C 5J1AB 4YHNB 4H0HB 1M1SA 2HN7B 3HR6A 4KFZC 3CFEB 2FSEA 3K4AA 4Y4FC 3MA7A 4LSSH 3MRMB 4OI9A 4R90L 3X14A 3JTTB 4YDKH 4E0RA 4PJGF 1U91B 3RVWC 4H1LB 4G6ML 5E8NA 1IZJA 4TVPD 3HLAA 3VFOA 1B2WL 4XNYL 4X9BA 4NHCH 1J12A 1XF2B 3PDOA 4B0MM 1RMFH 4KTEH 4Y8AA 5HI4C 4KMLB 4AEHH 3QNXA 3C2AL 3W81A 4NJAL 3SGDH 3S6CA 2D4DA 1CXFA 5HGAA 1EBAA 2IANB 4WUUB 5T3ZL 4OD1H 1T7YA 4ZFFA 1G7MB 1X5YA 2QSCH 1DANU 5D2NB 1Q9LB 2OK0L 1EEUA 1SJHA 3O0RL 4WV1A 4IRZL 3LH2L 3VGGA 3MRIA 4OD3L 4N1HB 3CDCA 1T1ZA 4OM1L 3VD4A 3SKNB 4Y16A 5IK3A 4PGCA 5A3IC 1I8IB 5I1LA 2P5EE 4MSWB 3EO0B 5HDBE 3GUTB 1X4YA 4HWUA 1Q38A 3NZ8A 3CGTA 4KKCC 5HHVH 3MOQA 4GW1A 2QSVA 4MNGA 5D7LB 3BRDA 4HKZB 3VXME 5IBUB 1FNSH 2ADGA 4BQ8A 3IYLW 1Z9LA 1DBJL 3CSPA 3I6KB 4UAOB 1UJ3B 4LLVA 4N8CH 4KI5C 5BMFL 4HXAL 1PD6A 4DN4L 3TA3D 1CGVA 1JTTA 3WHE0 1HDMB 3ARTA 2DKMA 3LN9A 2UZXB 3NA9L 1BFOA 5C0RL 4QRRB 1CXHA 5DDHB 4N8VB 5DQDH 5K9KA 5EO9A 2EE3A 1F4YH 5FCUL 4YR6B 4KUCF 3VFNA 1JGEB 4JHWL 5I1CH 3QO0B 3LQAL 4KDVA 3BZEB 5SWQA 2AABL 3D3VD 5BVPL 3RIAF 4HJ0D 5DZOA 4JM2C 1T66C 5I73C 4U1IB 4UDTA 1D6EB 2GK2A 5F96H 5IEKB 5FHBL 5KTEH 2VISB 4DW2L 3OGCA 2ZOLA 5LWYL 2XFXA 3INUH 1HEZB 3K46A 5FGCB 1KLUA 1NCTA 1VACB 3FO9A 4MQXD 4WCYH 5BVJA 5J6GA 3AB0B 2GW5A 1ZE3C 1MAMH 5T3ZD 5E2UL 3O6LH 1QNZH 3BP5A 1OF2A 3MV7B 3G6AB 2OR7A 5GQBA 2V17H 3BUYA 4TSCL 1U92B 1C7TA 5EZJB 1DCLA 2Q3AA 3EW3B 1BFTA 3LEYH 4P2YA 2H3NB 2X89A 4ONFL 5IGXL 2DQJH 3SOBL 4FQCH 3RTQB 4JPKH 5IM7B 2BY0A 1EXUB 4LGPB 4NDMA 1OSZA 4J6RH 3SKUD 3G6DH 3IFLH 1J10A 1KPVB 5D7IF 3TV3H 2AJZB 1A7OH 5DF0A 5JXEC 4FFZH 2V2TA 4MXVE 2FJFA 2P7TB 2AS5M 5KZCD 2HG5B 3ILQC 3Q6GL 1TETH 1FPTL 5C86A 4DZBB 1M7XA 5B4MD 1LO0H 4R4BB 1JPSL 1MCRA 5DXWA 4PG9A 4JPWL 3VFVA 1JVKA 4GSDL 5IESH 3HI5H 1A22B 3LKQB 5DHYB 3GZKA 5D70H 1NGQL 1PZ5A 1JWUB 1M7IA 1MRFH 3QAZB 1GC1L 3MRHA 3DARA 1A7RL 1NCAH 4Z7UB 4KUCD 3QIWB 1JNHA 4EI5C 1BD2E 3IDMA 2PYEB 4QWWD 1HSAB 2DQUL 2W92A 1AGCB 1B4RA 1IM9D 3E6FB 3LKOB 3WS3A 1KENL 5GJSH 5JQ6H 5C07E 4JVUA 3DVIA 3CFCH 2QQLH 2VXUL 5D1QC 4WFFD 4Z7QE 2VZSA 4N0RA 3OJ2C 5EORL 3T77B 5D6DA 3SBWC 2BVEA 3D25A 2A1WH 1U3YA 2QQNL 2NY4C 4FQIH 4CAGA 5GS0L 5JZ7C 2LAAA 4G42A 4YXHH 1E4JA 1O7VA 5DD0L 4KPHH 3W11D 1ZVSA 5I0ZA 4HWBH 4YAQA 3AXLA 1I1RA 1Z0NA 3VFGH 1OT2A 3PGFL 1JNJA 5BQ7B 3ARWA 5JDSA 3LPWA 5ISZD 3WXWL 3BT2H 1AQDA 3L3JB 2ENSA 1A7NH 3LIZH 5CFHA 1HHJB 2A77H 4LPUA 3WHXB 2BY2A 1BQHA 1C08A 1S7UB 3IU3B 4YDLB 1UWEH 5DJZA 4IOIB 1MVFA 4Z7NE 5HYEA 5C6PB 1TZHA 1FDLL 4JZNB 5KG9A 3RNKB 2AQ2A 1GYAA 1EK3A 1LP9A 1F3DJ 3SE3C 5F1SA 3MJ7B 4HUNB 3R4DA 2IBZY 1UYWH 3TO2A 5IVZB 5E2VH 5JHDE 4JPVH 3L5XH 3QUXA 4ETYA 2C3VB 1FZOA 3ECBB 3IDIA 4XBGB 4WGVB 3MBEC 1CLZL 5E1AB 5ITBL 1Z0MA 2V9RA 4ELKB 5B8CB 3DMMD 1WIPA 1P4LB 1I4FB 3MFFB 4JFED 4XCYA 1MCPL 3K2MC 4ONHB 4ACPA 1G0YR 2UY7A 5FCSH 5DRNB 5DRXA 3TPKA 3OPZL 2R69H 1CFQA 4FQQB 4P4RB 4F33B 1N0LA 2VAAB 2P5EB 3T0DA 2DQGL 3MCKA 4HUWB 2VH5L 1FVCA 4JFYB 5E5MA 4ZUTB 3RY6A 1MCDA 3O6ML 3DX8A 3E6HB 3VD3A 2R56H 4KHTH 1ZGLM 1RPQA 3VXMB 5GS0D 3HE7B 3BAEL 3VFWB 1A8JH 3P3YA 1P7KB 5C0FB 2B5IB 2CO6B 4PD4J 3AROA 2FLRT 3CU7A 3QIBB 4PJXE 2KPNA 3VWKD 1JZ3A 5IKCB 2WNGA 3F58L 3QG7H 3EO1A 1W2KT 3FT4B 1UEYA 4EN3C 5IWLA 3ZDYE 3NCYS 4XMKH 2AK1L 1MY7A 1QKZL 5FYKU 4ISVB 1NFIB 3QSKB 1KTLB 5IB2B 3U79A 1IGJA 1UB6A 2DTSA 5KVEH 4OLUL 2R0ZL 5I75C 3ZLQC 3TT3H 3U1SL 2RFXB 3HPLA 1JL8A 3GKWH 1MWAA 5D96B 1A6TB 1QFPA 3QEGL 1BAFH 4NBXB 2EDDA 1F11A 2YC1B 1URLA 3VU2A 4JGMA 3VD5A 1CG9A 4IDLA 4JFFE 1Y6KR 1E27A 3KLHD 4X6CA 2AEQH 1YMMA 1DE4B 2BNRA 5EB9A 1UXSA 3QEHA 4LAQH 5I19H 2B2XL 5I6XB 1SYSB 3MV8E 5C0CE 5BO1H 3KXFD 4A6YA 4RGMB 1YECL 4UT7H 4UI2A 4L3CA 1V3JA 2BC4A 3TZVC 4WUKL 3O8XC 4UOJA 2D7QA 4NNXB 4MAYA 4D0CA 3ARDB 3TBVB 2AKRA 5IFJA 3ROLB 3HG1E 2VXVH 1PQZA 4OIIL 3PGCA 4Y4FD 1TTGA 4G8EB 3QQ3A 5C0BB 1R3JB 3MC0A 4OM0L 3B9KB 3DYPA 5C0AD 4X5XB 1TJHH 2GSGA 3QHFL 4GQ9H 3QUZB 2IMNA 4K71B 5CJXC 3KPOB 1RAMA 3QQ9C 1QSFE 5DUML 2AEPL 3KS0J 3V7MA 1OP9A 4KJWC 3RHWF 4YK4B 2VAJA 3U9UB 1GAFL 4OLVL 1IZKA 4BQ9A 1F6AB 4FQXD 5SWZA 3X12A 4PJBA 3LV3B 1LO3L 2YPVL 1JV5B 3TO4A 1A0QH 3MPCA 3VGAC 3G04B 3S7GA 2JCCA 4OZ4A 5IOPA 2GAZB 5DEZA 2FX9L 5E6ZA 2X9WA 4MVBC 1BOYA 1BD2B 4U6HA 5I2IB 3WLBB 5E08H 4HEME 4UUJA 3MRGA 2YKLL 5T3XE 5MP6L 2FB4L 4IM8A 5F44A 4ZFZA 3V4PH 2MJWA 1Y18A 5CJ8A 3GBLA 4G3YL 1X3DA 3SCMB 4XCCL 4MJ6A 5C07B 4CW1A 1CFVH 3CLEH 4RMRA 2QHRL 4NCDA 4AENA 5A3ID 2A73A 2B1AL 3BQUC 1FO0B 3CH1A 4BH8B 4QLRA 4MDJB 4OAWB 1NBVH 2AJSL 1G6RA 2OZ4A 5I1AA 3BW9B 2IAMD 4KKCD 1QRNE 1G9MH 5CSGA 3BX7C 1ZHLB 2VOTA 3ARPA 5DEGA 5I1JH 2G2RB 3N50A 3R0MA 5EOCH 3S35H 4KI5D 4Z8FH 4NQDE 2DQFB 5F97E 1JYNA 2UYLA 5EZIL 2ICWI 4JY5L 3DURB 4UTAL 2FHCA 5DLMH 4HQQL 4HV8A 3QDHA 2Z92B 4HGWA 1W0YT 1NEZG 3GJEA 3FAXA 4JRYA 4GKNB 1ETZA 3LMJH 4R3SA 2F19H 5JW5B 1AHWA 1EHLH 5IW6A 5LJYH 4KUZL 3TH3T 1WAAF 1FVDA 4DOHE 3IVKA 5L88L 1T20A 2BCKB 2N4IA 4WENB 5AYQA 3OAYH 1S8DA 3VXSE 4O5LL 4C56E 4OZFG 1IQDB 5JPNB 4GAYB 1ZAGA 4XCFL 4HFWB 1WWBX 1L6XA 3NBNA 5LAXB 4XGZA 4RGNC 2OP4H 4PGDA 5BCAA 5JHDB 5HSFA 3KAAA 2K7QA 5CUSL 1T0MB 2ILLA 5DEFB 5EUOA 4PRIE 3REVB 1ES0B 4LFHD 3V95A 4LCYB 4XP5H 2GHWB 3QJHA 1ZLVH 2MTPA 2OJEA 3O9WD 2X10A 2WK2A 3VI4E 1MCCA 1F13A 1FYTE 1UWGL 1F8TL 1VFAA 5EO0A 1Q8MA 3R1GL 5CWSB 3HUJA 2HJFB 5SX5H 2UUDH 4WI2A 3FFCD 2LABA 5ESQB 2CKBA 4KROB 4WTXA 5HHOE 5ACMA 1J5OL 3V7AG 5TPWL 2BVPA 3BKMH 3ARZA 4JN1L 5DJAA 4WFGD 4ZPTA 5ID0A 3VRLE 4PJXB 1OLLA 1YEGH 3OHXB 4L4TA 4V1DE 3WIHA 5JXAL 3ILQD 4LCIL 4YHOL 1I1AB 4B5EA 1ORSA 4OF0A 43C9A 3U46A 2E5EA 4N9OB 4OGYL 4HAGA 1QHPA 2FLBT 1TENA 1FL5A 2VKXA 4X83A 5AG9A 5C8JB 3K2UL 4XNUL 4UTBL 5SX4I 1RJYA 2YSSB 5EIVA 1MCQA 2IH1A 3MODH 1MCHA 5L2JA 4L8BB 5EU3A 1I1YB 4IEFB 3MLWL 5ITFA 2ESVB 4QT5A 2J5LC 5F6IB 1PYWB 5IIEA 4LRIC 3QRGL 3O2WH 2NY5H 5J9PB 4JFFB 4XBEL 3ARYA 4WJ5A 4LDOB 2LE9A 2VZUA 2WINB 3QPQD 3UBXI 3GSWB 5HD8D 2KZWA 4BA8A 3V8CA 3MTRA 3KPRE 5KSBF 1MAJA 1JK8B 4OCXL 5JZ7D 4K3HA 5K9QI 3O45A 5T5NG 4HULB 4OZGF 4OZIF 2HTLD 3MV8B 5C0CB 3SDCC 1CE6A 1XGRA 1TZIB 4I8DA 1EA9C 1IBGH 5F8RC 1YJDC 3K81A 3T3ME 2DM3A 2K9UA 2XXMB 4J1UA 4L9LB 2LU3A 3HAEH 5C09A 3R8QA 1CYGA 1K2DB 4M7JL 2Y5TB 1NDMB 4JE4B 3V5HB 1MCSA 5J89A 1SBSH 3HG1B 2APXA 3C8HA 1QVOB 3W0WD 4QRPD 4LCWE 2YD9A 1X5JA 3C60B 3MUJA 1H5BC 2WANA 5I30L 2ED9A 3VMOA 1AI1H 4LEOA 1QSFB 3I6GB 2D2OA 3BD5A 1G6RH 5L8JB 2D4FA 5B38G 1NUDA 3FO1A 2ORBH 1QQDB 3RAJH 3RWGA 3QEQA 1JE6A 4LSSL 4JO2H 1M7DA 4M00A 4LAJH 1A2YB 2P4AB 1WT5A 5D1XC 3IGAB 4YDKL 5IW1B 3V5KA 2C7UB 1J1OH 1A21A 1ZHKA 1ZGLP 2H2PC 4IRJA 3ZDZE 1AGFB 3SKOA 2R2EB 4NHCL 4U1KB 1IVLA 2EYRB 4X7SH 1RMFL 1XIWA 5EUKB 4KTEL 5C0DA 4F9PC 4L8SB 4AEHL 4AQ1B 3KYNA 1RZJC 2PXYB 2VLMD 5FYKE 5HHXL 4EJ1C 1G9NH 1RURH 3FFDA 4XMPL 1S7QB 4JKWA 1F3RB 4G8GE 2O5XL 4WRLA 1D6VL 1EEZB 1QRNB 4LLYA 4WWKB 5DHXB 5ICXA 4GBXC 1IGIH 3MX0A 3TCLB 2D31B 5IVXE 4XVJL 3H7BA 1QSVA 1SJVA 4H88H 2VUYA 4NN5B 1ZOXA 4NCC2 3STZA 3GJFA 1HCVA 1NKOA 1XCQA 2ZCKH 4JR9H 2A9MH 4ZS6D 5D7JD 5ICZA 3TBYB 5HHVL 4YDVB 4F37F 4HK3J 2P8PB 1CL7I 4KDTC 1T7XA 2IQ9H 2LAGB 4DOHB 4N8CL 3AVEA 4KK6C 3B8YA 4MA1B 1KJ2A 3B3IA 3IKCB 3VXSB 3GGWA 4C56B 2P45B 4AQOA 4HWZA 1CDGA 1IGMH 3N85H 3RZWA 5I17A 3ULVH 4HUUB 5ILTL 5DQDL 5LVEA 2CIIA 2W0PA 5TQ2H 2CKBH 4I9WE 4P2OD 1KYOJ 1SJEA 5I1GH 1OGAE 4ZTOH 2F74B 2M26A 5HPOA 1HOCA 2XOTA 4I13B 2NY3B 3LEXB 1J8HD 3WIHH 5I1KH 4DUVA 4W81A 3MRPB 3IDUA 3OL2A 4QHNB 5LKNA 2PTTB 5F96L 1N59A 5DJDA 5KTEL 1DLFH 5IQ9B 2NY2B 1FYTB 3RPIA 3DECA 4QHMA 4MA8H 5LBSL 5ERWB 4HG4K 3RKDC 3RVUC 4Y5YA 4WCYL 3GSXA 5F88A 3IXAA 2BVOA 1CT8A 3ZTJG 1MAML 4PGEA 3QUYC 1WC7B 3MROB 3O6LL 1LVEA 4ZSOA 2OJZH 3WKMH 1FFNB 3V6OA 4C59B 2B4CH 5F7EH 4GXVH 5HHOB 2IQAB 3QDJD 1ZKAA 3FQTA 4ODTH 2V17L 3TNNA 3KYOB 3LEYL 4HS6B 4IRSA 2F54A 2ADIB 1G7PB 2RBLA 2DQJL 3BXNB 3QQ9D 2EDYA 4AMKH 4FQCL 4JPKL 3TGXA 2B0SH 1DQDH 1V3LA 1JBJA 1BMGA 4OKVA 5EOQH 3LKSA 5F9JB 3HC3H 4UOW1 5H94A 4AYFA 3G6DL 3VGDA 3EOTH 3U4EB 3TV3L 4R7DA 1A7OL 5KSAA 4N0FB 4M7ZB 1G9MC 4FFZL 5JMOC 5DFVD 2CDGB 3GSVB 4LSRH 5C0EA 4KVNH 3VJ6B 1TETL 1B0GB 3W9EA 4K3DH 4IOFC 1LO0L 4PJEB 3JZ7A 5IESL 3HI5L 5C92A 3QBTB 3TJEH 4J2XA 4PRHB 5H2BA 1HZHL 2CRZA 5D70L 1MRFL 3NACH 1AIFA 4EVNB 2HTKC 1C5DB 1GZQB 1NCAL 2QHLA 2VWEC 1MVUB 3BQUD 4WHCA 3BKYL 2DI9A 1DN0A 1UCBL 3KPRB 3MGOA 4Y4KC 3IRZA 1C7SA 3KPLA 5TGBB 3T8XA 3KYAA 4HIEB 3L3OB 3C09B 3L3HB 5D1ZA 5GJSL 3HMWH 5JQ6L 4HIHB 1S9XA 1G7LB 3L7EB 1WIOA 3CFCL 4HAFA 4CVXA 2QQLL 1XF1A 2WWKT 2OYPA 1CFNB 4R7NA 3IB4A 2A1WL 1W0WA 4KC3B 3EGSB 5DC4B 4YXHL 3F6IA 4KPHL 4LCWB 3HC0A 1F00I 3OZ9H 4AT6A 4HWBL 3C8KA 5AZEL 2A6IB 4UU9B 2R8SH 2BFVH 1BVKA 3DROA 4NGHH 1XZ0A 1XT5A 5FHAL 2O93L 4KJQC 2NTFA 3BT2L 4OF7A 4NYLB 2ZNXA 1CXEA 4P23C 4P48A 5KSVA 4LVHC 1A7NL 4UILL 3S37X 3LIZL 1HHIB 2PN5A 1A14L 2A77L 4JFHD 3VW3L 3GIVB 1UWEL 4NM4H 2WWKO 3JWOH 5SWSE 4Y1AA 2JJSC 4MJID 4X8JA 4M4PA 2BK8A 1T0NB 3QEUB 5DSCB 1T04B 2DMBA 3RU8H 4I18A 3VCLA 2P24B 4DCQA 1MFAH 4F15B 2OMBA 1BZ9B 3GJFH 2GT9B 2QADB 1RULH 1QUNA 3VRIB 2B20A 5TJWK 3NGBB 4NN6C 3VD9A 2BSRA 5E2VL 1U8IA 4JPVL 3L5XL 43CAA 3FO2B 5KVDL 3TYFA 1KJ2H 4N0UA 3EUUA 2EDLA 1FE8H 2B1HH 5E24E 1FNGA 4L3ED 2NX5E 4YEFA 2EXWD 1JGLL 5DJ2A 3NCMA 4BSJA 1ED3A 2R69L 1HH9B 2W07A 1T0PB 2BNQD 4Q9RH 2H6PB 5DC9B 4Y5VB 1TQCC 3D18B 1S9KC 3C6SB 2NY5C 1K8IB 2NZIA 3F7QA 3DTXB 3WIFB 1NBYB 4CVZA 1KLFA 1QD0A 2R0LH 2R56L 5KS9B 3BZFA 1NL0H 4U7MA 2FWOA 4Y19E 5EC1A 4XHJC 1R3HB 3CX2A 1OD7A 2C4FT 1PW3A 3QI9B 2A6JB 4Q2ZB 4NQXB 3RL2A 4AEIH 3BGMA 4G6AD 1YA5A 2ATKA 5ELIA 4XMKL 2HN7A 3BIKB 4HKBB 3RWHB 3GSNB 1U8NB 1LK3H 2YUXA 2QBWA 4D9QD 3R06B 1DBMH 2DWDB 4P46B 3MRMA 4TYUA 5DURB 3S3PA 1MCBA 5GGVY 1HHHA 1WJ3A 5DJYB 1FZJB 2GK0B 3SE4C 4H1LA 2BDNH 4Y16D 3RUGE 3OKKB 2DYPB 1BAFL 4LFHG 4XXCA 1RI8A 4NNYB 1XF2A 4FS0A 2W60A 1V3MA 4S11A 3TN0C 3U0TB 3AM8C 1EV2E 2AEQL 1J1PH 1Q9OB 2JJTC 3FQNA 2IANA 4WUUA 5DI8A 4PJ9B 3HZYB 4LAQL 5TDPB 1G7MA 3A0OA 5B3JE 5I19L 4WFHE 1W8NA 5E8DH 1AGDB 3H3BC 1UKQA 4GKOA 4XX1G 1A6ZB 2H2SC 5BO1L 2EIBA 1Q9LA 2AQ3A 5D2NA 3OXSA 4QF1B 2ERJB 4UT7L 4J3OC 1O7SA 4S1QL 4I0PA 2ZUQC 1G7QA 5E7BA 1QSED 1EO5A 4G8IA 3HE6C 3SKNA 3CMOH 2H1PH 4P9MH 3P0VH 2VXVL 2ZJSH 3AGVA 5D72H 2NLJB 3M1BB 4MSWA 3GUTA 2KZ1B 4DAGH 2AK4B 2BVYA 3QT2A 3O3BB 3PL6A 5D1XD 5C3TA 1EEYB 5IT2L 2OTPA 5D7LA 1U93A 1TJHL 5FM8A 4GQ9L 1FL6B 5DD5H 2XZZA 3TFKC 4QHLB 3FHQA 4LSPH 3UJIH 2ICWB 4X6DE 1UJ3A 1GCFA 1HNFA 4FFVC 1V5JA 3LN5B 5C0NC 5LQBL 1CD0A 4X9FA 4NQCB 2XQYG 3NIDE 4KRPD 2DOCA 3W9DB 4Q6IA 1DQQB 1FSKB 2ARJB 1FG2A 5L2KE 1FC2D 5DDHA 4N8VA 1U8LB 2HP4A 3JUYA 2RIKA 1JGEA 2MKLC 5E08L 1NBQA 4TSAH 4NO5B 3QO0A 1YEIH 3RWDA 3UTSB 3WUWB 3BZEA 4BJLA 3SO3B 3BHBB 3V4PL 3D69B 4GBXD 1IC4H 4U1HB 1YEKL 2FL5B 3QCVL 5HJ3A 1CFVL 1D6EA 3CLEL 2B7DT 2YN5A 2FEDD 2W9LA 3ULVC 2VISA 2A9NH 3D2UB 1SVZA 4YDIH 5GGQH 4MD5B 4LASH 5DD1L 2YUVA 5L9DH 1KCRL 1LP9F 3OB0K 5FV2A 4JEGB 1KBGH 5I1JL 2J8UE 1P4IH 4N5UA 3QZWG 3MRCB 4JKMA 5BZDA 1H3VA 3MV7A 4HJGB 2ZUSA 2J2ZA 3S35L 4KK6D 3KPMB 2XTJC 5TH2A 3MLXL 2F5AH 1SMOA 5DLML 2AJ3B 1OTUC 2H3NA 2GUOB 2YD3A 4Y8DC 3NA4A 3S97C 3LMJL 3SO5A 5E5RB 2F19L 3RTQA 4IHOA 3T3PF 3KNBA 5IM7A 1AD9B 2XA8H 5DZLA 1E4XI 4Z95L 4APQC 5IB3B 4HHAA 5DGQA 1YEEH 4XCNA 1HKLH 3BJ91 1CICC 4YHKH 1KPVA 4WFED 2GJ6E 4TTDD 2P43B 3CLFH 4QHUB 4RAVB 1F3DH 3L95B 4U4BA 4YO0A 5ESVB 3OAUH 2HG5A 1PLGH 4NZRL 3ZE1E 4Q0XH 4Y5XA 2OP4L 4K94H 4R4BA 3MRQB 5GGRB 4G6JL 2WP3T 3TBSB 1X5XA 3RKDD 3RVUD 3FB6B 3LKQA 5DHYA 1MQKH 4AIOA 3EDDA 3QUYD 4Z7UA 1NJ9B 3L9RA 3H9ZA 4XP5L 3MRRB 4GG6E 4FXGA 3OKYA 3AU1B 2DWEA 5DUBB 5FXCH 5EULV 2NX5B 4G80A 4FTVE 2GQHA 4KQ3H 4ONGH 3WFCH 5DS8B 3DUHA 4L29A 3RI5K 1AGCA 1R6VA 3E6FA 3WJJA 1HXMB 3B5TA 3ARGC 5CP7B 3E0GA 3UBXB 5J0BA 5J1TC 4JO1H 1QPPA 4PTUB 3WE6A 3CSBA 4JFPB 4L8DB 4ZG1A 4Z0BH 4GAFB 4YXKH 4H1LH 4XI5D 4EDWL 1MWAL 3T77A 5I74C 5L8LB 2QL1A 2FBOJ 3FTGB 4JM2B 4RA0C 2WP3O 3GBNH 4WNQA 5I73B 3WO4C 3VFPA 4XPGH 4JFDE 3ARRA 4ZNEA 3NTCL 4GRMB 1YEGL 4X6CF 3G08A 1IAKB 1NCNA 5I8EB 3V6FB 1RK1B 5DK2B 4IOFD 4Z7VE 3Q5OA 4NZTH 4LQFH 3QUXD 4G43A 1EFXD 4NN7C 3VMNA 4OSUH 3L3JA 4A6YL 2H41A 5GGVH 1NANI 4KJYB 3X3FL 3C6LC 3WHXA 2CQVA 4Y88A 1QP1A 1KCLA 3CX5J 3IU3A 1S7UA 3LQZA 4J4PC 3H9HB 3DO7B 4IOIA 2XKNB 3MODL 1FFOB 4QOKD 3WNOA 3S8WA 3RUGB 2F53E 3H42H 2Z91B 2VLKD 5J13C 4RWHA 4JZNA 3RNKA 2X4RB 1D9KC 1IAIH 3O2WL 1TCMA 4L4JA 4U1JA 1TQBC 2NY5L 1N6UA 3BWAB 2FBJH 1VENA 1PG7X 2W65B 4LU5H 1X5FA 5GRVL 4OB5H 3P4NA 4GRLC 3DVNA 1OCWL 3JWOC 1BQSA 3TT1H 3QXVA 1FZMB 3ECBA 4XBGA 5CZVH 4QY8B 5IMKA 1IGYB 2EDWA 4PJBF 5INCB 3F7VB 1IBGL 1P4LA 1FGVH 1KEGH 2PETA 3MFFA 1Y6NR 3ZE0E 2R2BB 5FGRA 2JCCF 1OOAA 4ONHA 2C1PB 5DRNA 2EO9A 2ITDB 4KJQD 4JFXB 4UIMB 4CGTA 2GTZA 4FQQA 4P4RA 1BP3B 3AUVA 5CHNB 4F33A 1RUAH 2VAAA 1ZLSL 1Q72H 4EI5B 3FO0H 4LIQE 3L5WB 4HUWA 4BFBD 1LE9B 4JFYA 4ZUTA 4HMEA 1PKQE 2IALB 4WI3A 3W5NA 1MCOH 4S1RL 3E6HA 1UQSB 2WBKA 1AI1L 3VXMA 5CJ5A 3VFWA 1P7KA 4X6DB 1G6RL 5C0FA 2BOCA 15C8H 5D1QB 3IAGC 3QIBA 4YX2H 1G1CA 2ORBL 3RAJL 5KW9H 5IKCA 1H3WM 32C2B 4JO2L 2QEJA 4NRZB 3LKNB 2NY4B 4LNRA 3FT4A 5J11C 5L2KB 3UYRH 2DICA 1LO2H 2NY7H 4AZ8A 3G5XB 5IHUH 3S98A 1L0QA 1AXSA 3SQOH 4ISVA 3V5DA 1KNOB 1NFIA 4KK5C 3VXRE 2ZPKH 1KTLA 4K23H 3JXAA 5IB2A 3VGBA 4FN0A 1KT2A 1HWGB 4X7SL 2RFXA 2NXYC 3B9VA 3SGKC 4ENEC 1GZPB 4TUOB 3RX5A 1A6TA 1AY1H 5HGHB 4P5TA 2YC1A 3T1WA 1G9NL 1RURL 2CLRB 5HTSA 4K8RC 3IETA 4MCYA 4R26L 2WM0A 2Y23A 3D6GA 4YBQC 2DKUA 5IG7A 3ORJA 5GSRB 1NGXB 2J8UB 4ZO8A 1IGIL 4NHUB 1A7PH 1MJJB 5SWZD 3PABB 4FFWD 4YFLI 3AY4A 4D0BA 5CINH 4H88L 1RJLB 2UVEA 3HI6H 3K4DA 5FUCC 2Z31A 4HCRH 3B9DA 5EUOF 3HB3D 2ZCKL 4JR9L 2A9ML 1KTKE 3QIUC 5DHVB 1YNLH 5FIEA 3U7WH 1U6AL 3MBEB 5FM5O 3ARDA 1QR1B 1FJ1B 1FN4B 4X99B 3TBVA 3W39B 3EJYD 3ROLA 5T5FH 4BUGA 1AP2B 4G7VH 4G8EA 2IQ9L 2WZPD 3K0WA 3JVGC 5C0BA 1D5BB 2GJ6B 1T83A 5IP4A 3HUJF 3ARFC 1B88A 1NCBH 3N85L 3KPOA 5DTFB 4U3HA 1EERB 3UTTD 5TQ2L 2CKBL 2X4QB 3U9UA 5H37H 1TVHA 5HHME 1F6AA 2Y7QA 1Z9OA 2HT2C 4YHIB 2X1QA 2MMXA 2GY5A 1JV5A 3BGFB 4I1NB 3SN6N 4NZUL 3G04A 3WIHL 2W0KA 1Z3GL 5I15L 2GAZA 3MBXH 3VXPA 4GG6B 1CBVH 2CJUL 1BD2A 5CZKA 4Z7OE 5I2IA 2IBBA 4ZXBC 5F7NC 1DLFL 4ZO9A 5JR1H 4EN3B 4R4FH 3EYVB 4JRYD 1I7RB 1I8LA 4J3TA 4MA8L 3CDGA 4G7YH 4PJDB 3SCMA 5C07A 3NFSL 1QFWI 3TC9A 2CUMA 1WITA 5I71C 1JMXA 5ADOL 5I75B 3JV5A 3WKML 5L0QC 1FO0A 4BH8A 4OAWA 5AZ2H 3WJLA 3TBWB 1EHXA 2B4CL 5E4EC 3LKRB 5F7EL 4GXVL 1KCSH 3P9MB 3BW9A 1FL3B 1JRHH 4U0QB 3LB6D 1VB9A 4JFDB 1P1ZB 3GSOB 2X4SA 1KXTB 2NY0D 1UXWB 3TFKD 3L3IB 4J8RB 2B0SL 4Z7VB 1DQDL 5JW4N 5EOQL 2DQFA 3KWWB 2HRLA 3HC3L 5C0ND 4XPBH 2YRPA 2OL3B 3DURA 3EOTL 3OG6B 2Z92A 3G5YA 2VZTA 2JIXB 3CXDH 2VLRE 5D5ME 1BOGA 5JOPD 5ABDE 5JW5A 1KTDA 4LSRL 4HGKC 5CLTA 3HKFA 1J7VR 3KPQB 1AH1A 1WUNT 1WICA 4K3DL 3TZVB 2F53B 3O8XB 1HI6A 3TJEL 1IQDA 3NACL 5JPNA 4GAYA 5I8CA 3P11H 5CILL 4N0CC 3ULVD 3U82B 5LAXA 1EJOH 1LHZA 1S7WB 4F58H 2E6PA 4WEBL 5EG6C 4Z78A 1WFOA 4UT6L 1MRDL 1FCGA 3NABL 4DQOH 2IPTH 1CFTB 3OKDA 4M7LH 1T0MA 4G6FB 5DEFA 2QLVB 4L4TD 2D3VA 4ZOEA 3MXVL 4X5WB 3REVA 4Q97A 3HMWL 4PJAE 4LCYA 4HUKB 4QRSB 4KK9C 1BX2B 5KVFH 4F7MB 3QDME 3VGAB 1OTUD 3JWDL 1D5MB 3FRUB 1S7XA 3D39D 1FAKT 2HJFA 2YA0A 4APQD 3QXUA 1PKQB 3OZ9L 1LD9B 1XGQA 3NPSB 1K3IA 1CICD 5C0IB 3GSRB 5ESQA 2R8SL 2BFVL 1NFDB 4NGHL 4ZFOB 3FL7A 4WEMB 3GIZH 2X40A 2AI0H 2E7LA 4XB7A 4XNMA 4YHPB 3OHXA 1KPRB 4CRPA 1NUNB 1PEWA 5HHPA 1JHKH 4NM4L 4F7PB 2Y06L 3ZYJA 4GAGH 2EDHA 4Y2DA 5KJRH 5EIQA 1L6ZA 3VXRB 4EDXB 5C8JA 2WIMA 3N1GC 4BK5A 1MFAL 2VMFA 2FHFA 3TWCH 1IAIM 1PAMA 3FN0H 5EIIA 1MAKA 1RULL 4L8BA 1J05B 2B8OT 5DRZA 3RGVC 3O3EB 3TJHC 4OZHE 1XCTA 2ESVA 4Z76A 1PYWA 1A4JB 3S4SG 4LCUA 1CDHA 5C9KA 5J9PA 4JFFA 1KJ2L 3UXFA 1M05A 5JA8B 2KH2B 2WINA 2CPCA 3FB8B 3MJ9A 4FZEH 1DL7H 3SGJA 1FE8L 2B1HL 3VE0B 1A4KA 2AJYL 1AQKH 4OIBA 1JK8A 3B43A 2EIEA 4YIQB 3VXQB 4KJPD 2WIIA 3BH8B 3PWLB 1PZUB 3MV8A 5JIHA 4BZYA 5C0CA 4DEPB 4Q9RL 4RGNB 4NC0B 3TNMB 3UTOA 1DBKH 1K4DB 1K2DA 2CRYA 5C7XL 4DVBB 5EU4B 3UTZB 3D3VE 2Y5TA 2IMMA 1HINH 1NDMA 4PJGE 3V5HA 2ICEA 4PYHA 1NL0L 3HG1A 1LEGB 1WBXA 3C6LD 1QVOA 3SJVD 3BD3A 3MV9A 4CADB 2OTUB 4YE4H 3DVFA 4J4PD 2ITCA 1OPGH 3CXHK 1ZA6B 2CSPA 3C60A 2YD7A 2P8LB 4GAJH 4AEIL 5BRZB 1BZ7A 3PQYA 2BSTA 1YEDA 3EYSL 4DKEH 2GTWA 3I6GA 2I60H 4LKCA 5CEYA 5T3ZE 4U7KA 3MNZA 3QFDA 4NQUA 3S5LG 1D9KD 4CMHC 5MEQB 4RX4A 1CZ8H 5HHMB 5E2TH 1F4WH 1QQDA 5GGUA 1JGUH 1DBML 5BOZG 5TDNB 4GRLD 1Q1JL 1A2YA 1A3LH 2D7NA 4OLWH 2X7LB 4JKLA 3WFHB 2C7UA 3VDAA 4NO0B 2VL4A 2BDNL 2UWEF 3OF6D 5DT1H 3KPSE 2F8XC 3QULA 1AGFA 1GGCH 3OGOE 4HUVB 4MNQB 4U1KA 2EYRA 5C2BH 3O6FB 4MA3A 5EUKA 2EDBA 4U1LB 2VN4A 1JHTA 4L8SA 4NQEB 4YWGL 2HWZH 1KULA 5E6IB 3T0EE 1XF4B 2AEWA 2YD1A 2PXYA 4PJ7E 1BQHG 3V0AC 5E8DL 1Z6JT 2AJUL 4NRYB 1EEZA 5E03A 3V79C 3MRLB 4OGXH 4JGUA 2J5LB 2VXTH 3P30H 1P6AB 2BY3A 3OWEA 2Q76B 1JPGB 3IDXL 4GW4B 4O02H 5DJ8B 5IFAH 2X1OA 2P5WE 3C87A 2H1PL 3I50H 5CGTA 3P0VL 2VWEE 4ZAKB 2ZJSL 5D72L 4K2UL 3O2DH 1OSPH 4K9EH 1A3RH 4DAGL 1F97A 4PG2A 5HYIA 5D5MB 4YDVA 4ODBD 1OAZH 2P8PA 3SDCB 3T2NH 5DD3L 5DD5L 4KK5D 2NTSP 3N1PC 4QCIB 4LSPL 2V5YA 4HXBH 4XP4H 1N0XH 1SYVB 3VXSA 4ENED 1KEMH 4C56A 4MXQC 3V0VB 3BP6A 3WMSA 3O4LD 3IJSB 2FJHB 5CMAB 4HUUA 5C9JB 3QIWC 3RQ3A 3G5ZB 4HT1H 1H5BB 3I75B 3RPKA 4H5SA 5KOMC 1A5FH 5L7XL 3B2VL 1YEIL 5D93B 4IRSD 3L7FB 2F54D 4HJJH 4YBQD 3SDAC 5HYQA 1ZS8B 3LEXA 1B6DA 1B4JL 1IC4L 1HHKA 4PJAB 1JF1B 3OG4B 3N1FC 4NFCA 2R1XA 5I1EH 1MHHB 3VI3E 1RV6X 2FZ3A 3GRWA 5AAWA 5IQ9A 4P59H 3QDMB 1FYTA 4O2FA 2JE8A 4I5BB 5D7IE 5KSAD 5GGQL 2HH0H 4LASL 3DVGA 5L9DL 4I3SH 1KBGL 5FYJL 1P4IL 2FO1A 1WC7A 3I3EA 2ZOKA 5F7UA 1OAYH 2L4OA 5B39B 4L5FH 5HHOA 2IQAA 2MPAH 2O5YH 5HDLA 1H3TA 3GMLA 3KYOA 1Z9MA 2F5AL 4J3UA 4NM8H 4RGOL 1PG7H 4HS6A 3KYKH 1GSMA 1G7PA 4OCMC 5GISH 3RVTC 1TZGH 1QLEH 4YDLC 1JIBA 2XA8L 4KKLD 4JFEE 1T5WB 2DM2A 2A2QT 3IS1X 1YEEL 2HT2D 2Q6WA 1HKLL 1OWRM 2E9WA 4YHKL 3S4SB 2OM5A 2E8YA 1DBAH 4RQQA 5F7YC 5D1ZD 1ZT1B 4J7RA 4N0FA 3QXTA 3EYFB 5A2FA 2CDGA 4WEUD 2H32B 5KVGH 5GS2H 4ZXBD 3OAUL 3VJ6A 3IF1B 4S1DD 4ZTPL 1B0GA 4S10A 3HS0B 4JREC 4OZHB 4Q0XL 2MOVA 4LRNH 4K94L 1K3ZA 1F5WA 4PJEA 3FOLA 1U8OA 1A6AB 3CSYB 4PRHA 4IIQB 1MQKL 4AEEA 1NLBH 4NQSB 1MLCB 3KJ4C 5B8CC 1C5DA 1GZQA 2W0FB 1MVUA 4B53A 2R9HD 1V7NH 3MREB 2CIKB 3O4OB 3RNQA 4KQ3L 4ONGL 5CSZA 3WFCL 5DC0A 4LLMB 3F7YA 3O3DA 5TGBA 1RZGA 4HIEA 3L3OA 3L3HA 4HH9B 4JO1L 1ZT7B 1YC7A 2ADFL 4HIHA 4DK6A 1G7LA 3L7EA 3E8UH 4Y1AD 1IC5L 4PJCA 3ALXA 4Z0BL 5E00B 1AR1C 1JF5A 4X80L 4PJGB 1CFNA 1NAKH 3HAEG 2WW8A 2PW1A 3HNSH 3HE7C 3K8MA 2DDQH 3GBNL 5T3XH 3BYTA 3EGSA 1HQRA 1YMHB 2B5IC 3MZTA 4JRXD 3D85B 4BFEA 1XGTB 4NKQB 4XTRD 2VTFA 3OXRB 5KOVC 5I8OL 1TVBB 1AGEB 2A6IA 2R0KH 1WISA 3MYJB 4MDIB 4WGWB 3H9SE 1INEH 2OR8A 1MUJB 1QA9B 1QR4A 1GHFH 1Q9WB 1U8HB 1UM4H 2C3XA 4NYLA 4N0CD 1ZXQA 1HHIA 1REIA 2VZVA 2G60H 2Q87A 2PO6B 4MA7H 4X4MA 4ODVH 1JGVH 4PRBB 1UZ8A 2KKQA 3ARVA 2RHEA 5D96C 1IM9A 7FABL 1T0NA 3O2VL 3QISA 3QEUA 4K3EH 3H42L 1T04A 3KPSB 4GMTL 5EOTB 1LEIB 3RVVC 1ODAA 1BZ9A 1IAIL 2VO5A 4ORZC 2FBJL 4MJ4A 3EAKA 4LU5L 3VRIA 4KK9D 5C08E 2XA3A 3T0EB 2CKNA 3RIFF 2Y1VA 5I6XC 4PRPB 4PJ7B 3FO2A 3A6BH 3TT1L 5DK0B 1P7HL 4RGMC 1WVZA 2D0GA 3VFMB 2FNBA 2X4NA 1KEGL 5TE7H 5CCKH 5GRUH 4K7PL 3DUUB 3EHBD 2P5WB 1K6QH 2X4OB 3CFKB 1RUAL 1NFKA 2H6PA 1Q72L 4Y5VA 3FO0L 4B41A 4E42B 3AMLA 3D18A 3B9KC 1I85A 5DD6B 4Y4KB 1KXVC 4OFYA 3WIFA 1NBYA 1JN6B 3QNYB 1LE5A 1MCOL 3QUZC 1S78C 3WSQL 5KS9A 1HYSD 2EKSB 1L7TH 5DZNA 3JV4A 4CDHA 4YK4C 4FQLH 5ICYB 1MJ8L 2WQRA 4N5ED 5BZWB 3MRBB 3SDYH 5GZNC 15C8L 4U1NA 4TRPH 2A6JA 4Q2ZA 5KW9L 4OFIA 4NQXA 1OP5H 3TJHD 2IAND 4WUUD 4JY6B 1N6QH 2JB6A 3U0PB 1LO2L 2NY7L 3F6LA 5IHUL 1WWAX 2ZCLL 4HKBA 3RWHA 4TTGA 5E9DB 3GSNA 4RFOH 1YUHB 1VDGA 1KJMB 2ZPKL 4ODXA 4K23L 1ITCA 1DSFH 4KMTL 2DWDA 4P46A 2DB8A 3U4BH 4MAYC 2XTJE 5E7FA 1T80A 2HVJB 3NH7H 3ULSB 5J56B 1RUQH 2LU7A 3BKJL 2ZCHH 5JORB 4P23B 4D0DB 2HT4D 2CXGA 1P7QB 1DN2A 3MLZH 1MFNA 3UZVB 2BY1A 5D7IB 3U0TA 2QKIB 5D7LD 2XRAL 3QCTH 4JB9L 4EQ3A 1MFDH 3W5MA 3L6FB 4LHUB 1J1XH 3BIBX 3A6CH 3FQUB 5TDPA 1F6LL 3EO9H 3GMOB 1A7PL 1AGDA 1DUZB 1CQKA 3VWKA 1I1CA 3ZL4H 4PTTA 5CINL 3O3AA 4NN6B 4QF1A 3HI6L 5BW7A 1NAMB 4QRRD 1RHHB 4OD2B 4W6XB 3U7WL 1YNLL 4Z7UF 3VXUE 2MCPH 3ARUA 1ND0B 3CFBB 4ALAH 4RFNC 5T5FL 2NLJA 2F15A 2VDRH 1M71B 3OKOB 5AEAA 1CS6A 4JHZA 2AK4A 3GDBA 3O3BA 3M45A 1VFBB 2PYFA 1EEYA 4OV6F 4LLUB 2X9XA 3BDYL 3DETD 3OJDA 4ZPVB 1NCBL 1FL6A 1FIGH 1NGYB 4OI8A 2QV2A 1TQCB 1VEMA 1DFBH 5GHWL 3T4YB 4NT6B 4QHLA 2ICWA 2RGSA 3LN5A 4YFDB 4P2CG 3LN4B 1JWMB 4NQCA 2D03H 1M6OB 4P3WA 2O61B 2G75B 4U0RC 3W9DA 1FNEB 4F57H 2ARJA 4FABH 1QRKA 3SDDC 4QEGA 4UV4H 3E1F1 1U8LA 3MV7D 4UB0H 3KXFA 1CBVL 3QFJE 3NZHH 4QRQA 5HI3D 1KB5B 4M6OH 3PIQA 4NO5A 3QWOA 3GBMH 3VG0L 3UTSA 3WUWA 3QUMB 1SEQL 4R4FL 3D69A 3TF7C 5T1DH 3RTQD 2XNAB 3W82A 4G7YL 1NMCC 2FIRT 2YWZA 4Y4FA 5DO2C 1H9VA 5T1KB 5FA4A 3FQRB 1SEBA 2APBA 5AZ2L 5B3NA 1KCSL 4MD5A 2RR3A 1JRHL 2BMKB 4YUEH 1D5IH 1I1AC 3NMEA 4R96B 1OAXH 3QB7C 4HIIB 4HJGA 3TN0B 1N7MH 5FYKH 3KPMA 3H9SB 3OKEB 4JPIA 4XPBL 3VFTB 4L9DA 2AJ3A 5I9QB 4WVRA 2GUOA 5I0DA 5K9OB 5GGRY 2FATH 3CMGA 4P9HH 2NXZC 3QIWD 5J6HB 2Q8AH 2DQCL 4KQ4H 2PYED 4AY0A 1MPAH 4I4WA 1FNFA 3BEWB 3PXHA 5CBAB 5IMLB 2ICES 4CL7A 1MIMH 1T1XB 3HE6B 4RAVA 4YGVB 5HDBF 3L95A 3SKJH 2R1YA 4BKLB 4XC1H 5ESVA 3P11L 5GRJH 1LO4H 5A16A 1W8OA 1DQLL 1KJ3H 5C08B 5DVKA 1EJOL 3NPZB 4F58L 1RIUH 1AGBB 5IVOA 3TBSA 4LPYA 4P3DB 4DQOL 2FECL 3FB6A 2IPTL 4M7LL 1G7HA 4L9LC 2G5BB 4JAMA 3RWCB 3WEXA 3P4OB 5ADPL 2XI9A 1RHFA 4TOYH 3AU1A 5DUBA 4XBPB 3UPRB 2VDQH 5DS8A 1DEDA 5KVFL 3NIGE 3GSNH 5TE6H 1IL1B 1Q94B 5GXBB 3EFFB 3PXJA 2Y36H 4GRWF 5E8EB 1NC4B 3LSOB 2ZUTA 3UJTH 2R4RH 1FNHA 2X1XR 3OAZK 3VWJB 4F80A 2WQ8A 4E41E 2ENYA 4PTUA 3VFUB 4JFPA 3DX6B 4L8DA 5JMRA 1RZFL 2HVKB 1W72A 3ZTJH 3FTGA 4Y89A 4JM2A 1N6VA 5HYFA 3GIZL 1X7QB 3QJFA 1RJZA 1ZEAH 5ACZB 4XH2B 4PGBB 4LCCB 5I8EA 3LZFH 1VERA 2VYRE 3UTPE 3V6FA 3X13B 1RK1A 1RUKL 1KJVA 2NY1C 3MFGB 5D71L 5DK2A 1I3VA 1JHKL 4P4KC 5CD5D 4ELMA 2W91A 3MLVH 5KJRL 5DUPH 4XP6L 3LS5H 1YN6B 5EOCJ 3DGCR 1S7VA 2XTJB 3TWCL 2UZYB 3H9HA 2UVFA 1TNNA 2C1OB 5FUCE 3MJGX 1MCWW 4YBHA 3ZSSA 2Z91A 2P5ED 2XZCH 4KK8D 2X4RA 2Q8BH 4N1EA 2W65A 1BBJB 4AH2B 4WWKC 3CZFB 3GKZA 4PB9H 3ABZA 1DL7L 4MXVF 4LLQB 3PJSB 3VXMD 3MLPA 1JUFB 5JXEA 1KN4H 3HE7D 4X7TB 2EH7H 5FYLH 1AQKL 1U41A 3ARBB 1YPZA 1FZMA 1KB9K 3QIBD 3SY0B 1X5HA 4QY8A 1IGYA 2AXJA 1NH6A 5INCA 4YHYB 3F7VA 3K4ZA 3EOBB 1DBKL 2R2BA 3ILPB 1N26A 5EU6E 4Q74A 2C1PA 3VXUB 1HINL 2ITDA 1J9CT 2FCBA 4YZFF 1C12A 4JFXA 4O4YL 1MFCL 2NYYD 3VXOB 3RP1A 4X7FC 1JPST 3DX7B 4PJIE 4EI5A 1AJ7H 3L5WA 1LE9A 4YE4L 1HIMH 3STBA 5I8KH 1KIQB 4RIRB 2IH3B 4GAJL 1UQSA 1C16B 3TP4A 3ARGB 2CO7B 4DKEL 2VQ1A 2I60L 1FO0L 4X6DA 1DBBH 9CGTA 5D1QA 4OQ1A 1B3JA 1CZ8L 1YNKH 2YZ8A 1DUYB 4GKZA 3LRSB 1JGUL 5I74B 1NQBA 3SBWA 2HJLA 3WDIA 2JELH 4O2EB 4S2SB 1A3LL 5K33A 4OLWL 1GRWA 1FQ9C 1T7WA 2AGJH 4IMKC 3QFJB 1KNOA 5DT1L 4UIKH 3OB8A 2R2CA 1GGCL 1EO7A 5EC2B 3OX8B 1KIUA 5C2BL 3Q5TA 2VLJE 3ARDD 3WN5C 3PWNA 4TUOA 4NN7B 4AIZB 2HWZL 3MNWB 3MLRL 3Q3GB 3MGTB 4ZDHB 3K1DA 3QZWA 2XTLA 2Z93B 3W0WA 3SJVB 3UC0H 1T89C 5TQ0H 4QRPA 4Z7NF 5FDWA 3B9KD 3RBSA 3S36H 4OGXL 3MRDA 2VXTL 1R5VA 3QUZD 1S9VB 4Z5RB 2HAZA 2MWCA 4JFZH 1TQBB 3SE3A 4O02L 1FFQA 3LHPH 5IFAL 25C8L 5GZND 3PABA 1KELH 3I50L 2DM4A 4RAUB 4JCMA 4GRLB 5K9JH 5SX4H 3O2DL 1OSPL 1MNUL 4K9EL 5GS3A 1A3RL 5DHVA 4L4VE 4QHKI 3QXDA 4MCZA 3RX8A 3ZKSD 4ERSH 1BREA 3B8SA 3MBEA 1OAZL 1BD2D 4LLAA 1QR1A 1FN4A 4X99A 3W39A 4U1MB 1YQVH 1D7FA 4LHQB 4V2CB 1AP2A 3P9WB 4LOUC 4XNQA 3CVHH 1D5BA 2VIRB 2DLGA 2GJ6A 4XP4L 3WCYA 3HZVB 2QQKH 5E95B 3SCMD 1N0XL 3DYMA 3U2SB 5C07D 3PP3K 4TNWK 5HGBB 2VRAA 4EIGB 1FHGA 5DTFA 3VH8G 5FECB 3HN3A 4LBEA 1S7RB 1S7TB 1Z5LB 3LRGA 4KKNA 3WUZA 1BLNB 5L8KB 2X4QA 4U6XB 3MXWH 2DBLH 4HT1L 1LO5A 5D9SA 1UH3A 1A5FL 3C5ZB 4YHIA 2OQJA 2D7TH 3MOBH 4YC2B 4ODWB 4HJJL 5EZOH 3RDTC 3GI8L 4M62H 3K80A 3C09C 4KHXH 5DJXB 2I07B 5GZOC 1TITA 3TYGL 3NCFB 5A43C 4GG6A 4MB3A 1R3LB 5CEXB 2ATPA 3ZDYF 4YNYB 2PF6A 4IOSD 5JPMB 2EEAA 5AYUH 3HNVH 3JV0A 4JM4H 4BFGA 4P59L 4YHMH 4EN3A 4PP1D 5J11B 1RU9L 2PNDA 3QUKA 2JLLA 1I7RA 2HH0L 3LOWA 4KGLA 4OCLC 4PJDA 1VFUA 4E41B 1XR8B 3PWVB 2ZUUA 1BBDH 4I3SL 1FVEB 5K59E 3GMQB 3M17A 4GUPB 1PFCA 3VG9B 3F62A 4N9GB 1OAYL 4JHAH 2O26U 2VLLB 3TBWA 4GFTB 2NXYB 3LKRA 3F7PC 1P2CB 3MJ6A 4L5FL 1AO7E 1ZGLA 4KY1H 2MPAL 1A9BA 3P9MA 1IKNC 2O5YL 4NQVB 1FL3A 4H1LG 4MQ7B 4JDTH 4NM8L 3O4LB 4RMQA 4QRUA 3T2QA 3KYKL 2V5MA 2AXFA 3VRJB 1P1ZA 1F3JA 2OR9H 3RGHA 3GSOA 5FO7B 2W9DH 5GISL 1TZGL 3TCXA 1UXWA 1YYLH 1QLEL 3L3IA 4J8RA 4Z7VA 5JHDD 4TNVF 4ZS7H 3CFIC 4HMDA 1CFBA 3HPJB 3KWWA 2R23B 2DMCA 2CRIA 2OL3A 3NFPB 2ZSVB 4DJMA 1J8HA 4M5ZH 4R0LB 1DBAL 4GG8B 3MRNB 1NCDL 1MRCH 5HDQH 4TPRL 2IPKB 2QADC 1KIRB 5E94B 2FH8A 5I16A 1KC5H 1T22B 3PWPE 2BRQA 3TZVA 3QIUB 1UJTA 4LRNL 3O8XA 1XGYH 1OHQA 5A2JH 1NLBL 5FOJA 1U58B 4HPOH 4KDWA 4WHTB 1N2RB 1FORH 4JDVB 5AAMA 3LVEA 4KROD 1S7WA 1JGDB 5IQ7L 4XZUB 3ARSA 1JI1A 5F7LB 2IADA 3ARFB 3S88L 1VSCA 1CFTA 5ESAA 5CJXA 4MNHB 3PGDA 5IBUG 3VGFA 1RQ5A 1FH5H 1I1AD 3O81A 1D5XB 4RISH 3AS1A 1BIIB 3RBGA 1CL7H 4DGVH 4QRSA 3SKMB 3ISWA 5IHZB 1U95A 3CUPB 5EU6B 4OUOA 1OLZA 3IFNH 3GB7A 4R2GC 3H0TB 3WFDH 3HNSL 4HG4J 1ZT4B 2DDQL 1D5MA 4XVTH 3FRUA 4PJIB 4ZOAA 3NAAH 3QI9C 1CLYH 4BQBA 1BZQK 1PKQA 1MIEH 4WO4C 1U8PB 4MX7B 1LD9A 2ESVD 4MNGE 3FB5B 2R0KL 1MH5B 5C0IA 3GSRA 4J3WA 1NFDA 4ZFOA 3IDGB 1INEL 3QPXH 4JFFD 3OR6A 1TIUA 5I71B 1UM4L 2I9LB 1CGUA 5L0QB 3IFOB 3BQUA 2HYMA 2V5TA 1F58H 4NWTH 4XMLH 3VXTA 5E4EB 4RAHA 3NOIA 4GJTB 4FNLL 4MA7L 5BV7B 5HI5D 3LKPA 1JGVL 4F7PA 3BRFA 4O51B 4O9HH 4U7SA 4JANB 2SEBB 3PHQB 3MV8D 5C0CD 1QSZA 4K3EL 3VXRA 1GIGH 4EDXA 3MNVB 3BH9A 2J7LA 2GITB 3F12B 3GHEL 5DHVH 4QKXB 1Q9KB 5IMOB 5GS2D 2NW3B 4XNZC 2VLJB 4U1GC 4CVWA 3O3EA 3B2UD 2D7PA 3HG1D 4PJ9C 1A4JA 1JWSB 3HZKB 4MMXC 3A6BL 4LGRB 3WXVH 4KKAC 4NCC1 3C60D 3JSSA 2WBJC 2VABB 1K4CB 3FB8A 2YBRA 3BESR 4MJ5B 5IEHB 5TE7L 4KRMB 4OFKA 4XPTH 1QSFD 3VE0A 5CCKL 1YY8B 5GRUL 3BVNB 4ODUB 4YIQA 3VXQA 4PRNA 3EZ8A 3DGGB 1J0KA 2V2XB 4MZ3A 4RX4D 4I48B 4FQJL 5HHQB 1K6QL 4X7CC 4HPYH 3MMEA 2EICA 4LKXB 2X9YA 4ORGA 5DVNA 4DVBA 4L4VB 4JZOB 5EU4A 1UZ6F 4OQTH 3UTZA 4R97C 5I18L 1LEGA 2LQRA 3GRWL 1TCRB 4HK0B 5T3XD 4F7TA 4FQLL 4PBVC 3VI4F 4LARH 3SDYL 4CADA 2OTUA 4TRPL 4BM7A 1ZA6A 3ARXA 4P57B 1N4XH 4BSVB 4JY4B 1YN7B 5BRZA 1CU4L 2PXYD 1N6QL 4HKJA 2H9GB 3UEZA 1M4KA 3IKKA 5MEQA 1SMAA 4I0PC 1QRND 1WZ1H 4WWKD 4NKMB 5H37G 5T1LB 4L3EA 2YS4A 2OXHA 2X7LA 3CC5B 1UENA 3WFHA 1RUQL 3VGHA 2Z8RA 2ZCHL 4NO0A 2K7PA 4MWFA 1MJ7H 5DJ0A 4E9LA 2BNQA 4Y2OA 5JW4M 2OL3H 3MLZL 5E8PB 4HUVA 4MNQA 4YXLH 1X4XA 4U1LA 2XV6B 4NQEA 1U8MB 5TF1L 1U8JB 1MFDL 1XF4A 4PJ8C 5IHLB 4WTWA 1U9KA 5IR1B 4EUPB 3A6CL 1BQLH 2PW2A 3EO9L 4M43L 2NMSA 4HWBA 5T5NF 4PJEF 1AO7B 1NGWB 3VXSD 3RGVB 4MD0B 3CFDA 3MRLA 3U7AA 4C56D 3WFZA 3ZKQD 1T03H 4BFIB 3PUCA 4LRIA 4XRCB 2V7NB 2Q76A 1S9WB 1JPGA 2IC2A 3AREC 5ENWB 1U3ZA 4OBRA 3DXAE 5AUMA 4ALAL 1MHEA 5H35B 1WIUA 2NY3D 2VDRL 1DR9A 4AIXA 1C1EH 4JVWA 5F6HJ 2XY1A 4LSTL 1RUMH 5D5MA 4TSBH 1H3UA 4D9LH 2J12B 1I3UA 3SDCA 2FYYB 1YC8A 3BISA 1EZVX 4LPTA 1FIGL 4PJCF 2PKDA 3PWPB 1DFBL 5GGSY 2NY2D 4E0RB 1FYTD 2XZAH 4BZ2H 1PJ9A 3HLAB 2F5BH 4K3JL 1AXTL 4X9IA 1PDKA 2D03L 4LIQH 2D7MA 4C57C 1LP9E 1X5GA 4F57L 3IJSA 5F1NB 2FJHA 3GSUA 4LP5A 5C9JA 4UV4L 2NZ9D 1MJUH 3VDBA 3V4VH 4UB0L 5HHOD 3NZHL 1E4KC 3TPUA 1H5BA 3I75A 1RZ8B 3GBML 1E0OB 1QSEA 2DQDH 1NUGA 2OLDA 1XR9A 4PJAA 1JF1A 5CGYC 4CMHB 4X9HA 1MHHA 5DRWB 3MRIB 5HY9A 4HDIB 1JYXA 3UZQA 2EDNA 3QDMA 3KYMB 5D1XA 5JO5B 1CDCA 3QHTC 1E6JH 1Z2KA 3CPLB 5CEZH 3QQNA 4S0SD 1D5IL 3DV4B 4GW1B 2C4FU 5FDYA 4LOUD 1OAXL 1UG9A 1N7ML 1J88A 4F9PA 4YDJB 2ZG1A 4WY7H 2OTWB 4PRHD 3WL9A 4LF3B 2K3TA 2FATL 3HNTH 4RMVA 4P9HL 1NMAL 5HVFB 2AJVH 3TLRA 3KPRD 3FONB 2AW2A 1MPAL 1T5WA 3JTSA 1H8NA 1I8MB 1XFPA 4M6AA 4GBXA 4M1CC 3S4SA 2PCPB 3VFNB 4F9LC 2Q20A 1ZT1A 1MIML 2C3HA 5GZOD 1JZ6A 3ULUC 3SKJL 2CR3A 4XC1L 4OV5B 1LO4L 1MI5E 3IF1A 3HS0A 1KJ3L 5KS9F 4UT9L 1RIUL 1TMCB 1A6AA 1IFHL 3CSYA 1VGEH 3DUSB 3OGCB 4KDTA 3LS4H 3CDFA 4LCWD 4NQSA 2ZOLB 1MLCA 1WTGT 1ZLWK 2ZSWA 3FO9B 2W0FA 2CLVA 5BVJB 1YMME 2BNRE 2DN7A 2CLZB 2CIKA 4TOYL 5J57B 1AKJB 2VDQL 5LGHL 2VDPH 4NNPL 3GSNL 4LLMA 5TE6L 4JQIH 2Y36L 2ZUVA 5JHLH 3M07A 4OLEA 3UDWC 3UJTL 2R4RL 4XHQA 4XWGH 4HH9A 1EAJA 5A40E 1GXEA 2Z0BA 4NZDA 1UKSA 5CSBA 3MRJB 3SDAB 2Q3ZA 1K8DB 2WBWB 4NDMB 2VC2H 3S5LA 1YMHA 3KGRA 3D85A 4X6FB 3J7HA 4QYOB 3UX9B 3BD4A 2QADD 1PX4A 3OXRA 1TVBA 4MJ2A 3LZFL 1AGEA 4GT7A 3C5JB 4DVRL 2FJFB 5FYKD 3LPFA 3MYJA 4MDIA 5JNYA 3QDGE 4OGAC 3QA3A 3RWFB 2GIYA 3T0WA 3MLVL 4RBPH 5DUPL 3QUYA 1U8HA 4G8GD 4PG9B 5SWZE 3VFVB 4H8WL 4B7IA 4EBQH 4PJBE 4F7EB 3V52H 1UH4A 4IS6B 2QJDA 1PZ5B 4N68A 2BHUA 2JCCE 4PRBA 2IJ0C 3S96B 4I77H 1K5NB 3IDMB 1CLOH 4RBPK 4S0TD 2CR6A 5EOTA 1A1MB 1LEIA 2XZCL 2XQBH 1YDPB 4IDJH 1HH6B 2Q8BL 1OTTD 3GK8H 4OFYD 3WDHA 4U6VH 4NP4H 1CK0H 5AG8A 3WS3B 1N3NB 2MCG1 1X5KA 2XN9E 4PB9L 5EPMB 1GGUA 5MEPA 3DSFH 1KN4L 3P77B 1YJDH 2EH7L 5FYLL 4PRPA 4Q58C 4PJ7A 5EN2B 5TF0A 1V05A 1NBZA 3QI9D 5DK0A 2QR0B 5MERB 4FZ8H 1BJ1J 4JREB 4OF3A 4ZQKB 4G42B 3VFMA 1SQ2N 4C83A 5DYOA 1E4XH 5FOBA 4WWID 1DQJA 4JKPL 1EFXA 3DUUA 4I9WD 3VFSB 4RZCA 5ACLA 2BVTA 3DXAB 3KJ4B 2P5WA 4M5YL 2CMRL 2X4OA 3U36B 1I7UB 4LNVA 4P46D 2CK0H 5DURD 4U1SB 4E42A 3GHBL 1AJ7L 4X5LA 1AQDB 4Y4KA 5DD6A 1HIML 4JRYE 4QOKA 5ANME 5I8KL 4OCWH 3QNYA 3GI9H 2VLKA 4AL8H 4LPVA 5DJZB 2DYPD 4LPWA 2YA1A 3T4AA 2RCSH 2KBGA 4WW2C 5ICYA 2F8VA 4HIJA 5BZWA 5FGBC 3MRBA 1DBBL 4CN4A 1YNKL 3EOAA 2K1MA 4K7FB 5KG9B 2BHYA 5HDOA 1N64H 1WZKA 3BGFC 1LP9B 2HA1A 4PJ9D 1F4XH 3EZJB 4G5ZL 4ZUVB 3KR3H 1HCFX 1TLKA 2AGJL 5KSUB 2UZIH 3TO2B 5E9DA 4KKAD 1YUHA 1KJMA 4UIKL 4P2QE 5GRWA 1FZOB 1RZJH 1FG9C 1QO3A 1CF8H 1EIBA 3BKCH 5LCVH 5EUOE 5GIRA 1DDHA 3ULSA 4P23A 4D0DA 4XCYB 3UC0L 5TQ0L 3WLWD 3IRPX 5DVLA 3U6RB 3EYUH 2E6JA 2AK4D 1RUPH 1CFQB 2JJSA 5JW3H 2QKIA 3S36L 1R3KA 3QWQB 3F8UB 5HYJE 3HUJE 1IRAY 2H32H 2YZ1A 5E5MB 5FYLD 3B5GA 4JFZL 1KGCE 1EZVY 5A2KH 3LHPL 1DUZA 3SQBA 1MF2H 1KELL 4NQCD 1NANH 2E8ZA 1NAMA 3L5IA 4UOW0 1RHHA 3ET9F 1W0VB 2R15A 4OD2A 3C5SB 4ERSL 3RWEB 4KI5F 4ONOA 5FYJU 5CJOL 5DFWH 4DGIH 2DI7A 4XVUC 1N5YH 3UTSD 3REWB 3DX9A 3ZKMC 3OKOA 4U05A 3WNNA 2QQKL 1ROWA 1VFBA 2E9IA 1T3FA 1IGJB 4YHLH 4LLUA 1I9JH 4KKBC 1CE1H 1W72L 2X4TB 2MQ0A 2BRRH 1MI5B 3HPLB 3D2UD 1WBYB 3LEVL 4NT6A 1XGPB 1MWAB 4JM2F 3MXWL 3RVWD 3C9NA 1WCBA 3TVMC 3LN4A 1JWMA 2Z4QA 1F11B 2O61A 3I02B 2D7TL 3MOBL 5EZOL 1TXKA 4EI6B 4M62L 4KHXL 2A6DA 4DKFH 2VZ3A 2ZKHH 4GKSB 3GM0A 1YMMB 1ZV5A 2BNRB 4BSWA 4HIXH 3PHSA 4XPAL 5HI4D 4QTHB 3QEHB 5T33L 5GSVB 1KB5A 4ELMF 5F21B 3WNKA 5AYUL 3HAEA 1A6UH 4JM4L 3QUMA 4BH7B 2A74B 4YHML 4Z7WE 1P4BH 4A6YB 4YLQT 3AFLA 2XNAA 3FRPA 3FCTB 1OW0C 3IXTA 5C09E 2BC4B 3BN9C 1BBDL 4OFPA 5T1KA 1SBBA 3NPSC 3D0VA 3FQRA 4X4XB 1BEYH 4MAYB 4UNTA 4KAQH 4JHAL 1H3GA 2ARWA 4KY1L 1PQZB 4LGSB 3SE4A 3PGCB 3T65A 4JDTL 1Y0LA 1NDGA 3FB7B 3NCJH 5LGJA 3ZKNC 2BMKA 2P44B 4PJ5E 3UTTA 2AAVA 5JUEH 2OR9L 2W9DL 4R96A 3SEPA 1DVFC 1R0AL 3EKCA 4ZS7L 3TN0A 3AM8A 5B3JF 3QDGB 1YPZF 2JJTA 3VFTA 4OCYH 3VA6A 5BMFH 1EX0A 5FO9B 4DN4H 4HWEH 2HJKB 3QEQE 3HRZA 4PJBB 1EO8H 5J6HA 3TO4B 1JFQH 1GOFA 5L6YH 4OJFL 2NX5D 4OZ4B 1KC5L 1QEWA 4W70A 4CU6A 4FQPA 5IMLA 1IARB 4JHWH 3U0WH 4U6HB 1WQVT 1XGYL 4UUJB 5BS0E 3IJYB 1IC1A 3LQAH 3HE6A 4YGVA 1IE5A 1F2QA 4ZFZB 3TH2T 4RFNB 1Y18B 2L7UA 3KLDA 2YRLA 5MHSD 4BKLA 4G6KL 3OKNA 4NIKB 4HPOL 3KPPB 2XN9B 5JOEA 2Y5EA 1U3HC 4MJ6B 4CW1B 2FX7H 4JM2D 1T66D 1AGBA 1F4HA 2EYTA 4LMQI 2W59A 2DQHH 1T7ZA 4X6DF 1LDSA 4HKXB 5I1AB 4PLJC 4DEPC 3DHJA 3RIAK 1FH5L 2XG5A 2G5BA 4RISL 3RWCA 3P4OA 4HBCL 4DGVL 4M93C 4HZAA 3UPRA 1T7VA 5BXFB 4U0RB 3IFNL 3NIFE 1IL1A 4XCEB 3WFDL 3EFFA 5KVMC 3SDDB 3LSOA 3N0PB 5DR5H 4HV8B 1CLYL 2XWJB 4ONFH 5ANMB 2HVKA 1MIEL 4R3SB 1AHWB 4WDIB 3CX5K 1OGTB 1NMCB 3QPXL 1H3PL 3BEVA 6FABH 1FVDB 1T20B 1NMBH 4PGBA 1S8DB 2Z9TA 4XMLL 5JXED 3WS6C 1KIPB 5DWUH 4WFHD 1FPTH 4O9HL 3BSZL 4JPWH 1GIGL 1IGTA 4GSDH 4P2QB 3HCVA 1NAMH 3O6FC 1C5BH 1NGQH 4D94A 1QFWH 4U3CA 5EUOB 1A7RH 3ZKXC 2HT3C 1GGIL 1ITBB 2C1OA 5E6IC 3D39A 2NXZB 4EI5D 1QLFB 4APQA 2DQUH 3I3BA 2KQNA 3WXVL 2IF7A 1VFAB 2HKFH 3LQMA 5EO0B 1BBJA 1CICA 3B6SB 5HGDB 3CD4A 3FOMA 5IF0B 5HYJB 3HUJB 2QSTA 2IFGA 3OKMB 4XPTL 1JUFA 4N90E 4G8FB 4X7TA 4ZSOE 2X41A 3TESA 3QO1B 1SVCP 5D1QD 3DIFA 3V6OE 3BO8B 2QQNH 4ZAKC 4X6EB 4HPYL 3STLB 2ZWLT 1CFSB 1S9YA 2NY4D 3EOBA 4ZPTB 5DD0H 5DJAB 5LXGH 5L2KD 5CS7A 3ILPA 2ZUXA 3GMPB 3MUY1 4GG6F 3SGEI 3WD5H 4JDZB 5EZLA 4YEEA 1KB5H 3VXOA 3DX7A 1F02I 1OQOA 3QUMH 3I6LE 2M1KA 1KIQA 4RIRA 4PJDF 1N4XL 1EBPA 1RJYB 1KPUA 1OB1B 1GJIA 5DJ6A 3ARGA 4ZODA 2QQQA 1PX3A 3L3DB 5L2JB 4Y4HC 3EJZC 5HXMA 1I9IL 2X4UB 4QT5B 5F89B 2D7OA 1IEBB 5KANI 4Q9BA 3JV6B 1DUYA 5D93C 4KZDH 1FDLH 3C08H 5IJVB 5EA0H 4WJ5B 1AR2A 1A6PA 4Z7VF 1SM3H 1MJ7L 3QFJA 1VPOH 4P5KA 1I9RH 4CN6A 3CJJA 3PDDA 1DEEB 3O45B 2OL3L 3DI2B 2NY1B 3ZE2E 3OX8A 4P4KB 4YXLL 4Z7WB 3MBED 1GGTA 2N7BA 3MNWA 5C09B 1MCPH 4L1DA 4ZDHA 3C6LA 1AC0A 3SJVA 4NPYA 5DMGC 1BQLL 1AFVH 3SDXA 2GJ6D 4J4PA 2ICCA 1MCIA 1T03L 4PJHA 4OD1L 4WU7B 2HRPH 4KXZH 1S9VA 4PJ5B 4PPTA 5ECJE 4Z5RA 2DM7A 1D9KA 2QSCL 4NOFA 5M7QA 4XNXH 1ZK9A 1CVRA 1V7MH 1TFHA 2GJZB 2X1WL 4GRLA 1G7JB 2A0LC 1C1EL 3BUTA 5D2LE 3QEQB 4TSBL 3F58H 3OF6A 4NQDB 4D9LL 3ZE0F 1G7IB 4EXPX 1CIDA 5MENE 5JQHC 1ZMYA 4EN3D 2XZAL 1FLTX 3CXHJ 4BZ2L 2F5BL 4IRJB 5BS0B 3WNPA 1U8QB 3SKOB 2NY6B 4IIQC 3U2SA 1GGBH 4LIQL 2R0ZH 3G5VA 5HGBA 1FNSL 3QYCA 5EU7C 4DFHA 3NCBB 3TA3C 1XIWB 5FECA 3TIDA 1S7RA 1S7TA 1Z5LA 2FX8H 5FYJE 5C0DB 4ZNCD 1BLNA 3KYNB 4KGJA 3O4OC 4U6XA 1NFDF 4ZFOL 1VEPA 5E4IA 4JFDD 3FFDB 3CFJA 4X7EC 4P3CH 1F4YL 4HK3N 1CD8A 4N0UE 5DJXA 5C2UB 3DYOA 2J8HA 2BZDA 2XZQH 4CJ0A 5I1CL 1GOGA 1P9MC 2Q1EA 2J6EA 4YNYA 5JPMA 2A83B 1YEHH 1ZLUK 1CGTA 4PRIB 3H7BB 2JIXD 1MCWM 3UTQB 4HLJA 2EE9A 5F3BB 1LQSR 1E6JL 1XR8A 1FP5A 5CEZL 4XVUD 3BP4B 1FVEA 3GMQA 2R39A 4MQXC 4YGAB 3MUGB 3INUL 3TZVD 4MS8C 3UAJC 4JN2B 2F53D 2X70B 3O8XD 3HFMH 4U3XA 3SGKA 3WN5B 4NQVA 4WY7L 4MQ7A 3O4LA 5KN5B 4QXTA 4R9HA 4X0KB 1X9QA 1QNZL 3VRJA 3BPCB 3B3IB 3HNTL 3CAFA 5FO7A 3ZT7A 2PO6C 1TJIH 2E9BA 3GGWB 2AJVL 2C5DC 3HPJA 2R23A 4KRNA 4AJ0A 1G0DA 3AS2A 4G6FD 4MD4B 1GAFH 4V1DB 1SJEB 5CD3B 2OX5A 3CCHB 4GG8A 4KJWD 4EEEA 4X4YB 3MRNA 5E99H 2UWEA 3N1MC 4PV9B 4J6RL 1KIRA 3IFLL 5F9AC 1WSST 3ZT6A 1J0IA 1T22A 1EAPA 3RHWK 3T0EC 3X11B 3QIUA 5FUZH 5HPMB 3FT3A 4MVBD 3G6JE 4R8WH 1J8KA 1VGEL 5B4MC 3R0NA 3RPIB 3LS4L 1P5UA 4G3YH 1U58A 1VKXA 3JVGA 3PV6A 4JDVA 4H0GA 2Z35B 3IXAB 1CXKA 1E28B 3HC4H 4XZUA 2IANE 2QSQA 3BPLC 4WUUE 3UPAA 3ARFA 4WI4A 3ME0A 5F71A 3CDYA 1JF6A 4JQIL 4MNHA 4W6WB 3IDJA 4QWWC 3LQAC 1D5XA 4Z0XB 3KDMB 4BK4A 4XWGL 1BIIA 2H26B 3SKMA 5IHZA 4QGTA 3CUPA 4LMQE 3BZDA 3RDTB 2DKSA 2OI9C 3H0TA 3VXRD 4Z7OF 4OKVB 3SE9H 1ZT4A 5H94B 2VC2L 4PJIA 4JY5H 5CEZD 4ZXBA 1NUFA 1D5ZA 5EO1B 3WUWG 4MX7A 2HFEA 5D7LE 4FQIL 1MH5A 3IDYC 4M6NH 4CBPA 3W11C 2X42A 5C0EB 3TBTA 3W9EB 1UM6H 1UC6A 3RL1B 2NQCA 4LVOC 2GFBA 2DL9A 2I9LA 3IFOA 4EBQL 1OARH 3BWUC 3SPVB 2IG2H 3VFGL 4FFYH 5H2BB 5EBLA 5IMMB 4UV7H 4XCFH 3K7UA 1QFWM 4W6YB 3PHQA 2ADJA 1FNLA 4Q6YA 4I77L 1CLOL 3LAFA 3MGOB 3MNVA 4RGND 1S7SA 1WGOA 4N8PA 2XQBL 2GITA 5CUSH 3KPNB 5FEBA 4IDJL 3KPLB 5IMOA 1Q9KA 2ZZUT 3T8XB 3VXNB 4U6VL 3WV0A 1CK0L 5D5MF 1KFAH 3BPNC 1S9XB 4CVXB 3DSFL 1JWSA 4JGJA 3HZKA 1YJDL 4JRXA 4PYGA 5DA0B 2Y9RT 5CP3H 1JHLH 2VXQH 1UYWL 4L8CB 2VABA 1K4CA 1CN4A 5BRZD 1E4XL 2JJUA 1EGJA 1GC1C 1YY8A 3BVNA 4AT6B 4I2XE 1PG7W 3DMMC 3DGGA 4G8GB 2R1WB 4I48A 5HHMD 5HHQA 5E8OA 5F7KC 1BVKB 3DROB 5TPWH 2CK0L 2NTFB 5TFSH 5IVXB 4L4VA 4JZOA 2HFFB 2R29H 5D2LB 1P84K 4OCWL 4PJAF 2VN7A 4NO0D 3AC0A 2EE2A 3VH8A 4AL8L 2J6EH 1TCRA 5MENB 2RCSL 4MNQD 3O6FD 4D3CH 3P0GB 2FR4B 3DBXA 1TVDA 3D1MC 5GS0C 2HT3D 4NQED 4KHTL 4R2GB 1N5AA 4P57A 5E6ID 4JY4A 1ZVYA 2H9GA 3UBXG 3KR3L 1JZ2A 3DI3B 5HVGB 4AM0B 3KVQA 4WO4B 1IM3B 3U7YH 1U8IB 5K9QG 3S35X 3QG7L 4L3AA 2Y6SC 4NKMA 1RZJL 5J1AA 4YHNA 4POUB 3TYFB 4XBEH 5LCVL 4NZJA 1I3RB 4F2MB 4N0UB 3CFEA 3CC5A