1RULH

Crystal structure (d) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 5.6 with a data set collected at ssrl beamline 11-1.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
221
Chain Sequence
RVQLQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
molecule tags Immune system
molecule keywords immunoglobulin igg2a, light chain
total genus 45
structure length 221
sequence length 222
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rulH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rulH01
4K9EC 4ESKA 4JO2L 4FTVD 3V6FA 5ACLA 3KJ4B 4V2BA 5DK0A 4DTGH 1F4XH 1F90H 3WIFB 4RX4A 1GIGH 5D1QD 1IC1A 3WLWD 4G7YL 3IGAB 4UT7H 3DRQA 2H1PL 2Q1EA 3MMEA 5C0CB 3QDHA 4IIQA 5CP7A 1OARH 5JQHC 2NXYC 2NNAB 1JPTL 4Y2DD 4HSQA 4YE4H 1FC1A 4IMKA 2CK0H 5C0EA 4KKAC 2RCSH 4JZOA 1D6VL 4AENA 1HH6B 5HVHC 1MUJB 2ZJSH 2XN9D 5L2KB 3IXAA 1YUHB 4EQ3A 3EFFB 3T2NH 4KAQH 3IJHA 4TSCH 2IMNA 3ZDZF 2YD5A 1IBGL 5EU6E 5EU6A 2G5RA 1BQUA 2E6PA 3MYJA 2GIYA 1T66D 3NABH 5KN5A 1X6NA 2DJ4A 3VFWA 1K9TA 2X4NA 4JCMA 4PLNC 2VQ1B 5EOTA 3HZMA 4ZD3H 1QSEB 1NCNA 5HI4C 5B4MC 1TIUA 2DD8H 3RL1A 5GJSL 1EVUA 4TOYL 5JO5A 3FQNA 5C0JB 4HMCA 1JNJA 1D5XA 4PGDA 2E9WA 1RULH 5TDPB 4YXLL 4F7MA 3MNWA 3O9WB 5LVEA 3OKLB 1H0DB 5I1AB 1FLTX 2QQKH 4OAWB 5DJCB 4JPKL 2X1XR 4YXLH 3P0GB 2YK1L 4Z7WE 3C2AL 4OLUH 1CL7I 4OGXL 3SCMB 2NY7H 2UV3A 3FB8B 3T08A 5DJAB 3PJSA 1G9MC 3T77A 2IADA 5MERA 4R96B 3VI4E 1OPGH 3NIFE 4HDIB 4OLUL 3E0GA 2BMKB 4WENB 1CDHA 1AGBA 3WKML 1ZGLM 5MENB 3T77B 4L4VA 3GSQB 3DXAB 2L0DA 1OPGL 5IQ9B 4HK3J 4XAKD 1KB5A 3I9GL 1T04A 3N06B 4S0TD 1XGYL 3O6LH 2OXGA 1DUZA 4MAYD 4C83B 3C08H 3KPPA 4MD5A 5ETUB 5FO8A 2A77H 3HS0B 2G5BA 3T4YA 4OZGF 4M3KB 4QOKB 4DGVL 4LF3B 3WDJA 3CDGB 5I71C 1INEH 5F72S 5ADPL 1T83A 1T7YA 3LCYA 4FQ2H 3TJEH 1QD0A 3VXME 2YZ1A 3MRFA 5C0AA 5F1NA 4M8VA 4Z78B 2JB6A 1F3DJ 5T1KA 2X70B 4WV1A 3LQAH 5DD6B 2WINB 4PV8B 1N5AA 4P5MB 1S78C 3U0TA 1EAPB 4Y8DC 1AXSB 3KWWA 4GMTH 1KPVB 3PWVB 2IEPA 4ZFFB 1TCRA 4N0FA 3JWDC 3MV7A 5CUSH 3QXDB 2N4IA 3WYRA 5I1IH 4XGZA 1J88A 3SKMA 1W0VA 3AAZB 4EBQH 2DDQL 4MQTB 5IK3A 1I7ZB 3QDMA 1BP3B 3C6LD 3WIHL 2YA1A 3FB6A 3GMLB 2C4FT 4FNLL 3WXWH 5B8CC 5D7IE 4NCC2 4NNPL 1U91B 2UZIH 2YOCA 3ALPA 5IB1A 3B8YA 3VXSD 4LVHB 3G5XB 2VAAB 4ZDHA 3QXWA 4MQXD 1L6ZA 1U8JB 3RWGA 3ILQC 3QIWA 4PJGF 1WICA 4WHTA 3WL9A 1WWWX 3HC0A 1KPUB 4JFZH 5ELIA 1IAIM 1XGPB 4CL7A 1AQKL 1IGFL 2EC8A 3HNTL 5FK9A 3O6KL 1Z5LB 5C0FA 3BZFA 1WIUA 2AXFA 5EUOF 2Q8BH 3P9WB 3QXAB 4QHUA 1R3HA 1FYTE 2A6KB 2MKWA 1S9YA 1HSAB 4Y1AD 3DSNA 5JOFA 4UIKH 1U2CA 3EOYG 3L5JA 1KGCE 1VCAA 4ODVH 3ZT6A 1OP3K 2R8SL 4HGWB 4JM2B 2N7AA 1I7TA 4MJIB 4MQ7A 3D25B 5JORA 2KUTA 1RHFA 3BH8A 4L5FL 4IIQC 2I5YL 4OFVA 2ZOKB 4X0KB 4BSWA 4ZAKC 1A6ZA 4JGMA 3WKMH 1NUFA 2R1WB 4KRNA 2MCG1 2EEAA 3WXVH 3QNYA 2R1XA 1LK3L 3STLB 4JFEA 1ZK9A 1INQB 2DQIH 2B8OT 5HVGB 3KYOB 5KSVA 4IHOA 4NJ9L 1QRND 4MSWB 4EXPX 3ARFB 3BP7B 2NY2B 4G8EA 5CJQH 5IW1B 4YFLI 4DGIL 4Z76B 5BXFA 2P8LB 1JI2A 1S3KL 1GL4B 3S8WA 4F58L 4KGLA 2DICA 5DJZB 5B4MD 1I8KA 4M02A 2HMID 2WBJD 4UQ3B 5I1HL 5FV2A 5E8EB 4KJWC 3ZTNH 2NW3B 1RIVH 4KU1A 5SWSA 1RIHL 2CIIA 1BPVA 2VSCA 1N64H 1IAOA 1F11B 3OF6A 1T5XB 3HZVB 2AGJH 4LLAA 4OV5B 1G7IB 3O2WL 5BRZB 4JFQA 3OZ9H 3IS0X 1DCLA 1I7RB 4NO2B 4IDJH 4Y8AA 1QSVA 1BVKA 4NC1E 5K9KB 3IRZA 2BSTA 4WW2F 3V7MA 1I1AB 3VDCA 1HHIA 4V1DA 3T1WA 5KANI 3D9AH 4HUUB 5LCVL 5CSGA 3MUGA 1BBDL 5CIPA 1MCKA 3T1FA 4NCC1 3QHZH 5I8EA 4Z95H 4L8BB 4TUOA 1PKOA 3U4BL 1AP2A 1NDGB 3PIQA 2H8PA 1K2DB 3D25A 3KLSA 4G9DA 2AJZA 1GPOL 2J8HA 3ARGA 4X9FA 1FNAA 3X14A 4N0CD 1XGUB 2R0KH 1GOHA 4O58H 4MCYB 1C08A 2X4UB 1N7MH 4RMVA 4WI9A 1EBAA 3MNVA 1P9MC 5DURB 5C3TA 2EE9A 3MRLB 2IPKB 1UWXK 2DM4A 4MJ6A 3O9WD 3SE8L 1J9CT 4ODBD 2UUDH 1S7SB 3IFLL 1YQ2A 3BZFB 4BA8A 3HCVB 5HGDA 3ULVC 4NRZB 4GAJL 4PRNA 5FYKU 4XP1H 1KN2H 4QGTA 4NZJA 5FGBA 3GMOA 5F88B 2WUCL 4Z7UB 4R4FL 3TO2B 4Q9QL 4O2EA 2ADIA 4EN3A 5HYSA 1XZ0A 1OSZB 1KJVA 5SWQB 2XWJB 1NGYA 3ROLB 1T6VN 1MIEH 1UXWA 4OQ1A 3VWJC 5FUZL 4K8RH 4ISVB 3EOTL 3OJDB 4WV1B 1T1ZB 1UB5A 4OCMC 4AENB 5JW4Q 5KVGH 1G7HB 2NY6C 3F7VB 3B2VL 3L9RA 1HN1A 4PRPD 1JGLH 2DWEB 4PREB 2EIBA 4LHUD 1JWUA 3B3IB 5TFSH 1H15B 2DL2A 4QXWA 1PSKH 5D1QB 5MEOA 4LCYA 5IJKA 3C87A 1IGJA 1IFHL 4XP6L 1NKOA 4P4RB 2IANB 2VLRE 3EOAB 5HGHA 3UBXI 3VRJB 4Z7VF 5GS1B 4F7TB 5IFJB 4N0YH 1PSKL 3TBSA 3C6SB 2GQHA 1C5DA 4Q2ZA 3QEQD 3LN9A 4CJ0A 1UM5L 1Z0NA 5DD1L 3SDDB 2C3VB 3QISA 1QFWM 3GMNB 4Y4FC 1XCQB 5HGGS 1ULVA 5GSRB 3PWPE 3UZQA 5E4EB 5JPMA 2NY2C 5C0IB 1A6PA 4JHAH 1QBMH 5CD5D 2GJ6B 3UC0H 5IG7B 5E7BA 3SKNB 2EKSA 5INCA 4G6KH 1F4HA 5TE4H 5I30H 4Q58C 5D1XA 2ZZUT 2EO1A 4JFHE 1MI5A 3RVUC 4PR5B 1B0WA 4KKAD 2CXKA 1T6WA 1K8IB 5SWZA 1NGXB 5GS0D 4PREA 1U95B 1T2QL 3AMKA 5HYJA 5JPNA 3VI4F 3GO1H 1Q94B 2YRLA 4GXUM 1OGTB 3MOBL 2IMMA 1JK8B 1RPQA 2ITDB 1VFUA 3AREA 3EO9L 3GBLA 3LIZH 1MLCB 4OV6F 4XPBL 3EFFA 3KAAA 5IHLB 4XPTH 3LKPB 2YHGA 2RB8A 1GHFL 4I0KA 2PW2B 3SE4C 3ZMRA 1LMKA 2DLGA 3QIBB 4Z7WA 3TA3D 4BQ8A 3DMMC 2MQ3A 3W39B 1R5WB 4I2XE 2NY3D 1U8QB 4FP8H 3ARDC 3KYOA 3SO5A 3PL6D 4HEPG 2J6EL 1I4FA 3I2CH 2VXTH 4NQUA 1HXYA 3S3SA 4C58B 2HA1A 1F4WL 3QQNA 1CTNA 1VPOL 4R4BB 1S5IL 4G8GE 4JY6A 1F3JB 3TT1H 4CBPA 3FHQA 3ISWA 12E8L 2V2WA 5TE7H 3QEUB 1LO4H 4IJ3C 4RZCB 3BJ91 3ZDYF 2A1WL 4HV8A 5IEHA 1L0QA 4R2GD 3HC0B 5DO2D 2X4UA 5KTEL 4XXDB 1QEWB 2UWEF 3EO0A 3SJVE 3RY6C 3IXTA 4JFFB 2RGSA 5E70A 5HDQH 2ATPA 3PIQB 3ALXA 5LXGH 2ICWI 5T1MB 1CD9B 2DRUA 3I3BA 5F1OB 1KENH 1ZA3A 3LMJH 5HHVL 4PTTA 32C2A 5CS7A 4Q7DA 4H0IA 2VXVH 3RWEB 3EGSA 4P2YA 2IH1A 3P4MA 3TYFA 4CJ1A 4PJ8B 3VXRB 4N8VG 2MCPL 1UZ8B 4UINL 3D18B 2PXYA 2R9HD 2JK5B 1CFVH 4N9GB 1VACA 4GXUN 1KIUA 2XYCA 5EO1B 3ULSB 3MLTA 3C2SA 1RJYA 4M6OL 5HYIA 4NNYB 5DJYA 5F96L 5C0AD 4X98A 3ZKMD 1CE1L 4YXHH 1EHLL 1KBGL 4HWZA 1MF2H 1W2KT 2AJUL 4HBCH 1DVFA 2P5EE 1QHPA 3LKNB 3K4AA 4G6FD 3I6KA 2IJ0C 4BUHA 2VDRL 5D2NA 1ED3B 3MOBH 4U33A 1KGCD 3PQYB 3EO1B 1V05A 4NIKB 4PJ7B 2OXHA 5CSZA 4HJ0C 2GAZA 1XR9B 2NMSA 3BO8B 3BVNA 4JHWH 3K4DA 1I3VA 1WVZA 4R0LB 4B50A 2HAZA 1Z9LA 3KPSB 4JFPB 1H8OA 1NCBL 2I07B 2F8XC 4ZTOH 1IEAB 3SOBH 1VEMA 3OGOE 1IM9B 1NBYA 3BW9B 1XF3B 5DQDH 4DK6A 5F1IB 2ARWA 3LEVL 2AJSH 4YUEL 2WBJC 5EBMA 3UJJH 2UWEA 4JKKA 1KV3A 4AT6B 1A1NB 2DL9A 3VJ6A 1YMHB 3FN0H 4PUBL 4NP4H 3EZ8A 3REVB 4PY8J 1P7QB 5DGQA 5ITBL 3QRFM 2VITA 3QEQA 3K7UA 4U31A 2K3TA 3MA9L 5JDSB 3R4DA 1UVQB 5HYQA 4ZAKD 3SHSA 5I0ZA 3HC4H 1LNUA 2HT3C 1HDMB 1G6RH 4FFYL 4YC2B 3GDBA 5KS9B 4HCRA 2X7LA 4D0CB 2LU3A 4LLMB 3BEWA 5FYKE 4ODHH 1SEQL 2W60A 3CMOH 3D0VA 4XCYB 1BJ1J 4U1MB 5TGBB 1OAUH 2V2XB 4MNQB 3R1GL 5DQJA 4BQ6A 3HI5L 1H9VA 3NTCH 1FSKB 1NFIA 2ICWA 4EOWL 3AU1A 1EMTL 4IMKC 2MCPH 3R06A 4MZ3A 2YXMA 4E42B 3S6CA 5CINL 2R15A 2XRAL 3OX8A 4HIHB 5C8JA 1A7NL 5DD6A 2K9UA 4KK8C 4WFGE 5IQ7H 4PJBF 1XH3B 4H1LG 1JRHL 1RURH 3O8XA 3WDHA 1JGDB 4U05A 4LAJH 3BN3B 4X9HA 3NA4A 3QG6A 1MHCA 4GAGH 3H9ZA 3MXWL 1KFAH 4JG1L 4M6NL 4KTDH 1DQDL 4DN3L 2BY0A 3O6FC 1GSMA 3OG4B 1A5FH 2ICES 1A7BA 1CE6A 1L9NA 4JPIB 4U1JB 1J10A 3VRLE 1RUAL 4PJEF 1ZGLA 4CNIB 4F9LC 3OJVC 5DT1H 5GGRY 3WFEH 5MENE 4CN4A 1NLBH 4NN5B 2FATH 4BFIA 1PW3A 4K7PY 5I1KH 1GRWA 3X13A 1FVDB 4QXTB 3IYLW 3RTQB 2E7HA 4OFYD 5GGVH 5ACZB 5BRZD 2FEDD 3CVHA 1N26A 3MLWL 1TZGL 3SOBL 5DC0A 4NOFA 4UUJB 1ACYH 5K9KA 4FFVC 2BOBB 3JSSA 4LLVB 3QYCA 2VXUH 3T0EC 2MFNA 5I1GH 2Q8AH 4LPWA 2AXGB 2Z8SA 3KNBA 2HTKC 4PJCE 3RDTC 1DSFH 1CBVH 4P4KC 2ESVA 2XIDA 3MLUH 1ZT4B 2R4SH 1AXTH 4RAHA 1BJ8A 2AABH 3WHXA 4JZNA 1DE4B 5HHQA 3P30L 5JOEA 3BQUB 1MPAL 4OLVL 2DN7A 1NCCL 1TVHB 2MOVA 1XGYH 2JTDA 3Q1SH 1G9EA 1EFXD 3M07A 4QHMB 3MNZB 5D7IF 1TXKA 4TUKL 3JV0A 3Q6GL 3G5ZB 3ECBA 4PB0H 1INEL 4TULH 4TQEH 4Z7VA 1DLHA 1MREL 3FJTA 1MUJA 2WBJB 3D85D 5SX5K 4XVTH 3MREA 4UT7L 3U1SH 3NAAL 4EOWH 5J13B 4JFEE 2G60L 5LGKA 3UBXA 5BS0D 3FO0L 5DA4A 3BKJL 1XR8A 3D2UB 1A7OL 1S7SA 1OWRM 1DQJB 4MJ5A 4XNXL 3O3DA 3D3VD 4UDTA 4OI8A 1CIUA 1FIGL 4JHZA 1K8DA 1G6VK 2PTUA 3VI3E 1JWSA 4LRNL 2OZ4L 2GCYB 4WO4C 4NQEB 2NX5A 1MLBB 3FO2B 5EOQL 4LSSH 4MB4A 3CFEB 2DF3A 1I9JH 1Q1JH 4M43L 3ZLQC 2JF1A 4ENEC 3TJHD 1WUNT 3NACL 5CFHA 3MV9A 1LK3H 4WI3A 1MLBA 4FQJH 4K07A 3UTSB 5TH2A 2XKNB 5F7LB 2LV4A 3BRDA 3GMRB 3UTTD 3JV4A 3MZTA 1GYAA 2NTFB 1U8NB 5IW3A 4OZ4A 3RX7A 4QT5A 1S5HB 4LNVA 2QQLH 3MGAA 4PRHB 4XPGL 3VG0H 3FRPA 5E08H 4YZFF 3QRGH 4H26B 4MMXC 2ICCA 4YHLL 1LE9A 4UOW1 3QQ4B 5I1HH 2N1KA 4M1CD 3U4AA 3KDMB 4DVBB 3VD7A 2VZVA 4PJHA 5D72L 5DMIL 1X5GA 2IAMD 3MUJA 3GK8L 3EFDL 4ZPVA 4Z7VB 5DWUH 5DMJB 3WNNA 3HB3D 5AWNL 5HHXH 2L7JA 4KI5F 3GMPB 3G04B 5CEXA 4Z7WF 2Q86B 1BM3L 3E1F1 2RIKA 1ORQA 3WN5A 5D96B 2EDYA 2EDWA 5HJ3A 2F53E 2BVOB 5D7KD 2EH8L 2CUIA 5LJYH 2YBRA 5CWSB 4N90D 4N9GA 5FXCH 3WN5B 2IC2A 1HEZA 2OTUA 3O6FB 2AGJL 3FFDA 4L1DA 3DYOA 3BAEL 2P8MB 3FZUC 3EYUH 5F1NB 4APQA 1XT5A 4OZHB 1QQDA 3QZWG 4PJEA 5JLZB 4NM8L 3BI9X 2ESVB 1TTUA 4TTDC 2IFGA 4KKNA 4P3DB 4NN5C 2QTEA 5F7UA 5C0IA 4B5EA 1EX0A 2W07A 3K46A 3UZVB 1MJUL 5BOZG 1TETH 4HJJL 4AL8L 3STBA 3KVQA 1E4KC 4HIIA 1TNNA 5MEQA 3LQZA 4OD3L 4X7DC 4U1JA 5F3BA 3ZL4H 4XNQA 32C2B 1JN6B 1XF4A 3ZE1E 1A3LH 3TN0C 4Y2DB 5F89A 2BMKA 3D48R 4YXKH 3G9VA 4LPYA 2EDHA 2VL4A 3DSFL 3RDTB 3WO3B 3ESVF 5GRZA 1EEZA 3DIFA 4FN0A 4QRRD 4W6WB 5F93C 1SJEA 5C0GA 3SCMA 2CLVA 4TYUA 5DUBA 1CE6B 4NUGL 3H8NA 3E2HB 3QIWB 3T8XB 3V0AC 3OF6D 1D6EB 4FNLH 5TDOA 2VN7A 5TDNB 4XNMA 3DOSA 4ZUWA 4RBPK 2W1NA 1UWEL 1MFNA 3WHE1 1V7ML 4MAUH 1YN7B 3Q5TA 3MBED 2CRZA 4GLRI 4PFEA 5D7JB 3QUXD 2A6DB 4HUWB 3LN5B 5CLTA 3P4NB 1S7UA 3ZDZE 3SGDH 5HHPB 5D2NE 3H3PL 3WUZA 4PRPB 4I2XB 4GBXC 4LLYB 4LP5A 1MAMH 5FYLH 4F37F 1CXKA 1UZ6E 2JCCB 3DX7B 2P7TB 5IBTL 2EDNA 1C5BL 3IKCA 3R8BB 3GMMA 1ETZA 4HCRH 4K2UL 5CEZE 4PJAE 1CLYL 2BY2A 1MRFL 2XI9A 4OCLC 4LDEB 1MFAL 5DF0A 1E4WH 35C8H 1P84K 4M1GL 5DMIH 3BH9A 2HT2C 5DQJB 3C5ZD 3NA9L 5FYJL 1DE4A 5DLML 2HFEA 2XXCB 4B53A 4H8WH 1QTYT 2ITDA 1NGPH 1YDPB 4XNYL 4CMHB 2QQNH 4Y5YB 3S5LB 4Q6YA 3BDYL 3T65B 4GKNB 2NNAA 5J4MA 4FOMA 4JKPL 3MRHA 2ENYA 2ZPKH 1FN4A 3H3BC 5E6IB 2XTJE 4LVEA 2M8XA 2VTFA 1J7VR 5E2WL 2OYPA 2DM2A 4ONFH 3ZTJG 2VITB 3QEQB 5CBAB 4GMSL 1EJOL 4FTVB 1T83C 4U7MA 3VFMB 4GKZA 1BQHB 3BXNB 4YO0B 3CVHB 1Q9KB 3FN3A 5I1DB 1Q9OB 4HFUH 1JHTA 1EV2E 2Q6WB 4YFLF 2FECL 1GH7A 4TUOB 3STZB 4GRWE 4BFEA 5J6HA 4PRID 4XBGA 4DQOH 3BO8A 3V8CA 4XBEH 3B2UD 4HWBA 1GGCH 3TZVA 1YECH 5ESAB 4OCYH 4WW2C 1RIHH 1I7RA 4HKXA 1J0KA 4HBCL 4NO2A 5KSAD 3CNKA 1OAKL 3D87B 1JTOA 5L8LB 5K59F 5L9DH 3SGEH 1D7FA 3BKCL 3TIDA 5EBLB 3KPOA 4U1KA 1F11A 3HN3A 2KQMA 2Z93A 4DJMA 1MVUB 5I19H 1IGJB 4GRWH 4GO6B 5D2LF 5L9DL 1TJIH 3BP5A 1F58H 3CZFB 4O2FA 1MCBA 2DAVA 1AO7E 1T5WA 1B4JH 5JHLH 4JANB 1KB9K 4ZO6A 5DHVB 2VISA 4NC2B 4R4FH 5D93B 4Q9QH 2PCPB 1WBXB 2EYSB 2BK8A 3ARBA 2RHEA 2XV6B 1V3KA 4PJ8A 3VXRA 5IMKA 3DO7B 2FH8A 5F9AC 5FYKH 2VZTA 1T89A 5CZKA 3G04A 3KPRD 5SX4I 4ZO7A 5IMOB 2Y6SC 4NO3A 5C09A 3MLXH 3ARZA 5D7JA 5HVFB 2CLRA 1PEWA 3KPRB 1QRNB 1ZT1A 2VDLL 3L3IA 3S34H 3MRDA 4MD4A 3BPCA 4D8PB 3BYYA 5IBLD 3GMMB 1QLFA 2AQ3A 4F15B 1FVCB 5T3XE 2FD6H 4JM2D 4CDHA 3DX7A 4RNRB 2EIZB 1P69B 2D0HA 4UI2A 4OFKA 1B2WH 3CUPB 3QIWC 4OB5L 4MHHI 1QA9A 1TQCB 4FFYH 3O4OB 2R69H 3GJFB 3GSNL 3VE0B 4HW6A 4F7EB 3FT4B 1CQYA 1U8HB 4KQ4H 1KB9J 1RZGA 3ARBC 3BZ4B 3N85L 4JO3L 4YHKH 5B8CA 1Z6JT 2KH2B 2BVYA 2X4TB 5B39B 2OLDA 2MQCA 4WFHD 3DYMA 3V5HB 2MSPA 1U3HD 1QYGH 2YUVA 1DBBL 2A6JA 5HVHB 4XCFH 3HR6A 3HA0A 4MLIA 1A4KA 1OW0A 5FYKD 1PD6A 2AK1L 4NKIH 5IFHH 4S1QL 3FQWA 1MFCL 1WSST 2NYYD 5I66A 4S1RH 3G5VB 4L4JA 5A1AA 2F58L 5KSBF 4PJ8D 4XWGL 3VXRD 4HKJA 1D6VH 1U92B 1A7NH 5TFSL 2NXYD 4XHJC 4J7RA 3PWPD 1V8HA 2OQJB 3TNNA 5E8OA 2EDDA 3BDBA 4M93B 4I0CC 2C5DC 3M8OH 3ECBB 3NIGF 2ZCKL 4PRAA 3BMWA 1CLCA 2EXWD 1IEBB 1U8MB 3W39A 5C0NC 4PJFA 1CN4A 4BZYA 2QR0B 4JFXA 3PGDA 4DN3H 1NUDA 2AKRA 4JY4A 1IEBA 1DBJH 1F2XK 4QTIL 3DV4A 5HHQB 5HY9B 3L5HA 4KI5C 2C3HA 1XGRA 2OR9H 5E5MB 4X5XA 1NCBH 3BJLA 1GHFH 2B7DT 4OIAA 1N3NB 5DZLA 2QR0A 4EI6A 4NZTL 3KNBB 4G7VH 4OUUB 4J1UA 4L29A 4K3DH 3BH8B 1OCWH 1WBYB 1SJXA 4KUCD 4PRPE 3TV3L 3PABB 1OOAA 3QFJD 4H20H 2FJHB 3CFCH 4JGUA 4NRXA 1EAJA 2D4DA 1OARL 1NFDE 1WTGT 3GMRA 2G2RA 4WW2B 3IFNH 3B5GA 1N5YL 2ZUXA 4DKFH 5FAAA 1JPFB 5ID0B 1NC4D 4PRHE 3DARA 5E5UB 3HPJA 4YHPB 4ZS7H 2NZ9D 3TT1L 2WQ8A 4YUEH 5ILTH 3PWJB 2AJUH 1CF8L 4NSKB 3QQ9D 4KKCC 5HPOA 2HFFA 3U46A 3IFNL 4R96A 3OGCB 4R7DB 3I9GH 1VKXB 1AXTL 4KH2A 2BHYA 2QADD 4F9PA 1WK0A 4WJ5A 5D1QA 5IT2L 5MEOB 5GGTH 7CGTA 3OB0H 1CGXA 1NCDL 2NY1B 5J1SC 1NSNL 4JRYE 4JR9H 4J4PC 5J3HC 4NOBA 4K23H 4HULB 3C6SA 3MBEB 2XTJD 4GG6B 2VDPH 2IBZX 5DQ9A 2FO4A 3DO3A 4PJEE 4U1SB 3BGAA 4RMSA 1VGEL 1E4XL 3QQ3B 4HLZG 4JM2F 5C71A 5C0RH 3CCHA 3TH2T 4R26H 1H3TA 3VW3L 2VLRD 1DLHB 4M6MH 5FKPB 5C3LD 3GRWL 2BNQE 1IGFH 3HE6A 4O5LL 1J8KA 4DVRL 4WFFE 3FMGH 4QXUL 3R06B 1YY9D 3CLEH 4HUVB 3QFJB 3X11B 4P9HC 1ONQA 1IKNC 5IESL 4NQSB 4O02L 3HE7B 1HHKA 1A6UH 1Z2KA 4LVNB 3U6RA 3AM8C 1S7UB 5F96H 1I7ZA 2AK4E 5IMOA 3ZE0E 3NABL 1IE5A 1CD8A 1FBIL 2Z0BA 4WW1A 3SKMB 5EOQH 2AW2A 4GUPB 4LLQB 1BQLH 1EGJA 3QPXL 3O4OC 4BQBA 1OLZA 4YHYC 4UQ2A 4FQIL 3T0XA 3ROOB 1HWGB 3R0MA 3RJQB 3ARBB 3TA3A 2XA8H 5FDWB 4KZEH 3TGXA 4PJDB 3GMOB 1WBXA 3LMJL 4DKEL 3ULUL 3C8KA 3OKKA 5E94B 2FGWH 2Q87A 3BD5A 2LFGA 4BH7A 4LRIC 4GW5B 5I1KL 2IBBA 4AG4L 4HAGA 2CLVB 4XC3L 1RV6X 5C0GB 4M5YL 4XVUC 4NZDA 5EN2B 5GRVL 4XTRC 3EYVB 3VFGL 3MJ9A 2ZUUA 1CGUA 3BHBB 4PV9A 5C08E 4D9LL 3QCUL 5MENA 3HZYB 4CVWA 5HHNA 1GGYA 3PHOA 3X13B 3M17B 1NMBH 2DS4A 4NO0D 1QKZH 3IDNA 3LY6A 5GSRA 3BIBX 1QRNE 4P59L 3IT8D 4XBPA 2LE9A 4M48L 3VGAC 3C5ZC 1QKZL 1BFTA 5T3ZD 3WUWG 4P49A 4NYLB 5CD5C 1N64L 5D2LE 5I75B 3MLSH 3M17A 4XPHL 4KUCF 5BRZE 5I1DA 1C7SA 4Z8FH 4H1LB 1EUTA 7FABL 2EKJA 4RSVA 2IANA 4ELMB 2VDOL 5FGRA 1TLKA 3IRPX 4O4YL 4CADB 1CD0A 2VL5B 4JRYA 2HVKA 1CFNB 4Z8FL 1WF5A 4X4ZA 3H3KA 4EI5B 4EN3D 1WWAX 4GKOA 1QBLL 3LN4B 1AQDA 4V1DD 3C60B 4MSWA 4RCAA 2V7HA 3U7YH 3VXTB 5J9PA 2ERJC 4ODHL 2MPAL 1XGTB 4Y4HD 5FHBL 5IP4A 2HJLA 4L9LA 4NCDA 3MRGB 4ZFGL 2NY3B 2R0ZL 3CFKB 4ETQA 1T1WA 3ULUF 4XXCA 5KVMC 1CG9A 3QUKB 5SX5H 5JNYB 3BPOC 4OF0A 4Z7OE 4X5WA 3SDCC 2OL3H 3SDAB 1VACB 2VXUL 4XNMB 2E9IA 5EO9B 1T2JA 4FHBD 4G80A 1MCPL 2NXYB 3KLHC 3MJ9L 3WS6C 4HKBA 3Q5YA 4MYWB 3EJYC 1QG3A 3L7EA 1EUUA 1H3VA 5D7LB 3TBTA 3VXUD 5TF1L 1BOGA 1CT8B 4X6BA 1T1WB 4LSTH 5GZOD 5HHPA 4YIQA 1KTLB 4MXQD 4L9LC 1KNOB 3KLAA 1CGWA 1HSAA 1JV5A 3RVWC 5J56B 1G6RL 3V6OE 1A6AB 1YEHH 1R3HB 3E6HB 5I8KH 2O5YH 4FQQA 1OSPL 1N0LA 5DEZA 3H7LA 4JM2A 3ZYJA 3BKYH 1JPST 1JF1A 4PRBA 2FHFA 3EOBB 1UZ6F 2X40A 2OTPA 4K7PH 2X9XA 4U3CA 2M26A 3O41A 3RNQA 1NBZB 3EYOA 1KJMA 3Q6GH 5EZLA 2OX5A 3RNKB 4PYHA 4G6MH 1BWMA 1CFNA 2Z8WC 1P4LB 2B1HH 4R6UA 1ZKAA 4HFWB 4RISH 1MQKL 2WWMD 4OFYA 1P7QA 4WU5B 3FQTB 4P4KA 3L3DB 4G43B 3BQUD 2AK4B 3JTTA 4LOUD 4QHNB 4XNXH 4LVNC 3T0EA 5HHOA 4RGNE 4HKZA 5AYQA 1FZMA 4X8JB 5GRYA 5GRJH 4JQVA 5CJ5A 5IMKB 3DO7A 1G1CA 3MSPA 3QUMA 1EO8H 4M7KL 2WM0A 3OB8A 1ND0B 3QO0B 5E0QA 4NKOA 4DN4L 3VD4A 4OFPA 1D5ZA 5DUPL 1WQVT 1UQSB 5GRXG 4PJGB 1LO0L 1YN6B 3QIUA 3VH8A 1RZ7H 4YHOL 2IQ9H 3VMPA 1R3IH 4KROD 4EUPH 2P8MA 3VFVA 2XT1B 3INUL 1L7TL 2EO9A 1FNFA 4PJEB 3DBXA 4LRIA 4FQ1L 1HQRA 5F7FA 4XCEB 1AD0B 4U1KB 1HZHH 1BZQK 2M2DA 2F74B 1EK3A 2GJ6D 4MDJB 1J86A 1UJTA 2VDKH 3CVIL 4M1DL 1K85A 4RAVB 1Q72H 3CSYB 5J12C 5E1AB 1S5HA 3P4MB 3RIAF 3STLA 4OD1H 4F2MA 3C5ZB 5HHOE 1BZ9A 1BECA 4L8CA 1TFHA 2OZ4A 5DFWH 1ZT7A 3V4PH 4DWHA 4DVBA 1YEIH 4QRUB 4HFWA 3TVMA 4HH9A 2IADB 2PYED 3QXTA 3ULSA 4KUZH 3QI9C 4NNXB 3CFDA 5I66B 4I3RL 2AABL 4QT5B 3O2WH 5GJTH 4G5ZL 4X6CA 3GIZL 1D5MB 4JKLA 5CLWA 1KCVH 4YGVB 4L4VB 4JAMA 4Q9RL 4B7IA 2CKBA 3Q0HA 4NO5B 4DW2L 5EORH 4JE4B 2VXQL 3IDYB 1P2CA 2O61B 3SJVB 1QPPA 3C6LA 4KC3B 3RUGA 1MHCB 3HUJE 5KZCD 1QO3B 2ICEA 3C60C 5L2KD 1A6AA 1UJ3C 2VZOA 5DJXA 2J8UF 2ERJB 3NCYS 1TQBB 3I50H 4MA8H 3WO4C 3SDDD 3MRCB 1WJ3A 1MJ8L 3VD3A 4OZIF 2FDBP 1R5VB 4NQEA 5T5NF 5C09D 5JA8B 2P5WA 5GGTA 4YAQB 5DJ2B 3MYJB 5T3XD 3I6GB 1NMCC 5FYJH 3WUWB 1QBBA 2VDNL 3WFBH 3DMMB 2W9LA 4OTXH 5C9JB 5E8NA 2L7UA 3CZJA 4X7TA 1U58B 1NANH 1BREA 3LS4H 2EDXA 2YN3A 5I16A 5DVKA 4HPYL 3EFDH 4FA8A 1BFOA 1SYSA 1YYMH 3UYRL 4H88H 2BSSA 4F2MB 4EUPB 3MR9B 2IQAB 2RFXB 5KAQG 2EICA 4HBQA 1YYML 3C60A 2WNGA 2FLBT 5F7EH 2WUCH 4KI5E 1MCFA 3VXTA 3C6LC 4EDXB 4WI4A 5CP7B 1YEEL 4IIQB 3AXLB 4XWOC 4FFZL 4G42B 3N9GH 5IBLC 1KIQB 4BUGA 5IMLB 2XN9E 2VE6B 4RBPH 4U2YA 1A1OB 4KHXL 3FONA 2EKSB 1S78D 4LF3A 1DANU 5ID1A 2ENSA 2W0FB 3IETB 4Z7UF 1XCQA 3KPMA 1PQZA 3CVIH 1CLYH 4OSUL 1HK6A 3AC0A 3IDGA 5IB5B 2VUYA 2R2HB 3KJ6H 3GSVA 5DDHA 2CUMA 6FABH 4MXWL 3GBNL 1FL6B 4KMLB 3ZSTA 5E99L 5E9DE 5EU3B 2PYEA 3P2TA 4C54A 3EO9H 3LIZL 1J8HD 3IDNB 4Q6IC 1KELH 1DBJL 3OKNB 3DX8B 5E00B 5LBSH 3KPTA 2DKSA 5HHMD 5LQBH 4IDJL 3JXAA 4WUUE 4M5ZL 4NC1C 4J8RA 3BKCH 4NYLA 4UZGA 5I18L 5LBSL 4UAOB 2YD8A 3D9AL 1I1AC 3FTGA 2A6JB 1FL3B 1B3JA 2QL1A 4WWKC 2J88L 5D6DA 1AC0A 1AFVH 4F57H 2VZSA 1HHHB 5I1IL 2PNDA 1FCCA 4DFHA 2H3NB 2VIRB 5EA0L 3DV6A 3NFNA 1BX2A 1FQ9C 4OF6A 4RGOH 4NJAL 1W72B 3BPNB 4HUVA 3VFWB 2X41A 5DR5L 2BFVL 3L7EB 3TBTB 4NN6B 2LU4A 4LHUA 1JYNA 1BD2D 4K7FA 3JWOC 3QI9B 3DTXA 1F8TH 4JFDA 4HT1H 4BFBD 1E4XI 2PR4H 2XWTB 3ZHDA 4XRCA 3BD3A 4PJCF 4POYA 4HUWA 1UM4L 1KC5H 5FFLA 2UYLB 4YEFA 4LQFL 1FRGL 5EDXA 2UVEA 3ARVA 4Y2OA 4LPUA 4G8IA 1J1OL 2NY5C 3D0VB 2FWOB 3V4UH 1JYWA 4YPGA 5DQDL 2KZWA 4MAUL 4XNUH 3MTRA 4UDUA 5DFTA 3QEHB 4HIJB 4XXDA 1RJLB 2V9TA 2XY1A 5GHWH 5JHDB 3SN6N 1H8SA 3L5IA 4XB7A 4EI5D 3I02A 4W6YB 2Y5TB 5E6ZA 3KS0H 3KXFD 4OZFB 5IW6B 3GJEA 1B90A 1NGQL 2NY6B 3MBXH 3OAUH 3NCYP 5FOBB 5IMMB 4ODWB 5BZDB 3TCLA 2WV3A 3B9VA 3VJ6B 4XPFH 2ZWLT 4TSBL 2HH0H 3PL6A 2NY4B 5A2LH 4K3JH 1LEIA 3BUYA 1JPFA 3O0RH 3SCMD 2XKUA 2IWGA 1QHOA 5D5ME 3QPXH 4X6EA 3VFPB 1U91A 5IB1B 1CGSH 2F54E 2F5AL 1JGUH 4N0YL 1RUML 5KSAA 3B8SA 4ZMAT 1WWCA 2CJUH 3KHOA 2XTJC 3S4SG 4QHKJ 1MVFA 3HNVH 1RFDL 4L3EA 5H37G 3RA7L 3T1FB 2CJUL 1F5WA 4DK3A 3ME0A 3JUZA 5EN2A 4X5XB 2OK0H 1JPSL 4J6RL 4WHCA 4IEFB 2E9JA 2BNRB 4HXBH 2OTUB 3O6FA 4PJGA 3DRTA 5E4EC 5BMFH 1FFOA 2R29H 4OCNC 3QUYD 3NIDE 3IVKB 4L29B 15C8H 1HINL 1NEUA 5T3ZL 4LSPH 2BOBA 5KG9B 4QCIA 3K8LA 5HDOA 3EGSB 1I1FB 2DQDH 2BSSB 1AXIB 4OIIL 4PJAB 1H3GA 1M1SA 2A38A 5TPWL 2V9RA 3MXWH 1YMMB 1A02N 1OAKH 1IAKA 3FB7B 3VFNA 4ZPVB 1CVSC 1RZIB 1PG7W 3PP3H 3EJJX 3NH7H 2RR3A 3RVXD 3ARXA 5DJYB 1KG0B 3GSXB 1MAJA 1FFPB 3IXTB 4GG8A 4JFFA 3VMNA 5DI8A 4U1IA 3FZUD 5GGRA 1HKFA 1BEYL 4UV7H 4HT1L 4GBXA 5DRXA 2YPKB 4U1NB 4OZ4B 3THML 3T0EB 2N7BA 2ZG3A 3I75B 1ADQA 2G75A 4ZSOB 3AROA 4YX2H 1XIWB 2XZQH 3QEQE 4U1SA 3H9HA 5LGHH 1W0WB 1U3YA 3MRNB 1CFBA 2DYPD 4YDJA 5FYKL 3ARDB 5T1DL 5TDOB 5F6IC 2HVJB 4JRXB 1EO7A 4RNRA 4XX1G 4WHYH 2VDQL 3DX6B 3BGFC 1BJMA 3U7WL 3V7AG 4JN1H 1IKNA 5IV2A 4X6DE 5C07D 3V6ZA 1QRNA 4ODXB 1UWGL 2P48B 1U6AL 4P4KD 1JJUA 4NFBA 2ESVD 3O2VH 3OJDA 3FFCD 1FIEA 2YD3A 4HG4K 3LKPA 4LDLB 4MX7A 3ARGD 4JO1L 4YIQB 3OKMA 1KIPA 3GSWB 2PUQT 3HE7D 3BE1H 4ODTL 5J13C 1GAFL 3TJHC 5D7LE 5ESQA 1IQWH 2HLFC 5LGJA 5KW9L 4Z7WB 4G6AD 1HYSC 4X5WB 1NUNB 3SDAA 4OGAD 2Z91A 3REWB 5JDSA 4OJFH 1AGCA 2G60H 2C3XA 4PJAF 4U6YA 2WBKA 5IFAH 4APQC 5E5MA 3UMTA 5C70A 3P4OA 3SKNA 5IG7A 4L3CA 3V0WH 1M7XA 5F9WC 1NDMA 4OBSA 4OGXH 4LSQH 1B6UA 1YN6A 3MOQA 2XZZA 3DRTB 3TN0A 2FO1A 3R8QA 1QSEE 1KTDB 4D9RE 1Y0LB 3FO1A 4LSPL 4LCWD 3BFOA 2BDNL 5K9OA 3EDFA 5DS8A 1VGKB 1M6OB 1FGVL 1K2DA 2YK1H 4P9MH 1AE6L 3O11A 3EJZC 3UEZA 1PKQB 1RAMA 3O6LL 5JPMB 4N0RA 1RZ7L 3BVNB 1FORL 4HWEL 1KLUA 1RJZB 4YHMH 2FR4B 1MHEA 1YYLL 1RUKH 1BGXL 5I8CB 1UFUA 2XACC 1DQDH 3O8XD 4KQ3H 3B9KC 1UEMA 5BV7C 5JHDD 1H15A 3DWTA 3L3HB 5DHVH 1EEUA 1RJZA 4X7EC 1IKFL 3DROA 5BZWB 1NSNH 3DXAA 3QIUC 4M5YH 4PP1D 3EOBA 1HCVA 4K9EH 3I6KB 4Z77A 3IKKA 5KSBB 1ERNA 1YJDC 3MV7D 2J12B 1WZMA 3WN5C 1Q9KA 1IARB 4W70A 3T0DA 4NKQB 2EIEA 5GGVL 1LO2H 3QNZA 3EYVA 2UVFA 3IFPA 5HGAB 3TIEB 3BKJH 3V79C 3CDCA 2HT3D 3KXFE 3NZHL 2P42B 5M94B 4HIHA 2VC2H 1MCOH 4G42A 3MV8E 5GIRA 4QRTB 3RFZC 1NGYB 3UTPD 1OSZA 4U0RC 5SV4A 5DD0L 2XWBA 3DPBA 3EYUL 1URLA 1KCSH 2YEZA 1UB5B 5IESH 4X6DF 2DMBA 1EDQA 1U6AH 2X44D 3D2UD 4EUPA 4PJXA 4YNYB 3MREB 1U0QA 5CZVL 3CPLA 3UJTL 4OLWH 1EZVY 3GSNA 3BUTA 1QFUH 1ZS8B 1CCZA 3UZEA 3VXRE 2DOCA 3H9SE 4L3EE 1XZ0B 5JORB 4QRPE 4BZ2L 1A9EA 1DQML 4BKLA 3DMMA 2XWJA 3QH3B 4Y1AA 2P43B 3VFSA 3QDJE 1TVDA 2P7TA 3FT2B 1QFOA 1EIBA 2GFBA 2P5EA 5KVDH 4I2XA 4LLYA 4BZ2H 4WTZA 1MQKH 2HP4A 1AHWC 1NLDL 4NRYB 4QRSA 5DVMA 2A74B 3BGFB 3JTSA 1NMAH 2B39A 1X5IA 4YZFE 2R0ZH 3GIVB 4D9LH 1BQHG 2QJDA 4YR6A 5CJXA 5HYJE 4LARH 4R90H 4JG0H 4K3EL 3KHQA 3A6OA 3O2DL 4O02H 3LZFL 2MJWA 1DBAH 4K71B 3SJVA 1H3PH 2IPKA 2ZCHL 3QDJB 5F3HA 5AZ2H 4WHTB 3WL9B 1JP5A 4R3SA 3G5YA 2VOTA 3MNVB 3BN9C 3TM6A 3T8XA 3VXNB 3WIFA 1A14L 4GBXB 3LOWA 1FH5H 4U1IB 2HKFL 1SVZA 3TO4A 3U0WL 3WE6A 4OV5A 3ZT7A 3BP6B 4M4PA 1JCKA 5I1CH 3KYKH 1J1PL 3GSOA 3QCVL 3EOTH 1CE1H 2X4SA 1RZFH 5EWIH 5DD3L 4LHUG 1JZ8A 1C8PA 4YO0A 1UKSA 2CQVA 4TRPH 2VE6A 2BSTB 4LSDA 4NHUA 4F3FA 1WLHA 2C9AA 3A6CL 1N6QH 1IT9L 4P9HH 2FATL 4NM4H 2XZCH 2ARJB 3BWUC 4LIQE 5ENWA 4Z7NE 5E6IC 3GM8A 5L0QB 3U7YL 1UADC 2B4CL 4KJYB 5JW4M 3A6BH 43C9A 1QFPA 2DQUH 4NM4L 2LAGB 5D70L 3TN0D 1BAFL 4PLOB 5F44A 1YDPA 4QF1B 4OM0H 1A3RH 1OGAA 4N1CA 2EDFA 3HG1D 2HFEB 5EZOH 1R24A 5IVZB 1IGYA 4RDQG 3ZTNL 4XPHH 2OJEB 2HJFB 5FECA 3QFJA 3T04D 3CMGA 3KR3L 3QQ4A 2WIIB 3LEVH 4TNWF 4UT6L 6CGTA 4L1HA 4ORGB 5EPMA 1RVFL 5L8KB 4PRAB 1D5BB 4QRRB 4OLZH 3UTSA 2C3WA 4BH8A 5EO0A 4D9QE 4AIXA 5LCVH 3F7RA 4LVOB 4TTGA 1ITCA 4YBQD 2FHCA 3HLAA 5MI0B 1LGVA 5E2TH 1F6FB 1G9NH 1MJUH 3V9FA 3SE8H 2EEBA 1D6EA 4MA1B 1VFOA 4HCRL 3OWEA 4QGYA 4MA3A 1QUNA 1AHWA 1YEDB 1KACB 5DJ0A 5DTFB 1AJ7L 2J6EA 1DFBL 2GK0A 2R9HC 4RGND 5C0BE 4FQLL 2DQTH 1JBJA 3HUJB 3GJFH 4XPBH 3S97C 5C0JA 1S7WB 1K4CA 4I9WE 2PR4L 1DBAL 4FQLH 4ISVA 4JJHA 3SDCD 3I02B 1CU4L 3VGFA 4Z6AT 1RZKL 2I9LA 1ZANH 4MNQD 1IC4H 3MGOB 1RUPH 3T2OA 1I9JL 1Q1JL 4KQ4L 1P6AB 1E6OL 4HHAA 4M7KH 3CSYA 5I1LA 1BBJA 2DIJA 3QIUD 4Q9CA 1E4JA 4Z7UA 1YUHA 5L6YH 3S9DB 3MJ8A 2EE3A 1DL7H 2ZSWA 4HQQL 4QRQB 1ZT7B 2B4CC 2ZNWA 3BT2H 3FB6B 1W0VB 3AAZA 3CPLB 5C0EB 4M61A 5ABDE 3QDMB 4ZO8A 4DUXA 3MV8B 5HDBE 4WEBL 3QO1A 3PWLA 2W65A 3PV6A 1FDLH 4C56D 1B0RB 3QG7H 4PYGA 1A5FL 1S9VB 1JGVL 1Q72L 4EZMA 2WIMA 4CVXB 2VO5A 2P46B 4M4RA 3TF7C 5F7WC 3CVHL 1KT2B 1KIRB 2IG2L 3RWHB 3HAEA 2D0GA 5FGCE 4Z9KB 1ZLWK 5K9QI 3OZ9L 4NWTH 3QDGE 5FHAH 2JK5A 3BKML 2OSLA 1J5OL 2JIXB 5E9DB 1HNFA 2K7QA 2OI9B 5T5FH 1CDBA 1T2XA 3LHPL 4BYHA 5ICZB 3AS1A 1BBDH 2Q8AL 4B7LA 3GKWL 5IB2B 5ANMA 4NZTH 3ULVE 3GSQA 3FOLA 4DW2H 1JF1B 5C1MB 4Y5VA 1FLRH 2GUOB 3LHPH 1S9KC 2J8OA 5JDJA 3LKSB 4PG2A 3RDTD 3UX9B 3V7AE 3BISA 4PRDB 4N68A 3CH1A 3UC0L 5JQ6L 4FTVA 4WFFD 1OP9A 4Z5RA 4OQTA 4ZXBB 3EYFB 1J0JA 1H3UA 5F97E 1DLFH 2EE2A 1WBZA 3HTLX 4LL9A 4S2SB 4Y2DC 3E6FA 5CEZD 2W0FA 4JDTL 1AJ7H 3AXLA 6FABL 1ZEAL 3W0WA 5T33L 3ARFA 3LV3B 5FO9A 5FM5O 5FDYA 1RZJL 1L4IA 5EBWB 1U9KA 4X9BA 4RGNC 3RZCD 1B0GA 4MNQA 3IFLH 4HXAH 1JVKA 4CU7A 5D9SB 5EORL 2JELH 1B0GB 1CK0L 1NGWA 3VXQA 3VCLB 4LLMA 4RWYL 5IVNA 5EBWA 2X4NB 2Y5EA 4EQ2A 4F33B 2X1PA 3QSKB 1FL5A 3PP3K 3KYMA 3WUWA 1MFBL 1WFUA 1HI6B 1PBYA 4MA8L 3MGOA 1AQDB 3WFCL 1A8JH 1T5WB 1JNNL 1MI5E 3SKUD 4HC1A 2Q7YA 3T3MF 4Y19E 5I73B 5IHUL 4PUBH 5FF6B 2APTA 3WHXB 1U8PA 1BX2B 1Q38A 3MJ7A 3QT2A 5KS9F 1BIIB 3MRJB 4JKWA 3KXFB 2P4AB 3BP4A 1JN6A 1XF4B 2DTML 3O2VL 1TITA 4PJ9D 1SHMA 4MJ4A 4JQIL 4OT1H 4XB8A 3FTGB 5TE7L 3V5DB 3QUML 4KRPD 2BOCA 4JM4H 1MI5B 3L3GA 4L4TE 2BVEA 2VDPL 3NFSH 2MHAA 3MRRB 2D3VA 3GBNH 4KJWD 4CMHC 4GJTB 1WT5A 2E9BA 1MHHA 5BS0E 3SGJA 1BMGA 2CIKA 5E6ID 4HH9B 4P5TB 2X1QA 4ZSOA 2PTTA 3HAEB 3UP1A 3F12B 1IGTB 4H8WC 4YHKL 2NR6C 4NWUH 3ULVD 2Z31B 3BHBA 4DKAA 4LBEA 4YGVA 4W81A 3BD4A 4EDWL 1EMTH 3GMQB 4FZ8H 4PJFE 1TVBB 5E9DA 3HNSL 5C86A 1FVEB 1A7QL 3NGBC 5KJRL 2AJVH 2FJHA 4LCCB 5CHNB 5HD8C 4L8SC 4U1HB 1J8HB 4PJXF 1EFXA 3U79A 2FEEI 1NUGA 2R23A 5BS0B 3QR2A 4JHAL 4PJIE 1OQOA 5KSUA 4E9LA 2PYFB 1FNGB 3O45A 1KEGH 4TSAH 3ZDYE 4X6DA 3RTQD 1JF5A 5BS0A 4PY7A 1QSFB 3VDBA 4WNQB 1QR4A 3X12B 4RIRB 1BBJB 5I71B 5LGJB 3HKFA 3CLFH 1BGXH 4X6CF 3MCG1 4QWWC 5C0DA 4J12A 3F58L 1BD2A 2NYYC 3UTZB 1X5YA 4HPOH 4YWGH 5IQ9A 4GG6F 4HJ0D 4ZFOB 5M7QA 1Z0MA 5E8OB 3GNML 4YXKL 4LMQI 2ATKA 1JPSH 4J6RH 3UTOA 2HKHL 5SWSD 3MV9D 2AJYL 1MCSA 5BO1H 1Q0XH 3VW3H 2HTLD 2AJ3B 3FL7A 1Z9SA 3I6GA 3VU2A 1E28B 4NUGH 5HYSB 5E8DL 1NAMA 3ZT5A 8CGTA 1JPGB 3M1BA 2FRGP 4I3GA 3DX9B 4ZXBC 2QSTA 3S37H 3QIWD 4YBHA 3ZKMC 4RFNB 2LAAA 4QHUB 2VLRB 1KTRL 1Y6MR 5H94A 2HYMA 4U1GC 5FCUH 3TCLB 4I18C 4GW1A 4LKCB 4HS8H 3JV6A 1QLEH 1ZTXL 1A7RL 1FZJA 5TF1H 4RGMC 5FF6A 1KJ2L 2A74A 4O2CA 4F15C 4L4TA 3DX9A 3C8DA 5BQ7A 4G3YL 4MZ2A 2QSQA 3Q1SL 3FQUB 4MCYA 1RK0A 1G7JA 4AMKH 3K8MA 4JM4L 4OUOA 4IMLA 4K2UH 5HDQL 3OKOB 1FFPA 1DDHA 4HWUA 1I1AD 3DVNA 4P0DA 4NQDB 3PWJA 2HJFA 3AGVA 1OAQH 1YEGL 2GSIA 2DBLH 1KCKA 3ARQA 4X83A 5IR1A 1RHHB 2V5YA 1RZKC 4HF5H 2Q3AA 1ZLUH 5DGRA 1PLGH 4G9FD 2HJLB 3BDYH 4L9LB 1SY6L 5EPMB 1M7IB 2CUHA 3G5ZA 3B5TA 2VDQH 3G6DL 2GJJA 2AJVL 4WI8A 3P0YL 1T03L 1FFOB 5D6DC 5JW4R 4L4VD 5DRWA 4ZAKB 3ULVF 1T5XA 1J1XH 5CINH 5M95B 1YPZB 2W0KA 2B1AL 5EU5B 5ICXA 4YDLB 1U8IA 3OXRA 2HVKB 5INCB 3CDGA 1CGSL 3G6AB 5ALCL 3HS0A 3C2AH 3ARDD 3VXMB 5C92A 5E5RB 2ARJA 5ENWB 2OMBA 3TWCL 1KPRB 4NHCH 3WXVL 1XCTB 2X4OA 4RMRA 4KZEL 2Q76B 4KWUA 3ZHKA 4QYOB 1YNTA 1MWAL 3MRIB 4RISL 4MNGB 1U8KA 1VFBB 3QNYB 1IT9H 5D5MF 5CJQL 1E6JH 3JV4B 4ELMA 3S7GA 3WIIH 3F7YA 3TC9A 2XKNA 2FX9H 5AEAA 1ZA3B 2YRZA 3RU8L 3L3DA 2HFTA 3TBSB 2Z8VC 1NL0H 1C5DB 4WU5A 5HI5C 1T66C 4G6JL 2HLFD 4MNHA 3JTSB 5IUSA 1CFTA 1HE7A 5EZIH 4CNIA 2VABA 4KJQD 4DGVH 3GMNA 3FN9A 3X3GL 4DN4H 3E8UH 1A6TA 3SDDA 3G5YB 1H0DA 5IF0A 1PQZB 3S36H 4KDTA 2P45B 4OAWA 4QXGH 4EBQL 1G7MA 5H2BB 3HZKB 4PB9H 5CCKH 4OLEA 2NY2D 1BZ7A 2FWOA 2EYRA 4M62H 1F4AA 4LAQL 4UT6H 1JYVA 4U3XA 5J12B 5BOPA 5IHBA 4NDMA 1J18A 4Y4FD 2E8YA 4Y4HB 4ZUTB 4KRPB 3VWKA 1CLOH 2NY1C 5I2IB 3DI2B 5DA0B 2A73B 2VXQH 3D85B 4RMWA 5T1LD 2CDFA 4P2QB 4D94A 1WAAF 2H26B 4U4BA 1ROWA 3MGTB 3MBEC 4CMMA 1MEXH 2A6IA 1JNLL 2ADGB 4Y16B 3AU1B 5I8OL 1T1YB 3QWQB 2Q8BL 3QWRD 5I2IA 2DBLL 5JIKA 3H9SD 1BIHA 4A6YB 3P3YA 4JCLA 3RAJH 3WNLA 1DFBH 2VXSL 3FB5B 3BP5B 2FBOJ 2W9EL 4N5ED 3REVA 5DC9B 4K94H 4NQCA 5E8NB 1MVUA 1FYTA 1P6FA 1PY4A 3MRLA 1R3JA 4U1GB 2FO4B 2CK0L 1TCMA 1X3DA 4MJ6B 2PCPA 2AI0L 5A16A 1TQBC 3L95B 3WO4B 3VWJB 1A6TB 2OJZH 2PTVA 5FKPA 1P7KA 4WV1C 3WFDL 1S7QB 2QEJA 2F19L 5DC4B 1EEYB 5CZXD 5FB8B 3VWJD 3F62A 2X42A 4MD0A 5ALCH 5GRVK 1NMCB 2D7OA 4X7FC 4UTBL 3GUTA 2IFFH 2EDLA 5ICYB 1HHIB 1DR9A 4V1DB 1KBGH 1P5UA 4BH8B 4KVCH 4EIGB 5IVXB 2E3VA 4JQXA 2HN7A 5D72H 1NAMB 5L7XH 3GBMH 4JO4H 5DT1L 3WFEL 3QJFA 1NBVH 1JNHA 3IDGB 5IB5A 3PGCA 5GS1C 3FAXA 1ZLVH 1QFWL 1EO5A 2EE6A 5GRJL 1DQLH 5I74C 3DXAD 4JFQB 1H3XA 3WLWC 2XPGA 3KYAA 4LCIH 2HFGL 3MLRH 2ZKHH 4DZBA 4U3HA 4R0LA 4NBXB 4N1EA 3VFOB 3X17A 2VLLA 3BMVA 4QF1A 4LCIL 4H25B 3FFCA 3OKEA 1KYOJ 3FO1B 5CGYD 5F7EL 1FGVH 1INDL 3BX7C 1AH1A 4YBQC 4GOSA 3MA7A 2F53D 3MLTB 2EXYD 2YPLD 4C57C 3BH9B 4Z76A 1EO8L 5FDWA 5JUEL 2PXYD 3MLUL 2R4SL 5E2WH 4G8EB 3JWOL 5IW1A 1HSBA 5LQBL 3PG2A 1RUKL 2F5BL 4HK3N 4H25A 2EZ0D 2NW3A 4QOKD 4CVZB 3W81A 4QRQA 3WIHH 4EI5C 1NCCH 4TNWK 3MJ8B 3TESA 3P30H 3HZMB 4OGYL 4O58L 4U49A 3QJHA 4Q6IB 3A6CH 3PDOB 4QO1A 1A47A 5EO1A 4PJFB 5DJ8A 1UH4A 3GEWB 3O3BA 5KS9A 1C16B 2ADIB 1FZKA 1IRAY 1BOYA 2JLLA 5D2LB 2UZIL 4E41A 1OW0C 5IVXA 2NTFA 1K4DA 2JB5H 2AK4A 3NCBB 1IBGH 3GSOB 4WWKB 2ESVE 1UCBH 4WDIB 2ZUSA 3S96A 3U82B 3EIFA 4YR6B 4D0BA 4ODUA 1I8LC 1ZHNB 3MBEA 5TDNA 1KEMH 2FZ3B 2BOCB 4ALAL 5F1SA 2YUXA 5AZ2L 2F54D 3VXUE 4Y4HC 3CUPA 3L95A 3LS5L 1NAKL 1FRGH 2UWEB 4I3SL 4WRLA 3T4AB 2GFBB 2P5EB 3VWKC 5ACMA 1T20B 1CK0H 3KPNB 1I85A 4ODUB 3V6FB 4RZCA 2HWZH 3DIFB 2W0LA 1IGCH 4EN3C 1IC4L 4YPJA 2VKWA 5JXAH 2X10A 4XHQA 1A6UL 2EYTA 3T0EE 2AQ2A 4YHPA 1ZT1B 2D7QA 4Y16C 4JPKH 3JZ7A 1PGRB 3MRBB 3K3QA 2VDNH 1T7XA 4JB9L 4Q0XH 2FB4H 1CR9H 1KCRL 3AS3A 1MCNA 1S7VB 1QQDB 4GSDL 5E1AA 5E8PB 4IRZH 5MEPA 1A7PL 1MCWM 1FC2D 4QLRA 4YDKL 4LHUB 1OY3B 1P9MA 2YBRB 4ZNEE 5DEFB 3HMXL 2DI9A 5AUMA 1SYVA 1PKQE 4R8WH 2ZKHL 3GSNB 4X6DB 4YBLC 1MFAH 3HI1B 5SWSB 3B9KA 5D8JH 1HEZB 3SQBA 1WC7A 5K33A 4FFVD 3VH8G 1TCRB 4N0FB 1ZLSL 2V9QA 3G08A 3N0PB 4ONFL 5I0DA 5EC1B 4AM0B 4ZG1A 4JFXB 5EBLA 1QYGL 3H6JA 3ARRA 3TNMA 5ITFB 4MGXA 1NGZA 4F37K 2IGFL 4KMTL 4PY7B 2X70A 3CZFA 4UINH 2BNUB 5C0AB 4HXBL 1P4IL 1YEJL 1IC7L 1Y6NR 4I77L 1CL7L 3MCLH 5TH2B 3TIDB 3E3QC 1UXSB 3O6FD 1KTKE 5IFJA 5IROA 3SE3C 5HGBB 4HLZH 4O4YH 3BRFA 3DROB 5BZWA 5D7SL 4UB0H 3QG7L 1T2QH 1BQHA 2IPUG 2VR9A 2J4WH 3WJJC 2EDQA 4JPIA 3FOMA 4NGHL 3OKLA 4XVSL 3D3VE 1KTDA 5A16B 4LLUA 1CDGA 1AGBB 4C56A 2JJUA 4N9OB 4Y19A 1ITBB 3IDIA 1U8LA 2VDRH 1NDMB 4NGHH 5HHNB 2OBGA 3CX2A 5D71L 1MHHB 3VRJA 2BHZA 3HC3L 5DJAA 1KEML 1I85C 3B9KD 5JO5B 3IF1B 4JY6B 1XGPA 3VXSE 5MHSD 3ROLA 3RZCB 3DURA 1K8DB 4RWHA 2CGRH 1QR1A 3PNWB 5EU6B 4EUPG 4JPWL 1MFDH 4MD4B 3WMSA 1JI1A 2VZUA 4YQXH 2BJML 4QTHA 3CU7A 3L3IB 4MNQE 4ELKA 3CD4A 1T7WA 4JY5L 4D0DA 1NFKA 1YQVH 5FKAB 4ZSOE 2H2PD 2J1KA 4PJHE 4KZDL 1BFVH 3RL1B 5ECJE 3WFHB 2XXMB 1OD7A 4PLJD 1CGYA 3UJIL 2DLTA 4NQDA 4ZNEA 1VPOH 4KZDH 5I1LB 1GGIH 3ZKXB 3IU4L 1FG9C 2AJXH 3MMEB 3QXUA 2Y25A 3WNKA 5C0CA 4CMMB 4XZUB 5GGTL 3ZE1F 4A2LA 3H9SA 2Y23A 1MRFH 3NFPB 4OD2A 4HJGA 4YX2L 2HRPH 2JIXD 4P5TD 1PVHA 1M71B 2EDOA 1J8HE 1T0MB 5CKAA 1JMXA 3DUUA 3HCVA 4H5SB 5C2BH 1MRDH 1FAIL 3H9HB 4PRHD 1IFHH 1VA9A 3O81A 4JDVA 2OP4H 5C7XL 5A40E 2G5BB 3C6LB 5DMKB 3VXOB 1GGBH 3HFMH 5CMAA 1I1AA 1XFPA 2JCCF 3SQOL 3WBDA 4MA3B 1ZGLP 1IM3A 3GGWB 1WBZB 1PG7H 1I3GL 2HVJA 4JRXA 5LWYH 1G7PA 5F1IA 4M7ZC 4XMLH 4PLKD 3VGHA 3P73B 3LKRA 4KROC 5JR1L 3MV11 3GKWH 1QNZL 1YPZF 5T5NG 5IHUH 1F45A 1LEGA 2P47B 3I85A 3LAFA 3RWDB 1S7XA 1KJ3H 1Q9OA 4G6KL 4KV5E 5TE4L 1U8KB 1VFBA 5EU7E 1GC1L 4XWGH 1QBML 2BERA 4FABH 1XR9A 3HAEG 5CJOH 1LEKB 4X9IA 5D1XC 3O4LA 1XGQA 5GRUL 4XX1E 4MA7H 4X9GA 5MEQB 4JQXC 4OZFG 4P2OC 4NUJA 3FT3B 4ZYKA 1Z9OA 1MF2L 4AQOA 1WTLA 1LP9E 3KS0J 1LP9A 1MNUH 5I15L 1BLNA 1GPOH 4EI6B 3QG6B 4RMUA 1AO7D 1YMMA 4UQ2B 4Y4FA 1AGDB 2Y06L 3RWCB 1JFQH 4F7CB 2CDGA 1DEEA 5F1KC 2DQGH 4PJ5B 2XZQL 4KK5C 3VFOA 2DI8A 3ULVH 2W38A 1IKFH 1A0QL 2ZOKA 4X0KA 3DV4B 4A6YH 1WCBB 2Z4QB 5DJZA 1OTUC 2B0SL 3I6LE 5IWLA 3SKJL 1S9VA 2MKLC 2GTWB 3EYSL 4ZNCD 4AJ0A 2IPTL 2DWDB 1N5YH 5FYJD 4KY1H 5CJXC 3NCMA 4AEHL 1LO2L 2CKBL 3P4LA 3N1QC 3CU1A 1CF8H 4ONHB 4EEEA 2CDEB 3TV3H 4FP8L 3S37X 1JPTH 3GMPA 3L5XH 4K8RD 4U6HB 5TQ0H 1OAZL 3SGDI 1A3QA 1ZEAH 3ILPB 3MLXL 5GGSA 3ZZ1A 5IB3A 4NN6C 3KLHD 1TZHB 3SJVD 1A64A 3THMH 4ZS6D 4YEEA 3SGKC 2Z35A 2DDQH 3T4AA 2RQ8A 3I84A 2DM7A 3D5OF 5ESVA 3SY0B 1R5VA 3RI5K 2NW2B 1HYRC 3RWJA 2AERT 2P5WD 3RGVB 3FQUA 3G5XA 4WO4A 2X4PB 3UROR 1RUQL 3B2VH 4HUNB 3W2DL 4D0BB 5GXBB 1VFAB 3UPRB 3GI8L 1WEJH 2ADFH 2I24N 4F7EA 4OZFA 5IW6A 4QEGA 1Z5LA 3DMMD 4HPYH 5C0FB 4TUJA 4DZ8B 4QRRA 2YPKA 3CLEL 4U1NA 4MXVF 3BGMB 5BJTA 1UWGH 4FQCL 3ZE0F 4GRMA 3LEXB 5B38B 1TZIB 1S7TB 4G8FA 3CFDB 1WFTA 4JO1H 1NCWH 3K1DA 3PXHA 1E28A 3HLAB 4NKIL 5IFHL 3UCRA 1NJ9B 1XR8B 3MV8D 5IROC 1MCQA 3SE3A 2AEPH 4NQCE 4FFZH 3MRPA 3ULUC 3PDOA 2PYEE 5CZVH 3QJHB 4G6AC 2F58H 5B3JF 3P0YH 1CI5A 1A2YA 3LRHA 4JJ5A 4P46A 4NO3B 5HPMA 5DRZA 3RHWF 5HHOD 4CN1A 4MB5A 4S11A 2BP3A 5GJSH 3C5SA 4YH6A 5ISZA 1TTGA 1B9ZA 3P77B 3TYGL 5CHNA 4CGTA 2FBJH 3VXSA 4KQ3L 4NUJB 1F13A 1CICC 3CFJB 2E7LA 2VXVL 4JN2A 5DMGD 1A6WH 5EU7C 5ISZB 1N0XH 5FIEA 2A77L 2VLME 2PYFA 25C8L 3GI9H 5T1KB 4XVUD 1MCEA 4GH7B 1U36A 2BNRD 1PAMA 2HT4D 2VLJD 3ZYIA 2ZUWA 3GJFK 1W0YT 4OFIA 3VFRA 1P5VA 4FZEL 1HOCB 3LQAL 1B6DA 3X3GH 4OCWL 1T80A 4H20L 1TJIL 5DMYA 4FXLA 1AD9B 2CRMA 1OCWL 3L3GB 5J6GB 1NFDF 3LVEA 2X4RA 3HPLA 7FABH 5B38A 1A4KB 3QUXA 3U0WH 4PG9A 4P2OB 3BP4B 3VRIA 1F90L 1IGTA 3BZDA 3MRJA 1KUMA 3ZE2E 1YY9C 5ID1B 4JDVB 1JZ4A 2CRIA 1RVFH 3FONB 4PGZA 4JFOB 1FFQA 4NHCL 4H5SA 3RVXC 3H2WA 4PB9L 5JW5B 3MRRA 1T20A 4RFEB 2RJMA 1KPUA 1R0AL 2VQ1A 5EOTB 1A1MB 4XH2B 1AR1C 2VAAA 2VZ1A 4ZDHB 4HWBH 3TBYA 2C1OA 1XIWC 1L0YA 1U93B 2DWEA 3SDAD 2VC2L 1F8TL 3IJHB 3BIAX 4RFOH 2LQRA 1BIIA 4O51A 1DEDA 4PGDB 3KLDA 3U48A 5J3HD 5GGUB 3TBWA 3U2SA 4TUKH 4J4PD 1JWMB 5IM7A 4OZIE 4OM1H 2R69L 1EEQA 1BOGB 1CT8A 3GSNH 1OTTC 1RZJC 1W8NA 4JN1L 5D5MB 3ESUF 4CU6A 3H9SB 4XP5L 1JK8A 3MRKA 5J9PB 3TCXA 3U1SL 3ZSSA 3AUVA 1UJ3A 4LVOC 1P4BH 3IDMB 3NIFF 4GAJH 3L3JA 2I9TA 4LCWA 1CG9B 3QUKA 4Y5XC 3V0VB 2VLJB 5D7JC 5DSCB 1K8IA 2C4XA 1F00I 3EYFA 1Y6KR 4MA1C 4IRJA 5F6HI 2CSPA 1EZVX 3IFPB 5I1CL 4OZIB 5CBEA 2JB6B 4UTBH 1FFNB 4NRZA 4S1RL 2VIRA 1KF9B 2MWCA 4X4MA 4AY0A 4X4ME 4LASH 4ZOBA 3W0WB 1MIEL 1FNSH 4C56B 5CJBA 1S7RB 1MJ8H 3W9DA 5FO8B 2CKBB 4JG1H 4U6VL 1UYWH 5DEGA 3O2DH 4BJLA 5E95B 4OZGE 1CD1A 1QVOB 4GSDH 4DKDC 2DQFB 1CYGA 2V17L 4G9FA 2DLFL 1ZVHA 5HGBA 4UT9H 4FXGB 5EUOB 5MEND 2OCFD 1BM3H 1V3LA 2PO6A 2DLEA 5IWLC 4OM0L 1I7UA 4M6AA 1JGVH 5IGXH 1NL0L 4HEME 4KK9C 3V5KB 2WUBL 2BXZA 1D5IH 2DQFA 3HUJF 4GRWF 1BD2B 2HFGH 3MLRL 3UTTA 3LPGA 4A2MA 4XBPB 1NBQA 4EIZC 1CXLA 4M9OA 4P9ML 5CGTA 2BVQA 1L7TH 1WZ1H 4N0UE 3QAZB 3MRHB 5FHAL 1TNMA 5AG9A 1WIOA 4JFYA 3D1MC 1DVFC 1OGAB 1LO0H 1OT2A 4P4RA 4LLQA 2VLKB 4F58H 3IU3B 4P46B 5HPMB 3MLVH 4TNVF 1FFNA 5BVJA 4WW1B 1VGKA 4M7JH 5BV7B 3U0PB 3OKDB 4N8VB 3NFPA 4OD2B 4OF8A 1LDPH 3WIIL 1S8DA 5BW7A 5ILTL 4HS3B 1W72H 3QIUB 4ENED 1B0RA 4OD1L 3A67L 2XQYK 2PO6C 3WD5H 1A3RL 4WFHE 4Z7QE 4TNVK 5HJ3B 5MEPB 1TZGH 3LKNA 2UUDK 3QBTB 2H32B 4ZUUB 1UZ8A 1JNLH 5EZIL 1YJDH 1CIDA 4O9HL 1M7IA 3O3UN 1ACZA 2B20A 4WWKD 4GRWB 4AL8H 2VAJA 3KR3H 1T1ZA 3CX5J 4KK6C 4YFEA 4NZRL 1A2YB 2QQQA 2BRRL 4R97B 4I0PD 1ZOXA 3ZL4L 1MOEA 1SYVB 2D2OA 2PO6D 4JLRB 5HGDB 1F2QA 3D39A 2AQ1A 2CMRL 2FYYA 3OKOA 5I19L 5F70A 4HHAB 4NZRH 5T1DH 3ARTA 2X7LB 1JUFB 1P7QD 4IOIA 4QHKI 1KSRA 1T7ZA 1OWWA 4LLWA 4O2EB 5JUEH 1WITA 2VMFA 3L3KA 3RY6A 1D3CA 2PF6A 5BCAA 5HHOB 1QEWA 2BVTA 5K9JL 5HYEA 4F7PB 2F53A 1FZJB 3OJMB 4WEUD 4I48A 4QHLA 3QHTC 2Z31D 4HH8A 1N7ML 4L4TB 3OPZH 4GRLB 4TUJB 3ARGB 2ZUTA 3UAJC 5C0BD 4R7DA 1VKXA 4BK4A 3W9EA 1RSFA 5KVGL 4NSKA 2FH6A 1O7VA 1U8PB 3V6ZB 4NQVA 4XP9H 2H9GB 3SDCA 5C0BB 5FGBC 4HGMA 4L5FH 4AIZA 2DQTL 2F53B 1UCTA 2D31B 4PJCB 3BKYL 2E7MA 1TENA 1NMAL 2X4RB 1X7QA 1XF5B 3HPLB 3X3FH 4JO4L 1NBYB 2HTKD 3BW9A 3QRGL 3T0VA 1SMOA 2DQIL 4Y89A 3MRQB 4NKMA 1NGPL 3KPSD 4BK5A 1U42A 1UGNA 3DYPA 3OKYA 1ORSA 4I4WB 4K71C 4POUB 5F7NC 3ARSA 5MP6L 3FRPG 1KTLA 3BEVA 4KTEH 5D9SA 1X9QA 3U36B 3SE4A 4NBZB 3MRGA 4KKBC 2ZUVA 1YEEH 3P9LA 4RWYH 4C4KO 1NLBL 2NZIA 4U2ZA 4ONHA 3T3ME 2GSGA 2XWBB 3C5JA 2DQEH 1B88A 2GT9B 4G80B 5INDA 2IAMB 2R1YB 1I8MB 3O3BB 4JN2B 4NO0A 1A21A 2XG4A 1RUPL 1EJOH 2AEIT 3MLYH 1M05B 5JIHA 4TVPH 5D6CA 1N3NA 4FQ2L 4J3OC 3TJEL 1N59B 4WFED 1Q0YL 4XC1H 3WJJA 2VLLB 1VSCA 1DUYA 3DVGA 4NJ9H 4P2CG 8FABA 4PJ5E 2R23B 5E2UH 4P48A 2VLKA 4YHLH 1FAKT 5C9KA 2Z93B 1TJHL 1N59A 1J8HA 1QFWH 4M03A 4PG2C 43C9B 1ZE3C 1AGDA 3KPOB 4FQ1H 5J0BA 1WGOA 4MXWH 5JQ6H 1CLZH 1NGXA 2PXYB 3FQXB 4MLSA 4C83A 4R2GB 2V5MA 4OIBA 2Z31C 4HJJH 3CJJA 3HG1B 1MCRA 4PJ5D 2I25N 2AEQH 3RWFB 3GUTB 2PW1B 3OXSA 5D8JL 1DP0A 4P5TA 4DTGL 1QBAA 5ERWB 3BP6A 2X2YA 3LRSB 4D2NA 3TO4B 4HDIA 3DUUB 4BFIB 2B2XH 4B41A 3LPFA 4KI1A 4I3RH 4IOFC 4G5ZH 1EEYA 5KVEL 2X05A 3HR5B 4NWTL 4KUZL 1HH9A 2X89A 2FJGB 4LFHD 1AQKH 1I9RL 1MELA 5DEGB 2XNAA 4Z95L 1MRCL 2NY0B 4BM7A 1T3FB 1FNEB 1FJ1B 3V52L 3GHEL 3O3DB 2V2WB 4IBLT 2R4RL 3BIKB 1SJHB 4NN7B 3F7VA 5HYJD 3QUZD 3GB7B 4P2RB 4JPWH 3VD5A 1RZJH 4PJXB 4YNYA 5F9JB 1OAZH 2LVCA 1MAML 5FYLL 3SBWC 1LK2B 1DBKL 3K2UH 1UM6L 5FYJE 1MCDA 1ONQB 3KYMB 1B2WL 2CR3A 4E42A 3WS3A 1ETZB 5FUCC 2R0WH 3D39D 5I76A 4BKLB 3MA9H 5KOMC 4NQCB 2P44B 3Q5OA 2FCBA 1BVZA 3G9AB 4GT7A 1KN4L 3UTSE 3CFKA 3MLPA 2W9DH 1FAIH 1UC6A 2E6QA 1HH6A 2B1HL 3QNZB 4PJXE 4ONOA 2IBZY 2J8UB 4ZUVA 2ITCA 3X11A 4NDMB 4WCYH 3QI9A 4ZUWB 4LQFH 3OMZA 3GK8H 1X4ZA 3RJDA 5LWYL 3BOVA 3CFBA 2DMCA 5DHVA 4RGMB 1YC8A 3V4VH 2D4FA 1NC2D 1MFBH 4TTDD 2IALA 1F6AB 3F7QA 4JY5H 5DVLA 5EUKB 2EDBA 2PN5A 3FMGL 4GKSA 2WLZA 5DHYB 5EIQA 5JW5A 1FNGA 3V8OA 1IL1A 2ZOLA 5E2UL 3CH1B 3CSBA 4CW1B 4ZFZA 1NCAH 1SMAA 3RPIB 3RWDA 3MV7E 3HPJB 5DUML 5IOPA 1KEGL 4Y88A 4DOHE 5CGYC 4KDWA 2CPCA 3B9EA 2NY0D 4PG9B 5DS8B 5E9DD 3UPAA 5EBMB 5DURD 1OAYL 3TZVB 4HUMB 4PTUA 2DM3A 3CDYA 3S4SA 1YNKL 3HI6H 4J8RB 5E99H 2Q76A 1KPRA 2GW5A 2IAMC 1F3DH 5CJOL 3NZ8A 5GRUH 2FGWL 4M1CC 1G1YA 1A4JA 3KYNA 1N0XL 3F7YB 1FFRA 5CBAA 1OB1A 1U3ZA 5C0AE 2PETA 3QPQD 3DVIA 4NFCA 2YUWA 3EYQD 5I75C 4ZS6C 2QADC 4EDWH 1CL7H 3MCLL 4POZD 5AYUH 4D9RD 4XMLL 3KPMB 3PHQB 5KSBE 1OD9A 3TPKA 5BXFB 5GJTL 1ACYL 1GGCL 3GIZH 1ORQB 4IRSA 1S7VA 3MJ7B 3FQNB 4R2GC 3BSZH 5IJKC 5SX4H 1YQVL 4NT6B 3QUZA 2IPTH 1DQTA 3MXVH 5E8EA 5HY9A 1IGIH 1OHQA 5IMLA 3S35X 5ICXB 3VDAA 1UACH 4J3TA 3KPSE 4WUKH 3QFDA 2I9TB 1CDCA 1S5IH 4JHWL 4RRPA 1AIFB 4OZHF 2DYPA 3TO4C 5DYOB 1DDHB 4YAQA 1G7JB 3ET9F 1UT9A 3C5JB 4RGNB 1HDMA 4RDQF 2K1MA 5D5MA 1A6VH 4HGWA 4CDGC 4MX7B 2CDFB 4JO2H 1ZHKA 4P2QA 2IF7A 2NY3C 1MQ8A 5EZJA 3JVGA 4Y5XA 1F4XL 1NCDH 2KPNA 3SDCB 5J11B 5BZDA 4A6YL 3HUJA 4JEGB 5D1XD 4TQEL 4J3WA 2Y7QB 3TH3T 4Y2DA 1A1NA 4JAMB 4F7PA 1NCWL 3GSUB 4NFDA 2FGZA 2ADFL 5DUBB 3RKDC 5I73C 4HIIB 1W0WA 5GS0C 4IDLA 3T2NL 5B38G 1CICD 2WP3T 5DJXB 2B1AH 5FUZH 5EO0B 2OTWB 4Y0GA 3TBVB 1FV1A 2AV1B 4PJDF 3RVUD 4WWKA 1SEQH 4R4BA 4DGIH 3VA2C 2XFXA 5F9OL 1R5IB 1JGLL 2FX8H 2YPLA 3QUZC 3ZKSD 3BZEA 5HI5D 3UTZA 4WTWA 3LD8C 1NAMH 1C12A 3HI6L 5F7HA 1UH3A 5J7CC 3QA3B 2DYPB 3ARBD 4MDIB 4P5TC 3V2AR 2W91A 3VXSB 1TJGL 1RFDH 3SPVB 1K3IA 3PUCA 4PV8A 1I9EA 3DBXB 1XEDA 3B4NA 3EDJA 5FA4A 4JZNB 3G6AA 1AKJB 3RU8H 3FAWA 5I1EL 1QFWI 1ZHBA 2XICA 2XPGB 3DLQR 1EAPA 4LCCC 4Z77B 1P7HL 3D3VB 3PGFL 4GQ9H 1J5OH 1WZKA 1X5ZA 4H26A 3WFDH 3QUYA 3MCKB 1GC1H 2DQJL 4N8CH 4X7SL 4O2FB 4NKDB 3TWCH 4G8FB 4MVBD 5BVJB 3UTTB 2C7UB 4X6FA 3GMQA 1EPFA 2OQJA 5DUPH 4JREB 5FEBA 5J89A 4E5XB 2FSEB 5I74B 2OTWA 3BWAA 1NC4A 3DGCR 5L2JB 5ETUA 1M6OA 3BAEH 3PJSB 3BXNA 2VJXA 1MJ7L 5EOCL 4JFFD 2AV7A 3QDGA 4UIMA 2D9CA 2VNCA 1HZHL 4LNRA 4P57A 2E5EA 2HLAA 3V5KA 5B3JE 1AI1H 5J6HB 3S34L 5JOFB 2QADB 3V6OA 3W9DB 2SEBB 4XWOD 2BY3A 3E8UL 4I8DA 2A6KA 3HC4L 4JR9L 4PJIA 1VFAA 4ZFZB 4PV9B 5JA9A 4XMKL 2ZG1A 4UNVA 5BV7H 1QZ1A 4W4OC 4GS7B 3CMOL 2R2BB 5T1LA 1YEKH 2P8PA 2EH7H 1HQ4A 5JHDA 1FN4B 1Q9WB 3IDYC 5C07E 3SDXA 3GRWH 5HHMB 4F7MB 3EW3B 4KHTH 2VB5A 1UJ3B 3MV01 1OQXA 4I18B 4Q9BA 5HHVH 2IQAA 2RFXA 2YN5A 1FGNH 2J8UA 1XMWA 3GFUA 2V2TA 2LVEA 4KHTL 2GITA 3F6LA 2Q7YB 1U2HA 3PQYE 5C0ND 1QOKA 1X6LA 4S1QH 4LK4A 4CVZA 1BQLL 4JZOB 1C5CL 1GAFH 2F15A 5B3NA 1IQWL 4JPVH 4OLWL 4XVTL 3SGKA 2W60B 4I18A 5J11C 3RWCA 2A83A 3BE1L 4ODTH 3E3QE 4F7CA 4K7FB 4P3CH 1G9NL 4S2SA 2DTSA 3UO1L 2Z92A 3LV3A 4WIQA 1JE6A 5EU4B 1LWRA 4OJFL 2OL3A 1ZWIB 3IJSA 4PLKC 1IMHC 4PRNB 5IBTH 2F5AH 1MH5B 3VWKB 1T1XA 5JZ7C 3SGEI 2DQCH 3DNKA 1V7NH 3ZDXF 3LDBC 1E27A 4ZFOL 4PIRF 1FJ1A 3QHFH 1N6UA 5MP6H 3RA7H 1T3FA 3RUGE 4WWID 3U83A 1RZKH 2ICWJ 4JG0L 4FRWA 2WW8A 1LE5B 4N8PA 3T3PF 1JNHB 1RY7B 3QUXC 2HWZL 3S36X 3S5LG 1FNLA 4EJ1C 2ZCLL 5T3ZE 2NY7L 3RVTD 3VXMD 1G7QB 1LVEA 5E2JA 1MCJA 1LP9F 5DJDB 1I75A 5H37H 4Z7OF 4ODSL 1IAKB 3SDXF 3ZKQD 4HWEH 4LFHG 1RK1A 3IAPA 2FB4L 1YZZA 1PKQA 1Q0YH 2VLMD 3IB4A 4XC1L 4YBLB 5GS0L 3O8XB 1TPXC 5F3BB 5AAMA 5EU5A 4U1LB 3HG1A 3L3OB 4NRXB 1GCFA 2EDKA 1MY7A 5DRNB 1WFOA 3WNMA 1AD9A 3NH7L 2H2PC 2FX9L 4RQQA 2WWKO 4XMPL 1JYXA 3QDJA 1MWAA 1NBVL 4L8SA 5F3HB 1KXQE 2V5TA 1YPZE 5L88L 3G6JE 3MV8A 1W8OA 2X1OA 3DSFH 2YD9A 5CIPH 1U8IB 1HXMB 5TQ2L 4UAOC 2H1PH 5EIIB 1BHGA 2AKRB 2VLKE 4JY4B 3RX8A 5CWSA 3FCTA 4ZAKA 2OL3L 3H0TA 43CAB 4NQTA 3QWOA 4GAFB 2APBA 1HI6A 5CSBA 5C0CD 5TQ2H 5KN5B 3SO3B 2Y72A 1LE9B 1TTFA 2O5XL 2X5PA 3B6SA 1I8MA 4I13B 2AP2A 2CO7B 1G84A 2P5WB 2CK2A 2GSGB 1T0PB 1KOAA 1ZVYA 1PZ5B 5HI3D 5DD0H 3UYPA 1LK2A 4GLRH 1G0YR 2CMRH 1R3LB 5DRZB 4M7LL 3SKOB 5IJVB 4PD4J 2BC4A 4X7TB 4G8GA 3BPNC 5FKAA 5HYFA 1C5CH 5I16B 3B5HA 3PL6C 5KZCB 4Q9RH 1GOGA 2EXYC 1UWXH 3WLBA 5J8OA 1S7WA 4ZD3L 4PRHA 1KJ2H 3GJEB 3MUY1 2C1OB 5I8OH 3D0LA 4LCUB 3SBWA 5C0CE 2I5YH 3RVWD 5T1KD 5HYQB 5GIRB 3MZGB 4FQJL 3O41B 4TSCL 3RNQB 4PJCA 4LNRB 2YRPA 3HNTH 1CZ8L 1D5MA 1HHGA 3DGGA 4YGAB 1U8OB 3RZCC 4UBDD 5E56A 4LCUA 4XAWH 3LKQA 5D4QA 4FFWD 2C1PB 1MIMH 3BYTA 1SBBA 1ZANL 4UNUA 2P1YA 1JGEB 4UIKL 3GJFA 3R1GH 2VLJE 2ICEB 4ODVL 3L1OL 5ERWA 4GG6A 2OZ4H 4PGBA 1OTTD 1H3PL 2ZCHH 2XWTA 3Q2CA 4E41B 2HJKA 1FH5L 3V4UL 3CH8A 3LH2L 1OM3H 5D2NB 4AK1A 3T0AA 1IAIL 4IOIB 5DXWA 5GGSY 2IGFH 4KMTH 2QQKL 2YS4A 4MAYC 2DWDA 4LEXL 3VFRB 3QFDB 3HG1E 3RL2A 2F8OA 2PW2A 4HMEA 5DD3H 5D7IA 2GAZB 3CC5A 3SKOA 5IJVA 1ZXQA 4WO4D 4XPAH 3MBXL 4G8GD 2G2RB 4WW2A 3WCYA 2DLFH 2JJTC 4QCIB 2VDMH 3WEXB 4I5BA 4CUCA 1Q94A 4XPAL 4OCYL 4M3JA 4N5EC 2GY7B 3VGDA 1WBYA 4FXKA 4YHML 1FE8L 2XTJB 3UXFA 4MDJA 5GS2D 3MACH 3QUMH 2CRYA 4ZYKB 3L6FA 3FQRB 4DFIA 2ZPKL 1NEZB 1MSPA 2FL5A 2NLJB 2BNRA 5JW4N 2XN9B 2VLKD 3C08L 2EDRA 1FE8H 3VRLF 3R0NA 1AGFB 2CDGB 4K9EL 4KROB 1OVZA 4OCSH 3GKZA 4KDVA 4MCZB 5BVPL 3RTQA 5I18H 3MRPB 5EZOL 5DEFA 2DQEL 5GSVA 4G7YH 4QRPB 4NKOB 2QHRL 4NWUL 3KPPB 1MCHA 3AS2A 1PG7L 3I3DA 1VHPA 2OR9L 2LTQB 3RRQA 3U9UA 4MMZC 1X7QB 1XF5A 4P3WA 3KJ4C 1S9WB 1U8NA 2XQBH 3BGMA 3N1PC 2XFXB 4LEOA 2I9LB 4PJ7E 5BMFL 1I9IH 1QPXA 2W92A 1I7UB 4V2CB