1RULH

Crystal structure (d) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 5.6 with a data set collected at ssrl beamline 11-1.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
221
Chain Sequence
RVQLQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords immunoglobulin igg2a, light chain
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
total genus 45
structure length 221
sequence length 222
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rulH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rulH01
3F5WB 1K2DA 4Z78A 4H0HB 1G6RA 3K3QA 4HS3B 4IHOA 1A3LL 2R39A 4WY7H 4ZAKA 1G7LA 3I3BA 4YBLB 2I27N 5A3ID 2EC8A 5DJXB 4P2RB 1QLRA 3T65B 1BZQK 2ICWI 1FNEA 3QFJD 1FYTD 2X4PA 3NFPA 5F7WC 1OPGH 3RIAF 5FO7B 4HWNA 4WU5B 4X4XA 5F21B 4OFYA 5F7LB 3P4MA 3OHXA 4OD2B 1JVKA 1OGTB 2OS7A 1F90H 3GNML 3VFNB 3LKRB 1BQHG 2X4UA 2EC9U 1JFQH 3WKMH 3TN0B 4ZUWB 3RDTB 3QUXD 2VL4A 1I1AA 3M17B 2DIAA 4NQDD 3HNTL 1YECL 2IMMA 2VDRL 4PRDB 2YPLD 4QRRE 2FEDC 2IQ9H 3WN5A 1L4IA 3QEUB 5DQJB 3S9DB 2R1YB 1QSFB 4R6UA 4RGNB 2H45A 3O2VH 2C9AA 3CDCA 5IMMA 1B4JL 1TETL 3OR6B 4N9GA 4S1RH 4XI5D 3R8BB 1OP9A 2OTUA 4L4VB 5DR5H 3WSQH 1JHTB 5HYIA 1J11A 1BD2A 5CBEA 1FRGH 4V2CB 1RUKL 3RWCA 3WEXB 4RQQB 4UNUA 4YX2H 5E2UH 3O8XB 1C8PA 1OB1B 2ADIB 5MI0B 1TQCB 1F42A 2BY1A 1MCOH 3AS1A 4L29A 5GSRA 1G9ML 3OKKB 1WSST 4HGWA 1ZT1B 3WJLC 3W2DL 3VGFA 43CAA 3TYFB 2XICA 3W11D 2AJSH 4JFEB 2AJYL 4JGMA 3VFTA 4FFYH 4WI5A 2NY0D 4JY4B 5I8OH 5H94A 3R06A 1CN4A 1MHHB 1YN7B 1TJGL 1R5WA 2HJKB 3FT2B 3QNXB 3JZ7A 2VLJB 4JHBA 1Q94B 2HYMA 2KH2B 3B43A 2P8MB 3V5KA 5AYQA 3D25A 2V2WB 1E4XL 4XP4L 4JPWL 1WITA 2OZ4H 3K4AA 3STBA 4K9EL 1GGYA 3PQYE 5GHWH 2E27H 3A67H 5I30H 3SKJL 5I1IH 1U58A 3FO1A 5F1IB 5A3IC 3MV7D 5D93C 3U0PB 4RFOL 4PS4L 2RAMA 5T3XL 5ENWB 2R1XA 1ORQA 3LVEA 4PY7A 5IQ7L 5IV2A 3BKJL 5JOFB 3AU1A 3V52H 1BFTA 4OT1L 3NZHH 3VDBA 3DECA 3MRMB 1URLA 3UTQB 1MRDH 4KVCH 1DQLH 4JGUA 4E5XA 3CH8A 2BVPA 4I0KA 4KK6D 2YD6A 3QUXC 1AO7A 3CDYA 1G9MC 2JJWA 3FTGA 4PGBB 2OI9C 3BVNA 3K4ZA 3WFBH 5I0ZA 1TVHA 3I02A 2UUDH 2OYPA 4OV5A 2MMXA 4YZFE 1A2YA 3IETA 4DCQA 5T3ZD 4XMPL 1XIWB 5F9OH 5CIPB 3I6LE 1GGUA 1A3LH 1PSKL 2A6KA 4XI5C 4HMDA 5L2KB 4F33B 2NY4B 1HSBA 3D0VA 4GG8B 4Z7QF 4WFFD 3B9KD 1PY4A 4AIXA 3MOBL 4DZBA 1NCWL 4JG0H 2V2XA 4NKOA 2J3SA 3O3EA 3ZYIA 3GKWH 2CD0A 1GXEA 3H42H 4JKPL 2RCSL 4R2GD 5MHSE 1SYVA 3OKMB 1KYOJ 3F58L 5DWUL 4K9EC 4PRAB 1ZTXH 3EKCA 3T3PE 1F2QA 1MCEA 1E6JH 4HLZH 2IANB 3RWHA 2O61B 1JN6B 5FO8A 3TESA 4LLMB 1N6QH 2FSEA 3EDFA 3P0VL 5DMIH 3N1GC 4G3YL 1UA6L 1INDL 3SGDH 5T3ZL 1A1MA 3HNTH 3W11C 2VDRH 5F1OB 4ZPTA 2BERA 2NY0C 4GW5A 3DXAD 5IEHA 1A7OH 4G43B 3X17A 2X4RB 4MA3B 2IFFH 4L8BB 4TNVF 1TETH 2AEIT 2RFXA 5C0DB 3WO3B 4MLIA 1A7NL 1X5KA 1ES0B 4NIKB 1MH5B 2GK2A 4I3RL 4QGTA 4ELKA 4MB3A 2Y23A 1I8KA 1ZS8B 4NUGH 4PJIA 1EA9C 5J13C 3WBDA 1CVRA 1NSNL 1DE4B 3MJ9A 2ZNXA 1U92B 2DLIA 1N3NA 1HINL 5IG7B 5TQ0L 5FUZH 4LVNB 5CWSB 4DEPC 5DEFA 5B3JF 3HPLB 1AR1D 3RL2A 1K6QH 2YKLH 1NDMB 3U6RA 2PW2A 4XVUD 1TZGL 1TJHH 3VXRE 2WBWB 3ZE0F 1A0QL 2X40A 3KWWA 1F11B 1TJGH 1IQWH 1QBLL 3H3BC 4ZQKB 3F12A 1N5AB 2AEQL 3MLUH 3O2WL 3S37X 1QFWL 3D3VE 3ARTA 3LB6D 5DURB 5EU6A 3VRJA 5BV7L 4CVUA 4XP4H 4JPWH 5BJTA 3MSPA 4R96A 2C4XA 3UJJH 1WJ3A 3CSYB 4LP5A 4JFFA 4DOHE 4Y5XB 2VDNL 3MLWL 1NGYB 1I1YA 1HNFA 4J3OC 3SKJH 4IMKC 4U6YB 3SQBA 4PS4H 4YHOL 5T3XH 2X7LB 4ZO9A 2FJGB 2ILLA 3KYOA 5DK2B 4MXVF 2GJ6A 4A2LA 3VMPA 1NUFA 1X5GA 1IFHH 3QHZH 1QLFB 3F7QA 2RQ8A 1NBZB 1CTOA 4WI3A 3G6JB 2QADD 3WXWL 2XKNB 3EYSL 5HPMA 4WUUD 3CXDL 4NKDA 3VFUB 1ADQA 2ZUXA 2ZJSH 4Q2ZB 5C0RL 1NFIB 4XMPH 2R1WA 2BVQA 4LHUA 5CZKA 3CMOL 2E6PA 1GL4B 3C09B 3RHWK 2FECI 1NCWH 1U0QA 4MAYA 2ZUYA 3L1OH 1OSPL 3K8MA 4N0RA 1AIFB 5EORL 2RCSH 1HYRC 5BV7C 1TMCB 1YEGL 2G75B 2OL3A 1IC7L 4D3CH 4PJXE 3SKNA 1FGVH 2DM4A 5DWUH 1C5BL 2AQ2A 3T1WA 1S7TB 4WFGE 1R24A 2NR6C 3UPAA 3NN8B 2HG5B 4XMKL 5ESQB 3D9AH 5TE6H 1WIOA 1AR1C 1UA6H 5FKPA 3CSGA 1INDH 3FQTB 1ZT7B 5DHYA 5HTSA 2OR7A 2DF3A 4DGYL 3S88L 2H6PA 2W1NA 1JYNA 4PR5B 4XVUC 3SDAA 1LQSR 5C71A 5IVZB 1GHFL 3CDGB 3ES6B 1RZ7H 2E6JA 1A9BB 1UB6B 5MENA 3VFPA 4PJ9A 2ED9A 4XTRC 3GHEL 3LB6C 1NEZA 4I3RH 4IOSD 4AEHH 2JCCF 4XH2A 1OD9A 3VXSA 3GMLA 1A6ZB 3O6FB 2HH0L 3QQNA 1R5IB 3A0OA 5I1JH 5KOVC 1NSNH 3WJLA 1UC6A 3MLTA 4N5ED 5CJXA 5I2IB 4JFXA 1P7QD 1M7DB 4X98B 5TQ0H 2QHLA 2GJZB 3Q3GB 2DBLH 3SE4A 3CC5B 4NO3B 3DVIA 5EOQL 2Z31D 4Q6YA 1KLFA 4UB0L 4V1DB 2W92A 4PJDE 1TZGH 2APVA 3WFCL 1I9IL 4Y19D 1IEAA 3GRWL 4P4KD 4O02L 1NDGA 5I1KL 2WQRA 2E7LC 4MJIB 3FN0L 3CSBA 3D2UD 3O3AA 2X10A 1QRNA 5CGMA 1IKFH 2NCMA 2FX7L 4M3KB 1W0VB 3VDAA 1BGXH 2VDNH 3U30B 1ND0A 3MGOA 3E2HB 4BKLB 1TIUA 5FYKD 4YEFA 3HZKA 5HVHB 1N5YL 4UTBH 3EOYG 2VSDA 1UJ3B 2QV2A 1YY8B 1XGPB 4X6CB 4IIQC 4C56D 1GZQB 4LEXL 1CF8H 1BF8A 1MVUB 2FYYB 5TDPB 4BH8A 3F7RA 5F9WC 2CDEA 4MJ6A 3ESVF 5AG8A 4NM8L 1YMMD 4GMSH 1FFPA 4YDKH 1H3VA 1SJXA 5B3NA 1G7HA 1NKOA 2DBJA 4JZNA 5JW3L 4OSUH 1ZLWK 4NFBA 3CXDH 3VWKB 2DKUA 5SWQB 1J1XH 5HGHB 2PF6A 1ITBB 3VXMB 1LD9B 4XVTL 3K2UL 1OAZL 3KVQA 5J9PA 1A7QL 1CFVL 5F70A 2C1OA 4U7SA 4UV4L 2AJZA 3CMOH 1NQBA 5FGCB 3L3IA 3MBXL 4M4RA 1BJ1H 2B2XH 2ICES 4LSQH 1NUDA 1JNJA 4F8TA 5CSZB 2NY2D 1K8IB 3EAKA 4XP1L 5D72L 1ZT4B 4BZYA 1MI5B 3QQ9C 4Y5VB 1IC7H 4HQQL 1XMWA 5C0BA 5BZDA 2ESVE 4PV8B 5ERWB 2OLDA 3QA3A 3SDDB 4QOKE 4ZPVB 4N5EC 1CBVL 2ICEA 4KUZL 3DX9B 4B53A 5J11C 3MOAH 4HZLA 2J2ZA 3MPCA 1AGBB 5BQ7B 2CUIA 2VIRA 4WUKL 4KKCD 3O4LA 2VXSH 2DQGL 4Y4KD 3CFJA 3LKPA 2Z31C 1IAII 4F7MB 2C3XA 5DJZA 2X1OA 4U1LB 1YNKL 1CGTA 5C2BH 3QDHA 4P4KC 5EU5A 1KV3A 3ARPA 1S7QB 3ZT7A 1OD7A 1ZLUK 3MLYL 4I77L 1F3DJ 2GTZB 3ARBD 4K7FB 2VWEC 2W38A 1CZ8L 4MA7L 1QR1A 1FFOA 1Z6JT 2DYPD 1CLOL 3MNVA 1L0XA 5I1DA 4XCFL 1UYWL 1WWAX 3L95A 3VXQA 4HJGB 4QY8B 1ZGLA 1BWMA 5AYUH 3OKNB 5HYQB 1U8QA 2YC1A 4NSKB 4KWUA 5GZOC 5EO0A 3DX6B 5EOQH 2ICWA 1NUNB 4UB0H 3QZWA 5FYLL 4LVOC 1MCWM 3UTSE 3GRWH 2YD2A 4PRBA 1E28B 2H41A 3LEVL 3PWNB 3BXNB 5BVJA 3OTTA 2UWEA 3HI5L 4YWGL 5DVNA 2VNCA 4UBDD 3B9KA 4ERSH 2J12B 5E00A 1CDJA 4HFWB 4BUHA 4RWYL 4N8VB 4YJZL 2X4QA 1ZOXA 2DL2A 2W9DH 2R56H 5MERB 1N5YH 4LCIL 1QQDA 2ARJQ 2ITCB 6CGTA 5DDHA 3WFHA 5K9JL 1BOGA 4XRCB 1GGBH 1G1YA 4UT6H 5JO5B 3QIBB 2NY2C 3L6FB 4X6EB 4Z7WB 4XNQA 2A6DA 1J0JA 2CK2A 3VFSB 4RFEA 3VXUD 2A6JA 5F9JA 1JPTL 5C0IB 1LO2H 1QSEB 3NFNB 4F9LC 3I6GB 3CXHK 4K3JH 1RHHB 1HI6A 5IBUB 4I2XB 2Y9RT 4HJJH 2VLMD 3ARFD 2HTLC 2NQCA 1XGTB 3NIFF 4M02A 3DXAA 4KKCC 3V0WL 1OOAA 4OZFB 2MCG1 1A4KA 5EO1A 2OXHA 4Y4KC 1U8LB 1AR2A 4LLWA 4MQSB 5GGSB 1X44A 3OXSA 4MNQE 3TCLB 3O3BA 4LU5H 3GMMA 1OAZH 3IGAB 5E4IA 3TZVB 5F44A 1FC2D 4G42B 5IMLA 4JHWH 2XFXB 3ZE1E 2AERT 1EERB 1FNFA 2UY6A 3PWPD 5GS1C 3OKLB 3FONB 4M5YH 5C0JA 3ARBC 1BIIB 5D72H 3M8OH 1IM9D 4OZHF 3HPJB 5GSVA 5AG9A 4HCRL 3T0VA 2H2PD 4HQQH 4B41A 1KGCE 3LSOA 2W60A 3JV6A 2MCPL 1NLDL 1CBVH 5C08A 2ADGA 1Q72H 4KUZH 1U42A 4TUKH 3ZE2F 4IRJA 3M1BB 2VERN 3GIVA 5H8DA 1RHFA 3AREA 5LWYL 4WJ5A 5ICYB 1JGEB 1G9NL 3QDMA 5FHBH 2J6EA 5ETUB 3GZKA 4RIRB 3QDGE 5F9AC 1NJ9A 3HLAA 1RUPL 1K3IA 3T0BA 3PGCB 4GG6B 2OK0L 5I8EA 3KLDA 5GS0D 1A02N 3DJ9A 4J4PC 4XX1G 5D5ME 2A6IB 3MRRA 5KANI 2A83A 4POYA 5IROC 3UX9B 3C08L 4CVZB 3T1FB 4N90D 5ANMA 3O41A 3JV0A 3X13A 5BVPH 2XZCH 2QBWA 3VXNA 1J05A 5CHNA 5EU7C 1H9VA 4UBDC 3PG2A 2EDXA 1J1OL 5CJQH 4MA7H 3KPRE 5D7SL 5IM7B 3ZKMD 3SDYL 4PGZA 4F9PA 4FQJL 2WLYA 2BNRB 4HKXB 4RFNC 1H5BB 3T0DA 4JFZL 1UYWH 5JHDB 5D70H 4ZUVA 5E70A 5GS0L 3P4LA 1I3RA 4LLDB 3CZJA 4HF5L 2K1MA 2PKDA 1EEYA 3S4SG 3Q5YA 1KTDA 5E99L 2RGSA 1DBKH 5FYLH 1IILE 2P44B 4ORGA 5DXWA 1I4FB 4NOFA 1MFEH 2GSGB 3LEVH 4K23L 1P5VA 5C9KA 4NZDA 4F7EA 3EFDH 4MZ2A 4ZG1A 4YWGH 3GK8L 2F5BL 3O4OB 3MUJA 4PJHE 4MX7A 3KS0H 2QR0B 4JR9H 3WLWC 4OZ4A 2W0KA 1QEWA 4HGMA 3MRGA 1W0WA 4NN5C 3FJTA 3R1GL 4IIQA 3KPPA 4CADB 4OCLC 3FQWA 2X05A 1FGNH 2R0WL 4FFZL 4TSCH 4BZ1L 3FHAA 4HK3N 4HIHA 3VE0B 4U33A 3EO1A 3IXAA 4QXTB 2H2PC 4CGTA 2WMPA 3HRZB 3BX7C 4NN6C 3OB0H 5SWSD 1V7NL 4IEFB 4BSVA 4U3CA 4H25B 3RGVB 1YYMH 1AHWC 1ROWA 3SGJA 8FABB 1HILA 2P5EA 1T22A 4GBXA 4YC2C 5J6HB 2HVJB 2GUOA 1N59A 3RWIA 5GS0C 1DDHB 3QBTB 4X6DB 2YN3A 4ISVA 4DN4L 2JELL 4M7KH 4NNXB 4I0CC 1VFAB 3WHXA 1JNHA 2X2YA 5I16A 3QULB 1RZ8B 3EOAA 3GSVB 3PWVA 4G8GB 3S3SA 3ARDD 3FFDB 4FMKA 4H26A 1QNZH 4PYHA 1KB9K 1JZ5A 1CDUA 1T5XA 3BSZH 2JB6A 5HDBE 2ZCLL 2GK0A 3T77B 4RISH 1WQVT 5D6CB 4ZXBD 5EZJB 4K71C 1EV2E 3JWDL 4PUBH 1QO3A 3FQXB 1NAMB 4R0LC 4UQ2B 4UAOB 4WENB 4L9LA 4JVWA 3NCCB 5T5FL 1KFAL 5KS9B 2PUQT 3PABA 5I1EL 3MRDA 1MOEA 1G9NH 1RSFA 3PJSA 3QIWD 1MAMH 2DM2A 4CU8A 4KI5D 5D96C 1B88A 1FZOB 3IDJB 4UT7H 3S35H 5BZWB 4J23A 5CZVH 1LILA 3IDXH 3LKNB 5DQDH 1VGKA 3B3IA 4JVPA 1S5IL 3C08H 4EIGB 4NC2B 4X6BA 4Q9BA 4O2EA 1D5XB 4P23A 4NQEE 5EZOH 1S7WA 3BPLC 3VFMA 3L5WA 4MJ4A 2B5IB 1NBVH 3OKOB 4LPVA 4RMWA 4ZUTB 2EZ0D 4JZJB 4YDIL 5JW4Q 5GJSL 4P4RB 3HE6A 1F58L 3MJ7B 3QRGH 1MJJB 4HAFA 3ULSB 4JO4L 4FQJH 4NZJA 1AKJD 5BOZG 1LO5A 1T1ZB 1XT5A 2YZ8A 3AVEA 2X9YA 1WBZA 4HS6B 1EEZB 1G6RH 1W72A 5JPMA 5DC4B 5C9JA 3EO0B 3QH3A 3SQOH 5E5MB 4CMHC 4PG9A 3BIBX 4OFPA 3MCKB 4P46A 3GMNA 2DMBA 1N4XH 5EC2A 5D7LB 1YNTB 2ERJC 3HZMB 4R7DB 1I3UA 1FFRA 4I8DA 2CKBA 2HRPH 4C55A 4APQD 3JWDC 1JMZA 1SMOA 2XG4A 3SPVA 2YOCA 2GY7B 1ZGLM 3GK8H 3QI9A 2F5BH 4PTUB 1NCUA 1BIHA 3TV3L 4UQ3A 1R5VB 1ZKAA 3AMKA 1GZPB 2XT1B 3IDNA 4NPYA 2J8UE 3HAEB 5TFSH 3ARDC 3KPMA 5JW5A 1NCBL 3D3VB 2ZOLB 1A1NB 1I3GH 4XNYH 5DMKA 2R0WH 4ODXB 2NTSP 2W9EL 3HB3D 3LDBB 5B38A 1WBXB 3EYQD 1RJZA 5FUCC 4OFVA 4ZXBC 4J2XA 4ODWA 1P2CA 5IT2L 1DZBA 4LKXB 1AGFB 2R9HD 1RFDH 1NBYB 5CKAA 4N1CA 2APBA 1ACZA 1MCWW 4JDVB 1TNNA 1R3JA 4EVNA 5KVEH 3P11L 4XPGH 3VCLB 3UJIH 3MGTA 1FO0A 3QIWC 3O6ML 4KI5C 3N1QC 3MRKA 4PJAA 5CGTA 1MELA 4DN4H 4X0KB 2W0FA 1U8OA 3KYKL 3IFLL 2PYEA 4YPJA 4KVNL 4GUPB 4L1DA 4OQTA 1MNUH 4IDLA 4OUUA 5FHAH 1SVCP 2CSPA 4IS6A 5H2BB 5IB1B 3RVXD 3MLZL 5KSBB 3G5YB 1E4WH 5IW6A 3BZDA 4B5EA 1MIML 2EZ0C 4XAKD 5C0CE 3IDYB 4EDWH 1EUTA 1U3HB 5EIIA 3TBSA 4ONGL 4ZFFA 1KPRA 1P6AB 5DUBB 3VJ6B 1XGQB 2VDQL 5SWZD 5BS0B 1UWGL 1WEJL 2WV3A 4FFVD 5ID1B 4A6YB 5I1EH 5DJ6A 4YHML 1HHHA 1N0XH 4PJXB 5JR1H 4PJBB 2MNUA 3CFDA 2W07A 4U1GB 5FEBA 3FHQA 2RHEA 1QLEH 1VCAA 3X14A 3S5LB 1AJ7H 2FJHB 2XZZA 1JF1B 5I8CB 4APQC 4OFDA 4N68A 4UUJB 5I73C 2O5ZL 4PRHB 2IJ0C 5HHNB 3BEWB 5I75B 1P7HL 2GAZA 1NL0L 1BX2B 4P3DB 4KQ4H 4LCWD 2CIIB 5JMOC 5HSFA 2IPKB 4UU9A 1DQMH 3CFBB 4PTTA 1S5HA 3MFGB 5IVXA 1MWAA 4P2QA 4Y4HD 3TT3H 3QCTL 4X8JB 1C5CH 3HB3C 5B8CC 4NJAL 1T5WB 3T0ED 1MCIA 2Y36H 3EYQC 2EH7L 1FZKA 1PG7W 4TNWK 4D0BB 3OAUL 1RIHL 5L6YL 3ARFA 4DFHA 1PG7L 1AH1A 1OY3B 2EE2A 2X1XR 2A74A 3HMWL 2VISA 5ISZE 1CGXA 5JXED 2JIXB 4G80A 2K3TA 4K3DL 1OGAA 3UXFA 5KSAB 1KJ2A 2EYSB 2ATPB 3H9SE 4B7LA 3IFOB 3T8XA 3I6KA 3QCVL 2B39A 3SDCA 4WFEE 4XGZB 4EN3D 1FL3B 1BVZA 1XF1A 3U9UA 1NCBH 2F54B 3B83A 3ULUL 5IR1B 4OIBA 4JLRB 1GOHA 3RVXC 4AG4L 2W9EH 3IVKB 4HGKC 4Q7DA 4ZD3H 1DLHA 4FP8H 4QRSB 3W0WE 3X3FL 4JPIB 1FN4A 1UQSB 5K9OA 1HN1A 1KG0A 4XX1E 4FXGA 2H26A 5FYJE 4HKBB 4PJFF 3WKNA 1OP5H 3M45A 1XH3B 4Q9CA 4NO2B 4FFVC 2XTJD 3UTZA 3FQNB 3H9HB 2DRUA 3GBNL 3QJHA 1X5JA 2AEPH 3MJ9H 2V5RA 4GAFB 3WNPA 2F53B 3IFLH 3KYKH 1X5FA 4OD3H 3KDMB 5C07D 4PGDB 3HI6L 3I9GH 2BSTA 4NNYB 4U1MA 5EO9A 5JA9A 4Z5RB 1HH9B 3C5ZD 4P5MA 2RR3A 4UILL 3TYGH 4WW2B 1I8MB 5F71A 4AT6A 3OAZH 3IU3B 3STLA 4ONGH 1DSFL 4ZFOB 3QWQB 2VDQH 4HHAA 1HXMA 1UWGH 4ZOBA 2FJFA 4Y4HC 4KV5F 3KLAB 4YHMH 3T0EC 3ULUC 4DUWA 1PW3A 4GXVL 4JO1H 4KRMB 3ULUF 2ESVB 3C2AL 5IOPB 5GS2H 5J7CC 4NZUH 4P57A 5HDQH 3W9EB 5JXEC 2YK1L 4M8QB 1I9RL 1MCRA 1CFNB 4DGIH 2VLRA 2O5ZH 4EI6A 4L4TE 3GBML 1RI8A 4QHMB 1NL0H 5FCUH 3QEGL 1MCBA 2ATKA 1Q9KB 4JRYE 2Q3AA 4EN3C 3MRHB 2N7BA 3SGEI 1XR9A 3IYLW 4WWID 1T66D 3CAFA 1IGYB 3EFFA 3V9FA 4KHTL 5DRWA 4XMLL 5SWSA 3RWGA 5KTEL 4JRXB 4LLUB 4KAQL 2CJUL 1M7IA 1X5IA 4S1QH 3SBWA 5C2UB 1RIHH 4RNRA 4R8WH 4OM0L 4Z76A 1KOAA 4NKMB 1CDGA 5E2WL 3AFLA 2XTJC 2OL3H 3HMWH 2J8HA 4L4JA 2NXYD 3DTXA 4F7CA 5I18L 4BSWB 1FORH 2ICCA 4JVUA 4OZIB 5F7EL 3UTTD 1KNOB 5DMYA 5GGRA 3X3GH 3BP7B 3SDXE 1YQ2A 5I76A 5FV2A 1EFXB 1QOKA 5JUEH 1FVEB 3KPSD 4HK3J 4WIQA 4N8PA 2Y7QB 1EVTC 1KBGH 4RAVA 2VXVH 1REIA 2VLKE 1H15B 2FD6H 5ACZB 1IZJA 3DUSB 3HZYA 3W9DB 3C5ZC 1JHLL 1NGZB 3ABZA 3TBWB 3MXWL 2HFGL 3LN4B 2NPLX 3X3FH 4FQCL 5D1XB 1MIEL 2D4FA 5D6DA 4DVBB 1CE6B 2Y72A 1OAXH 1G7MB 4YPGA 2E7MA 3OJMB 4UDUA 4IJ3C 5F3HB 5BRZB 1EO7A 1MFBL 1YA5A 1L0QA 3PWJB 4U7KA 4HIIB 3WXVL 1C08A 2FBOJ 4AM0B 3P4OB 4GKNB 3PP4H 5KG9B 1FNLA 5LGKA 4Z7QE 1KIPA 4AY0A 4R90L 4I18A 2Z9TA 3DRQA 4Y4FC 2WINA 4TVPL 5EOCJ 1FG2A 1C16B 5JXAL 1BQUA 4FZEH 5DJ2B 2IADA 2EDHA 3KG5A 2EEBA 1R3LB 5JNYB 4WHYG 4HT1L 3TM6A 1DVFD 4NP4L 1NCDH 4KJPD 2AK4B 3PL6A 1DUYA 4XB7A 4HUWA 1CGSL 2RIKA 5D2LB 2EH8H 5K9KA 3DBXB 1CI5A 1A9EB 1WAAF 1DSFH 1KC5L 2K9UA 1TXKA 1RUMH 1T66C 3OV6A 2CDFA 4G8IB 3U36B 2APTA 3DVNA 4NHUA 5T3XE 2V7HA 1X3DA 1KCUL 2HT3D 2BNUB 4URTB 3QPXH 1HQ4A 4U1NB 2ORBH 5DUPH 4HS8L 3C2AH 5TQ2L 2LFGA 5DD0H 1XGUB 3MR9B 3FOLA 2NXYC 3U0WH 1N2RB 2VDLH 1I9RH 4MJID 2UZIH 4MMXC 3F5WA 3LV3B 4CVXB 1UT9A 4HS3A 3REWB 4OFKA 1QSVA 3ZT6A 1QHOA 1S9WB 2VDOH 4ORZC 5DJXA 4B50A 4P2RA 1AGEB 1LO3L 4IDJL 4QRUB 4XVJH 3T65A 2I07B 3RBGA 5E6IB 1DQJB 1X9QA 5I1CL 5DYOB 5FO7A 4WU5A 4P3CL 3QUZC 4O51B 3CZFB 4NJ9H 1U8PB 3S96A 4K3EH 3BYYA 3QDJB 1FIGL 4QF1A 4F37K 1OGTA 1HKFA 3GMOA 2R2HB 3DMMD 1B6DA 3KPRB 5D71H 3RHWF 4KAQH 3VFNA 2CJUH 3BKCH 1FFQA 3ZE0E 2N4IA 3TN0A 4ZUWA 3RDTA 1RULH 3M17A 1J0IA 5J1SC 4WI6A 3H9ZA 1K4DA 4PRDA 1M05B 4ENEC 4ZTOL 4QTHB 1M71B 4OLWL 5T33L 3QEUA 5DQJA 2UWEF 5MEOB 2I60H 1QSFA 5F7EH 1OL0A 4M48L 5CJOL 2BSSB 2D7TL 1NC4D 3MV8B 3OR6A 1M6OB 1A4JB 3U7WH 4L4VA 3KPQB 1JHTA 4GW4B 2H9GB 4XNMA 4YIQB 5HHOD 4M6AA 5CJ8A 4MXVE 5IHUH 2QQLH 4WI4A 3FZUD 4ZYKB 3WEXA 4BJLA 3HG1D 4FQ2L 4EOWH 4NQCD 4YFLI 5JLZB 3GUTA 4DW2L 2NTFB 4E41E 2CUMA 1DVFC 2VDML 1HHKB 4ZO8A 4HJ0D 1OB1A 2ADIA 4KJPC 3KR3L 4FQCH 1MF2L 1MIEH 4G6AD 3OKKA 4LLVB 4UV7L 3NACH 1KJVA 5CFHA 1ZT1A 4EUPG 4NN7C 4BFBD 4G9FB 4Z7NF 4HUNB 3CH1B 2FZ3B 3IF1B 4JFEA 2NNAB 1QFUL 2HT3C 1F8TH 2CR6A 1T89C 4GQPH 1MFBH 4JY4A 3V95A 3ALPA 2YD1A 4L3ED 4F58H 4P5TD 2RB8A 4M6ML 1MHHA 1YN7A 2HJKA 2D9CA 3OKDB 3T4YB 1LO4H 3KNBB 3QNXA 4HUKB 2VLJA 1EFQA 4R90H 5I6XC 2P8MA 4JG1L 5SV4A 4TVPH 1PG7X 2VR5A 1WFTA 1ZA3A 2IH1B 3QQ4B 4WGWB 1J0HA 1FLTX 4RGMC 1P84K 3WS3B 2ZG3A 1SY6A 4HT1H 5F1IA 3SJVE 3U0PA 4DN3L 5F6IB 5ENWA 3G08B 3MA7B 3GB7B 4KKBD 5I0DA 4CDGC 4Y4HA 1GYAA 1A6UH 1KC5H 4Y1AD 4LASL 4Z95H 3ARRA 1AD9B 3MRMA 4M7ZB 5A2IH 3V0VB 3DMMC 3N06B 4GOSA 1I7TB 2I5YL 1MFDH 4LCCB 4BZ2H 4HS8H 5EU3B 2A9NH 5TQ2H 1DR9A 4PGBA 4M7JL 2JCCE 3T2QA 1NLBH 1XIWA 3P0YL 1QVOB 5JDJA 1ZA6B 2E9JA 5CIPA 5D7JD 4GG8A 2I25N 4G5ZH 4IDJH 4ZUSB 3AS3A 3WNMA 1QD0A 1MCLA 3RZWA 2JK5B 1FSKB 4XVSH 3FZUC 4NQEB 1EHXA 3KXFB 3D39E 5E1HB 5C6TL 2EDBA 3OKMA 3V4UL 2IGFL 3QIBD 4FTVB 1QBMH 4HBCL 1PEZA 5IKCB 3RA7H 3X11B 1RZKL 3HUJB 2D4DA 1MCNA 4JQIL 4HJ0C 1FAKT 4ODTH 4YBQD 4HSQA 2IANA 4G6AC 3ZSTA 2O61A 1JN6A 4G8FB 3GBLA 3UDWC 4LLMA 4M00A 4YHIB 4NQUA 1MAKA 2BHYA 4Y88A 3RNQB 1YMHB 1ITCA 4RBPK 4ZTOH 4LRIA 3QO0B 5T33H 1WZ1L 5I1HH 4XC1L 1TENA 3VD7A 4G43A 5E03A 2X4RA 2D7TH 4MA3A 5CJOH 4ZDHB 3ZMRA 1NCAL 4JFOB 4P5TC 4YO0B 1MJUL 1NGWB 3V5HB 3BRDA 5D7IE 1ES0A 3U1SH 1MH5A 1UCBH 2J6EH 3OKEB 1BM3H 1LHZA 3C5ZA 1CDIA 1OTSD 3BOVA 1GOFA 3FFCB 1ZS8A 4QCIB 4M9OA 4DW2H 5DFVD 4FQ1H 3D25B 2NX5E 4BELD 2HWZH 3F6LA 4JFDE 5CEXB 4EI5D 5IIEB 2XG5A 3H6JA 1U92A 5B22A 4KKBC 4KTYA 4JB9L 3S34H 3HPLA 1CICD 3C87A 1QFUH 2OTWB 1NDMA 4L8CB 1QBAA 1VERA 5HYJB 4X7TA 1RZKC 2E7HA 2DM7A 1N8ZA 4ZFGL 4X7FC 5IBTL 1F11A 4ZQKA 1D5BB 3AB0B 1N5AA 4JG1H 4H0IA 4JDTH 5ILTH 1WC7B 2BVPB 2QQKL 3ZSSA 4QRRD 4Y5XA 3KLHD 4WI8A 3RWDB 1NGYA 4XNZC 3Q2CA 1FCCA 4MDJB 3BPNB 4L8SB 3T09A 3U7AA 1TVHB 1V3MA 4GS7B 1A2YB 1RK0B 4U6HB 2X7LA 2FJGA 3OWEA 1U6AL 5DK2A 2A6KB 3VD5A 1FP5A 3B9EA 4LEOB 3TVMB 4TSBH 1AC6A 4KDTC 1ZXQA 4OBRA 4YDJB 3SEPA 1F3RB 1GGTA 4LSVL 3AXLB 3RQ3A 2V2XB 4OF0A 3O3EB 4YXKH 2E3VA 5JIIA 1NBZA 4YBQC 4QHNB 4PJ5E 1PKQE 3G6JA 1NAKH 2XKNA 5F8RC 4PJEA 3IXTB 2BZDA 5JDSB 2EDDA 3FB6B 3DETC 1DEEB 1AI1L 1SQ2N 3BP4B 3UTPE 3VFUA 4PJ7E 1P4BL 4MWFB 3KPSA 4Q2ZA 3VGAC 1NFIA 4MVBD 1ZLUH 3P0YH 3SE8H 1DBBL 1OQOA 3BH9B 3T4AB 2VWEE 1U8JB 3DOSA 1A7BA 2DTSA 4M1CC 2XYCA 1MJ8L 1IGTB 5C0GB 5CCKL 5LBSH 1YEHH 3T2PA 5IEHB 1OTSC 1JNNL 4U3HA 1QUNA 1AIFA 3P77A 2G75A 4K2UL 2XQYG 4I0PB 1NCTA 3RKDC 5C6TH 5DFVC 1LMKA 4EBQL 3I75A 1X5AA 4EI5C 4JQIH 3PQYD 1FDLL 1I8KB 3C8HA 3ZDYE 1S7TA 4Y89A 3MBED 4WTXA 1HWHB 3NN8A 2HG5A 4ZS7H 5ESQA 5T1KD 2B4CC 3QNYA 4BFIA 2CLVA 3MV9E 1ZT7A 4LGSB 1CICC 3QQ3B 5A2KH 3RY5A 4H8WL 4LDLB 2DQUL 5IVZA 3U9PH 4GRLB 2VL5B 3QXDB 4GRWF 4FQXB 1XEDA 3CDGA 5HI4D 3ES6A 1NCAH 1MQKH 5IB2B 4PRPE 3BE1H 2ZCKL 1A9BA 3U6RB 4YR6A 3JVGA 1UB6A 2BXYA 2FEEI 4NCC2 5E4EB 1KB5B 3F65A 4I1NB 1CFQA 4LARH 1RURH 3KWWB 5D2NE 3KPLB 3MNZB 2NW2B 3KLHC 1B2WL 2XPGB 1A6ZA 3O6FA 4ZTPH 1OAQH 3RTQD 5CINH 4OCWH 2VXQL 1I85A 2DN7A 2P46B 1R5IA 3VRJB 2WIMA 3D85D 2NY6B 3I6LD 1UM5L 4Q0XL 2Q76B 1I1CA 3EHBC 2FHBA 3LD8C 5I2IA 1M7DA 1I1YB 4Z7VE 2GJZA 3NIFE 3H3PL 3Q3GA 3RUGB 5FYKH 1T89A 1KIRB 4JM2B 4LCUB 3CC5A 4NO3A 3H7BB 4G6JH 3D1MC 5MHSD 3W0WB 3BUTA 2GJ6B 2C3VB 4PJAF 2IAMB 2I9LA 2A9MH 2CRIA 4CUCA 1W72H 4MJIA 5IBTH 5FYLE 4RGOH 4O2CB 3QP3A 1ZHLB 4ZSOE 1EMTL 4MVBC 1W0VA 4BFEA 4JANB 3ROOB 5HPMB 4OZHE 3NCJH 5EZLB 4H8WC 1OP3K 1H0DA 1UJ3A 2GIYA 1J1PL 1YY8A 4M43L 1XGPA 4X6CA 5HY9B 1DL7L 3VFOB 3DMMA 2MPAH 4GRWH 1GZQA 1KPVB 5GGVL 5KVGH 4QWWD 4JJHA 1MVUA 2FYYA 5TDPA 3S4SB 3L5XH 1EXUB 1OARL 4TPRH 4X80L 4KRNA 1IE5A 1IQDB 2BK8A 1CDCA 2VZ3A 4Q9RH 5IGXL 3VWKA 2G9HB 5SWQA 4PYGA 5HGHA 4TTGA 2BVOB 3TF7C 3IFNH 3OR7A 3VXMA 1LD9A 2WBJD 5K59F 1NCCL 1YEIH 5J12C 2DQFB 2CPCA 5HI4C 4QXWA 5EBMB 3VXRD 1MFCL 5CCKH 2G60L 1FO0H 1ZLVH 3MTRA 3TPUB 4ALAL 3O11B 4OIIL 2YEZB 1Z2KA 4L4TB 5CSZA 1K8IA 4PLNC 1ZT4A 3DV4B 3RTQC 1MI5A 4Y5VA 2ARJB 1UXWB 1NEZB 5IB4A 4OQTH 4OF3A 4XH2B 1OAYL 4PV8A 5ERWA 4LCYB 3SDDA 4ZPVA 1ORSB 1KTRL 2EXWD 3LIZH 3STZB 4DQOL 4FFWD 3U0TB 4NKIL 2BP3A 3NBNA 2YXFA 5FDYA 1U8HB 5BQ7A 2VABB 1AGBA 1CGWA 1JUFB 3BIKB 2MWCA 1X4XA 4F7MA 1JGDA 3AC0A 4U1LA 2DMKA 5TE7H 3LEXA 1S7XB 1RZJH 4F80A 4ETQB 3H0TB 3RL1B 3QXWA 4LQFL 4OGXH 1Q9OB 4HH8A 3NTCH 4Z77B 1PLGL 2Z92B 1S7QA 4WWKD 3OJVC 2FHFA 2GTZA 4UOW0 5ALCL 4ONOA 5ADOH 1JI1A 2VXQH 3CLEH 4AL8H 4QRPE 4XXCC 1SJHB 1SHMA 1JI2A 4TVSa 5D93B 4AMKL 2YD5A 3QFJB 1FYTB 1WV7T 1GPOL 4P59L 2MOVA 5HYQA 3OKNA 4NSKA 1HE7A 4QWWC 5ITBH 5J3HD 3DX6A 2C1PB 2QTEA 1UG9A 5IJKC 2X4OB 4R4ND 3ZHDA 4PRID 2WW8A 4MHHI 1VGEH 2LU4A 4PLJD 2YPVL 3MROA 1E28A 3ZL4L 1MWAH 3PWNA 3BXNA 4WFGD 2FBJL 3QUXB 4NQDB 4HEPG 2A38A 2OI9B 3M07A 5D7JA 2YPLB 4QHKI 1DLFL 2WBJC 2XRAL 1QP1A 3DYMA 4M62H 4N8VA 3TNMB 4LFHD 3VFVB 4JFPB 3UROR 3O9WD 2B0SH 3G04B 5MERA 2HJFA 2WWKT 2YRLA 3SOBL 2ITCA 1KJ2H 5JO5A 3QIBA 2C1OB 3UYPA 4OCYH 2B1HL 3KGRA 3L6FA 4X6EA 3W81A 4Z7WA 5F97E 3R0NA 5GGVH 4P9ML 4LMQE 4XNXH 3WDIA 1VEPA 2P5WE 4KK8D 5EUOF 3VFSA 1F4WL 2ZUTA 1QSEA 1OARH 3NFNA 3HZVB 3I6GA 1C7TA 2EXWC 1RHHA 1R0AL 1IAIH 3K7UA 3GFUA 1MEXL 3KJ6L 4I2XA 5HGGS 1XGTA 3RZCC 5LVEA 3IJHB 5IGXH 4OZFA 4UOW1 2BY0A 5DTFB 1U8LA 1BD2E 4Y8DC 1GC1L 4QLRA 1QRKA 5GGSA 2CGRL 3TCLA 1NCCH 2VIRB 3IGAA 2NY0B 1JRHL 1EAPB 3TZVA 3MRLA 5CLWA 4G42A 1KEGH 2XFXA 4Q6IC 4O4YL 4XHJD 1T3FB 4PP2B 1J8HD 2G60H 3BN3B 3EYOB 3OKLA 4WWKC 1ZLSL 4F57L 4ALAH 1L9NA 1S3KL 3FONA 2V2TB 5D1QD 1BIIA 5HVWA 3HPJA 3QDAA 5DD5H 4U2YA 1A3QA 2R0LH 1RJLB 4L5FL 1A7RH 3MV7B 5J13B 1F3DH 5CEZH 3VRLF 4DQOH 3M1BA 4NKIH 3WFEH 3BKMH 1JGEA 5ICYA 5J3HC 1E4KC 4DEPB 4LHJB 4XWGL 3MNVB 4HMCA 3V2AR 1GSMA 1KJMB 3PGCA 3MLSL 1P6FA 2DQCH 4RSVA 5E9DE 1MRFL 3DUUB 5EDXA 1U8QB 3QWRD 4MDIB 1MLBB 4PLJC 1MCJA 4CVZA 2ICWB 3T1FA 1LEGB 3WV0A 2YRPA 1SM3L 4XPAH 3LN9A 1T2JA 2GEEA 5J1TC 2EDWA 1BMGA 4ODVH 3VFGL 3IJSB 1GC1C 4XC3L 5IM7A 1CLYH 1VFMA 1RUQL 3O9WC 4W4OC 1ETZB 2BNRA 2AJXH 4QXUL 5DEZA 3B9KB 5JHDA 4OCXH 4FABL 5EB9A 1AO7E 2DTML 2WUBH 3PIQB 5E1AB 2J8OA 4JO3H 4P59H 4LLDA 4U0QB 1T80A 3LRHA 4KK8C 1T1YB 1N64L 4E41B 4POZD 4NGHL 3BESR 5KSUB 2DDQH 3QZWG 3O0RL 2AJ3B 3N9GL 3CUPB 1YJDL 2GSGA 2AI0L 4JM4L 3LZFL 3V6ZA 2X89D 4QOKD 3ZL4H 5AAWA 5KBNC 2HP4A 3ALXA 4PBWD 4TNWF 3QUYD 4OCRL 1B3JA 1HI6B 2VB5A 2MSPA 3T2NL 4P2OD 2QR0A 3DO3A 3C60D 2BNQE 4XHJC 2EO9A 1JWUB 4YHKL 4CADA 2ZCHH 2Z93B 3GMMB 3K74B 4W70A 5D1QC 4LSDA 3WL9B 4CDHA 2IWGA 3MQIA 4P9MH 1FFNB 1WIPA 1NANI 5BV7B 1UZ6F 3MBEA 1LO0L 3HRZA 4X6FB 1HQRB 5B21A 3TT1H 2CQVA 4OLEA 5KN5B 5T1DH 2Y6SD 3UP1A 5JTWA 4J6RH 5E94B 4LSTL 4H25A 5KVDL 5ADPH 3RGVA 1JTPA 5D4QA 1R0AH 1VFOA 2FL5B 8FABA 4PJCB 3BDBA 5J6HA 3HC3L 5C7XL 1RZGB 2QKIB 5E95B 4X7SL 1G7IA 1YYLL 4X6DA 2CGRH 3NIGF 3GIVB 1YEDB 4NNXA 3V4PL 3LQAH 5E8PB 1VFAA 3BDYL 4U6TA 1JRHH 3LEYH 1QZ1A 1RZ8A 3GSVA 1NJ9B 2J7LA 3FFDA 3UTSD 5AD0B 5AWNL 4HULB 1S3KH 4MA8L 3D85A 2I9TB 3GEWB 1RU9H 4N0CD 1W0YT 4RX4A 5CP7A 4JPKL 5BCAA 4N8CL 3BZ4B 3T77A 4FA8A 3BH8A 4X5WB 5D6CA 3CFCL 5EZJA 1YEEL 2F19L 1MHEB 5F9DC 5LKNA 2DD8L 4ODSH 3GKZA 5EIQA 3FQXA 1NAMA 4M6OH 4UQ2A 4NWTL 5KS9A 4CNIA 3MCG1 5EU6E 2LV4A 4MLSA 4PG2A 3I3DA 3I2CH 3I85A 3IDJA 4POZC 4Y8AA 5MEPA 3MLSH 4JFFE 1U8KB 2FIRT 2Q3ZA 1JJUA 4YH6A 4ZUVB 1MRFH 3WUWG 3TJEL 2W9LA 4F7PA 3LKNA 2DLHA 4F2MA 3VG0H 3FT3A 4NFCA 4WUUB 1D5XA 3QUYC 1XCQA 4I3SH 4XXCA 5HHQB 4P2OC 3VFGH 3OKOA 4ZUTA 1KEML 4LRNL 5C70A 2NY3D 4JZJA 4F7EB 1JWSB 3C60C 1FV1B 3MJ7A 3ULSA 1MJJA 3T08A 4MNQD 5CUSL 5E08L 4PJFE 4QXUH 1T1ZA 2Q86B 1HHJB 1YDPB 4HS6A 1EEZA 2DTMH 1A6PA 5DUMH 4NNPL 4OCMC 3FN9A 3EO0A 5E5MA 5IWLC 1BVLB 4D9QE 1PEWA 2Y07L 4J3VA 2EEAA 4IIQB 3MCKA 1T4KB 1VDGA 3CFEA 5EA0L 1YNTA 1P4LB 1N64H 4IRSD 2Y6SC 3FAXA 3HZMA 4R7DA 3GGWB 5F96L 1KXTB 4HIHB 1KGCD 5F9WB 3O0RH 1YJDH 2QL1A 4WHTB 1RJYB 3QYCA 2EE9A 3LZFH 3MRFA 1INEL 3MODH 1EPFA 3UBXB 1FHGA 3G9AB 3QDGD 1HILB 4KK9C 1R5VA 5GZND 5BO1L 3THMH 3HAEA 1GGCH 3LH2L 1VFBB 3D3VA 2ZOLA 4NDMA 1A1NA 2DQTL 4HBQA 3T2OA 3V79C 5IB3B 4KV5E 4ODXA 3WHXB 1CCZA 1HXYB 1JNHB 2ZUQC 1FH5L 4KRPD 3PWVB 3U4BL 1KPUB 3ULUE 1CDHA 1J0YA 2JB6B 1OM3L 3KPRD 1F6FB 1NBYA 4LSTH 3QIUD 4JDVA 5MENE 5GRVL 1KCVL 1P7QB 1CU4L 5TJWK 3EYUH 3V4VH 1JP5A 5J11B 4X7DC 1T6VN 1VENA 1QO3B 4HH9A 5DA0B 4X7SH 1YEJL 1YYLH 2NY4C 4WO4D 4K8RH 4NQXB 4X0KA 1XF2B 2Z31B 5TDOB 3V4PH 2R2BB 4JFHE 3PHQA 4GUPA 5GGQL 4Y19B 4P4KB 4KPHL 2AXFB 5H2BA 1OAUL 3D2UB 1MCPL 5IB1A 2R4RL 2BSRB 4CAGA 3QCUH 5KSBA 3G5YA 4MA8H 4TUJA 1NMBL 2CKNA 5IBLD 2OR9H 4GRMA 1A8JH 1U3HA 1YEEH 2F19H 3E1F1 1JF6A 3L5WB 5DUBA 4YHPB 3B5GA 4X7EC 1XGQA 4NWTH 5BS0A 2KUTA 5ID1A 4Y2OA 4A6YA 1T7ZA 3WJJC 2X70B 4OLYL 3W39A 1QRNE 1SY6H 3ZE1F 4PJXA 4C56B 4UI2A 4PJBA 1RY7B 4OGZA 1IC4H 4F15C 1S7UA 1GRWA 2ED8A 2IPTH 4IRSC 3S5LA 1JBJA 2DI8A 1JF1A 1J10A 1D6EB 5GGVY 3QUMA 1OTTD 4WNQB 4LVOB 1YMMB 5EC2B 1SBSH 2D0FA 2OR8A 4UUJA 4PRHA 3WS6A 3MV9B 5HHNA 5FFLA 2V9TA 2CKBB 1BX2A 3QHFL 4P3DA 2E8YA 2HAZA 1IAKA 3PF2A 2HKFH 1Q38A 5GZNC 4DTGL 2CIIA 4RZCB 2IPKA 1AXIB 3MLXL 3F6IA 3CFBA 4EDXB 4UQ3B 5CMAB 3RWEA 4D9RE 5D5MF 3IDNB 3FB7B 1X6LA 5CIPH 4KRPC 4FXKB 4X8JA 4JKWA 2NY2B 4NO5B 2PXYD 2DQDL 5GISL 5HVGB 2DLTA 3UYRL 3WLBB 4D0BA 5DMKB 1IBGL 1MPAH 1F4XH 1I9EA 4KQ3L 3QIUC 4KMQA 4F37F 3JWOL 4YE4L 4KHXL 2JIXA 5DVOA 1INEH 1JHKH 1S7VB 3MLVL 5KSAA 2ATPA 4HUUB 3FRPG 3IFOA 2J4WL 3JUYA 4WO4C 4Y4KB 5J89A 2W65B 1WCQA 5IK3B 4HZAA 5JORB 1MFAL 1UKTA 1X5HA 2VDKH 3UYOD 3PV7A 1DN2A 4IOFD 2PO6D 5D1QA 1WAAE 3HI1A 4XP5H 2F54A 1FVDB 2HLAA 5IR1A 4JLRA 4D8PB 4OCSH 5GS1B 4WEUD 1FH5H 3ZDZF 3O4LE 4XPTL 1A6VL 4HWEL 4OZHB 1XGYL 4CBPA 3ARBB 5B38G 1IGIL 5GGTL 4QRSA 4JPIA 3U4BH 1UQSA 1TJIL 1BQHA 1A6AB 3BT2L 4HKBA 2DYPB 3TJHD 1XH3A 1WK0A 3FMGL 4NO2A 2ZKHH 1KCVH 4UZGA 3FQNA 3H9HA 3NZ8B 3SKUD 1Z9LA 3B8SA 1Q9LB 1AD0A 1EO8L 4P9HH 5DRXB 4HIXH 4OAWB 1KCRL 2DI9A 3ORJA 1P7KB 4GLRI 4M7LH 2F53A 4XZUB 1DBAH 3N85L 2JJTC 3OB0K 1OTTC 3J7HA 3KDMA 1VACB 4PGDA 5GGQH 2C26A 4NNYA 1OHQA 3JWOC 1OAUH 1G9EA 1IVLA 4Z5RA 1HH9A 3BPOC 5C0AD 2AV1B 4DJMA 4TVPE 1NMBH 4WW2A 4FZ8L 4XB8A 5BW7C 4O9HL 4LK4A 1CL7L 2AJVH 3IU3A 3B9AA 5I74C 4ZFOA 1FNGB 5C1MB 4RFNB 4EUPB 1FQ9C 5FUOL 1S7SB 4LQ1A 3S3PA 4Z6AT 2UWEE 3KLAA 1T2QL 4LVEA 1EGJL 2PXYC 3Q1SH 4ONFH 3BAEL 4GKZA 2ESVA 4OM1L 3DGGB 3VXUB 5LAXB 4LVHC 2OJZH 5L88L 3W9EA 4CU7A 4M8QA 4U05A 1CFNA 1OW0A 4P2OA 3HS0B 5DJAB 4UT9L 2F8OA 3Q5OA 3ALWA 1H8OA 3ROLA 4ZO7A 4G80B 1Q9KA 1CE1H 4GQ9H 1A3RH 4R4FH 3MRHA 4IOFC 1XF5B 2PO6C 2C5DC 2DQEL 2WUCH 1LEKB 4Z7NE 3ZTNH 3MUZ1 2AXJA 4JN1H 4NN5B 5E8DH 1BHGA 1UENA 3G6DL 3PWPB 4YDLC 3SN6N 1IGYA 3BP6B 3CVHB 3N50A 2VZ1A 4LLUA 1I9JH 4JZOA 4QRPB 1IM9B 2DQDH 4EKXA 1C12B 2DB8A 4K7PL 5E2TH 2D0HA 3U4AA 4DKEH 4CVWA 1IBGH 1P9MA 4NN6B 5C0CD 1FE8H 3EBAA 3TJHC 4KU1A 2VUYA 5IQ9B 4NKMA 3DURB 4BSWA 4QRTB 3D87B 1AHWB 1KG0B 4OZIA 1KNOA 3MLVH 2P7TB 4Z7OE 3BP7A 1A6WH 3HMXA 1AC0A 1EFXA 4YC2B 5HGBB 2Y7QA 4CW1A 2F5AL 2PTVA 1MFAH 7FABH 2GTWB 4U7MA 4JY5L 1RIVH 1BZ9B 1H15A 4ZOAA 5ACZA 5C08E 4ZS6D 3S36H 4AENB 1E4JA 5A2FA 1U2CA 3QDME 3TBWA 3CGTA 4XPTH 1A6VH 4OLUL 4HWEH 3LN4A 4OQ1A 1IGIH 5HHVL 5GGTH 4I0PD 1YEFL 4DAGH 2NY5L 5D1XA 1TJIH 1SJVA 1CE6A 3BT2H 3IDIB 1G7MA 4K71B 1CD1A 4XCCH 4X5LA 5L8KB 2F58L 4R0LB 5ANME 2EICA 1GH7A 5F3HA 5BRZA 3T3ME 3STLB 3PWJA 3GMRB 4HIIA 2P5WB 4GJTB 1NGXB 3P4OA 1EO8H 1HXMB 2FWOB 4AM0A 4GKNA 2FJFB 5D96B 5IFAL 4FQXD 4HC1L 2YN5A 1FNHA 1C16A 2AV7B 1AXSB 2V17H 5ISZD 5DJ0B 4Q9QH 3SGEH 2APFA 2XKUA 3RRQA 3SE3A 4P57B 1R3LA 4LIQL 3GI8L 1DJSA 5JNYA 1AXTL 3BPLB 2WM0A 3H9SD 3BI9X 5SX4I 3NCYP 2R29L 4FZ8H 2AK4A 5F3BB 4PJ8D 5D2LA 3ZTJH 3DBXA 4WY7L 1A9EA 1CL7H 2Y06L 4WFED 3SGKC 2CLZB 4G8IA 3U36A 2APXA 5FDWB 1DN0B 4U3XA 1P69B 4RBPH 3ARUA 1XR9B 3QPQC 4M7LT 4PFEA 1EGJH 4CMHB 3V6OC 2QSQA 3LMJL 3BAEH 3G5VB 4OM1H 3SGDI 4ACPA 4POUB 3W0WD 2NY5C 3IDGB 5SWSB 1F90L 1XGUA 2ERJB 3MR9A 5FYJD 2ED7A 1N2RA 1MREH 1FYHB 4WDIB 7CGTA 1JFQL 3WIIL 3LV3A 3V5DB 4CVXA 2MHAB 3PDOB 2E7CA 3F7YB 3ARSA 2IQ9L 2AK1H 4ODHH 1R6VA 1S9WA 1AGEA 4GAGL 4QRUA 1T7YA 3O2VL 5E6IA 1GVIA 3I50H 4S1RL 4BA8A 4ZS6C 4AJ0A 3ARDB 4O51A 3CZFA 5HPOA 1U8PA 5DR5L 3WSQL 4L1HA 3QDJA 2P5EE 2R2HA 3KPRA 4KZDH 3SY0B 3LS4H 3GSNB 3DARA 4PD4K 5DVMA 3BGAA 4K3GA 3HZYB 3VDCA 1WZMA 4EZMA 5E2UL 4ZXBB 2M8XA 5ALBL 1YPZF 3MLRH 4TN9A 3VD4A 1OAKH 3MFFA 1M05A 2QLVB 1MCOL 4QTHA 2GYSA 5MEOA 1A21A 3MRIB 2BSSA 3WFZA 2UZXB 3QIWB 1M6OA 4R97C 3RVVC 2FR4B 1A4JA 3HE7D 3DROB 5B39G 4UDUB 1U8IB 2QQNH 3KPQA 4FFYL 5MP6H 5IFHL 4GW4A 1E4XI 2BOCB 2H9GA 4YIQA 4GO6B 1ZANH 1B4RA 2PCPB 3P2TA 5EBWB 4C58B 3NFSH 5T1LD 3VI4E 4ZYKA 2D7QA 2Q8BH 3OF6D 4MGXA 1EUUA 5JLZA 1VFUA 4XP6H 2VZTA 5CILH 4G6FD 2NTFA 4L4TD 4OLUH 4Z7UF 1FG2B 1HHKA 2NYYD 5HHVH 1KF9B 3Q6FB 4UTAH 5EOCH 4PJ8C 3OXRB 1LDPL 2Z8SA 1IARB 4LLVA 5GHWL 2E27L 3A67L 1UJTA 5I30L 3RY6A 3CX5K 4JRYD 1A5FH 4JQVA 1AKJB 4G9FA 3MREB 3CH1A 2FZ3A 2Z8VC 3IF1A 5EBGA 2VSCA 4YFLF 1D9KD 1T7XA 1UH3A 2ZZUT 2Q7YB 5MEQA 4P2CG 4IOIB 1UADC 1H3PL 3P73B 1FBIL 1TZHB 2JJTA 1DP0A 3O45A 1MRDL 4G6MH 3OKDA 4KVCL 3T4YA 3KNBA 1DQLL 4HC1H 3EW3B 1HQ4B 2FX8H 4APQB 4HUVA 1KN4H 1XCTB 4I13B 5I73B 4ZMAT 2Y5TB 5BW7A 3JTTB 2R8SL 3WS3A 3WFBL 4LIQH 5HHPB 4CN6A 3N1FC 2OBGA 2R29H 5DFWH 3G6AB 1NMCC 2VLLB 5F9OL 3RU8H 3G08A 3MA7A 1A1OA 1P1ZB 3GB7A 2ZUVA 3EGSA 5L2JB 3PWUB 5A16A 2Y06H 4X4YA 2ZUWA 4EEEA 2VLKD 1AD9A 2DQIL 1Y0LA 4JG0L 5I19L 3V0VA 1FIEA 3GKWL 5F7NC 3H42L 3LKQA 1I7TA 4O58L 4U1KB 5B8CB 4GRWE 4WU7A 4GG6F 3NOIA 1NC2D 2JF1A 3S96B 3LMJH 4LCCA 4QF1B 5EU3A 1K5NB 1EEQA 3GMOB 1FJ1B 2Z0BA 1WFNA 1ZTXL 3OAZK 5GGUB 5IW1B 2VZSA 1E6JL 2CO7B 5DSCA 1BQLH 1IM3B 4O2FB 3WIIH 1N6QL 4K94L 1QVOA 5DMIL 1ZA6A 2X4NB 1K4DB 2YXMA 3HE7C 5DRNB 5DC0A 4KZEL 2Y4SA 3C5SB 4BQ9A 4UNVA 3DUHA 1H5BC 2YPKA 4GAGH 5KAQF 3K1KC 4ZUSA 1A7OL 4M3JA 4OZFH 4LOUD 2IFFL 2JK5A 3GHBH 4NQEA 5H37H 3C9NB 3KXFA 3VG9C 4XNMB 4AIZB 1BJMA 4FTVA 5IKCA 3BD3A 3X11A 2ZG1A 2D03H 3HUJA 2NYYC 2G2RB 4PJAE 1QYGH 4XPHH 4NUGL 4G8FA 3OGOE 3GUTB 2PYEE 1LE5B 2DLFL 4YHIA 5ALBH 2KBGA 3RNQA 1D9KC 1IT9H 1YMHA 4PGEB 5SWZB 3FB5B 3QO0A 3U4EA 5FUZL 4XBGB 1KJVB 5T3XD 4ZDHA 4HG4K 4YO0A 4JFOA 1K6QL 2YKLL 1QFWI 3EZJB 1NGWA 3V5HA 4O5LL 2IQAB 5IFHH 1TJHL 5ACLA 3OKEA 5J0BA 1KJ3H 4JN2B 1OP3H 2VAJA 5DRZB 4OTXL 3FFCA 4MJ5B 1JZ7A 3O2DA 1IQWL 4WCYH 3Q6GH 3MLUL 4M8VA 1CIUA 4QCIA 1Z0MA 1BFVH 3QXVA 4EXPX 15C8L 5CEXA 4LCWB 5IIEA 1ZA3B 3UJJL 1I7RB 4PB9L 1LDPH 2JJVA 3SDXF 4HWZB 5ACMA 3LS5H 1UGNA 4FMFA 2L7UA 4W81A 3HNSH 2OTWA 4L8CA 5HHME 3FB8A 1BJ1J 4Y4HB 1H3PH 4E42B 5K59E 1FBIH 4G8EB 5HYJA 3T0EB 2FB4H 5KVMC 2WANA 4X6DF 3VI3F 2JJSC 1IFHL 3QHZL 1D5BA 2EKSB 2YR3A 3A6OA 2D9QB 4K7PX 2XN9E 4N0YH 1WT5A 4NO0D 1WC7A 3ME0A 5IVXE 2DI7A 4P2QE 1ZK9A 4FNLH 3RWDA 5ID0B 4MDJA 2R8SH 4L8SA 2ZJSL 1PVHA 1RK0A 3HC0B 4U6HA 1DQDL 3SO3C 4PJGF 1IGFH 5F6HJ 4LOUC 4R4BA 4P48A 4EN3B 5F88B 3MRPB 4KTDH 2FHCA 4LEOA 3TVMA 2AXHA 2YS4A 5KS9F 4YDJA 3SCMD 2DQIH 3AXLA 4OLZH 5I19H 3P4NB 1OGAE 3L1OL 2OQJB 1WISA 5DJ8B 1S9XB 4O58H 3OSKA 1FPTL 3K81A 4QHNA 3KYMB 4GT7A 4D3CL 4E41D 3IXTA 1FGVL 4YHNB 5JDSA 3FB6A 4YFEA 4LSUH 3FO2B 1DEEA 3BP4A 1EJOH 5FM5M 1MCKA 4KGLA 5F6HI 4P5KB 3TBVB 5J56B 4MWFA 2WP3T 4CMMB 2XTJB 2J5LC 3X12B 4PREA 35C8H 1I8LC 3D9AL 4K94H 5TE6L 3ARYA 2AW2A 3BH9A 3T4AA 1U8JA 4KZEH 1IGTA 5C0GA 5IW3A 1B90A 2OTPA 3CLFL 2OXGA 5C07B 1RZ7L 4I0PA 1FNSL 4XBPB 3F8UB 4DKFH 2LAGB 4AEHL 3C5ZB 5GRWA 1IL1B 4NZTL 4C4KT 3UBXI 3G5ZB 3SJVD 4Y16D 3D6GA 2DLFH 5I1JL 3QEHB 1U8MA 1JPFB 2AXGB 2W0PA 4I9WE 3QQ3A 4MNGB 1Y18B 5CEZE 3UC0H 2NR6D 2P49B 4IJ3B 4GRLA 2DBLL 2VL5A 3QXDA 4FQXA 1NAMH 2UYLB 1F2XK 5IB2A 2L7JA 4LDEB 4G6KL 1T0MB 4O5LH 3GI9H 5IHZB 4Y5YC 5LG1A 1KB5A 3BWAB 3S6CA 2XZAH 4MAUH 4X7TB 5DT1H 3UZVB 3VH8G 4OTXH 3TH3T 1N8ZB 3KPLA 3MNZA 2NW2A 2XPGA 4Q97A 1KCSL 5EUOE 4XTRD 1LNUB 4PJ8A 2M1KA 3NPZB 4QT5B 1IKFL 1Q0YL 15C8H 2Q76A 5D1ZD 1BGXL 3BP5B 4PB9H 2R0ZH 2R23B 5SX5H 3RUGA 1KIRA 4JM2A 3SCMC 4LCUA 4UTBL 3W5NA 4JQXA 2VLRE 3HRPA 3H7BA 2P43B 4PGCB 1Q1JH 3W0WA 1JMXA 2DLGA 2CDGB 1TQBC 3D39D 2C3VA 1ZWIA 3WNOA 1H3WM 2PTTA 3QAZC 2IAMA 1CF8L 2XA8H 5ESVB 1AGDB 4ELMB 4O2CA 3WHE0 4GMSL 3WNNA 4YDKL 1ZHLA 4K7PY 1DTUA 1EAJA 1PDKA 2NXYB 1VPOH 3QG6B 4PJEB 4JANA 3ROOA 4OSUL 2XNAB 4YK4C 3UTTB 5EZLA 4Z18A 5EOTA 5EWIH 3BDXA 5FIEA 3O6LL 3NCEB 1J1XL 3DYPA 3KPSB 5EIVA 4JAMB 2SEBB 1RAMA 1DQDH 2OM5A 4OBSA 3B6SB 3VRLE 2C4FT 1YC7A 2JKXA 1A6TB 5HY9A 3VFOA 1KPVA 5FK9B 1J5OH 4TYUA 5M94B 1K4CB 4GMTH 1KLGB 2B2XL 4LSQL 5K93A 5TF1L 3HAEH 3S4SA 1EXUA 2BOBB 3FOMB 2VZOA 4CU6A 1FPTH 1IQDA 3P77B 2NX5D 4JO2L 4JFDD 4Y16C 4PRIE 3KPNB 5JHLL 3I75B 2D31B 4EXKA 2G9HA 4X9IA 3GM0A 3JTSB 2BVOA 2MTPA 3MOAL 3QNYB 4BFIB 2CLVB 2DQFA 2VXSL 5EBMA 5FGBC 3BKYH 3FRUB 1OVZA 4RRPA 2QJDA 2E9WA 2VO5A 5FXCH 1XF4B 3G5XA 5EH1A 3EZ8A 3TPUA 4OZGB 3CLFH 3O11A 2YEZA 5C2BL 4L4TA 1KIUA 3DV4A 2ADFH 4YR6B 1FNSH 2ARJA 5IHLB 3MZGB 2D7OA 1UXWA 2HKHH 4NWUH 4X5XB 2RJMA 4G7YL 3MNWB 1CFQB 4LCYA 4NZTH 5D1ZC 1DVFB 1ORSA 3V6FA 1K85A 4S0TD 2WZPD 3KS0J 3QQ9D 3STZA 3U0TA 5BMFL 2H8PB 3KPOB 1U8HA 2VABA 5FYKU 3BUYB 1JUFA 1N6UA 4S1DD 4NN7B 3BIKA 3WD5H 1VHPA 1J18A 3ILPB 2WIIB 1MSPA 5AYUL 4ZFOL 1S7XA 2D3VA 4ETQA 3H0TA 3RL1A 5CJ5A 3TC9A 1Q9OA 3ZHLA 4G6KH 4A6YH 4Z77A 4PJ5D 2Z92A 1JPGA 1JL8A 1PX4A 5I6XB 3BQUD 3DLQR 1KELL 1J8HE 1ZV5A 2I9LB 4CJ0A 1JTOA 4UDTA 1A22B 3UTPD 5CSBA 3ARZA 1KCSH 1UZ6E 2Q8AH 2DJ4A 1GGIL 2FH6A 1B9ZA 3QUMH 1SJHA 4RGMB 3L3KB 3GSOB 5AUMB 1Q0YH 1TCRB 2CIKB 3HN3A 5C09E 2VLKA 4ERSL 4X9GA 4Y0GA 1FZMA 1FYTA 2VC2L 3QFJA 3AAZA 3MX0A 2W9DL 2R56L 1LP9B 2C3HA 3MRNB 1H0DB 2C1PA 4HAGA 4WI7A 5D7IF 4H1LG 1GGBL 3NIGE 4UT6L 2X4OA 1AQDA 4GXUN 4BK4A 2IC2A 4PIRF 3DMMB 1CFTB 3WUWB 3CMGA 4P2RE 5GZOD 4GAJL 4U6XB 4WV1C 2PTUA 1LO2L 2ADJB 3QUXA 5K9QI 3L3OA 4NQDA 4YFDB 4K3JL 2YPLA 1FL5A 4HJJL 3MV9D 4D0DB 2EYRB 1NC4B 3TNMA 1OCWL 3VFVA 5C8JB 2YD7A 3O6LH 4GW1B 4JFPA 4WW2F 3G04A 2D7MA 3OR7B 4LU5L 4JCMA 4PRPD 4OI7A 3HR5A 4FS0A 5HHOB 2JB5H 2M26A 4FN0A 4JHWL 4PRNB 5KZCD 4Y2DD 4HWBL 3HG1B 1S9YA 1QSFE 4NQCB 5TF1H 4RGNE 2NY1D 4M5YL 3HZVA 5KVFH 3E3QE 3M8OL 1LE9B 1PD6A 2LVEA 1FG9C 1IAMA 4L4VE 4JO2H 2P8LB 4WI9A 5IB4B 2FO4B 5JHLH 1V7ML 3IJHA 4S1DC 3VXTB 5DTFA 1CR9H 4YAQB 1NGQH 1Q72L 4TUKL 2HTLD 1U9KA 3HCVB 5FHBL 2EIZB 1EAPA 4L3EB 3TBYB 3ECBB 3HFML 4XCYB 1T3FA 4P5TB 3ZLQC 1B6UA 4PP2A 3NVQA 1T1WB 1JGDB 3EYOA 1UM4H 4M9PA 3LEXB 3BQUC 3VGDA 2V2TA 1MRCL 2WQ8A 5FV1L 5FYLD 4JFEE 1KYOK 1T0PB 4WTWA 1NFDF 5BVPL 2XZCL 5FO9B 1RJLA 4G7YH 5LXGH 4W6YB 4PJ7F 3TO4D 2Z35B 4JHZA 3MV7A 1YEKH 1D6VH 5CJQL 2LTQC 1NMAH 5DVLA 1B0WA 5BMFH 2VLJE 3REVA 4OF5A 4S2SB 4R9HA 4Y1AB 1KJMA 4NM4H 5D70L 3OJDA 3QSKB 1G0DA 3DUUA 3AS2A 1RK1B 1BBJA 2HFTA 4ODUA 4MDIA 1MLBA 4NZRH 1R3HB 3G9VA 1G7QB 2LVCA 1DBKL 1LEGA 4OLXH 3BD4A 4J4PD 1F3JA 3ZDYF 1XGRA 1VSCA 1KELH 1MFEL 2IALB 3CFIC 3MROB 3BMWA 3IJSA 4TOYL 2C3GA 3EFDL 4C4KO 2VZVA 3FCTB 1GGIH 4XNZB 1ETZA 4OF8A 5D7JB 4J12A 3L5JA 4IMKA 4JR9L 1AFVL 2VC2H 3PIQA 5E1AA 2BFVL 4CJ1A 1I8IB 2LU3A 1QKZH 5FGRA 4Y2DC 2HJFB 1YY9D 1FGNL 1T1YA 4E41A 1E6OH 5D2NC 2NY1C 5KSUA 3B8YA 4G9DB 4ZUUB 4TSCL 5L2KE 4J1UA 2AJ3A 3CUPA 4GAJH 5INDB 2IBZX 5I1AB 4LAQH 4YGAB 3MMEB 1YYML 2ZG2A 4Z7VF 3VGAB 4U6VL 1X5ZA 3C6LD 5IMKA 4N8VG 1OCWH 2IANE 3GSQB 3DI2B 2HVKB 3IAPA 3VFWB 1JWUA 5FECB 4M7KL 5D2LF 1CXHA 2Z93A 3WLWD 2A77H 4FG6D 3HMXH 3D0LA 3MRLB 3WL9A 3ARGD 4JHAH 3TA3C 1CGVA 2AVGA 1QNZL 3VA6A 1FFNA 3FAWA 3GJFB 4HWBH 1U95B 3P40A 4X6FA 1HQRA 3BSZL 4Y16A 5KN5A 1L6ZA 3TO4C 4NBZB 4MD0B 1I7UB 4OV6F 5E94A 4BQBA 4QRPD 2DKMA 4EI5B 1AP2B 5IBUG 4RISL 2FL5A 5FM4A 2H1PH 4PJCA 1V7MH 1QFPA 1S7RB 4OZFG 4PUBL 2LE9A 1RZGA 2QKIA 2X4SB 3EJYD 5FGBA 1CICB 1OF2B 2GKIA 4AIOA 1T83C 1YEDA 4WTZG 2XWTA 5E8PA 1MAML 2CRZA 1PQZB 4YHLL 2G5BB 1F5WA 1FL6B 3HFMH 4UT7L 4PBVC 3S35L 5AD0A 1SBBA 2JCCA 2KQMA 3J8F7 5CZVL 3IDXL 5DQDL 3CK0H 1ZVSA 5I15H 1MRCH 2I9TA 2YWZA 1OSZB 3BZ4A 4QRRB 5JW4N 4OFYD 4X5WA 5DK0B 5EZOL 1MHEA 5L9DH 4KH2A 3L3JB 2UZYB 1NBVL 4AH2A 3LD8B 3QRGL 1L7TL 4S1SH 5F7DB 3Q48A 1ZLVK 1HOCB 1YY9C 1I1AD 1EVUA 1G6RL 1U8KA 3ET9F 3SQOL 4G7VH 2P5WD 3QHTC 1N4XL 5IB5B 3ULVL 3HNVL 4DWHA 2E7LA 1I1FB 4WUUA 1WFOA 2HRPL 4GXUM 3ZDZE 4KROD 1U91B 2ARWA 5HHQA 3V6ZB 1BD2D 4TOYH 3C6LC 5HHXH 1JWSA 2QHRH 1FV1A 5KAQG 2D0GA 1UACH 3MYJA 1F13A 3S7GA 1G9NC 1KTLB 3G6JE 1NANH 2Q86A 1HHJA 1YDPA 2MKWA 5F1NB 1KCKA 4FG6C 1AFVH 5TFSL 4OFIA 2BFVH 1OQXA 3ARGC 3FL7A 1BVLA 2D7PA 2ZPKL 1CGYA 1T4KA 4XP9H 1I3GL 4XNYL 1P4LA 2GT9B 4HWUA 3GGWA 4OJFL 4LSPL 3PQYB 4WHTA 5F89B 1RJYA 3MBEB 2OSLB 2A2QT 5FKAB 5T1KB 4TULH 3TH2T 1RFDL 2IBZY 4JGJA 5HHMB 3EJYC 4LLQB 1JYWA 3UBXA 1MCDA 1T03L 1BWWA 1DEDA 4Z0BL 1DFBH 5KVEL 4YDVB 1KSRA 1DQTA 1WZLA 4U6VH 2B1AL 4XPGL 3UJIL 4KTEH 5J12B 5E9DD 4ZAKC 3BJLA 4YUEH 1VFBA 1P53A 1G7IB 2XA3A 2XN9B 3P9WB 5IB3A 1HXYA 4TQEL 1MNUL 2YD8A 5FHAL 5F1SA 1V3LA 3ULVF 4HLZG 2X4TB 1KPUA 3RTQB 1LWRA 3AS0A 1MUJB 5DHXB 2KKQA 3D85B 1E4WL 4KJWD 5H35B 3MA9L 5CP7B 4X9FA 3O2DL 4KJQC 2YD9A 3BH8B 1QBBA 4EDWL 1LK3L 1P7QA 1L7IL 2PN5A 1AO7D 3WMSA 1I1AC 1PZ5B 3WN5C 4XBEL 1XF2A 4NQXA 5A2JH 2Z31A 5TDOA 4CNIB 1D7FA 3QNZB 1G6VK 1PKQA 2R2BA 1N0XL 5JR1L 3ARXA 4YHLH 4Y19A 5MEPB 3BYTA 4P4KA 1QLEL 3QISA 4QEGA 2AXFA 1UM6H 2AABL 1AJ7L 3D2UA 4XNUH 2BSRA 1QA9A 4RA0C 4F7PB 4KROC 4DVRH 4F2MB 4U49A 3FT3B 4V1DE 3SHSA 1XCQB 1BFOB 4U0RC 4PLKD 4KQ4L 4YHPA 2BNQD 3IDMB 3QUKA 1H8SA 2ZP0T 5IF0B 1ZVYA 3ZYOA 4FXLA 3I84A 2X70A 1DQML 1L7TH 3WE6B 4C56A 4FHBD 1KXVC 5DD1H 4WW1B 1KN2H 3TT3L 5DD3H 1T21B 1C5CL 1D6EA 5LGHL 1PX3A 2Y36L 4LLAA 4MS8D 4WNQA 1YMMA 1JK8B 3CFEB 3ULVH 5E5RB 3MV9A 3HNVH 4X6CE 3MYZA 2VZUA 1OT1A 3LHPH 3MRFB 4MXWH 5C0AE 2WBJB 1E27A 4RZCA 3LKSB 3RI5K 4EDXA 3VXRB 5INCB 5CMAA 1PKOA 5CBAB 1EIBA 3RPIB 3FB7A 3LPWA 4FXKA 1G84A 1DCLA 3CCHB 5EUOB 5DD6B 2ZPKH 5KJRL 2IG2H 4NDMB 4NO5A 5IVOA 3MXVL 2EYTA 1RVFL 3WLBA 3VXME 1FCGA 3DIFB 1N6VA 2ZUSA 4MNHA 1UXSB 4KJWC 1WGOA 4DOHB 4OJFH 4ZD3L 4LSPH 2V5YA 5FGCE 4FP8L 4F9LA 2BVUA 4UIKH 5I1LB 4XAWL 1IMHC 1S7VA 2HRLA 4CRPA 1ZGLP 1M4KA 5DZLA 4HUUA 3RZCB 1ZHKB 5CLTA 1EHAA 5EU6D 4Y4KA 1KCLA 1MI5E 1T03H 4Z0BH 2W65A 1SMAA 2B1AH 5IK3A 3ELAT 5JORA 4JFFD 4U4BA 1CYGA 4UIMB 4HH9B 2AEPL 3MJ9L 3V8CA 2P4AB 3C5JB 3IS0X 3LRGA 3MCLH 1JGVH 3PGFH 4Q6IB 1FVDA 1S9VB 4D8PA 4OD3L 1GJIA 3LAFA 3C6SB 3PHQB 5GS1A 4TQEH 1GCFA 2EIBA 4WWKB 4YHZH 1X4ZA 4HDIB 4OZHA 5GS2D 3ARBA 3I9GL 4XPFL 2VMFA 1L9MA 2KDGA 1ZMYA 1F45A 1ED3B 2YMXH 1A6AA 4PLKC 2YSSB 3V6OE 4TUJB 2DYPA 2FATH 3MA9H 4LSRH 3TYGL 5I17B 3O2DH 4GRMB 3EOBB 1LK3H 1L7IH 1GAFH 5JW4M 1G7PA 3NZ8A 4WI2A 2EXYD 1Q9LA 4NT6A 4RAHA 4RWHA 5E6YA 3S8WA 1K9TA 4D9QD 2FLBT 5DRXA 4OAWA 2GJJA 4XBEH 1P7KA 3W39B 5B39B 4XZUA 4J4PA 4MS8C 4PRIB 5HYSG 3LRSB 1VACA 4JO1L 1S7UB 4E9LA 5IROA 4JFYB 5K33A 2AABH 4NZUL 3QUMB 4XCNB 3TNNB 4MAYD 5HDQL 2AV1A 1WIUA 5JQ6L 4DGIL 4TTDD 2DL9A 4KKAC 5TDNB 1CD0A 3NCFB 5FCUL 2EDEA 1YPZE 1IAKB 5L7XH 4LIQE 1QTYT 4BK5A 3O9WB 1FNGA 3LQMA 3OB8A 4PJIF 4ZOCA 4EUPA 5I71C 1S7SA 3MACH 6FABH 1TVBB 1ADQL 2AGJH 3HC4H 2UV3A 3RWEB 3OPZH 5JOEA 1HHIB 2DQJH 3DGGA 3VXUA 1MHPL 3EIFA 3ULUD 5LAXA 4HIJB 5LGHH 5TGBA 5TPWH 4HCRA 4S1QL 1EH9A 4LNVA 2VDPH 4GAYB 1JGUH 1CG9B 4R8WL 3HS0A 5DJAA 5MEND 4PJ9D 3UZEA 4HW6A 4Z7WE 5CP3A 2OL3L 5A43C 4Z7UE 1CVSC 1FORL 2GY5A 2CRMA 1QSEE 3X3GL 3V7MA 1XF5A 5JUEL 5L8LB 4PJDB 1LEKA 4JFHD 5D7KE 1UWEH 1WFUA 2HT4D 4I2XE 5E2VL 1KBGL 3PWPA 3MRCB 1J8HB 3S35X 3BP6A 2VXVL 3CVHA 4JM2F 2FD6L 4FRWA 5D1QB 1BLNB 3HI1B 5KJRH 1OLLA 5CZXD 4QRPA 3MXVH 1IM9A 1C12A 1RVFH 2HLAB 3INUH 3OAYK 1ZHBB 4MQTB 5FGSA 3NA4A 5IQ9A 3DURA 3GSWB 4GLRH 4XAWH 4QRTA 1BQHB 1AHWA 1OAXL 2EXYC 2P7TA 2VQTA 4JY6B 4AEIL 1PGRB 4N1HB 2XV6B 5HGBA 1QRND 2R4SH 4MQ7B 1IRAY 2GTWA 4M93C 1AD0B 1BZ9A 3U46B 3DX8B 4PPTA 1YC8A 1TVDA 3PP4L 4Z0XB 4AENA 1KACB 4NQSB 4EQ3A 3UPRB 2R2EA 3ZKXC 3TWCL 4MAYC 5DQ9B 2PW1B 2ZNWA 4TTDC 2BDNH 4X8XA 4XPFH 4IMLB 4GG6E 4FZEL 4MCYB 1MY5A 3S3JA 1KB5H 1EEUA 4WEBL 1WZKA 1T0NB 3S37H 1PJ9A 3IDIA 3RWFB 5KOMC 5IFJA 1Z3GL 1NCDL 4R0LA 2XTLA 4W6XB 2EH8L 2ZOKB 3RNKB 3GMRA 4D9RD 2P5WA 1RUML 1NGXA 2FWOA 2XXCB 3SDAC 5EZIL 2BNRE 3QPXL 1XR8B 3K46A 4GKZB 1KT2B 5AEAA 2ORBL 2YA1A 5DUPL 2AV7A 5JHDE 1RIUH 2LQRA 1AXSA 2UY7A 3DSFL 4QOKB 3DO7A 5DJ0A 4PJ9C 5DD0L 3BHBB 4NRXB 2VKXA 3QUYB 4Y4FD 4GH7B 4MHHG 4PB0L 3U0WL 2VDLL 5FYJH 5JQ6H 2UZIL 3BPCB 4P2OB 1K3ZA 5F3BA 2HLFD 4HV8B 3C60B 5C0BD 3ROLB 2VDOL 2CLZA 2HT4C 3WDHA 2O5YH 3VGEA 4XVJL 1DN0A 5FDWA 5CJXC 4I4WB 2XQBL 2FIKA 4AZ8A 1ADQH 2F74B 5C0ND 5CZXC 4NJ9L 3SE4C 4NQVB 4K3EL 3G5VA 3O4LD 3IDGA 1MHPH 5D71L 2XZQL 1G7JB 3BKCL 4JZOB 1P4IH 4WDIA 2F15A 4NRZB 3V5DA 1QG3A 1QSZA 1NEUA 2MHAA 1RULL 3PDOA 2CH8A 3F7YA 5IMOA 5E9DA 1T7WA 2FNBA 2EECA 3CFKB 2I60L 3ILQD 3GSRB 4HX1B 4BFGA 2OP4H 4OF7A 3U7WL 2YRZA 2C7UB 3ARDA 4CW1B 3UTSB 3PGDB 1QACA 5E2VH 2ZUUA 1UH4A 1VKXA 2ZUQB 5IHUL 3SY0A 2QQLL 4QTIH 1BF2A 3GSNA 3QUZD 4X6DE 3VI3E 4EOWL 5L0QC 4TVPD 4LDOB 2A1WL 5IJVB 4ZXBA 1OTUD 1SJEA 4G8GE 1R3IH 4UINH 1LEIA 3O3DB 1SEQH 3OJ2C 1YN6B 3NACL 3MRIA 4JCLA 4AEIH 1IAOB 1CD1B 3QIWA 2VQ1B 1HSAB 2VRAA 1JZ8A 2FR4A 4ENED 3ZYZA 3DROA 3C8DA 5A1AA 1F8TL 1U8IA 2BOCA 4JKMA 4PJGE 1K8DB 2PYFB 5SX4H 2PCPA 4F58L 4L8DA 5EBWA 1J88A 4GFTB 2C3WA 4OKDA 5KS9E 1LO4L 2YBRB 5FM5O 2Z4QA 3TWCH 1WWBX 5E8NB 3MO1B 1G0XA 3Q6FA 1DQQB 2BNQA 3GNMH 4OKVB 2NY3B 2HLFC 3OXRA 3DGCR 4WEBH 5LGJB 4MNQB 5E7BA 1AKJA 3MREA 1Z3GH 5DLML 2Q7YA 1YECH 3PP3H 4IOIA 4K07A 1A6UL 3B2VL 3BO8B 3P73A 5C0NC 3V7AG 3QXAB 1TZHA 4XWOD 4OIAA 4Z95L 4N0UE 3DRTB 3RX8A 1B4JH 4F15B 4IRSB 2V7NB 5EZIH 1T1XB 1MFDL 4YHYC 4E0RB 4NYLB 4APQA 5EG6C 4BZ2L 3KHOA 5F7KC 1XCTA 2A9NL 3DSFH 3VH8B 2Y5TA 1RUKH 3JTTA 1TTGA 4PB0H 1RZFL 5HHPA 3OX8B 5D7LE 1NLBL 3ILQC 3QDGB 4PP1D 3G6AA 2EDYA 2VLLA 1U3ZA 3RAJL 2W0LA 1P1ZA 1SEBB 5L2JA 2EKJA 3PWUA 1G9MH 3U82B 1FVCA 5FA3B 4MD5A 4L3AA 5D5MB 3E8UL 4G5ZL 3W2DH 3DPBA 3SKOB 2AAVA 1KUMA 5C08D 2AJYH 3CNKA 3P0GB 4IRJD 2XQBH 4KRPB 1F4AA 3ARED 4XVSL 5DJDA 4U1KA 5B8CA 3QDMD 2UVEA 1OTUC 1K5NA 4JRWA 1QBML 2M2DA 4KK6C 1FJ1A 1WBYA 3RA7L 4KMLB 2HN7B 5GGUA 3FQRB 2XZQH 4ODTL 5IW1A 1G1CA 3QIUB 1UKSA 1IM3A 1E4XH 2CXKA 3K4DA 4I48A 4O2FA 1MAJA 3CXHJ 3L5IA 32C2B 1BFSA 2X4NA 4K9EH 3MFFB 3R4DA 1JYXA 5DRNA 2I26N 3C5SA 5I1HL 3DVGB 4WO4B 3B9KC 3ZYJA 4RFOH 5I9QC 3QXTA 2HTKD 4KKLD 5IQ7H 3L3GB 3BKJH 4R2GC 2ITDB 3C9NA 3U1SL 4OT1H 5E0QA 1UCBL 2J6EL 4AIZA 5EU4B 3CDFA 3UTOA 1BM3L 2G2RA 3WO4C 3VXPB 4PJHB 4PJFA 2A1WH 1LE5A 4FQ1L 1WCBB 3DI3B 2HWZL 4HPYL 4PGEA 5SWZA 3FB5A 1TCMA 4ZNEA 2E6QA 1W8NA 4XBGA 5KSBE 4IRZL 3S34L 4XWOC 2JLLA 5E8EB 1C1EL 1PSKH 1IAIM 5MEQB 2IQAA 4U1JB 3CVIL 1XAUA 5E24E 3MOBH 4JN2A 3AMLA 3O45B 5BS0E 2YUZA 5DRZA 4MJ5A 4JKPH 2OJEB 1T6WA 2GHWB 3BPOB 4JDTL 4PJBE 5ILTL 3F58H 4LCWA 3U7YL 4HUVB 4PP1C 1I7RA 3GJEB 5I66B 5F7YC 2MQ3A 4Z7OF 5JQHC 4HWZA 2KPNA 2BC4B 3P0VH 5HJ3B 4G3YH 5I74B 2YA0A 4PRHE 5T3ZH 4PJCF 5DLMH 1IGJB 1A1OB 2VAAB 2VQUA 3EGSB 4IRJC 4AEEA 3AREC 5A16B 3B2VH 2P5ED 3B5TA 3BGFC 4E42A 4X4YB 4G8EA 3T0EA 3OG4B 4TSBL 4GBXD 3SKMB 2PXYB 1Y0LB 4KKNA 2UVFA 4YXKL 2EKSA 1A7NH 3LKQB 3NABL 4WU7B 4HFUL 3K0WA 4LVHB 4C59B 1NAKL 5HYEA 1A14L 3F7VB 5JXEA 2VE6B 2VH5L 5ID0A 2WK2A 3IRZA 5DSCB 1RZFH 4DK6A 5EBLB 3HC0A 3T3MF 3RAJH 3SE8L 4U31A 4NBYB 1V3KA 2HTKC 1HINH 4KKLC 4F9PC 4EN3A 2X1QA 5F88A 3MRPA 2PO6B 1U3YA 3E8UH 3L9RB 2YPKB 5LBSL 1YEHL 3IAGC 1PBYA 4EQ2A 2NXZD 5FB8B 5ESAB 3P4NA 4YDLB 4H1LB 2OQJA 5DJ8A 1S9XA