1RULH

Crystal structure (d) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 5.6 with a data set collected at ssrl beamline 11-1.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
221
Chain Sequence
b'RVQLQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin igg2a, light chain
molecule tags Immune system
publication title Probing the antibody-catalyzed water-oxidation pathway at atomic resolution.
pubmed doi rcsb
total genus 45
structure length 221
sequence length 222
ec nomenclature
pdb deposition date 2003-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rulH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rulH01
1F11B 2A1WH 5FKAB 2MQCA 5BW7C 3TNNB 4Q9CA 1HIML 1W0WB 1GZPB 4G6AD 3S4SG 3MRKA 4J3SA 3RWGB 3KPNA 2WWMD 5CKGA 1FZKB 2HFTA 3GI9L 4HS8L 2D4FA 2E9JA 3ZYOA 2OTUB 3RIAF 5HHVL 3LQAL 5DVNA 5EA0H 1ZHKA 3V4PL 1RJLA 3HN3A 4JRXD 3QT2A 1HILA 2Q6WB 3BKCH 3PQYB 1BMGA 5INCA 5GIRA 1WWBX 2X89D 4U1MB 2Q87A 1MFEL 1FLRH 5FV2A 1A21A 1CZ8L 4ZPVA 1EFXA 4OGAD 3NA9L 4PJHF 3NCMA 2ADJB 2VABA 2A38A 1NGXA 2NY1B 1IEBA 3M1BB 5IEHA 4U0RC 1T04B 2B4CH 2YBRA 1K2DB 3MGTA 5D7JA 3EYUH 3WFHB 4NM4H 2DLIA 1KN2L 3GEWB 2VAJA 3UYRL 4ZTOH 2DLTA 4FQXB 3MYJA 5ICZB 4FQIH 2IPTL 4PJGB 1T4KA 5IMMB 5C9JB 1R3JB 3WIHL 1S7XB 3RVWD 2X89A 2Q86B 4Z77B 4XBEL 1WVZA 3DURB 1BGXL 5FYLH 5JIHA 4I3RL 5FF6A 2Z4QB 5FHBH 4XX1G 4HLZH 4MQ7B 3MFFB 1U8LB 5CJQH 3RUGF 2C1PB 4Z7WB 2E8ZA 5FXCH 4PJBB 2CIIA 4WHDA 3BN9C 1EZVY 4MJ4A 4X8JA 4NT6B 4CAGA 4HT1H 3VFMB 3BYTA 4L3CA 4E41A 1K8DB 1MAJA 1QFWL 4XNXL 1OD9A 2DLHA 5DMIH 5FB8B 1ADQA 3BZFB 4Y19E 4RAVB 5DUML 4FQLL 4MMZC 4XCEA 2B5IC 3CJJA 4QRUB 1CYGA 5DJ6A 2RGSA 4CADB 2DQJH 4MQXC 4LP5A 4U7KA 5I19L 4X9IA 1U8QA 3FB8B 1MLCA 3F7QA 1N5AA 5ID0B 4LVHC 3IF1B 4P4KA 3IXTB 4KK9D 5D7LB 1JWUA 3PIQA 3MJ9A 4WFHE 2MCPH 2QJDA 1CGXA 4AH2B 1HKLH 4MJ6B 3O6FC 3U36B 1DN2A 3JTSA 5C09D 2F54A 3LS4H 5CBAA 1U91A 3RDTD 5JHLH 5D6DC 1DFBH 3CUPB 4RWHA 1JMXA 3ZYIA 2IBGA 4R90L 1EGJL 4APQA 5GZND 3O9WC 1S7XA 4WI4A 2NXYD 5D1QC 5ADOH 5J6HB 3MYJB 1BOGA 1AIFA 1OWRM 4H5SA 3B9VA 3DIFB 4JO3L 4KJWD 4NQDE 1NCDL 4LCCA 2M8XA 1HCVA 3UPRB 1HKLL 1AXTH 2ZUSA 1MH5A 3VRLF 3H7BB 3U7WH 4Y4HD 4GKZB 1RD6A 1X7QB 1U92A 4QTIL 5CLWA 1WBXB 1HSAA 2R2CA 4FZ8H 5F71A 3C2SA 3VXSB 3OB8A 3BO8A 4F7EA 5DFVC 4CU7A 1HILB 4OFYA 5DVMA 2ARJQ 4QRSA 4ZUVA 4GBXD 4HWBA 4X7FC 2DMBA 4R4FL 2D7TH 3TJHD 4X8XA 3EGSB 5F89B 5DZOA 1P4IH 4KKAC 2YRZA 2DKSA 1VGEH 4NJAH 3PV6B 2VH5H 4WO4B 4X9HA 3BWUC 3V6FB 1PLGH 3D39E 1O7VA 5T3ZH 4OJFL 1C7TA 5HYSB 1BQLH 4MQTB 5GJTH 3U1SH 1QHOA 3VMNA 2J8UF 4Y16D 1MPAH 4KTYA 4YEFA 5F1KC 1SM3L 5IW3A 1C5CH 2BVPA 1YC8A 4XBEH 4OZIB 3RTQD 3IKCA 3GJFB 5F1SA 4NPYB 1A7RL 3TN0D 3V0WL 4G6KH 3NZHH 3LOWA 5GSRA 1BZQK 1V5JA 3T0EA 1T0PB 3DROB 4ZNEE 4BQ9A 2GJ6B 1AC0A 5JNYB 2AJYH 3BP5A 2HJLA 4H20H 1S9KC 2AJYL 3A6BL 4H20L 4TOYL 4FQCH 4D0CB 1YNTA 1IMHC 1A0QH 5ILTL 2FNBA 2A6DB 5DJCA 1LK2A 2FECL 1A7NL 2F54D 2OBGA 1UZ6E 1X7QA 3M17B 4YGVA 4M1CD 4TVPD 1UQSB 5H37G 4J3TA 3QFJE 5BCAA 1DEEB 3OAYK 3ROLA 3ARBD 5KS9E 3OJVC 3T65B 3UDWC 5IGXL 4X6CB 3T3ME 1KELH 5EZJB 5D9SB 1IEHA 5IB1B 1WK0A 4O00A 4JVUA 5B3NA 4NQEA 1VEOA 3PWJB 4JN1H 5CEZE 2XN9A 5IW1A 1HIMH 2C26A 3BH8A 2J7LA 3ILQC 4XGZA 3UBXG 3KYNB 4XP5H 2X4RA 3BP6A 4GT7A 3H9SD 2P5EA 1VB9A 1WEJH 2F5AH 5IHUH 4C55A 4AM0A 3LRHA 5D7IB 5EC2B 2EC9U 1G7PB 3KJ6L 3WUWA 3QXTA 2RB8A 4BQ6A 4LPWA 4U1JA 4KUCF 1INEL 4ODXA 1T2QH 1EBPA 2DJ4A 5MENE 4AQ1B 1FP5A 3QBTB 4L4VD 2P43B 1OP3H 1BFVL 4EBQL 5HHME 2YS4A 4PGBA 5ID1B 1G7LB 3O6LH 4QYOB 3U0WH 1J5OL 2VLJB 5HHXL 4PGEB 2LU4A 1MLBB 4QRUA 3VGBA 3L3DB 4XWGL 4ZUUA 1ZLVK 2F54B 3IFLL 1ZA6B 5INDB 1L7IL 2XG5A 1MWAA 3O3DB 4M61A 1YEDA 5DK2A 3TA3B 3F62A 4HWEL 4AH2A 4XCNA 4GQ9H 3PIQB 2IFGA 2ATPB 4R90H 3TEUA 1NBZB 1E4XH 1U92B 2XTLA 5KSBB 1IC4H 5JHLL 2RHEA 1HHJB 3QUYA 5HVGB 2GQHA 1BM3L 4LAQL 3UAJD 5F3HB 4PY8J 3VD9A 2A6IB 2YA1A 4ZO9A 3I3BA 4WW2B 4YHOL 1RZKL 2EDEA 3L1OL 3U30C 1UCBH 4KTDL 1AQDB 4RIRB 2PUQT 3C60D 4L8CA 2YSSA 3QCTH 5DJZA 2V7HA 4KJWC 5IBTL 4P5TC 3KDMA 2LQRA 1QR1B 4EUPA 1ZVHA 4FN0A 4Z7VE 2ZOKA 1IGTB 1AD0A 4JZJB 4ZO8A 3L7FB 3P0VH 2WK2A 3KPQA 3MV8B 5I15H 4YWGH 3HG1D 2LV4A 2IG2H 1M4KA 4LPYA 1YEHL 4OZGE 1NEZA 4XPHH 1QG3A 3K8KA 4GG8A 5I17A 1C12A 3AY4C 5INCB 2C5DC 3P73A 5E95B 4KI5E 1SYSB 1RZGB 1YUHB 4D9RE 4WO4C 3G04A 5C0CD 1U8QB 2W91A 3W0WB 3MTRA 1NMAL 1IGCL 4JLRB 4KK9C 3HMWH 3TYFA 1VKXB 3B9KB 4JRYE 4B0MM 3HG1A 4R0LC 3GIZL 3HR5A 3QQ9C 5FHAL 1VADB 3NIGE 3BPLC 3P0VL 1U8KB 3RNQB 1XF3B 4FQIL 4L4VE 5IBTH 4PJIE 4M8QA 5FDYA 4I2XE 4U1IB 1A2YB 1EFQA 3BPNB 4YUEH 4YIQB 4NYLA 3DTXA 3LY6A 1NC2D 4KJQD 4GRWE 1BJ8A 1IZKA 3MODL 3UZVB 1XGTA 2EYRA 4XMKL 2VDLL 4GXUM 4PRAA 3L5WB 4ZAKC 3RVXD 1FLRL 5TE6H 3VA2C 3BT2H 5I1AB 1ZHLB 1HHIA 5IBLD 1MJUL 4Z8FL 3ARBB 43CAB 3T0WA 4JFDE 2XRAH 3QA3B 4HUUA 3I3EA 2P24A 1GGCL 4BFIA 4LPTA 4DGVL 4JFPA 2FX8H 5DRWB 3K81A 5F93C 1UM6L 1EBAA 3DBXA 5BOZG 3Q3GB 4ZTPH 1QFWI 1D9KC 4Y19B 5D7IF 3CFKA 1H0DA 4BELD 4Z5RB 4OIBA 2C3XA 2P7TA 4QRRD 3G6DL 3L3GA 1JVKA 1ZHKB 3GSNA 4RAUB 1IGCH 4YFLF 4F7PA 4HUWA 3L95B 1XF2B 3ZKMD 4S1QL 3FKUS 2AXGB 4FFZH 4MJ2A 4O2EA 2I25N 3KPSD 4CDGC 2VDNL 4XB8A 2WLZA 3DX9B 2W60A 3RI5F 4NNYB 2G60H 2NZ9D 3BQUB 3ULVH 4NOFA 4MD4A 2QQLL 4IOSD 3K80A 4LHJB 3S34L 3TN0C 5I15L 3SKNA 3O8XC 4MDJA 3RL1B 5CGYC 2GKIA 3VFWB 2FSEB 4N8VG 5C2UB 3U30B 3V5HA 2F5BL 1YDPA 2NMSA 4ZS6C 3ZTNL 1LO3H 2F53D 2NY3B 3NOIA 3QFDA 2HRPL 3S37L 2DKMA 3HPLA 4XMPL 3EYOB 5TF1L 4RGNB 3EOYG 1XGTB 2EYRB 3BUTA 3MUHL 5C0AE 2W1NA 5C0RH 1FNHA 5GZNC 3D48R 1P5UA 4K7PH 1BJ1H 2DQIL 4JKMA 1KOAA 4OCSL 3CDFA 5BVJA 4DN3L 3SPVA 2EKSA 2Y07H 4JCLA 2HKHH 3FTGB 3GJEA 4TRPH 4S10A 2Q76A 2CDFB 1NCWL 4HGKC 5JA9A 3WMSA 1NAMH 4MA1C 3I75B 3UAJC 1JP5A 4O4YH 3C09C 3DX6B 4ZFFB 3WIFB 4K23H 2DTML 5FUOH 1FZJB 1WT5A 4X5WB 1FFPB 2AABH 4ODUA 4WUKH 4DZ8B 4E42A 5EOCH 4XXDA 3OBAA 1TITA 4JLRA 2YPKB 4CRPA 2VDOH 1CLYL 3CFBA 1UWEL 5DR5L 4NNPL 4HMDA 3VWJA 1S7SB 3K2UL 3AGVA 5GGUB 3VXRD 1KB5A 2EZ0C 3SGJC 3I6GB 1H3TA 3F12A 2IALB 43C9B 3RVTC 4Q0XH 5L2JA 1YPZE 5C0DA 1HINH 4BH8A 3G6DH 4HIJB 5E7BA 3S36L 3UBXA 3TYGL 4PGDB 4ERSL 5HYEA 1F2XK 2F5AL 3B3IB 5CUSH 5JOFB 3BHBB 4M5YL 5IESL 4ZODA 1PKQB 3LRSA 3UTSB 1CS6A 3SE8L 3FRPA 4BK4A 3HS0A 1QEWA 2CKBH 2R0LH 4NM8H 4C59B 4MA8L 4YPGA 4H8WL 2E7LC 3RDTA 3QZWB 4EEEA 4QTIH 4JVPA 5ABDE 1FAIH 1P7KB 2MOVA 1FV1A 3DMMA 2I07B 2DM4A 4LLWB 2ZP0T 4QOKB 4OF6A 1I1FB 5CMAA 1N7ML 2PCPA 3OR6A 1CFNA 5BZWB 4XNZC 3KYOA 1CFTB 4MCZB 5E6IA 3AVEA 4LEOA 2LE9A 3S5LA 1M7DA 3FRUB 2BMKB 2DQHL 5CWSA 3ZHLA 4OLVL 1CGTA 1A9BB 3TESA 4AEHH 1IJ9A 1ONQA 2XZQH 5D8JH 4YXKH 1QSEB 2EKSB 4G8FA 4Z7OE 1NUDA 4MA3B 3R0MA 2MJWA 2BFVH 3GMPB 4M7ZB 1PGRB 3PGFH 4OM1L 2YUVA 4WU5B 5ESAB 4X4ME 4N8VB 4OFYD 1OQXA 2XFXA 1G9EA 5CIPH 3SY0A 3OKOB 2Z35A 1BZ9A 2I9LA 3S96B 5MERB 1SBSL 4QY8A 4IMLA 4Z78B 1U8HB 5C71A 4E0RA 2ZNXA 4WJ5B 3ILQD 2HLFC 4GRWB 4UDTB 1UWGL 4KHXL 3VXUD 2WUBL 1M05B 4DZBB 3HE7D 4NQUA 5GS2H 5DK0A 2AV1B 5C08B 1U95B 3DYPA 3WS3B 3OHXB 2VLJE 3BUYA 1NFKA 1WBZA 1YEEH 5GHWL 3VFUB 5CJXA 2NY4D 3V52L 1SVZA 5ADPL 1BD2A 5GHWH 3QFJA 3IFPA 2JJVA 3RWFB 2NW2A 3ALWA 2JIXA 1KIRA 4OLXH 3OJDB 4RWYH 3BIKA 4HIHB 5KAQF 4K9EC 3WNMA 1CQKA 1YJDH 3MBED 2XPGB 1NANH 1ZT4A 3PWVA 3ZTJH 4TSBH 5DJ8B 2MKLC 3OG6B 4OFPA 1IM9B 1QSFB 1T2XA 4M6NH 5SX4I 1G7QB 2XKUA 1FSKB 1QLFB 3MX0A 2FCBA 3FO0L 4J3UA 4HWUA 3WIHH 1KJVB 4L4JA 4UUJB 1MUJB 1IZJA 4IRZH 3VRLE 1ED3B 1IGMH 1KB5L 2FZ3A 3RWHA 3O3EB 4JHWL 4I5BB 1DBML 3QDMB 3QXAA 3JUZA 3BPCB 5FUCC 4OLVH 3FFCB 4HWEH 5I1EL 1T6VN 2NY5C 3QIWD 4PJIB 3HUJE 3KLAB 4QRPE 4U1NA 2J8OA 4XCYA 5DZNA 1J1PL 5A2IH 4NQDA 1PZ5A 1A6TB 3ARGC 1I4FA 4HV8A 5JUEL 3V4UH 5SWQB 3QULB 1UXSB 3EBAA 3GBLA 2EDRA 4U1GC 5DD3L 5ALCL 5H94B 2P8PB 4YDVB 5EU7E 3QUMA 2OMNA 3H3PL 4AJ0A 3O6LL 3U0WL 4ZSOB 2OK0L 3MRMB 3W0WE 2Y36L 1HXMA 3LRGA 2VZUA 5EFIB 5MEPA 3QXUA 1A5FL 1NAMB 4KDWA 5FYJD 3WO4B 1GYAA 2HTKD 5L2KE 3GSWB 2DQJL 1JHTA 4K9EL 1E4WL 5C0CB 4ZXBA 5IJVA 5IK3B 4N0FA 4I2XA 3IDJB 4TSAL 3Q6GH 3O0RL 2NZ9C 1NANI 3FT3B 4NGHL 3S36H 2IMNA 3B9KA 4LF3B 1WZLA 1RULH 2XOTA 2NY6C 3QRFM 4P48A 4XP5L 4M8VA 4PJFB 1QFHA 5D5MA 3EIFA 3LD8B 4J4PC 1XH3B 5EIQA 4L3ED 5CJXC 5HI4D 3O3UN 4RBPK 3H7BA 1Z3GH 3EDEA 3V6ZB 5I75B 4LKCB 2MNUA 3C5ZC 4PY7A 2CJUH 3QXDA 3N1FC 5JXAL 5C9KA 4PJ7E 1JF5A 3OKKA 1PSKH 3C8HA 3C8DA 5ALCH 4R97C 1L9NA 1BOGB 5FYJU 4JDZA 5DD6B 5EU6A 4WUKL 3D69B 1MVUB 1I3VA 4KROB 3KDMB 3FAWA 3ROOB 3GSNL 5KVDH 4OM0H 5E5UB 3TBTB 4ZTOL 3CUPA 1D6VH 1PY4A 3IJHA 2P44B 3TCLA 4N90D 4NM4L 2N4IA 3F58L 4E5XA 3EYUL 1DLFH 4I3GA 3HI1B 1OWWA 2XZAL 1PEZA 3HHRB 3QI9B 1F3JB 3PV7A 1S9WB 4FRWA 4M4PA 3TA3D 2ED9A 5IT2H 3E6HA 5BO1L 3WFCL 5ACLA 4M9PA 5JDJA 3NA9H 3QUZB 3TIEB 4JO1L 3KS0J 5C0RL 4G43A 3LDBC 4PJXF 3EO1A 2OP4H 5IP4A 3JV4B 1JWSB 1C5CL 1WFUA 2XZCL 1RU9H 4YC2B 4NIKB 2X4NB 4KY1L 5D1QD 4TSBL 3SDCA 2LVEA 2DQFB 4CW1A 2ZG3A 2F5BH 4U1SB 1N64H 1SBBA 4PTTA 5ICYB 1G7MB 3F5WB 3VFMA 2G5BA 3ROOA 3BX7C 1HXYA 1MLBA 2ESVD 2XXCB 4LCYA 5D70H 1NC2B 1P4IL 1U0QA 3GUTA 4HK0B 3L5XH 3TBWA 2A83B 4M62H 2PO6C 1U8LA 2CUIA 3RIAK 5I74C 1YEFL 3DRTA 4L9LC 4D9LH 2KQNA 1GVIA 1UXSA 4GBXC 3QXDB 5LGHL 5LWYL 5CHNA 3QEGH 1ZT1B 4P9HH 5AZ2L 3LKPB 1WTLA 2JKXA 3O8XD 5DYOA 2DL2A 1D6EB 1E28A 3VGGA 3O4LB 1J0KA 3U7WL 1G0XA 2M1KA 2HKFL 4NWUH 5GRWA 1LEIA 1OGAE 5DJ2B 3TZVB 1LO0H 2CRIA 4XGZB 5EO0B 4XVSH 2CRMA 3RHWF 5F7EH 4DGVH 5E8PA 3MGTB 1PVHA 4YC2C 1MCJA 5C0JA 1EGJA 1WIOA 5GRVL 5BW7A 3DV6A 4OCXH 4JGUA 4YXKL 1IEBB 1ZHBB 2XRAL 5C3TA 3RL2B 2JE8A 1RJYB 3QQNA 5ADOL 5DC4B 3QEQA 1Q9LA 1PY9A 1LO2H 2YD9A 1FNEA 3LEXB 5IVZB 3MRMA 4G9FE 5AG9A 2R1YA 3S9DB 3QNYB 2OL3H 2Q6WA 4P3WA 3G6JB 2DS4A 2FJGA 5DK3A 3GGWB 4PRHB 2H2PC 3U46A 3O4LE 4HMCA 4N5UA 3MODH 1ZS8B 4I0KA 5HI3D 5DUBB 1MCOH 2DQGL 1X5ZA 3ARYA 3KPNB 1KIQB 4O9HL 5FOBB 2ORBL 2DAVA 2VZ3A 3KLAA 4DWHA 3BSZL 5GRYA 4MAYD 1UH3A 1JGEA 3REWB 2VLKB 3BN9D 3QIWB 2NXYB 3BUYB 4WWKB 3EYQC 4WFFE 4J12A 4OFVA 4RRPG 4RX4D 4ZOAA 1JI2A 1R0AH 1M71A 3E1F1 3BP4A 4HH9A 1HYRC 3V9FA 3G6JE 4HCRA 4LK4A 3QSKB 4LASH 4XVUC 1IILE 1MRDH 4WI7A 3W5NA 4LQFL 4AEIL 3FOMA 3WN5A 2BNRD 1A7OL 1L4IA 3LSOB 5J3HC 4ZYKA 1FYTB 1IM9D 2HWZL 3KLSA 5DFTA 3CLEH 3DUHA 3EFDH 1I7RB 4X83A 5CJQL 1F00I 4PRIB 4PR5A 3B83A 3HRZA 4GKNA 1MIML 4U6HA 3BZEB 4PRDA 3KPOB 3MV7A 4QNPE 4WUUA 1UB6A 4HGMA 4PLJD 5BRZE 3B2VL 3CPLA 1F3RB 5JIPA 1I9RL 4MZ2A 5BV7C 1KPUB 4OZFB 2Q20A 4FG6D 3ET9F 4K7FB 5GGQL 1MCNA 3RDTC 2GTZA 1VA9A 5JW3L 1ADQH 2JCCB 4YHNB 4O5LH 3E6FA 2HMID 3S5LB 1PX3A 3UYRH 3WCYA 5ELIA 1A7BA 4NQED 4U31A 4YHIB 15C8H 1FVDB 4EN3B 3T8XA 1MI5A 4LLWA 1RZKH 3L1OH 1OLLA 3CVHA 3DV6B 3L3OA 2EC8A 4YQXH 1WISA 1B0GB 1ZT7A 5J89A 5HHOE 1H8NA 1RIUL 2IH1A 5GISH 2GHWB 3EJYD 1F4XH 1JNJA 3H9SE 2FGZA 4X7TB 3SGEH 5F3BB 3F7VB 4DKFH 2DQEL 4BYHA 1JV5B 4LLUB 1D7FA 5GGTA 4L5FL 4HBCH 1V05A 4HXAL 5EU5B 4MD5A 5DMGC 1QSEA 4YO0A 3OMZA 5LJYH 5ACZA 2ITCA 3DUUA 3OXRA 4ODWA 3PHOB 3I2CL 5K9QG 2FX9L 2NY1C 4XWGH 1II4E 3SKUD 2FH6A 3DOSA 4XXCA 1I7TB 1DJSA 3SDXF 3DARA 2ERJB 4Y8DC 4LCCC 4EKXA 1YZZA 5TDPB 3GRWH 4P3DB 2OJEA 5HDLA 4YDJA 3TJHC 5E9DE 4P4KB 4XBPB 1U3ZA 1KF9B 3GBMH 3V0AC 4LKXA 4EBQH 3S96A 5I8KL 4O51A 1XGYH 3ARPA 5FGCB 2ADIA 5IOPB 5JPMA 4LLAA 2Y1VA 1UH4A 4WEMB 3VDCA 1V3MA 4OZHB 2WBJD 3SCMC 4FTVA 3LB6D 5KVEL 1K8IA 3U9UB 4G8IA 3P4OA 4PLKD 1E4XI 2DD8L 4ZFFA 3RWIB 5IHUL 4WHTA 3KPMA 2JF1A 4GKSB 4M7LH 3PXHA 4MXWH 3ULUF 1UJ3B 4YLQT 4X8JB 4CU6A 5ACZB 3IVKB 3H9ZA 5TDOB 2FX9H 4LCIL 4G8GA 2FATH 2IAMB 3FQWA 5D1XB 1UZ8B 2C1PA 1S9WA 3ARWA 4M7LT 5DJDB 4MS8D 4ZFGL 3F12B 3FCTB 4W6WB 4BUHA 2JB5L 2AXJA 1T20B 5CP3A 5F1NB 1LO5B 3P11H 3EOAB 4A2LA 1R3JA 3NMEA 3B9AA 2F8XC 1MI5B 2DF3A 1FGVL 4JFHE 3QUZD 5FKPB 1PKQA 3LRSB 1FNGA 4M1DL 3KYMB 1BEYH 1FFPA 2QSCH 1A3LL 5TH2A 3ARGD 3ZSSA 3C5SA 4MNHB 3HFMH 4YO0B 1A6UH 3VFTB 1AE6L 5CJ8A 4NNYA 3Q5TA 4OZFA 1LP9F 1QRKA 3QHFL 4ZQKA 3IDGA 3RWCA 5D5MB 4JANB 1A7RH 3QNZA 4KROD 4TNVF 5DJ0B 3SQOH 1DBKL 1I3GH 2OR9L 4IS6B 1BX2B 3QRGH 5GGQH 2HG5A 1YMHA 3KPSE 3KAAA 4HKZA 1I7RA 4P23B 1MEXL 4XP6L 3RWDB 4I2XB 4ETYA 5HGAA 4EZMA 5EZOH 2I26N 3CVHB 2PO6D 1ZSDB 1KT2B 3S35X 1FIGL 4R8WH 4NP4L 1NMAH 4OJFH 4RFNC 5TQ2H 1OL0A 2R1XA 5DS8A 4OLWH 3VWJD 4JO4H 4POUB 4Z7QF 3C6LA 4Y88A 3KYKH 3HE6D 1NFDF 4ALAH 2E7HA 2UVFA 3KPTA 4AY0A 5FO9A 1NDMB 6FABL 2XWJB 5JHDD 5E1AB 4MD4B 2EEAA 4ODSL 2AXFA 3BPOC 3ARQA 4LFHG 3PHQA 4MZ3A 4OLYL 2JK5A 4KKLD 2NY0C 3ZKSD 4PJIA 5FYLE 1KJ3H 4FZ8L 4WI2A 3VMOA 4YFDB 4WW2C 3O2DL 5I1IL 1W72A 4N9GA 4ENED 2IH3A 4KTDH 3AU1A 3VGFA 3HUJB 1Z5LB 1MCOL 1WWCA 4YHOH 1YQVH 4NRZB 1XF4A 3P77A 1U8MB 3DJ9A 2FSEA 3R1GH 1KLGB 3ZE2F 1D5BB 5SX4H 1CR9L 1CXKA 4YHML 3G5ZA 2FD6H 4P4KD 4XH2B 3BFOA 3RNQA 1V3JA 3DVGA 3H3BC 5FA3A 4W68A 5JW4N 1H3PL 4MAYC 1ZK9A 4U6YB 4JM2C 1CVRA 5SWSB 3LIZL 4P46D 1CF8L 2BHZA 2N7BA 3MRBB 4IS6A 4JAMB 4HUWB 4PJ5E 2YRLA 2P46B 5I1AA 1CDUA 3ZE1F 5GGRA 1QP1A 4PJEE 1SYSA 4J3VA 4K7PX 3MR9B 1JGVL 4ZD3L 4PJ8B 3SDCC 3VI3F 3QNYA 4XVUD 4L8DB 2F19H 1Q9LB 5T1LA 5DK0B 5H35B 5B8CA 3JV5A 4WTZA 5DQ9B 5K9KB 1YYML 5C6TH 5C0JB 5E2VL 5C08E 3NIDE 4WI6A 4X99A 1BVZA 1XF3A 1G1YA 4APQC 2BSRA 4MVBD 1JTPA 4KMTL 4I0PC 3D87B 3NIGF 2CRZA 1VADA 2XWBA 2H8PA 4WU5A 5LXGL 1A6WL 2E9WA 4ZDHA 1BD2D 1IAII 1FAKT 2BRQA 1V8HA 2AK1L 2XZZA 1D5MA 3C6LD 2JTDA 1Q72L 1TCRB 4J6RL 5T5NG 5C6WH 1HN1A 1Q94A 3DSFH 5EIIA 2W9DH 3DTXB 1BREA 1OTSC 3G08A 5ISZA 5AG8A 3MRJB 1G9ML 2GW5A 1QFOA 3RZCB 1QACA 3WE6B 4MS8C 3TGXA 4IOFC 4R26L 1A7NH 2WWMC 1TQCC 5KVFL 1G7MA 1GCFA 4JY4A 1FV1B 1OAQL 5J6GB 1A0QL 4LU5L 2Y6SD 3V6BR 2IAMD 3WLWD 3L3DA 1RVFH 1KBGH 1Q0XL 2XZAH 3HG1B 3PGDA 4HJGB 5HYSG 3MRDB 4F2MB 4XBGB 3FRPG 1NLBH 1NLDL 2PW2B 1LP9A 5TDPA 1BP3B 4FXGA 5DHVB 2W65B 2J8UA 4MD0A 1ZEAL 3S4SA 4MDIB 4NQVB 3VRIA 1YUHA 2XQBL 3QEUB 5FCSH 2CIKB 3RVUC 5BOPA 2A2QT 3HPJB 5E00B 1XCQB 2IAND 2WBJB 3AC0A 1TQBB 2PETA 5HHVH 3FN9A 3QAZC 2VZOA 5JXAH 2J5LC 2NR6C 3VFRA 1CWVA 3PWPA 3AM8A 1JN6B 2JJTC 3KYNA 5BJTA 4OD3L 4L8BA 2VLMD 3MOQA 3VXNB 4F9PC 4OKDA 1JPTH 4OB5H 5F7UA 5KVGL 3OSKA 2D7TL 4F9LA 4XNYH 3VD3A 4NGHH 5IR1B 1CBVL 4NO2B 3C5JB 3VWJC 4NO0D 4ODUB 4WHYG 3OKKB 4FZEL 2B0SH 3A67H 5ESQA 2YN3A 4F37K 4PS4H 5KG9A 3VXMA 4S0TD 3RGHA 4UOW1 5FOJA 1MHCB 1F4YH 4FP8H 3CFJB 1A14H 3PABA 1H3GA 4CKVX 4YAQA 5C0GB 1TLKA 3PDOA 2IANE 4IMKC 3IRZA 4NJ9H 2NCMA 3CFDA 1SY6H 1BOYA 4N0FB 12E8L 1AH1A 2VDQH 4JO2H 1A9EB 5GGSY 4FMFA 3B5TA 5JR1H 4OQTA 1ZAGA 1CGYA 2D0GA 4N90E 3D18B 3ISWA 4PB9H 4QRPD 3VWKA 3DO7A 1RJCA 3EYOA 4XPFL 5SWZE 4MXQD 3TO4D 3RWHB 2ZUQC 2X4QB 4I1NB 4ODTL 3UCRA 4OF0A 3VFPB 3QIBC 5CS7A 4NQXB 2IEPA 4S1SL 4PTUA 1AO7B 4JFZH 1L7TH 3MCKB 5DRNA 3DXAE 1BWWA 1M71B 3GIVA 3IDNA 3SKNB 5FA4A 4H1LB 5E94A 1H8OA 5T1DH 4OZGA 4GXVL 4NN6B 3TC9A 5DHXB 5HYQA 3ES6B 2Q3ZA 4M7KH 3MA7A 4XCYB 4M6NL 4U1NB 4XC1H 2XPGA 4KGJA 1AQKL 2HT2D 3NFNA 2CDEB 5I19H 3MBEB 3ULUH 3VFGL 5FYJH 1CFBA 3RWFA 2RAMA 4HZAA 2B2XL 2YD5A 3QR2A 2FJHB 1MCDA 4HZLB 1MHHA 3RI5K 3O6ML 1TZGH 2JLLA 4XPAL 3HNSH 5CJOL 5C6PB 3GI8H 4YJZL 4MA7L 4FQ2H 1BFOA 2WBJC 3SCMD 4WHYH 3ZLQC 4MGXA 4OZFH 3MV8E 5FUZL 2Z93A 2MPAH 1AY1L 5C08D 2A9MH 2J6EA 4KJPD 2BJMH 1FH5H 2XXMB 4PGJA 1P84J 3MMEB 4XT1C 1FE8H 4BFEA 5BS0D 2PTUA 1QSEE 4I0PD 5FHBL 1DBBH 1NL0L 1CT8A 1JRHL 2A73A 1BGXH 3CFCH 5CINL 3NCEB 1LP9E 1W0YT 4I8DA 1INDH 1EXUB 1AI1H 4HKJA 1OW0A 1KN4L 1CE1H 3C5ZD 4Q9QH 4LLMA 5C08A 5I0ZA 4UB0H 4BSWA 3L3KA 2VUYA 2XZQL 5C0EB 2KH2B 4JM4H 4OV5B 4B5EA 1TTUA 1URLA 3PGCB 3D39D 4P99A 1L6XA 2CDGA 4L9LA 4YGAB 3FO2A 4QHLA 2W9EL 1Z9SA 1T03H 2YMXH 4WFHD 4HEME 3F5WA 3SDYL 2E7BA 3UPRA 4DFIA 2P5EE 3MOBL 1SEBA 4I77L 2GTWA 4AENB 3HAEA 2EIZB 1DL7L 1DCLA 3P4NB 5CP7A 5C92A 1OOAA 4JN2A 3HA0A 4GMSL 3CCHB 4NO2A 5EOQL 4MMXC 2PN5A 1I9IH 3UTTB 3TWCH 4D9QD 4OCRH 3FL7A 4ZUVB 1MCHA 3QQ4A 2APWA 3EO1B 5F6HI 5B22A 1IQDA 1OSZB 5FGRA 3LKNA 3NCJL 1KCLA 1OARL 2D31A 4JKPH 3JV6B 4L4TA 4OF8A 2Y06L 3ECBA 1CFTA 1IGYB 4MCZA 4M5YH 2KL6A 2YD4A 3VXUE 5JW5B 4O2CB 3OJ2C 4HD9A 3TBVA 2GJZA 2HVKB 3RX7A 1MFBL 2CO7B 1IKFL 1VFAA 5GQBA 4MJ6A 4QHUA 2WP3T 1M1SA 1ZGLB 5FF6B 5GGTH 1S7QB 1J86A 3DMMD 3ARXA 4P5MA 5E70A 4RDQG 4ZUSB 3U4BH 3CXDH 1BZ7A 1LO4H 1MQKL 3J7HA 4BM7A 1YN6A 1BBJA 1KG0A 4DCQB 4XXDB 1RUPH 5F96L 2M2DA 3B3IA 5JOFA 1JZ4A 3QWRA 4PP2A 1IC5L 5D7JB 1K2DA 3MUJA 4Q6IB 5I6XB 3MLZL 3STLB 2VAAB 5TFSH 3V6ZA 3MV8D 1YY9D 2VABB 3UEZA 3QQ9D 1OARH 5BS0E 3TBVB 1I9JH 1AXSB 1U3YA 4UMGA 1NBZA 5ALBL 3VXOB 3N1GC 2XICA 1R24B 5DEFB 3VI3E 3BZDA 3VDBA 4HAGA 1I9IL 3M45A 1ITBB 4N5ED 5IQ7L 1XAUA 4NKMA 3FJTA 4LBEB 1J88A 1T1YB 1PG7H 3EDDA 4DKEL 1TTFA 3O9WB 1FJ1B 1XEDA 5A16A 3SDYH 1GZPA 2HTLC 4Y4HA 1W2KT 2Q1EA 4X0KB 1TQCB 4TUJA 4YK4C 1NMBH 2P8LA 3Q6FA 5I30H 4JG0H 1G0DA 3X14B 3STZB 4Y4KA 4G7VL 4YZFE 4RFNB 3DX8B 4X6DF 3PP3K 1PZ5B 3L3KB 3PP3H 2FHCA 2NY5L 4HAFA 1HK6A 1FRGL 3K46A 2V5RA 2AQ2A 3EYVA 1QPXA 2WWKT 1OSPL 2XQYG 3GMNA 3C60C 1TVDA 4L8DA 5F9WB 2BVTA 1G9NC 5DD5H 2IBBA 2R69H 3N0PB 1WFNA 1T1ZA 4F7PB 1QBMH 4JY6B 3TBSB 1TVBB 3AFLA 4UNVA 2BZDA 5FYKH 4I0CC 3WIIL 2DWDA 4UUJA 3CZFA 3BOVA 3CVHH 4NQSB 5B39G 2E6JA 4G8GE 4HIIA 1AY1H 4ZXBC 2MPAL 4D2NA 3B8SA 1FHGA 1NCNA 1F11A 2AJUH 3O81A 5D5MF 1QBBA 3ORJA 4YXHH 5J13B 1S5HA 4NFDA 1HZHL 3DVGB 2AJSL 4NQCE 1QD0A 4BUGA 4PLNC 2YXFA 3QA3A 4NHUB 5AD0A 1TZGL 2IADA 3U7YL 1L0QA 3GIVB 3IDNB 1KIRB 3QPXH 5DO2C 2NW2B 2VTFA 5FYJL 4ODHH 4LEXL 3B5GA 3Q1SH 4LGRB 3T0EB 3HI6L 2L4OA 4DGYH 5IJKC 4G9DA 4O2FA 3RU8H 4EUPH 4ODVL 3SDXB 4NPYA 1B4RA 4U6VH 2R23A 5JDSA 3MJ8A 4NHCH 4XHQA 2VWEE 5DJXA 3VXRB 3Q3GA 1RIVL 2HRLA 5IM7A 1KLUA 2VLRD 5B21A 2X70A 4RGOH 4YDIH 4BFIB 4BFGA 1I3RA 1RK1B 2BNRA 3MRGA 1A1NB 3RGVB 1S7VA 1IFHH 4S1SH 3PWNB 5EN2A 3S98A 4ELMB 5D7KE 2X1QA 5L88L 4PJ5B 4X0KA 4WWID 2D3VA 4EOWH 3ME0A 3DLQR 4BA8A 3HMXA 5F9DC 2BSTA 1EVUA 2UWEF 3IKKA 3PWPD 5D7JD 1UJ3C 5F1IA 1KT2A 3T2QA 5BZDB 2H32H 5C70A 4J3XA 4KV5E 2QV2A 1AKJB 5DD1H 3WLBB 5KSVA 3QCUL 3AM8C 5CWSB 2MQ3A 1IKNC 3VI4F 4KUZH 3OPZL 2QL1A 1QUNA 3CSYA 2YD8A 3VXOA 2DLFL 2VDKH 4M93C 4WO4D 3NCFB 2HFGL 4DUVA 3ARDB 4DW2H 4JPKH 4MSWA 3MGOA 4PPTA 5LCVL 2ZOKB 1NGYA 2Q7YA 5L7XL 2RFXA 1XIWB 3ZE2E 2P1YA 2V2XA 1SJEB 3CAFA 5KVGH 3P9MB 1I1RA 1YEIH 2IQAA 4I9WE 4TUOB 4MDIA 1BZ7B 4P2QD 2VLKD 2BC4B 5EUKB 2ID5A 2XYCA 1B0WA 4GBXA 4APQB 3O6KL 3BAEL 4DJMA 1XIWA 1JWMB 4U7SA 5JW4Q 4F3FB 4FQ1L 5I1KH 5F88B 1NEZB 1JGLL 1U91B 4MXQC 4OLUH 3TO4C 5E9DB 4P9HC 4PRHD 3QIBD 4U6XB 4HWZB 2QHRH 2QEJA 3V4VL 3KPQB 4TSCH 5F88A 3GSXB 5BQ7A 3TA3A 1F02I 4GQPH 1F3DH 2D4DA 3F6IA 5T1KB 4Y1AB 1P7QB 3BW9A 4HEPG 1MLCB 3BGMA 3NABH 1JPGA 2PXYC 3KGRA 5HDBE 2YPKA 2AJVH 2PW2A 4YHYB 4XI5D 3M07A 32C2A 4YHLL 1JPSH 3PGDB 1KTLA 1E6OH 4R26H 4NZUH 3BEWB 3GKWL 2EDJA 1HHJA 2H8PB 2YK1L 2BRRL 3MLWH 2UZYB 1RZFH 3MJGX 5AUMB 1N6UA 1XR9B 3I50L 4ELMA 5E6YA 2CK2A 1UYWH 3RVWC 3MSPA 2R2EA 4NQTA 5A40E 5BQ7B 1MF2L 3OL2A 2FGWH 4ZUWA 1AKJD 4U6XA 2GITB 3CNKA 4X6DB 4MQ7A 1IBGL 2AI0H 4L8SA 1BQHB 5ESVB 5KOMC 1WT5C 2AJ3A 4GXUN 4P5TB 4M6MH 1EPFA 3LQMA 5EUKA 1RZJL 4UOJA 4PGBB 5ID1A 2VXUL 4V2BA 1FO0H 1YDPB 4TUOA 2NLJA 3B5HA 2IQAB 3VFWA 4HJ0D 2R2HB 3HLAA 5C6TL 4N1HB 3D0VA 4D8PA 5AD0B 4QT5A 3SQBA 5I1DB 5HI5D 5D96B 1KELL 4WCYH 5IGXH 4EN3A 3V0VB 3UTSE 1GIGH 2FLBT 3FQNB 3OB0K 1AJ7L 4PYHA 2Z92B 3TVMC 4JQIH 2GK0A 3GB7A 4EI5A 2QQQA 3BP5B 2D0HA 5JNYA 3P77B 1P6FA 4CMHB 3CGTA 1C1EH 1NGPL 5GSRB 1CF8H 3CIQA 5GJSH 5SWSD 5BMFL 3RTQA 5HHMD 2DM3A 4OT1L 4OGZA 4HWNA 1I1AC 3GMNB 3IAPA 1P7QD 1QLRA 4YXLH 1U8OA 4K3JL 2X5PA 4ZO6A 5CEYB 3BJLA 5ECJE 1ZLSH 4XPTH 1YNLH 1D5IL 2B5IB 2P5WE 5HYSA 2VLRE 3MRGB 4PV9A 3T2PA 3V6FA 4Z0XB 1IE5A 3BKYH 4Q2ZA 5T3ZL 1RSFA 2GEEA 1YN7B 1PLGL 3DV4B 4OF5A 4OTXH 5FYLD 2AJXL 4ZOCA 1UVQB 3H0TA 5FO7B 4OD1H 1NGZA 4HKXA 3ESVF 4UT6H 2EYTB 3REWA 3RVTD 4D0BB 4DGIH 1NC4A 5IV2A 3CZJA 3BGAA 3CFDB 2Z9TA 4PREB 2BVPB 1FG2A 4HDIA 1LMKA 4FNLH 4Z6AT 4EDWH 4NYLB 5CEZD 2ZSWA 5LKNA 2HG5B 4YAQB 3HC0B 1A2YA 3WSQL 1FVCA 4M43H 2HFGH 1WBXA 1ZVSB 3QO1B 5DO2D 5DEGA 5GXBB 2PYEB 4N0YL 3WD5L 2JJSA 2ZPKH 3PV6A 4K71B 1ZXQA 4L3EA 3VH8B 5F70A 4PP2B 2X1XR 4Y4FB 4IDJL 3N9GH 2EH7L 1YN6B 1NCDH 1FYTE 4H0IA 4N5EC 3QUZC 4NO0A 5TE4H 1DBKH 3TBSA 3LKSB 3NGBC 3ULUD 3LMJL 1H15A 1RZJC 4QHNA 2CKBA 3MCLH 1F58H 4Q9BA 5E4EB 2GT9A 3GM0A 1MJ8L 3EO9L 1AE6H 5GRZA 5DJ0A 1FFNA 3FCTA 3MLYH 2XA3A 3CK0H 3L7EB 3LKPA 1H3WM 3UTPE 1DFBL 2JB6A 1L0YA 3D0LB 3MFGB 3N1MC 1CU4H 1PG7W 5TH2B 2OQJA 4K71C 4IMKA 1QOKA 3U79A 3P11L 3QWOA 2V7HB 2B7DT 4FTVD 2J8UB 4MD0B 3M8OH 2IBZX 4UIKH 2X42A 3CCHA 3VGEA 1K4DB 3L9RB 1OAUH 3ARBC 4TUKL 2BVEA 3GSUA 5DQJA 2BVQA 2EIZA 5GS1A 1MAMH 4AENA 1CD1B 1A3QA 1FC2D 5HVHC 3KR3L 3H8NA 1KYOJ 4L3CB 4PTTB 5DJDA 2EO1A 1HSBA 2I9TB 1CE6A 5E8EB 4KK8D 5C7XH 1T5XA 4WNQB 1X5GA 4M7LL 3PL6C 2X7LA 4KK6D 2EE3A 4JFEB 5MI0C 1HSBB 2I9TA 3MC0A 5GS3A 5BRZD 3CVHL 4CMMA 3MREB 3UTTA 5EWIL 1AGBA 5IB5B 3R0NA 3UJTL 5SWZA 4GG6F 1CG9B 1A22B 4KRMB 3JZ7A 3NH7H 3OZ9H 4JFOA 3I02B 2D9QB 2WINB 1QKZL 5DRXB 1C8PA 3GKWH 3MRRB 2GUOA 1E6OL 1FO0B 1KLFA 4XP1L 1IRAY 3PGCA 3MLXL 1SYVB 4Z7NF 4OV5A 4P46B 1CIUA 4RMSA 4G7VH 5EC2A 3ZYJA 2W0PA 4C4KT 3BMWA 3W11D 1J10A 2Y7QB 4LSQL 4GMTH 4XHJD 3O6FB 4XVTH 2LAGB 2ITCB 3DUUB 2GJJA 5E03A 5JPNB 3JWDH 4YHNA 1I3UA 4FFWC 2GFBB 5DDHB 5KSUA 1IAOA 4TVSa 4UBDD 5EZLA 2ITDB 3MNZA 4NC2B 4XRCA 3OAZH 2I5YH 4KJYA 4Y5VA 5GGRB 5CSGA 4PJAE 1LE9B 1MIEL 2IMMA 1AO7D 4GAYA 5BS0B 1DSFH 1YEGH 5E8DH 3FOLB 2VDPH 1QRNA 5I6XC 5EA0L 3V4PH 3VXUA 1OW0C 4HXBH 2OR8A 4PJAB 1ZTXL 1N0LA 1KCUL 1EEZB 4P23C 3T8XB 3QDME 3RPKA 4O5LL 4P2RB 2FL5A 4LHUG 1ADQL 5T5FL 1E4KA 1MCLA 2A1WL 3EJZC 3PJSA 4TVPH 2AGJL 5DFVD 1R6VA 5DA0B 3UBXI 5EZIL 4MAUL 4S2SA 1U6AH 4NKOA 1IC5H 2NX5A 3EHBC 1NGQL 1F5WA 1ULVA 4PREA 1OTUC 2DKUA 3UMTA 2FJHA 4FFYH 4Q6IC 5HTSA 3VFPA 1QRND 5ETUB 5F6IB 2ADFL 2HJKA 3F6LA 2J88L 1W72B 4N9GB 1NGZB 1OPGH 4MNGB 2PYEE 4OZFG 4LVNC 4NQDB 1N6VA 3CLFL 3RNKA 3I6LD 1N6QH 5FKAA 4YHZH 3DI2B 3RJDA 3QUYC 2VE6B 4QHKJ 2VXTL 3MA9H 4HFUL 2HJKB 1IGJA 1G6RH 2CUHA 5EO1B 5F97E 1YNKH 3GGWA 1WZ1L 4RFOH 3WO3B 3LZFH 4ELKB 2V5YA 3IFNH 3OV6A 4DQOL 1OCWL 1MAML 4UTBL 3F7PC 3TO4B 4PTUB 1CGSL 3WLWC 1VDGA 3D25A 5KW9H 1U8OB 3PP4H 5ESQB 4XNQA 1N2RA 4UIKL 3RTQB 5EUOF 3QQ3B 2YUWA 3W81A 1TCMA 3MV11 5HGAB 3RA7H 4Y16B 3TV3L 3RWDA 1BBDL 1Q0YL 3MOAH 5GS0H 5CZXC 3VXUB 5ICXA 2GSGA 5C1MB 5DJ2A 3TZVA 4ELME 1LEIB 3AAZB 1NEZG 3HNVL 4M1CC 3CK0L 3MV9D 4XRCB 3KPRB 4Y5VB 2R4RH 2W59A 5CGTA 3G6JA 4QXUL 4B53A 3VFUA 1JFQH 2NXZD 5KSUB 3D39B 4FQHA 4OZGB 3RZCC 4OCXL 3HPJA 2R2HA 3NFPB 1NGWA 3QEUA 5F7EL 2FEDC 5T1LD 2EH7H 3GFUA 3O2VH 1E0OB 4IDJH 2NY1D 3MA9L 5D7SH 3T0EE 4M5ZL 3GJFH 5KN5A 2HN7A 5IFJA 4KWUA 3X3FL 3W39A 5MERA 2ZUVA 2Z35B 5T3XD 1QFUL 2YOCA 3C09B 2WAHA 4HIXH 5E2UL 3FMGH 4X6DA 3NPSC 4X7DC 5DYOB 4D9LL 4LSPL 4DK6A 2ZKHL 4NC1E 3GMOA 1YEFH 2HA1A 4M03A 4FFYL 1AHWA 4PJGE 5CFHA 4P2OA 3RHWK 3SBWA 2WBJA 3RKDD 3WDHA 5IB5A 4KI1A 5I8EB 4WIQA 3PABB 5IMLA 3SN6N 3NACH 4U1KB 3SDAB 5I2IA 3C9NB 5LBSH 1N5AB 5ID0A 2VC2L 3P9LA 4MA7H 1GHFL 4RISH 2W65A 1MWAH 1W72L 3UTSD 5DHVA 1JUFB 1GC1C 1EMTH 4C54A 1IGFH 1AGFB 2L0DA 4DFHA 32C2B 1KIPA 4ZDHB 5DWUL 4HXBL 3HZKA 2VDPL 4EIGB 1KB9K 5HYJE 3DVFA 2HLAA 2Z8RA 4PJ9B 2FRGP 2I60L 5J11C 1TJGH 4M7KL 1JF6A 3H6JA 1JN6A 3Q48A 3UDWA 5C0BD 4GXVH 5EU6B 3QUXA 1E4JA 2CMRL 3MBXL 5FEBA 3TV3H 3QNXB 4U1HA 4F33A 1PG7L 4WDIB 5E2TH 2HT2C 3CDYA 5F6IC 3UBXB 4LP4A 5IQ7H 5GJSL 4RNRA 1NGPH 4Z18A 5T1MB 1T0MB 3RWJB 2Q86A 4Z77A 5L2JB 1CGSH 1S8DB 2VNCA 4PB9L 4Y8AA 4QEGA 1MCIA 1BQSA 4DQOH 4N8CH 4F7MA 1IEAB 5I66A 2X4TB 3IFNL 2X44D 2MKWA 2Q7NA 2LFGA 4P5KB 2NW3A 1ZT7B 4R2GC 1TVHB 3BMVA 1UACH 3QUXD 1B0RA 2YPLA 3OGCB 1JNLH 4UT7L 4CMHC 2VXTH 4HS6A 3SE9L 4YE4L 1QSVA 1R3LA 4QTHA 1J7VR 4K8RH 3G5VA 2H6PA 3ULSB 1A1MB 3LEVL 4JRXA 3U4BL 3G5ZB 3UC0L 3OKEA 3MLSL 5DQDL 5GZOD 3QDGE 4ZSOA 3GMRA 4YR6B 3L3JB 1RUKH 5DSCA 1YPZF 5C7XL 5FCUH 3IDMB 5CGYD 1FN4B 1FVCB 4TSAH 3HE7A 1U6AL 4OCYH 1S7WA 1RV6X 3QISA 3O2WL 4Q9RL 5DT1L 4FQQB 3K4AA 1A6ZB 2X4PA 1IARB 1MY5A 1U93B 3QG6B 4JPIB 2PO6B 1R5VA 3BPNC 5KANG 5KTEH 3PG2A 4LCUB 4W4OA 3S3SA 2DYPB 4J7RA 5KSAA 1RZFL 1KLGA 3FO1B 1ED3A 5FDWA 1BLNA 4K3DL 2G75A 5IM7B 4XPGL 5K9OB 2H2SD 4NFBA 3GNML 1ZEAH 1XZ0A 2ATKA 3WFBH 4PJEB 1ZSDA 5I1EH 1GC1L 3HI5L 5SV4A 1AGCA 1MJ8H 2DTSA 1F58L 3OKNB 1VGKB 3LKOA 3GNMH 5EU6D 1LK3L 4HWBH 3CD4A 5IQ9B 4JDTL 8FABA 3UTQB 4PBVC 4PRHA 2NXZC 1MCCA 1RIHL 4R7DB 1AGCB 3FN3A 3RZCD 2J4WH 4RDQF 3NH7L 1VEPA 3FQXB 1N5YL 1G7QA 4R9HA 5JXEC 3D9AH 1A1MA 3KLDA 3EYSL 1ORQB 4JFPB 2EO9A 3OR7A 3TPUB 3NPSB 3V5KA 2H32A 2WBKA 3CSPA 2VSDA 5IEKA 2VR9A 3OGCA 2A9ML 3HUJA 5LXGH 3D0VB 4D8PB 1KYOK 4FNLL 3H9SA 1TZHA 2ED7A 3MV9A 1RUKL 4PJCE 4DGIL 2NLJB 1WAAA 2X1PA 3SJVE 2O26U 2P5WA 3D85D 3KXFD 5CJOH 5K9JH 5E4EC 5E2VH 4QXGL 4RQQA 4DUXA 3KPPA 3ZL4H 4DUWA 5CD3A 2DN7A 3HE7B 4FXKB 1IM3B 5IROC 3QPQC 1MI5D 1QFWM 3VJ6A 5JHDE 2VYRE 1DQLH 1UACL 4POYA 1T7ZA 1BLNB 5I1JH 4UNUA 1YNLL 3PDDA 3D2UA 1ZLSL 4N8CL 4PJ9A 2BNQE 2W0KA 1K8IB 3G5VB 4JFYB 1U8KA 5L88H 4EVNA 3OKYA 4I3SL 4OUUA 2NXZB 4ZUTA 3D3VD 4K3GA 5JIIA 1JK8A 1X5LA 4M1GL 4LKXB 1TVHA 2X4SB 4CW1B 1XF5A 3U2SA 1C1EL 3JTTB 2IAMA 3DGCR 5CILH 1S7WB 4MJIB 1BX2A 2IPKA 3OF6D 3QNZB 1NMCC 4OLZH 2QKIA 4NRYB 2HP4A 3BW9B 4OFIA 4WV1B 5TE4L 1UKTA 4EN3C 4OV6F 4Y1AA 12E8H 4I13B 1WIUA 1OP5H 1M7XA 3VG0H 3WS6C 1BAFH 1LNUA 2ZUUA 4GG8B 1REIA 2DQUH 1MHPL 5I18H 3GMOB 1K85A 1TTGA 5F72S 1FYHB 4E5XB 3BKML 4HS6B 4OD2B 4XTRC 4N0YH 1GZQA 1KB5B 5F8QC 2VXUH 4P5KA 3RKDC 2WIIB 3L5JA 2BC4A 3TN0A 1HZHH 3LEYL 1I7TA 2EXYD 1NFDE 1I85C 3CDGA 1KCRH 6FABH 2V2TB 3FHQA 1FVDA 2K3TA 3SGDI 4HHAB 4O2CA 3E8UL 1EO7A 5JW5A 3HC4H 4ALAL 2ZKHH 1A4KA 2VKWA 1JPTL 2UUDK 2WUCH 5K33A 4WY7H 5EBGA 1CFSB 2BOCB 3TT1L 1I7UA 1J9CT 4K7FA 1ZVYA 4F15B 3BZ4A 3FTGA 1FDLL 5BVPL 4BQCA 5ITBL 3ZDXE 4JN2B 4LARL 4I18C 1BIIB 4PR5B 4PRIA 3MACL 5IROA 1JK8B 5GPRA 3K1DA 5EOCL 4EXPX 4AEEA 1HYSC 1H3XA 5IFAH 4H1LG 4IIQB 3N85H 1XT5A 5I30L 3QG7H 4MX7B 2F58H 3OX8A 1FZJA 1ZLUK 1GC1H 2GCYA 3HI5H 3WFBL 1J8HE 2AEQH 1WAAE 2KDGA 3P9LB 4X7EC 4HG4J 3BH9B 4JB9H 2BXYA 3AUVA 5C09E 4MCYA 5EH1A 4M7ZC 3MOAL 4PRID 1A7QH 2DQCL 2IAMC 4HKJB 4TNVK 4RQQB 2VLKA 2O5YL 5IVXA 1JGEB 5D7LD 3DHJA 2J5LB 4PJEF 3UPCA 2HTKC 1X5YA 1IAIM 2X4RB 2R23B 3OF6A 2F53E 1EV2E 3QDMA 5IHZB 2EYSB 1ZA3B 4LAJH 1B9ZA 4G6FD 1I9EA 4IRJC 2YWYA 3GSNB 1IGIH 3QDJD 3LCYA 3LZFL 2P7TB 4K55A 3WNOA 3IXAB 1FO0L 2GJ6D 1DBJH 3O4LD 5LCVH 3FO9B 3NIDF 4KMTH 3MZGB 3G9AB 1NBQA 3FQXA 3HC3H 1AGEB 5M95B 3BRFA 3KVQA 1WITA 3RL2A 2GTZB 3T2OA 3MQIA 3M17A 4O02H 1IBGH 1AHWC 5JW4M 1FFOB 2LABA 5BRZB 5F7WC 1R3KB 5AWNL 1UB6B 4G6JH 4Z76A 3H3KA 1ES0B 3ARBA 2F19L 1HHIB 5ICXB 3ARFA 3HRZB 1Q1JH 1IC1A 2MHAB 3N1QC 5CSZB 5HHMB 3K8LA 3RPIB 2BNRE 5EUOB 2NNAA 1DDHA 2N1KA 1MRFL 4GSDH 2EDHA 3T08A 3G9VA 5D1ZB 3IU4L 1MHEB 2YK1H 1LD9A 3RKPA 3TH3T 3WL9B 3VXQB 4QWWC 4NCDA 3CFKB 3CSBA 1NKOA 2VJXA 3I2CH 1DQJB 3O6FA 2KPNA 3IETA 3OKMB 5D1QB 2AJVL 2Y5TA 1RJZB 1Y0LA 5FUCE 4GMSH 5C07B 3ARSA 2XG4A 1WF5A 4Z8FH 3E2HC 5E8DL 4XVJH 3MLTA 4HW6A 4IHOA 4WWKA 4OSUH 2BERA 3JUYA 4YDLC 3MO1B 1S9XB 4PB0H 1G9NH 3RGVC 2PO6A 1F4XL 2APFA 3A6CH 5FGBC 5GISL 1TJGL 5T33H 3ZHDA 3RVUD 3P0GB 5IVXB 1KIQA 5FOBA 1CG9A 3IJYB 2H2PD 5I1KL 2BOBB 1OAZL 3VW3H 4JM4L 4N0UB 2X4NA 5EORL 2BY0A 4KRPB 4JQXC 4EN3D 3W0WA 3AREA 3O45A 4KMQA 1S9VA 4YBQD 2VISB 1EMTL 2NR6D 4NKMB 1CE1L 1WFOA 4B7LA 1MWAL 2UVEA 4BZ2L 1S5IH 2G2RA 2XA8L 5BXFB 2QQNL 3OKEB 5LBSL 1S9YB 3OX8B 1U8JB 1CE6B 1V3KA 4Y4KD 4KDTC 3QI9A 5L7XH 1MH5B 4C4KO 5GZOC 4PV8B 1R3LB 5IIEA 1MCPH 5DI8B 1CQYA 4C83B 3HMWL 4QRPA 3KHOA 3EOBA 1FO0A 3KJ4C 3TBTA 3P40A 2CXKA 4LSPH 3VD5A 4OKVB 5D71L 1K4DA 3FOLA 4JO4L 5HGHA 4PJ8C 2HFFA 3SDCB 4MNQB 1U8PA 3VFOA 1BBJB 1KG0B 4N0UE 4DCQA 1BF2A 1GOHA 2R69L 2YSSB 4LQFH 4R8WL 1MQ8A 4ZUSA 1EVTC 4LPXA 1ND0B 1PYWA 3BHBA 2FYYA 2OS7A 4JDVA 1E4KC 4BZ1L 2NY5H 5IF0A 3RQ3A 1AGBB 3OQ3B 4GW1B 2CK0L 1PYWB 2C3HA 3LKQB 4NZTH 3U7AA 2ILLA 1XH3A 4RX4A 2IALA 5C07E 43C9A 4X6EA 3HE6A 1I1AB 1T1XA 3I6KB 2MCG1 2FBJL 3GHEH 4WTWA 1YEDB 4YX2L 4MAYB 3JTTA 5HGHB 2CPCA 3QQ4B 4F7TA 5J1SC 1VSCA 4LHUA 4N0RA 3HB3D 2QQKH 3KLHD 4ZUUB 4JFOB 3GKZA 5T5NF 1BM3H 4LAQH 3IU3B 4ZXBB 5C0CA 2D2OA 4U1GB 1JHTB 5D2LB 4UILL 3WN5C 1T22B 3RA7L 4KVNH 3GSQA 2ZUXA 2VLJA 4L3EB 3VH8A 3QHZL 4HPYL 1JWSA 1A8JH 2VDMH 1CDGA 2Q76B 3MCLL 3O45B 3ARDD 3T0VA 3AREB 1JRHI 4PJFA 5I76B 4N68A 5I8EA 5JR1L 2EXWC 1P2CB 3AMLA 3KPPB 5CD3B 2VDQL 1G7PA 5E8EA 4Q7DA 7CGTA 4XVSL 5JXED 4X80H 2YD6A 4JGMA 5KAQG 3MRLA 5M7QA 3IS1X 3RVVD 1JNNH 4JPVH 5EULV 2OYPA 2R0ZH 1FVEB 4KFZC 4YHPA 2BVQB 2W0FA 3GO1L 4P23D 4DVRL 3CFEA 3VXMD 3WD5H 4MJ5A 3T4YA 3D2UB 5HVWA 5AEAA 4L9DA 1T2QL 3QFDB 3CX5J 2BSSA 1FNLA 3HAEG 5FECB 5KVEH 2IANB 4UIMB 2W38A 3A67L 5KS9F 3IETB 1NGQH 1DQJA 1IAIL 3MRHA 4NFCA 2DDQL 2NPLX 5DRZA 5EZIH 4PJ8A 5GRJH 5DEGB 1QTYT 2E3VA 3UTZA 1FRGH 2ADGB 4CVZA 4OD3H 3QDMD 1AFVH 3BDXA 3L5HA 3TO2A 4JN1L 1MCKA 2EECA 4K3EH 1ZTXH 3QUYD 1N64L 5F9JB 1FG2B 4HDIB 4J8RB 1OGTA 1QVOB 4PJ9D 2GJ6A 4PY8I 3L3GB 2ZG2A 3WFDH 5IB3B 2OTUA 2WNGA 5IMKB 2C1OB 5C0ND 1Q8MA 4IBLT 4XH2A 4XAWH 3FQTB 2I5YL 4DEPC 4XPTL 3T04D 4XNQB 1U95A 4IRSB 1D5BA 3FQNA 1T03L 3B2UD 2GAZB 2EC9T 4YXLL 4BSJA 4DZBA 3QUMB 5F1OB 1XFPA 1EEYB 1YPZA 1G6VK 3FO1A 5FDWB 4F9LC 4N0CD 1S78D 4R3SA 1C16A 1DLFL 1MFCH 2D0FA 4LHUD 3ZZ1A 1QO3B 1JGDA 1B4JL 1M6OA 3PXJA 5E0QA 5DRNB 2DICA 4J3OC 5D1XC 2XN9E 1I9JL 2JK5B 1AI1L 4JQIL 1MJ7H 4ONHA 1RAMA 2XI9A 3PL6D 5I9QC 1OT2A 1JRHH 1OB1B 4QRQA 3BH9A 1K4CB 4JJ5B 4NUGL 4UTAH 3UJTH 5GSVB 4WW1B 1MUJA 3V5DB 4F7EB 1CL7L 4UDTA 2EH8L 1TDQA 3QP3A 4PG9B 5DURB 3K0WA 4Z7QE 1KEGH 1WAAF 2YEZB 4WO4A 5AYUH 5GGVY 1UKSA 2LTQB 5E56A 1JNHA 5GRUH 2X4PB 3O0RH 3TLRA 4AIXA 1HWGB 3EGSA 4DTGL 4Z7VF 2AI0L 3WDIA 2Y06H 4LCWA 1Q9OA 4K9EH 1K5NA 5I8OL 5J6HA 2AQ3A 3G04B 4ZXBD 5BV7H 2EDFA 4JVWA 1IAOB 1GGYA 4EI5B 2LU7A 5MENB 4JFFE 5JPNA 1BQHA 3PWPB 1O5DT 4OCWL 3H9HB 4HWZA 2EDKA 2H6PB 3MLRL 4GKZA 3ULSA 1CGVA 3CFIC 3V4UL 3L7FA 1B6DA 1ACYL 2YMXL 1J1PH 3MUGB 4KH2A 2C9AA 2XY2A 4EUPB 1QR1A 4HMEA 4Q74A 2VRAA 1LVEA 4GS7C 1BZ9B 5E6ZA 4M7JH 4PG2C 1AQDA 3N06B 1XCTA 3CVIL 2QADC 3RWJA 4YHMH 1C08B 1WFTA 1TZIA 3VU2A 4G8GB 3LS4L 2QHRL 2CR6A 4NJ9L 1BFSA 2CXGA 3S35L 5I73B 3SDDD 3BZFA 3PNWB 2NXYC 3FO0H 5JLZA 4FQ1H 3FZUC 4HG4K 2EZ0D 4GRLA 4X4YB 4KQ3H 4B41A 3K7UA 4ZUWB 1NH6A 1J8HA 2Y9RT 4M00A 2IGFH 5AZ2H 1TETH 3RZCA 3DUSA 2Z8SA 2CIIB 1MNUL 4I48B 4U2ZA 4GRLB 1T21B 2H1PL 3RVVC 1DE4B 4P59L 2PTVA 1TMCB 2NYYD 2EDNA 4OGYH 4OLXL 2EE9A 2GJ6E 4JFHD 4PIRF 5DUMH 4JFXA 4JPKL 4XBPA 1C08A 3KPSB 2HN7B 2VXVH 4XCEB 1P53A 1D9KB 5D70L 1ZLUH 4OD1L 1UH2A 3I84A 2OMBA 2V2WB 4PYGA 2OX5A 4OTXL 1BHGA 4AMKH 4ORGA 3NFPA 4TN9A 5D7IE 3OPZH 3GJEB 1ZOXA 4PRPB 1NGYB 2Q7YB 4DN4L 4HUMB 4QCIA 4L4VA 2R56H 2YBRB 5TE7H 5JXEA 5D6CA 2JB6B 3DX9A 3OB0H 1UM4L 4XC1L 5I1GL 1K6QH 1KV3A 5H37H 5C8JA 4RGND 3MLVH 1I3GL 2OR9H 4JE4B 4EOWL 5MENA 4K3JH 2EDOA 1T83A 1TZHB 3TVMD 4CNIA 3FB6B 4QHKI 5BO1H 4OZ4A 1YQ2A 2W92A 1Z9LA 2X4UA 5C0NC 5ISZE 3QEQD 1QSED 4JFZL 1EAPB 4JAMA 5FO8B 4POZC 4F8TA 1RVFL 1B90A 2LAAA 1FZKA 4LU5H 1GXEA 1UXWB 3RX5A 1UENA 1UKQA 3TJEL 1FGVH 4JJHA 5H2BB 4HUVB 3TO4A 2PF6A 2NY7L 3M1BA 5A1AA 5IEHB 2ADJA 1ZV5A 3KPRA 4BKLA 5I1HH 3BRDA 4U1LB 1N7MH 1KJMB 4ODVH 4GUPB 4KXZH 4U3XA 2MWCA 4DGYL 4JFED 1KCVH 2R9HD 3MCG1 1P6AB 1MREL 3Q1SL 3PDGA 2XKNB 4GKOA 3SCMB 3VGHA 3GI9H 4PJXE 4RAUA 1K4CA 4JJ5A 3LV3B 1TVBA 3CX5K 1YEKH 4LCIH 3VXRA 4JHAL 3S88H 3EFFA 1LE5A 1CDIA 4G3YL 3IJSA 4GH7B 5A43C 4KXZI 3SKOB 1QQDB 1KPRB 1N2RB 5IESH 5J4MA 4ERSH 4KZEH 3F8UB 4XNYL 2VL5A 2Z31D 3UO1H 4S2SB 3TCXA 4M93B 3V2AR 3K8MA 1EUTA 1YYMH 1E4WH 4GUPA 5E8OA 3V7MA 2R0WH 3G5XB 2YUXA 1HH9B 5J06A 1V3LA 3UJJL 3K3QA 2NY0D 4OF7A 1OAKL 4OZIF 5CD5D 2I27N 4NCC2 4LDEB 2AW2A 4Y4HB 5IB2A 2F15A 5JOPD 4LIQE 3MXWH 3IFOA 4IOFD 4NNPH 4HULB 2JJTA 2AXGA 5DR5H 4F9PA 5BS0A 4QRRE 1OF2B 3T1FB 1KEMH 3MJ7A 4S1DC 3WNLA 3T3PE 3H7LA 3GSRB 2OL3B 4HKZB 3QPQD 4Z5RA 1VHPA 3UTTE 3MYZA 4UV7L 5DEFA 2ZCKH 3QEQB 5IHLB 1LEGB 4P2YA 2YD2A 1Y6KR 4JM2D 3OKLB 4F7CB 1J1XL 1CR9H 3LD8C 2CR3A 4X9BA 5KVFH 1CFQA 4RAHA 1RZ8B 4PRHE 3X14A 2XKSA 1G0YR 4GAFB 4NZRH 3WKML 4MQSB 2CUMA 5DRXA 3BRGC 4WI9A 4X7SL 1ZHLA 3FT4A 2E9BA 4LNRA 2ICEB 1VEMA 2MSPA 3VGAC 1RUML 1S8DA 3EOAA 3MNZB 4JEGB 1ORSB 5D2LE 1JIBA 3DO3A 5TQ0H 2FR4B 1WICA 5T1MA 4PRPD 3C5ZB 5E99L 2AJ3B 3QO0A 4OLYH 5J1AA 4U3CA 3INUL 5ESVA 1HNFA 1NAKH 4QHUB 1KXTB 1VFAB 3HMXH 3B43A 3SE4C 3TH2T 3I9GH 4JFEA 4QLRA 1T2JA 4L4VB 1J8HB 1DQDH 5D7LA 3QDGD 3KYKL 3IXTA 1HXYB 2VDKL 2HLAB 1EDQA 2WV3A 1ZA6A 5AUMA 2A9NL 3HKFA 1XGUA 1RHFA 2NY2D 4GG6A 4BH7A 1CXHA 1FIGH 3W9DB 3OAUH 1T22A 1UWGH 4KHXH 5JA8B 4QRRB 4XB7A 4P3CL 5CEXA 1A6AA 4O58L 1WQVT 2A6JB 1F13A 1KXVC 2BNQB 4OGXH 3SDDB 3IGAB 1ZWIB 1UM6H 2OQJB 4DK3A 2ATPA 3MUGA 1INQA 4KQ4H 4QXWA 2SEBB 4D0DB 1R24A 1WSST 5F44A 3D0LA 3BSZH 3O3DA 5D7IA 3HFML 1OQOA 3O4OC 2GJZB 2HVKA 1QSFD 2ICWJ 4AM0B 5E9DA 2ZSVB 2DQGH 4GW1A 3WDJA 4J3WA 1YECH 4RGOL 5EU4A 3U4AA 2GIYA 4XHJC 3BVNB 3QIUC 3DVNA 4I9WD 3SJVB 2VUOA 4ONFH 1JZ5A 3X11A 4PGCA 1G7LA 4QYOA 1T4KB 3FT4B 2BHYA 1GSMA 1MCBA 4LVEA 4C56D 1YQVL 5IVXE 1J0ZA 5C2BH 4OKVA 1UWXH 4JFDB 3HAEB 3RVXC 3T65A 4P5TD 5C0FA 4S0SD 4Z7VA 4PY7B 4H8WH 25C8L 1SJXA 4HIEB 1DLHA 4CVXA 4Y7MA 1DEDA 1U8JA 2BHUA 5ANMA 1B2WL 1IGYA 2VLRA 3FO2B 4UAOC 4MXWL 1VERA 3CMGA 3AAZA 2PKDA 3R8BB 2GSGB 4R4NC 1IAKB 3ESUF 3U6RB 2DD8H 3QEGL 3LS5H 2XIDA 5IWLC 1FQ9C 3EJJX 3MJ7B 2RR3A 1UB5A 5EO9A 3TZVC 1TIUA 3R06B 4LRNL 4UT9H 2FO1A 4RZCA 2CLZA 3GJFA 2FJFB 1KJ2A 4QO1A 2CD0A 1JMZA 1CDJA 2OXHA 4W4NA 1MSPA 1OM3L 4XNUH 4ELKA 1F4HA 4U1JB 1C16B 5HXMA 1ACZA 4WEBL 1J11A 1D5ZA 1GAFH 2B39A 2MFNA 4HH9B 2AP2A 1HH6A 4PJHB 2FH8A 3QHFH 1NC4B 5IV2B 2ZCHL 1RZ7H 4KY1H 3MJ8B 1AQKH 4HBCL 3VWKB 4DKAA 3BPCA 4L5FH 2FEEL 3DECA 5EO9B 4TPRL 1J12A 4HUXB 1QLEH 4L29B 2OP4L 1IQWH 4LMQE 5ENWA 2NNAB 1KFAL 2X09A 1MRCH 4OCSH 5GS2D 1DUZA 5DA4A 1S3KL 2GK0B 2QADD 3HR6A 2EIDA 1IC4L 1ZS8A 3QCVH 1L7TL 5BRZA 2ARJA 3SKMA 1QSFA 2DOCA 3MRPA 4H88L 4F8QA 1XIWD 4XMPH 1Y6NR 3X17A 1D6VL 2HRPH 4RA0C 5CEYA 1AC6A 1ZT4B 4QHMA 3IFLH 3WNKA 4PJXA 4LCCB 1EERB 2F74B 5FA4B 3MROA 3QXVA 4PJBF 1NSNH 1ZKAA 4UOW0 5I8CA 1EAPA 4X6DE 3TNMB 4KPHL 2X4UB 2EXYC 3ULVL 4GJTB 1F4AA 4LLQA 5KS9A 4ONGH 1EAJA 5GRXG 3VXSD 4MJ5B 2APXA 1A14L 1XR8A 2DIJA 4HUXA 1X4YA 3BO8B 3EFDL 3WJLC 1JGUL 3CX2A 4KJPC 5EBLA 4EI5C 3UTZB 3SOBL 1NCBH 1NCTA 2AV7A 4V1DE 3UO1L 3AXLB 3GRWA 3FN0H 3GBML 1Y6MR 3AY4A 1ZE3C 3GBNL 3MRRA 1I85A 1GPOH 2DJUA 2ZOLA 4P2CG 2X05A 2A83A 1T89A 2FJFA 2FX8L 1CVSC 3SJVA 2ICWI 3MRNA 1CGWA 3GMPA 3MV9E 2VN4A 3MRDA 4RGNC 2OK0H 2UYLA 5EOQH 2VXQL 3NN8B 4JY5L 1MREH 1XGUB 5DURD 4HXAH 1P4BH 3BQUC 1A9BA 3MOBH 3OG4B 1YYLH 1EO8H 3ETBF 5AAMA 4HX1A 2SEBA 3V7AG 4ENEC 5I1LA 2V9TA 5ANMB 2LTQC 4WI5A 4PJAF 3MRCA 1V7NH 1YECL 1OY3B 4G43B 1NLDH 1NLBL 5KJRL 5J1TC 1DUYA 4FQCL 3A6BH 3QIUD 4KRPC 1NQBA 1Q0XH 3NIFE 15C8L 2Q8AL 4WWKC 1KB5H 3L9RA 3UZQA 3QZWA 3FT2B 4U0RB 3NA4A 2BVOB 1AIFB 2R9HC 3RWEB 5J13C 3CDGB 3EYFA 3QIBB 3X11B 1EEUA 1RUAH 3LAFA 3IJHB 3BE1H 4XP4H 3HAEH 1FZOB 1W8NA 4MNQA 2RQ8A 3RJQB 2I24N 5BJTB 3AB0B 4NNXB 4P3CH 2FEEI 1FGNL 3EOBB 4MWFB 1MVUA 1MIMH 3MGAA 2R56L 4WUUD 1BQLL 1NGXB 1Q72H 4J6RH 4IRSD 4EDXA 4F80A 5H35A 5T1LB 1S9YA 2HWZH 4AMKL 1T5WA 4R4ND 4L4TB 1A7OH 1A6WH 5BXFA 2D31B 4D9QE 1CXIA 4CU8A 1F4WH 4KDTA 4QKXB 3V52H 5ADPH 2VXVL 4OIAA 4PJHE 4UINH 5DMKB 1F4WL 5C9JA 3GI8L 4FXGB 4LNRB 3HNSL 1Q9OB 1RUQH 4Q58C 4G8EA 2P5ED 2HFFB 4OGYL 4DZ8A 2E5EA 1XF5B 3V8CA 4LVOC 3FT3A 2OM5A 4P59H 2HT3C 5GGVH 3MLUL 4G9FD 1K8DA 1U3HB 4HGWA 1K9TA 1R3HA 4TYUA 1IKNA 2UZIH 3QCTL 4DKDC 3V8OA 3PQYD 3CSYB 5J56B 5IMOA 4U1MA 3C87A 3MRJA 2ZSWB 3G08B 3S35H 4FMKA 4WW1A 2P8PA 2OL3A 4OGAC 4OZHF 3WFCH 1KULA 4G42A 4LOUC 5D2NA 2C4FU 4XCCL 3TBYB 4OUOA 5SX5K 2C3VA 4JZOB 5D8JL 1MFNA 4N0UA 4HF5H 1A3RH 2BOBA 1CD0A 4XWOD 3IJSB 3VFVB 2H2SC 1AP2B 1T0NB 4L1DA 5HDQL 4XP9L 3T0AA 1EGJH 2DIAA 3GSNH 5KVDL 3D6GA 2V7NA 1QR4A 1FLTX 1M6OB 4HC1A 1FL3B 3UROR 1UA6H 1N26A 5IUSA 4GOSA 3R1GL 2APTA 1FYTD 1XIWC 4CN6A 2MMXA 4R3SB 1P9MC 5E8OB 5SWSA 2VIRB 1R3KA 3MLRH 2FX7L 4XI5C 2JELH 5TGBA 1LO0L 1T7YA 4BKLB 1E27B 1X6LA 1S78C 2HKFH 5JOEA 2VXQH 3MXWL 5DXWA 3SKJL 4LVOB 1KLUB 1J5OH 5D1QA 5DJXB 4ETQA 2Z31A 5KVMC 1KJ3L 3UJJH 5I8OH 3MLUH 1BVLA 3U0PA 5DJ8A 5EBWB 3EFFB 2HT4C 3GSRA 4JFFB 4DTGH 1RUQL 4MLIA 4JKLA 4M62L 3SCMA 4HIHA 3U0PB 3FN0L 1MCRA 1H0DB 4UINL 1HINL 2YKLH 4N9OB 5MHSD 4JANA 5HHPB 1NCBL 3O2DA 1WBYB 3IDGB 3RWCB 3JWDC 2VLLA 5FK9A 1JGUH 2FLRT 2R0KL 4JHAH 3ES6A 1HWHB 3KYAA 1CL7H 2ATKB 1HH9A 4NP4H 5IVXF 2IWGA 4MCYB 3DXAD 1FPTL 2VZTA 4MYWB 1PW3A 4HIIB 4NZJA 4OFKA 2VDOL 2P42B 3V7AE 1FGNH 4UQ3B 2ZCLL 3RP1A 1M05A 2IANA 2XZCH 4I3RH 3O6FD 4NDMB 1SVCP 4B7IA 4NRZA 3DRQB 2AEPL 1NSNL 1BVKB 4URTB 2NY7H 3LQZA 2XQBH 1ZGLP 4JO1H 2ICWB 2YPLD 4JFXB 4ZAKA 5HYJA 1HI6B 3ALPA 2C3VB 4JZOA 2I9LB 3VXME 1A9EA 2KKQA 1U93A 3LV3A 1T6WA 2FWOA 4FQJL 4XC3H 5IW6B 5J57B 2HKHL 4FQJH 4XC3L 5CAYB 4Y5YB 1UZ8A 2QLVB 4K3HA 5KJRH 1CD8A 3NZHL 1MCFA 3V0WH 4L3EE 3H2WA 4PRPA 2QSQA 4LLVA 4U1LA 2UY7A 3TFKC 1MFEH 3MRIA 4ODBD 1U3HA 1YYLL 5JLZB 2VR4A 3BKJL 1U9KA 3PNWA 3ILPB 3N1PC 3VXPB 4JRXB 5GJTL 3P4OB 3U1SL 1TZIB 4YDLB 3JWOH 1T83C 3V6OA 3ABZA 2C7UB 1TJHL 1YMME 5L2KD 2NY0B 3WBDA 3BEVA 1HQ4B 4OZIE 2ADIB 1F90L 2AK1H 2EDXA 5IOPA 5JPMB 4WTXA 1DVFA 2WIIA 4A6YB 5DGQA 4F37F 4KVCH 9CGTA 1YMHB 1SJVA 1FORL 1I1AA 2EDQA 1RULL 3GMMB 1NDGB 2VLME 1KTRL 4JG1L 1YEEL 3UTSA 4EDXB 4FFZL 1O0VA 2NTSP 3PWLB 3BPOB 2FECI 4MWFA 2H3NA 3LKNB 1WJ3A 1XGRB 3KPLA 1QBAA 4LLUA 2V2WA 3QH3B 4NN6C 2H45A 5E4IA 1Q9WB 1F6AA 1W0VA 3H3PH 5IVOA 4L1HA 1U3JA 3CXHJ 3VFOB 2FIKA 4LCWB 5F1NA 2JELL 3OWEA 4OZHA 4QRPB 3L3OB 3P4MB 1P1ZA 4PRBA 4YNYB 3O3AA 2A77H 5CSBA 2V17L 3EO0B 4QF1A 5KZCB 3REVB 1P5VA 5IKCA 3RBSA 4AEHL 1H3VA 3JV6A 5C0IB 4NO5A 3T2NL 2G2RB 2CLRB 3E6FB 3EW3B 1DBMH 1BJ1J 4X4YA 5DC9B 4LOUD 4XCCH 1EFXD 5TE6L 2JJSC 1S3KH 1CK0L 2YWZA 4IRZL 4XXCC 3WLBA 5KSVB 4QRQB 4FXLA 4JM2A 4ZAKD 1CTNA 1K5NB 2BY3A 2VDLH 1NKRA 1MRCL 5D4QA 4EI6B 1HHKB 1FFQA 1IQWL 3GK8H 4GKNB 4Y5YA 5AZEL 1RK0A 1KTKE 5CP7B 4OLEA 1RZKC 1QLEL 2GTWB 3P9WB 2OLDA 2A73B 4PRPE 4YX2H 4OUUB 1DN0A 4IRSC 4EVNB 4HK3N 5DMGD 3OKDB 3ULVE 1DANU 4ZAKB 5IFJB 5EN2B 2CKBL 1YJDL 1CXLA 1S7TA 3HZYA 3RUGA 4IEFB 1I1YB 4ZPTB 4WEBH 1EEYA 4O58H 4BSWB 3QDJA 2ICES 1OB1A 2AK4D 2KBGA 1S7RB 3DWTA 2EDTA 2XT1B 4Q0XL 2COQA 4GFTB 3WHXB 5IB3A 1JV5A 8FABB 4PJDA 2MHAA 5CSZA 2E7LA 1QRNE 2CDEA 5ERWB 5EZOL 2IADB 1ZLWH 3I9GL 2BNUB 4KGLA 4JKKA 3LN9A 4NKIL 1ZLWK 4NSKA 5HY9B 1JNHB 2FJGB 4JFFA 5IEKB 2AABL 4MNGE 3G6AB 4XP4L 2XA8H 3SE4A 3NAAH 5JHDA 3ARUA 3LEXA 4PJCB 2PXYA 1MELA 3D25B 1WUNT 3T1WA 4ZS6D 2F8OA 3FONB 2XTJE 4KKCC 4O9HH 2AQ1A 1KPUA 1A3LH 4KK5C 2QSCL 4NQXA 1T1WB 4DN3H 5KSAB 1OGTB 1QVOA 3Q2CA 3WKMH 2HMIC 4ISVB 2IH3B 2DQHH 1Y18B 2DI9A 4YHPB 4FTVE 1OP5K 3P4LA 3SDDC 5CZKA 1X9QA 4JZNA 1E4XL 1D6EA 1E28B 3BKCL 3FZUD 2VKXA 3DYMA 1D5XB 5DTFA 4XVJL 4WHCA 4K2UH 3PDOB 3U4EA 4P2QE 1JPFB 3WN5B 3EOTL 3IAGC 1P2CA 2YR3A 2A74B 1FAIL 3EJYC 3IDMA 4AK1A 3MRHB 1JF1A 2P8LB 3Q6FB 3KG5A 3L3JA 4XZUA 3S34H 2IBZY 4NM8L 5MEOA 5KG9B 3DNKA 4IRSA 3SE8H 4U1IA 4HUNB 2NY6B 2CLZB 5DS8B 3PJSB 2A6KA 4LCYB 4YHKL 4CL7A 2F54E 2N56A 2VN7A 1ZHBA 4HC1H 3L3HA 4P4RB 5SV3A 2J8UE 1KCSH 2R8SH 2BDNH 5ICYA 2YPLB 4G6JL 4J2XA 2R0WL 3KS0H 3EHBD 2R8SL 1GH7A 1GGTA 1IEAA 2X41A 3EAKA 1AD9B 5I76A 2ADGA 4CVZB 5DMKA 1DQDL 1Q9KA 4OAWB 3WUZA 5M94B 4RGMB 1ZGLM 2R0ZL 1L0XA 2X4OB 1J87A 4ONGL 3LB6C 2VERN 4FS0A 1A1OA 2Q3AA 3MUZ1 5EC1A 5DZLA 3HMXL 2FYYB 1F3JA 3DIFA 3INUH 1G7IB 4JHBA 1JHLL 4K23L 5FUOL 1HYSD 3D3VA 2V2TA 3NGBB 4LLDA 2BSSB 5TQ0L 4PJ7A 4QOKD 3TN0B 1AD0B 4LHUB 5EU7C 4HPOH 3DVIA 5I1HL 1CFVH 5F6HJ 2Y4SA 3P3YA 1DTUA 4ZO7A 5C0AB 3TFKD 1LDPH 1QYGH 4TNWF 5HHNB 3ZDZF 5B39B 4XMKH 3C60A 4P2QB 2KZWA 4MXVF 5F9WC 1GOFA 1LNUB 1INQB 2HVJB 4TPRH 3WHE0 4UV7H 1OSZA 4NQCA 2X4OA 2YZ1A 3EZJB 4FHBD 3P2TA 4P46C 1CICD 4HK0A 3L3IA 2N7AA 4Q97A 4QGTA 5IMLB 2IPKB 1CL7I 2IQ9L 1CI5A 2AEPH 4NN5C 1I9RH 2XTJB 2BXZA 5FHAH 1OTUD 1CDYA 4NC0B 3W9DA 2X1OA 2ZCLH 4BH7B 1ETZB 3SDAD 4M9OA 1OM3H 4BK5A 1PSKL 5TE7L 4KK8C 2OTWB 4O51B 2Z31C 3L3HB 1DQQB 5DUPH 4DN4H 1KIPB 1PQZB 2HLFD 4IJ3C 4PJFF 1UFUA 5D7JC 1T80A 4K94L 2UWEE 2R0KH 4H25A 4S1RH 4Y89A 5C09A 5E9DD 4X6EB 4WY7L 4OCNC 4AEIH 2DQTL 2E27H 1MRDL 4OCLC 3FFDA 4XPHL 1YEHH 1TCRA 2HVJA 3Q6GL 2NY4C 4P2OB 5E24E 1AHWB 1MI5E 5JQHC 2AEWA 4JRWA 1X6NA 4PBWD 1QPPA 1Q9KB 4OAWA 4BZ2H 4G3YH 1MNUH 4U7MA 3GSOA 3HNTH 2BY1A 2P5EB 1A5FH 1EHNA 3W39B 3BKMH 1XR8B 4OI9A 3SKJH 4IHOB 3MLTB 3W11C 4C83A 1MJUH 4NRXB 3LN5A 4K07A 2ARWA 4F7CA 5HHOB 3BT2L 1NGWB 4JO3H 4KTEH 4LRIC 1EFXB 1NAMA 1HXMB 4PB0L 2JCCF 4R2GB 3FO9A 3ZKQD 5MEOB 3TJEH 4YGVB 3G6AA 3VE0A 5D1ZA 5JIKA 1T89C 3B2UC 1MHHB 1OTTD 2D03H 3MRPB 3VD7A 4W81A 1A3RL 1L7IH 4HF5L 1AD9A 4JZJC 4Z7UF 3VWKD 4X9FA 4M1GH 5IQ9A 4X5XB 2X9YA 2A77L 3MBEA 4P4KC 4LF3A 3QIUA 1CDCA 4H26A 3NFNB 5E6IC 2Z0BA 4K94C 4R7NB 2RCSL 2ZUTA 1BF8A 5FGCE 1JBJA 5I1CH 4JZNB 4C56B 3RUGE 4OCWH 4WVRA 3GSVA 3FFCA 2EDLA 4V1DA 2GY7B 5E1HB 4ZYKB 5L6YH 1JZ6A 5HHXH 5FO7A 1PDKA 3GIZH 1S7RA 5I73C 1BFVH 2FZ3B 1HHGB 4X4MA 2AV1A 1NCUA 4EQ2A 1KNOB 4OCMC 4U33A 3QUXC 5AYQA 3C8KB 4I18A 5GGVL 2DIBA 4XZUB 5H94A 4LHQB 1EEQA 4L4TE 4DOHE 3TP4A 4O02L 1AR1C 4LMQI 4JG1H 5JHDB 4PJIF 1PKQE 3H42L 1A4JB 4LVHB 2VO5A 3MNVA 1LE5B 1WZMA 3PWVB 4RGMC 1FORH 3UYOD 4C56A 1DDHB 3VGAB 1QLRB 4W6XB 2ESVA 2EH8H 4YWGL 4H26B 4ZS7H 1NAKL 3QXAB 1UB5B 1ES0A 5C0GA 2PYFA 4BQ8A 3KJ4B 2H1PH 4ISVA 4YFLI 4UTAL 4TNWK 1LWRA 1TETL