3LN9A

Crystal structure of the fibril-specific b10 antibody fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCTASGYTFSHRYHRWFRQAPGKEREIVAVISQSGMRTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAMYYCAAGTRKNVWTRQHPFDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin heavy chain antibody variable domain B10
publication title Amyloid Fibril Recognition with the Conformational B10 Antibody Fragment Depends on Electrostatic Interactions.
pubmed doi rcsb
source organism Camelidae
total genus 31
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2010-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ln9A00
4Y1AB 2BRRL 1IVLA 3PWLA 3V7AE 1G9EA 3DX8A 1BOGA 3QDGD 2NW3A 4UILH 2APWA 1KCLA 5SWZD 4JFPA 2G5BA 4PJ9C 5FB8B 4XXCC 4TTDD 5ANMA 5DFVC 4HLZH 4HMCA 1JHTB 4X4XA 1QLEL 2EE9A 4ODUB 1T21B 5HHOE 1MHCA 4UILL 3OAZK 4JFOA 2ZUUA 4XBGB 2ADJB 1CIDA 3GSNA 4HS6A 2YA1A 4WUUE 1X3DA 5HGGS 1NBVH 5DD3H 5I73C 4KUCD 2HTLC 4KJQD 3A6CL 1YECH 3VXMA 3A6BL 2R2EB 1OP3H 3KWWB 4P3DB 1NBVL 5F7WC 5LQBH 4R4FH 3WFDL 5E4EC 4U1SA 2HT4D 1XIWA 1AE6L 3FFCB 4LLYB 1GL4B 2PW2B 3WIFB 4YHKH 3CFJB 1BX2A 2MCPH 3C60C 3WN5C 1OLZA 2JJVA 5LQBL 4R4FL 1XCTB 3KHQA 4U6HA 4LPXA 2FH8A 5DJ6B 3MUY1 5IG7B 3GRWH 1MJJA 4ISVB 2BSTA 5E8PB 4YHYC 5AUMA 4YHKL 4U1KB 3WO4B 1RUAH 1BZ7A 3KPSD 5GIRB 1GGTA 1T2QH 3ARED 1I8LC 4CVWA 4GXUN 5I76B 1J8HE 4HKXA 3SDAA 4NFDA 4X98B 2YXFA 2WAHA 4ALAH 3PF2A 1W0YT 4H88L 3Q5YA 1C5DA 5E5UB 4J23A 4YDIH 1RUAL 2IH1B 4LDEB 4AIOA 1T2QL 3QEQB 4PJ9B 3DPBA 2X4SB 3PQYA 1HH6B 4X6DE 1S7VB 5D1XA 4YBLC 3I6GB 4JPVH 4CBPA 3O8XA 2VE6B 4L8SC 3WHXA 4NUGH 5DD0L 5ID1B 3QULB 1FG2B 3G04B 1EHXA 4DVBA 5I73B 3CDGA 4HIEB 1ZOXA 3MLPA 4RAVA 2AV7A 5KSAA 2LU7A 2R0LL 2YBRA 3UMTA 1T5WB 2DQEL 2W9DL 2X1WL 3GM8A 1UA6H 2WINB 5JQHC 2BNQD 5AG8A 2OM5A 3MRHA 3SKMB 1R3HA 2P49B 1T7XA 3DX7B 3LHPH 4X7TB 1QEWB 1IZKA 4FN0A 5E4EB 2Q8BL 1ADQA 5EWIL 2C1PB 2NY0D 2NY7H 5EOCH 4G43A 5HHMD 4GQ9H 3INUL 4WEBL 3ZDYE 1LE9B 1G9NH 3WN5B 1RZGB 5TH2A 3TT1H 3A6OA 4IDJH 5EOCL 1A7PH 1TZHA 4YHYB 3O11B 4GQ9L 4F9LA 2XOTA 5MI0C 1NL0H 3ZE0F 1ZHLB 5FKPB 2X9WA 1YDPA 4GKZA 3VU2A 1UWXH 4P5MB 4IDJL 4HAFA 3NBNA 4HK0A 1X9QA 5AZ2L 3PWPD 2DLIA 1N6UA 1N5YH 1NL0L 3VFMB 5J7CC 4U6TA 4N0FA 2LV4A 2QHLA 4JHWH 1Q0YL 3GBNL 3FB6B 2W0LA 4YBLB 1J1PL 1TTGA 4CVXB 4R90L 3MRQA 4XC1L 4XP4L 1N5YL 4HJ0D 5BRZA 4H0HB 4L8SB 4OKVA 5HTSA 4PG2A 5HYJA 4HC1H 3VD7A 1GXEA 3QUYA 5JW4Q 2VKWA 4KRPC 1WZMA 3V0VA 5KOMC 3B9KA 1P5VA 2DYPA 4JRXE 3SQOH 1X4ZA 1H3WM 4E41B 3MRMA 2ZSWA 5DWUH 3RZCC 2MQ3A 5JQ6H 5EZJA 4MXVE 3F7YB 4KKAD 3D9AL 1S9VB 4LFHD 3KPRB 3C5JB 4FQCL 5IESL 1P2CB 1MI5D 4QRRD 4Q6IA 4R0LA 3SGKA 4MVBD 4BSVA 5EUOE 4GG6E 3STZA 1T03H 1BHGA 2H32B 4CW1A 4JDZA 1GZQA 1PYWB 3TBVB 2F53E 4FQXC 2ICWJ 5GGQH 3MRNB 4PLKC 3QT2A 1T03L 1F11A 2OZ4H 3LKSB 2Q86A 1L6XA 4IRSD 1OWWA 5GGQL 5MI0B 3F5WA 5J1AA 3KYOB 4P9HH 1SHMA 5L2JB 2FR4A 4X7SH 4NRZA 4U7SA 4HCRL 3AY4A 1DSFL 4NUJA 4Y5XC 4X5LA 1T1ZA 3S36H 1OAKH 4PREA 3F58H 3RWJA 4MWFA 1HWHB 2AK1H 3T2PA 4X7SL 4N5ED 5C09D 1G0DA 3OQ3B 2NXZC 3NA9H 4GBXD 4I3RL 2XTJD 4OQTA 5HJ3A 3OKYA 1JZ5A 3W9DB 5I6XC 4P57A 4YFLI 1JUFB 3S36L 1OAKL 5BS0E 4BFEA 5HYEA 1HYSC 1ZGLB 3W11D 1YNTA 3H7BB 2EE2A 5HHPB 4PIRF 3RZCB 4LLWA 1FORH 3OB8A 5ITFB 1PEZA 1VADA 5LAXA 3WO3B 3DTXB 4LSQL 1HINL 4DZBB 5I8KH 3ULVH 5C0NC 4WW2F 1QLRA 2FATH 1G6RB 2FBOJ 4JPWL 1CDIA 2D31B 3HI1A 3RX7A 3MR9A 4PY7A 3BGMA 5DR5H 5I8KL 3ULVL 2GTZB 3L7EB 4YBQC 2FATL 1IAMA 2X6MA 2QQLL 5GRYA 1K85A 4HF5L 2FSEA 4LF3A 3RBGA 4BZ1H 1ZHBB 3NCJL 3BPOB 3QDMD 2E7BA 3RWGB 1FNFA 3M17B 3X13B 3T4AA 1OW0C 3GDBA 1IQWH 4XNZC 1WEJH 4NNXB 1DLFH 4IOFD 3P11L 4RAHA 4HWEH 1VFBA 4PJFA 2X2YA 3CNKA 4Y5XB 5I19L 3BO8B 5FA3B 2V2TB 1FO0B 1IQWL 4KJYA 5MENA 1WEJL 2C4FU 3TO4D 2NXZB 1RMFH 3MBEC 1KUMA 1QG3A 4U1MB 5I6XB 5DYOB 2HFEA 1UENA 4UT7H 4YH6A 3PWVA 4ZOEA 4ZS7L 5HI3D 2EYRA 1F3JA 1KCKA 4QTIH 2K1MA 1DBJL 1AKJD 2H41A 5L0QC 3B5HA 1RMFL 5IJKC 4LCCC 1MHEB 1IRAY 2VSCA 3L3IA 4UT7L 5DK2B 2AXFA 3BEVB 4QTIL 3RY5A 5KSUB 4QRPD 4M4RA 2D7NA 3R8BB 4PJ7A 5DRZA 1CI5A 2BSSA 2J8UE 3AU1B 2VDNL 3LN4A 3MLXH 3T77A 5C0EB 2GSIA 4Z7WF 3HPLA 1KTRL 4WW1A 4YEFA 4PJDB 1YEHH 3GGWB 5DLMH 2XQYK 3SBWA 2CDEA 1FAIH 2DOCA 4IOSD 5L9DL 3ZKXC 3MJ7A 4D0DB 2CMRH 4QHNA 2MCG1 5HYSB 1FNLA 4K8RH 4KXZH 3DXAA 3VWJC 3LEVH 4P2RE 1RK0B 5DLML 3G5YA 2EIEA 3E6HB 3MV7B 1FAIL 2EIZB 3UTTD 5IHUL 2CMRL 1JN6B 1NCTA 4MA8H 5D2LB 1LEGB 3OHXA 1CWVA 4YPJA 2NY6D 3L9RA 2C3VA 3LKRB 4PP2A 3QHFL 4XGZA 4XNZB 5GZOD 1KIRA 2IPTH 1FNEA 2R1YA 3LS4L 5D8JL 5FYLD 1VKXB 3PGDA 1OTUD 4ODWA 2AQ1A 1NQBA 1URLA 4RGND 4NFBA 1EX0A 2QHRH 3GMQB 1UT9A 2Q8AH 3DYMA 3MBEB 3VD5A 1IAII 5DQ9B 2OI9C 4NWUL 1IC5H 4URTB 5D5MB 3R06B 1JIBA 1SJEA 4XMKL 1X7QB 1Q8MA 1ZHKB 2HFFA 2QHRL 4MAYB 5L0QB 1C5CH 3DHMA 3U9UA 4OIIL 1CE6A 4MNHA 1R3IH 5TDOB 4OBRA 2SEBA 1F90L 2OLDA 3C08H 5GRUH 2NLJA 4EJ1C 1C5CL 1FPTH 4YHLH 1BMGA 1Y6MR 5DJZB 1DEDA 2Y23A 3J7HA 1R3IL 2XWBB 4RIRB 3O2VH 1T1WB 3VXSE 3VFNB 4XI5D 1DEEB 1NGZB 1KGCD 2EXWD 5GRUL 1FPTL 4YHLL 1U58A 3C5ZA 5HYSG 4EOWL 2OSLB 5A2IH 3RKDD 2AXHA 3VWJB 3QNYB 3U0WL 4MCZB 4PJHA 3VJ6A 3WXWL 2NYYC 1TTUA 3UYRH 1T4KB 2XPGB 1QFPA 3EGSB 4PRHA 5DT1L 1BVLB 5ETUB 1OB1B 1CGWA 2Z4QB 2P42B 1CVSC 4IHOB 3MLRH 4MXQD 1NC4B 2ZCHL 4Y19A 3GSNH 2VN4A 3ZSSA 4I0PC 5EBLA 4KHXL 3O6FD 3IU3A 2HRPL 3DRQB 3MRBA 4PJ5E 3ZYJA 1E6JL 3GMLA 3MLRL 3WXVL 3DO7A 2LFGA 4QXGH 3ARDA 4RGMC 4YDKL 2OI9B 3SDCD 3X12A 3TFKD 5A2JH 2YN3A 1JMZA 1N0XL 4M6MH 3QWRA 2M2DA 1Q38A 3TCXA 3E2HB 4J8RB 2VLJD 2DQGH 4LVEA 2EE3A 3FB7B 1Z5LB 5DO2D 4YZFF 4XHJD 4P4KD 3F8UB 4LCYA 4M6ML 4TOYH 5ID0B 4KAQL 3EJZC 4FQHB 3IDUA 2ZWLT 3UJIH 5C9KA 4G5ZL 3DV6B 4OI7A 2DQGL 3DI3B 4I9WD 4WI5A 4FZ8L 4LRNH 5I16B 3W9EB 3QRFM 1JBJA 1FGVH 2Q20A 3MJ8B 2Y5TB 3SOBH 3ROOB 5INDB 4N8PA 1SYSB 2YZ1A 3AMLA 4M48L 4LRNL 3VI4E 3EUUA 3OXSA 4ZPTA 4QF1A 2IG2L 4JZNB 1XGRB 4X8JA 2L0DA 2GCYB 1FGVL 3JTSB 2IH3B 3SOBL 4I3GA 3HAEA 4LCIH 4JGMA 2XZQH 4G8FA 5F88B 3DMMC 4EI6A 4KROD 5IB5A 5C3TA 3B2UD 1EHAA 1JHLL 4GW5B 4JO3H 4PJAE 4AIXA 2CQVA 1GIGH 4Y1AD 3S4SB 2GITA 1R0AL 2F8VA 4LCIL 5IFJA 5TFSL 5JLZA 2XZQL 5J57B 5JORA 1I8MB 3NPSB 3OX8A 2HVKA 4RGOH 3V7MA 3F62A 1V8HA 4JO3L 4TUOA 5F9JB 2XN9A 2DDQH 4FTVA 3QBTB 1KSRA 4PY8J 4MB5A 5E6IC 3RUGE 4RGMB 4QT5B 5H37H 2F19H 2DDQL 3L7FB 2X4RB 2X4QB 1CD1B 1ZA3B 1MLBB 5I18H 4CJ1A 1XGUB 3FQNB 4PS4L 1LO2H 3JWDH 4OD1L 5C0BB 1Y0LB 2R29H 3SKOA 1PAMA 1L7TH 8CGTA 3GJEA 5T1MB 4DGIH 2HVJB 3FFCD 1XF5B 4GAJH 4OLXH 4XNYH 3G6JA 5MHSD 5T33H 3T1FB 1J0YA 1RZ8A 1KJMB 3KPNA 3NIFF 3ALWA 5F1NA 2CK0H 3BRDA 1YNKL 3UJTL 4CMMB 1KTLA 2BSRA 1MCWW 4ZYKB 3OKMB 4L3EE 3RJDA 4OLXL 1TZIB 1YEJL 4BZ2L 2A74B 5T33L 4R4BA 5DF0A 1K9TA 4RX4D 3V6ZA 2NX5B 4NO2B 4Z7OF 1MCDA 1WT5A 5J8OA 2CK0L 3H9SD 4UB0H 3DMMB 4HWBH 3WUZA 3QPXL 5FB8A 3S4SG 4ESKA 3MV11 3Q48A 1FIGL 3MXWL 4S1DD 1HNGA 1JHTA 1HK6A 3SGJC 2N1KA 5JR1L 2VLKB 1RK1A 4HWBL 1SVZA 3BAEH 1T1YB 4XBGA 2ADJA 4NCC1 4HT1H 2NR6D 5F44A 1F3RB 5E6IB 1N5AA 1S7QB 6CGTA 4G9FD 1EUTA 3RVUC 2R2EA 4TQEH 3RFZC 4HT1L 3V2AR 5JHLL 2JB6A 4LPWA 3QQNA 3UCRA 1BGXH 2F5AL 1MFCH 4NN5C 2V7NB 4MHHI 1IEAB 1LP9F 1XFPA 2IAMB 4KVNL 4NJAH 1G6VK 2FH6A 2VYRE 5ALCH 4JFEE 4LMQE 3VXNA 4H5SB 2WUCH 5C0AB 1ZA6B 1FYTD 2X7LB 4ZFGH 1MFCL 2PW2A 1CTNA 4HFUL 3CFJA 4MJID 3WIFA 1WTGT 4Y2DD 4HKBB 1CLOH 1JZ3A 4NJAL 5C6WH 5ALCL 3PL6A 2Y4SA 3VA6A 4ISVA 5E8PA 3N1MC 4F58H 1CLOL 1QPPA 5J1SC 3NCEB 2AXJA 5C07B 5CILH 1C7TA 5I76A 2BOBB 3HMWL 5CINH 2BHUA 4JKMA 3MRIB 3LH2L 4P2OA 3ARVA 4F58L 5KSVB 1M71B 2EYSB 4P3CL 4DTGH 1YPZF 4J3OC 2IH1A 2VKXA 4OD2B 4WI8A 1RHHA 1EGJA 5J0BA 3QEQA 4PJ9A 3U4EB 4F3FB 2B39A 4XXCA 1HH6A 1UADC 4OQTH 1RVFH 1S7VA 3SHSA 2DL9A 5KVEH 4MYWB 3N1QC 4JY6B 1FBIL 4L4VD 5EU6B 1ZT7A 4E42B 2VE6A 4XWOC 4YHZH 2IANE 1MCLA 5KVEL 2DJ4A 3UTSB 3QULA 2UZYB 1LHZA 3MLSL 4Z7QF 5F71A 5GS2D 3EYFA 4YHZL 4WUUA 1SEQH 5T3ZE 1CGUA 2WINA 1KG0B 1NSNH 3WHE0 4NN5B 5IB4B 2V17L 1YMHB 3VG9C 3K81A 4YIQB 2F5BH 4IS6B 3DX7A 1FHGA 3ARZA 3K8MA 4X7TA 1QEWA 4KZEL 1L0YA 4JEGB 4KV5F 1IEBB 3H9HB 1MCIA 5GJTH 3D3VD 4QXWA 2JCCF 4L9DA 5KAQG 3C60A 3U0PB 2F5BL 3WN5A 2ID5A 4HUVB 3MUGB 2I9LB 4JO4L 1RFDH 1RZGA 3W39B 4HV8A 4CU8A 4XPGH 4H8WH 3WNPA 3O11A 4EUPG 5BQ7B 3WV0A 2PYED 2AABH 1ZHLA 5FKPA 3P4NB 4UINL 1I8LA 1RFDL 5D9SB 2Q1EA 4P5MA 3CLFH 1EBAA 4H8WL 4YQXH 4PJIF 5HHQB 3GSXA 3QUKB 2DQTH 4JCMA 5IBTH 3C2SA 5HPOA 3VFMA 2AABL 3LMJH 1G9MH 3P2TA 4L4TE 5IIEB 3QUZC 3DUUA 1Q9WB 3CLFL 3HUJB 1FZJB 1SJHB 3NH7L 1FV1A 4XH2A 5E2VL 4MX7B 3FB6A 5AWNH 3TA3C 1GGUA 2G60H 3KXFE 4N9GB 4CVXA 1G9ML 3C6SB 1BQUA 3GEWB 4X6DA 4Y5VB 2QSQA 1JPGB 5IOPB 1LE5B 3V5KB 5D96C 2X42A 1UB6B 3BHBB 4E41A 2ESVE 4ZSOE 3DSFL 3MLUH 3EOAA 4ZO8A 1S9VA 3KPRA 1KB9K 4X5XA 1CFTB 3VG9B 4X6CF 1SYVA 1KB5L 5E7FA 1AC0A 3L1OL 3PWJA 2W9EL 1T6WA 1KXTB 2QEJA 3TBVA 1IGTB 1G7IA 1L6ZA 1DANU 3FO9B 5A2KH 5L88H 1GGYA 3DHJA 2ZUQC 3MGAA 3BPLC 4J2XA 5CJOL 2FEEI 2ZNXA 2NZ9D 3LKSA 5F9OL 3OB0K 4HUWB 4NWTH 5FYKD 4GW1B 3KYOA 5L88L 4LOUC 3O3UN 1FE8H 2A9NL 3RVXD 4LAQL 2NY1D 2DAVA 2R0ZL 4ODSL 4KUCF 4NWTL 3KLHC 1LO4H 4PD4J 3VH8B 1CLYL 3CFBB 3BIAX 3TIEB 4UUJB 2CJUH 5CLTA 1LDSA 5IVXF 3ULUC 1BIHA 2XT1B 1KEMH 2QQKH 4MLSA 3BXNA 5HXMA 1ZGLA 1FGNH 1P1ZB 5ERWB 5JHDD 4B7IA 5D96B 3UTZB 5HHPA 3IJSB 3RZCA 4UTBH 4WU7B 4IM8A 1FGNL 4EDXA 3FO0H 5F1KC 4JRXA 3DTXA 4FHBD 4DZBA 4DCQB 2R0KH 4YEEA 3ARUA 3IRPX 1B2WH 2FX8L 2AK4D 2D31A 2NNAA 2NY4C 4XVSH 4J1UB 2VO5A 3RL2B 5E99H 3RIFF 4LLQA 4P4RB 1W2KT 2R0KL 3JWOC 3QFDB 3PE9A 1II4E 3L7EA 1KIQA 4FQXA 4MD5B 5K9OB 5GGSA 1FAKT 4LVOC 2X1PA 4XVSL 3T2OA 2ZUQB 1N6QH 4PRNB 2F53A 5E99L 1SVCP 5DRWB 3RWGA 3M17A 4IJ3C 1BFVH 1AO7B 3X13A 3MMEB 3E3QE 4O4YH 5I71B 4Z9KB 3H6JA 1H0DB 2BCKB 3R0MA 1BFVL 4Y5XA 5FYLL 4DW2L 2VDMH 1MRCH 2X4UB 3CFKB 5FA3A 2V2TA 3LEYL 1FO0A 3QPQC 1XF3A 6FABL 5DUBB 3QZWB 3VH8G 1ED3A 2BRQA 3OKEB 3O0RH 1IM3B 3BN3B 5B3NA 4FMKA 4BM7A 5DDHB 1W72H 2I60L 4JJ5A 1MRCL 5DMGC 2AEWA 3IJHB 5DYOA 5HPMB 1WWAX 2D9CA 4Y4HC 3U30B 4UQ3B 2ZUYA 3DRTB 1KLUA 4XPBH 1QFOA 1P6AB 3CVIH 3HZYB 4DVRL 1WCBA 2EDEA 4YPGB 2NQCA 3MLWL 4WHYG 1CD8A 1MHEA 4MAYD 5J6GB 2PYFA 3UTPE 3BZDA 5DK2A 3QEGL 3BEVA 2C1OB 1TNNA 5KSUA 2WZPD 5I8EA 3D39E 3BUYA 3D1MC 1RIVH 2E9WA 1S5HB 3P73A 5SWSE 3ARGD 2E7CA 2NY4B 4U33A 4XVUD 4AY0A 4LLVB 1W8OA 4D0DA 5FUCC 5HYSA 4BQCA 3BX7C 1N4XH 3I75B 3FFDB 2UZIL 4XP5H 3GNMH 3FOMB 1A6TB 1A0QH 1RK0A 1T2XA 1TJIL 3MV7A 4NQED 4ZS6D 4LVOB 3TPUB 1QA9A 2EIZA 3SDDD 1Q72H 2WQ8A 4N9OB 2W0KA 2HWZH 1AXTH 2YPLB 1FL3A 2XA3A 3BPNC 1N4XL 4BQ6A 1TVDA 2OL3H 5D2LA 4PRDB 1T7WA 5HDBE 1A0QL 1OW0A 3LKRA 5DURD 2IADB 5I1LA 1CU4H 1VKXA 3FRUA 4WFGE 2OL3L 4EXPX 1F3DJ 1Y18A 3QZWG 3A67L 3LDBC 3GMQA 3IKCB 5E8OB 5T1KB 1CU4L 5DQ9A 1NCUA 3ORJA 5CP3H 3PP4H 1M7DB 1J12A 1MJ8H 1HH9A 1J9CT 5IHZB 4OGAC 5IJKA 3KYAA 4LCCA 2GTWB 5C8JA 3DVIA 3G5ZA 1CF8H 5F7EH 3V5DB 5J89A 4XB8A 4OD3H 1MJ8L 4KRLB 5DJZA 3NZHL 1MREH 1X6LA 1O7VA 2XWBA 1YY9C 4RIRA 3VFPB 4XP6L 1T1WA 1GOHA 3VFNA 1DEEA 2IGFH 4OD3L 2J8UA 1HHIB 3KPOB 1IT9L 2XG4A 2DIJA 2R9HC 2OSLA 2DIBA 4MXWL 3CFIC 3RWCB 3PP3K 3VWJA 1MJ7L 2JIXD 4MNGB 2D7MA 5E8EB 3UXFA 1OTTD 1T4KA 2E6JA 3CMGA 3QUMA 2PKDA 2DS4A 1VB9A 4OTXH 5FV2A 4FXKB 5ETUA 4GAGH 5I1CH 2IMNA 3MV9B 1BWMA 4OIBA 4JFZH 3FL7A 1V5JA 4IHOA 2EIBA 2RB8A 2FIKB 1NC4A 4M5YL 5CIPH 2AS5M 3X3GL 5ISZE 2ZNWA 4F7EB 5ICYB 3T0WA 4GAGL 5I1CL 1U8MA 4JM2C 3IDYC 3LDBB 4JFZL 5DD6B 3F12A 1CQYA 3OXRB 5LG1A 1VEMA 3O45A 1R3JB 1LDPH 4AM0A 2X1OA 3OKKB 3U9PL 5ALBH 4U1IA 3AMKA 4EIGB 3HC0B 4OQ1A 3FB7A 1WTLA 1Z5LA 2YOCA 4RFOL 4LIQH 5EZOL 2OXGA 1LDPL 5EU3B 5ID0A 1LK2B 3FRPG 1EMTH 4IMLB 3T3MF 3OAUL 5ALBL 3ZKMC 1KENL 4HIXH 3HLAB 4Q74A 1UJTA 1RUMH 4XBPB 1MOEA 3ETBF 2C4XA 4WHTB 3MJ8A 3BKYH 1EMTL 2VAJA 3HS0B 3ROOA 4O02H 5KSAD 1YUHB 1IGYB 2PETA 4CRPA 5CJQH 3TN0C 3L3HA 4QO1A 4JZNA 1XGRA 4Z7VE 2GCYA 5I1GH 5FYJD 2OJEB 1IMHC 4XBEH 1EJOH 3IDJA 5F88A 5K9QG 4F37K 3PJSB 4GW5A 2HN7A 4LSUH 4NO3B 3S4SA 4BZYA 5ENWB 1LD9B 1EO8L 2WBJC 2YD8A 1EJOL 2DQFB 1FNAA 1I8MA 3STLB 1FH5L 2FGZA 4G8EB 3CSGA 3C9NB 4L8BA 1UKTA 4I0PA 4KDWA 3T04D 1GRWA 4JM2B 4XCCH 1GCFA 4LDOB 3IDYB 1FVCA 4OCLC 4NN7C 3CDFA 4DAGH 2VZVA 3FONB 5FCUL 3L7FA 2X4RA 4ZDHB 3ZKND 2X4QA 1ZA3A 4KKLC 3KS0J 2AEIT 1XGUA 4DAGL 2HMID 1KNOB 2GJ6D 2V9TA 1ZHNB 1H3TA 3MTRA 4FZEH 5C0BA 2A83B 1QD0A 3HNSH 3O9WB 2IAMD 5I1AA 5KVGL 2YD6A 4RRPG 2V9QA 5T1MA 5KW9H 2HVJA 1DFBH 5LGHH 1XF5A 4DGYH 3NZ8B 1IC7H 2F54D 3QIUD 3T1FA 4FZEL 3O3BB 3N1FC 3G6DH 1KJMA 5A1AA 4L29B 3QXUA 1NKRA 1UXWB 3OG4B 3C5SB 1NGXA 4ZYKA 3MGOB 4CMHC 5LGHL 4PJBF 1TZIA 1IC7L 1YEEL 3UPRB 2EXYC 4ONGL 5F7DB 4NO2A 1CD9B 2F8XC 4R3SA 4G6AC 2CLRA 1KTKE 4KQ4L 2MKWA 2V2XB 5CSZA 3B9DA 3QDAA 5IWLC 3ZSTA 3RA7H 1NFDE 3CSPA 4NZRH 2FJFB 5JO5B 4JPKH 4AG4H 1B0GA 1RZJC 2B2XL 5E00B 2CDFB 1F97A 3T0BA 4GH7B 1UKSA 3SDYH 4PB9H 1T1YA 1EXUB 2VABB 2ZCKL 3CFEB 4H1LH 3RA7L 1U3JA 1WBXB 3BIBX 5F7KC 3CVHB 4HUXB 4OUUA 5CBEB 4PRIB 5HGAB 1HHGA 1RJLB 1D5IH 5CP7B 5E6IA 1S7QA 4TSAH 3V4VH 1NDGB 4NQDD 4Q97A 5ESQA 5FOBB 4M7JH 4K3EH 3SDYL 1RPQA 1NEZB 1IM9A 2XKUA 4KMLB 4LVNB 5M94B 2V7NA 4PGBA 3D85B 3V4VL 1YEKH 5D4QA 5D7IE 2HTKD 2H32H 4Z76A 5C08E 4H5SA 4QRQB 5C0AA 5D7LD 3WL9B 1ZA6A 1RU9H 3NVQA 5SV3A 4AENB 5ACZA 1YEKL 1A6VL 4JRYE 5JXEC 3TH4T 1N8ZB 2CRYA 3FHQA 4U0RC 2X70B 5E5MB 7FABL 4AQOA 5L7XH 1MH5A 4FS0A 4EUPA 4KK5C 4CMHB 4HUNB 5C07A 3CMOL 2CLVA 1WAAA 3HNTH 4MAUH 4DUVA 2BOBA 3MRIA 1FRGL 5L7XL 3WJLA 2XY1A 1M71A 1YC7A 2EYSA 5CGTA 5TE6H 2EH8L 1WF5A 1ZANL 1J18A 3FCTB 3U4EA 4OZGE 1EFXB 4FABL 4NC2B 5A2LH 3NABL 5I9QC 1HE7A 2FJGB 3VFVB 5EU6A 2RGSA 5FGBC 1X4YA 5FGRA 3RIAF 3P9LB 2E9IA 5B4MC 5L8JB 3BJ91 3ILPB 5KANG 3VFRB 3MX0A 1KPVB 3NGBC 3TZVC 1H3VA 2YRPA 1NEZG 4QOKE 4GXUM 1KG0A 5HVFB 1G6RH 5IB4A 2DMCA 3WEXA 4YIQA 1DL7L 3BZ4A 3ES6B 3VFWB 1CGTA 2QADD 3RGHA 5FK9B 3V4PH 3TBYA 4DEPB 2Z92B 1IEBA 3V8OA 1ZVYA 3H9HA 3DX6B 1VFUA 2G75B 4M00A 1I8KA 4TUJB 4N90D 2UWEE 3CFDB 3U0PA 4HUVA 4JFEA 3W39A 3BE1L 3V4PL 1MJUL 4U0RB 1BF2A 3WFEL 2O5ZL 3L3GA 1T7VA 4EKXA 1INEH 2CLZB 2DLHA 4JRYB 3TBSB 1E4XH 4JFDD 4R7DB 3QXWA 4P59L 5K59E 1ZAGA 2ORBL 5FYKL 4QTHB 5D9SA 3IS1X 1INEL 1JTTA 4P23C 4R2GD 3HC4L 1FO0H 1ZLWK 5B38A 1IAOB 4ZUSA 5IIEA 1ORSB 1A9EB 2PR4H 1Q9WA 4BQ8A 2NY5C 2QR0B 3HUJA 4HWUA 1FZJA 1SJHA 2X89A 3NFNA 4MX7A 1YYML 1BAFH 2P8MB 5I9QB 3DXAD 5I0DA 1QVOA 2CUHA 1GZPA 4P5KB 4TVPD 4WI2A 3C6SA 1G7MA 1GGBH 5EO1A 3RHWF 3S37X 1LE5A 1YEDB 2CR6A 1UB6A 3G6AB 2VXQH 1TCMA 2AJVH 4PJXF 2LVEA 3NGBB 4NQSB 2K9UA 1FNSH 4HH8A 3IDMB 3P9MB 3W81A 1GGBL 3NAAH 2IANA 4P0DA 1QSEB 1PX3A 2GK2A 4XPTH 1SJVA 2VXQL 4ACPA 2AJVL 4F9PA 5HYFA 5DEGA 2A6IB 1NBZA 4YFLF 1FNSL 3GM0A 1F5WA 2YPVL 5I1IL 1RZIB 2HAZA 3NAAL 1MAJA 1QHOA 4XPTL 4LGPB 4NKMB 1VESA 4QXUL 4GRWF 3O4OB 4ZFOB 3FO9A 1MHPL 4KGLA 2QV2A 2BHZA 2DM3A 1I7RA 2WQRA 3OMZA 4HUWA 4NRYA 4UU9B 2BVQA 3ARFD 1RQ5A 1VPOL 1G7JB 4GW1A 5C0CD 3PGFH 4UI2A 1T0NB 1S3KH 4B0MM 1NANH 4P23B 1EERB 2WUBL 4ZO6A 2DLGA 3U4AA 1ZEAH 3SO5A 3SE4C 1UZ6F 3QUZA 3PGFL 3B43A 4V1DE 5C92A 3TIEA 4PRPE 4UUJA 5BV7C 3TA3A 1X5YA 1A3RH 1QACA 2UUDK 4L4TA 1ZEAL 1J88A 3H3KA 5ERWA 1R5WA 4HAGA 3TJEH 3D69A 3F65A 3MFGB 1A3RL 3QRGL 3SJVE 3IJSA 5B3JF 4QRTB 2VAAA 3RVWC 1BQSA 5JDJA 1JNLH 5TGBA 3ROLB 2ESVA 4DCQA 1NAMB 1JNHB 3BKMH 4I4WB 4J1UA 1JNLL 2VUYA 3ZHLA 4DKEL 4JN1L 3QFDA 1T5XA 4MD5A 5K9OA 4R9HA 3W5NA 1YMMB 5EA0H 2VLMD 4PRNA 1KEGH 1P4BH 5DRWA 3RRQA 4KY1H 4D0CB 1X6NA 3DURB 4DWHA 3TH3T 1AO7A 1RSFA 3P77B 5F97E 1TJGH 3MMEA 4QYOB 1PKQE 3VRJB 5EA0L 4B7LA 2BMKB 3T3PF 3VD3A 1H0DA 3CXDL 1CFSB 3O2DL 5TPWH 4M61B 2Q6WB 1KEGL 4XPFL 2AJ3B 1SM3H 3U82B 4BK5A 3I50H 1EFQA 4D9RD 4S1QH 5DUBA 3QZWA 3UAJD 3NIGE 4Z0XA 3OKEA 4U31A 3O3EB 5BV7B 3U7WH 1A2YB 2Q76B 5DDHA 1H5BC 3FQXB 3I50L 1IGFH 3IJHA 4CN1A 4S1QL 5BZWB 4UQ3A 5T1KD 2DMKA 4FNLH 1PZUB 3CXHK 2V5RA 3HZYA 2HJFB 3U7WL 3KYMB 1V7NH 2Q7YA 4WIQA 2PO6A 3GB7B 4HH9A 4JQXC 2C1OA 1R5IA 3U7YH 4DGVH 3HTLX 3MA7A 5I66B 1V7NL 1S5IL 1S5HA 5EU7C 4GXVL 4M93C 3NCCB 2Y9RT 5C7XH 1NGPH 3U7YL 3PDGA 4DGVL 4LLVA 4MSWB 5FM8A 2FYYA 5IMLB 4P46C 2AVGA 3I75A 1E4XI 1KCSL 1XMWA 3FOMA 5FHAH 1A6TA 4HWNA 3RWHB 2RCSH 1NGPL 2ZUWA 3TPUA 1U8HB 2R0WH 1XGQA 2YPLA 3BP5B 4HWZA 4HZLB 4MJ4A 1D9KD 4HGMA 3WKML 4P5TD 5FHAL 4G6MH 5E2WL 2RCSL 1V05A 1CCZA 5GS0D 3JVGC 1AP2B 4HJJH 4OGYL 3MV9D 5T5NF 4FQ2H 4UOJA 4WW2C 1OD9A 3IGAA 1SMAA 1ACYH 1P7QB 5I2IB 4HJJL 1OTSD 1LK3H 3IKCA 2CR3A 4ZD3H 5E8OA 4DN4H 1KJ2A 3GHEL 3ZO0A 5J9PB 3MUHL 3Q5TA 4PV9A 1D5XB 3W82A 4Y4HA 2ITCB 1ACZA 2O5YH 5KBNC 2ICWB 1M7DA 2E5EA 4UV4H 4N0UE 4ONOA 2R2BB 1LK3L 4HUUB 5IHZA 4MS8D 4DN4L 3BP4B 4M8QB 2YHGA 4F15C 2GTWA 4G7YH 1F42A 5MEQB 1KCRH 3K2MC 1JWMB 4TULL 4M5ZH 4JQVC 3K4AA 3ZKQD 1H8SA 3GZKA 2AGJH 3QDJE 2M8XA 1K6QH 3AGVA 4M93B 3X17A 2VDKL 2XQBH 4BH7A 3D39A 3QB7C 5D72L 3VFPA 3KPTA 2EDRA 3LPFA 4O5LL 5EN2B 4M5ZL 3BRGC 2DN7A 2J88L 3KNBA 5GRXG 2R8SL 2AGJL 3GJFA 4RMTA 4P46B 1K6QL 3V95A 2DQIH 1R3KB 1DQLL 2K7QA 3LB6C 5GPRA 3RWCA 1L7IL 2XQBL 2NZIA 5GGRB 4NQCB 5FYJL 4OKDA 4KK9D 3MACL 5CEXB 4KUZL 1NANI 3DWTA 4PJCF 1JGEA 2DQIL 3H3BC 4ZFZB 3CH1B 3DI2B 5KJRH 3VE0B 4JO2L 3CLEL 3FO2B 2NXYC 1Z3GH 2OR9L 3ZTNL 4CNIB 1VEPA 2FIKA 3BFOA 3KYKL 4WW2B 5ICYA 4I5BB 4U3CA 3LKNA 3ZL4L 2VISB 5A43C 3SDXF 5DD6A 4OT1H 1Z3GL 4MCYA 2A0LD 4P9ML 2HJLB 4K7PL 4NRXA 5GISH 1R3JA 2P5WB 4KTYA 3OKKA 4NCC2 1KLGA 1CIUA 1MELA 2Y06L 4RBPH 1S7TB 3HC0A 4F15B 5GISL 1QSFB 4FFVC 3NOIA 3MFFA 3MODH 1EIBA 4RRPA 4NKOA 3L3JA 3RU8H 3O9WD 1XEDA 3HLAA 1V3JA 3CH8A 4JKPH 3QO0B 3VXRB 3DVFA 4WHTA 3BESR 5HHOD 4NQTA 4XT1C 3HS0A 2ITDA 5CCKH 2XZCL 4GRMA 3UBXA 3RU8L 1AHWC 1S9YB 2OJEA 4YE4H 3JUYA 3OR7B 1TVBB 1WWCA 4NKIH 3T4YB 2BNRB 4WGVB 2P1YA 1NBYA 1IKFL 1MQKL 1UZ8B 1XF4A 3O6MH 1QRNE 3PJSA 4JJHA 1UQSB 3MCKB 1HOCB 3AS3A 4YE4L 5ENWA 1BEYL 2X10A 1P84J 2DQFA 3P0GB 1KC5H 3BD3A 1F8TH 2FL5B 3C9NA 4Z7WB 4JN2B 1TCRB 3GBML 1QFWH 1OSZB 4JM2A 4N68A 1OOAA 4FXGB 1KC5L 1Z9SA 4LKCB 3SQBA 1BD2B 1UJ3A 5ISZA 2YZ8A 3OJ2C 4WCYH 5DQJB 2OTWA 4K3JH 1QFWL 1JZ2A 1J8HD 1N2RA 3KLSA 2O26U 3VFGH 3KPMB 1ZHNA 4M7ZB 5E2UH 1PJ9A 4K3JL 3V6OE 3S35L 2VR9A 1IQDA 5CLWA 3EYVA 2C7UB 1MWAA 1ZLUK 4JFXB 5JXAL 2ED7A 1YEGH 2ATPB 1MF2H 4TTGA 2HT2C 3HFMH 3VFGL 3NZ8A 3RL1B 4H25B 4OZIF 1CXEA 2IWGA 4L29A 2FIRT 1UEMA 4DN3H 1S9WB 1UXWA 1HWGB 3C5SA 4XTRC 1GHFH 4J4PC 1MF2L 1Y6NR 3MGOA 3TN0A 1UM4H 3U2SA 1JCKA 1AHWB 3TNNB 2LAGB 1KPRA 2H6PB 4Y2OA 3BZEA 1GHFL 1MCWM 4Z7VA 2V2XA 4K9EH 3LKOB 2F58L 3VXTA 1IL1B 1Z0MA 2FJFA 5JO5A 5L6YL 2WBJA 2PXYB 4LCUB 4LPUA 3ZE1E 4HX1A 4OCWL 5E00A 1RAMA 2CDFA 4K9EL 1EXUA 2VABA 5HGBB 1T22B 1KELH 1WIOA 4OFYA 3CVHA 4HUXA 5GSRB 3U1SH 4ENED 4PRIA 3VXUB 2X4NB 1RJLA 5HGAA 4MMZC 1A1NB 2VXVL 3S36X 5BOPA 1IE5A 4P9HC 3C8HA 1KELL 3BN9D 3QJHA 3OPZL 3IVKA 2OK0H 4L8DB 1HDMA 4NYLB 3D85A 2H1PH 1AH1A 2DQHH 4IRJC 8FABB 4NBXB 1NC2B 3O6KH 5F9DC 2EECA 4KK8D 1YY8B 4PJ8C 5D1ZC 5KSBF 3MCLL 3WL9A 4S0SD 4NT6A 3LVEA 1B0RA 2R15A 1N8ZA 2DQHL 4A6YH 5E5MA 3D0VA 5TE7H 3QH3B 1Q1JL 2KZWA 2DTMH 1U36A 3ULVE 4NJ9H 5I15L 4Z8FL 1A6UH 4A6YL 2ERJC 5EPMB 4MQ7A 4LSTH 1A1MA 2WIIB 3TBWB 1CK0L 4EXKA 1K8DB 2DD8H 4X6EB 5IHLB 3ULVC 4GSDH 3LY6A 3UJJL 3GFUA 4TVPH 5IWLA 2DLFL 3O6LL 1GC1L 4NO0A 4HS8H 4OI9A 4LSTL 5F6HI 2HA1A 3QI9C 4HGWA 3E6FB 2DD8L 3QQ9C 3MJ9A 3VFUB 5KS9E 4TVPL 1NFDA 1IKNC 3GI8L 1T0MB 3QG6A 3WS3B 1YA5A 1CTOA 3ILPA 3QXAB 3VFRA 4J3XA 4ZNCD 4AH2B 1UWGH 4UV7H 4DJMA 5I1EL 4JFQB 3GI9L 4G8GB 2FD6H 3T0EC 2XFXA 5IKCA 3OBAA 1QSED 3VFWA 1H3PL 1UWGL 5FK9A 4IRJB 2EE6A 3DX6A 1SY6A 4TUJA 2G75A 4PJ8B 4WENB 3W2DH 3HE7A 4XAKE 2FD6L 1XGTB 4DUWA 1PKOA 2OBGA 3CFDA 2QLVB 1AJ7H 3MV8B 4JHZA 3CFCH 5JXEA 3MNZB 2DWEB 2JK5A 2OTPA 5C08A 4FRWA 4XXDB 3OKLB 5BS0D 3UYOD 2PF6A 2CLZA 4OZHF 4JRYA 3TBSA 4OCSL 5CEZD 3AXLB 4R7DA 1AJ7L 4X7FC 2ARJB 3T0AA 2O93L 1X5GA 4JVWA 4QTHA 2ERJB 4UMGA 4GS7C 2X05A 4EDWH 1WZLA 4OSUL 1GJIA 4WJ5B 4HUMB 4ZOCA 1BWWA 4W81A 1IAOA 3TNMB 5L2KB 4ERSL 4P23D 4PTTA 3BGFC 1A9EA 4HDIB 5EC1B 3RJQB 2QR0A 1L0XA 2P8MA 3IXAB 1CLZH 3QI9B 3EDEA 5FGCE 3VGEA 1PG7L 4G6FD 4P5KA 1QYGH 5FGBA 4XCFH 3HB3C 1MSPA 4M7LT 1K8IB 5D2NC 2NY3D 1YEDA 3MRRB 5HHVH 1UM5H 5DUML 3G6AA 3QA3B 9CGTA 3KAAA 4NQSA 4B41A 4CU6A 2YXMA 3P9MA 4GJTB 3TZVA 4PB0H 3T0EB 4FP8L 4LSDA 2AAVA 4UTAL 5HVWA 5K9KA 2IQAB 4LMQI 3VMNA 4YWGH 3TT3H 3FB5B 4ZUUB 1RZIA 4PB0L 4X4ZA 4NKMA 3ARRA 2DJUA 4WFED 5E6ZA 4YWGL 3GIVB 4ELKB 4P2QB 4K94H 5TE4H 1D5ZA 3M07A 1DQJA 4JG1H 2F9BT 4EN3B 1J5OH 1YMMD 3RPIB 4RFEB 1NLBH 3GJFK 3WDIA 5DRNB 5AD0B 4NM8H 4K94L 4M1GH 3RVVC 5LCVL 43CAB 1T0NA 1MPAH 3ZHDA 4GS7B 3OAYK 1NLBL 3QJFB 4HBCH 1OARL 4APQD 1LP9B 2R1XA 1PY9A 2IFGA 3BGFB 4Y4KC 1MPAL 3SGEI 5D7SL 4KI5E 4QNPF 3JV4A 4R26H 5I17B 4LLUB 4RDQF 3LN5A 4P2RD 5D2NB 3THMH 4HPYH 3WIHA 5A3IC 1AI1H 2HLAA 4NO5A 2YN5A 3IU4L 4MQXD 1FN4B 3RGVC 4ZAKC 1HHKB 2YKLL 1QO3B 3ROLA 1S7RB 3OJVC 3B2VH 1JYNA 4HPYL 3VXME 1K3IA 2R23B 2YK1H 1YPZB 1JNHA 4MZ3A 4HS3B 1A6AA 1AXSA 4I4WA 5EFIB 1MFAH 3OGOE 2D4DA 5C0FA 4KK6C 1QLFB 4OLUH 3BDYH 1TMCB 4MQSB 4WDIB 5JW5B 5GGUB 1I4FB 3CZFB 4O51A 4KTDH 5B39B 3EJYC 3DYPA 4P3WA 2ENYA 3LSOB 1DP0A 2IQ9H 2W0FA 4ZG1A 3DURA 4NNPH 1U9KA 2EZ0C 2ZCLL 3ZKSD 1UEYA 5C0IA 4JB9L 3FTGB 2H9GB 1A02N 2BMKA 5GS0L 3FT4B 1D5BB 5A16B 3D87B 4Y16B 3O4LB 2Q6WA 4M61A 3DROB 2IQ9L 3PV6B 3AB0C 3SE4A 2Y36H 5T1LB 2J6EA 3WFBL 3IF1B 4Z77B 2YD1A 5SWZE 4Y4KB 3U4BL 1GH7A 3BRFA 1L9NA 3VXSD 3EBAA 3BVNB 1F02I 4ZFFB 3FQXA 1A1OB 2M1KA 2NTFB 2Y36L 3QCUL 4QHLB 3IAGC 4PV8B 5CD5D 4JAMB 2HJFA 3VXQA 4P99A 4TTDC 1X5IA 2AXGA 3KYMA 4S2SA 4M62L 4MNQB 3X3FL 1FLRH 5B8CC 3GB7A 5GGVL 4HK3J 4L8CA 4ZAKB 1JPFA 5MERB 3VCLA 2GYSA 4ONFL 4M7KH 4PD4K 1HQRB 2HG5B 4Z7UF 4PJIB 3SJVA 1V3KA 4I13B 3QIWB 2YUXA 4KJQC 4O2EA 4PJ7F 3T09A 4MSWA 1C5BL 1KJ3L 5F93C 4TYUA 5IMLA 4NZTL 4HGKC 5ILTH 4YXHL 1MVUA 1AFVH 4OM1H 2D7TL 4PJ5D 5DJYB 3VI3E 3RWHA 1TXKA 5B39G 3ZHKA 1FJ1A 2HT4C 1U8HA 4R7NB 4HIHB 1QTYT 1JVKA 5CGYD 3BP5A 4Z0BH 4NQCD 2LU3A 4UAOC 5DTFA 1A21A 3GSVA 4NIKB 4ELME 1AP2A 1BJ1J 1JGUH 3KPSE 4J3UA 3IXTB 2LAAA 5I8OH 3RIFK 5TQ0H 4X6CB 3AB0B 4G8IA 1AXIB 4M7LH 4LU5H 5FO9B 3LZFH 3AREC 5I2IA 2HLFD 4POYA 1OCWL 1U8OB 4Z5RA 3VG0L 5I8OL 3PIQB 2OYPA 1CDCA 3TH2T 1Y6KR 1H5BA 2HKHL 3DVGA 2CKBH 2YD9A 3QDGB 4M7LL 1D5XA 4QRSB 2PCPB 3FQWB 3LZFL 4F7TA 4NPYB 3WLWD 2P5WD 4OFKA 4M8QA 1EGJL 4PJGE 1U3YA 2CKBL 3MRJA 2APVA 5B8CB 5MEQA 2FX7H 4JQXA 1JWMA 4M9PA 5H35B 1NAKH 1JHKH 3WIIH 4YHIB 1QSFD 5GJSH 2V9RA 3BP6B 2IMMA 5ADOH 2DQDL 5CZVH 4HXBL 5DC9B 3PDOB 3U6RB 2FX7L 1A3LL 1EZVX 4LDLB 5EN2A 3HRPA 3WIIL 1XH3B 1XZ0B 3VXRD 5IVXB 4P46A 1HCVA 1R3KA 5FA4B 1CN4A 2EDDA 1QR1A 3FN0H 1X5FA 3LQZB 1KXQE 5GGRA 3BH9B 3WHE1 1C16B 2NY0C 4M1DH 2A9MH 3WNMA 4ZFZA 2BNRD 2RAMA 1IC4L 4PLOB 1HCFX 4PJHF 2W65B 3FN0L 3EZJB 3VE0A 1KPUA 2DKMA 1S78D 2EDWA 4CNIA 2YC1A 3W0WB 3ZDXF 4LPTA 3AROA 4WW2A 3D48R 4I5BA 3PWPE 2WNGA 5EH1A 5CBAA 1JZ6A 3EO1B 1S7WB 3AREB 1QBMH 4M1CC 1U0QA 4PLJD 2FO1A 4W68A 4XVTH 1MHHA 4QGYA 2HJLA 1BD2D 4F2MA 4L3ED 5H94B 1YJDL 3TVMD 1KCVL 1AGEA 5DI8B 3EDFA 4XVTL 1S7TA 4FOMA 1LGVA 3FMGH 3P0VH 4HJ0C 3PXHA 4JQVA 3BPCB 5IJVB 4YHML 3TIDB 4FFWD 3BZFB 5E2JA 2I5YH 4NZJA 3MLYL 5HI4D 1MI5E 5AG9A 3QDJA 5F96L 3BMWA 1FFPA 1M7IB 4KKAC 5K9QI 3MXVH 1BFTA 2EDBA 1DUYA 2BNQB 1K2DB 2DBLH 1ZSDB 4F57L 3QWOB 3KPQB 3F7VB 1S9YA 5ECJE 4MVBC 3OR7A 1ZGLP 1TVBA 5CZXD 2IPUK 4TUKL 1LO5B 1UZ8A 4WFHE 4AIZA 5HHMB 1PZ5B 2DBLL 2P7TB 5D6CB 3QNXB 1BJ8A 4C4KO 1X5ZA 4JLRB 4R4ND 1F13A 2OJZH 4LSPH 2FL5A 5FECA 1BFOA 2PXYD 2KBGA 4Z7WA 4IRSC 1OSZA 3HMXL 4H8WC 4FXGA 4LKCA 4NZDA 4PJFE 5C09E 4C56B 1QPXA 2P47B 3OKNB 2XTJE 4Q2ZB 4H20H 2EDYA 5DQJA 5MENE 2BJMH 5E5RB 4N5EC 1A4KB 2DQJH 3S3PA 4HEPG 1LILA 1UACH 4GBXC 2XTJC 5K9JL 1QQDA 3EYUH 4NQVA 2G2RB 1G9MC 4H20L 1F00I 1WZ1H 3FZUD 2BJML 4S11A 2C7UA 1MFBH 3UBXI 2DQJL 4OLWH 4JFXA 3W11C 2ATPA 1JMXA 1OAZH 4H25A 1MCRA 4MB3A 2DI8A 1MFBL 1S9WA 1X5AA 4XX1E 3ZZ1A 5JIHA 3G6JF 4K7PY 5E8DH 1AHWA 3TNNA 4QRRB 1RURH 2N7AA 1BECA 2H6PA 1IGCH 2ADFH 5E94B 3MJ6A 3QR2A 3K2UL 1CDBA 1S7SB 5E8DL 5JOFB 4M6NH 1HKLL 1S8DB 3QDME 1IGCL 2D2OA 1IL1A 2X4TA 3HI5H 5DMKB 4WWID 4ZODA 4E9LA 3PNWB 3B3IB 4OGXH 5DJAA 4X7CC 2VIRA 2ZPKH 4UIKH 5TF0A 1D6EA 3IFNH 3HCVA 4O00A 1A7OH 5GSRA 3VFSB 1MNUH 4CU7A 1FC1A 2X4NA 3VXUA 4IOFC 2FHFA 4OGXL 1A6ZB 2OCFD 4JFYB 5DRXA 5FYJU 5HDQH 3IFNL 1FDLL 5IEHA 1HI6B 5ITBH 4GRLD 4UIMB 2VNCA 4NYLA 3TO4C 3IFLL 4GBXB 4LCWB 4ORGA 4JM4L 2DICA 1NC2A 2B1AH 2GJZB 1YY8A 5HI3C 4YHOH 2APXA 4FQ1L 2Y5EA 3HC3H 5CEZH 1BPVA 4X7EC 3KXFD 4KDVA 3FQUB 1GAFH 4HJGB 4Q58C 4HEME 1RZKL 3QH3A 1LVEA 4ZFOL 1NUFA 4J4PA 2MQ0A 4LFHG 4KZDH 1K4CB 5CEZL 1KB5B 3P4OB 1ZT1B 3RNQB 2BY1A 3EYOB 2D0GA 1GAFL 4OFPA 2GAZB 5DZLA 4ODXB 3N1GC 3TBWA 3Q6GL 1T20A 3NMEA 3GMRB 4HQQH 1W0VB 5E2TH 2COQA 3M8OH 4Z95H 3UTTE 4R96B 3RWFB 3D2UD 1KBGH 4OLVL 5DGQA 2D7PA 5L2KD 4XCNB 3L6FA 4PJEF 1T04A 4Z95L 3QXDA 4NQXB 1KBGL 4WGWB 1F4HA 1I9RH 2YA2A 3WIHH 1DCLA 2NY6C 5CUSL 5GZOC 4DOHE 4HCRA 1FVEB 1AY1H 2FJHB 4MA3A 4RGNE 2VJXA 1C08B 5KN5B 3S37H 1OTUC 4JFQA 1CICD 2FNBA 2VC2L 4G8GA 4RGNC 1NAMH 1AY1L 5I1HL 3BWAB 4X0KB 1IBGH 2ZOLB 4IRJA 2CIKA 2AQ3A 3D18A 3SE8L 5D1ZA 1XGTA 2VXSH 4C4KT 3HE6B 1AKJB 3ESVF 3MV8A 2W91A 4WTXA 3IYLW 3MNZA 2DWEA 1JTOA 2NW2A 3JWNC 4XXDA 5IMKB 4ZUTB 1UWEL 4JREC 5F1OB 3OKLA 4W70A 5IROC 4QRPB 2MFNA 4C54A 4P2QD 1WBYB 2PO6D 5FGSA 3P4MB 1KGCE 2EH7H 3ZYIA 4EN3D 5IBLD 1CDHA 4MA7L 4ZQKA 5J3HD 2H2SD 2A77H 4AL8H 4G3YH 5DUPH 4F37F 4GQPH 1DQML 3AM8C 4XI5C 2EXWC 4YR6B 3OKOB 2EH7L 1JWUB 5C6TH 3RKDC 4AL8L 3QXTA 5BV7H 4ZPVB 3ARXA 3KDMB 3LPWA 3WFHB 2ICEA 1B4JL 3QI9A 5CJ8A 3RTQD 4NKQB 43C9B 5C70A 3IS0X 3HZMA 4K3GA 4MDJB 3HNVL 4AJ0A 4UNVA 2UUDH 1IKNA 1ODAA 5DEFB 4QLRA 3QA3A 4P48A 4KGJA 4NHUA 4X6DF 1A5FH 2WWKO 2YD7A 4K3DH 2XN9E 4MXQC 1PVHA 2XWJB 4PJBB 3JV0A 4Q7DA 2VERN 3QAZC 2VWEC 3O6FC 4RGNB 3T0EA 3MNVA 1I9JH 2FX9L 2IQAA 1A5FL 4K3DL 1BQLH 3FB5A 3EOTH 4ZUUA 2VLJE 1F45A 1FL6B 3SDCC 3TFKC 4D8PB 1U8KB 2FWOA 4UNTA 3P0YH 4WI4A 5IEKB 1I9JL 1NGYB 4JCLA 3GIVA 5DO2C 1RZ7H 2ICES 4JREB 4PTUA 4XHJC 4P4KC 5MEOB 2Y1VA 1U93B 1ZVSA 4RFEA 3CCHB 5IBUB 3LAFA 4C59B 1DBMH 4MJ6B 1T80A 5DRNA 1EDQA 2EYTB 2Q7NA 1HEZB 5AD0A 4K71C 3SPVB 4OCXH 5KVMC 3ZDYF 3I84A 3FHAA 3GHBH 4ZTPH 1OP5K 3UTPD 3BWUC 1GGIH 3D39D 3CSYB 3RVVD 1LP9A 2FBJH 4Y16D 3O4LD 4JANA 3HA0A 3MRDA 3G5XB 5SWSD 4F7PA 4Y1AE 1GGIL 1XCQA 5I17A 1WGOA 4KROC 25C8H 5LXGL 3B2UC 1I9EA 2FO4A 2A1WH 4B50A 5D2NA 4B5EA 3CGTA 5JZ7D 1QSVA 4X6FB 3UC0H 1LO0H 3JV6B 4H0GA 1U95A 3EO9H 2DKSA 1H9VA 25C8L 1NCDL 2YD3A 4LP4A 5CMAB 1HHKA 3V4UH 2I07B 1S7RA 5T3XH 3T2QA 1EBPA 3BSZL 4U2ZA 4ZXBD 3QIBD 3SDCB 2X9XA 5HVGB 2WLYA 3QIWD 2AEPH 4WUKH 4LSRL 5JW3H 3HRZA 3EOBB 4IIQC 4YXLH 5IR1B 4WDIA 2E27H 2W9LA 2VLJB 3RX8A 1MLCB 3MNWB 1I4FA 1OY3B 3CZFA 5GGUA 4UDUB 2HP4A 3FFCE 4LIQE 4P4KB 5IF0A 1I75A 1T3FB 5EUOF 3WNOA 4GG6F 1QFUH 5IBUG 4OZ4B 1SMOA 1VFMA 1ZLVK 2H9GA 4K71B 3D6GA 1OP3K 2GK0B 3FT4A 1D5BA 2Z35B 2N4IA 5A16A 5BJTB 2BOCB 4R8WL 3PV6A 3RQ3A 5JDSA 4F33B 4LPCA 3MRFB 4Y7MA 5T1LA 3IF1A 3TEUA 5DHYB 4X80H 4Z77A 5GRJL 4RISH 2BRRH 4Y4KA 3WO4C 1N3NA 3WS6C 4YC2C 4ZFFA 1A1OA 5EORL 4KROB 3QEQE 1U8JB 4RISL 1QLEH 4PV8A 4JAMA 5F3BB 4OFVA 3VW3L 4PGDB 4S1DC 4OF5A 4MNQA 3Q1SH 5DS8B 1QSZA 2J7LA 3RGVA 2XNAB 4ZAKA 2ADIA 3GMOA 4KMTH 2FECI 3K80A 1JJUA 1YN6B 3A6CH 1YQVH 2HG5A 2NR6C 3A6BH 4OCMC 5CIPB 3HPJA 4NGHH 3Q1SL 2AJYL 2A6JB 3LRGA 1S7XB 4KMTL 5D70L 3AS2A 4IIQB 1YQVL 3WFDH 5ICZA 1RD6A 5DJYA 1FYTE 3GSRB 1AE6H 3NACL 4NGHL 3MOBH 2QSCL 4QXTB 1MFNA 2X4PA 2R4RL 4R7NA 4WI6A 2VDPL 3IETB 2P46B 3N50A 1DN0A 1YZZA 4PJXB 1CFNB 4Y2DC 4GAYB 3MOBL 3GSQB 2WWKT 3GK8H 2WIMA 3HN3A 3IXTA 1TLKA 3MRKA 4W4OA 2G9HB 1DUZB 3BEWB 5KTEH 1RI8A 1MVFA 1CFVH 3GK8L 4H88H 5EOTA 3W0WD 4DQOL 1U8OA 3PIQA 4YC2B 3H9SB 4GRWB 3I02B 3QDGA 2ZSVA 4QRSA 3FQWA 5SWZA 3GSOA 5KTEL 1TFHA 4JDVA 2D0HA 1CFVL 4GUPB 4IDLA 3IJYB 1CL7I 2IBZY 3S8WA 1LWRA 4QY8B 1RULL 5IGXL 1R6VA 1VSCA 5DD0H 5F6IB 4WHCA 2EO9A 4NZUH 5H35A 5GS3A 4YHIA 2N56A 1UWXK 3TWCL 2J8HA 3V0WL 2R0LH 1E27A 2MNUA 3BP6A 1E28A 1JRHH 1CE1H 1H8NA 1MFEL 1QZ1A 4E41E 5CFHA 2DQEH 2W9DH 2XZZA 3PDOA 1OGTB 4OFYD 3U6RA 5JPNB 4AEHL 2Z31B 4G9FB 4NZUL 1IEHA 3K4ZA 1KN4L 3KPRE 3F7RA 1XZ0A 1JRHL 3OJDA 1CE1L 4U6XA 4CN4A 4LPYA 5IFAH 5IVXA 2VLLB 2Q8BH 5EWIH 4DKFL 2J8UF 2FB4L 5I74C 3VFOB 1OWRM 1NMBH 1JV5A 3INUH 2Y7QB 4FQJH 3FKUS 4WEBH 3O3DA 1C16A 1FYTB 5IFAL 4MJIB 4Y2DB 4HULB 5GGVY 2W65A 4KRMB 1RJYB 3H0TA 1NMBL 4FQJL 4P2YA 4RWHA 3B8SA 4Y4FB 2Y25A 4WO4D 2ADGB 3K74B 2MKLC 4ELMA 3KPSA 5ESVA 3AREA 4WI3A 5AZ2H 5D7KE 4EVNB 1MIEL 5C0DA 5KVFL 3LEXB 3QDHA 4NBZB 4K7FB 4M1CD 2QL1A 1JYVA 1HHHB 1Q0YH 3GBNH 4C56D 1J1PH 1JTPA 4R90H 4XC1H 4XP4H 4H26B 5CKAA 5DI8A 1Q94B 5HHNB 4QHMB 1CXLA 4NO0D 4HWBA 4L4VB 2VQ1A 5IW6A 1IAKB 5IJVA 3TIDA 3DUSB 1G7LA 4PJGA 5K93A 4KWUA 3D9AH 4J3WA 2E8YA 1Z9MA 1IGML 4H1LB 5EULV 4J3VA 1NCWL 1MCNA 4FQCH 4JFFB 5IESH 1M7IA 2CUMA 4I2XB 3MV01 4OZFB 5DHVB 5E9DB 1JZ4A 1OT2A 2BNQA 1K2DA 3C8KB 2NY2B 4LBEB 5EB9A 5I74B 1OP9A 5IQ7L 1I1AB 1VGEL 3GO1H 1AIFA 1DBAH 1P4IL 3D3VB 4J3SA 1WFOA 3G9AB 3I6KB 2JE8A 2E6PA 2AJSL 4HKJA 2P7TA 2VDRL 3HE7D 2BFVL 5D6CA 1DDHA 1ULVA 4RQQB 3GO1L 1OL0A 1P7KB 1FZOB 1ZT4B 3OKDB 1DBAL 4N5UA 1OAYL 5GGTL 2NZ9C 4PRAA 3QEHB 4XHQA 5DC0A 1WJ3A 5FEBA 2PYEB 4HCRH 1HILB 3BPOC 1DSFH 5D1QA 1FSKC 3CXHJ 4KU1A 3RVXC 2NY1C 3PWPA 1EAJA 4MLIA 4I3RH 3QNZB 1ZGLM 1P4LB 1RUPL 1A4KA 1EVUA 5E56A 5IM7B 5EU4A 1J1XL 2G2RA 1JF1B 4LCWD 3FOLB 5F89A 5L8LB 3REWB 4BUGA 2A6KB 4H1LG 3QFJB 4M43L 3MYZA 4LSQH 1HINH 4F7CB 4JPWH 4GKNB 4S1RL 2ATKB 2D7QA 4PJDE 1MI5A 4WWKD 4QHUA 4RMUA 5E94A 4KDTC 2QQLH 4QOKD 4LAJH 1U3HB 4HF5H 1S7SA 4DKAA 5JOFA 3CZJA 3EO0A 1CXFA 1S8DA 2CIIB 3MV7E 3MSPA 3NCJH 1BVKB 4JR9L 5FO8A 1TNMA 5ADPL 5DMKA 3VI4F 4LL9A 1T7ZA 2M26A 1GGCH 3B3IA 4GFTB 5D2LE 1W8NA 1JGLL 2VXUL 4IRSA 1U8QB 2P5EB 2VDQL 3KPLB 3P11H 2EKSB 4N8VB 3R4DA 4NN6C 1A22B 4PJAF 1FSKB 3FQRB 2JKXA 5I19H 1GGCL 2NY1B 1AQDB 3PHOB 3DLQR 4L3CB 1NEUA 1CLCA 1HI6A 4Z6AT 3LPGA 4UIMA 3ARBB 5C09A 3T0DA 5JW4R 4PJCB 4GBXA 4YAQB 1P84K 5TDPB 5CJXC 4ZS7H 2ZOKA 1D5MB 3K8LA 2IJ0C 1DBJH 1QOKA 4KH2A 5D5ME 1S7UB 1AGBA 3RUGF 3WLBB 5JHDB 2I24N 3CK0L 3V0AC 1O5DT 1K3ZA 3SY0B 5T5NG 3O2WL 1FFNA 4MD4B 3HE6D 1U91B 4MAYC 3FQUA 4HJGA 4NC0B 3RWEB 2WW8A 2VDNH 3CU7A 3SDXB 5F8QC 1UH2A 4LHUB 3FJTA 5T1DH 3RVTD 1TVHB 1K4CA 4EI5D 3V5HB 3P4OA 1ZT1A 1GPOL 4NHCL 4E0RB 5L9DH 3ARGC 4AK1A 2AK4B 2GAZA 3IDXH 4ODXA 4XVUC 5IB3B 3QQ4B 1W0VA 5T1DL 3EDDA 4R96A 4RWYL 1FVDB 1E0OB 1ZTXH 3RWFA 4G7VH 1ES0A 4FQIL 5IHUH 4RAUB 4GKSA 4Q9BA 4ZS6C 5AAMA 3IDXL 4XCNA 1CDJA 3SDDC 1H15B 1HNFA 1AGDB 1U8PB 3QDMA 1ZTXL 4YGVB 3QHFH 4G7VL 4NQXA 1X5KA 5J11C 1INDH 4N8VG 3LS4H 5D8JH 3FAWA 3DVNB 4NN6B 3BOVA 2XZAH 3LRHA 1FVEA 2FJHA 1KJVB 1WICA 1JF5A 5EU5B 4TPRH 1FNGB 4JHBA 3MA9L 1C08A 3G5VB 4MA1B 3CC5A 4BKLB 1INDL 4QCIB 2YMXH 1VGKB 4HMEA 4XP9L 1GVIA 2XZAL 4NWUH 3VA2C 3O41B 2YD5A 4KTEH 3BWAA 3TO4A 4TPRL 4X0KA 4RMSA 3Q3GA 2A6DB 4XMKH 2VLRB 5IB1B 2YMXL 4UBDD 5LGJA 3T1WA 4OIIH 4WI9A 2OP4L 1KJ2L 2ZJSL 1AKJA 2EDNA 4V1DD 1X5HA 4KTEL 4OF6A 4PRPD 5GGSY 1U8IB 4FFZL 1DQQA 1F90H 4YFEA 4U7MA 2EC9T 3MRLB 3QQ3A 3WD5H 5IMKA 3TP4A 3E2HC 4I18A 3C6LD 3IT8D 1IGIL 3OF6D 4QRPA 4J3TA 1WBYA 3P4MA 1Z0NA 5SX5H 3WD5L 4NC1C 3TO2B 2IBBA 3ARGB 4ODTL 3HG1B 4EOWH 1AD9A 2NPLX 3FB8B 1F2XK 3OKOA 3U0WH 2ENSA 5JTWA 1I7UB 3AUVA 1JWUA 3WXWH 3OAYH 4NQEB 3KDMA 2W60A 3SDDB 5LBSH 3UTTA 5DT1H 1OTTC 1TIUA 4EBQH 5JA8B 2IFFL 5J11B 4OZIB 1VFAB 3AAZB 5DURB 2WBWB 2ZCHH 4ODVL 5EUKB 1HHJB 5LBSL 4RSVA 1I1FA 4GLRH 4KHXH 1R24B 4EBQL 4M8VA 2ILLA 3FT3B 3TJHC 2HRPH 3PV7A 3EHBD 1E6JH 3ALXA 3N9GL 3WXVH 3NPSC 1EH9A 1OGAD 4YDKH 2YWYA 4MJ5B 1E4JA 3MRGB 1N0XH 4I1NB 1FL6A 1AC6A 1KFAH 4LSVH 4XWGH 3SCMD 3MRCB 5IEKA 3PWLB 3DX8B 2PTTA 1BOGB 1NGYA 1UYWH 2AV1A 4JFPB 1W72A 2G5BB 4KAQH 5C0BE 3UO1L 1FQ9C 1XR8A 1KFAL 5ANMB 4LSVL 4G5ZH 3VGBA 4XWGL 5IROA 1AR1D 4FZ8H 4PP1D 1NUDA 1UYWL 1U93A 4JGJA 3MLTA 2EYTA 1KIUA 1HEZA 2VTFA 3SPVA 4XB7A 3EYQD 5C9JA 3VDAA 4M48H 3AM8A 4LSSL 5KSAC 2IG2H 2UVFA 3EFDH 3QCVH 2BVYA 2Y07L 2NX5E 4FQQA 2CH8A 2JIXB 5DA0B 3G5XA 5KSBB 4CVZA 5HGDA 1JHLH 4YLQT 1P53A 2XQYG 3EFDL 12E8L 4U1SB 1CR9L 1M6OA 3QCVL 4X9GA 4PYHA 1R0AH 5CS7A 1S9XA 5TFSH 1Z9OA 5C2UB 5HY9B 1F4YL 4WY7L 1XF1A 4X6FA 4I48B 2VLKE 4OB5H 5AZEH 4K7PX 2OL3A 5J12C 2P43B 3VMOA 3L3DB 5CMAA 5GSVB 2PUQT 3O6FA 5AUMB 5E1AB 2CXKA 2I07A 4U6YA 4OB5L 5AZEL 4WNQA 3N85H 5DK3A 4Q9CA 4HKXB 2MWCA 3SDCA 5JOEA 3ZKNC 2VDLH 3EOBA 1C5DB 4PS4H 5IR1A 5DD1L 4OD1H 2VLJA 2AKRB 1MLCA 1I7ZB 3N85L 2XWTB 3PQYB 2HMIC 1D6VH 3DX9A 5CP3A 5C0AE 1MAMH 3B8YA 3C09C 1EEZA 2VDLL 4U1NA 3RY4A 3MREA 1T3FA 5M7QA 2IAMC 5J6HA 3RDTD 4OZ4A 1J1OH 1D6VL 1IGJB 1MWAL 1YNKH 3QIUC 1MAML 3UJTH 5BJTA 2R2HA 4DVBB 1J11A 2BOCA 3CDGB 1J0HA 4X5WA 1EEYA 3S34L 4KXZI 5KSAB 1YEJH 4UOW0 4BZ2H 3MRFA 1UCTA 5C07E 1J1OL 1WAAE 3BMVA 3ARSA 5FKAB 5HHXL 3MRHB 1AQKL 2D4FA 5FHBH 2V2WB 4Q6IC 3QPXH 5IVZB 1FIGH 2GFBA 3MXWH 1U8JA 4O9HH 3A0OA 2P24B 4Y1AA 4G43B 3ULUF 5JR1H 4PGDA 3IFOB 5FHBL 4OZHB 1T66D 5EU6E 4JVUA 3T2NL 5E1HB 5J12B 2KQNA 5TH2B 5DS8A 1DBKH 4O9HL 2XNAA 5D71H 4ODUA 1T21A 3UTSE 2CRMA 4WFFE 5F7HA 2R56H 4L4JA 5DC4B 1QKZH 3QUXD 5CIPA 4YFDB 4GKZB 4F8QA 2AEQL 5JHLH 1DBKL 3PG2A 3QISA 3S35X 1G1CA 2F5AH 1TENA 2XKSA 4HPOH 1S7XA 2QBWA 5D71L 5EOQH 5IV2B 5E08L 1TETH 3ISWA 2R56L 2Z31D 4KVNH 4GOSA 5DGRA 1QKZL 3KWWA 4ETQB 4QXTA 2GJ6B 2CO6B 2HTKC 3DARA 4BFGA 4HFUH 4HPOL 4P3DA 1Q9KB 3C09B 5EOQL 1TETL 1PGRB 3IETA 1L0QA 3H9ZA 4U0QB 3BJLA 1N6VA 4GAYA 2R69L 5F21B 3FFCA 3GSQA 4LLYA 3QUYB 2F54B 3QIUB 4JQIL 4XPHL 1FL5B 1XCTA 2DYPB 4JVPA 1ZV5A 1BBDL 1A6WH 4N0CD 3HMWH 5DJ6A 2G9HA 2OMNA 4XCYB 5IG7A 1DUZA 1QBAA 4Y4FD 3BEWA 3LH2H 3CX5J 4NBYB 3PHSA 4U1KA 4P3CH 4RX4A 3WS6A 3BQUD 5GIRA 1A6WL 4Q6IB 3H9SA 4R0LB 5JA9A 4GLRI 3I02A 4G9DB 4PUBH 4X98A 4AMKH 1QBLL 3HUJE 1B6DA 3MO1B 4GUPA 1FBIH 3WBDA 3WFZA 4QY8A 5J56B 4NSKB 2X4SA 4C83B 4PUBL 4K9EC 4AMKL 2C9AA 1FFQA 1QRND 1P9MC 1F11B 4D94A 3I6GA 2Q86B 3ZDZE 3MLSH 3ZT5A 4Y5VC 4BK4A 5E6YA 5JPNA 2FR4B 4NQDB 1F3DH 5ID1A 1FG2A 2V17H 3G04A 3H3PH 4HIEA 4UT9L 5FV1L 1NCNA 1T5WA 4KZEH 4JFFD 3RWJB 4AEIL 5E9DD 2QADC 3H3PL 2NY2D 3SKMA 2Y7QA 5D7LB 2XKNB 4HZAA 4Q9RL 4JO4H 1FYTA 5E4IA 4MJIA 1I1AD 2C1PA 2JELH 2GSGB 5INCB 1LE9A 1YNTB 3PDDA 3UZQA 4FFYL 4UINH 2ADGA 5C71A 4N8CL 3K3QA 1ERNA 1I9IL 4FG6D 2JELL 5J4MA 4EVNA 3L5JA 3RKPA 5HDBF 3LEXA 1KOAA 3BD4A 3BYTA 4R2GC 3SBWC 1RY7B 2DQUH 5E2VH 3NH7H 4OFDA 5ICXB 3MR9B 1G1YA 4TVPE 4YHNB 1GC1C 2LQRA 4RMWA 4QHMA 3LCYA 4LEOB 2DQUL 4Y8DC 4L3AA 4JKWA 5LKNA 1Q0XL 5TF1L 5JIIA 4HW6A 3DUSA 2JJUA 2BVEA 3RWIB 4L8SA 3DSFH 4OV5B 3VGGA 4H1LA 4XNUL 1JF6A 2FEDD 1VFBB 1HYRC 1KB5H 3QFJD 3L1OH 3F7YA 3WSQL 4F7MB 3I9GH 4MJ2A 4KJYB 2W9EH 3ILQD 2QADB 4OM0L 3C5JA 5D93C 1P2CA 2P8PB 2VR5A 3D3VA 5HD8D 1ZE3C 3I6KA 2W07A 3I9GL 2DM4A 3PWVB 5I1JH 2EYRB 2H32A 1F3JB 1WZKA 3L3KB 5CJOH 1U3HD 4RQQA 1PYWA 1P7KA 3NCMA 1FZOA 3H9YA 3OKDA 5F9OH 3WDHA 5C0CE 1N0LA 3MRNA 1AO7E 1JP5A 2YUVA 4Z7UB 3L3IB 4JFDB 3QEHA 2AXFB 5I1JL 3VWKD 2A9NH 3ARFC 1PBYA 4LAQH 4A6YB 5DZNA 1L9MA 2R0ZH 4PJ7B 4RZCB 2BSSB 5DRZB 4ODSH 2P5ED 3T77B 1PG7X 2IPKB 4WW1B 4R2GB 15C8L 5L2JA 5FO7B 1CLYH 5I71C 1F58L 1SJXA 3VMPA 2D7OA 3QNZA 2EDTA 3DGGB 3MJ7B 3ULUE 5IM7A 4G42B 2HJKB 3DXAB 5FM5O 3G5YB 4HIJB 4JKKA 3ARBD 1JF1A 1UKQA 3FOLA 3JV5A 3LD8B 4HFWB 3W9DA 3NCYP 1JUFA 5A2FA 5CSGA 3T08A 3U30C 2A6KA 1IJ9A 3BUTA 1YEIL 4XGZB 3H7BA 4F7CA 1FNEB 1C12B 3I6LE 1ZLSL 4GKNA 2ATKA 2FX8H 5ITFA 1R5VB 3X11B 5IMOB 4DUXA 4LHUD 4DK3A 4E5XB 1JGVL 5D93B 1WV7T 2AI0H 2HRLA 3PUCA 1G6RA 2C3WA 3KS0H 2VUOA 2VLME 1TZGL 3NPZB 2CIIA 4ZOBA 1YC8A 1BVKA 2GTZA 2AI0L 2YPLE 4Z7VF 1CE6B 4NOFA 2MSPA 4XAKD 4LVHC 3KR3H 2SEBB 1U8QA 1ZHBA 3ARFB 5KVDL 2NLJB 4K94C 4N8VA 5D7JD 5C0CB 1WK0A 2XIDA 5FYLH 4DW2H 4P2CG 3LEYH 1AQDA 6FABH 3KR3L 4I77L 4KPHL 4NNXA 4U6VL 3UAJC 1QBBA 2I60H 1A7RL 2E8ZA 3BO8A 1OM3L 4PJCA 4YAQA 2JJWA 2J6EL 3H2WA 1OSPH 3PWUB 1U6AH 1D5MA 5LWYH 4PJHB 2HT3D 4DVRH 4KKBD 3MLWH 3WLBA 4K8RD 4WHDA 2Q3AA 4U1MA 2DQCL 4PRHB 2H8PB 2VLRD 3K1DA 4GAFB 3SY0A 1I3VA 3QEGH 1OSPL 4MD4A 1U6AL 1RZFL 5LWYL 1U91A 3DSNA 3RWEA 4OLYH 3VXPB 1MCOL 4ZMAT 4Y19B 3S88H 3V5HA 3EIFA 4XZUB 4E0RA 5HI5D 1JPSL 3AU1A 2AK4A 4OLYL 5F9AC 2AJUH 4KDTA 3DYOA 3DO7B 5C0EA 2UZIH 5FUCE 3M1BB 4PJDA 3GGWA 4OIAA 3X12B 2XV6B 1TJIH 1FVDA 3S88L 1KCUL 3HG1D 3ARWA 3EDJA 2OQJB 4MNGE 2Y6SD 2AJUL 1NMCB 1ZWIB 1SBBA 1AGDA 1U8PA 3E6HA 3MOAL 4YGVA 4LVHB 1D9KC 3MV9E 4P5TC 3VRLE 5DMYA 2UV3A 2J2ZA 5EO0B 1CGSL 1JN6A 3DVNA 4U1HB 5GS0C 1LEGA 3U36B 5EU5A 4ZUWB 1F4AA 1NFDF 1NCCH 4IRZL 2GHWB 3G5VA 4HSQA 3A67H 3WJJC 5BVPL 5BXFB 4X7DC 4QCIA 1MIMH 3QG7L 5BO1H 5HYQB 2PTVA 1OTSC 4R97C 4DZ8B 1SQ2N 4ZPTB 3OXSB 1JZ8A 1NCCL 4QF1B 5TDNB 5CJXA 4X8JB 2A6DA 3AVEA 3ZMRA 5IB1A 1MIML 1WT5C 3MBEA 4KKNA 5BO1L 4G8FB 1DVFD 5F7LB 3BDXA 1R3LB 1VERA 3OV6A 4I3SH 3BT2H 5CJBA 4MS8C 5D5MA 3R06A 4KI5D 3MRLA 4RA0C 3N1PC 1X7QA 1ZHKA 2GITB 4MAYA 5F7YC 3MUZ1 3FO1B 5IFJB 5JLZB 3SO3B 3NZHH 4XNMB 5JORB 5D7IF 5TDOA 2I26N 1KV3A 4I3SL 3BT2L 3MLVL 2YEZB 4XP6H 2WLZA 2JJSC 4JRWA 3TO2A 1IT9H 3CDYA 4JPIB 4MXWH 3B9EA 1UFUA 3H8NA 4AYFA 1ITBB 1F4WL 1MJ7H 3N06B 1I7UA 3I2CL 3ESUF 3WFCH 4FA8A 1NGZA 4GKOA 4UT6H 3VXMD 1CT8B 1MFDL 5MP6H 4NQEA 2GT9B 2XRAH 3MROB 3H42L 3H7LA 3QO1B 2Z93B 3SDDA 1CG9B 3QNYA 4KK9C 1KTDB 4MCZA 5J06A 3IFPB 5AEAA 3WFCL 1D9KB 1PX4A 4P5TB 4UT6L 4WEUD 2WP3T 4OZIA 2MTPA 3QSKB 1J0KA 5BCAA 2XPGA 5MP6L 3SKJL 3EGSA 3STBA 2XRAL 1XIWD 3GJEB 5F1SA 4M5YH 2P4AB 5EUKA 1HHJA 3O2DA 1B88A 3X3GH 3WNKA 1BVLA 1TPXC 2DJSA 3UPCA 1OB1A 4OZGF 3G6JB 5CHNB 2Z4QA 1UVQB 3BKJL 2WBKA 3D0LB 5I8CB 4PYGA 4R97B 3TJHD 2BSRB 4MJ5A 2VDOL 2RIKA 2X40A 2A0LC 5EIVA 3U46B 3U9PH 5BOZG 1RUQL 3DRQA 4CJ0A 3TV3L 3MRCA 3JZ7A 3SDAD 3NA4A 2ZZUT 4RFOH 5EZOH 2H2PD 3OAUH 3P30H 1KENH 1U42A 4J8RA 4UDTB 3PQYD 1RK1B 3LKPB 3SE3C 5D1XD 2D9QB 1B3JA 3O9WC 3P30L 2UWEF 2VRAA 4FQHA 2KZ1B 3IRZA 3O8XD 1MCCA 3DV6A 1N5AB 4Z7NE 5I16A 1ZLVH 3W9EA 2Y5TA 5INDA 1SYSA 2JB6B 2JIXA 3NIDE 3ARTA 5KSBA 4GRWH 5DD3L 5K59F 1YECL 4NKDB 3Q5OA 3KYNB 3JTSA 2IH3A 1EO8H 3VXNB 1FH5H 5HY9A 2R2CA 4YJZL 4I48A 4PGEB 2XA8H 1TPXB 3L3DA 3PL6B 4K3HA 2ZUTA 5GSVA 1K4DB 2GEEA 4PRIE 4QWWD 5E1AA 2MCPL 2XA8L 5F9JA 2V5YA 5FCUH 3EOYG 3GRWL 1UGNA 3OAZH 4P2OB 2B8OT 5H2BB 1YJDC 4QT5A 5DXWA 3V6BR 4PJEB 5IMMB 1RHHB 2AKRA 1EEUA 1I7ZA 1WVZA 1CD1A 2CKBB 2XWTA 4LVNC 2J1KA 4Y88A 5KVGH 1MLBA 3VGFA 4ALAL 1MCJA 3FQNA 2WM0A 4YDIL 1OHQA 2F8OA 3OR6B 3EKCA 2AW2A 1ZT7B 1VFOA 1Y0LA 1JWSB 4LNVA 1GOGA 1IGJA 5BRZD 5HHOB 5HYJD 4JPVL 3QUYD 1YEEH 3EYFB 1F6AB 3B9KD 4ONGH 2DYPD 4NUGL 4WUUB 2XI9A 1KULA 5FKAA 4CMMA 4KC3B 4U3XA 2I27N 3OKMA 2HH0H 4KQ4H 2V2WA 2A74A 1MEXH 2CO7B 5IVZA 2NX5A 1UA6L 1EV2E 5EIIB 2P24A 2B2XH 3GSWB 3BW9B 3DMMA 1M7XA 5GZND 2HH0L 3IFOA 3C60B 4YK4C 4OZHA 3LHPL 4KRNA 4A2LA 1MEXL 2ZCKH 5IUSA 4HV8B 4HXAH 2NY7L 1NCBH 2VLKA 4TNWF 1G9NL 4ENEC 5GS2H 2J8OA 5D1QD 3TT1L 4OZFH 2Q87A 5DHVH 4HXAL 1A7PL 1NCBL 4AT6B 3GSXB 3BN9C 4GW4B 3IDNB 1ZMYA 4LLDB 3TPKA 4BH8B 5IV2A 3K0WA 4FQPA 5TQ2H 4LQ1A 1J8HB 5HGHB 4ETQA 3ZE2E 4YNYB 3DUUB 2GJ6A 4XH2B 1FV1B 3V7AG 5T5FH 1Q9KA 1IEAA 1ZVHA 4KK8C 4C58B 1A6VH 2IAMA 5TQ2L 4U1GC 5E7BA 4DEPC 4X6DB 7FABH 5F72S 4JHWL 2X7LA 2F54A 3QIUA 3HR5B 5T5FL 3DETC 4HKBA 1IAIH 1FL5A 1JI2A 2O5XH 1M05B 3CMOH 2GUOB 4X4ME 4XCYA 2VZTA 4HC1L 3EOAB 1FRGH 2EH8H 1IAIL 4X5XB 1SYVB 3L3OB 3SQOL 2O5XL 1XGPB 5DWUL 1SEBB 5JQ6L 1ZANH 4G9DA 3PWJB 4FABH 5KSVA 3NABH 3MO1A 2J12B 1YNLH 2BY3A 2JTDA 4OD2A 4HHAB 5JMOC 4YK4B 3NIGF 5I1KH 1G7IB 1I1CA 4NSKA 5DQDH 4F3FA 2VQUA 4C83A 3WKNA 4WFHD 2BHYA 4JY6A 3SGJA 1B0WA 1YNLL 3RPKA 4V2BA 5E0QA 4E42A 1JNNH 4BA8A 4DKDC 5I1KL 5DQDL 1PY4A 3V52H 2DMBA 4NQDA 1QSEE 4A2MA 3UTSA 1QFHA 1VDGA 2OZ4L 1DL7H 4F80A 1QNZH 1JNNL 4LHJB 4MZ2A 3V52L 4P9HL 4Y8AA 1YMHA 5I30H 4IS6A 3HZVB 3T8XB 5D7LA 1I3RB 2XKNA 5MEND 1QNZL 3F7QA 2CGRH 3BE1H 3BXNB 1MJUH 4U1GB 1MRFH 3WFEH 2O5ZH 3F58L 5KZCD 2EEDA 2ARWA 2AK1L 5CEZE 2GSGA 4J12A 5INCA 3BYYA 4KRPB 5I30L 3NA9L 3O4OC 1RZKC 3UX9B 2D03H 3MUGA 2RJMA 4P59H 2I9LA 2CGRL 4MGXA 2ORBH 3KPPB 5FYKH 3IAPA 4HUKB 5BW7C 1MRFL 4JZOB 3DECA 1F6LL 4EDXB 1JI1A 1AD0B 3HC4H 4JRXB 5BQ7A 4LRIC 2D03L 1KIPB 3P4NA 1NDMB 5CZKA 2RR3A 5FDYA 1FORL 2CKNA 3CU1A 2NNAB 1S9KC 2V5MA 1I85C 1YYMH 5ICXA 5HHQA 3QUKA 4YHNA 4C57C 4LLQB 1XAUA 4FQXB 1I3UA 1KIQB 5EUOB 4GG6B 1T7YA 5GGSB 4LEOA 1PLGH 2X5PA 5E8NB 1P9MA 2F53B 5DR5L 4N9GA 2BVOB 3RWIA 4OI8A 2NY3C 4D9LH 5SWQB 2VZOA 4Y5VA 3LRSB 4OV5A 1JPGA 1PLGL 4CN6A 5IOPA 4O2FB 4BZ1L 1HKFA 3V5KA 1U92B 3BHBA 3S9DB 2UY6A 2YPVH 4D9LL 1WQVT 5I1IH 3WUWB 1XF3B 4F7MA 4ORZC 1ED3B 5L8KB 1DLFL 1TQBC 4WFEE 1P6FA 1CFTA 4QXUH 4HWEL 2P8PA 1MHPH 4JJ5B 2CK2A 4WVRA 1YMME 3L3KA 1KLUB 1HQ4B 3IB4A 1D7FA 1IGTA 1WCBB 3MC0A 1VPOH 5BS0B 2L4OA 4Z7UA 3UTOA 2PYFB 2NTSP 4JFDA 2XXCB 5I8EB 3BUYB 4A6YA 5FUOH 4RZCA 2WUBH 2EC9U 2BXZA 2IPKA 2FLBT 3CD4A 3P73B 5FO7A 1I1RA 2PN5A 4CGTA 4APQC 4QKXB 5FUOL 1GSMA 3I3DA 3MLZH 3VD9A 3DGGA 3MLXL 3MBXH 4G42A 4O58H 2HJKA 3VH8A 1YEHL 3CFBA 4HIJA 4G6FB 5JOPE 3C5ZD 2IEPA 3UZVB 1QA9B 3ARYA 1DE4B 3MLZL 4M3KB 3QRGH 2BX5A 3VGDA 4HFWA 1FL3B 4K8RL 3MBXL 4O58L 2NY3B 1P1ZA 3LEVL 3ZE0E 3FN3A 2EC8A 4PRHD 5KG9B 4UQ2B 4MQXC 3L95B 1IZJA 2V5TA 4MA8L 3UTZA 5I1LB 1C12A 3FRUB 1P69B 4WU7A 3DJ9A 1R5VA 3X11A 3WUWG 4JO1H 1Y18B 5IMOA 4NM4H 4Y19D 4DKEH 1TQBB 4E5XA 3UTQB 2IPTL 4JN1H 1KYOK 2YR3A 3ARPA 4OFIA 3ARDD 4JO1L 3RL2A 4NM4L 1WITA 4P4RA 1HH9B 2Q8AL 3QWRD 4LCCB 1IC5L 2E7LC 5C8JB 3G5ZB 5EOCJ 3REVB 2BY0A 1WC7B 3CXDH 3ARFA 5IB2B 3O2DH 3B6SB 5C0CA 4