3LN9A

Crystal structure of the fibril-specific b10 antibody fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCTASGYTFSHRYHRWFRQAPGKEREIVAVISQSGMRTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAMYYCAAGTRKNVWTRQHPFDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin heavy chain antibody variable domain B10
publication title Amyloid Fibril Recognition with the Conformational B10 Antibody Fragment Depends on Electrostatic Interactions.
pubmed doi rcsb
source organism Camelidae
molecule tags Immune system
total genus 31
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2010-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ln9A00
1NDGA 2XQYK 2XKNA 4PJ7A 2NY2B 3P30L 3DO7B 2OR9L 3O9WA 1CTOA 4UIMB 2YD7A 5GGQL 5D2NC 2Y6SC 1FYTA 4ZUUA 3BP7A 4P2QB 5ACZA 1NUDA 4LEXL 1D9KD 2O5XL 3OAUL 2NX5E 4YDVA 3VXPB 1PYWA 5IVNA 1JHTB 1XCTB 1Z3GH 3G5VA 2H8PB 5GRJH 4P5MA 1H5BA 3W81A 2LVCA 4OZ4B 3N06B 5LXGH 3I6LE 5JOFB 3UDWA 3QG7L 4FQCL 2HG5B 4U1IB 5IVXB 3BWAB 4KUCD 2NTFB 4GAGH 5L7XH 5D2NA 1HSBA 4D0BA 3OR7B 2EC9T 3U83A 1IC4H 3PUCA 3WO4B 4KTEL 1UJ3C 3BDBA 4DGIL 5ADPH 4X6CF 2HMIC 5D6CA 4JO3L 5F96H 3F58L 2EYRB 2ITCA 1JF5A 3GI8H 3QA3B 4ZFZA 4UBDD 5E2TH 4B7LA 2A1WH 2MQ0A 1QRNB 3OKLB 3I84A 5DMYA 4K07A 4P46B 2KZ1B 4F9PC 3NFPB 4JRXD 1JN6B 3LAFA 3QEHB 1LP9A 4Y4HA 1A6TA 1CDGA 3B9AA 4L8SB 4M1GH 4M48L 5KVGH 4K3EL 2APWA 3PP4H 5TQ2L 5K9OB 3ZSTA 3OMZA 4J8RA 3AXLB 1Y0LA 1H8OA 2VN7A 1ZA3B 3C8DA 4MAUL 3ZKMC 5B4MC 8CGTA 4LVOC 4Y1AA 3NA9L 5C7XH 1GGUA 2C3GA 5GHWL 2AJSH 1RK0B 3O41A 3QUXC 4CW1A 1AGBA 5F8QC 4XC1L 1S5HA 1AH1A 4G9DA 4MXQD 5BVPL 4LHUD 1J0HA 1J1XL 3HZYA 1HOCA 5AWNL 1CWVA 3WXVL 4GFTB 4ODSL 3TIDB 4RGNC 1NDGB 2XKNB 4PJ7B 1EEZA 1FNEA 4DZBB 4PG2A 3T04D 5FYJL 3V6FA 1FYTB 3CD4A 4EI5D 5J13C 3V6ZA 1RURL 3EJZD 3GZKA 3QUXA 4LLDB 3QWRD 4Q97A 3L5XH 3S3PA 2HT2C 4GQPH 3NN8A 4ZFGL 3HI1A 1SM3L 4JG1H 4AL8H 2VLJA 4JFXA 1J5OL 5EUOA 4EUPA 4YFLF 1KT2A 1IAKA 3PWLA 1QZ1A 4YX2H 4HIHA 1GHFL 3FQNB 1H0DA 1HSBB 5D2NB 3PGFL 4HWUA 2Z0BA 3IXAB 3D48R 5CGMA 2W0LA 4LLUA 3WHXB 4H0IA 2IEPA 3ZTNH 3PJSA 1UM5H 3BZ4B 1P84K 1CE1H 4QY8B 4FQ2L 2A0LC 4C4KO 1K6QL 1LP9B 5LCVH 1U2CA 3OJDA 3VGFA 4M00A 4JPVL 1ETZB 3FRPA 5FHAH 1S5IH 4M7KH 1UJ3B 4F58L 1PG7X 3D2UA 4U7SA 5B39G 4L4VE 5E9DD 3RVTC 4Y4FC 4EN3A 4Y1AB 4M7LL 1HINL 5I19H 4G6JL 4CW1B 4PJAA 5CUSL 1AR1C 3N50A 4KRPD 2CLVA 3NH7L 2CJUH 1RUPH 1S5HB 1FAIL 4G9DB 5D70H 1D5XA 1YN6A 2JJTA 4KVCH 3QCVL 4ZAKD 2D7OA 3HZYB 4BZ2L 1ES0A 3MLWH 4UV7H 2BOBA 2Z8RA 3B6SA 3M8OH 1FNEB 1AY1H 4TTGA 3EYOA 4LVOB 2GIYA 3V6FB 2OR9H 2IC2A 1KLUB 1OAYL 2BSTB 3SKMB 1GCFA 1HH9A 5H35A 3QUXB 2YUVA 3GJEA 1QLRA 3K4ZA 4LEXH 2O5XH 4OQTL 3ULSA 1I4FA 5HHOD 3NN8B 1EHLH 3HI1B 2V2TB 2GEEA 4JFXB 5F9DC 2F8XC 1MJ7H 4JKPL 4XP9L 1I9IH 1KT2B 4XNUL 5IV2A 1WF5A 4RGNB 3VFVA 1A6UL 4LPXA 1I1AD 3JVGA 4NNYA 3QG7H 4M61A 4FQCH 1HXMA 1H0DB 3Q5OA 1EFXD 4WCYL 5T3ZD 3VWJA 3C6LA 4KTEH 5DGQA 4ZTOL 1H3XA 1TVDA 4N5EC 2J8OA 3CDGB 3PWPD 4X6CA 4POZD 4BFGA 3PJSB 3PXHA 4NM4L 2HTLD 4ONGL 5JW3H 3MA9L 5F93C 4LARH 5TPWL 4DKEL 2PW1A 4FABL 3M45A 3QXWA 1NKOA 5FAAA 5C2BH 3OJDB 3K0WA 2NR6C 4JPKL 4G9FA 3CVHA 4F37F 2NY3C 4K3EH 3VMPA 5EO1A 3BEVB 5CKGA 2B2XL 3IRZA 3MCLL 1Q72L 3DXAD 4I48B 5EU5A 3DX8A 4EN3B 1AKJD 1ORSA 1R3JA 2HKHL 4MAUH 1EUTA 2NW3B 1SJEB 3HAEA 3FZUD 5CJQH 5GHWH 5FM5O 2CLVB 1MCCA 2IFGA 3MOBL 4LSSH 3IU4H 4XC1H 1P4IL 3OTTA 5CP7B 5HDQL 1ES0B 5BVPH 2WIMA 1J1XH 1EA9C 1YEEL 3FO2B 2P8LA 4ERSH 2BOBB 3WXVH 4TSBH 5JOPD 3C5ZA 1AQKH 1FFQA 4ODSH 4Y4FB 3RAJL 2OL3A 3LMJL 3V6BR 3NIGF 1J18A 2VMFA 4MX7A 5FYJH 1HH9B 1T0PB 5H35B 5LJYH 3GJEB 3SCMA 3ARPA 1QLRB 4Z95L 1KELH 4LASL 3O45B 3IYLW 4OM1L 2IAMC 1U93B 4ZFGH 3BWUC 1SM3H 1ZOXA 1BZ7A 4D2NA 3TVMC 5IV2B 1FGNL 1T0MA 4E41A 4PV8A 4NNYB 2MKLC 3D0LB 4M61B 2H2PC 4PYGA 3SDAC 3SE9H 4DEPC 4FQXC 4GG6A 1NLBL 2CO6B 4MJ5A 5EA0L 4Z7WE 3FRUA 3KJ6H 2AK4D 3OAYK 3MRDB 5DVNA 3QDJA 4LP5A 2OZ4L 2H9GB 3EOAB 4X6CB 2APVA 1M71B 3B8YA 1BQSA 4I0PD 5JXAH 1CK0L 2R0LH 1DL7H 3TVMA 2PW1B 3OX8B 1X5XA 1CGWA 5D7SH 3E3QC 3T4AA 3CFJA 1OGAE 4YGAB 1FP5A 2CKBA 3WO3B 1ZHLB 2GFBA 3ARFA 3CVHB 1FJ1A 4ZPVA 1KCSH 3RNKB 5EO1B 3DSFL 5DD1L 3QCUL 4KH2A 5C3TA 5DF0A 5EU5B 1YEIL 2FIRT 1R3JB 2EIDA 5CEXA 4LOUD 4M7LH 3HAEB 3RWCB 1WSST 5CUSH 3UTSA 2B8OT 3NH7H 5JORB 5JMOC 2J6EH 3QCVH 2NY3B 3KYAA 3GSXB 4UAOC 4BZ2H 5DURD 4WFGD 1I1RA 3CFBA 2Z92A 1N3NA 4YO0B 1F3DH 2OL3B 4MX7B 2CXGA 4F9LA 5SX4H 1UQSB 5D1ZA 4OZHE 4DUVA 5E5MA 1NUNB 5DJ2A 4C59B 2FO1A 4OQTH 4M8QB 5D72H 1NSNL 1J7VR 1P5VA 1F2QA 2BK8A 2XOTA 1INDL 1BZ7B 3VGHA 1J8HD 1WBZA 3DI3B 4GXUM 4XP9H 4XNUH 2R0ZH 2VXVL 4L4JA 5BRZA 2Q1EA 4ODXA 4H8WC 3Q6FA 1D5MB 1MELA 4G6ML 1Q9KA 1P84J 4YXHH 1ITCA 3LKOB 1IGJA 3QDJB 3IKCB 4RAUA 2HFEB 5E2UL 5B3NA 3K7UA 2R1YA 1FVDA 3K4DA 4OIIL 2IAMB 3RVWD 3SN6N 4IMLA 2R2EA 4NM4H 3BW9A 3L3DB 4ONGH 5CAYB 3MA9H 3TVMB 4NN6C 4PRIE 4LPVA 5I0ZA 3T4AB 4DKEH 3HN3A 3CFJB 1U3ZA 3QUKA 4G7YH 4FABH 2X5PA 3SDAB 4M4RA 4DEPB 4DJMA 4FQXB 4PR5A 2D4DA 2GFBB 5MHSD 1FJ1B 2VITA 1NQBA 1HSAA 4PB9H 4Y8AA 3RPKA 3VH8G 5JO5A 4G43B 2B2XH 5SX5H 2VQTA 3MCLH 1Q72H 2J7LA 5E8OA 4U2YA 1JL8A 5E0QA 5TDNB 3HZKB 5CJXC 1U8KB 2ICWJ 3ELAT 3UTSB 2NY0B 4P99A 2IANA 1KYOK 3MOBH 1HXYB 4QHMA 4APQD 3GIZL 1FNSL 1P4IH 1U8MB 3WYRA 2JJSC 5HDQH 5TH2A 4C54A 1KG0A 3LPFA 4G8GE 3WE6A 1YEEH 4JGUA 2DQUL 1A6ZA 2EKSB 3UYOD 3AS1A 3RTQC 3ARUA 1CR9L 1CGSH 1IC7H 1X6NA 3DJ9A 4N9GA 3LMJH 4QOKB 4Y2DD 1I9RL 4LSQH 3Q5TA 5D1ZB 1PX3A 5E5MB 1N6UA 4Z95H 4WWKC 4S0SD 3WFEH 2JJSA 1C1EH 4UAOB 3IKKA 5DI8B 4HJGA 3D0VA 4WEMB 3PQYE 1WEJL 3T09A 3V7AE 3RTQA 1RZJC 1QO3A 1S9YA 4HPYH 1YDPB 1CE6A 3Q6FB 1Q9KB 3UTOA 5EA0H 5C86A 2YD6A 3U7WH 3QUMA 5JNYA 1T7VA 5HYJE 2OZ4H 5FHBL 5F7NC 2DYPA 2R2EB 1BJ1H 3BW9B 3DHJA 4FRWA 2WUBH 2UY7A 1M7DB 3QUKB 2JK5B 1G7PA 1WZ1L 4X4ME 2JB6A 4LP4A 3N9GH 5DA0B 2BVTA 1ZVSA 5JHDD 2VITB 5LWYL 4FNLL 1NEZG 4H88L 3KPPB 5IIEA 4LSPL 4NO2A 3S36X 5JO5B 5J7CC 1F5WA 4NDMA 3QRGL 4D0CA 4NJ9L 4PJHE 1JNNL 3DUHA 4P2RA 5E8OB 1YEIH 3WKMH 3O6KH 7FABL 2DB8A 1AR2A 5DSCA 3V2AR 1XIWA 4M03A 5DEGA 1QR1B 4O2CA 2IANB 2DM3A 2F53D 3FO9A 3PWUB 3NBNA 4RDQG 5TH2B 5BOPA 3EOBA 1KG0B 3E2HC 2OK0H 3UO1L 3WE6B 2GK2A 3CH1A 5IBLC 1A6ZB 2OMBA 1A0QH 4RZCB 1EHNA 4LVHC 3KGRA 1T20A 4GBXA 4I4WA 5DQ9A 3KLAB 5D6DA 5J89A 3BPLC 1AE6L 2NX5A 5GGSB 1QTYT 5T1LB 3ZKXC 1VGEL 3DVGB 5I1LA 3FJTA 3OL2A 3QNXB 1YEDB 4NZUH 5EO9A 3QEUA 3QFJE 1BQUA 5HGDB 3MRQB 5HHXL 2VZ3A 2AERT 3OHXA 3V8OA 3D0VB 5D5ME 3DIFA 3C8KA 3PL6D 4MQTB 1HYRC 1P5UA 3BJ91 5C2UB 1I8LC 3RTQB 1YNTB 1S9YB 2A6KA 3MLUL 2DRUA 3GSRA 4R9HA 1FZKB 2DL9A 4XCEB 3LQAC 2KBGA 5ICZA 4H26A 2LAGB 5JNYB 2R9HC 4WRLA 4WWKB 4JRXE 5E2UH 3ZHDA 4PJGE 4OIIH 5EORH 1BREA 4W70A 1TTUA 3F7QA 3GRWH 1EEQA 1VFUA 2EC8A 4RMVA 4XCCL 2F15A 5CHNA 3VDCA 1G7PB 3SKUD 4BJLA 4XMLH 4M62L 2EDBA 4WTWA 1F42A 3VFTA 3PNWA 4PJIE 5GISL 3DV6B 1JNJA 4ODBD 3TYFA 5HXMA 4TSAH 1IM9B 3CFDA 3UYPA 3FFDA 3BKML 1UM4H 4BZYA 4D0DA 2VDRL 3ARWA 5I73C 1S78D 2Y25A 3VFSA 2Y06L 5DEGB 4H1LB 4O2CB 4NZRL 4V1DD 3ZHLA 1OWRM 2EEAA 1Z6JT 3FMGH 4Y16A 1BD2E 3FO9B 1FZOA 1AXIB 3EOBB 3GIZH 2FHBA 3CMGA 4AIXA 4GJTB 1RZKC 1U95A 3CH1B 3QNZB 4LIQL 4U1NA 3OSKA 3BQUD 5E2WL 3QUYA 5A2LH 1LO5A 2N56A 3IFOA 4I2XE 4G80A 4A6YL 4U6VL 1T20B 4GBXB 4I4WB 1CR9H 2GUOA 4ZTPL 4N0CD 3GKWH 5EOTA 3W9EB 1A6VL 1UH2A 5J3HC 3W9DB 5T1DL 2W0KA 5EO9B 2EXYC 4EOWL 4KKLC 3G08B 4M93C 1MFDL 2IH3B 3U0PA 5I76A 4HK3N 3OHXB 5JR1L 2X9XA 3GNML 3C8KB 1IC5L 2E6JA 1OP9A 4EXPX 4LVHB 2X42A 1WEJH 4IMKA 4KHTH 4HGMA 3GSRB 4JGMA 2X4OB 3DOSA 2AGJL 3BPLB 2UZIL 1DEEA 2MWCA 4LSVL 1EBAA 4FG6D 5ICZB 4LU5L 3ZKXB 1CXHA 4H26B 5FF6B 5A2FA 2FL5B 1I8MB 4WUUD 3GMMA 1F4AA 3HC3L 2F54D 1U8HB 2CRYA 3UBXG 3QAZC 4HQQH 3MMEA 2N1KA 2C3WA 2VH5L 4FQQB 3I6GA 3GBML 4MQXD 2NY1B 2DQJH 5BO1H 5E9DE 1JTPA 5GQBA 3VFTB 1WZ1H 5DHYA 3B83A 3AREC 3PNWB 3SBWC 1MCPL 4M02A 1CGYA 2NLJA 1BPVA 1YNLL 4H88H 4L4VA 1F6AA 2ZCHL 3TYFB 4LSPH 4LKXB 2HFFB 3QRGH 1EGJA 1JNNH 1MCOL 2FLRT 3FFDB 3O3EA 2EO1A 7FABH 1XR8B 1XF4B 5GXBB 3RHWK 1X5JA 2H41A 4NOFA 5F3BA 3S7GA 2VC2H 4OF3A 1RJYB 4Y16B 3CSPA 3EDKA 2V2WB 4JO4L 4U1NB 3UO1H 2WP3O 5I1KL 5F7WC 1NBQA 1YMHB 3CFCL 3P11L 1LO5B 4PJBE 3IFOB 3REWA 3CLFH 4OIAA 5HHOE 5I73B 5EOTB 5C6WH 4HG4K 5GS0L 4QWWC 3S96A 1VGEH 3X13B 4Y0GA 4ZSOA 1QVOA 2AW2A 5I76B 3QI9D 3DUUA 3D3VE 4JRYD 3WUWA 5ESQB 1OF2B 2YPKB 1GAFL 3P9LA 1WBXA 5HHXH 4NRXA 5T3ZE 1RU9L 4X98A 1BWWA 3UMTA 5B3JE 3FFCD 2R4SH 5DD0H 1DEEB 4FQIH 5FO8B 1ZS8A 2PTVA 3ULUL 1PVHA 3VGDA 3CXDL 1C16A 4R4NC 4M93B 1CS6A 4P2YA 5D7JA 2CK0H 4R2GD 4L5FH 3DTXA 4ELMF 2OS7A 3WD5L 4L4TB 2V2XA 4RWHA 3SDYL 3I6GB 4O2FA 3MRIA 5CJ8A 3C08L 3OAZH 4GW5A 1BOYA 1NCWH 5KSAD 4LRNH 4OLWH 3BP4A 2NLJB 3MV7D 4ORGB 3U46B 4H25A 4YHOH 3EDJA 3IJHA 1F6AB 4PJEE 5EPMA 3O3EB 4YPGB 3CX5K 4YZFF 1F4WL 1KPVA 2VDRH 3EW3B 3QAZB 3MNWA 2QHRH 1FG2A 4NZRH 5C0AE 5F3BB 2FH8A 1DTUA 5I8EB 1BBDL 4XNYH 3AREB 4ZUSA 2YC1B 3ULUE 4NSKA 4R8WL 4LLQA 2HJLA 1MRCL 2VYRE 3F7VA 1KPUB 4LIQH 5FV2A 4BK5A 3ESUF 1PEZA 3MJ9A 4FP8L 3REWB 4KZDL 5E2WH 2MSPA 1YYMH 1UXWB 3FOMA 4U6VH 1A4JB 5D1QC 4IRSD 2IBZX 1A6VH 4FA8A 2X1XR 2PCPA 1AGFB 1G7QB 5C1MB 5FB8A 2HT4C 3GBLA 4LQFH 4ZSOB 1GZQB 4OQ1A 2CR3A 4KMTH 4EOWH 2D7QA 2QQNL 1CDUA 2RIKA 3RVXD 3NAAL 2CDEB 4P4KA 5FCUH 1WBXB 4KKCD 4KK5C 5KN5B 5JR1H 3ARBC 3FB5B 3GNMH 4X98B 2AK4E 5I9QC 3BP6A 4H8WL 3CVHH 4PYHA 4Z7WA 3KPQB 4J6RL 1NFIA 2UZIH 4LSVH 1C16B 3UPRB 2VZTA 2IMNA 5T1MA 4L3CB 4LU5H 5IUSA 3W0WD 1MJJA 1FNLA 2XPGA 5C0CB 4J4PC 3HC3H 2R2BA 1FZJA 3NFNA 1E4XI 5KG9A 2V2XB 1OGAA 4O2FB 3MRIB 2B4CC 4NO5A 5D9SA 4URTB 5KTEL 3GBMH 2AQ2A 2NY6B 4O2EA 5I17A 4PJHF 5DJCB 5C0JB 2AP2A 3RP1A 4H25B 2ICWA 1MCSA 3O4LD 2W65A 4XX1E 1YNLH 2ZCHH 5EPMB 2OL3H 1E4WL 1Q9WA 1MCOH 5HD8D 2PR4H 1UKSA 4NGHL 1PG7W 1JYVA 3EO0A 5C0BD 2RFXB 5FYKL 4RA3A 5K9JL 1G1CA 2X4PA 4ZUSB 4XAWL 4IS6A 4UUJA 4UMGA 4F57H 4LLQB 4PJ5D 4JO4H 3F7VB 2DKUA 5IEKA 1QOKA 2QKIB 3FOMB 1V8HA 2DJUA 5DK2A 3BIAX 1I9JL 4I77L 2EE9A 1KENL 1CVRA 4MVBD 4S10A 2MQCA 4OZHA 43C9A 2Q8AL 5FUCC 3TIEA 1UZ8A 4KUCF 3HE6C 4YBHA 5T5FH 5FB8B 3EFFB 4HMDA 3F7RA 4NWTL 5D5MF 3VGAB 1TLKA 1IAII 1PKQB 5T5NG 3PHOB 1GAFH 1PZ5B 2XQYG 4Z78A 5DFWH 1X5HA 1RZJL 1WWBX 4OGAC 4KJYB 1SBSL 3NA4A 4Q6IC 2FRGP 1DN0A 1NCDH 5IW1B 4PJGF 5SWZB 5FYKE 2HKFL 3W2DL 4WVRA 5CSZA 3T0DA 1MJJB 3DARA 2XPGB 4X7FC 5HI3C 5ISZB 4PB0L 1P6AB 1MEXL 4RMUA 4PRIA 1JZ8A 4IRJC 5KG9B 1DUYB 3LSOB 4POUB 3ARBB 2C1OB 4NO5B 4K7PX 4PJIF 3JV0A 4R0LC 5I9QB 2FR4A 4O2EB 5I17B 2YD2A 2VDMH 5I16B 2ICWB 5GSRA 1QSEE 1LO3L 2HLFD 3MJ7A 4ODTL 1A8JH 3LEVL 4OFYD 4M1DL 1Q9WB 1MOEA 3JWDC 1QFOA 2A6IA 1G6RA 1UVQB 2LABA 1R3HB 3EO0B 4LLAA 5DLML 4R0LA 4WTZG 1HYSC 2X4PB 5IROC 3CLEL 5BJTB 4TPRL 4IS6B 1BBDH 2XZAL 4G8GA 4WFHD 5IJKA 4ZS7L 1KB5L 2AEPH 3QQ9C 5KJRL 1BZQK 1UZ6F 1DANU 2V7HB 1A14H 4HG4J 1X5ZA 2A74A 1U8OA 5DK2B 1LEGB 1ACYL 5TE4L 1IBGH 2HT3D 2X4UA 4PLJC 3DMMD 2AJYL 3TIEB 1RZGB 2CUHA 2J88L 1UZ8B 2OTUB 2FLBT 1VFMA 1OTSD 4PRBA 1TNMA 1DQML 2HA1A 1M6OA 4IOSD 1ZHNA 2QQNH 4FQHA 3PQYA 4ONFH 3GSUA 4U2ZA 3MLRL 4JKLA 2XNAA 4H8WH 1XGPB 3KPLB 5DFVC 3LQAL 4FZEL 5BXFA 1DSFL 5HYJA 3HE6B 4C56D 5DJAA 5EZJA 1LVEA 1UXSA 4LAQH 3MLYH 3BVNA 1FFPA 5EUKA 3MRPA 4HSQA 3J8F7 4C4KT 1W0YT 5FA3A 4X4MA 4ELMB 3H42H 5KTEH 4GKZA 3U30B 1R5WA 4X9HA 2Y5TA 1PFCA 5J4MA 3LDBC 1N6VA 4OCYL 5MP6L 3U2SB 5C08D 1KIQA 2DIBA 5GSRB 3CX5J 3WEXA 4PJHA 1D9KC 1DJSA 5E7FA 3MJ7B 1NGXA 4OGYL 3PABA 4OJFL 4JCMA 2AJUL 1G6RB 4LCYA 3AM8C 1A6AA 4NBYB 3K2UL 5DJ0A 2B0SL 3U36B 5I8CB 4R0LB 1NCBL 4NKQB 3TNNA 4KZEL 4JHWH 2CQVA 4OTXL 4DQOH 2CUIA 2ENYA 4G8GB 1RZKL 3NPSC 1N7ML 4PJBF 4HEME 5HDOA 3MV8D 2W0PA 2PO6D 3RVUC 3ZYIA 4LSDA 1U8OB 4UBDC 3BESR 3IDNA 4ZYKA 1KENH 4OI9A 5E08L 3MA7A 1NGQL 3FQRB 3QFJA 2N4IA 1KV3A 3A6BH 3F12A 4PRBB 4EEEA 3VFUB 2BVUA 4JFED 5D5MA 4FQHB 5B3JF 4OUUB 4GRWH 4DVRL 3GSUB 1E28B 1DANT 2WIIA 2VOTA 2XN9D 3HG1B 2WNGA 4IIQC 4JO2L 4PGJA 1QLEH 5HYJB 5CSBA 5J1AA 4JRXA 5DJAB 2R8SL 1QSFB 4PJGA 3W2DH 1A2YB 4S1SL 2AXHA 2GT9A 5GGVL 1FFPB 1MJUH 5HHME 5JDSA 3CGTA 5GRYA 5IKCA 3MRPB 1HHKA 4H1LH 4H20L 5CP3H 2BNRB 4BM7A 2Z8SA 3CK0L 5T3XD 1F11A 3MXVH 1RUMH 3VXRE 1OP3K 2VXSH 4HH9B 2Y5TB 4PJIA 2SEBA 4PJEF 5J12C 1VFOA 4NQCE 4EI5C 3WEXB 3IS0X 4PJHB 2F5AL 3EJZC 3V9FA 3NIFE 2EDKA 1NGXB 1LO3H 2XWJB 5EFIA 3RBGA 4ODTH 1IT9L 3VDBA 5DJ0B 3FQTB 1N6QH 1T7YA 5DLMH 1P9MC 1A9BA 3G5XA 3CLEH 3BGFC 3LDBB 3TBWA 2XZAH 4W6YB 4YEFA 4R90H 5KJRH 1D9KB 3GHBL 3C5SA 4GG8A 4I2XA 4JDVA 3TH2T 1LEKA 3ARDD 3QULB 4QRSB 3AGVA 4F33B 5HYEA 2Y07L 4Z5RB 3IDNB 4M7ZC 1ACYH 4D9LL 4M6AA 5TE4H 4JKMA 4ZO6A 1MCDA 1NC2A 2J88H 5FK9A 5DUML 1ZA6A 1A7OH 3F12B 3V6OE 3NPSB 4ZUWB 2IH1A 5D5MB 4R6UA 3FTGA 3IDYC 4MCZB 1CF8H 3QIWA 2E9BA 2VXUH 4WGWB 5AAWA 2APTA 4M43L 3MLRH 2KL6A 4X7EC 1CI5A 3LQAH 2F54E 4FZEH 3E6HB 5GS3A 3DV4A 3VXTA 2PYED 1DSFH 4JRXB 4KRPC 4CVWA 4PJGB 1YC7A 3IFNL 3LH2H 2GT9B 4WFFD 4ZAKC 4KDWA 4AT6A 1PDKA 2FX8L 3RHWF 1HHKB 2ICEA 1JYXA 3WIFA 4PRHD 2XWBA 1F11B 1UWGH 1GGCL 3N0PB 3B9DA 1CU4L 2VXQL 3FAWA 4QCIA 4A6YA 5E9DA 3D85A 1R3IL 3RUGB 4JHAL 4B50A 4PJIB 4IIQB 1BZ9A 4OCYH 1CLOL 2HTKD 5BW7A 4UTAH 3RL2A 2ICES 3N1GC 1PY9A 3LS5L 2DKSA 3TBSA 4LHUB 3PWJB 3WN5A 2AJUH 1J0IA 3MLVL 4YHPB 2B0SH 2RAMA 3STBA 4CN6A 2Y4SA 3RWEB 3O0RH 1I1AC 1SMOA 1V3KA 3TBWB 3QO1A 2ZNWA 5J12B 1JZ2A 1U8IB 1IARB 1ZLSL 1FDLL 1RZKH 4TN9A 4EI5B 3H0TA 3EHBD 3RIFK 4PJBA 4I2XB 3TBVA 1EO8H 2R23A 2UWEE 4C58B 5HHOA 3BE1L 3TO2A 1VPOH 4POZC 4TTDD 5IBUG 4GMSH 2HTLC 2Q7YA 5E6IC 5LKNA 3NFSL 2J4WL 5E08H 1I1AA 3D3VA 3VXME 2IH1B 2D2OA 3AS3A 1P7KB 4OLZL 4NZJA 1ZGLM 4EDXA 1ZHKB 2FDBP 4HUXA 1HKFA 2DLHA 1U8QA 5JXED 1MRDH 5DTFA 2YUWA 2GJ6D 5TQ0L 4DVRH 1FORL 4HXBH 3HC4L 3MGAA 5J0BA 1RUKL 4FXKA 4RIRA 1I8KA 2V5SA 3D9AL 5ID0B 4M7ZB 5FUOH 2FJFB 3ILPB 3MPCA 3FZUC 3DV4B 3BSZH 4JO2H 1EGJH 5I1AA 3X3FL 4EJ1C 2X4TA 2BSED 4UDTA 5SWSD 5DEZA 2ICEB 2B4CL 3IDYB 1R0AL 3MV7E 5J8OA 4XPFH 4H20H 5HPMA 5KW9L 4LVNC 4D9QD 5E9DB 1CGVA 2QSCL 3KNBA 3L9RA 1T4KB 4K71C 1WIUA 3TH3T 2BVOB 1RQ5A 1W8OA 2HN7A 1BZ9B 1MJ8L 3WS6C 2ID5A 2IMMA 4UI2A 4PJEA 4KRPB 3GMRA 3T0EE 3RL2B 2UZXB 4XP4H 3P0YL 3TBSB 2EECA 3F7PC 3LIZH 4X5WA 1IT9H 1F4YL 3A67L 1N2RB 2WSKA 2A83A 4FQJH 5C0AA 4B5EA 3QDGD 2ICCA 3STLA 3N1MC 4L9LA 4JFPA 1ADQA 5E2VL 3CSGA 3H0TB 2XWTA 2B5IC 3L6FA 4PJBB 1LMKA 5HHOB 2VDKL 3R0MA 1PX4A 2V5YA 4UOW0 2JIXD 4KGLA 4I0PC 2Y07H 3ZDYE 1QBMH 3BDXA 4D9LH 2EICA 1LE9A 1IM3A 1I1AB 4F15B 4LCWD 1IKFL 2ZOKB 3GMLB 1OPGH 3BH9A 1HQRB 2DS4A 1BQHG 1EFXB 3GO1L 4HUXB 2AK4A 4X5LA 1U8QB 3C9NA 4RRPA 4JAMA 5DTFB 5L2KD 4HUVB 4ZQKA 1DLFH 1DUZA 2VLKE 1ZLUH 2OR8A 3PWPB 4JREC 4LHUG 4JFOB 4GW1B 1CQYA 3W0WE 4M43H 4CNIB 3CSBA 1WAAE 4YHMH 5EN2A 4F7MA 4YFLI 4TRPL 3ZHKA 2XTLA 5I1AB 2VLLB 4J3WA 4WFEE 4XMKH 2VUYA 4Y19D 4I3GA 3QQNA 2ZOLA 4LDEB 2YOCA 4PJ9C 3NZ8A 3IAPA 3TFKD 1VENA 5D1XC 2FX8H 4U6YA 5HPMB 3Q5YA 3OJMB 1YPZE 4KK9D 1T04B 3L9RB 2VXQH 4MJ4A 1TTFA 1FFRA 2HN7B 2DMKA 3WBDA 1R3IH 4JHAH 3TO4D 3NCYS 1S7WB 3U6RB 2QL1A 1KC5L 3ZE1F 5GGRY 1LEIA 1GJIA 4OT1H 4PJEB 5J11C 3VCLA 3GMRB 1CLOH 2R1XA 1QP1A 1UFUA 3MJ6A 3H3PH 3VFRB 5C0BE 5D71L 3MROB 1CG9A 1UWEH 2WQ8A 3LS5H 3MRNA 1T66C 2A83B 4HUKB 2JCCE 2VABB 4LVNB 4XB7A 3GSNB 4QKXB 1KN2L 4K71B 5KVDL 4G42A 4ELKA 4TQEH 2XRAH 3NGBC 2X09A 4NN5C 3S4SA 4JFPB 3SKJH 2B39A 4MJID 2CO7B 1ZLSH 1DBKL 2XWTB 1CIDA 4U3CA 1S9VB 2A9NL 3P0GB 2B1HL 1NFDE 3RWIA 1IJ9A 3BE1H 4LPYA 3X3GL 3EZJB 3RVWC 4XWOC 3SOBL 4ENEC 1P2CA 3P4OA 2A6JA 1PY4A 2JF1A 1A1OB 2VDPL 3MR9A 3NFSH 3PIQA 4R97C 2QQKH 3K2MC 2VDOL 3KYOA 3BH9B 1MCHA 1A6WL 1YQ2A 2B5IB 2AK4B 3AB0C 3C9NB 1DLHA 4P2OD 2AQ3A 1T03H 5IG7A 4LCUA 2G2RA 2R69H 2V6HA 1JV5A 1RUKH 1H3GA 5C9JA 4I0PB 1F4XL 3RZCD 5EIIB 3ZE2E 3ME0A 4JRWA 4BUHA 4AQOA 2M26A 4DAGL 4LCIL 3X3FH 1EO5A 4APQC 4WI7A 3NZ8B 2YR3A 1HNFA 5FECA 2B4CH 1R0AH 4XT1C 1B0RB 4P23C 2QSCH 3OGCB 3NIFF 2AK1L 2AEIT 2EE2A 3O9WD 4ZXBA 2CMRL 4FQLH 1NMAL 1QSEA 4BQ8A 2P43B 4Y2DC 3V0VB 3VCLB 1MCIA 2R1XB 1H8SA 1IEHA 2ZUXA 4JLRB 1DBJH 5DJDA 1CG9B 3G6DL 3MRNB 4U1MA 1BF8A 2FWOA 1PAMA 4KI1A 5DURB 3A67H 5HHPA 4OB5H 4LFHD 4EI6A 3N1FC 1YA5A 3MREB 2P48B 3S4SB 2I26N 4Y2DA 5E8PA 3ET9F 5E2VH 5J11B 2NW2A 2X7LB 1Q1JL 5FO7A 1ZGLP 5DHVB 1IEBA 3DURA 1DQLL 1UT9A 3ARXA 5I8KH 3MGOA 3T65A 1P2CB 5I8OH 4P3DB 2ZP0T 4LPCA 5HGGS 4IRZL 3PIQB 1IGCH 3LZFL 3X11B 4Y4HD 1N64L 3IF1A 4LBEB 3L7EB 3BX7C 4NN5B 4X5XA 4F7PA 3KYOB 5DJ8A 5DO2D 5AYUL 4NHCL 4DW2H 5ESAA 4JQXA 1DLHB 3GO1H 3FONB 1FH5L 4HUUA 3R8BB 3WNKA 1MCRA 1KJ2B 5C9JB 3L3OA 3OB8A 3F65A 2CGRH 1ZKAA 4PJCE 5EOQL 4G7VL 4R97B 5E1AB 3KAAA 1S7TA 5GJSL 5F1OB 5FECB 1T21A 3AB0B 2EDLA 5C08E 1OAXH 5DQJA 2R56L 2UYLB 5F9WB 3P4LA 4XAKE 1RHFA 4G6KH 3QEGL 1S9WA 3FQXA 5F7LB 1D5IH 5I74B 4KQ4H 3MJGX 4M6MH 3H6JA 3H9YA 5DJDB 3JWDH 4APQB 1WBYA 4QTIL 3LY6A 4U1MB 2VLJD 4XXDA 5CZVL 1V7MH 2FWOB 3BN3B 3ZL4H 5HHPB 5DJZA 3BUTA 4EI6B 1DZBA 4WHDA 3QB7C 5DZNA 3UYRL 1QACA 3PL6C 1QHOA 3MV8E 5SWQB 1HN1A 1WCQA 2UWEF 4Y2DB 5E8PB 3QUZD 2WP3T 3EFDH 2PUQT 5INCB 3C09C 1CFQB 3O8XA 2VB5A 5FO7B 1YEJH 2ZKHH 5I1EH 4QXGL 1IEBB 1YEKL 2XA3A 3DURB 2BOCA 4TUJB 1OAUL 4LF3B 5C09E 4Y4KC 3MRKA 2ATKA 2B1HH 5JIPA 1A22B 3MGOB 2ZSVB 1T7ZA 3RKPA 3SOBH 3O6LL 3MNZA 4MXWL 1RIVH 1HILA 2VDPH 5H2BA 3GSWB 3WUZA 1IKNC 1TXKA 4R7NA 3VWKC 4X5XB 5JOEA 1G6VK 3B43A 2J1KA 2IPTH 2MCG1 3VXOA 1FN4A 2VDOH 5ESAB 3D2UD 4NC1E 1CFVH 4Y8DC 1U92A 1N0XL 5DMGD 2DLIA 4HUUB 2OXHA 3L3KA 1FO0A 2YRPA 1OWWA 4MWFA 3L3OB 4X9IA 1S78C 4FZ8H 1KULA 3IDGA 4U1HB 2RHEA 5CEZD 3E8UL 4U33A 3ESVF 4DAGH 1S7TB 2Z8VC 4LCIH 5JHDB 5EC1A 4ALAH 4PD4K 5DRZA 3WXWL 1MREL 3PDGA 3VXRA 4PTUA 3BQUC 3RI5K 4YXLL 1BVLA 3QO0B 4NQCA 3EYQD 1UH4A 1WISA 2CMRH 3O3AA 3WNMA 1NMAH 3MACL 4N0CC 1S9WB 3FQXB 3GGWB 3BRGC 3MV9E 3OF6A 1KJVA 4RFEA 2F53B 5SX5K 1P7HL 1WTLA 1WBYB 1WJ3A 3U4EA 2GHWB 5DJZB 5KS9E 5CFHA 4U6XA 3BZFB 4TYUA 3ULVD 3BQUA 4DKAA 3EYSL 3A6CL 2LU4A 1AO7E 4H0HB 2IPKB 1LK3L 1OT2A 5ALCL 5JLZA 1NUGA 3R0NA 4NO3B 3VWJD 3C6LD 2ARJQ 4FG6C 1FPTH 4JJ5A 3FB6B 2BOCB 3QXAA 3ZDYF 5ID1B 5C0GA 3MRKB 3H8NA 3I50H 2H1PH 4XWGL 2XY1A 3MNZB 4P9HL 5KZCD 3PL6B 3V6OA 4R7NB 4IRZH 4MQXC 2AJXH 1P1ZB 3MLZL 1UYWL 4XNXL 4G9FD 3VXOB 2CD0A 1ROWA 3LEXA 3SE8H 1FC2D 1INEL 1GGBL 3C09B 5EU6E 5AYUH 5DMJB 1OTTD 1U92B 2FHFA 3O6FC 4P49A 1WAAF 4YAQA 2EH7H 4HS3A 3LKRA 1ZXQA 5IJVB 1FO0B 1FH5H 4PP1D 5CGYD 2F54A 4MWFB 1GPOH 5C0IA 4WFFE 5A2KH 3RY4A 2G9HA 2R2HB 1S7SA 5CZXD 5EOQH 4G7VH 4XP6L 2YKLL 1RFDL 5EC1B 1KTKE 4OCXL 5GJSH 3LRSA 3KPTA 1SEQL 5DMIH 5DRZB 4LGRB 3SGDH 4PTUB 1XH3B 1TITA 3C5ZD 1ZE3C 2DIJA 3EIFA 1BVLB 1BIHA 2R56H 4Y2OA 1I3VA 3CIQA 4XMPH 5IBTL 4E0RB 4N0YL 4QHLA 1WLHA 3SCMD 4U6HA 4KJWD 4ZNEE 5DMKB 4V1DB 1DN2A 4RFEB 5DD6B 3CXHK 2JCCF 1SEBB 3ARSA 3JBG7 4KY1L 4BQBA 3U4EB 2V17H 4QTIH 3QI9C 1HWGB 4JY4B 3QFDB 2CH8A 4O4YL 3UJTL 1KB9J 1IFHH 3SE4A 3BD5A 1BFVH 3BQUB 3V95A 4E41D 1YY8A 4EQ3A 4PBXA 4HXAL 1AP2B 4M6NL 1JNLL 3UYRH 2X4NA 4K3HA 1J10A 1KLGA 1T5WA 5I30L 4JFDE 1DE4A 4J1UA 1NFDF 5HYIA 2NY7H 3LB6D 2UWEA 1AD0A 3K81A 4U31A 3QXAB 1MWAB 3HZMA 4NFCA 5ESVB 4QXGH 5F7EH 5C0GB 1WFTA 3WMSA 3BN9D 5JQ6H 3QI9A 1OCWH 4R2GC 5MERB 4YHIB 1NGZA 3O6LH 3VXMA 5F1IA 4AEHH 1INQB 2P8MA 1K9TA 4ZOAA 2CK2A 3CJJA 4MYWB 2GJ6E 4C55A 3ARFD 3LEXB 5KSAC 35C8L 1CXKA 2RJMA 2ZJSL 1A7PH 3PDOB 4IM8A 4WUUB 4HS3B 3ZE2F 4A2MA 4ETYA 1N0XH 5LAXA 2F54B 3QIBA 2DDQH 4OLVL 2NY0D 4X4YB 3HNVH 4KTDL 4F7EB 3MTRA 3E8UH 4D9QE 2P44B 4PGEB 5L9DH 4BELD 3MV7A 3LRSB 4RWYH 4EDWL 1U2HA 3T2OA 3B2UD 4FXGA 4JZOA 4YFEA 4WI5A 2O26U 5C0RL 1JWSB 5IT2L 3M07A 4ZS6D 3WFCL 3DRQB 2FECL 2A6DA 1BGXL 5CD5D 1OHQA 4IRSC 1I7UB 3AU1B 5EULV 3T0EA 4U6HB 1KIRA 3MACH 3AAZB 3O2DL 4I13B 5D1ZD 3RY5A 2XXMB 3J7HA 1QYGH 1EXUA 1EIBA 1T6VN 3DSNA 3QDGE 5DRNB 3RVXC 4JJHA 2V9TA 1CD1A 1G9NC 2DLTA 4KKCC 5E5UB 5E00B 1YY8B 5BRZD 2X4NB 1RUAL 1RJLB 3VE0B 3FB8B 1URLA 3A6CH 1DE4B 4HX1B 4J1UB 4XZUB 5F7UA 5T3ZH 3FT2A 1AD0B 4ZFOB 5IESL 1E4KA 2H32H 1FV1A 2Q3ZA 4Z7UE 1HEZA 3LPWA 5JUEL 4OLXL 2UUDH 3QQ4A 2Z8WC 1KJ2L 3HNSL 3T2NL 4Q74A 3QI9B 1BF2A 4JRYB 3NVQA 1NGZB 4PV9B 4XWGH 1EMTL 1B2WL 1HZHL 1IGML 2BSSA 5L2KE 3FFCB 4QRUB 4NUJB 4UT9L 4XNXH 1QQDA 1YQVL 1NLDH 1MCKA 1INEH 2VLKA 2F8OA 2EH8H 5LAXB 3W0WA 3DVNB 3MO1B 1S3KL 4I18A 4PJCF 4Q9RL 1WAAA 3GFUA 4HS6B 3TN0C 4R2GB 1P4LA 2QSQA 1MCWM 4MA8L 1R3LA 1NAMB 3MBED 1N59B 4PD4J 4I3SL 4NQSB 1VA9A 4QGTA 3TJHD 1FRGL 5KSAB 1OAZH 4XP6H 3MV7B 2YKLH 3QWOA 4OCXH 1YPZA 1OB1A 1SEQH 3GSNH 5IWLC 4WI3A 3NACL 1ADQH 3G04A 4OLEA 3VFPA 4NPYB 4N0YH 2I07A 1KIRB 5KAQF 1PSKL 4DVBA 5C0BA 1EXUB 1JTOA 4PJFE 5TF0A 3AROA 4X7DC 2DN7A 4Y5YC 2AKRB 4JZJC 5EC2A 2JCCA 3LV3B 1CD1B 4MJIE 5KANG 3VXNA 5DJ6B 4HXAH 4O00A 4M6NH 2X89D 1JNLH 2Y5EA 4X6FA 3T3ME 2IJ0C 5H8DA 3VD5A 3V0AC 4IRSB 1DBBH 3FT2B 5I30H 3BKJL 1JGDA 3GB7A 3TCXA 4OBRA 5GGUA 1FV1B 2Q8BL 1TJIL 1NFDA 4OKVA 1HEZB 4HIEB 2E27L 2DYPD 4MXVE 4HKXB 1YEFL 3D87B 5CD3B 3IJYA 4LSTH 3KPRD 4GQ9L 5I1GL 1GIGL 5I75C 3MRRB 5HHNA 3BKYH 2BSRA 4QRQA 3B3IA 5DEFA 1KN4L 1QQDB 35C8H 1AGCA 2ADFL 2VLKB 3PWVB 5CIPA 2ZJSH 4MA7L 2HLFC 4P2RD 5CZKA 3W0WB 3NZHH 4S1QH 2ESVE 3VD3A 4I18B 1CVSC 2XYCA 5CMAA 3L5HA 12E8H 4LK4A 1XIWD 1AXSA 5FYLL 3S34H 2W0FA 3GSVB 1VFAA 1ERNA 1WT5C 5FDWB 4N5UA 1X44A 1S8DB 3ZKNC 5ICYA 5E6ZA 3O4LB 3QZWA 3SY0A 4EDWH 1OB1B 5I2IA 1MFEL 3TEUA 4DWHA 1UJTA 4JM2F 3VG0H 1XCQA 4LRIA 3LKNB 2B20A 3G04B 4C83A 4TULH 1B4JL 4ISVA 5C0RH 3CXHJ 3VFWA 5J06A 5KSBE 4FFVD 3S37L 5IT2H 3WFCH 2HT3C 2NX5D 4KUZH 1F3RB 3T8XA 2YEZA 5DS8A 3O6MH 5DHVH 3H7BA 5C0BB 3O2DH 5H94B 4BSJA 3FN0L 5KS9F 4Q7DA 1OTSC 4OCRL 3QQ3B 1DVFA 4W4OC 2JCCB 4PJ5B 1WVZA 2GITB 3JV5A 3I75A 1T83C 1QLFA 1RUAH 1K8DA 2DWEB 3WLWD 4NRYA 2WBWB 1JGDB 1NCNA 3DMMA 3GB7B 3HNTL 5C9KA 4FFYL 5GGUB 1SVCP 2MOVA 1NFDB 4OKVB 5IW6A 2DTML 3G5ZB 1MCJA 3HCVA 4Y5YB 4OLXH 2BVEA 1KJ2H 4MAYD 1QBLL 4X80H 2KQMA 4D8PA 1JJUA 1X5FA 2R0KH 4S0TD 3BD3A 4ETQA 1Z5LA 1XF3A 1B2WH 1TIUA 5EBWA 2PTUA 1UEYA 2BSRB 4QRQB 1IGMH 2Z91A 5DEFB 5DYOB 2NZ9D 3E6FB 4UT9H 1OW0C 1XMWA 2WWMD 5CIPB 4BSVB 5I66A 1BIIB 5CILH 5IM7A 2OP4L 5DUBB 5FKAA 25C8L 1IQDA 2OMNA 4F8TA 1S3KH 4Q9RH 1U3JA 1AXSB 3I85A 4PJCA 4PJXF 4GMTL 4YHZH 2W0FB 5I75B 3D69A 2DBLH 3GDBA 4I3SH 5IOPA 2VZSA 5C08A 5I2IB 4GS7C 1ORQA 3FOLB 3L1OL 3MCG1 4U1LA 3EO9L 5DC0A 1XCQB 4N8PA 2PO6C 1QKZH 3QUYD 2YRZA 2DI9A 5GGRB 3VG9C 4C83B 3ZSSA 4ISVB 4KK8C 3QXDA 2YEZB 3E0GA 3OPZL 4PLOB 5DS8B 1FG9C 2CDFB 4OF5A 3BAEH 5MEPB 1SBBA 4S2SA 1L4IA 3ARGD 1ZTXH 1WUNT 1NBZB 5B38B 2UVEA 1ZLVK 5I1CL 4G6AD 1Y6KR 2P4AB 3H9HB 3SDCD 1MAML 4GRLC 2CRIA 4KRMB 3MV8A 2VIRB 1QLFB 2PW2A 4UOW1 1K8DB 5JMRA 5DD5L 2CIIA 4X9GA 2XKSA 1FL5A 3DMMB 4XPHL 5E24E 4YEEA 4HBCL 2FB4L 3BKJH 4KU1A 1E6JL 3TGXA 5IW6B 2Q8BH 1TJIH 3S3SA 5I18H 3SGEH 4OFIA 1PLGL 1MRFL 5IMKB 5IGXL 1MLBB 1BFOA 1YEFH 2PKDA 1NAKL 1GIGH 1WICA 4JFYA 1V3JA 3MUZ1 3T0AA 2Z91B 4BZ1L 3DUSA 2XN9A 3TM6A 4HAGA 5MI0C 4Y5VC 1KN4H 1JPGA 4R4BB 4L4VD 4TVPE 4XBGB 2DQTH 1E4JA 5I66B 5IM7B 4C56B 5CEYA 5FKAB 4M5ZL 4U7KA 4P9ML 1IQDB 2O93L 5CEZE 4YDKL 2D31B 4MDJA 2DQHH 4PJCB 2APBA 1K8IB 5FYLH 2Z31A 2O5YL 4O9HL 5I1JL 1K5NA 2X6MA 1DQDH 2WV3A 5C08B 2X70B 3AS0A 5HHQB 2R0WH 3DO3A 4U1LB 1MCWW 2FX7H 1MFEH 4QYOA 3LN5A 5GRVK 1CDJA 1CGXA 3ARDC 2ITDB 4JM2A 2BNUA 3SE3C 1B4JH 1XGRA 1KNOB 5LGKA 1I85A 3QXDB 3MV9A 3S37H 3OKDA 4M9OA 5GIRA 1O0VA 3RWHB 1DCLA 4S2SB 5K33A 2FZ3A 1M1SA 5C0FB 4QHNA 5KS9A 4OCRH 2ZCLH 5C8JA 1W72A 3MV8B 1SYSA 1AO7A 3HUJB 1QA9A 4TNVK 2PW2B 4NKDB 2XTJD 2QLVB 4PJDE 4Z7UF 1MI5D 1VACA 2F5BL 3HKFA 1MF2L 3HNTH 3HFML 4X7SL 1FO0H 4WU7B 4AIZB 5D7JD 4JFEB 2VLME 1QBLH 2A2QT 2OJZL 3WFBL 4DFHA 1NCAH 3MRCA 5FGBA 2DF3A 1J8KA 1AGDA 4X0KB 1F97A 4I8DA 5DJXA 3WIIL 4JVWA 2XN9B 1JRHL 3O2WL 4JN1L 1VEOA 1O5DT 4YHNA 2PNDA 2F8VA 3DRTA 5EU6A 3MLSH 1MPAH 4HWBA 4EZMA 2GJZB 2IQ9L 3THMH 2FJHB 2HTKC 2I24N 4AH2A 2D9QB 4Q9CA 5B38G 2OP4H 4MDJB 3DX7A 3QCTH 4OFDA 4GMTH 4F37K 2MJWA 1AC0A 1RHHA 5BS0D 3TPUA 3G6AA 5DRXA 5MI0B 3KDMB 4Y5VB 1J0KA 5GRWA 5J9PA 1T5XA 1CLZH 2C3XA 3EHBC 3BPCA 4PPTA 4HGWA 1A9EA 3EO9H 4QYOB 3LN5B 4MNHB 5HI5D 4PJFF 1EUUA 3HMXA 1XGRB 5HHVL 4L9DA 5DWUL 4ZNEA 4RISL 4MNQD 5GIRB 5LGHH 3JWOL 4NUGL 1RUQL 1MWAH 3RPIB 4Q58C 2FZ3B 1EJOL 1MFAH 2JTDA 4QHNB 5KS9B 2CPCA 2WAHA 3O2VH 3SDDA 4JB9L 1NMBH 5I1CH 2EYTB 1K3IA 3T3MF 4P4KD 4CMMA 1J1OH 1W72B 1SYSB 5JXEC 4KC3B 1AJ7H 1QA9B 4JFDA 3ARDB 4YNYA 1CFNA 3HC0A 5EG6C 2WBJA 4XPTL 5DD5H 1BVZA 1CTNA 1JGEA 4TNWF 4XPHH 1HK6A 1WZLA 3P4NA 4MXVF 2FB4H 1MFCL 5CJOL 3HMWH 1EEYA 4PY7A 1FCCA 1A64A 5EZIL 4HZAA 1PLGH 5IK3A 3TJEL 1X5KA 5IGXH 4WNQA 1OGAD 3KHOA 3MRCB 2V9QA 3UTTD 2Q7NA 2GJ6A 5DJXB 1A5FL 3WS3A 4J3UA 4YHLL 4QRRD 3RGVD 1MY7A 3UPAA 5GZOD 2CLZB 4UT6L 3X12B 4JY5L 3IU3A 4JR9L 2E7BA 1OQXA 2PYEB 4AH2B 3TNMA 2EEDA 3MUJA 4M5ZH 3V0WL 5JW4Q 1Q9LA 3VXUE 2KQNA 4KDTC 4PRHB 3PV7A 1XR9A 4ODUA 4PJXB 1F45A 2O5YH 3IDIB 3GHEH 1MAJA 2VO5A 4O9HH 3TPUB 4WUKL 2ORBL 5DRXB 2X4RB 2VDNH 2BVQA 1U8PA 5J9PB 3TA3A 3BPCB 5KSBF 1AFVL 5MEOA 3GMOA 1CCZA 3GSOA 4MA1C 5GS2D 1LO4L 1J88A 3QPXH 1FLTX 1GC1C 5GRJL 5DK3A 3U9UA 1LK2A 2G75B 5CLWA 3EYFB 3QDGA 3DETD 4GAGL 4GRMA 3SPVA 5JW4N 5L7XL 4U1GC 3ROOB 1NGYB 1X5AA 4WI8A 5ADPL 1G9MC 4CMMB 5F96L 3RWDA 3JTSA 4S1RH 4XBEH 3GI8L 4CUCA 4YNYB 1CFNB 3HC0B 1ED3A 4K23L 1JGEB 4RGMC 4Z7UA 3P4NB 1L9MA 2F5BH 2RR3A 3GJFA 4Y88A 2A9ML 3T0BA 1EEYB 3REVA 1U91A 4M1GL 4X7SH 1T7XA 4K9EC 4Z7VE 2ZUUA 5IK3B 4PRID 5KVEH 1MHEA 4WNQB 4JQIH 3TFKC 1NAMH 4OM0L 3W11D 3KYNA 5ETUA 4CKVX 2OJZH 3WFBH 5L2KA 2YA2A 4KK9C 2GJ6B 3WIIH 1SJHA 1JRHH 3O2WH 4JN1H 3TO4C 3IU3B 3JUYA 3OZ9L 3RWFB 1IL1A 5EBLB 3JWNC 5AZEL 3OV6A 4PGZA 4BUGA 4HJ0C 4JZNB 3QRFM 5SWSB 2KZWA 5EU7E 5JPNA 4RMRA 5IB4B 2DMBA 3P40A 4MHHG 3P4MB 4WEUD 3G5YA 2IGFL 2W9LA 1LD9A 5HGAA 3B2VH 2FGWL 4FFZH 4LDOB 1TZIA 2W07A 3C2AH 1X5IA 2BVQB 1U8PB 4XCFL 2BRQA 4PTTA 3GMOB 3L5XL 3GSOB 4KI5D 3FQUB 5IF0A 3FT3B 1K4DA 3P77A 3HZVA 4AL8L 2FEEL 1R5IA 1FVEB 3FCTA 3VFOA 2XFXB 5HHVH 4PJFA 2BXZA 5TDPA 3QDGB 2V7NA 1CT8B 4GRMB 3DGCR 4U05A 5HVGB 1CXLA 2GI7A 4MJIA 4AK1A 1LO0L 4GKNA 1G9NH 4XCYB 3PQYD 3RWDB 3S5LB 2AXJA 3PWNA 4P2OC 4MA1B 4Z7OE 4CDHA 2VUOA 3ZTNL 1AGEA 4RX4A 1CE1L 1WC7A 2JIXB 3P0VL 3IDXL 3CDCA 4K3JH 4Z7UB 4XPTH 3RZCC 5DK0B 4MD0B 4Q6YA 5HGHA 3GJFB 4BH7A 3HHRB 2D03L 3KPRE 1MFCH 5CJOH 3REVB 1N5AA 3HS0A 5FHAL 1KXTB 1CL7I 1C5BH 1MHEB 3CFEB 5L2JA 3TJEH 4FTVE 1ONQA 5L2KB 4RA0C 3NIDE 3OKOA 4XGZA 3O9WC 1A5FH 4PJAF 4N0FA 1NUFA 1OM3H 4YHLH 3SQBA 1TQCC 3EYUL 4RGMB 3WHE0 4JY5H 2W9DL 1ITBB 3VXQA 1RUPL 1IL1B 2ESVA 5D70L 3UBXI 4NBZB 2YPLE 3RFZC 2GTWB 4Y19B 4NZTH 3MLWL 1YECH 1EAJA 5JPNB 4UV7L 4JHZA 1H5BC 4I3RL 3G5YB 3EJYD 3EDFA 4P5KA 3M8OL 2K9UA 5HGAB 3UDWC 1AY1L 2PN5A 1TZIB 3O3BA 3F5WB 4WUKH 3IAGC 3TO4B 2ORBH 4RFNB 3LRGA 3O11A 1AFVH 4JO1H 1K4DB 3HZVB 1EHLL 4WW1B 1DR9A 1LDPH 5KSBA 1LO4H 4HULB 4LLYB 1MJ7L 3ULVF 5I1IL 1I9IL 1LHZA 4PJFB 2P5WE 3K1KC 3HE7A 4N8VG 5TDPB 3OKMA 3QFJD 1OSPL 2AV1A 4Y4HC 2W60B 4MJIB 4QRPE 4GKNB 3ZKMD 1TETL 5DO2C 4PJDF 2UVFA 2VJXA 3PWNB 4HV8A 1OAKH 3HRZB 2YZ8A 1NCCH 5D2LB 5JW3L 1TVBB 4LARL 4Z7NE 4K23H 1VKXA 2Q20A 3V5HA 1BFTA 1N26A 4BKLA 5C2BL 3U9PL 1SJXA 1HCFX 1N5AB 3UJIH 4PGDA 2A9MH 2Q76A 4X4ZA 5J1SC 2D7TL 1MQKH 4UNVA 3SHSA 4XVTL 5T3XL 5L2JB 3K8LA 3SO3C 1S9XA 4P2OB 4OM0H 2OR7A 5D7KE 3OKOB 4XGZB 3C6SA 4PG2C 4MJ6B 4N0FB 1G7MA 5MENE 5CJQL 3RZCB 2H26B 3MYZA 5BZDA 3OZ9H 4LSSL 3IU4L 2WM0A 2AEQH 1A1MB 1ZLUK 1AIFA 1TENA 5AZEH 5D8JH 5ADOL 1CFTB 4OFVA 1ZT1B 2F74A 4YDLC 3S5LG 4ERSL 2D0FA 4AMKL 4TSBL 1AQKL 4S11A 4X6DE 2IGFH 3MCKA 1BD2D 3O9WB 2FGWH 3O3BB 2BVPA 1TQCB 3FHQA 3QUZC 3U7YL 4ZUUB 1FBIL 3BP7B 3O11B 5BZWA 5ACZB 4XCFH 3FL7A 1KELL 5GS1A 4YDVB 1PYWB 4KMQA 4B53A 1OTUD 1RZFL 3G5VB 4P5MB 2OTPA 5ENWA 1H5BB 1KCVL 5J6GA 1NMCC 1TFHA 4Q0XH 1NC2D 4GG6F 3OKMB 5IFHL 3L3IA 3SE9L 1DQTA 2AV1B 2YUXA 2QEJA 3FQWA 4D0BB 3RVTD 3QUZA 5F70A 3KJ6L 2AJVL 1LO0H 4MD5A 5FKPA 2QBWA 5D6CB 3VI3F 3QIWD 1WV7T 2ITCB 1AR1D 2RGSA 5DMGC 5ALBL 2X9YA 4EQ2A 4ZFZB 3SJVE 4EN3C 5JXAL 2R0LL 1VKXB 1DL7L 3P0VH 5D7SL 3IDXH 4BKLB 1VFBA 2CDGA 1BJ8A 4JANA 4PGDB 2D03H 3C60A 4Y4HB 5ILTH 2JJTC 5FYJE 1A6TB 1KCSL 2C4FT 2EDEA 1M7XA 4KPHH 1S9XB 5HDBE 1RMFH 4LPTA 4G3YH 4HIJA 2E9JA 3WNLA 1EH9A 4GUPA 1MUJA 3D85D 4J8RB 1Y0LB 4KFZC 5EOCJ 3I2CH 4LSRH 4R26L 1A3LH 5HVHC 3EYQC 1G7MB 1BFSA 4K3GA 3RQ3A 5A16A 5BZDB 3O41B 3EYUH 5JIHA 3OXSA 1AGBB 4JDTH 2ZZUT 2W9DH 1UEMA 4Z8FH 2J6EL 4MD4A 4OLUH 3ARVA 1HOCB 1BHGA 1UCBL 1K3ZA 3V4VL 1HQ4A 3SO3B 1MSPA 4Z76A 4I3RH 1EVTC 3ULVC 1EEZB 3JVGC 2BVPB 3INUH 1QPPA 1G0XA 3L95A 3RA7H 3L3HA 3V6ZB 1E4XL 3VWJC 3C6LC 4TNVF 5F7KC 4W6XB 5D72L 1MCNA 2LVEA 2CUMA 2F58L 1IQWH 3VRLF 2VLJB 5DD3L 4KV5E 5EUOB 4EUPB 4YDLB 5J6GB 5I1IH 3PWLB 1IAKB 2R0ZL 5TFSL 4PJ8D 1L6ZA 5IW3A 4HIHB 4HKBA 1PQZA 1OSPH 3D3VD 1AD9A 1X4XA 1MVUA 3QUZB 2XTJE 2FX9L 5FKPB 4YXHL 5M7QA 1TETH 1MI5E 1S7UA 4LLUB 1NJ9A 4XHQA 5DXWA 1UB5A 4PJDA 1B88A 4RAVA 2ILLA 1NMCB 3LKPA 4E9LA 4XVSH 3PHSA 3QXTA 4Z7VF 2I5YH 1VFBB 4F7TA 4G7YL 2CDGB 4X4XA 5E94A 4JANB 1T7WA 5CZXC 3U9PH 1CDYA 5F89A 3RU8L 2YD4A 4PB9L 2D7TH 1RULH 3U0TA 5FV1L 3BHBA 1MLCA 2FO4A 4XVTH 3B5HA 3D2UB 5T3XH 3BGAA 4GUPB 1X5YA 1MUJB 3C5ZC 2DJSA 3L3JA 3VA6A 1H15A 5GS0D 2MCPH 5A16B 4O5LH 4PJAB 2BNQE 5BV7C 3SCMC 4PUBH 3IGAA 4KJWC 1FNGA 2EDOA 1D5XB 1YN6B 3BIKA 1OVZA 3AMLA 5H37H 4MD4B 1MIMH 4LCCA 3N1QC 5ADOH 1T3FA 2H2PD 5DT1H 5BS0E 1JIBA 4Z76B 1FIGL 5C0AD 4AMKH 5K9KA 1MHHA 3B6SB 1U3YA 4U0QB 3Q48A 2BVYA 3MJ8A 1ND0A 3EYOB 3ULUD 5HVHB 1CGSL 1IC7L 5TJWK 3S9DB 2K1MA 4LSQL 3L95B 3U7YH 1FBIH 1W72H 3SDXE 2CXKA 1GC1L 2ENSA 4MNQE 3ULSB 1I4FB 3WFHA 2FBOJ 3WFEL 2ADJA 1RZFH 1C1EL 3IFLL 4ZDHA 5TGBA 3KXFE 4XHJD 3RDTA 2J8UE 3L5WA 3L7FA 4YBQC 1KCVH 3VFVB 1PEWA 5IFHH 4HKBB 1PQZB 3DBXA 5FCSH 1AD9B 3QP3A 4WO4A 1HXMB 5F3HA 1DDHA 4HPYL 1G9ML 4Z7OF 1MVUB 3ARFC 1AHWA 3VWJB 3C6LB 2AJVH 3OR6A 1JUFA 3U7WL 1NJ9B 1I7RA 1UB5B 5JPMA 3U4BL 4ZPTA 2BJMH 2AABL 5IMMA 5ALBH 1KF9B 4DN3H 4HWBH 1MVFA 3LKPB 2WUBL 3DECA 4OSUL 5DJYA 1PGRB 3MZTA 4F7TB 3RIAF 5KZCB 3BRFA 4NN7B 3IFPA 2NY0C 1HDMA 1F58H 3N9GL 4K9EL 5F89B 2VKXA 3UTTE 2VWEE 5GGTH 1YEHH 4G9FB 5LGJA 5HYSA 3U0TB 3BHBB 1MLCB 2FO4B 3NIDF 4M8VA 5JDJA 4QRRE 4Y89A 3TC9A 3B2UC 1DQJA 3DX8B 3L3JB 2EIZA 5DVKA 3WKML 3O6KL 1H15B 1ORSB 3SKOA 4EUPG 4R26H 3LN4A 4F9LC 5CD5C 2ED9A 4I1NB 3H9ZA 3IGAB 1FNGB 5D1ZC 3BIKB 4LSUL 1OOAA 4AEEA 1A02N 2OSLA 2BY0A 3LS4L 4LCCB 2OK0L 1T3FB 1OD7A 4MGXA 2P8LB 1C8PA 4YHKH 1UCBH 3X14A 4HC1A 1A0QL 3V4VH 1Q9OA 5K9KB 1MHHB 3C5ZB 4GXVL 4Z0BH 1FL6A 4JFFE 2GAZA 1U58A 1UGNA 5BV7B 3SCMB 5IB3A 1T1XA 1E4XH 4NZUL 1J12A 3FRPG 4ZDHB 1KTDA 2F58H 2VDQH 3RDTB 5DD3H 3L5WB 2YWZA 3MXWH 3L7FB 4AYFA 4LLVA 4Y5XA 5EDXA 3MRBA 1T0MB 4O58L 4E41B 4PV8B 1B0GA 3STZA 5TFSH 1F8TH 3DBXB 5F3HB 4JGJA 3FO0H 4NQXA 1DDHB 4GG6B 1G7HA 4P2QE 1JFQL 4MJ5B 1P6FA 1AHWB 4XPGL 4EBQH 1KFAH 3LRHA 3OR6B 15C8H 3FRUB 1WCBA 1JUFB 2FX9H 4JFHD 2ARWA 1I7RB 2C1PA 2IQAA 4LQ1A 3T0WA 4Z7NF 4NQED 3EDDA 3BPOC 2E9IA 5EORL 2GJJA 2XIDA 3RX5A 5DJYB 5FYKD 3GRWL 3MBEC 2X4SA 3IFPB 5IVXE 1HDMB 1YUHA 2AJZA 2CKBB 4XMLL 3ETBF 3TJHC 2K7PA 4Z7VA 3BZEA 3ARRA 3R06A 3ARFB 2PXYA 3RU8H 4ZPVB 5HYSB 5LGJB 3V4PH 2BFVL 2P46B 4QXTA 3JSSA 1JCKA 4TSAL 4NRZA 1DQJB 5F9JA 2EIZB 1QRNE 1UM4L 4ZXBD 1YJDC 3TZVD 1KOAA 5CEXB 1NC4D 1QSED 2N7AA 4XCNA 2JELL 1QR4A 4JQVA 1IAIH 3MBEA 4HCRA 3Q1SL 3ES6A 1H3PL 4F2MA 3FMGL 5ERWA 2LTQC 2OSLB 1E27A 4X6DF 4DGVH 2J5LC 5DR5L 2Z93A 3TF7C 3TESA 1ZSDA 4NYLA 3CFBB 1J05A 2Z92B 4WV1A 1N3NB 1FIGH 3MV01 3UEZA 3UPCA 2ZCKL 4U3HA 1FL6B 3Q0HA 2ZUWA 4KI5E 3B9EA 3UXFA 1U58B 3GKWL 3DVFA 1W2KT 2DM2A 4V2BA 3WDIA 5DJ2B 3GKZA 4QGYA 1GC1H 5CBEA 4UINL 4HWZA 3ALWA 5E56A 3PG2A 1S7QA 5D93B 1VSCA 4OV6F 3ZYOA 1KTDB 1MFBH 3IFLH 2A38A 2IG2L 4LLVB 4Y5XB 1U8JA 1T2XA 3MRBB 1TTGA 1WBZB 1KCUL 1B0GB 3GJFH 1QBBA 5BRZB 5I1HH 1BVKA 1V5JA 3D1MC 4KHTL 4NQXB 3SKNA 1G7HB 1HH6A 1NBVL 2X89A 3HAEG 3CFKA 3WJJC 4BSWA 3VFMA 4ODXB 3WIHA 4AG4L 1G9MH 1Q0YH 1YYLL 1DFBL 3IB4A 2E6QA 1WCBB 2AJ3A 1MH5A 1IGJB 4RAUB 2C1PB 1PZUB 2R1YB 3U4BH 1FVDB 5IP4A 1YEGH 2DQCH 2AABH 4KKAD 4IMLB 4HQQL 1A6PA 1XIWC 1KPRA 5K93A 1F3JA 2JKXA 3KPRA 4OSUH 5JW4R 5EO0A 1YUHB 2DQJL 5IBLD 5BO1L 2EDHA 4PR5B 4K9EH 4YHYB 3WJJA 2P24A 1HSAB 4FTVA 1BM3H 3IVKA 1OLZA 4LL9A 4PRDA 2WWKO 4HGKC 3BPOB 3QSKB 4NRZB 3T1FA 1AI1H 5DZOA 5F7DA 1L0XA 4GBXC 3WFDL 5D6DC 2C3HA 3GIVA 4WW2F 3MBEB 5BMFL 4JN2A 2YPLA 2JJWA 1BQLL 2VC2L 1JE6A 1TVHA 4G8EA 1CFBA 3DYOA 1E27B 3D18A 4QHMB 4LSUH 5C0ND 3GK8H 3LS4H 2CKNA 4M1CD 4NYLB 2BC4A 5FGRA 3MUY1 4X7TA 4J3XA 5K9QG 3BPNC 4Y1AE 4PIRF 4HT1H 4GXVH 3CLFL 3DNKA 3JV6A 1C7TA 2Y1VA 4N9GB 3LQZA 3BEWA 3KPNA 2DWDA 2BHZA 4PRPD 3WLWC 5IQ9A 5KSVA 2D9CA 3O8XD 4GO6B 5CBEB 2LTQB 2VERN 1ZT7A 3WL9A 1D6VL 1S7QB 2J5LB 3IS1X 4IDJL 5A43C 3KPMA 3MZGB 4MAYC 2P5WA 3C2SA 3EAKA 4UB0H 4HIXL 4HJGB 3RX8A 4PP2A 4O58H 4DGYH 2GY7B 3UAJD 2NY1C 4QRPA 2X1WL 2R4SL 1I8IA 5DD0L 1QO3B 2D0GA 1CE6B 4FQIL 1JFQH 2NZ9C 1MH5B 4XPGH 4R7DA 5C6PB 4KQ3L 2WWMC 4XBPA 1HHIA 1FFNA 3QUMB 5F7MC 4G8IA 1I3RA 3N1PC 2LAAA 2CK0L 4OLYL 5IVOA 1IAMA 4L5FL 2DYPB 1C5DA 5FM4A 4MAYA 4QXWA 4RGNE 3L3GA 1F3JB 3KPRB 3S6CA 1T6WA 1G1YA 4YH6A 3RY6A 1NCWL 5HHMD 2JB6B 1RAMA 4LRNL 5ICXA 1ZVSB 2UUDK 1G7LA 3QPQD 1SY6H 4OLWL 2P24B 4Y16C 3TBYA 3IVKB 4YHOL 2HLAA 4P2CG 5IIEB 5M95B 2BFVH 4NO2B 5FGCB 4NDMB 2HYMA 2ZUVA 3VXRD 2B7DT 4WDIA 4D0CB 3T1FB 4P2RB 5IB2A 4NIKB 3QUYC 5F7DB 4QNPE 4NQCD 1HIMH 2P8PA 2P5ED 4DKFH 2GW5A 5DSCB 1XIWB 2X9WA 5LQBH 2JELH 2QHRL 2VE6A 4JN2B 5C07D 2YPLB 3OXRA 3OF6D 1TVHB 1DBAH 4G8EB 1XGQA 3Q1SH 1H3PH 3ARGC 4ONHA 1KCKA 3D18B 4XNYL 3OKYA 3KLHC 4NKIH 2EDQA 1XGYL 4OGXH 3MRHA 5DR5H 4MCYA 4X6DA 2BC4B 3SDCC 5C92A 5J57B 1BEYL 3KYMA 1YYML 2ZCKH 3ZT5A 2KDGA 4IMKC 5DQ9B 3LQZB 1GGTA 2KH2B 2DWDB 5KSVB 4OCWL 2NX5B 3JXAA 4M3JA 5A1AA 1XGUA 4OGZA 5I1LB 4LQFL 2J8UF 4WY7L 2ZNXA 1ZT7B 3ARGA 1X3DA 4KMTL 4RGOL 3NTCL 3QEUB 4UINH 3OG4B 3RNQA 5FCUL 4HIIA 1X7QA 1N8ZA 2IG2H 3SDCA 3DIFB 3BPNB 4UOJA 1KCUH 4Z7WF 1DQQA 2NPLX 3CVHL 3MLPA 2A6KB 3CVIL 1QUNA 1NBVH 4RBPK 4AG4H 1YYLH 4HKJA 4R7DB 1DFBH 4UV4L 4LEOA 2V5TA 1FFNB 1L9NA 1UB6A 3ARTA 4U3XA 3SJVA 4G8IB 4QT5A 4HKZA 3O4OC 3ZKQD 5DRWA 5F1NA 1IGYA 4MAYB 5TE7H 3K8KA 2HWZH 3D25A 4LIQE 3S37X 1T89C 5CHNB 4UILH 5DVOA 4WW2C 1Z2KA 5B8CA 4OZFA 5ICXB 3QEQD 1G7LB 1JGUL 2HLAB 2YRLA 3MUHL 4GAFB 4BQCA 4WDIB 4N0UE 3SGDI 5IB2B 2OL3L 3CFDB 2PR4L 4D0DB 1GOHA 1XF5A 1B0WA 3VFSB 1FL3A 4XRCA 2VE6B 3WFDH 1T89A 3HI5L 4CMHC 3OXRB 5BMFH 4WW2A 1XGQB 1TMCB 1BQLH 3MLTA 2BZDA 2G5RA 5J6HA 1KUMA 1FZOB 1VHPA 5F44A 4F57L 4EUPH 1U95B 3BP5A 3QUYB 2HJKA 4LNRA 4R4ND 4G80B 4NNXA 4BFEA 4OZHF 1KACB 3QWQB 2GUOB 3CMOL 1CICA 3QHFL 1XGUB 2HRPL 3PGCA 5T5FL 1Y6NR 4NJAL 3EZ8A 3ARGB 4JG0H 3RNQB 1F90H 3U0PB 1D6VH 4IDJH 5D7JC 3OKNA 4P48A 1TZGL 5EBMA 3SDCB 1DBML 1N5YH 4HIXH 1H3WM 3P9WB 3VXMD 1HHGA 1D5ZA 2NY6C 3NCMA 1MCQA 3WFZA 3DVIA 1NCDL 2R15A 3ZYZA 1MI5A 1QG3A 4H1LG 1M05A 5A3ID 2O5ZL 3GMMB 4KQ3H 3P73A 4HKZB 5IVXF 5F1NB 3QIBD 1F4HA 4OLYH 1LNUA 3D25B 3ZZ1A 3MMEB 1FVCA 4H5SA 5CEZH 1JI1A 3IXTA 3M1BA 5GRVL 4OZFB 2VDML 5KBNC 5DHYB 4JDZA 3EYVA 5HYFA 3WHE1 4WIQA 1A7RH 4OQTA 4L4VB 2QHLA 5FA4A 1QNZL 3GM0A 2OJEA 4XH2A 5JW4M 3W5MA 3O4OB 4DZ8A 2IWGA 1F00I 2FBJL 5HI5C 2HT4D 2QR0A 2BNQA 1OSZA 4XRCB 3T0ED 4GAJL 4OZGE 4WW2B 1HKLH 3MLTB 3BFOA 4KK5D 5J6HB 5BS0A 3EGSA 4OF8A 2AEPL 4HPOH 1YZZA 3ZT7A 3VGAC 3FB7A 1G84A 1XGYH 4KI5F 4P4KC 2ZPKL 2FCBA 1A14L 2XI9A 4YDIL 3ULVH 1C7SA 4K55A 1WTGT 2HJKB 1BEYH 4XP1L 4NNXB 2VAAA 1OARH 3BMWA 2AXFA 1IBGL 2VR9A 4U1KA 3E3QE 4RCAA 3SDXA 1CICB 2C7UA 4OCWH 4MNQA 3DPBA 3PGCB 4CMHB 2XV6B 3FO1A 3S96B 2DLEA 5CINL 4WY7H 1QVOB 3MOAH 4X99A 1IMHC 3KXFA 4RGOH 2DQEL 2J8UA 3DUUB 3NTCH 3WUWB 3KYKH 5EBMB 3P9LB 1LILA 4BFIA 4NRXB 4ONFL 1D5ZB 2YK1L 4QOKE 2XTJB 2NXZD 5AUMA 1MI5B 3CVIH 4F3FA 5GZOC 1ZS8B 3N85H 4D9RD 3HB3D 2VLKD 3GUTA 2IALA 4UV4H 1J87A 3FAXA 3P73B 4K3DH 4QTHA 2EKJA 4LAQL 3MLYL 5KSUA 4MLSA 5D7JB 3HAEH 1LNUB 3DTXB 3UROR 4QHKI 1OQOA 4WENB 4WFED 3H42L 3UTTA 2I27N 4GW5B 4X6EA 4JDZB 3BP4B 3RGVA 4QRRA 4HF5H 5F9AC 1JGUH 3IJHB 4XNMA 3F7YA 4IOIA 4XH2B 3DYMA 4NM8L 3MRLA 5F71A 1KEMH 1KIPA 1ZLVH 43CAA 4F7CA 1KPVB 4GOSA 5IVZA 5BV7H 3MNWB 4M4PA 1FG2B 3SGJA 2DM4A 3CUPA 3HI5H 4JHWL 4PY8I 4DQOL 4ZODA 5BS0B 3DETC 3EGSB 2ED8A 2QSTA 4Z18A 4NSKB 2VR5A 3VGBA 2OZ4A 1B90A 1I7ZA 1YNKL 3U1SL 2HJLB 4JFFA 3R8QA 4CADA 4K8RD 2NNAA 3I6KA 4GLRI 1J0ZA 4HUMB 2C7UB 4MNQB 2UV3A 3QUML 3CMOH 3QHFH 5T1KD 3QIUD 1JGVL 4IRJD 4UQ2A 2PCPB 2HRPH 3A6BL 2IBGA 4GH7B 4NJAH 1MCEA 2J8UB 5EH1A 4EXKA 3TPKA 4MB4A 3BO8A 1KEGL 4P4KB 5D7LD 1TZGH 4UIMA 3W11C 1DBMH 2CKBH 3AY4A 4JFHE 4P2QA 2R1WA 3BP6B 5AUMB 3V7MA 4NQEE 3U30C 4Z7WB 3VXPA 5B39A 1NFIB 2DBJA 4U0RB 1XCTA 1QLEL 3GUTB 2IALB 5T1MB 4QTHB 4OZ4A 2O5ZH 5KSUB 1MJUL 4K7PH 2R2BB 1FZJB 3NFNB 1TNNA 5TE6L 5IVXA 2VRAA 1OGAB 3BWAA 4N68A 3MXVL 1RUML 1QFWL 5D9SB 3UTTB 3SGKA 4X6EB 2VXSL 5DVLA 4QRRB 3RGVB 5IJKC 4QNPF 3B5TA 3RKDD 2W65B 4XNMB 4MS8D 3F7YB 3SO5A 5DC9B 3T0VA 2MQ3A 1FGVL 1QRNA 1R24A 3LHPL 4KI5C 1QNZH 2I9LA 1KIPB 3WUWG 1JN6A 1RD6A 2FBJH 2H45A 4QEGA 5IVZB 1N6QL 3EOTL 4GRWE 1BLNA 4JPWH 3ZKSD 4L8SA 3IJSA 2FECI 3CUPB 4GAJH 3S88L 1QSVA 1A7BA 4M7JH 3ILQD 4RMQA 1SMAA 5AZ2H 5K9OA 1DVFD 1L0QA 4R90L 4UUJB 4LDLB 1ZA3A 4I5BA 5DFVD 2VAJA 2ZPKH 4YDIH 5IEKB 2NYYC 1RK0A 4XP1H 2G60L 2C9AA 3A6OA 1X4YA 3GRWA 3QYCA 3M17A 4KRLB 1IE5A 4OZHB 3CPLA 43C9B 4UQ2B 4JM4L 2X1PA 1A7OL 5CINH 3TIDA 3H3KA 4NFDA 2KUTA 2DQEH 3BO8B 4CRPA 3KR3H 4DZBA 1CF8L 5EOCL 4S1DD 2VXUL 4NQDD 5F97E 1UADC 4Z78B 1IGFH 4I0KA 2R1WB 4L3ED 4LLDA 2YK1H 1MCLA 1DN0B 5B39B 3VGEA 2OX5A 3S8WA 1GGIH 4NBXB 4ODVH 1CLCA 3NCFB 5CSZB 5DA4A 3V4UL 5BOZG 3LH2L 4OCMC 4PRIB 1UWGL 2N7BA 4IDLA 3FQNA 4HCRH 8FABA 3EJYC 1QBAA 2YZ1A 5I1DA 2FR4B 3IXAA 5C0DA 3RVUD 4MLIA 3WHXA 4M5YH 1JK8A 2XZQH 4UTAL 3BZ4A 4XAKD 1R24B 1YJDH 4NM8H 4QY8A 2I9LB 1RVFH 2A6IB 4DUXA 1BLNB 3LVEA 4Y7MA 3IJSB 1ETZA 5E8DL 3O0RL 5TDOA 1UJ3A 1FNFA 1WIOA 5CSGA 1REIA 1JPFA 4I5BB 5IB1A 3CAFA 1QSZA 4PRPE 1U6AL 1EO8L 1YNKH 3I9GL 3U1SH 1JHKH 2A74B 1S7VA 4F9PA 5AAMA 1VPOL 1GXEA 3M17B 3WIHH 5GGVY 4GMSL 4LAJH 2X4UB 3CPLB 1N4XH 3IDUA 5C09D 3QUMH 4TUKH 3I3DA 1JGVH 4HEPG 4XVJH 1P4BH 4DTGH 3SGEI 1M6OB 1ZHNB 3ZDXE 3K74B 3PQYB 1MRDL 1KEGH 1KLUA 3SKMA 2BSTA 1EZVX 4HXBL 4MZ2A 2XNAB 5FUOL 5BXFB 3BSZL 2V2TA 2DD8L 1EPFA 1EGJL 3KPSD 6FABH 3X17A 5EZJB 1UXSB 4MXQC 1Q0XH 3BVNB 1G0DA 2LE9A 5EUKB 4RDQF 4XPFL 8FABB 3QHZL 5TE6H 3OB0K 1I9EA 2Z31D 5FA3B 5I1DB 2VL4A 1QFWH 4GKZB 1R5WB 5C0DB 4OF0A 2XZCL 4YE4L 4MNGE 2EYSA 4BFBD 4V2CB 1KIQB 3CDGA 1JK8B 2BRRL 3VW3H 1YMMD 2P5EE 3NCYP 3GMPA 5C07E 4XP4L 4Q2ZA 1FGVH 1OTUC 3LHPH 3LIZL 3PABB 4TOYL 4X83A 4OZGF 4HS8H 4L4TE 4JM2D 4LCYB 3NCBB 1A6AB 4FQJL 3D39E 3MV9D 4PLKD 5MEQA 1ZLWK 3EOTH 1K2DA 3MC0A 3T2PA 3ULUF 3TNNB 5TDOB 4WHYG 1BD2A 3S88H 3R1GH 3BEVA 3FHAA 2BCKA 4I48A 1OLLA 1JPFB 2BDNH 5IB1B 1FFOA 3CZFA 1AO7D 3QIWC 2NW3A 1SJEA 1S7VB 2G60H 1BP3B 4ZYKB 1QBML 5AG9A 5CP7A 3MA7B 3QFJB 2EIBA 4JM4H 2OQJA 3FO2A 3ALPA 1XT5A 1OPGL 3LEYH 1JGLL 4AEIL 3GM8A 4Y4FA 3P30H 2X1OA 5EOCH 1DLFL 5GGQH 2WIIB 4XI5D 5L88L 4WI4A 3OAUH 5EU6D 3VH8A 1ZK9A 3O45A 4YHML 4LHJB 4J3SA 1C08A 2VNCA 5J1AB 1U93A 4ZSOE 5F88A 5BW7C 4WI9A 4XMKL 3V4UH 2VQ1A 4RFOL 1V7NL 1Q38A 3DI2B 3WN5C 5JDSB 3QEQE 5IKCB 3D0LA 5AEAA 3KHQA 5CWSA 5J13B 1LQSR 1QD0A 1A3QA 3MRDA 4DGIH 2DLFL 3MRGA 2EYSB 2SEBB 4JO3H 1EO7A 2H9GA 3EOAA 3F58H 4OT1L 2VZOA 3RJQB 4N0UA 1B3JA 1M71A 3MJ9L 4BK4A 5C0CE 1WWWX 3GMPB 3H3PL 5EFIB 4Q2ZB 3ISWA 5E6ID 1UWEL 3OX8A 3VMOA 5J56B 5ELIA 4HK0A 1ZHLA 3V7AG 5MEQB 1FC1A 1K2DB 4M48H 4PJ8C 5E8DH 4J23A 1JZ7A 1BD2B 1PKOA 4TQEL 1A9BB 1I1CA 3RNKA 2XRAL 3BOVA 3SKJL 4F15C 2DQFA 3G5XB 1BWMA 2BCKB 5TQ2H 3SDDD 3JV4A 1Z9MA 1FFOB 4K94C 3CZFB 3C5SB 4HHAA 4GG8B 4JDVB 1U6AH 3NA9H 3RWCA 4I9WE 3I9GH 1LEKB 4JFDD 5JORA 2WBJD 5I15L 4G6FB 2COQA 2BY2A 5SV4A 2E7HA 1NC2B 2NXYD 4PJ8A 5FK9B 3GSXA 1GL4B 2OQJB 2QQKL 3FN3A 3U79A 5AWNH 1ZA6B 5KANI 4EKXA 4YBLC 2C5DC 4XNZC 3U48A 4YO0A 3FTGB 1II4E 3OKEA 4JHBA 3QIWB 4JPIA 4P3WA 2DAVA 1T03L 4OZFH 1WITA 1A7QL 1NEZA 1UQSA 1RURH 3PP3K 2R69L 4NQVA 1EHAA 3VH8B 5GS0C 2OXGA 1C08B 4JVPA 4M8QA 2RCSL 4X7CC 3VXTB 5F88B 5CS7A 2DD8H 2VQ1B 4KXZI 1J5OH 3DHMA 1NGPL 4OFKA 1PKQE 1A4KA 2CLRA 3B9KD 5L8LB 5LVEA 4AT6B 2KKQA 3WIFB 2XWBB 5FGSA 1NCTA 1GHFH 5CWSB 4A6YB 4QCIB 3QHZH 3D85B 3PGFH 1D5MA 4OCNC 3LKOA 3IKCA 3MRGB 1IILE 4FQLL 3ULUC 4L9LC 4KROD 2XZCH 5SWZE 2HFEA 4YE4H 5JIIA 1P69B 1I1FA 4YUEL 4N0UB 3TA3D 2IAMA 3ZO0A 2BRRH 1VEPA 5ISZE 4GRWF 1DBJL 3L3DA 1CZ8L 3OJ2C 1VDGA 5EIQA 4TOYH 3WN5B 4D3CL 4FQ2H 3SDAA 1K6QH 4FQXA 1R5VA 4HK0B 4XHJC 4OB5L 4OZGA 1U36A 5TF1L 4JPVH 1IEAA 4A2LA 4F58H 3ROLA 2DQFB 4U6TA 4PS4L 3QO1B 3VMNA 4G43A 3JV4B 4KK6D 4AIOA 1T2JA 2WMPA 4HHAB 1GSMA 1HINH 1WWCA 3TBVB 2R23B 5TDNA 3HZKA 4I0CC 4G6JH 1U8KA 2R2CA 3TO2B 1I1YA 5I8KL 5F1KC 5I8OL 4NP4L 1FAIH 4OKDA 2Q7YB 1HXYA 1U8MA 4PJ9D 4PJ8B 1IGCL 5D1XD 3D3VB 4UDUA 2EKSA 4MQ7A 4DW2L 1JGLH 1ZT4A 1T80A 4KKBD 4EDXB 4AEIH 3OKEB 1ZHBA 4JPIB 4QOKA 4D9RE 1MHPL 1OAYH 1NEZB 4NQVB 5L88H 4FXKB 4RIRB 1I8KB 3GMNA 1GRWA 4LOUC 1JRHI 2CGRL 3ORJA 1T66D 2V5RA 2DI7A 1BOGA 4JKPH 2X4TB 4IBLT 1A4KB 2CLRB 4YBLB 5DI8A 1G6RL 2YSSA 4RFOH 4NQTA 4XNZB 4UDTB 1V7NH 5B21A 1A6UH 5FM5M 1JI2A 5E70A 1OAXL 1YDPA 3KNBB 1ZAGA 4WCYH 1HHJA 1NH6A 4G6KL 1JBJA 4ZTOH 5FUCE 2DLFH 2ZG1A 1I1FB 2VL5A 1D5IL 2WWKT 5GPRA 4JKKA 4KQ4L 3B4NA 4XWOD 3IRPX 4ENED 1A1NA 3MJ9H 4M6ML 1UKQA 3JWDL 2VLRD 3ZDZE 5TPWH 1M7DA 1V7ML 4X5WB 1ACZA 1EZVY 2JK5A 3ZL4L 1R5VB 5CJ5A 4OZGB 4ELME 5C0AB 4CVXA 5JZ7D 1V3MA 2OYPA 4UNTA 1IEAB 4JPKH 2Y36L 5DC4B 3KPPA 3STLB