3LN9A

Crystal structure of the fibril-specific b10 antibody fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCTASGYTFSHRYHRWFRQAPGKEREIVAVISQSGMRTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAMYYCAAGTRKNVWTRQHPFDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Amyloid Fibril Recognition with the Conformational B10 Antibody Fragment Depends on Electrostatic Interactions.
pubmed doi rcsb
source organism Camelidae
molecule tags Immune system
molecule keywords Immunoglobulin heavy chain antibody variable domain B10
total genus 31
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2010-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ln9A00
3T0EA 2X09A 3QEUB 5FKAA 1NMCB 3HN3A 5E99H 3AFLA 1A9BA 1N5AB 4NKIL 4MVBD 2Q7YA 1MCPH 3RVVD 5I1AA 2H6PA 4QRPA 5DZLA 4IIQC 3U7YH 4PREB 2YD4A 4P23C 3K4ZA 3RA7L 5HPMB 5I0ZA 5DC9B 1L7TH 4KPHL 5BS0A 3EDFA 3SEPA 3P4MB 4Y8DC 2GYSA 3CH8A 4P4KA 5C0DA 5MEQB 3W5NA 2XRAH 4NQCB 1DBBL 3VH8B 2DQIL 3Q6FA 2R0KL 3ARYA 4WFHD 4LGSB 5SWQA 4MVBC 1QFWH 5EZOH 2IANB 1T22B 5JW4Q 4I48B 2H41A 1QG3A 1R5IA 4Y0GA 3AMKA 2CIIB 1I1YA 3TP4A 3NGBC 4F58H 1A0QH 4XMLL 1E27A 1IMHC 3UROR 2AJUL 8FABB 5GJSH 3RZWA 3ZT5A 4RWYL 1R3KA 3QEQD 3W11C 1QRNE 1D9KB 4KUZL 1IGFL 3FN0L 3MRPA 4WNQA 3TPUB 1XIWD 4YEEA 5B39A 3RL1A 4JRXD 3LV3B 1CTNA 1OP5H 1HINL 4XCNA 3CSPA 3VGFA 4BSVA 3MRLB 1XGPB 1OSZB 4JZNA 3NH7L 1B6UA 3JTSA 1ZWIB 4HKJA 3VXPB 1I7UA 2XZAH 5EOCJ 3QWOA 4JCMA 4D9RE 4M6OL 2CLZA 5IOPB 4J3TA 1FG2A 3DTXB 4PJGF 5DD3L 4HGWA 5HHOE 3OKEA 4XNUL 3BWAA 1HQ4A 2QTEA 4Z7OE 3WEXA 3FQXA 2DQDH 1W0YT 3FOLB 1EAPB 1R6VA 4LKXB 2FSEB 2IBZX 2ZG3A 4PJGB 3ZTJG 5E4EC 5IR1A 2Q3ZA 4PFEA 5HHOA 4GUPA 5ELIA 1AO7A 4LKCB 5LCVL 3HNTL 3FOMB 1UB6A 4JO1L 2FX7L 4XZUA 3S7GA 4JN1H 4F3FB 3V6BR 3WNPA 2R1WA 1U3YA 5CSZA 1RI8A 4U3XA 1YNTB 2ARJQ 2R2BB 3KYKH 3U7AA 1KACB 1JWSA 5T5NG 2F74A 2UUDH 5B38G 3HMXA 1KPRB 2CKBL 1MREH 3JWDL 4WUUE 1JWUB 1IM9A 3MV9A 1HHIB 4FZEH 4J3SA 1T3FA 1J8HA 3KXFA 4WCYL 5TE4H 1SJHB 3MLSL 4AM0B 4HGWB 1KN2L 4LCCB 5SWSB 3ZDYF 4ZUVB 2VWEC 4M3KB 4KV5F 4FNLL 5E24E 2FJGB 4HIIB 3FOLA 4BQ8A 4BELD 3I9GH 5F1IB 1NL0L 2DDQH 4DGVL 3FFCA 3U0TA 1HH9A 4GBXC 3Q3GB 3R0NA 4KRMB 4TPRL 2NY1B 4LFHD 2N1KA 4LBEA 4NCC1 3MLVH 3KJ6L 3VH8G 1NANI 3U46B 2A6JA 1X5FA 4LF3B 4HWZB 2EYTA 1A5FL 8FABA 2CUIA 4EN3D 5A3IC 5DJ0A 4UOW0 5DUBB 3VWKD 4Z7QE 4BSWA 3CH1A 1QBLL 1ED3B 2EIEA 5JQ6H 4TTDC 2F54A 4HZLA 1A6WH 3MLUH 4ZAKC 1GAFH 4Y88A 2HWZL 3Q6FB 2WINA 4ELMF 1NFIA 3VH8A 2EDHA 1MI5A 5AAMA 2YN5A 3MYJB 1FSKC 1SJEA 4RGND 3QNXB 1BAFH 4PB9H 1ZHKB 1MVUA 4YGVA 3WBDA 1U92A 5I8OL 1QPPA 2X9XA 2YKLH 1A6UH 3AAZB 3DX6B 4K3JL 4PRIE 5DJAB 1RIVL 3SY0A 2DIJA 2R0ZL 3S97C 2KKQA 4LARH 5I19H 3BRFA 4P2RE 1UYWL 2CRIA 4AMKH 1NDMA 4D8PB 2C9AA 2ATPA 3BJ91 5DMKA 1A14L 4E42B 4RGNC 4MA7L 2FX8H 4Y1AE 5ECJE 1MHEB 5DI8A 2VAAB 1DN0B 5HYSA 5MENB 2IQ9L 3IDXL 3SKUD 15C8H 2H8PA 3RFZC 3U6RA 1BGXH 3LVEA 4CNIA 2ZUTA 2P4AB 3H8NA 1YYLL 4HQQH 3UTPD 2Z8VC 1G9ML 4GBXD 4APQC 3BPLC 1S8DA 4WJ5B 4OZHB 1EPFA 1WBZA 3ULUF 3I84A 3QUXC 1IL1B 4RNRA 5EUOA 4ZXBA 2AEPH 4LHQB 2DS4A 5C9JA 2P8LA 2XXMB 2GY7B 4WW2B 3RWCB 1DQML 3DSFH 3HE6A 4FTVB 3S9DB 5E2UL 1F6LL 3B2VL 4IMLB 1PEZA 5IMKB 3WE6A 2VZ3A 1MCOL 3PIQA 4HUWB 1FYTE 2VDMH 3S5LG 1Y6MR 3BVNB 4TTDD 4LVNC 3M8OH 5BMFH 4ZAKD 1LO2H 5DYOA 3ME0A 4WFEE 4OI8A 5SWZD 2XFXA 3WUWA 4B7IA 5F89A 3GRWH 3GM8A 3MZGB 1QBAA 5FM5O 2GITB 5I8KL 1SJXA 5LBSL 3TO4B 4NDMA 2NY0C 5TDPA 4LCIH 3V6FB 5I8EB 4NQDB 2GTWA 4L9LB 4YBQD 2VNCA 3SDXB 1M6OA 3IB4A 4HJGA 5IHLB 2EECA 4ELME 4IRZL 4FQHB 3C5JA 4G9FB 4IRSA 2VDKL 4NRZB 3EOYG 3ZDXF 4ALAL 4Y5XC 2EH8H 4HIEB 5INCA 4PJFB 3PGCB 1Z3GH 3QCVL 5EN2B 2DF3A 4YHYC 3GMOB 4UQ3B 4H5SA 2FX8L 4KVNL 1UKSA 4JPVH 5EU3B 4NQED 3VI4E 4JFZH 3IFNL 5E94B 5INCB 2P43B 2R0WH 2MQ0A 5T1DH 1VENA 4FQIH 1S5HA 2PUQT 2C1PB 3UO1L 3KS0H 3K0WA 1X5HA 4Y4FD 5C0GA 3VMOA 4ZDHB 1VESA 3EO9H 4FQHA 5I30H 1YJDL 3BJLA 3OJDB 5JOPD 1JGVH 5IK3B 2ZCLL 3B4NA 3WNMA 1ES0A 1H8NA 1YY8B 4I0PC 5HYSB 1U58B 1CR9L 3PP3K 5FIEA 4LCCC 4P3CH 2RCSL 3DRTA 2BMKA 1JZ6A 4FMFA 4JY6A 1P7QB 4ZS7L 2A74B 2HWZH 5GZOC 3CFCL 2D7MA 1F11B 5E2JA 3H42H 4Q9RL 3LPGA 5HI3C 1JWMA 2YOCA 5DZNA 3NABH 3RBGA 2H26A 5DD6A 4MNHA 4V1DE 2P5WD 2ORBH 3P0GB 4NHUB 1MAKA 3N50A 3FRPG 1A5FH 3MOBH 1Z2KA 4PGDB 2DL9A 3TWCL 5C7XH 1YJDC 4TUJB 2GT9B 4OZHA 3HE6D 5DJZB 4TPRH 3VXSD 1QOKA 4GG6B 3WCYA 3W9DA 4LRIA 1EUUA 3FFDA 2Y07L 3CXDH 1T1XA 4Y2DC 1XGYH 2IANE 3S37H 1QR1B 1IE5A 3ARXA 5KSBE 4FRWA 5BJTB 4MJIB 4DJMA 1X5AA 3V4PL 1F3DH 1HILA 1NBZB 2FWOB 3QFJA 5I18H 5F7MC 2R0LH 4G9DA 1G84A 3F58L 3QWRA 3RUGE 4HH9B 4KI5C 1M05B 2Y7QB 3INUH 2G2RA 5D7IA 1QRNB 2GHWB 1DQDH 4G9DB 3TZVC 3WN5C 3KYKL 3QHFH 3FFDB 1YEKL 1RUPH 1P7KB 5TQ2L 2YWYA 3W5MA 4JN1L 2DQGL 4NQUA 4JO4L 5DRXB 3DROB 3RVWC 1QO3A 1FZJA 4HXAH 1U93A 3DECA 1I3RB 4WFED 3O4LA 1KCUL 3V0AC 4P9HC 3EFFB 1GGBH 3U1SL 1U8KB 3E3QE 4WWKA 1EMTH 3TBVA 4I1NB 1D6VH 1DUZB 2PO6D 2F74B 3ILPB 4IRJA 5F6IC 2HLFC 4NSKA 4KK5D 1SYVB 3A6CH 3VFOA 3NFNB 4MMXC 3CH1B 4WDIB 3MROA 3DOSA 1KEGH 3RHWF 1LEIB 1BOGA 3IKCB 43C9A 4GUPB 5SX5K 1CFTA 1XEDA 5FFLA 1MCLA 2VXQH 1RZJC 4JJHA 4KGLA 3ZL4H 3PP4H 1WV7T 3PNWB 2EC9T 3CPLA 1ES0B 4JQVA 4PJGA 5CJQL 1K8DB 2PO6C 5IMLA 2OR8A 4KKLC 5IVXE 4B0MM 5I8CA 2YUWA 4NQEA 4L3EE 5L2KD 3QXAA 3ES6B 4Y1AD 1P4IH 4OZ4B 4QRTA 1NH6A 2E7HA 2AJUH 5IT2L 3FRPA 5FUCC 3PHSA 4NGHH 5EZLA 5A2FA 5H35A 5DD1L 5BQ7A 3ES6A 1R5WA 4X9IA 1JPFB 3MJ9H 5E00A 4KI5D 4JKMA 1FL6A 1WBXA 4U0QB 3ZE0E 1KG0B 3CPLB 1N6VA 1JWUA 4PGJA 5IMOB 4H5SB 4XP4H 1RULH 5I1GH 1NGPH 4ZAKA 3V4PH 1QSEA 1RJLA 1ZLWH 5I18L 5J11C 5L0QB 1EEYA 4Z9KB 1VFAB 4V1DA 1Q8MA 5B22A 1MEXL 1NMBL 3HRZB 4POZD 5T3XH 2V2TA 1J5OL 4O58L 2ADFL 1NAML 4YNYA 4M6ML 3KPSB 2YD8A 2P1YA 4ISVA 2OL3H 4K3HA 4I13B 4GAJH 1TIUA 2BVQB 1RSFA 1QFWI 5D71H 4QF1B 2CIKA 4DKDC 2BSTA 5D7IF 1CGTA 5DD0H 2NXZB 4QHUB 4X6DB 3REWA 1Q0YH 3MUZ1 4LKXA 1NFDB 4MJ2A 5F88A 5HGDB 5IROA 1SEQH 3GMPA 4OLWH 3O4LB 5JIPA 2OQJB 4H25B 4P9HL 1MRCH 1QKZL 1IEBB 5CEZD 1WJ3A 4OJFH 3NFSH 3KS0J 4YHOL 1L7IH 3TVMA 2HT4C 5IMMB 4CL7A 3O8XD 1R3IL 5GS0C 3JBG7 4PG2C 1GZQB 4L3CB 1RUMH 5BOZG 3U4EB 3LV3A 1CR9H 4M8QA 1YEGH 4LSQL 3ARUA 4RBPH 3RRQA 4JR9L 4XBEL 3GSXB 5TH2B 4DW2H 3QZWG 1PG7H 1ITBB 3MCLH 3EO1B 4IRJD 4U6XB 1YJDH 3U9UB 3F5WA 2NXZD 1IC5L 4JFDD 1KTLA 1R3HA 3R06B 5IHUL 4I8DA 1C5CL 3FO9B 3GSNB 5GS0D 1O7SA 5C07E 4UBDC 5MENA 4QRSA 3VFRA 5FYKD 1A6AB 4RZCA 4G43A 4GRMA 2FX9H 1XAUA 1U3HB 4KVNH 3PGFH 3I3EA 3SKMB 4O9HL 3EGSA 3QYCA 2BXZA 1H3VA 1Q1JL 5EPMB 1KUMA 3KYOB 4XRCB 3G6DL 1HZHL 1HSAA 3FQTB 1BD2D 2PXYA 5F72S 4R4FH 1VEPA 4HWUA 2QSCH 1CF8H 3SKJL 3C2AH 2PNDA 3U0WL 4MB3A 1DL7L 3T0EE 4YGVB 2O5XL 3OX8A 3RWCA 5J6GB 4QRSB 3VFRB 4XRCA 3PWVA 5FUZH 1X5XA 2DI7A 2VTFA 1OM3L 3OG4B 5MEOA 1P9MA 1B0GA 3RAJL 3SKMA 3A0OA 4LLVA 5JNYB 3V8OA 4DVRH 3QULA 2OJZL 1T80A 2K3TA 3AY4C 3LQZB 3V0WH 3OXSA 4OFIA 1X3DA 3M8OL 4X99A 4PJIF 3KPQA 3QWRD 4NBZB 2DBJA 2HT4D 4APQA 4MXWL 1U3HD 4KV5E 2HJFB 1AXSA 2C1PA 4RISH 3RVUD 2ADJA 4DTGL 2V5RA 2VITB 5KS9A 2B0SL 4ELMB 3ZE2E 2JE8A 4DKEL 4XVSH 3UJIH 4G5ZH 1K8IB 5GRJH 4D8PA 4OCSL 4JM4L 3QEHA 1G9MC 5ENWA 3WNNA 2NY6C 3EYSL 2PXYD 4Z6AT 1JI2A 2FJGA 1T1XB 4R2GD 4PV9A 3FT3B 5ETUB 3M17A 4OF3A 5I1KL 4DN4L 1MELA 2OR7A 5J1SC 4R96A 4JFEE 1JNLH 3S96B 15C8L 2P5WA 5DHYA 35C8L 2VXVH 3QJFB 4P23A 4N8CL 4C4KO 4IOIB 3PGFL 1OP9A 3OAZK 5J11B 1PFCA 3O4OC 2BOBB 2X4RB 1KB5L 2QADB 3CFIC 3N1FC 5D8JL 1CG9B 2R9HD 1XGRB 1D5XA 1U91A 4U1NA 1ETZB 2X7LA 3UYRH 4WFFD 2E5EA 3MCLL 2IMMA 3JVGC 4UIMA 4FZ8L 4Y4KA 4XNXL 1FFQA 4JFFA 5FUOL 4DOHE 1KENH 4MQTB 4OLEA 3ARGA 1WISA 2C26A 5DJXB 5F9WC 2V9TA 3WXVL 3OR7B 5DEZA 4FQPA 2VABA 1BAFL 4PB9L 4HEME 5DEFA 2BDNL 3T2PA 2AJSL 1RUML 1J8KA 4LLYA 3D3VA 4KQ3L 2M8XA 4JFQB 4GS7C 1R3IH 2IGFH 1I8MB 4LASL 4HWEH 3DX7A 5B38B 5DRNB 3MNVB 3TT3L 1N0XH 4PJAB 5FM5M 5ICZA 2ZSVB 2OJEB 3BISA 5J4MA 2XWBA 3LD8B 5J6HA 4U49A 4NJ9L 3CSYA 3U6RB 1KEMH 3E0GA 1JHLH 5H2BB 1JL8A 4KRNA 2AGJH 4Y5XB 3FFCD 5B39B 3GI8H 4YDIH 4J4PC 3D1MC 2DQUL 4YXLH 4F15C 4X7FC 4NO3B 3PGCA 5D71L 5HYFA 4ODTL 1CD1B 4WVRA 2JKXA 4LSUH 3G08B 2FR4B 2YA1A 1JF5A 5CUSH 3SBWA 2FLBT 1U8LB 4G9FA 1QACA 4XAKE 3A6BL 2ADFH 3O3DB 3TA3D 4NO0B 4LAJH 5DUMH 2O5YH 4NSKB 2DMCA 4AT6A 2DOCA 3CDYA 4P46B 5H37H 2ZUSA 3UPCA 3HC3H 2MCG1 2DD8L 4WI3A 1KJ3H 5I1GL 3QDGA 3MROB 4WCYH 4CVUA 2WUCH 5F7LB 3MV9E 5E0QA 5HVGB 4P4KC 1DSFH 4OCWL 2R9HC 1S7VB 5I9QC 4GKNB 2X1QA 5E9DE 3TCXA 3QFJE 5FEBA 1XGUA 4KVCH 4R96B 5IVNA 1AGFA 4MAYB 1TZGL 4PP2B 4LLDB 3V52L 2J6EH 1PKOA 1JGEA 1PSKL 2QR0B 3N1PC 4RAUA 4XI5C 4FQXB 4JO1H 2BSSA 4Q6IB 4N5EC 1TQBC 4G7YH 1CK0H 2AK4A 3ZKSD 4N1HB 1FNEB 3Q5TA 2GCYB 3KHQA 3TBYB 1D5MB 3F7YA 3BKMH 4F7CB 2NYYD 3QUZD 1N8ZB 1NCNA 2CD0A 5I15H 2CLVA 4NQDD 5L2KA 2W9LA 4Z7UE 2ADJB 1FVEA 3Q3GA 3D5OF 4CNIB 1MQKH 2IPTH 4QYOA 4CGTA 1CXLA 1UH3A 4FOMA 3DXAD 1IKFL 4ZUUA 2C3VA 5EOQL 4P59L 2LAAA 4MCYA 5EH1A 4J4PD 1FO0H 2MQCA 4LVOB 1DP0A 5HGBB 4GSDH 2PTUA 3FMGH 3MRGB 3O2DA 5F1KC 4PJFF 4XGZA 1Z6JT 3RX7A 3LMJL 4HXAL 4PGDA 1T2QH 1K5NA 4PG9A 5F6IB 3GSOA 4WWKD 2I60H 4FA8A 3MRGA 2YPLB 3QXUA 4G3YH 5DS8B 3FO2B 4P0DA 1K4CB 3PQYB 2W0FA 2HT2C 2B20A 2D03L 3I3BA 2MKWA 5HYJE 2HVJB 4DUVA 3K4AA 1CL7I 5KSAA 1G0YR 3QNYA 1UJ3A 3FO9A 3U2SA 3RIFK 4ONOA 4JVPA 4DKFL 1B9ZA 4IHOB 3W0WB 3B3IB 1R3LB 4N1EA 5DJ6A 5DFVC 2GJJA 1HH6B 4O4YH 5HGHA 2IAMB 2EDBA 1S5IH 4ZTOL 5F7NC 1WK0A 1NBVH 2XWTB 3LS5L 1ORQB 4KTDL 5MENE 1NLBL 1JTPA 3CU1A 4KKCC 4XVTL 3TCLB 4NKIH 4HIHA 1WIUA 5KSUA 1RK1A 4RGMB 4F9PC 3GB7A 1P1ZA 1QFUL 3S34H 4P2OB 5F1IA 4K7PY 4PY8I 3TVMB 1AR1C 5JO5B 4XP6H 4MNQA 4MQ7B 3KYMB 1ZTXL 3I85A 1WZ1L 3JV4B 2YN3A 2P8PA 3W9EB 2FEEI 2BC4B 4LAQL 1MRFL 5F7EL 3TO4A 3C5JB 4KQ3H 2PR4L 4WV1B 3WIFA 4NHCL 4ODHL 1NCWL 4G80B 4GKNA 2P8PB 3UAJD 4RFOL 2OZ4A 3UTPE 4FQJH 3IDYB 5E6ZA 5KJRH 1GXEA 1OP5K 3GIVA 4X7CC 2A6DB 5D5ME 5JO5A 4OGXH 1KENL 3BZFA 5DQ9B 1YY9D 3GSRA 1NEZG 4BH8B 3P11H 4PJDB 1UFUA 1NMCC 5DT1L 5H94A 5LG1A 5HDBF 4HWBL 5HPOA 3IAGC 4RMVA 4X7EC 4OV5A 1DVFB 2DM2A 3UTSE 1FGVL 1BOYA 1DFBL 3DXAE 3HUJB 4OM0L 3PJSA 1C5BL 4G42B 1OP3K 1DR9A 5BQ7B 4WGVB 4LHUA 5GRUH 1PG7W 1JPFA 5E00B 3OKEB 4BQ6A 4K3DL 4OF0A 1CTOA 2DJUA 5I73C 4JGJA 3BH9B 2CO7B 3Q6GH 4OKDA 1XCQA 1IGCH 4QRTB 5E4IA 2XZQL 5CBAB 4LCUB 5JOPE 5IGXH 5CS7A 3B9KB 2LU4A 2AEWA 4LCIL 4Z77B 3CFKA 1I1AA 1GGCL 5DEGB 5I8KH 3P77B 3RWFA 2OM5A 1REIA 4NKOA 5GSRB 1NMAL 1AR1D 5IKCA 3V6ZB 1N7ML 1NGQL 3CK0H 3OR7A 1CZ8L 3L7EA 3WIIL 3MRKA 3WIHL 5BS0D 5GIRB 2QHRL 2NTSP 4G8IA 4AEIH 5GRYA 3BKCL 5DGRA 1XFPA 1RZGA 1LO0H 3WJJC 2ESVA 3U83A 4M43H 3IFLL 4PJDF 4BUGA 5C0BE 1YPZF 5ESAB 1YNKL 3RHWK 1NC2A 3G5XB 2AEPL 4Z7UA 3VE0B 5CEZH 3NZHL 3PABB 1ZHKA 4W81A 5D7IE 2XYCA 1BP3B 3BEWA 5ILTL 1DL7H 3L5IA 1GZPB 3SKJH 3TYGL 3KPRA 5KZCB 4EUPA 4YHIA 4Z8FH 4YXKH 3DYMA 2D7NA 5A2IH 1YEDB 3N1MC 5KSBA 4PY7B 5GS1A 4I3SH 3QXDB 1TJHL 2DYPB 3UTZB 3V0VA 2AJXH 2NTFB 5ICYA 3GSWB 4J8RB 3RU8H 2CDEA 1G6RB 4KWUA 3NN8B 5FO7B 4APQB 3KYAA 2PCPA 4LLWA 3D39D 5J3HC 4YHIB 3MRCB 4WEBL 2FIRT 1TNNA 3AB0B 1X5GA 4XBEH 3NZ8B 1F02I 1NDGB 1DZBA 1HOCB 4UT7H 1MAJA 1A6VH 4OZIE 3DURA 4JANB 4QTHA 1MLBB 1GZPA 4JKWA 5E8PB 4KY1H 5I6XB 4M6NL 4PLOB 3Q5YA 4X6BB 2EE9A 2XTLA 3SDDC 3WHE1 5T3ZE 2AXHA 5IW3A 1QQDB 3S3PA 3BKJL 5TGBB 2J8OA 1IAMA 1FN4B 3P77A 1F4WL 3MA9H 4JVWA 4EZMA 2X2YA 2W9DL 4MNQD 2WMPA 4KKAD 5H8DA 1IZJA 4HJ0C 4PJCA 5FO8A 4I5BB 2I9LA 1QBBA 3D9AH 3UYOD 4LCYB 2BXYA 2J3SA 3DVFA 4XNYL 1U58A 1CYGA 3MQIA 1AC0A 1NL0H 4S1DC 3GMRA 1JYWA 1AFVL 1YEFH 2CSPA 3IDNB 1IFHL 4G42A 1XCQB 1EHLL 1LEKB 1UM6H 1FFRA 2XWJA 2BNRD 3QB7C 3P4NB 3PGDA 4KU1A 1T5XB 2CUHA 4HJ0D 4RDQF 4K2UL 1VKXA 4N9GA 3QO0A 3GMMB 5IB3B 3CFJB 4PJ7B 2YK1L 1KB5A 1AGEA 1JF1B 3MJ9L 1H3PL 4LNRB 4IIQB 1IRAY 3SE3C 4YGAB 1PVHA 2D31A 5IT2H 5F88B 4PRPE 3MREB 4TSBL 3TNMB 4YDLB 5JHDA 4HS6A 3RIAF 5J7CC 4JO3L 3QRGL 2WQ8A 1OCWH 3BAEH 1A3RH 3G5YA 2SEBB 5EU7E 1RVFH 2GTWB 5CJQH 3ZSSA 2Q86B 1FORL 2AJVL 3BGAA 4OCLC 1CI5A 4ZFGL 1KBGL 4P2RB 3MV7E 4WI7A 1H5BB 5T33H 2WNGA 2QV2A 4OD3H 1OWWA 3CMOH 3O11B 4OV6F 2DQDL 1KEGL 1B3JA 1WITA 2FD6L 5B3NA 2AQ2A 1ZT7B 5GS2D 3UJTL 4CW1B 5I1LB 1V8HA 1MJ7L 4X9FA 4ORGA 4KTEH 1Z9MA 5D1QA 3JSSA 1QSFE 2EDXA 4ERSH 5DQDL 5I74B 1VFUA 5CWSB 1YZZA 2WAHA 4OM0H 1EMTL 4ZO9A 2AJ3B 5I1IL 2F5BL 1BWWA 1X4XA 4M7KL 3MLWH 5TF1H 5T1LD 1RPQA 4JFDA 1PG7X 3IDYC 4HIHB 4X99B 3MBEB 1WBZB 2AV1B 3VDCA 1EDQA 5A2KH 1LDPH 1H3TA 3PXHA 3EOTH 3WO3B 4MJ6B 4Z7QF 2BNRB 3WSQL 4C56B 2YRZA 5IF0B 3O45B 2D7OA 2V9RA 3AGVA 4XVJL 5D5MF 1VB9A 4FG6D 1OAUH 2AV1A 1YN7A 2X89D 3C2SA 3QEQA 5GGRY 1FFPB 4OD1L 4RFOH 2X05A 2W0FB 1GL4B 1IM3A 1Z5LB 3O3BA 3D6GA 1KIQB 3L3KB 4QRUA 3PHQB 4WW2F 5HDQL 1MRFH 5A2LH 3KJ4B 1CFTB 4PRHB 5KANG 5D1QB 1E6JH 4OGYH 4UOW1 3QQ4B 4NN5C 1FFNB 5DTFB 3DV6B 1A7RL 3H9YA 3VGEA 1YEHL 1JHTB 4W6YB 1PLGL 4OLZH 2NLJA 3EYVB 3EFFA 4HG4K 4LPWA 4OLVL 4ESKA 4NKDB 5MHSE 4NJAH 3O3BB 3D69A 1IM3B 1Z5LA 2X4PB 3IF1A 3TWCH 4APQD 5D6DA 4FXGA 4U2ZA 1NAMB 3T77B 2I25N 3QUYB 5DK3A 5AWNH 3MCG1 1NFIB 4G7VL 3QUXD 1A7NH 4MD4A 2CDFB 4C56A 1A7RH 3C9NA 1Q9LB 1YDPB 2WQRA 5HTSA 1JMZA 1I9RH 5EOTB 4GS7B 3VG0H 2ZZUT 5EC2A 4IIQA 32C2A 1KIPB 2KQNA 1FZMA 1RJZA 2A6JB 3MODH 1MUJB 3QPXH 4KRPB 2AK4B 4HIJB 1S3KH 3IFPB 1Z0MA 2Q3AA 4KHXH 1IT9H 1I75A 4OZFG 3QDMD 4MA1C 4F7CA 1ZGLA 4NQCE 4C83B 4JN2B 1E28B 3EOTL 4HKXB 4Y4FA 1LDPL 1RZKH 4X6DA 4HJJL 2H3NA 2ZCKH 1FNHA 3ZYJA 5FDWA 1HYSC 4Q6IA 4AH2A 3ULVH 2H2PD 3QQNA 4LPUA 3WNKA 4WI9A 4YDVB 1JNNL 2VLME 4A6YL 4LLMA 4OUOA 5IQ9A 2F5BH 1FCCA 3QDGB 1NC4A 4X4MA 5HHVL 2VDOH 3IGAB 4EBQL 3STZA 1P53A 3SO3C 2DRUA 4K94L 2BSTB 1OTUD 2ESVB 2EH8L 4QNPE 4KROB 1F11A 1MJ7H 1LK3H 4D94A 3KG5A 5BXFA 4U2YA 2D0FA 4LCWA 1QLFB 5IVOA 3MOAH 4E41B 1CU4H 2I24N 4GW1B 4YNYB 1VADB 1JZ4A 1I9IH 4JZOB 3O41A 3P30H 1LDSA 3BD4A 4D0BB 4KK5C 1Y6NR 3DUSA 4ZFGH 4NM4H 3RWJA 2BFVH 4MJIE 1K6QH 3ZKNC 1E6OL 3D39B 2X4NB 1WLHA 1P4LA 3SQBA 4QRRA 1EAPA 5K9OB 5IQ7H 4NO3A 4GG6F 1F90H 2EIZA 4OZIA 3S88H 5BMFL 4D9LL 4YQXH 5I1EH 3O3UN 1UVQA 3BP6A 2LQRA 1MCOH 4BH7A 3P9MB 4CRPA 1WAAE 1MJUH 4WHTA 2EIZB 1UWGL 1ZWIA 4XXCC 3I75B 2P8MA 1Z9SA 5B38A 5KSVB 1O5DT 5FO7A 3MFFB 4WDIA 2RAMA 3LZFL 2DD8H 4PTUA 1UM6L 2YD3A 2X4QB 5DUML 2YHGA 1KNOA 4POYA 1J86A 1HYRC 2H2PC 5SX5H 3FO0L 1W72H 1I85C 4YAQA 2GITA 4JZJB 4FQCH 3SDDA 5ID1B 4GRWF 2GK2A 4U1JB 1ROWA 4RA0C 2VDLL 4KHTH 2XQBL 2W9DH 3WIFB 4NQCA 1KFAH 3MXVL 2VC2L 3RX5A 4JPWL 2ZP0T 4OZFA 1VA9A 2Q1EA 3RP1A 1OQOA 3MA7A 4OIAA 1I7RB 5E6YA 1EZVX 4LP4A 3LCYA 4PRNA 3IS1X 1N0XL 4K3JH 1XF3B 5T5NF 3EOBB 4N0UB 2HJLA 1JNHB 5HY9A 3BPOC 2LTQB 4PREA 4GKZA 2V2WA 2AXGB 2R1XA 2VITA 1NC4D 2B1HL 4LSPL 4GQ9H 3MRNA 5JOFA 3QEUA 1X9QA 2F54D 4XWOD 2NY2C 1IGTB 3P4LA 5BO1H 2J4WL 1CBVH 2G5BA 4WFGD 1JPSH 1XF1A 5C3LD 3UYRL 1GJIA 4LLVB 2HJFA 2NY7H 3VXUB 3ZYIA 5AZEH 3BZDA 3CFBB 3MR9B 1KB5H 1OTTC 3HAEB 1OTSD 3ESVF 1U2HA 3HMWL 4HS8H 5D9SA 5HHPA 4HFUH 4S1QH 1MH5B 1TENA 3WV0A 2P42B 5GGQH 1U8HA 2NY2D 2CK0L 2MQ3A 5C0CD 5GGUA 1XF3A 3E6FA 5GXBB 2APBA 3H7BA 4CMMA 1XR8A 3I50L 3IXAB 3L7EB 2VZ1A 4PS4L 1KN2H 2H1PL 1W72B 4C54A 5IJVA 1KCLA 4RMTA 2Q86A 4XVSL 1F4YH 2OCFD 4PRPB 5KAQF 5FYJH 1I85A 2ENYA 4JFPB 3I6LD 3T04D 1OP3H 4XWGH 3TNMA 2YPLE 4I9WD 4N5UA 1MHCB 3CVHA 2P5EA 1NGZB 2UZIH 4PJ9A 3S5LA 5C08E 1TQCC 2W9EL 5FB8A 1FLRH 1WSST 3MRFB 2AEQL 3S88L 1BJMA 4P57A 3ULVF 4A2MA 3V7MA 3WD5H 2RB8A 3SCMB 4Z7VF 2EZ0C 4GOSA 2JJTA 1BQHG 4L3CA 3GB7B 1B4RA 1T66C 4BFBD 4IRJC 5I71B 4FQQB 5F96H 3HPLA 4PGEA 3RDTD 2EYSB 4JY5H 3O0RH 2CMRH 2QSTA 2DTSA 3RNQB 2I9TA 2YXMA 1A7OL 3C5SB 5D7JA 2YR3A 1R5VA 5D7LA 1CU4L 5HHOD 3ZDXE 1S9YA 4L9LC 4JHWL 1T7ZA 4PRPD 4WGWB 4K3DH 3NCYP 1F6AB 4PJ5B 3WS3A 1OWRM 4MD0B 3SDXE 3W0WD 1OTSC 5F3HA 4EBQH 4G6FB 3AS3A 4XBGA 3MNZA 1NUNB 2ICES 4LCWD 2BNRE 2MHAB 2NY3C 2V5MA 2FATH 4DEPC 2B8OT 3WFZA 4PJHE 1JYNA 2ITDB 1W0WA 1ZT4B 2CKBA 5FO9B 3BPLB 3SN6N 3WUWB 1UZ8A 4UTBL 2NNAB 3CGTA 5JIKA 2P8LB 2GW5A 1M71A 3BOVA 5CSZB 2W92A 1RK0A 4AY0A 4IMLA 3X13B 1IEAA 5K59E 3LN5B 2HH0L 3ZSTA 1A7PH 3H3KA 4LLUB 5IV2B 5HSFA 4JANA 3ZDZF 1CDJA 2A77H 1MWAB 3BGFB 2YPKA 2Q76A 3RZCD 4F9PA 2B7DT 1WBYA 3ROLB 2KUTA 1UWEL 1JPTH 3EOAA 1L7IL 5T5FL 3V4UL 4KROC 4P2QD 1TZIB 5IHZA 5H35B 2GJZA 3SDCB 3ZT7A 5K9KB 3NBNA 2R2EB 1T66D 4F2MB 4J1UA 1Q0YL 3QNYB 3RWJB 1QLRB 5L2KE 3TT1H 2W60A 3T0ED 1IEHA 2E7BA 3T1WA 3T3MF 1JNHA 5HY9B 3D0VB 5IMLB 4LSSH 4JZOA 1NBVL 3AAZA 1PY9A 4D3CL 3HZYA 2BERA 2VISB 1T2XA 3OL2A 4HPOH 4KROD 1KJ2L 2DQTL 4YHNA 1OD7A 1MFCH 5C0RL 1JK8B 5JDSA 2D4DA 4K7FA 2P47B 4A2LA 1ZK9A 1JPTL 1BM3L 5DJAA 1NGPL 2KBGA 4UB0H 3DX9B 5ESAA 2JJVA 1LHZA 1TCRB 4ONGL 4E5XB 3RZCA 3P4OB 1F4AA 4GW4B 2QHLA 4DOHB 1SYSB 3QCUL 2IEPA 2HYMA 4K7FB 1MJJA 4OD1H 3C6SA 2CRYA 1IGML 2BNQA 3BT2L 4CMHB 2VXTH 4RMQA 2XKSA 1I9JH 4JO2H 4PJ8D 1EXUA 2PYED 3EFDH 1JK8A 4UTBH 5DXWA 4Y16C 4NO0A 4K3EH 1F4XH 4P9MH 1U8NB 3L3OA 2XPGB 3BRDA 5C0AD 4GFTB 3RJDA 3FMGL 1QHOA 4FTVD 5BS0B 1KCVH 5C0BD 3QIWB 2N56A 1R24B 4WHTB 4QHNA 4N5ED 5H2BA 3VD4A 3UMTA 3QUKA 5I66B 2QQNL 5EU6E 2J8UF 2XNAA 5F44A 1KPVA 1IBGH 4F33B 4OCMC 1MI5D 2Z93B 4IRSD 1NBYB 3MRIB 4KJPC 2X4NA 1S7VA 4Q0XL 5HI4C 1KULA 3U30B 1D3CA 5GSVB 3OKLA 3TA3C 3EYUH 1RD6A 1RVFL 2XQYG 1N4XH 4LMQI 4N0YL 1A3RL 1AHWA 5CZVL 5SV4A 1UB5A 2Y25A 2A2QT 1WWAX 3ARBA 1LNUB 3VRIB 1DE4B 1VFOA 3EYOB 2ZNWA 1G7JB 3V52H 4MNQE 3DUHA 2IAMC 4DCQA 1FYTB 2ERJC 5GRVK 2C3HA 4L3EB 2BSRA 5DMJB 2JB6A 4NT6B 3AVEA 1U41A 3QHZL 4U6HA 4GRLC 3RTQC 1XGQB 2B1AL 2DWEB 4X5LA 3BMWA 1YEIL 5J9PB 4F7TB 5EBLB 4YO0B 1DBMH 1QYGL 1OF2B 3TYFA 2FB4H 2DQCH 5C0IA 1XGYL 1QFWM 3KWWB 5TDOB 3UTSA 4UDTB 1P2CA 2R23A 3EZ8A 4NRYB 3BPCA 2W1NA 4LSUL 1LE5B 5C6PB 2A38A 3QO0B 4LPVA 2DQHL 3VRJB 2Y5TA 4JRYD 3VFTB 3OGCB 1M7IA 5F7KC 5DK2B 3U4EA 3PJSB 1FJ1A 3MOBL 4PRDA 4HXBL 1RZJH 4KZDL 4RSVA 1FIEA 1F4WH 3IKKA 3MA9L 5DJXA 5AZEL 3IJYA 5HJ3B 5IVZB 4O51A 3GMNB 3GZKA 4L4TE 4NNYB 1WIPA 1FHGA 4GBXB 2EH7H 5ESVB 2X5PA 4XCCH 4I0KA 1Q0XH 2X4UA 5T3XE 3KNBB 3SE4C 4IBLT 2GUOB 2CR6A 1ADQL 1NGZA 3DHJA 4K94C 4PJ7E 4OQ1A 4R7NA 5BV7H 1T89A 2QL1A 1SHMA 3KLAA 4YFEA 4TVPL 3B5GA 1U8IA 2Z31B 4H26B 3HZMA 3RL2A 2HT2D 1MJ8L 3LN9A 5DTFA 4AQOA 4X8XA 4FQ2H 1AGDA 1Q72L 4M5ZL 4H20L 3MRBB 1JRHL 5I30L 4HK3J 1OAYL 2J6EA 3P4MA 3UO1H 3MMEA 2ICWA 3KAAA 4V1DB 4W6WB 1FVCA 4NO0D 1V7NL 4OZGF 1MFDL 3OJVC 1N6UA 2XQBH 1F58L 4L29B 3R4DA 3BN3B 4OQTA 3VA2C 3PWUB 2DQJL 1SY6L 4PJXE 1BIHA 3HAEA 1T1YA 4JJ5B 4ZOEA 1KPUB 5C0ND 2H32H 2JJSC 5CKGA 3RI5F 3TBWB 3T2NL 2FJFB 1PBYA 4RIRB 3HRPA 3I02A 4GKSA 3ROOA 2LABA 5DD5L 4JQIH 3MRCA 3WKML 2C7UB 5HGHB 1LWRA 5J89A 4E0RB 3UBXB 2DLFH 3BHBA 1K85A 2F19L 4XT1C 4HG4J 4D9QD 5ILTH 4ZNEE 1KELL 3JWOH 4BUHA 2RHEA 3H0TB 3MGTA 3PG2A 4UT6L 4WWKC 1ND0A 1S7RB 1YNKH 4YH6A 1HWGB 2N7AA 3PNWA 4Y5YB 1AHWC 4PD4J 1IC7L 3KPOA 4MB5A 3L9RB 1UWGH 4DTGH 2UV3A 3QXDA 1C5DA 3IU3A 5L88L 5D7JC 2IMNA 4V1DD 4QT5A 4HPYL 5EIQA 2J88L 1U9KA 5KVDL 3L7FA 1B6DA 5I1EL 3CDGA 1YN6B 4M7ZC 5F1SA 4YWGL 3RWIB 2WBJC 2X4TA 2Y9RT 1IAOB 5EU4B 3NFNA 1UJTA 1MCRA 4HDIB 4XC3H 4OZFB 4HV8B 5CEYB 1MLBA 5EUOF 2QLVB 1TITA 2VDPL 3ULSB 3H9SB 5DSCA 4Z76A 3GJEB 5FUZL 3HE7B 3OKKB 4QGYA 5BW7C 2G5RA 4KGJA 3LH2L 2ICCA 2HTLD 2AW2A 5FYLD 2BVQA 1J9CT 1GYAA 1NJ9A 1GC1C 3V4VH 2XKUA 4U1HB 3QDJB 1U93B 1G6VK 4GMTH 4KKCD 5F9WB 1X5IA 4HUVB 1HQRB 1QEWA 3C5ZC 1C12A 1IAIL 4LRIC 1GVIA 2FBOJ 4X6DF 4ZFOA 3GJFA 1MI5E 1T2JA 4YFLI 3IDJB 4N1CA 4ETQA 1ED3A 4I0PB 3CVHL 3LQMA 2CXGA 1A02N 5E9DD 3TC9A 4MA7H 3MRJB 2BP3A 4KK9D 4YR6A 3STBA 1GGUA 4S10A 1UCBL 1A14H 4FFYH 5HDLA 6FABL 3NIDF 3PDOB 1FFOA 2HTLC 1YNLL 1FL6B 9CGTA 3GUTA 1NBQA 1KJVA 4ZOCA 4E9LA 1HSBB 1TZIA 3B5HA 4IDLA 3WFEL 4ZSOA 5JORB 3WNOA 3ET9F 4EUPB 2WP3O 2EDLA 2AQ1A 4DFIA 1VHPA 4TNWF 3S37X 4HUUA 3L3DA 5I8OH 1T1ZA 4LSQH 2GAZA 4MJID 4XC1H 4YHYB 2XTJD 4NC1E 4NQVB 2IBZY 5J3HD 5F3BB 3EUUA 3TBSA 3RJQB 3HUJF 2AP2A 3RVVC 1A6PA 4HX1B 4UOJA 4LDLB 4AM0A 1EEZB 2R1WB 1J0HA 4KI5F 3O9WD 4U3HA 3K46A 1J12A 4UDUA 4L4VD 4WUUD 1IVLA 4WO4B 5D7SL 3VG0L 3RPIA 2V2TB 2WBJD 4DAGL 3GSUB 4UT9L 1NGYB 1MRCL 4AT6B 3O2DL 3IGAA 4L4TD 5CLWA 5IFHL 3MJ7B 2XTJC 4KDTC 2FO4A 3KPSE 3B5TA 3OPZH 3LPFA 4HXBH 1CT8B 3WFDL 3OF6D 3CJJA 3TBSB 4PRBA 3F6LA 5F3BA 2P49B 5LGHL 5E7BA 2NY4B 3RX8A 4R9HA 5IQ9B 4KTDH 4NRXA 3HR6A 3G6JF 3KGRA 3OB8A 4YDJA 4LQ1A 4Y5XA 1YY8A 1S5IL 1Z9LA 5D2LB 3L6FA 4F9LC 5HVHB 4XAWH 4OF7A 4PJ5A 4YC2C 4G6MH 1T0MB 2CR3A 2J8UA 3DUUA 3IRZA 1ZAGA 1BWMA 2R4SL 3S36L 3V95A 1RULL 5HDQH 1E4WL 5JUEH 1S9XB 1BJ8A 5IB4A 2QQKL 3BKYH 3G6JE 4FZEL 1X5KA 3ILQD 5LAXA 2XOTA 3KPNA 2D03H 3OR6B 3LKRB 1R3KB 5D7LE 4TTGA 4AL8H 1N5YL 1RIHL 1N2RB 4N8VG 2WBJA 2GFBA 4PRID 3ARBD 4JFED 5HHXH 4QXWA 1X5ZA 4RCAA 5D4QA 1CD9B 3WFCH 1ZS8B 1T2QL 3VWJA 5LGKA 4PJEB 2JK5A 5E2WL 1R0AL 2GSIA 3JXAA 4GG6A 1QBMH 3U48A 2KL6A 3MSPA 4M4RA 4TUOB 5IJVB 5ABDE 2PW1B 3LHPL 5DC0A 3ULSA 3JV6B 1FO0L 3O9WB 1IGJA 4NCC2 5A2JH 2YXFA 5M7QA 5C07A 2X4PA 1KTRL 1X7QA 2WANA 3O9WC 4DVBB 2AXFB 4ZSOE 4PRHA 4FXKB 3B9DA 4Y8AA 1A7BA 5IBUB 4P48A 3QXWA 4TSCL 4X8JA 1JP5A 4KJQC 1MFEH 1KC5L 3WE6B 4M6OH 4XMKL 5IKCB 4MJ4A 3PDGA 4ZO6A 3CNKA 2HFEA 4MDIB 1TJIH 4G6AC 1NKOA 4K71B 5I15L 1B90A 1KBGH 5FA3A 2B4CL 3IJHA 5AG9A 1AD0A 1OQXA 2IQAB 1VFBA 2A6KB 5E2WH 1R0AH 3FN0H 5CD3B 5E08H 3SGJC 2OL3A 1RUAH 2NY5L 3WDJA 1D7FA 25C8L 2VQ1B 5IWLC 3ROLA 5IF0A 1H8OA 1VFBB 1C7SA 3EDKA 3RGVB 4IJ3B 3SJVD 1OGTB 3SDDD 3BT2H 3L3JA 1JZ8A 3C8HA 1V05A 2A6KA 1BQSA 2IQAA 5EWIL 5BV7C 2ICWB 2OR9L 4RGOL 2HA1A 3BI9X 2EXYD 4GAYB 4KKAC 4ORGB 5EO0A 1T1WA 5DJCB 3TIDB 3VWKC 3GSOB 3OWEA 2O5YL 3IETA 2H26B 5DD6B 2A1WL 1KJ2H 3A6BH 2W0KA 1J11A 2X42A 1G9NH 1X6NA 1L7TL 1A3LL 1M71B 3REWB 4X5WB 4MAUH 3V5DA 2OMBA 4L4TA 4MXVF 5C7XL 3U36B 2Y06H 4X4ZA 2E3VA 5CSBA 5ITFB 3VFMB 3EYFA 5DR5L 4X80H 4M48L 4GBXA 5ESVA 1PZ5A 3KPMA 4TUKL 4DAGH 4KJQD 3LKRA 3BUTA 5IFJA 3BYTA 4R0LB 3DHMA 4S2SA 4M7ZB 1II4E 1UWEH 3CUPA 4M7LT 2CLVB 1NAKH 2APTA 4O5LL 3QUYD 4J4PA 5DFWH 4MA3A 4S0SD 4X6CB 5DJDB 2NX5D 5F1NB 2F58L 3BP4B 1CICC 1R5WB 4LLAA 3RGHA 2NY0D 1A9EB 3NPSB 1QRND 4RNRB 3MRFA 4CVWA 3TO4C 1P2CB 2X40A 1LO4H 2IAMA 1S9XA 4Z7VE 1JUFA 3MXWH 4BFIA 4R0LA 1XIWA 2Q8AH 2VDQH 4PJAE 2BY0A 4WFHE 4YO0A 2HAZA 4FFWD 1EEQA 3QUYC 5KVMC 3IFNH 5EB9A 4U6HB 1UCBH 5HHMD 1NCAL 1KV3A 1ACYH 1KN4L 4GLRI 1UXWA 2Z92B 4OF8A 1OT1A 4JFHD 3CVHH 1H15A 3D39A 4WU7A 3MOQA 3OB0H 5LGJA 1DANU 3UDWC 1OAQH 3AREA 3O3DA 4PJBE 4M61B 4HUWA 1FN4A 5DDHA 2W91A 1ZHBA 4HK0B 3LS4L 3O0RL 1S7SA 2RR3A 1BX2A 3KPPA 3L3HA 1AR2A 3MRMB 5ANME 5CEZL 4LOUC 4D9QE 2OK0H 1PX4A 1MCKA 4Z0BL 3VXUA 3OMZA 1T20B 3Q0HA 2YD5A 4YWGH 4MXWH 2AAVA 1QA9B 2ENSA 1NC2D 3FQUB 1IGTA 2OSLB 3HC4L 3VFSB 3WLWC 4CDGC 3BPNB 3QUKB 1JGLH 1BZ9B 3IFPA 1P4BL 3FQWB 4BQCA 2OJZH 2XTJB 3SO3B 2X70A 1IC7H 2XG4A 2DYPA 4M7LL 3C87A 3SJVA 1E28A 2NY5C 4LEXH 5FCUH 2YD1A 1EVTC 1F4YL 5TPWH 1RIUH 3EOBA 3ARGB 1F5WA 3O2WH 2VUYA 1VACB 1CF8L 4LGRB 4XTRC 1ERNA 1G9MH 3T8XB 1CDCA 3T65B 1XF5A 5MEPB 2OSLA 5F1OB 4ENEC 4UU9A 4QHKJ 4UV7H 4KFZC 2KPNA 4TUJA 3T2NH 1PKQE 5I1CH 2P7TB 2HVKB 1FAKT 2GSGA 4PIRF 5SWSD 4XPFH 3RNKB 4BK5A 2IANA 1NC2B 1NCAH 3G5XA 4ZUWA 1AO7D 4OF6A 1KSRA 2D3VA 4YHZH 4FQXD 5GIRA 3HHRB 1U95B 2QKIA 5IHUH 1WF5A 2WBKA 5I19L 1U3JA 5I2IA 3QUMH 1JRHH 1QP1A 1RZGB 3L9RA 1WZKA 1NCDH 2PTTB 1HCFX 4NKOB 3T0DA 4X4XA 3PHQA 2GJ6E 4KUCF 2UYLA 2O61A 5D1QD 3G5VB 1JYVA 3BESR 4JHZA 4Y4KD 2WBJB 2ZUQC 4GQ9L 4LOUD 2QSQA 4LLQA 1Y0LA 5IBTH 3VWKB 4G8EA 2PR4H 3D85B 1Q9WB 3P9MA 4FQXC 4I4WA 4MLSA 4PJXF 1GAFL 5F7EH 3GRWA 5JQ6L 5D72H 4NP4H 4OZIB 3LY6A 3GSNL 5BVPH 5FYJD 3HFMH 3MBXL 2VL5B 4C55A 3QUXB 3MCKA 1ORSA 1OTUC 2B4CC 3QWOB 1FG9C 3S34L 3QXVA 4QXTA 2MSPA 3W9DB 3UTSD 1MCDA 5CWSA 2XZZA 1Q9KA 2Y06L 3QIUB 3RKDC 4JG0H 5F9DC 3ARSA 4LEOA 1N64H 4NQDE 1VPOH 4WTWA 4XTRD 2IH3B 4CKVX 1GPOH 2ICWI 4OF5A 5L7XH 5DLMH 5JMRA 2DQCL 1RJYA 4X7SL 2QADC 3RVWD 1HXMB 1ZHBB 4FNLH 1G7IA 2A6IA 4KMQA 3GSRB 3QJHB 4RGOH 4QRPD 2ADIB 5L6YH 1Q9OB 1QFPA 1AXIB 2CXKA 4XBGB 1QSFA 1UKTA 3OZ9L 3MUGA 2C4XA 1A4KB 4AH2B 3AU1B 5FV2A 3MV9D 3U4AA 5DA0B 1YPZE 2JK5B 1RY7B 5C8JB 2RJMA 3OF6A 4YHML 1NEZA 4G3YL 1FPTL 4R97B 4C83A 5MEQA 4PJHA 4HUUB 25C8H 2V7HA 3RUGF 1N59B 4ZTPL 5I1JH 2XQYK 3OHXA 5D1QC 4P3WA 3MLZH 4TULH 5IW6B 2H3NB 3V5HA 1K3ZA 3D2UD 3FJTA 3D3VD 4N0YH 1V3KA 1KXTB 3LQAH 3ARFC 4LEOB 3ARED 4KQ4L 4PGEB 3WJJA 5B4MC 4WTXA 4FHBD 3LRGA 2VXQL 4BSVB 1AGEB 1JF1A 1KB5B 1OGTA 3MRJA 4G6KH 2I5YH 3OG6B 1OGAD 4XPAH 4LP5A 2IJ0C 1KC5H 2CDFA 1OTTD 1XCTA 5EBMA 1N59A 1DQQA 3T4YA 4YDKH 4PG2A 5FYKH 5JR1H 2WLZA 4P2YA 4RRPA 4S0TD 4Y4HC 1NFDA 4M1CC 2VMFA 4PLJD 3KVQA 1ZSDA 3RGVD 2ZUQB 3VMPA 4JFPA 5TQ0H 1A2YB 1PZUB 3JTTA 4L4TB 1HINH 2YD9A 1KCUH 5I74C 3X3FL 1NFKA 3U7WL 5DRZA 3HE7C 3IETB 5LXGH 1K4CA 3PQYA 1V7ML 3WFCL 3QDMA 3BO8A 2J6EL 4UDUB 5IEKB 1RUPL 1FP5A 1VEOA 1X7QB 4PG9B 1U95A 2QKIB 1BFTA 3OSKA 3RUGB 4PD4K 4NNPL 3QG6B 4ONGH 4ZUUB 3F58H 2HVKA 4QXTB 4OLYL 3VWJC 3HC3L 2ICEA 4HKZA 4MS8C 4QWWD 3VXRE 1UM4H 3KR3L 2E6QA 1X6LA 2DJ4A 4XAWL 3BHBB 3S37L 1FL5B 5L7XL 2Y07H 5T3ZL 3KJ4C 2VLLB 1E4JA 4KPHH 5GGRA 2P44B 1CFSA 3UTOA 5AWNL 4ZFFB 1HWHB 2R2CA 2YA0A 5IWLA 2VLRA 1I8IA 2BY3A 1RU9H 3H7LA 4GRLB 2DQUH 1T0NA 3RTQB 5D6CA 1C7TA 1JTTA 4ZPTA 1NGXA 4PJIA 5D1ZD 1HI6A 1ZV5A 3NA9L 1RV6X 3SGKA 3TA3B 3QDJA 3GSNH 4U33A 5BVPL 1I7RA 2IADB 3VXQA 4RWHA 3CFCH 1U3HC 5C8JA 1UM5H 1D9KC 1T20A 2G75B 4NN5B 4NFBA 3B9VA 4U1JA 2AJSH 1JGDB 2H9GB 2J8HA 3WKNA 5IBLD 2CGRL 4K9EH 1I1CA 5HBBA 2HFTA 3IJSB 5JMOC 2EZ0D 1VCAA 2CO6B 4XNMB 3GO1L 3HZYB 4Q9QL 3DYPA 2X4UB 2UWEF 2X4QA 3W2DL 3BW9A 2JTDA 3EO9L 1LD9B 1GSMA 1AO7B 3KYNA 4LKCA 1JCKA 2R0WL 3HG1E 1T5XA 1L6XA 3IJYB 2GY5A 3FFCE 1IJ9A 1DANT 1UG9A 2WUBL 1G0DA 4J12A 2HTKD 3S8WA 3HCVB 3DPBA 3SJVB 4PR5A 1O0VA 2X70B 3FB5A 4JFXA 1JNLL 2R2EA 3O6LL 3BD3A 5ANMB 3BIKA 5FYKE 4DN3H 1U8OB 1U8MB 3O3EB 4IRZH 2JB5H 4LHUB 3ULUH 3NFPA 3BZEB 4B41A 4XPHL 3CMOL 2OI9C 5DJZA 4JY5L 3HS0B 3X11B 2HKFL 3LH2H 3LKOB 1FZKB 2VLKB 3KDMB 3P2TA 5FK9B 2FH6A 4G6JH 4LEXL 4DK6A 4UQ3A 4WI6A 1DDHA 1HHIA 2XTJE 3WHXB 3WD5L 4IRSC 4LSRL 3GSUA 2AEQH 5L8LB 3FT2A 1CG9A 4GMSL 4GW1A 4HUNB 5ALBH 4D9RD 4HT1H 1W8NA 5IW1B 1U8QA 2FEDC 2E7MA 5E8PA 1JFQL 2W07A 2YK1H 5DHVH 1BIIB 1FNSL 4LVHB 5CEXA 3GBNL 5MI0B 2AJZA 4X6BA 3IU4H 2BOBA 3QZWB 3VDAA 1EBPA 1OM3H 1NDGA 3MRDA 4JM2C 2O5XH 2HG5B 4P4KB 5C0DB 3U0WH 2NXYD 3O6MH 3QJFA 4P23B 5LKNA 1G7LB 3R1GL 4J3UA 2A83B 4ZOAA 2X1WL 4PBXA 1RHHA 4RAVA 5FUCE 5MEPA 4I0CC 2FIKB 5F7UA 2CK0H 3NN8A 2MPAL 4UILH 5GISL 3HI5L 5GS2H 2R69H 2B39A 4GH7B 3AXLA 1LMKA 4AG4L 1C5CH 4J3WA 1RFDL 4C4KT 2NY7L 1MHCA 3CVHB 4ORZC 3TPUA 3SBWC 2O5ZH 5JLZA 1Q9LA 3RGVA 1D9KA 1BQHA 5EOTA 5CCKH 4YK4C 3VXRD 1BVLA 2EIDA 3VXME 1EZVY 2HN7B 4WW2C 1BEYH 4JRXA 5J6GA 2FYYB 3NMEA 4L3ED 4XP5H 5HD8D 1INDL 2IPUG 4JG1L 4Z78B 1SEBB 4Y19B 3GK8L 4F7EA 1AD9B 1BVKA 4NOBA 5LJYH 1UJ3B 3G5ZA 4OCRL 1FYTA 1IZKA 4P46D 3IXTB 4R26L 5KVEH 3O6FB 5E5MA 1Q0XL 4NQTA 4XCCL 1TNMA 4M5YH 5CCKL 1CDHA 5DK0B 3DV6A 4TUKH 3RWEA 5E6IA 5GGSA 4WHYG 3TVMD 2Y36L 1C5DB 3IU3B 3ALPA 4OLWL 4OB5L 3O8XA 4WTZA 4DQOH 5CZXD 3D2UA 4FFVD 3MBED 3L3KA 5C08D 3S3SA 4XPGH 3LQAC 4MHHG 5DHVB 1QRKA 4LCUA 4P4KD 4PTTA 2H6PB 3N0PB 4QRPB 3KPRD 2W60B 4R90H 3I6LE 3TIEB 1NBYA 1TJHH 4QCIA 4MAUL 3OAUH 3VGAC 5J12B 3MR9A 4I3SL 1L4IA 3NCMA 4HUXA 4BFEA 5HGAB 4O58H 3QXTA 1DQJA 3I9GL 4MYWB 2FB4L 1G1YA 1NMBH 4EI5B 5IB2B 4Z7WE 2IFFL 4L8BA 4QCIB 2AXGA 2R1XB 2RFXB 1DQQB 4XP4L 4FFVC 1XH3B 4PJHF 5EBWB 2OTWA 1RZ7H 5KG9A 1DVFA 3JWDC 3VRJA 1JF6A 3GHBL 5A1AA 2BSSB 3M07A 3CZFB 4ZO7A 1FGNH 3EZJB 3PWNA 4X6CF 3KXFD 1KCRH 4FP8H 3QWQB 2J8UB 3DUUB 3RVXC 4AEIL 3CLEL 5AZ2L 1FVCB 1EXUB 3WIHH 3G9AB 1IGYA 4LSRH 4OGAD 4L4VA 4ZUSB 2EDKA 3K2UH 4ZFOL 5CZVH 1OAXH 5DRWA 4Z5RA 4FS0A 5GRVL 2VXUH 4GAGH 3TNNA 3WS6C 3BZFB 5DQ9A 4QHUA 1PYWB 4U6YB 3IDGB 5E2TL 4RA3A 1PX3A 4OZGE 4HC1H 4JQXC 1Q94A 4RFNC 3VI4F 4BA8A 5I76B 4P3DA 3QBTB 3PQYD 4QRQA 3QDME 4J3XA 1WWWX 1NGYA 1WT5C 1BMGA 4H88L 4M1DL 5EU6A 3PWPB 3CFJA 4PJ7A 4NYLA 1WFTA 4O2CA 1NSNH 2NW3A 4K94H 5D96C 5C6WH 1I4FB 1DUYB 3BEVB 3ARDC 3K1KC 4L5FH 2WUBH 2EXWD 3SDCD 5JHLL 1ORSB 1QBML 4OIBA 5F7FA 3ULVL 4PJ5E 2VR4A 4MXQD 4HJJH 4RWYH 3W0WA 3QXAB 1C1EH 1EO8L 1YY9C 2VXSL 4Q9QH 4B50A 4JO2L 2IALB 4Q9CA 4XMLH 2XACC 3CSYB 2CJUH 4AL8L 4HCRA 3QIBB 3GFUA 5I17A 4K9EL 3BKYL 5D6DC 4KXZH 5JHDE 3N9GL 4POUB 1K4DB 3D85A 1MPAL 3F7QA 3S36H 2R4SH 2HFEB 1BOGB 1E4XL 2B5IC 4TSAL 3VRIA 3QDJD 3PUCA 3CXDL 1CGVA 1JYXA 1J1XL 4ODSL 1NC4B 3IAPA 4EDWH 4PJCE 3G5ZB 3C08H 4X4XB 3E6FB 2JJSA 4LSSL 1NJ9B 2Q6WB 3HC0A 3JUZA 1SJEB 1DUZA 5FV1L 3T0WA 5GSVA 4GW4A 3ILPA 5EOCL 1F3DJ 3H9SA 3DROA 4OLVH 3WS3B 4Y16B 3DMMB 1TQCB 1DVFD 3VXQB 4NN7C 4P5TB 1J0IA 3O2DH 5EUKA 5IFHH 3SOBH 4WENB 4IOIA 2FHCA 4BSWB 4UT9H 4XNQB 5IROC 5SWZE 4U0RC 1E6JL 5D7SH 3TFKD 1OGAB 4QT5B 2JIXD 2ICWJ 3T2OA 4HWZA 4PB0L 5ESQB 3GBML 5JPMA 3ARDD 4Z7UF 3OR6A 5F7HA 3TN0D 4GXUM 5C70A 1A7PL 1ZLWK 1XGTA 5E8DH 1JV5B 1R24A 3WL9A 3JWNC 1EHXA 2ED8A 3V0VB 4N9OB 3FL7A 1UACH 5CJOL 4NWTH 5EUKB 4P5TA 2HLAA 4UTAH 4R8WH 3LD8C 1DTUA 5DF0A 1C1EL 1EO8H 2IBGA 4LRNL 4WO4D 4ZNCD 3IF1B 2XN9B 2HG5A 3GHEH 3CU7A 1F6FB 3GDBA 2MOVA 3TBTA 4QHMA 3LDBC 5EU5B 3ULUD 4JPVL 3ZYOA 1UT9A 3UPRA 5JNYA 3DJ9A 2IG2H 5EOQH 3LIZH 1MFNA 5JR1L 5DVMA 4HGMA 4XPTH 1QTYT 3BP7A 3EYQD 3ULVE 4NKMB 4L3AA 5DRZB 1MVFA 1W0WB 1ZT4A 2BMKB 2CKBB 1D5IH 3HZMB 5EU7C 5D2LE 4U1MA 1A1NB 4XB8A 4K23L 4YHNB 5HHPB 3EBAA 4GRLA 3RTQA 4WUKL 5HHME 4PBVC 3GGWB 3O45A 3LKOA 3QUZA 4GAGL 2BZDA 2VXUL 1ND0B 1S7RA 4JCLA 1LP9F 2FSEA 1DVFC 1P9MC 4NQVA 1IQWL 4JO3H 4PRIB 4A6YA 3BH9A 3VW3H 2C7UA 4F8TA 4LL9A 1KCRL 4HKZB 3TFKC 1AI1L 3C60C 1FGNL 4PR5B 1XIWB 2DBLH 2ZUXA 1F3RB 3MRNB 5JOFB 2HFFB 3JTSB 4PJAA 1NLDH 4MA3B 2VWEE 4F7PB 1SBBA 5DUPH 3SO5A 1B4JH 3PWUA 1OOAA 1FQ9C 1M7IB 1FAIH 1FBIL 2DIAA 4LPXA 2HJLB 3VXNA 4DGYH 3WFBH 1DBKL 2EKSB 3SGKC 1G7QB 4JQIL 3GMPB 5MP6H 1EHAA 1HQRA 2LU7A 1GC1H 3MLRH 4ACPA 2XI9A 4S2SB 4XNYH 4ONFH 3WDHA 3D9AL 3Q1SL 3VGBA 1A2YA 1E4XI 3ZKXB 1LQSR 3OKKA 2F5AL 5F9OL 3PWLA 1JN6A 4R7NB 2ERJB 2ZUWA 4F37F 3CFEA 5I1DB 4AMKL 4ODXA 3VA6A 1LO3H 1FYTD 1S9KC 3H9HA 2YUVA 4CU7A 2J12B 3K74B 3FT3A 4AZ8A 5EO1A 1OAYH 2Z9TA 4NJ9H 2W38A 1T6VN 1CWVA 1X4YA 3MBXH 1G7QA 3JV4A 3W9EA 2R0ZH 4HGKC 4GXVH 1IAIM 4CVXB 3O3AB 5GHWH 5FM4A 1B0RA 3WUZA 5IESH 3X3GH 5HPMA 5CAYB 4IS6B 1KG0A 3HE6B 3PF2A 4OCNC 5ICXB 1YMHA 1WTGT 2BDNH 2YMXH 4LSPH 4M00A 2AEIT 3HLAB 4JG1H 5DK2A 5CBEA 3BZEA 3WXVH 5KG9B 1A6VL 4DWHA 3VJ6B 3CAFA 3RVTD 5BVJB 1CGXA 3ZE2F 3UXFA 4UDTA 1FE8H 32C2B 3NPZB 1F2XK 1AH1A 3ZTNH 4EI5A 5IB2A 2WK2A 1CS6A 5BRZE 4L8BB 3QUML 2FJHA 4OFPA 1ZT1A 5HYQA 3ESUF 3NOIA 2VLJA 4KK6C 2BHZA 4EN3A 4R7DB 4AG4H 3ZYZA 3SKOA 4UQ2B 3TO4D 4OCXH 3VWKA 1HN1A 1MY5A 4EKXA 1W8OA 1MHEA 5DI8B 4PRIA 4Z7WF 3T4AA 1HKLL 5KVGL 1AKJB 1CXEA 4D0BA 4N8CH 2HJKB 2PYEB 4U1MB 1YMMD 5DHVA 5F8QC 3V8CA 5I1CL 1JNJA 5EO9A 1T83C 3DBXA 3RVTC 3QA3A 4I18C 3GGWA 4TNWK 4LVNB 2NLJB 3BDXA 1GC1L 4FFWC 1SYVA 3HNSH 3MRBA 4U1SA 4JRXE 3FKUS 1AD9A 3ARBB 3MV11 1YEIH 4HCRL 1HNFA 2ZPKH 1MVUB 4W4NA 5ADOL 1RIUL 5E5MB 3QHZH 3V79C 5IFAL 5DWUH 3T1FA 2DN7A 4YHKH 5K93A 3ARFA 4OLXH 3P40A 4FQ1L 1JFQH 2BJML 5A40E 2GUOA 2F8OA 2FYYA 3X14A 4TUOA 4LDOB 2F53B 4ZPTB 3FN9A 1G7MB 3SKOB 3T65A 1CICD 1QSZA 1CZ8H 3V0WL 1I3RA 2EC8A 1IQWH 1BJ1H 4PJEA 2ARJB 1Y0LB 2VZTA 1I8LA 1GGCH 2FIKA 3VXRB 3B9EA 12E8H 1DBAL 1CL7L 3Q2CA 4HD9A 1FVDA 3TBYA 4Q2ZB 5CJ5A 1LE5A 2RGSA 3KPRB 4IS6A 1CFQA 4XPTL 5TF0A 4LSTH 3H9SE 1KT2A 1Q1JH 1A1MB 2YZ8A 3I2CL 5FDYA 5TE6H 4I2XA 3DMMA 3UP1A 2YA2A 2V17L 4FG6C 3F7PC 3DARA 3QIWC 2FX9L 1I8LC 1KCVL 1FGVH 3IDMB 3NACH 1JPST 1DEEB 2EDQA 4AEEA 4EDXB 1YC7A 1RK0B 3FOMA 1N3NA 4TYUA 3AMLA 1WUNT 3BDYH 1IGIL 3VCLA 4JZJA 1FFNA 3AREB 3W2DH 4R8WL 5E5UB 1YEJL 4F3FA 4UTAL 4K8RL 1WQVT 5BCAA 1LO4L 5FO9A 1JIBA 2MCPH 5KJRL 1IT9L 4KHXL 4PGBB 4Q9BA 4GRWE 4WU5B 1ZVHA 1AHWB 1IQDA 5EZOL 1OW0A 5IB3A 3ZE0F 5B39G 3R0MA 3WLWD 3L3DB 5IMOA 2KH2B 4WIQA 3E2HB 3KLDA 1BZ9A 3FQWA 1FZKA 2VLKA 1WCQA 1BQUA 5GGTH 5JOEA 1ONQA 1S7WB 4I0PD 4Y4KC 3U9PL 5FHBH 3NFPB 4AEFA 1QA9A 5HYQB 5C0RH 4YBLB 2JLLA 2GQHA 3BSZL 4YLQT 3VFUA 4KZEL 5HYSG 3OB0K 4PGCA 4JAMB 4LVHC 1FNLA 3B8YA 3EOAB 1RJCA 1SEQL 2PYFA 4ZS6C 3RNQA 4PLNC 1KOAA 1D6EB 1ZHNA 1ZA6B 5DR5H 4MZ3A 5CMAA 4R4BB 4OZ4A 3SE4A 4LSDA 3TT1L 4XVTH 3IT8D 5IVXB 1T21B 3GJFB 1PKQB 4JM2B 2NW3B 2DI8A 1PDKA 5ICXA 5EC2B 3GIZH 3JZ7A 3MYZA 4MSWA 5K9JL 1J5OH 1ZT7A 3KPMB 2WIMA 1BZ7A 3PWPA 3LB6D 4OGYL 3V4UH 4NZUH 1T22A 3SQOH 3X14B 3HE7A 1QSFB 3N9GH 3LSOB 1DQLL 3D69B 1G6RL 3F62A 5DRWB 5J8OA 2XN9E 1A4JB 2ZKHH 4G8GB 3IFOA 1NKRA 2CJUL 4MQ7A 1WZMA 1RAMA 2E8YA 3JWOC 5F6HI 5I1HL 2DQEL 4JFHE 1YEJH 4WI4A 2BK8A 3P9LA 5CGMA 5J56B 3BPNC 4HWNA 1TTGA 2HKHH 4GAFB 4QNPF 1H3GA 1HE7A 3EJJX 4Q97A 1TQBB 1FLTX 5F1NA 1FNGA 4L5FL 3PP4L 4X6DE 4OFDA 3VXRA 2OTWB 2VLRB 1RK1B 5EIIA 4LHUG 1QR1A 1QRNA 1WC7A 3CC5B 4ERSL 3VXTB 1J0ZA 4HAGA 4H88H 3V7AE 1C08A 2H8PB 2PN5A 3AREC 1I1RA 2FWOA 3ALWA 3A6CL 3DYOA 2JJWA 4GO6B 4K3GA 4LCYA 4QOKB 1W0VA 4XVUC 3SPVB 2ITCA 1GOFA 2HLFD 5LWYH 1WEJH 1CXKA 1KTDB 1S7UA 3GKWH 4DUWA 3PABA 3QUYA 3BAEL 3EAKA 4Y4HD 3NPSC 4RQQB 4YC2B 4FTVE 1PQZA 3CLEH 5AZ2H 1FYHB 3O8XB 4OAWA 2UZIL 1MWAL 4XVUD 3KLAB 4XH2A 4UNTA 1KCSH 2BJMH 2ITCB 4FQ1H 5MI0C 3DETC 2VE6A 4U31A 5JXED 1CE6A 3CX5K 4H26A 3P0VH 3JTTB 2R0LL 3VI3F 1QPXA 3LKPB 4YAQB 1URLA 3QEQB 2R4RH 4OQTH 3LN4A 5DLML 3G04B 5FYLL 2F54B 4M8QB 4Y19D 5SX4H 3I6GA 5CUSL 4QRPE 3OKYA 4MXVE 4QYOB 3K8KA 2R39A 2YBRA 1JBJA 1ZA3A 5HJ3A 5IVZA 2QADD 3BPCB 4Y89A 1KJ2B 3VXUD 3P9LB 4ZO8A 5C09E 4KK8D 1JHLL 4M1CD 4PP1C 3OGCA 4PLJC 3UYPA 4RAVB 1B0RB 3ARGC 4XP9H 2K1MA 5FOBA 1YEDA 2C1OA 4LPCA 1T5WA 2LU3A 4PGZA 4F7MA 3ZTNL 4EOWH 1A4KA 3BQUB 5HGGS 1IAKB 4UUJB 5I0DA 2A9NL 4G8FA 1HH9B 3BQUC 4H25A 4P5TC 4BH8A 4WHCA 4OCRH 5EBGA 4AIXA 1WT5A 4BZ1L 4KY1L 2B1HH 4UINH 1A4JA 4OD2A 5CGYD 5BZDB 4X5XA 1WWCA 2YMXL 1L0YA 4Q58C 4KK8C 2X1OA 3HR5B 1XR9A 1A1NA 2J2ZA 1HKFA 4NT6A 3ARGD 1CD8A 2ZNXA 2E7LA 2FH8A 2AVGA 1S7QB 2O5ZL 4WEBH 1RFDH 2UVFA 2EKSA 4RMUA 2EDTA 3VWJD 5D8JH 4I3RH 4HS3B 1GGTA 5IB5B 4JFZL 3ISWA 2Z8RA 4JRYB 5TFSL 1UB6B 3O6KH 4QLRA 1P1ZB 5CGYC 3WXWL 2AJXL 4GRWH 3ARPA 4YUEH 5J12C 3VGAB 1Z3GL 4KRLB 3RGVC 1T03L 2X4SB 1FG2B 3DTXA 5D2LA 2IALA 2VDKH 1BBJA 1EAJA 1YPZA 4PJBF 1BBDL 1DN0A 4YXHL 2HTKC 3WEXB 4DKAA 4I3GA 3UTTD 4PJ8B 5GS0H 3QIWA 3LZFH 4PGBA 1FFOB 3DX7B 2ATPB 4JFFE 4DKEH 1F42A 4BSJA 4PJBB 3U30C 1FZOB 5C0AE 2UY7A 3IFLH 1GRWA 1YUHA 2VAAA 1F3JB 4K7PH 3RPKA 1EGJH 1P4BH 3MRLA 4HT1L 2VDML 5HVFB 4GMSH 4ODUA 1MCFA 4XNQA 4BQBA 5DMGC 4IRJB 3VCLB 5L88H 4DVRL 4XCEB 3LEXB 4WW1B 5JIIA 3DO7A 1QVOB 4U7SA 1IC1A 5L2JA 4Z7NE 5K9QI 4G6JL 3UPRB 2L7UA 2BFVL 2AJYL 3RNKA 2LFGA 3FRUB 2V5TA 5AAWA 5JXAH 2DLEA 4NN6C 2WZPD 5GS0L 1S9VA 1D5IL 5ITBH 2FEDD 4ZG1A 4PYGA 4PJIE 1AIFA 4K8RD 4TNVF 1T7XA 4R4FL 4B7LA 3SJVE 5DD5H 1K8IA 3S96A 2GTZA 2C3VB 5B3JF 3O6LH 1LK3L 3MRQA 5ID0A 3CZJA 2HLAB 1BVLB 5KTEH 4YX2L 2CRMA 4PRAB 2OP4L 3WXWH 1SY6H 4MDJB 2ED9A 2NXYC 3AUVA 5TFSH 4EVNA 3CFDA 1H3WM 3DXAA 1ZANH 1ZLSL 1V7NH 4HLZH 2GJ6A 1Y18A 5B3JE 1D9KD 3BX7C 3GHEL 5CIPA 5DVNA 1OGAA 4K8RC 5D1ZB 3CSBA 5IBLC 2WW8A 4H20H 3P11L 3RQ3A 2BHYA 4JQVC 4IJ3C 1JGEB 4Y16D 5IUSA 4NWTL 3RDTB 3PHOB 2CPCA 2F53A 1HDMA 1YQVH 3KHOA 4FXGB 3UTQB 3BEWB 4BZ1H 4HV8A 4UMGA 3GBMH 1I7ZA 2CUMA 3O4OB 3GMQB 4PJ7F 4X7TA 4YHOH 3DVNB 2KZWA 1S7SB 1I9RL 5HD8C 1T04A 3QQ4A 5E2VL 2PW1A 4G8IB 1I3UA 1BPVA 4KZDH 5DEGA 3DRTB 2RIKA 3NAAH 1RU9L 4U6YA 3KJ6H 5F8RC 1ITCA 5D2NC 2OL3L 4YIQB 5FYLH 4ODBD 4EDWL 5HYIA 5T3ZH 4M6MH 1V5JA 4BKLA 3LEVH 3GSNA 4O4YL 1QFOA 4OZHE 4G8GE 1MEXH 5HHMB 1UM4L 3KR3H 4DKFH 4S1RL 1JUFB 3BWAB 4OLYH 5DQJA 1T1YB 2OR9H 4JJ5A 1GZQA 5B8CB 4JFDB 5D1XC 2EE6A 3TJEH 4NNPH 2D4FA 3EO0A 3W11D 1AJ7L 1H8SA 3SE9H 3QG7L 1I7UB 4EUPG 2DQFA 1MUJA 2I07A 1MREL 1KLUB 2CKBH 1X4ZA 3F65A 4MA8L 3HPLB 1D5BA 1QZ1A 4PJFA 3MNWA 4OIIL 3NCJL 3S6CA 1AGDB 3LN4B 2HFGH 2CIIA 5C2BH 3RL1B 5I1DA 4IMKA 1MSPA 5FHAL 5L9DL 4F80A 4QRQB 1DQJB 5ADPH 4PP2A 3SDXA 2B2XH 4HJGB 1EIBA 2BRRL 4QY8B 1N4XL 3OKOA 5GQBA 3LKSA 1MLCA 4J6RL 3EYUL 4UIKH 2B4CH 3RI5K 2EICA 2R56L 1LK2B 4Q0XH 3MFGB 3OV6A 5CJBA 5MEND 1LP9E 1MFAL 2JCCB 2BC4A 5DQDH 1MF2L 1RJYB 2WWKO 4JDZB 1IBGL 5F89B 3P3YA 5IB1A 1JZ7A 4M1DH 4WV1A 3MBEC 5FYKL 4X5WA 4PJAF 1IKFH 1LNUA 3FT4B 2WM0A 5IJKC 2FD6H 5DK0A 5CINL 3TH4T 5J0BA 5I75B 3UTQA 3QUZC 5C0FA 3HRZA 3G08A 5EO0B 3QPQC 1N5AA 1MFAH 5E2TH 3L5JA 1KLUA 5T33L 4JKKA 4AIZA 3LHPH 3QNZB 1WCBA 4J6RH 4AENA 4KQ4H 5HDOA 2ID5A 4MCZA 2Q7NA 1C16A 1HDMB 2IAND 2VL5A 4JB9H 2RFXA 4KUZH 3OTTA 1HSBA 2DKMA 4Y2OA 3CSGA 5F7DB 5C9KA 4OKVA 5HHXL 3EFDL 1G7PB 5TQ2H 4FP8L 2FJFA 4RIRA 1YEKH 3P9WB 3PL6A 1XGQA 3BIBX 3MTRA 4M6AA 4MA8H 2Y72A 3V6OE 2LVCA 1AXTH 3QG7H 2G5BB 1ZEAL 4ETQB 2OI9B 4YHLH 3N85H 4K2UH 2R0KH 1CLCA 3MRRB 3E6HA 3ARWA 5FF6A 4PRAA 5C0NC 5KSAC 2L7JA 1KYOK 4MDIA 4U1IA 4ZUTB 4ZOBA 1NCTA 4EIZC 1AFVH 1YEFL 1U8IB 2O26U 2Z31A 4EN3C 3DX6A 3GJEA 4NZJA 1XGRA 2BHUA 2BNQB 2CQVA 2AKRA 5HGBA 4JFEB 5LGHH 4XPGL 4YXLL 2AGJL 2NZIA 5TJWK 1JJUA 4JRXB 2JJUA 3FQNA 3TBTB 5E2VH 4R6UA 1YEEH 4LPTA 5C0EA 3NABL 3NIFF 2P24A 2EDOA 4NP4L 1F45A 2V6HA 1WC7B 4H8WH 3FAWA 1CD1A 1CGWA 3FO1A 3FB6B 4X4YA 3RVXD 3V5KA 4MXQC 1LE9A 2P8MB 2Y5TB 3VFTA 5DURD 2IH1A 5DMIH 4QEGA 1HEZB 1JPGB 5HVWA 1SBSL 1UVQB 3BP6B 5FUOH 4YDJB 2OJEA 4JREC 2FEEL 2D7QA 1U6AL 1CXIA 1P4LB 4N8PA 1S9VB 1CT8A 1BVZA 3FQUA 2RQ8A 3QO1B 3SDAB 4XHJC 4M3JA 4R4NC 4PJCB 4XPFL 5FO8B 3HI5H 2D7TL 2NW2B 5C0FB 5L2JB 3V2AR 2V17H 4X9GA 35C8H 1P69B 4MQXD 3HC0B 2V5YA 2Q6WA 3E8UL 4NKQB 1QLEH 5C0AB 4M02A 1A7OH 3FN3A 4Z8FL 1MHPL 1HXMA 4XZUB 5TE7H 2DICA 3UEZA 1J1OH 5F9JB 3CX2A 3SDAA 5F96L 5D96B 4L9DA 5JW5A 5IM7A 3TZVB 3WN5B 1CL7H 1A6AA 4K7PX 4RZCB 4ONHB 43CAB 1P7QA 5IK3A 3GBNH 3OAZH 4GQPH 2UZYB 5FGSA 2BRQA 4R7DA 1LO0L 4F33A 2C1OB 4WI8A 4HKXA 3WJLA 3VFUB 5E9DB 4FABH 3TESA 1FLRL 1CFNB 4NIKB 4XB7A 3GUTB 3M17B 4NUGL 5ETUA 1U8MA 3HC4H 3O3EA 1FCGA 5E94A 5EZLB 5IOPA 2XA8H 2WIIB 1TXKA 4CN4A 1HCVA 3WNLA 5JW4R 1EGJL 3R8QA 5HVHC 3DGCR 3WS6A 4G9FD 4ZDHA 1MCNA 4ZFZA 3HAEH 2FGWL 4GW5B 3HLAA 5FYJL 4P2RD 3I6GB 1QSED 1AGCA 2L4OA 3L95B 5IFAH 1QEWB 1UXSB 5E70A 1MRDH 1TVHA 2ZPKL 2HKFH 3J7HA 3JWOL 5KS9E 5IMMA 4XPHH 3IDJA 1OF2A 3TYFB 1KB9K 1NUFA 4YXHH 2NNAA 1JTOA 1DBJL 4JGMA 3HZVA 3ULUC 5DJYA 4EEEA 1HZHH 2QBWA 4PJDA 4MJ5A 1KIPA 4MZ2A 4IRSB 2YWZA 4O9HH 1XR9B 4Y4FC 3A67L 4S1QL 3JVGA 1KN4H 4Z76B 3UZQA 1ZHLB 4L4VB 3BVNA 4PJXB 4OCXL 1MFDH 2NR6C 1J0YA 3FQRB 4HWBH 3CLFH 1V3MA 3LOWA 5T1MA 2Q8BH 1XR8B 3MJGX 1T7WA 4LARL 1VGKA 4LVEA 5DT1H 2M26A 3MV8D 4M5ZH 4OSUL 2DIBA 4LCWE 2LAGB 4U6VL 5E03A 4JR9H 3BGMB 5EUOE 1GHFL 3JV5A 3FB7B 5EU6D 4HZAA 5C0CB 3SPVA 4Q74A 7FABL 1MCEA 2OXHA 1I1AB 3QIUC 4NHCH 5J1AB 5D7KD 1KTDA 3GSVB 4QRUB 5HYJB 3VXMB 4NUJA 3UZEA 1A6WL 3MLUL 4L1DA 3D48R 2EH7L 2V9QA 2FJHB 5FB8B 4U6XA 3CCHB 1G7MA 2XY1A 3T08A 3U9UA 4EOWL 2VSCA 1BD2E 1WICA 1YN7B 3ROOB 5DJ6B 4P9HH 1EFXA 4XP6L 1WZLA 1A6TB 4L29A 2VC2H 5JIHA 3MXVH 2VQ1A 3CC5A 4HIXH 4KMTH 3CX5J 2MTPA 3OXSB 1F8TL 2F9BT 3MV8B 5GGSB 4H1LB 3VFWB 3Q1SH 2FECL 4TVPE 3FO0H 3OJ2C 2IFGA 4XNZC 1G9NL 4JFDE 1HHGA 2ARWA 2GIYA 3FB8A 2BNUA 4JDZA 3WLBA 2AXFA 2OZ4L 3F12A 5E6IB 4C56E 3VFOB 1OARL 3WFBL 3D25B 2A6DA 2Z91A 3VD9A 1MI5B 1SVCP 4JKPL 5F70A 3P0VL 5EWIH 3LRSA 3L3GA 2BVYA 1X5JA 5BZDA 4O2EB 3UDWA 4HULB 3LEXA 2FO1A 1ZEAH 4G8GD 3REVB 4JPIB 4FXLA 3C60D 1SMAA 5KOVC 3KNBA 4PRHE 3BZ4B 4ZXBD 4WEMB 5C2UB 1V7MH 2CRZA 4LNRA 2FX7H 1T21A 4JM2A 3T8XA 3QAZB 1RZIB 4ZAKB 1GGYA 3VJ6A 1J1PL 4R0LC 4G6AD 5EORH 4EQ3A 1ZA6A 2MJWA 3QIUD 4GW5A 3ZKMC 3ZTJH 3OXRA 5TDOA 3LEYL 4PRDB 3UTSB 2A0LD 3QEQE 4WFGE 4K23H 3P30L 1TJIL 4MJIA 4XMKH 4P59H 4PRNB 4BH7B 4ZUVA 4TSCH 2R1YA 1T0PB 4LHUD 2QQNH 1OW0C 2GEEA 2XWJB 4KKLD 4NM8L 1UQSB 4NRZA 1RHHB 3LIZL 3B3IA 2FL5A 3QCTL 1LGVA 5E9DA 1MF2H 4NO2B 5CEXB 2XZAL 2EO1A 3OKDB 1D6VL 3LEYH 2VDOL 1U8QB 5ID1A 2A0LC 3QEGH 5CILL 3U36A 4X4ME 3PWPE 1TVBB 1BF8A 5GJSL 1UB5B 5EC1B 2V7NA 2VDRH 2FHBA 5FHAH 2AS5M 4WO4A 1AE6H 3QHTC 1RMFL 5GGVY 5IG7A 3NCJH 3MGOB 1WWBX 1GIGL 5FK9A 5CJOH 2VH5H 3ZKQD 3OKDA 1DQDL 5D9SB 1L0XA 3NA4A 5KSVA 4NN7B 1EEYB 3QPXL 3G6JB 4WTZG 4DZBB 5DGQA 4CN6A 5L6YL 5C3TA 4MMZC 1CFQB 4ZXBB 1W0VB 3QIBC 2ADGA 2FZ3A 2PO6B 4C56D 2VRAA 4G6ML 4PGCB 2LV4A 1TPXC 4X7SH 1S8DB 2ZSVA 3SOBL 3LEVL 4HPOL 3KPRE 1C08B 5M94B 4UAOC 3VXSA 4PJEE 4I2XE 4KTYA 4BYHA 5K9OA 5I8CB 2AABH 1NGWA 2APVA 2BOCA 1VPOL 4MDJA 1RZ8A 2ARJA 3GSWA 4J8RA 2ZG1A 1I1FB 1MCPL 1VERA 4O2FA 3VG9B 4LLQB 3W82A 4NYLB 4O2CB 1I3GL 2VYRE 5GS1B 1OAZL 1YMMB 4OLZL 1PLGH 3UZVB 1VADA 3VDBA 3HG1D 1A7QL 4TN9A 2MWCA 5AD0A 1ZLUK 4XX1G 2VIRB 2PTTA 3QIWD 4OCYH 5FKPA 3SHSA 2JELH 2KQMA 1OAKL 1E4XH 2BCKA 4P4RB 2C4FT 2X9WA 1NCBH 5JW4N 4FXKA 5IBTL 4CUCA 5ITFA 2RCSH 2FHFA 1IAOA 5EU4A 5K33A 1T7YA 2P7TA 3O9WA 4HEPG 1GCFA 1OAUL 2EYRA 3RWHB 4YPJA 4UBDD 4WWKB 4QTIL 2C4FU 2J1KA 2ZCLH 5CEYA 1EJOL 4MNHB 4RFEB 4FZ8H 4YK4B 5EDXA 5IMKA 3U4BL 1I7TB 4NNXB 1FZJB 1A9BB 4FQIL 5LQBH 1EV2E 3UPAA 3QA3B 4J1UB 4WU7B 2IC2A 5BRZA 5JHLH 4M7KH 5TF1L 5BV7B 2AXJA 4EUPH 3SDCA 3D0VA 2R8SH 1GOHA 3T4AB 3WFHB 3PE9A 4ZS6D 3QCVH 1ZHNB 1D6EA 3SDYH 1HXYA 1WIOA 3UJTH 4JHWH 4OUUA 5D7LD 3V4VL 3EYSH 3THML 5ITBL 4PJ9C 5GRZA 4JM4H 3ULVD 3EW3B 2C3XA 4AIZB 2VDPH 1FORH 4V2CB 4WRLA 4HLZG 1LILA 4N0FA 3UBXI 4PJCF 4NHUA 4HWBA 3GRWL 1MAMH 3BRGC 3MMEB 4OZHF 5IP4A 3K2UL 4Q6IC 1LO2L 2ITDA 3RWGB 3ULUE 2W59A 2AI0H 4NUGH 4PY8J 5BXFB 4OV5B 4U1GB 3VXUE 4ENED 1OLLA 5IG7B 2X7LB 4KDTA 4LIQE 4G8GA 3LKQA 3ZKND 4BZYA 4PYHA 2A74A 3EGSB 2IF7A 4I18A 4JFOA 3O6FC 3RAJH 2X4RA 2FL5B 2SEBA 1E4KC 1G9NC 3PWLB 1IM9D 3ZLQC 5IR1B 4UV4L 5DJYB