3LN9A

Crystal structure of the fibril-specific b10 antibody fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCTASGYTFSHRYHRWFRQAPGKEREIVAVISQSGMRTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAMYYCAAGTRKNVWTRQHPFDYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin heavy chain antibody variable domain B10
publication title Amyloid Fibril Recognition with the Conformational B10 Antibody Fragment Depends on Electrostatic Interactions.
pubmed doi rcsb
source organism Camelidae
molecule tags Immune system
total genus 31
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2010-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ln9A00
5ELIA 5F9WB 3WL9A 1J0KA 5IUSA 1VHPA 1RUAL 2NY6B 4Y1AA 3ZKND 1Z6JT 2G2RA 1DEDA 1FBIL 2R0ZH 5IJVA 4GRWH 3T8XB 2A1WH 1B0RB 3MLVL 1G7QB 4NJAH 3KWWA 2P48B 2AJYH 2X4PB 1F90L 4YBQC 3HI5L 3UYRH 3Q6GL 4XCYA 5KSVB 4HUVB 1ZANH 3TIDB 4WHYG 3X12A 3GMNB 3NCJL 3RWFA 2ITDA 1JZ4A 4OZGA 2E27L 2HLFD 5BOPA 2RQ8A 5IEKB 2HJLB 4PJFE 3QCTH 1EFXD 3L5XL 1GGUA 4GKSB 4LCCC 3C09C 3QUMA 4D9RD 2DWDB 4QOKB 2V5TA 2VRAA 1A6VL 1S8DA 5E4EB 1I8LC 1S7QA 5CINH 5C9JA 2WP3O 2VXVL 4JN1H 1T5WA 2Q8BL 1HWGB 3RVXC 1JPSH 1RZKH 5J6GB 2FR4B 3ORJA 1KLUA 5D7JB 2NX5B 1EHXA 4WWKD 3KPPB 1LEIB 1WV7T 3L3JB 5E6IB 3IF1A 2G75B 1M7DB 4MD0A 5F7WC 1UJ3A 2NY3C 4APQB 2ENYA 3VXUB 4PV8B 3O6FD 3C5ZC 3FB8B 1CXFA 4YHYB 3PWVB 4U3CA 3SKMB 4IMKC 1CGVA 1T21A 4CMMA 4KUCD 1OWWA 2AKRA 3VXPA 2P5WA 3TV3L 5J12B 2FRGP 4NIKB 4M6OL 2OL3H 4OF7A 2FLBT 5IK3A 5FKAA 3WNOA 4J23A 4YDJA 2AXJA 2V5MA 3QEUA 4E41A 1T2JA 1UZ6E 2A6DB 3D39B 4JFHE 4EN3D 1D7FA 2EDDA 4CVUA 5HYJB 1FL3A 4QO1A 4D9LH 5DDHA 4P9ML 3BGAA 3FQTB 1MIEH 4F7TB 5HYQB 3IFNH 5D5ME 4PJXF 4ONGL 3TA3D 1CDBA 1YY9C 4MB5A 4XPAH 1A64A 1IEAB 3QO1B 2EEDA 1MCPH 4KRNA 4JM2D 3MV7B 4QRUB 4O2CA 3U9PL 1I1YA 2XZCH 3HC3H 1G6RL 5CEZL 1A6TA 1S9WB 5IHLB 4NM4L 2BJML 2EE2A 2BERA 2OP4H 2DL2A 1WIOA 4PP2A 3GMRA 4G8IA 3BEWA 1FO0L 5CIPH 5JOPE 3VI4E 4PGJA 1YN7A 2VOTA 5F7EL 4PRID 1FFOB 5IJKA 1JNHB 4XPHL 3HCVA 4BFIB 2YD9A 2Y1VA 3H3PL 1QG3A 3NOIA 4ZUUB 3WIFB 3KS0J 4C56B 3HZVA 3N85L 4PRBB 2C9AA 4KV5E 2XWTA 5EUKA 5E2WH 2A38A 3FJTA 2WZPD 5FB8B 2I5YH 1BBDH 2Z8VC 3BHBA 4MQTB 2YC1A 3GI9L 1ZEAL 4NRYA 1XIWB 3C6SA 4QF1A 1EH9A 4F37K 5GGQH 2Y06H 5HJ3A 3QIWA 3JXAA 3MV8B 1WT5C 1I8MA 2LQRA 1QRNE 1NMCB 3WSQL 4KQ4L 4NQUA 1U93B 3RIFK 5I6XC 4LGPB 5FECB 3BP7B 2JB5H 3RL1A 1JFQH 5JW4Q 4LPTA 1DVFD 5H8DA 1JRHI 4X9HA 3VRLF 3F5WB 3DNKA 2CLZA 3VXSA 1CICC 2YRPA 3VFTB 2WBJA 4MSWB 3KR3H 4GRLB 2BY2A 2VUYA 5C08B 5DA0B 3FN9A 1SBBA 2B39A 4R2GB 2FX9L 2AQ3A 3PWLA 4XMPH 4JFDD 4LRNH 3U4EA 4BK4A 3ECBA 2DM4A 2K9UA 5GZOD 3TP4A 1KCSH 3MNVA 3FT2A 1BX2A 2DTML 5LGJB 1HNFA 4PBWD 35C8H 5L8LB 2APXA 2BP3A 3HUJA 1UM6L 4HKXA 5F72S 1JNJA 1UG9A 5SWSE 4KHTL 2KZWA 4GG6B 3GHEH 5B8CA 4POZD 5L7XL 5I17B 5AD0B 1FRGH 3FB5B 4PJ7E 4P23C 5IBUG 5IB2B 1OTUC 3LB6C 1A1OB 1FP5A 3WN5A 4IRZL 1CBVH 1SY6L 3P2TA 4WHTB 5CJBA 3MRQB 3ZT7A 2BRRL 1LDPL 1MRCH 3S37H 1OSPH 1U92B 4QY8A 5IHZA 5DUBA 1H3PL 1HHHB 5B21A 5BZDA 4KROB 2R39A 4D0DB 2ICCA 2C4FT 3R06A 3DURA 4PJ5E 3LN4A 4QXGL 4MD4B 1ZE3C 4HC1L 5M95B 2ADJB 4ZD3L 4OV5A 1RJLB 2ICWA 5EO9A 3LH2H 5GSVA 12E8L 2W07A 3RA7H 1VEMA 4YZFE 3LRHA 1JGUL 4QRSA 1PLGL 5L6YL 1EJ6A 4OZHA 2IPTL 3ULVL 3EYUL 5JHDA 3FL7A 2X05A 5D93C 3C2AH 4EDWH 1T22A 2GT9B 3VXQB 4AIOA 1ORQA 3I6LD 3PGCB 2AJUH 3BXNA 3U0WL 1E4WH 1K6QL 4JZOB 3F12B 2P7TB 2NXYD 1S9YB 4UQ2A 4Y4HB 5T3XE 4JKMA 3GMQB 4HZLA 3QO0B 1D5XB 3L3HB 3ZKMD 3EW3B 5GGSB 4IRSB 2GFBA 1QBML 1DR9A 3TNMA 3MLWH 1GHFH 5EBGA 2NNAB 2ATPA 4Q58C 1DDHB 2BNRA 4JFEE 3T0BA 1QNZH 5DD0H 2FSEA 4LLWA 3B9KC 2R2HA 5C0NC 3CVHL 3KPOB 4NP4H 5KOMC 2AP2A 4FN0A 2AW2A 3LOWA 3K2UL 5FF6B 5BCAA 1KEML 4F7EA 1HYSD 1NSNH 4ZO6A 1U95A 5KVGH 4OM1L 2Z92A 3P0GB 3QUKB 4AMKL 4NQSB 4WTWA 3WEXA 5EORH 1PKQB 4XP5L 3VRIA 1NMAL 5IHBA 3BP5B 2VXQL 4XVJL 4F58H 3HPLA 2BDNL 2VH5H 2YKLL 3P3YA 4LEOB 4NO0A 1CLYL 5IWLA 5EU5B 3NFNA 1JZ8A 5TE7L 1H8NA 1VDGA 1LDSA 3OJVC 3RIAK 4QRQA 1RUKL 4JRWA 2Q8AH 2JB6A 1ACYH 4FMKA 4HK0B 4HIXL 1SJEB 1XF4B 5J9PB 2DYPB 3BYYA 3ETBF 4TYUA 4LDLB 1HZHL 4HEME 1JF1A 5DQ9B 4I18A 4F3FB 5GS0C 2AXFB 3I3DA 5AZ2H 3E2HC 3EYQD 1IT9H 2XPGA 1RZGA 5HGDA 2ZSWA 5KZCD 1X5YA 3SDAA 1NGQH 5C71A 3QEGL 3S97C 1BQSA 2WW8A 3KPTA 5DJDA 4L8SC 5DJAA 4U1NB 4YIQB 1YJDL 4NDMB 5K9QG 4OUUA 5IMMA 1KC5L 4I13B 2YD1A 1LGVA 2X4UA 3H8NA 3IDXL 5MERA 4HLZG 4HUWA 3IXAA 5A40E 2DIAA 1IVLA 4LHUG 4RFNB 4XT1C 2W0FA 4OD2B 4CUCA 3WNNA 1UM5H 2PXYD 4MDIB 3KJ6H 4FTVD 4YPGA 3S5LA 2D4DA 1IGCH 1YEFH 2BFVH 3P4OA 4P9HC 3ZSTA 1SM3H 2PKDA 4X5LA 1QD0A 5DZOA 4FQIH 1SMAA 1S7SB 4IDJH 1QFUH 1OCWL 2DM2A 1E0OB 5I19L 2AK4B 3RI5K 4PJFB 4OJFL 3W82A 3CPLB 1CQKA 3J7HA 4I2XA 3RWJB 3V6ZA 1I9JL 4KJPC 1W8OA 3ULUF 1KXQE 4H5SA 4JREC 1WISA 3V0AC 4R4BA 4OIIH 3GBMH 3EJZC 4GSDH 1P1ZB 3FQNA 3FTGB 1BQHB 3GI8H 2BVQB 3RL2A 4OCNC 4PJ9D 4FQ2L 5GJTL 3MR9A 1BMGA 1A2YA 3S34H 1JI2A 3V2AR 5EOTA 1CZ8H 4MA3B 4M5ZH 5EOCL 2FYYA 4M62L 5T33L 1P2CB 2F74A 1N0XL 3MBEC 5C7XH 3B2VL 4NQCD 5DC0A 4P46D 4S2SB 2HJFA 3MLTA 1MJUL 2VDPH 4HT1L 4M6ML 5B39A 1BIIB 2HFEB 2VTFA 5LGHH 1WIPA 1T1ZA 3GHBH 4NJ9L 4JZJA 4HBCH 4PTTB 4P99A 4XP6H 3TFKD 3UEZA 3ULVC 1OP3H 4JFQB 3BD4A 3RWEA 1KPUB 1IGFL 4WTZG 1LMKA 4JRXE 3MRBA 2PW1A 1YMHA 4JDZA 4YDLB 1S7RB 1EEZA 4Z7VE 1RMFH 4GT7A 4TVPE 5GRXG 2V7NB 2MCPH 2JF1A 2NZ9C 1FNSH 2H32H 5D5MB 1X5XA 1A5FH 1Z9MA 3WJLC 3HZMB 1YEKL 3AM8A 3FN0L 3W39A 1R3LA 3SE3A 3C6LC 1VGEH 4IJ3C 3HZKA 3EZJB 1J8HA 5KVDH 4LBEB 3U0TA 1UEYA 3VWKC 3K4AA 4WEUD 1OGTA 2VZ3A 2R2EB 1WJ3A 4XHJD 3LRSA 3OKOA 4YHPA 5C0CA 3RNQA 1JYVA 1ZGLM 3EYVA 4C4KT 1OSZA 3CSPA 3GSNH 3SPVA 2EDHA 2FL5B 4LCYB 1DQML 1KBGL 5LCVL 1JWUB 3Q6GH 4XP1L 2JJVA 3SDXE 2VDRH 1H0DB 2VLLA 3BPNC 3O2DH 5EO0B 3DGGB 3RBGA 4L4TA 3UPRA 4G8GB 2FWOA 4LDOB 3MODH 3HR5B 3PABB 3JTSA 4N8VG 1FPTL 5B3JF 1FFNA 4PRHD 3QDMA 1A4KA 1MFDL 4P4KD 1RFDL 1K3IA 1S78C 5GGVL 2B0SL 3OKMB 4LNRB 2HTLC 3ARDA 4YHLH 2F8XC 3EYFA 3MROA 4JFFD 1VFBB 2Q8BH 3TLRA 1DBBL 1P4IL 4GUPA 3KPQA 4NQXB 3JVGA 1E6JL 1E4XH 3BZFA 1FIGL 1JYXA 3MO1A 5C0IA 2VL5B 3KYMB 3SDDD 4HGKC 4PYHA 2EZ0D 2J8UA 4GRWB 2OCFD 1T1WA 3NPSC 4RDQG 4JQVA 4F57H 1YJDC 2D0HA 5JW3L 5HPMA 2APBA 2VDKL 5K9OB 4Z7UF 5F7KC 2ZPKL 1EO8L 3O6ML 5DWUL 3DTXA 3ULSA 5J57B 1CS6A 3ULUL 4YBLB 4PJIF 5I1EH 3RGVA 1BZ9A 3DX7B 4Y4FD 3HE7C 4MAYA 5D8JH 1FVCB 4PJDE 2MHAA 2Y5TA 5D7IE 5C0GA 1U8MB 5IBLC 1L0QA 4LLVB 4FFYH 1G1CA 3KLAB 5FOBA 3MX0A 1PKOA 4HIIA 4JO4H 4P9MH 3UTQB 1CR9L 4OGAC 1AXSB 3TJEL 5ICYA 2B1HL 2GJZA 5SWSB 5ID0A 1FC1A 4L3EB 2XKUA 1IAKA 4KKAD 4OKVA 3CFJB 2DF3A 4R0LC 3V7MA 1INEH 3IJSB 1G7MA 1U8JB 4JHZA 5ESVA 3IXTB 4JY6B 3MXVH 5D6CB 4XHQA 1ORSB 4HMCA 4S1SH 1HOCA 5D6DA 1ZSDA 3CUPB 2VLRE 5DD3H 5E2VH 3TO4A 2FB4H 3CFKB 1RPQA 1TTFA 4QRPA 1QR1B 5KVFH 2UVFA 1HXYB 3F7VB 4KFZC 2FJGA 1JUFB 1JHLH 2YPKA 3JTTA 2YEZB 5LBSH 4X6EA 5TF1L 2EH7H 3HE6D 4PJ5B 2OL3B 1N64H 4RAHA 5DYOA 1TJIH 4D9QE 1OPGL 4PRDB 4KXZI 1CXEA 3VMPA 3BRGC 2FIRT 3EYSH 4RGMC 1BEYL 2VDMH 3VRJB 2X4QA 4LCIH 1YNKL 2MKWA 4NKDB 3IGAA 4YHIA 4Q9RL 3SE9L 5FUCE 1PYWB 4U2YA 5GS0H 4HS6A 5EUOA 5I1AB 2NY4C 1HK6A 3DO3A 3DVFA 5I8EA 4KTEH 2XN9A 5F21B 1FAIL 1BOGA 3NCEB 5D70L 5EOCJ 4KUCF 4F7MB 2ZG2A 3LV3A 3SHSA 1RZJH 1IAOA 1BVLB 4M7ZB 4ZFFA 3Q1SL 3GO1H 4KRPD 5F7DA 2A9MH 4A6YA 2YPLD 2DQEH 2YOCA 2HWZH 5HHMD 3ZL4H 5J1AB 5KSAB 4M7LL 2M26A 4P2QD 2HN7B 5FDWA 1MREL 2JJUA 5IBUB 1NAKL 4XBGA 3TCXA 4FQXB 1TVBA 5CIPB 3QRFM 3MNWA 3LN5B 2NPLX 4HF5L 1BFOA 1G7HB 4P9HH 1QPPA 2RIKA 3UAJD 1KG0A 4X6CF 5T3ZD 4Y4KD 4OBSA 2CRYA 4WW2B 3SCMC 1UM6H 1J0HA 5TDNB 3KPSE 4P2OB 5L8KB 4K3EH 2FJFA 2ESVB 4X80L 3RVUD 5L7XH 1VA9A 3ARFC 3RWHA 4ODTH 4DKEL 5DR5L 4DOHB 4YR6B 3U82B 4JVWA 4BFGA 3DARA 2YMXL 3BGMB 5CEYA 2XNAB 3EBAA 3ZE2F 3E6FA 4H25A 4MMXC 4F7PB 4TOYH 2O93L 4UT9L 4CAGA 3KLHD 1U3HB 5C0JA 4PJEA 1I7UA 1RUPH 1W72A 4RMSA 1KB5L 4QT5B 5IVZB 5HYFA 1SEBB 1OAZH 3ZDZF 4NN6B 5C0BA 5IVXF 1TCRB 1LO0L 3CXHJ 5JOFA 1A1NA 1QSED 4GMTL 3S7GA 1LO5A 4HIEA 4HC1H 4L4VA 3WDJA 1F5WA 4ZD3H 2BK8A 1P84K 2IF7A 4ZAKD 3SOBL 1I7RB 1XR8A 1IM3A 1FCCA 3CDGB 4HFUH 1GGIH 1FL6B 5TJWK 1BD2E 1GIGL 4XRCA 3VGBA 5ADOH 3QIBB 3MUJA 4B41A 3SGJC 3RWIA 3MLYL 1A7RL 4UDUB 1DEEB 3HMWL 3ULUC 3V5HA 4YDKH 2CPCA 3S96A 4Z76B 1FN4A 4FQCH 3D48R 1CGXA 4Q6YA 3IDMB 3U36A 4K7PL 1DQTA 3WFCL 2OR8A 1RU9H 2IBBA 4K3HA 1EDQA 3NMEA 5DI8A 4WO4C 1NBYB 2C5DC 5ANMA 2H1PH 4KI5E 2ED8A 2J7LA 4R90L 3PL6C 1PJ9A 3VWJD 1PY4A 4PJDA 3RTQA 3QUXC 3TVMC 2WUCH 1WZ1L 5E5RB 2JJSC 3W0WE 1M6OA 4BZYA 2APFA 2X4RB 5FYJD 3QI9D 4X4YB 3C60C 4Y19A 1ERNA 3E3QC 3KPMB 1JWMA 5CHNA 3BO8A 1PSKH 3IDJA 5JW4M 2NLJB 4MNQE 4LSTH 2NXZD 5F1OB 4Q2ZA 3VGEA 2E7HA 4NUJA 3QIUD 4XVSH 3TIEB 3CVHH 3NTCL 4HIJB 3RWGA 4U1IA 5J6HB 3W11D 4EQ3A 1RV6X 1K3ZA 3OJDB 2EXWD 1YN6B 3MA7B 4EZMA 3QNZA 2C4XA 2HMID 2ZSVA 5EO1A 5TE6L 2FGZA 3DHMA 5LJYH 2OJZL 4DTGL 1B88A 1P7KA 2B8OT 1BFTA 4HDIB 4QKXB 5GGRY 3MACL 1X44A 2VABA 2YKLH 2UWEB 1CD8A 6CGTA 3IDYB 3FFDA 5IROC 3MRIB 1C08B 1T04B 1RJYA 1BVKA 1DBML 1F6LL 2R2BB 1K4DA 3VFGL 5ACZA 2IAMC 1INQA 4WI5A 4LHUB 5IQ9B 1FCGA 2BRQA 4CJ0A 1L9NA 3O3UN 5J0BA 5GRYA 4YE4H 3AREB 1FNFA 2V7HA 3DPBA 3H0TA 1G9MC 4JRXB 3RP1A 5EWIL 1HZHH 1J7VR 4O5LH 1A0QL 4Z7VB 3U30C 3CZJA 3KPLB 1OP3K 4KJYB 1I8KB 3QXVA 4YHKL 5BZWA 3OJ2C 5BS0B 1EPFA 3WD5L 2QQLL 1FLTX 4HMDA 4JR9L 4XNQA 2VZTA 3LY6A 1NQBA 3IDXH 1RIHH 5JO5A 3T8XA 1NCCL 4LSSL 1B0RA 3BDYL 2QQNH 3HNTH 5BV7L 4P2RB 2N7AA 1Q9WA 1RUQL 4UZGA 1E4KC 5KSVA 4HUVA 3RAJH 1NFDE 1NPUA 4RA0C 1KJ2L 2X1XR 1ZXQA 4QXUH 4ZS7L 1OAXH 3CMOL 5DMIH 2BSTB 3SDXB 1MVFA 3C09B 4I5BA 1JZ5A 5JNYA 4HPOH 5IEKA 3S3SA 1U2HA 5D1ZD 4XPGH 3WFEL 5D9SB 2N56A 2VLKD 3H2WA 1NC2B 4HCRL 3DX9B 5A16A 2DWDA 1KV3A 2E9BA 3HNSH 2P46B 4MYWB 5F1NA 4G6AC 1U58A 3HA0A 4XCEA 5ACMA 1WFOA 3B9EA 4XXCC 3QG7H 3GK8L 3ZKQD 1BQUA 1I9JH 3OR7A 2FR4A 3MJGX 5D7JA 3KPSA 2BVOB 4WI7A 3OX8A 4NCC2 2GUOB 3D39D 5E6IA 1AH1A 3U7WL 1KCUL 5CMAA 5DUPL 4TNVF 4APQA 2R69H 1CIDA 5CBEA 1YY8B 5DEGA 3WNKA 1CLCA 3AU1A 5LQBL 4L8BB 4Q9BA 1DCLA 5KS9A 2DWEB 4QHMB 5I66A 4EDXA 1MHPL 1XF5B 5E8DL 4YHNB 3O6KH 4HS3B 1MJUH 2LVEA 4Y5YC 1I1AB 4M6MH 4OFPA 2A6DA 5D1QC 5AAMA 5MP6L 2A77L 4NM8H 4PG9B 4U3XA 1Q1JH 5HYJA 4WWID 3T2QA 4W70A 3GJEA 1YZZA 1XCTB 3GBLA 3UJIL 5GRUL 5K93A 3FQTA 5D7IB 5F93C 1QFOA 5HYQA 3AXLA 4LSVL 5EC2B 4BSWB 3MFGB 3VFMB 1CD1B 4YHML 3QQ4B 1I1CA 1JJUA 3E0GA 4J4PD 1IEAA 3QEHB 3PJSB 4XTRD 5IR1A 3QFJB 1MQKH 1YPZF 4R4ND 1ZS8A 3MGOB 3KXFD 3I9GH 3MV7A 4M93C 1KCLA 3F8UB 4QRUA 2UZIH 5I8KH 2XKSA 4ZUTA 4XNYH 3CK0H 3GBNH 5HYSA 1IAIM 2I07A 4WFGD 1A3LL 1S9WA 2QLVB 3LHPH 4TPRH 1LE9B 5E9DA 4WWKC 1AGDB 1ACZA 2BNUB 4W6YB 5H37H 2EE3A 4JG0H 2GW5A 1IFHH 4PRNA 2VN4A 3DIFB 4CU8A 3O6FC 4TUOA 5ESAA 2AQ2A 1U91B 4X6BB 1NLDL 5LCVH 3SBWA 2CQVA 4XP1H 1FFOA 3BOVA 2DKMA 1AR2A 2YD3A 3G6DL 1JCKA 1WC7B 2VWEE 3MV9B 4LVOC 1I4FA 3RU8H 3IDIA 1DUYA 5JZ7D 1Y6MR 3DV4B 3B2UD 2APTA 4QXTB 1CGUA 3SQOH 4NC1C 1MFDH 2F5AH 4EN3C 5E7BA 5E5MB 5J11C 1H3TA 3IDGA 4LSRH 1GGBH 1AY1H 4JPIB 4M6NH 4OFYA 2H32B 5C08D 3WNLA 5L0QB 3THMH 4I8DA 4MJIB 3RUGB 1U8OB 1Z0MA 2QSTA 3TA3C 4WDIA 1JZ2A 2IQ9H 4ELMB 2IBGA 1E6JH 3V4PH 2A6IA 1CICB 3SGEI 3ESVF 1NBZB 5HDQL 1FIGH 1FFPB 4RNRB 3GZKA 2KPNA 4JM2C 1K4CB 5DSCA 3FO2A 4Z7QF 3F5WA 1RURH 1TZIB 3GSNB 3VFTA 4OGXL 3PDDA 3TBTA 1T03L 1AQDB 4MXVF 4GRLA 5MEND 1WBXB 3WHE1 1VGKB 5JUEL 5C8JB 2FEDD 1PX4A 3PF2A 5HPOA 2VXTH 3ULUH 5E8OB 3S4SA 3RJQB 4GQPH 2DS4A 1JNNL 5IW6A 2PO6A 4XNUH 3WFHB 3GIZH 3WKMH 2P5WD 1UB6B 1T7VA 3DHJA 4GG6A 4WV1C 2R1WB 3IAGC 3OF6D 5ALCL 3O3BA 3KPRA 3F7RA 5BQ7B 1T0MB 3S8WA 5H37G 4E41D 3QUYA 4NWTL 2YA2A 4MVBD 4GKNB 4MCZB 1R5WB 3WIHA 1LD9A 3MJ8B 1J8KA 1KENH 1PG7W 2CRIA 5ENWB 3V0VA 1X4XA 1U92A 4OF5A 1HHHA 1U3YA 1MFEL 1JV5B 3KNBA 2KQMA 3ZYIA 4DUVA 4O4YH 2AJSL 2IMNA 3LKRA 3W5NA 1R24A 1FYTE 1NKOA 1S7WB 5E08L 3EOAB 2FECL 1AQKH 1H3XA 1AR1C 4F8QA 5H94B 3FFCE 3BZEB 4GBXD 1DVFC 3DX6A 3RY6C 5C70A 2FHCA 1Z9SA 2EDOA 1DLFH 4PJCA 5D93B 4GXVL 3DUUB 1XEDA 2HFFA 2H9GB 2XACC 4HHAA 1IBGH 4J1UB 2A0LD 2MKLC 5DD1H 5E94A 1G7LB 3IVKA 2OQJB 2CK2A 1BD2B 1YEJL 5I71B 1S9XB 4IRSD 3MRNB 3VXQA 5GZOC 3R8QA 3EFFA 1RAMA 4I0PA 3I3BA 3ARWA 3RQ3A 2AV7B 1G9MH 2IPKB 4ZOCA 5HHPB 5JW4R 3AMLA 5JXAH 4JZOA 3LAFA 4QHNB 2D7NA 4AYFA 4XP9H 3RVTD 1S9YA 4POZC 1J1XL 2K1MA 3IDNB 4NQEB 4UINL 4CN1A 3VG0H 3QO0A 1D5XA 3D3VE 1P7QB 3L3HA 3O3AA 5JORB 2CR3A 2K3TA 2WK2A 5CZVL 1IGYB 2PYFB 5B22A 5JIHA 3JV6A 3W0WB 3LQAC 4KWUA 4HJGA 3DX8B 1CGTA 3RFZC 1CDGA 1IAIH 3TESA 3KPOA 4LLYA 1U8PB 5D7LB 1BZ7A 1QLRA 2DYPD 3I02B 2Z31D 4DW2L 1SMOA 1RHFA 2ICWJ 3RJDA 4F15C 4X99A 1CLZH 5I1CH 1VB9A 4Z95H 2DQFB 2H6PB 1PKQA 3BP5A 3VXSD 4NRZA 1Q0YH 1QBAA 3CX5J 2Q87A 3HS0A 4LEOA 1U9KA 2PTTB 4PGBB 1SEQL 4YQXH 2FLRT 4NBYB 4WEBL 5KOVC 2V2WB 2R0LL 3QJHB 1KPVB 1KULA 3WFBH 4UNTA 3E2HB 1S7VB 3EOYG 5CAYB 3CU7A 1R3HB 2ADIB 4XC3L 1W0VA 4F3FA 3MUY1 1M1SA 3IU4L 2OTUB 3VD9A 2AXFA 4K3JL 1NC4B 2AGJL 4U6YA 5CWSB 3I84A 1JWSA 1NCUA 5AYUL 5B38B 4P5TD 2NXYC 4FZEH 1M7XA 3O2WH 4WJ5B 1OTSD 4Q6IB 4ZO9A 1L7IL 1Z9LA 4U1NA 3ZKMC 1DBKH 1C5BL 2YD5A 1T80A 3HI1B 2CDEA 2ZCKH 1A02N 3VCLA 4IS6B 1ZGLB 1YEGH 3BDBA 5A2IH 2CRZA 5EU3B 4OD2A 3B8SA 2WUBH 3QNYA 2ORBL 4S1DD 5I30L 1JGDA 2Q86A 3N50A 2EDXA 2EDFA 3O11B 1GH7A 1GIGH 5HDOA 3INUL 4U1HB 4DZBA 1HYSC 1IGIH 1A7RH 5KJRL 4RIRA 3B5GA 4NZRH 4M61B 4XZUA 3P4MA 1MEXL 3H42L 3DOSA 4QTHA 1S7SA 1QP1A 5D2NE 1HEZB 4WY7H 1LP9A 2AK4A 2ZG1A 2XWJB 5JHDD 5EA0L 4D0BB 3LKQB 3CDYA 1CVSC 3EJYD 3G6JA 4JG1H 3WKNA 2R4RH 3WFDL 3BDXA 2AEQH 5EU4B 2EYTB 3KHQA 2Y7QA 4IMLB 4ZXBA 2EDNA 1WBZA 2EDTA 2O5YL 4ZS6C 1TVDA 4X7CC 1INDL 1GCFA 2HKHH 1U8HA 3P0VH 2J5LC 2RFXB 1S9VB 4UT7L 4RWYH 1IC4L 1OLZA 3FTGA 3QDGE 1KJ3L 5J3HC 3TBVA 3L7FA 3OMZA 3N1GC 4JFHD 3ALWA 4PJXB 3V4UH 1T7ZA 1P9MA 2GY5A 4HUKB 4F9LA 5F88A 1J11A 4JPVL 4MA3A 1DFBH 1P53A 2D7TH 4ODSH 4BSJA 2RJMA 2BNRD 1AC6A 3OZ9L 2GEEA 1ZLSH 1Q72H 4XAWL 2FO4A 4R97C 5CUSL 2HFEA 4HJJL 2H3NA 4DTGH 5GRJH 2VMFA 2PXYC 3CH8A 4RGOL 1ZHBA 4JO2L 3RVWD 1KPUA 2DQJL 4KKLD 3H9SE 1GGYA 3ARGD 4NSKB 5HI3D 2VKWA 2C3HA 2WIIA 3DVNA 4JO1L 5L9DL 1PQZA 4M1DL 5D1XA 4GLRH 2D2OA 4W4NA 5EWIH 3HZMA 4JPKL 2NW2B 5B3JE 2X9WA 3O41A 3IJYB 5GJSL 3VWKB 5TF0A 5T1LB 4WU5B 5JOPD 3ZTNL 1MLBB 3MUGB 1ZVHA 4LBEA 3VXRA 1TTGA 1IC1A 4XVTH 4RRPA 5DRWA 4LFHG 1A22B 4EI6B 1JPGA 1Y0LB 1FFRA 3SDAD 4I3SH 1X4YA 3P9MA 3FRPA 2HA1A 4MWFB 4LCYA 2F8OA 4PJ9C 1Z2KA 1JWUA 3U48A 2DAVA 1H0DA 3NABL 4JQIL 3BI9X 1A1MB 3O9WD 3AS0A 1KJ2H 3VXME 3UTTA 3CFCH 1HHKB 4A6YL 5TGBB 4G8GA 5ILTH 2H8PB 4OZIF 4P46C 3HR5A 2FJHA 3PABA 3BKCL 4HWZB 4OCRL 1QRND 4XCNA 1MWAA 1ZTXH 5FM5M 5I8OL 3L3OB 1JNLL 4PJIE 1DQDH 1HKFA 1MSPA 1NCNA 3TFKC 1AFVL 1AXTH 2QSCH 5J4MA 4UAOC 4ERSL 1IC5H 2HRPL 3BE1L 3OKEB 3LS5H 1NAMA 4S0SD 5JXEA 3OAYH 1MF2H 3RDTD 5E00B 3S88L 4NQXA 5C0AB 1MVUB 3NPSB 4EI5A 2VL5A 3S36L 1TJHL 1QOKA 3TH3T 2FNBA 3LEXA 4DKDC 3BKJL 3IU3B 4GW1A 3RX5A 2GCYB 2YRLA 5AUMB 2CRMA 2P8LA 1F3RB 5SWSD 1RIUL 2XT1B 3HE7B 2ZZUT 5IV2B 3GM0A 2RB8A 1UCBL 1T0PB 5SWZE 2F58L 1NANI 3V8OA 1E27B 3IFLL 1NMBL 1AGCA 1U8MA 4EIGB 1F4WH 1CVRA 1WZLA 4LLVA 4HUNB 1ZT1B 4KUZL 2X1OA 4UIKL 3RY5A 4R0LB 3TBSB 1AXSA 4FHBD 1CFNB 1JPTH 4JKPL 1XF2B 4L3EA 4DCQB 4QCIB 3CFJA 2D03H 3TM6A 1A3RH 3FONA 3MLZH 4PJ5D 2R4SH 4U1SA 4V1DA 3IJSA 4P4KC 1U8JA 3TPUA 3IXTA 1EUUA 4JY6A 3LQAH 5D6CA 1GSMA 5KSBE 1MHCB 4WI8A 1O7VA 4ONHA 5LWYL 3D9AL 3DLQR 4OGYL 3QWQB 5F9OL 4N5ED 4I48A 3E8UL 4L4JA 3CFKA 1J1OH 4DAGL 1S5HB 1QR1A 1HXYA 2XICA 3F6IA 3F7VA 4AJ0A 3WLWD 3D18B 4TSBH 4J3SA 5EBLA 3MGTB 3SE8L 4OCXH 1R3IL 4RGMB 3GMPB 4XWGL 1FYTB 4RISL 1NKRA 3SDDC 2EZ0C 4PRDA 3FFCB 4OD1L 3LS4H 2DI8A 2Z8SA 2EKSB 2O5XL 3PQYE 4DK3A 5T3XD 3E1F1 1FYHB 3LDBC 3VRJA 1TTUA 1GGTA 4LSPL 2JLLA 1IGTB 3OGCB 2NY4B 3HLAA 2AXGB 3WHXB 4Y4FC 5E2UL 1V7NL 5TE4H 5I0ZA 4NUGH 3GSVB 1PYWA 1CD0A 4IRJA 3PIQA 5I1GL 5I1AA 2OI9C 2HTKD 3LPFA 4RAUB 25C8H 4JFED 4L4TD 5MHSE 1U8KA 4X6CE 1BAFH 4F7MA 4JLRA 4WNQB 1OGAA 1BVLA 2AJXH 2HT4C 1JMXA 1WZMA 4KKAC 4L29B 4XH2A 4JFZL 2OZ4H 5L8JB 3QUZD 15C8L 4UV7L 3ARDD 2BOBB 5DLML 3UJJH 1KYOJ 3LSOB 3WXVH 5I16A 1E4JA 1A14L 2VAAB 5IB4A 1KTDA 3LKOB 3ZE2E 5CIPA 5HYIA 4PRIE 3P30L 5HI5D 1EHAA 4M43H 4OV6F 2R56L 4QNPF 4IOIB 1OLLA 3SCMB 5GS1B 4HKJB 4G5ZH 4OLEA 1WLHA 3BQUD 4XMKH 1MPAH 4O2FB 3ZDZE 5IVXE 4HS8L 3HE6C 4R4FL 3ARFB 4HUMB 1U3HD 4FQPA 2F53E 1MJJB 3FOMB 2Q6WA 3BKYH 5TDNA 4P2OA 3TBWA 1OW0C 4KKBD 3H9ZA 2XA3A 5ALCH 5FO9B 1KCVH 1ZOXA 3HI6H 3RGVD 2VUOA 2ZUVA 4YR6A 1UVQB 4MAYD 4QRRA 4QHUA 1EEUA 2R0WL 2EDJA 3QJFB 2APVA 3BGMA 4MA8H 2I25N 5CSBA 3WUWG 5JA9A 1A7PL 1MIMH 3VXOA 2VISB 4ODHH 4X98B 3STLB 4BELD 1N5YH 4L9LC 3OWEA 4I1NB 4YK4B 1K8DB 4Q7DA 5I1KL 5TQ0H 4YNYA 3ARUA 3RNKA 4QT5A 3H7LA 5J13C 4OGZA 5L2KA 1F58L 1TCRA 5HVGB 1NUNB 3SDCC 1B2WL 4KY1L 5EG6C 1PEZA 1I7RA 3ZDYF 1CU4L 1XGRB 2XKNB 3ZYJA 1FL6A 2NR6D 1FG2B 4OZGF 3I2CH 3O3EA 4S0TD 1PG7L 4O51B 1LWRA 1A9EA 2XZAH 4OZ4B 5CKAA 5C0EB 4CN6A 3NZ8A 1N26A 4Z76A 1YEJH 4K94C 4WO4B 2HH0L 3UAJC 3UJTL 1OM3H 4DGIL 5C07A 3PL6B 1CL7L 4Y4KC 1HHGB 1JF6A 5CILH 5GSRB 3DUSB 2NY7L 3QUXB 2QR0B 3C5JB 4JDTH 3TVMB 4X5XB 1NBYA 1WFUA 2HJKB 5BOZG 1GL4B 2Z8RA 3L7EB 3C60B 4W4OA 4S1QH 1M7IB 4O58L 3RVUC 1XMWA 3MRJB 4MLSA 4MXWH 4LF3B 5HGBB 4LDEB 4JEGB 1JF5A 2X4RA 2OR9L 2DICA 4QLRA 4G6KH 2UYLB 1M05A 2AV1B 5DHYA 2VXSL 2AJ3B 2XN9D 3CDFA 1QEWB 2NLJA 5I0DA 4HWBA 1G0XA 1GRWA 3V4VH 5I75C 3L6FA 1N5AB 4LU5L 5EZLB 3KLHC 1XGYH 5CJQL 3QDGB 3AUVA 1Q8MA 4GAYB 3TIEA 4LHUD 2Y07L 5FA3B 3N1FC 3MLSH 1EMTL 1AGFB 3GRWH 1B3JA 4JPWL 5KSBA 4JRXD 4HV8B 4U7MA 4G6MH 1QBLL 1YN6A 1QKZH 3X14B 4TVPD 1MFBL 2CK0H 3STZB 2YRZA 4KDTC 1UB5B 1OD9A 4NHCL 5IMOA 2W1NA 3NFPA 5KTEH 1I1RA 4RQQB 4HDIA 2UWEA 2MTPA 1BIHA 4P3CL 1QYGL 4GKOA 4R7DA 2AJVL 3MRIA 4G3YL 4L5FL 3UMTA 4KTDL 4PUBL 1VFUA 4RFEB 1UGNA 1DQLL 4BM7A 5JTWA 2BHZA 1DBJL 5SX5H 5CSZA 1SJVA 4H1LA 2IGFH 3IKCB 4GRMB 1HQRB 3BP6B 3LVEA 3TWCH 3H9SB 3DI3B 5I1HH 2NY1D 2P24A 1YEEH 4PLKD 4RX4A 4N0YL 3LQZA 4M9OA 2A9NL 4U6XB 1LK3L 4KJYA 2ADGB 3VWJC 4BFBD 2Y6SD 3CAFA 5F7FA 1EGJH 1YEHH 2WINB 3CH1A 3PP4L 4FQ1H 4NFDA 4TUKH 5CJXC 3UPAA 3QI9C 3DSNA 4CVXA 3FQRA 4OCLC 3R0NA 3VW3L 4CMHC 4DN3H 4AH2A 3MCKB 4M3KB 5HHVH 2C7UB 3GSWB 5IB3A 2VZ1A 3ZHKA 4Z7NF 4Z0XB 1ZHKB 1YMMB 4GAJH 2CKBH 4P2RA 1A7BA 2DOCA 1MCQA 2NXZC 5TDOB 3UBXI 3BUYB 2IG2L 3QIUC 5ERWB 2ORBH 1C5DB 4X6DA 2R1XB 4PLJD 5T1KD 5I1LB 5IIEB 3CC5B 1S7UB 3BGFC 3MBXH 5LXGL 1BFVL 2BSTA 5C0RH 2EXWC 4LCCA 2WBWB 4NKOB 5DD5H 1HKLH 3VXMB 2HMIC 5HSFA 2NTSP 1NC2A 3GJFH 1YEIL 2MQCA 1VCAA 3DRQB 1A9BB 1XH3A 3EYOB 3OHXB 1ZLUH 4Z7UB 1FDLL 1IM9B 2NY6C 2EYRA 5DJ8B 1P5VA 4PJIB 4OZFG 3DO7B 4OLYL 1T7WA 1AO7A 2F53A 3GB7B 4JANA 5GGUA 3VU2A 3C5ZA 3PXJA 1NCAL 1I1AD 4XCFH 1MUJA 4IMKA 5FEBA 1KJ3H 2B1AH 3BIAX 4PREA 4WW1B 2CUMA 3QH3A 5IB5B 1HYRC 3D2UA 1BJ8A 1DANU 4FQLL 4N0FB 3M8OL 1I9RL 1YPZE 4P59L 3X3GH 2WNGA 1KFAH 3D0VA 3OAYK 3IFOA 2QKIB 3OKLB 4X8JA 4JHBA 1XZ0B 4P2YA 1RIVH 4KPHL 3P9LB 3LKSB 1AJ7L 4YHNA 2I24N 5T1DL 1MCOH 2EIDA 1A6UH 3L3KB 4EVNB 4PG9A 4CU6A 3NH7H 5SWZB 1IGJA 1K2DB 4N90E 1XCTA 3WO3B 1VPOL 1Q94A 1EFXB 2BX5A 4GW4A 4XBEH 1EV2E 3B43A 5CEZE 2VLRD 1FAKT 4MA7L 2I60L 3B9DA 2C26A 2YS4A 4BSWA 3VFMA 4P3DB 3QQ4A 4JO1H 2QQQA 3QEHA 3PJSA 4ODVH 4Y89A 3QFJA 1C8PA 4YHYC 5HYEA 1YEDA 5GISH 4LCWE 4PTUB 4KI1A 5E99L 1AHWC 1KLFA 4D9QD 3HAEH 4NKIL 3FO9B 2WP3T 1D3CA 3S3JA 1R0AL 3REVB 2ED9A 2CDFB 2VQ1A 4M7LT 4HPYL 2FBOJ 2EDRA 3O6FB 1LE9A 4JHAH 1QFPA 3TN0B 3U46B 1ES0B 2P8PB 5F3HB 2VLJE 2X4NA 1G7JA 4LVOB 4LHQB 4WUKL 2VC2L 3O3DA 3S3PA 1MCRA 5F9AC 3ROOB 1CFTA 2MCG1 2JELH 2EDKA 3DUHA 1B0GB 3PGDB 1MCLA 1WC7A 3NABH 5BJTA 4PLOB 4UU9B 5BO1H 4JQIH 3RRQA 3MV9A 4Z7QE 1J0JA 1UFUA 4PRPE 2OX5A 3MXWH 5J11B 4CU7A 3PQYB 1BGXL 4MXVE 1FNEB 5IFAL 2F54A 3VGFA 4ONFL 4QXTA 1UZ6F 4WIQA 4LCUB 2O5ZH 4NN7C 5E5MA 1I1FA 2DQTH 3TA3B 4FP8L 1OAKL 5DHXB 1WT5A 4JPIA 5JPMA 1Z5LB 4WI2A 4MJIA 4KVCH 4KK9D 3RUGA 2ZJSL 2ICEB 2G5BB 1U8OA 2BCKA 3MNZB 2GJ6A 4X6CB 4ELMA 2JJTC 4J4PC 3T4YA 1NLBH 4LPXA 5DJ2B 4XTRC 1QBBA 2PETA 2W0LA 3G5XB 1CICA 4RMTA 4R4NC 1AI1H 3V6OE 1QVOA 4TSCH 3H3KA 1FL5B 3SO5A 4DWHA 1KSRA 5DUMH 1QPXA 3BKJH 2ARJQ 1U3ZA 3PV6B 4PJAE 3G5ZA 3C87A 4XCCL 1TZIA 3GSNA 3KPSD 3HMXH 1AQDA 4ORGA 3L1OH 1BQLH 1WBXA 4E42A 5DK3A 3T3MF 1N7ML 1VGKA 3SDYH 3OL2A 4LLDB 1HIML 2AK1H 3D1MC 2DDQL 5DD6B 1QSVA 4PRIB 5I15H 4K94H 4WV1B 1CN4A 5JA8B 1TZGL 1NGYB 3UC0L 4HGMA 4M9PA 3WFHA 3HAEG 3VI4F 1NMBH 2VZSA 5T3ZH 4H0IA 4G8FB 4P23A 5IVXB 4RBPH 4OTXL 2V5RA 5FUZH 3FHQA 4KUZH 1KN4L 3JV4A 1T0MA 4IM8A 3GIVA 3RZCD 1KOAA 2W9EH 4JKPH 1BWMA 5JZ7C 2KQNA 32C2B 2V5YA 2APWA 3VFVA 1RZ7L 1T0NB 1BLNB 2X6MA 3OGOE 5FCUH 2J88H 5DMKB 2YBRA 5ENWA 3QPXH 4WUUE 1V05A 4JFPB 1KELL 5LWYH 4R2GC 1HSBA 1DN0A 4OIAA 3V52H 3WMSA 4FNLL 4ZO7A 1MAMH 1S7WA 2D7MA 3EOAA 1BZQK 1R6VA 4JM4L 3BISA 2R1YB 2A73B 5EZOL 1F11A 1LEGA 3OPZH 3VMOA 4XWGH 3T04D 3B83A 1UWGL 1C16A 2ARWA 4JFDB 3BRDA 2JCCE 3F7QA 4ZOEA 4KI5D 1P7QD 5E9DD 1CL7I 1MHHB 3ROLA 2O61B 1G7LA 4AQ1B 5F44A 3KYKH 4LLQB 1S9XA 6FABH 3W0WD 2W60B 1TVHA 4K8RH 3QT2A 3M17B 4X9IA 1VFAA 3MRKB 5D2LE 5FUOH 2IPKA 5HHPA 2HVJB 2V2TA 4MNQD 3NFSL 1LK2B 4Z78A 3IDNA 4NQEA 1XGUB 1YECH 1MJ7H 4K3GA 3O4LA 5JORA 4MVBC 4PJ7F 3GSRB 4K71C 3T09A 1H3VA 3VJ6B 2H45A 3GSOB 5FYJH 3SJVE 3RPKA 5FGBC 4Q9QH 2IH1A 4NZUH 2YD6A 3B9KA 3L5JA 1G6RA 1B4JH 3V6FA 4LGSB 1JL8A 1IL1B 3BD5A 3AY4C 1RZIA 1RK1A 4KHXL 1PAMA 1QLFB 5D7LA 1FO0A 2ADFL 4LCWA 5IVNA 3WUWB 2BMKB 1ZA6B 4J6RH 2VDQL 2XTJE 4YHZH 4LAJH 1X9QA 3TNNA 4YHOH 2DQFA 4GBXC 3A6CL 2W65B 4OLUL 1A6WH 1DLHA 4Y4HC 4Z5RB 4LSUL 3NZHL 1DZBA 2FH8A 5FHAH 1N3NB 5DS8B 3HRZB 4YZFF 4M48H 4IEFB 3K4ZA 2A0LC 2MSPA 2GIYA 3QJHA 4KQ3L 4DFHA 4H0GA 1OAUH 4IRSC 1S7VA 1H9VA 3PXHA 1WITA 1JTOA 1A4JB 2PO6D 1NL0L 4PB9L 2NXYB 4HW6A 4JCLA 5I76B 2OTUA 1TCMA 1NC4A 2H2SC 4L8SA 5HHME 2XA8H 5B38A 3W2DH 1ZV5A 1OAQL 3QUYD 5ESQB 4WJ5A 1UZ8A 1HH6A 4Z18A 1MNUL 3GUTA 3PWPA 5SX5K 4FXKB 3VFSA 5FV1L 2IH3B 1B2WH 5F7HA 4IS6A 1UKQA 4LEXH 4DZ8B 5MEQB 1EAPB 2CSPA 4PR5B 2VAJA 4HXBH 1HILB 2BVYA 2EC9T 3P40A 2ILLA 5FYKL 4AIZA 2DQGL 1SJHB 2X40A 5T3ZE 3QCUL 4NO3B 1ZLWH 4NHUB 5IFJB 2X42A 2B20A 2Z31C 3UZVB 1J1PL 4OM0H 1TNMA 3VD5A 2GI7A 3TT3H 4ODWA 3UJTH 1M71A 5ISZA 4XNZB 2R0ZL 3V9FA 4ODXB 4Z7WA 2A1WL 4U0RB 4D0BA 2P47B 3T0VA 4NJAL 1H3UA 4NYLB 2AJYL 2XWBB 3UYRL 5EU4A 1P5UA 2EYTA 5HHNA 4IMLA 3BAEH 1ZAGA 3BPLB 3NACH 4X7TB 5L88H 1P4LA 3P0YH 1YYLH 4RFNC 5KZCB 2J8UF 2GITB 3BPOB 1S9VA 3GJFK 1CG9B 3VFPB 5EZJA 5IP4A 4OUOA 1PZ5B 3QCTL 1ZLUK 2DQUH 4ZFOB 1OL0A 4P5TC 4D3CL 4PJXA 4AY0A 1L0XA 3MBEA 5BRZA 4HC1A 5CD3B 1OTSC 1IE5A 1TIUA 4G43B 1ZVYA 1FLRH 2Y07H 4D0CA 3WE6A 3W5MA 5KVMC 5CINL 3VH8G 4H8WH 3S35H 1H15B 1YPZB 4JN1L 5FO8B 4YO0B 2GTWA 1OQOA 1JPSL 4RGNE 4FTVB 4S1DC 2K7QA 4YUEH 3V79C 3OXSB 4P3CH 1QYGH 3ES6B 2WLZA 4PBXA 5FV2A 4XXDB 3VGAB 3WJLA 4EUPH 1ZHNA 3EOBA 5EU7E 3VXNA 3C6LA 5CGMA 3SKJL 2XZQL 5FYJE 4U4BA 5KG9B 2IFFH 2OL3L 3WNPA 4Y2DD 4EJ1C 3ZT5A 3VWKA 3EJYC 5T1LA 4WRLA 4FXGA 1AKJB 2H41A 1YNTB 2A9NH 2DLFH 3L95A 3PP4H 4D9LL 1ZT7B 2FGWH 3H9HA 1R5IB 1MIEL 3CVHA 4MNGE 3VW3H 3IFNL 3QZWG 2B2XH 3O2VH 1TJGH 2PYEE 4MWFA 4HMEA 4OZFB 3D69B 2CXGA 4XPAL 3ZO0A 4MA1C 4RAVA 3SN6N 1GOGA 4YXKH 5KVEH 4NQCB 2IG2H 4P46B 3VA6A 4HXAH 4YC2C 3T0EE 5ICZB 2GSIA 5FDYA 1YYMH 4TULH 5T3XL 3MRDB 2IANE 5TGBA 5ITFA 2H8PA 2XZCL 3HC3L 2CH8A 4U6HA 4UQ3B 5B3NA 4ZUVA 2QTEA 4XAKE 4UAOB 4PRPB 3U6RA 3P4NB 3QFDB 4ZUWA 3PWJA 3L3OA 3NIDF 2OP4L 2Z8WC 4RMWA 2IALA 3RVWC 5E4IA 3IAQA 3OKEA 3OBAA 3FQWB 4KKLC 8CGTA 3ARGC 3NAAH 5HI3C 5E00A 1LO3H 4Y16D 3CFBA 5C0AA 1LQSR 1MVUA 1R3KB 4RWHA 3ILPB 4U1LB 4ZTPH 2W9DH 3QUMH 4C58B 2GTZA 3RWCA 5E2WL 3WJJC 4ZXBD 2I5YL 3IS1X 3V0WH 8FABB 1BBDL 1NBVH 4PJBE 1SYSA 4YAQB 3HE7A 4DQOH 4I18C 2CKBB 4WI9A 1VERA 5FYKU 1KIQB 3REWB 1DE4B 2ZOLA 5GGQL 2Y06L 3DYOA 5EBMA 2ZUXA 1AJ7H 1KT2B 2A83B 4ZPVA 3D6GA 5IFHL 5T1DH 4FMFA 4F33A 1KPRA 2J12B 2JB5L 3MC0A 1JFQL 2C3VA 5DVMA 1QFHA 1N0LA 1ZT1A 2SEBB 3GJFB 3IS0X 3O9WC 4R0LA 1CDCA 4PRHB 3TBSA 5EDXA 2GK0B 1T7YA 2FBJH 4P4KB 1ONQA 5FKPA 3NIFF 1I7ZA 4QCIA 3KR3L 2DJ4A 3CSGA 5DO2C 3LN9A 3M1BA 1OB1B 4XMPL 4LRNL 1GPOH 1RJZA 3FFCD 5MEOB 1WBYB 1MHCA 1KCSL 4RBPK 3LZFH 4O02H 4C55A 3ARBD 35C8L 4U1MA 1EBPA 2Q7YB 2UY7A 3RDTC 3QDJE 3QYCA 1WTGT 3GHEL 4URTB 3SDDB 3QXAB 2B4CH 2JTDA 1X5GA 4HWEH 4FQHA 1FRGL 4NT6B 3D18A 4LVHC 1JGEA 2UVEA 3F62A 1L0YA 4NPYA 3GMPA 4AT6B 1DL7H 5K9KB 3UTZB 3T0DA 3OR6B 2VDOH 4WUKH 3VXRD 1CBVL 4N9GB 2D31A 3CFEB 2AQ1A 4S1RH 3FQUA 5DFVD 3W9DA 1JI1A 3R8BB 5KANI 1BJ1H 3U1SL 4OF6A 5BMFH 5CZXD 3NCBB 3D3VD 3MSPA 5EBWA 1G9EA 1IGTA 3AFLA 2OI9B 3WHXA 4GW5B 5F9DC 3GSVA 1MCCA 4PV9B 4PJDF 3F6LA 4KTYA 1Z0NA 4G80A 3UTTD 4YFLF 2BNQE 3P73B 4MX7A 4ZSOE 2XG4A 3LH2L 3KXFE 4M7JH 3RA7L 4CN4A 2P1YA 3S6CA 3CSYA 3ZDXE 4CVZB 4L29A 5D7SH 4D8PA 4NQTA 3HAEB 5E5UB 3C2SA 3EO9H 4FXLA 4WFGE 2CR6A 3C2AL 2BOBA 4EDWL 1XR9B 4OAWB 3K46A 2GJJA 3LSOA 4NO2B 3R1GH 3SJVB 2AJUL 3L5WB 5JXED 2VAAA 4YPJA 1NJ9B 1E4WL 3HHRB 4Y1AE 3CVIL 4WFED 2E6QA 4HX1A 1LE5B 3SCMA 3WLWC 3BZDA 3QPQD 1OAYH 2EEAA 2HFTA 4G9FA 2XTJB 2X9XA 3ARFA 4KMTH 3MLWL 1GHFL 4MD5B 1I8IA 1A6ZB 4HBQA 3ZDYE 2JK5B 2DQCH 3VGHA 1QNZL 4YXHH 1CGSH 5DD0L 1SBSH 1UVQA 4NP4L 4J3UA 5DRNA 1JTPA 3LMJH 5KSAC 3QJFA 3CLFH 3UYOD 1MI5A 1NSNL 4XMLH 1CF8H 5KVGL 4LQ1A 2BSSA 3BWAA 1FZKB 1G9NH 1GZPA 2HTKC 4B50A 5EORL 1W0WA 4FQXC 2VE6A 5FGRA 4KRPB 4F58L 3MJ6A 3UZQA 2YPLB 2VH5L 5HHMB 5JDSA 2RAMA 4KZEH 1RK0A 4X7EC 3O6LH 4V1DD 3LKNA 5CLTA 2KH2B 1BM3H 3A6BL 4P2QB 3QUZC 4JVUA 1ACYL 5GGRB 2F9BT 2W9LA 3SGJA 1OT2A 5CZKA 1FG2A 5AZ2L 5GGTH 3PNWA 1CXHA 4J12A 4LNVA 2P5WE 3X3FH 4OZ4A 5C0EA 1MFCH 4X4MA 3DJ9A 3GMOB 5EZIH 4J3VA 3DRTB 4IBLT 3BQUC 3FB7B 4E41E 4PJBA 4XB8A 4ACPA 3PL6A 1U3HC 1FH5H 4NOFA 3QDGD 3FT4B 3DUSA 3QUXA 4BZ2H 3TVMA 2JJSA 3L7EA 4KKBC 3C60A 1ZLWK 1U8QB 1M7IA 1F2QA 4NN6C 4L9DA 1LEKA 1JZ7A 1UM5L 3KJ6L 3KPNB 5LAXB 3S35X 2MPAH 1GJIA 3Q5TA 3FB6A 3NCMA 3BT2H 4JJ5B 1IGCL 1YEFL 2AV1A 2BFVL 5KS9F 3R0MA 4NQDA 4L3CA 5IEHB 2IFGA 1I3RA 4FQIL 5TH2B 3MRPA 1OGAD 4IDJL 4NOBA 1QFUL 4FS0A 5EZLA 2FH6A 3PWNB 3QIBC 5JMOC 1QSEB 4I4WA 4UI2A 2VB5A 1IC7H 5FA3A 1AGFA 1TETH 4ZAKB 5HGAB 4HQQH 4HV8A 1VKXB 1QZ1A 4R3SB 1Q9OB 1UQSB 3U7YH 4N0UA 4HFWA 5FCSH 3STZA 5IROA 4G42A 1R3JB 4HAFA 4WHYH 1FVEA 4NO5B 1J9CT 1KNOA 4UDTA 4RQQA 4QTIH 4N68A 2IAMA 2BXZA 2WSKA 2NR6C 3MRCB 4RGNB 1H5BB 1EIBA 2LVCA 4R96B 3GI8L 1X5FA 5DRZB 4JN2A 4RFEA 3G9AB 5DTFB 3S34L 3U9UA 4ODUB 1CLOL 2IC2A 1CZ8L 4M5ZL 1ETZB 3IKCA 4GRMA 1HQRA 3BP6A 5JW5B 3I50L 5DRXB 5C7XL 4MS8D 3FT3A 4ZNEA 3ARQA 1BOYA 1EEYB 2VDPL 2DLGA 3DYPA 3QI9B 2XG5A 4MGXA 4OZIB 5LGHL 4ALAH 1RHHB 3GHBL 3IFPA 3OKKB 1CDUA 1MNUH 5E0QA 4HBCL 4XP6L 5FOJA 3FCTA 1RSFA 4Z77B 2FZ3B 3OB8A 2NXZB 2X4TA 3QIUB 4OF3A 1C12B 3SKOB 1IEBA 1E4KA 2VITB 1RMFL 1F6FB 3IDYC 2MCPL 1IM9D 1YMMA 1FNSL 3UZEA 1S7TA 3BGFB 3VXSE 4XX1E 4TUJB 5L2KD 1D6EB 1A5FL 3RVVD 1XF3B 5ERWA 4MZ3A 4JFOB 3ABZA 4ZTOH 1VADB 1MLCB 2R1XA 1VGEL 5IIEA 4BH7B 1S7UA 2YSSA 4NKOA 5IT2H 5KVDL 3HZYA 1CDHA 5SX4H 3PV7A 1HDMA 2EKJA 4G7YH 2IANB 1KEGH 2GAZB 4YDVA 4Y88A 3HUJE 4XXCA 3DRQA 3MGAA 3MOBH 4Z7UA 3GSNL 3VH8B 2CLRA 4XGZA 3PHSA 2Y9RT 1ED3B 1OARH 2YUZA 4M02A 2VDRL 1EHLH 2DLTA 3O2DL 3BVNB 1MELA 1B90A 2RGSA 1FV1A 1CXIA 1KB5A 2NY1C 3RKDD 4PLKC 5SWZD 3MODL 5I1DB 5E70A 4NFCA 4JKKA 4LFHD 4JFYB 1FVDA 1CD9B 3CX2A 4D3CH 5F70A 1X7QB 2Y6SC 3K2MC 1NCDH 4JDVB 4NRXA 2LU3A 3FAXA 2QKIA 4Y5YA 3D85D 4YHLL 5K9JH 5D1QA 2X4SA 1XZ0A 3BX7C 2I9LA 1CTNA 1T5XA 3GSXA 5BVJA 4OLZH 3G5VA 1WCBA 5EPMB 3GDBA 3ZKSD 2Z35B 3L3KA 4JCMA 4PJHA 1E4XL 3ARYA 4IOFD 5HI4D 4TSAH 1FZOB 3F7YB 3MLUH 4OZHE 4GKZA 5D1ZB 4PLJC 5JHDE 5I2IB 2VLKB 1NFDF 3QZWB 1RUMH 1EFXA 3UP1A 5F96H 2MQ0A 1JHKH 3TN0D 4F57L 4GO6B 3QNXB 2OTWB 4J8RA 4P3DA 1AHWB 1XT5A 1KN2H 1FORH 4AM0B 5HVHB 4MDJA 3QQNA 2XZQH 3SKJH 1NDMA 1IQWL 3KDMB 1CT8B 5I1EL 1VFOA 4K2UH 2VJXA 1P84J 5D8JL 4WWKA 4ELKB 3FZUD 3FO9A 2DQIH 5IKCB 3L3GB 3PQYD 4KK6D 5AAWA 4FFYL 3RPIB 3VFWB 3O6FA 4JO4L 4PJCF 1I1AC 1RJCA 3BMVA 1NFIB 5CGTA 3VGGA 3U46A 3QDJB 2BC4B 2P8PA 1HN1A 4HKBB 2OYPA 2BNRE 5A2FA 1HI6B 1QFWH 3OSKA 2BVPB 5AEAA 2CLVB 1N8ZB 3OKDB 1INEL 3JWOC 2OSLB 3ROOA 1CFBA 4MJ5A 2HLAB 5IM7B 5HGHA 3MXVL 1N2RB 5MHSD 4IOSD 5J1SC 3WFZA 4S1SL 3MUHL 4AG4H 5T3XH 4EN3A 4NN7B 1JHTA 5DD3L 5E2VL 1FNEA 5IOPB 3KYOB 2FB4L 3T3ME 3UPCA 4LSQH 3MRGA 1NGPL 4ZUSB 4V2CB 1EHNA 4P5MA 5KVFL 4E0RA 4EUPB 2D7QA 3TA3A 3WLBA 1JHLL 1V3KA 5LBSL 2EH7L 5E1HB 1N64L 1YQVH 3DROB 1TJIL 4M4RA 3NN8A 5K9QI 2HFGH 4M6AA 1PD6A 3EYSL 4ZSOB 3KXFB 4GOSA 2VDML 4JM2A 5C3LD 2Z93B 1HHJA 3G5XA 4LCIL 1NGXB 1BWWA 4YGVB 1GAFL 2PR4H 4LAQH 2X7LB 2F53D 4I77H 4XNMA 5GS0L 1X5AA 2ID5A 2AS5M 2CUHA 1VENA 4CNIB 3VE0A 5K59F 5FK9B 5E24E 3TH2T 1D6VH 4KTEL 3MYJB 3RWDB 3OJMB 3WL9B 3TJHD 1CK0H 3O81A 2EH8L 2XXCB 1RZJL 3O8XD 4Y5XC 1KJ2A 1X5ZA 3GO1L 4WV1A 4MQXD 5F9JB 5F7YC 5FUCC 5F3BA 2A9ML 5IJVB 5IFHH 1NGYA 5L0QC 3DECA 2DQEL 4LLMB 3VXTA 2HWZL 4G8FA 3ZL4L 3KWWB 3JUZA 3FO1A 1JK8B 4HCRA 4XCYB 4OF0A 3ZKXC 1IKNC 4OFVA 2CIKB 5T5NF 32C2A 1V3LA 3RWFB 2ITDB 2YUVA 4M8QA 5ICXA 4OZGB 4U6VH 1H8SA 4PBVC 1BLNA 3C9NA 4XPFH 4P9HL 1CFVH 3MCLH 1F6AA 3SY0B 1CE1H 4I2XE 4X9GA 3QUMB 5IW3A 1P69B 4KK9C 1S8DB 1D9KD 1DVFA 1PFCA 4K3EL 1T5WB 1ROWA 3I6GB 3CZFB 3JZ7A 4ODTL 3T1FA 3SKNA 1WQVT 3Q6FA 5DVKA 4PB0L 1W0YT 1DJSA 2A73A 1SJXA 5MENB 2BSRA 3IF1B 4JFDA 3A6OA 2H26A 1UJ3B 4J2XA 5HXMA 4TOYL 2VDNL 4DGYH 1MHHA 4R8WH 4XBPA 2O61A 3LIZH 3IRPX 3U1SH 4Z9KB 4H20H 1H8OA 1LP9F 5INCA 4CMMB 1RUPL 1MAJA 2P5WB 3VXPB 1L9MA 1OAZL 3G6JF 3RKPA 7CGTA 5IK3B 1KIPA 4YDJB 5F89A 1RVFH 3ZHDA 3MRKA 3QEUB 2CXKA 3BZ4A 2HVJA 4E41B 1XGPA 2CDGA 4K71B 2DQHH 3T2OA 3BIKA 4ZFZB 4U1GC 4HFUL 3KYNA 1GGIL 3RZCC 3GSRA 3VD7A 5C0FA 5ALBH 3UTSA 3FHAA 3GSOA 3VJ6A 5ADOL 3RBSA 3EO1A 4YDKL 4NNPH 2EDWA 4ZYKA 4FQCL 3BPCB 3BH8B 1RU9L 5HHOA 4FZ8H 5MEPA 1J8HE 4HLZH 4OD3H 5I71C 4LMQE 3EDKA 4A2MA 4GBXB 1QLFA 2C1PA 2H1PL 4J3XA 3CVIH 5C09E 4O2CB 1ZA6A 1I1YB 4Q0XH 5C0CE 3AC0A 1ZMYA 1A6TB 2WUCL 2C4FU 4TVPH 2JIXA 2AJZB 3BH9B 1PSKL 4NZTL 5SWQA 1J05B 3G5YA 4G8IB 4RCAA 2XI9A 5GZND 1UH3A 1N3NA 3BEWB 4KI5C 3G04A 3GSUB 4KZDH 1YN7B 1N4XL 4LSTL 5F1IB 4L4TE 1NBQA 4GMSH 1NEZG 4XVSL 1A4JA 4OBRA 1FG9C 3QDME 2H2PD 3HZVB 1UA6L 2EIZA 2XWTB 5EUKB 5IB1B 4MCYA 2OZ4A 1GC1C 5L2JA 4UIMB 4JB9H 3BHBB 2YC1B 2UZXB 3C6SB 4FXKA 2QHRH 3A6BH 3MLXH 1I8MB 1WGOA 4DZ8A 1E6OH 4MLIA 1HHIA 4YE4L 2J8UE 2Z31B 3DVGA 2VXUH 4O5LL 1W72H 5CD5D 4NO3A 1SYVB 5IFJA 2CLZB 3VXSB 4I9WE 2N7BA 3QQ9D 3G08A 1RZJC 1YC8A 3CFIC 1F42A 3PWLB 4GQ9H 3U4EB 3BEVA 1A6AA 1NGWB 1VFMA 1RIHL 2WWKO 4IHOA 3EDEA 4KK5D 4ODXA 5HBBA 3FT2B 3BUTA 4Q6IC 1BX2B 2AI0H 1UKSA 5D71H 1UACL 4KKNA 2XRAH 4NYLA 3TYGH 2QQNL 3HNTL 4HKXB 4U2ZA 4YDIH 3O4OB 3P77A 5B8CB 2LTQC 4X7TA 3RAJL 3MRMA 2X1WL 2PO6C 4P5TB 4QXUL 4G7VH 1U8LB 2GITA 1OAXL 3SGKC 5DMIL 3I6KA 1YDPA 3VFPA 3FMGH 4HPOL 4XPGL 3WN5B 4W6WB 3RI5F 3QUYC 4HULB 3BJ91 1TQCC 3EOTL 4JAMA 2V9TA 4G43A 3JWOH 4N90D 3HNSL 5IHZB 4QRPE 4U1JA 4P49A 1E4XI 3RHWF 1H15A 3FO0H 5CEZD 1T4KB 4YO0A 2PXYA 3QG7L 1IAMA 2QSQA 3DURB 4FTVA 4L1DA 3A0OA 1AKJD 5C6WH 1G7PB 1Y6NR 2ICWB 4LCWD 2ZNWA 5EO9B 4OB5H 2R69L 5EN2B 3HB3D 4XXDA 4QRSB 3VI3E 1CLOH 5JHDB 2HT3C 4N0CD 2YZ8A 5AWNH 4UB0H 4PPTA 3I50H 1T22B 1IQDA 3GSQA 5EUOE 5AZEH 1ORQB 4HD9A 2XN9E 1DUZA 2VLJD 4JRYA 3BXNB 3O6KL 5FM5O 5GIRA 3VFUA 2OBGA 1B4RA 4MNHA 4UBDD 1YNTA 3NIDE 3DXAA 4NM8L 5SV3A 2NY2D 5C3TA 1C7SA 1Q1JL 3PE9A 4UQ2B 5FM8A 4BKLB 2EDBA 4PJ9A 4PRPD 4MA1B 1ADQH 2EXYD 4XC1H 2P5EA 5EH1A 3TZVD 3IB4A 3GRWA 1AC0A 2WLYA 4YC2B 4AEIH 4AEEA 4HGWA 2GK2A 2P8MB 3D69A 2X89A 2GFBB 3TBYA 3P4LA 3PWPD 3TNMB 4XWOD 4FQQA 1WWWX 2ATPB 2XFXA 1WICA 4P48A 3IDUA 4P46A 1CQYA 2BNRB 2ED7A 3ARVA 3I9GL 3T2PA 2HG5A 4RZCA 1QR4A 3MRDA 1D5MA 3PG2A 2UZIL 1Q9LB 3GGWB 5I8KL 4UQ3A 4XNYL 3CK0L 1VEPA 1J0IA 4F7EB 3GBNL 1X5HA 1S3KH 4WTXA 3X11A 1U95B 1V3JA 4PJ8A 3LHPL 4TPRL 5E6YA 3QFDA 5C09A 3WEXB 4NNXA 4JG0L 3SE4C 3WS3B 2DLEA 3ARGB 1NFKA 1IFHL 3OB0H 3QHZL 1HSAA 4FQJH 2P45B 3U2SA 5D7KD 3FQWA 4AEHH 2E5EA 3Q3GA 4LVNB 2E8ZA 4QRQB 4PGDA 2JB6B 1TZHB 1AP2B 1RQ5A 2QL1A 3ILPA 3RU8L 3NIFE 4Y2DC 4I18B 4PJEE 2EYSA 5JIIA 8FABA 5T5FH 3SQOL 2F5AL 2XPGB 4DN4H 5ETUB 2HVKB 2ZSWB 4LSRL 3SDAB 1GGBL 1AY1L 5C0BE 4M6NL 5DQJB 1P4BH 2VWEC 5DJDB 3THML 1KIQA 3HG1A 1DE4A 5DJAB 2RBLA 2Z91A 1RZFH 5E2TH 4L4VE 4OUUB 5IMMB 3HC0A 1L7TH 2I27N 2IQ9L 3O9WB 4AENA 3MJ7B 3MREB 1Q38A 2RCSH 1MY7A 4LKXA 3V4PL 1MCEA 3VD3A 1YNLH 2SEBA 1FJ1B 2W0FB 1QRNB 4WUUD 4RMVA 3LKPA 1F8TH 4PRHA 4WCYH 3C08H 4HEPG 4P4KA 1RURL 3ULVD 1GOHA 3B9VA 4UOW1 2D0GA 2HP4A 1EJOH 3FOLA 3O45A 1AGBA 3MJ9L 1ZA3A 1EEQA 2ICES 4JFFA 1IQWH 1WFTA 2VXTL 4N1HB 5ANME 1A7QH 3RDTB 1AGEA 2PCPA 5FM4A 2VN7A 4XNUL 3GIZL 4KRLB 4JGUA 3WKML 2Q7YA 4LVHB 5F71A 4Y19E 4Y16C 4ZG1A 3SDDA 3V6ZB 3QXAA 1B6UA 4H5SB 1PGRB 4NT6A 2D7PA 3ILQD 4J3TA 4R4BB 1QSZA 4AT6A 2EECA 1ZHLA 2R8SH 3OQ3B 1JIBA 3SGDH 3FQNB 4ZXBC 3F58H 2YXFA 3RL2B 3TCLB 5IESL 4PJ7B 1KENL 3MLPA 1D5ZB 4HK3J 3CFEA 4PJGA 4Y4FA 4UTAH 3MR9B 1A2YB 1U8NA 5EOTB 3K7UA 5LG1A 1F97A 3TGXA 4TNWF 2R9HD 2VR9A 1CXLA 5J06A 1G7IB 4O4YL 3SJVD 3EZ8A 1FZJB 1NGPH 3N06B 2HJFB 3MLTB 3BSZL 1AQKL 4M8VA 1EXUB 4AEFA 3WXWH 3AMKA 1KJMB 3P73A 1T1ZB 2A2QT 3AS2A 1GC1H 1DLFL 3IETA 1BF8A 2HTLD 4GAFB 1R5VA 3RWEB 4MHHI 1IBGL 3MRBB 2PW1B 3HAEA 1TQBB 2OJEB 5DD1L 2XTJD 3B6SA 1EEZB 1HNGA 1XR9A 4HUUA 3MCG1 4WHCA 7FABH 4NO2A 2ZCLH 5IMLA 2Q1EA 4YWGH 2I26N 2ARJB 4K7FA 1GAFH 5KSBF 3L5WA 5DJ6B 4OQTH 3ARBC 4X0KA 4TRPH 1R3LB 1G9ML 5JXAL 5DEFA 5C2UB 5DK2B 4XP9L 3P9WB 3HE6A 1J8HB 4L3AA 5I9QC 3ZLQC 4PGCB 3VG0L 2OK0L 2EH8H 4X6FB 2BOCB 1OW0A 4GJTB 4OT1H 5EU6A 3OKOB 5ITBH 3RNQB 3EYVB 1OSZB 1N6VA 3UBXA 3SPVB 1X5JA 1NCWH 5DFVC 2J6EH 2JK5A 5IBLD 3ZYOA 1IAIL 3NCYS 4LP5A 2VLLB 5CZXC 3VG9C 5F7UA 2FATH 4O9HH 4L9LA 4X9BA 4JFEB 4L4TB 3IRZA 3UPRB 2FWOB 2VZUA 3QWOA 4MMZC 1JN6A 1FFQA 2FDBP 3JTSB 4PD4K 1XGQA 1KJVA 1CLZL 5I1CL 4Z95L 4JZNA 3QDMB 1A4KB 5HYSG 1Q0YL 1A6PA 3SDCA 2YPLA 3D0LA 3QUZB 1JPFB 3ARDB 4G8EA 4YQXL 5GS1C 3FRUA 1T3FA 3EYFB 3WIHH 4YX2H 4DEPB 3MOAL 4P2QA 4BJLA 4Z8FH 5DJCB 4GUPB 2G9HA 4HSQA 1HH9A 3KPQB 3WFBL 1NCBH 2R0KH 2MWCA 4PB0H 4X6DF 4LQFH 3H7BB 3EJJX 3K8LA 5JXEC 5ID1B 3MO1B 5KS9E 1JPST 1KF9B 2ZOKA 3J8F7 3QHTC 3BQUB 1YC7A 2J8UB 1OVZA 2VDNH 4FZEL 2NTFA 2DM7A 3O2WL 3MLRH 4K55A 4Y4KA 5HHQA 1WWBX 1FGNH 4M4PA 3GMOA 1DBKL 3DTXB 3ULSB 1ODAA 3N0PB 1I85C 4YK4C 3QRGH 2ZCKL 4Y0GA 3RGVB 1BZ9B 3OAUH 3FT4A 3AAZB 4MAYB 5HYJE 1ZVSA 4CW1B 1NGZA 5C0DB 1YEGL 1DTUA 2MHAB 2Y5TB 4LLUB 1U8QA 5C0GB 2OS7A 4F7CB 2WUBL 4ZOAA 1A7OH 2W38A 5FOBB 5DK0A 3KPNA 4HIIB 2YWYA 3FKUS 2GJZB 4K3DH 5ID0B 1IGIL 1QSFA 2M2DA 3NPZB 5EIIB 4OKVB 4NZRL 5AYQA 4RGND 3QWRD 3LD8B 3MV7E 5TH2A 4K8RD 1G7MB 4B0MM 4UNVA 3ISWA 1NEZB 1UENA 2X70B 3EGSB 4WY7L 4BH8B 3KLDA 4N8CH 3S4SG 2CMRH 4P57A 4JG1L 5HGAA 1ZSDB 2R4RL 5E9DE 1F3JB 4R3SA 2AEQL 5J7CC 1UQSA 1ZK9A 5E8NB 4QRPB 5GRVK 1R3JA 5I1IL 4K9EC 1N6QH 5D2NC 3EFDL 4OCSH 2HKHL 3P0VL 4BYHA 2YPKB 3NA4A 1MCBA 3MZGB 4DVBB 1D5IH 4NGHH 4NZTH 3QEQA 4X6EB 4QWWD 4RWYL 3WHE0 2X2YA 3IT8D 3O0RH 4K23H 5DYOB 5I1JL 4EKXA 3CD4A 1N4XH 4L8CA 3E6HB 3V4UL 3VA2C 5DTFA 2CGRL 4ODUA 2YA0A 3X13A 5DQDH 1KLGA 4G9FD 1U8IB 3QXTA 1ETZA 4OFIA 1DFBL 2D7TL 4ODSL 3TF7C 5TDPA 1UA6H 3VWJA 1LO2H 1WAAA 3IGAB 4YHIB 4M7KH 3AGVA 5CJXA 2PYED 2VKXA 1ZLSL 1Q72L 3TC9A 4HS6B 4WU7A 4OZIA 5IBTH 4P5KA 3BFOA 5I8EB 5GRJL 3DGCR 2XN9B 3T0ED 1MI5D 4PG2C 3DSFH 1SHMA 4KMQA 3LV3B 4Z77A 3CFDA 2IAND 1IAOB 3QIUA 1C12A 3MRFA 5TQ2H 3SKOA 1OTTD 4QGYA 2LAGB 4LPWA 4XAKD 3D25B 1D5BB 2C3GA 4KAQH 1XF3A 4JFOA 4TQEL 3W9EA 1EX0A 1VADA 1A7NH 4XBGB 1TVBB 4LL9A 2LU7A 2NY0B 1BFOB 4XVTL 1BBJB 5IGXL 2GAZA 1EK3A 4TN9A 4GG6E 4I3SL 3VH8A 4LSDA 1UACH 3KPRE 1G7QA 2DJSA 2X4PA 1IJ9A 4WFFD 2NY1B 2FJFB 2PNDA 5AG9A 3MMEB 3RGHA 3TIDA 3RWHB 1VSCA 3CFCL 1HWHB 2W92A 3GMNA 4MS8C 5ILTL 2OXGA 2WWMC 1L6XA 4MQ7B 5CEYB 2YA1A 2HJLA 2JJWA 4C59B 1WWAX 1P7HL 1ZTXL 3OB0K 1QO3B 4H25B 1BFSA 4GKSA 3EOTH 3V5KB 4JDVA 4G6FD 1DQDL 4QOKA 5C0JB 1AXTL 5CP3H 4NQDD 2QSCL 1EVUA 1IC5L 1W72B 1QUNA 3LS5L 1Z3GH 2K7PA 3BN3B 4LP4A 1MF2L 5EPMA 5JOFB 1A1NB 5T1KB 2Z35A 5J6GA 4PJCE 2NX5A 1LO5B 2XY2A 3KPPA 1AIFB 1LEIA 1UWEH 2EDLA 3L3JA 3RVVC 4N1EA 5HHXH 4GAGH 2G75A 3QHFL 1M7DA 3EKCA 2VLKA 2VIRB 3VXUA 2QJDA 4PV8A 2J1KA 3FB8A 3OTTA 1C5CH 3PWVA 1MCIA 3QNXA 3SKMA 4H0HB 1IMHC 3QDJD 4PP1D 5T5NG 4B7IA 2IAMD 3ZKNC 1URLA 1CXKA 4AM0A 3S96B 1PVHA 3U36B 3KDMA 3QDAA 4X5WB 1CT8A 4JKLA 1KCKA 2AVGA 3DMMD 3D39A 1BP3B 5H2BB 1IKFH 1F4WL 3ZTJH 1PY9A 5GQBA 5E7FA 4PJDB 3RTQB 1M6OB 4F7TA 2WMPA 3LCYA 1JPTL 3LEVH 3RKDC 4W4OC 5GHWH 5CHNB 3BO8B 5GGVY 2HLFC 1HI6A 3BIBX 2D03L 2BVPA 3IDJB 1A3RL 1N8ZA 3MLZL 4D2NA 2R4SL 3MFFB 3K1KC 5FYLE 3QO1A 5IM7A 1N2RA 2BNQD 4GS7C 3LQAL 5JPNB 4Q2ZB 4NUJB 4Z6AT 2E7LC 1GVIA 4XPBH 5DC9B 4U1IB 3B8YA 2DQDH 4N8VB 5K59E 1PKQE 4EXKA 3KYOA 4X4XB 1J1OL 4FG6D 2OM5A 4EUPA 3QNZB 2VLRB 2ZSVB 4IOFC 4TSBL 4GG8B 4ZODA 5EO1B 5HI4C 4OCXL 1P7KB 2JJTA 3QHZH 5FO7B 3WNMA 1MCKA 3LS4L 3JV5A 3ARTA 4Y1AD 5CGYD 2AABH 3TN0C 1RJYB 1MWAH 1HXMB 1JNHA 1K4DB 5ACZB 5KANG 5F1KC 2YPVH 1INQB 4BFIA 4ZUUA 3WIFA 4C56A 1NGXA 4PRBA 5TE4L 2VLME 2EDYA 2ZUQC 4NUGL 2X7LA 5FB8A 4MJ2A 1NAMH 2FX8H 3FZUC 4CNIA 5FK9A 4Y5XB 25C8L 3MYJA 4KK6C 3RWDA 5GS2D 1XIWA 5BZWB 1BAFL 1WVZA 3CNKA 4AK1A 1CDYA 4XNQB 2AJXL 1BJMA 3MV8A 5F9JA 1IAII 5JO5B 2OZ4L 1U93A 4LLMA 4UTBH 5FECA 3BP7A 3ZKXB 5D1QD 3UJJL 4X7SH 4QEGA 1JK8A 1Q9WB 3ZTJG 5DEZA 2QADD 4YEFA 3WXVL 4C83B 3VDBA 2CIKA 4MSWA 2FD6H 5C08A 1NUGA 4M43L 1WSST 4I5BB 2A6KB 3MJ9H 5JNYB 1LP9E 2AK4E 3AB0C 1ITBB 4G5ZL 3VFRB 4XMKL 3G6JE 1MPAL 3SY0A 5A16B 5LGJA 1T1XB 4RRPG 4Y5VC 1EZVY 5F1NB 3BKYL 1U58B 1F4HA 4XCEB 3FRPG 3KG5A 3JWDC 3HKFA 3I6GA 3CZFA 5I17A 1KCVL 2OMBA 3HI6L 3OR7B 4M1GH 5AD0A 3L5IA 5FGSA 1S9KC 5JQHC 4WI3A 3KPSB 5IQ7H 3FB5A 5HVWA 5MENA 3OX8B 2WANA 4MA8L 5IB2A 1CE6B 4K9EH 1JGVH 5CMAB 1A1OA 3PUCA 5CBEB 4PJAF 1MIML 5IESH 4N8PA 4ODHL 4LRIC 5DEGB 5A3ID 1N5YL 3AU1B 4WHTA 3CDCA 3MRQA 5DA4A 2IADB 5KS9B 3TJHC 4Q74A 3MA9H 5E6ZA 5TQ0L 1MH5B 2VQTA 4Z7WF 3O8XC 5I66B 2AEPH 4EDXB 3Q0HA 1DSFH 4D0DA 4MQXC 3OF6A 4ZFOL 4U1GB 1I7TB 3RZCB 3BSZH 4FFZH 5EFIB 4MD4A 2ADJA 3DYMA 1UM4H 1RJLA 2Y72A 3QCVH 4ISVB 3NA9H 5FGBA 4ZFZA 1T7XA 5I18H 3GJEB 2EICA 3I2CL 3UO1H 2DLIA 2XZAL 3WUZA 4FFWD 3AXLB 3AY4A 3ZYZA 1AXIB 2YD2A 4DKFH 1MRFH 3BPCA 2GT9A 5IR1B 2CUIA 3BH8A 1OM3L 3PGCA 1ZS8B 5CILL 4JDTL 3VXRE 5KN5B 1D9KC 4GBXA 3ULVF 1UC6A 3F12A 4S1QL 2P7TA 3WYRA 2O26U 4Y4HA 4ZUTB 5KW9H 3GMQA 2FHBA 3K3QA 4MXWL 2KL6A 5HYSB 2OK0H 2I07B 1T89C 5E9DB 4G6KL 4Z0BH 5GGSA 2AJZA 2QEJA 3BH9A 1J05A 2VNCA 4IRSA 4DKAA 4PRNB 4DVRH 2JCCF 2EDQA 4TUOB 2NNAA 5ESAB 2IPUG 3GSUA 3V4VL 1DDHA 5F1IA 5FHBH 3UTTE 3QIWD 1XGYL 4G8GE 3ZE0E 5CP7B 3WIIL 1KCRH 3MLSL 2NW3B 2ATKB 4MNQB 1I4FB 3GRWL 3IDIB 1DUYB 5FF6A 1J12A 2COQA 4G6ML 3FQXB 4PS4H 5D2LF 5FYKE 1QKZL 5IB1A 3QUKA 4NQSA 2CK0L 1CCZA 2DIBA 3EDFA 4UIMA 1BHGA 3CXDH 3N1MC 4ZO8A 5KTEL 3IDGB 2WBJD 1B0WA 1MOEA 4OSUL 5A1AA 2YN3A 5EU5A 4K7PY 4GLRI 3MOAH 4I3GA 4WFEE 2J3SA 4ODBD 4WDIB 4HK0A 2IGFL 2P43B 1SJEA 1XF4A 1BECA 5J9PA 1UXWB 1AR1D 3TWCL 2DYPA 4GRWE 2A6IB 2AXHA 2Z31A 5I1HL 5DQ9A 2CJUH 4RFOH 3LEYH 4PFEA 1YEEL 1SYVA 4NBXB 3QISA 1F3DH 4XPTH 5DSCB 3FO2B 1VEOA 2BY1A 4J3WA 5DT1H 4LOUD 1FNGB 2C3WA 3TBTB 4KU1A 1EGJL 1YEHL 4FQ1L 3GKWH 4TUKL 5JHLH 3UDWC 3LRGA 4YIQA 4NDMA 3CLEL 1NGWA 4DN3L 3S4SB 5GZNC 4UNUA 5HHVL 3IYLW 2LTQB 3CIQA 5IW6B 2PO6B 4GAJL 2CKBL 1ZLVH 2WBKA 4JHWL 4L3EE 4UT6H 3BW9B 4MDIA 3UROR 2L7JA 3O3BB 3KPRB 2V5SA 1AD9B 1J18A 4P5TA 1NDGB 5I74B 3FAWA 1F4YH 4V1DE 1U8LA 1J87A 3QUYB 2H2PC 3MBXL 1TQCB 5C0RL 1J10A 5DD5L 1LD9B 1NFDB 1HKLL 2VR5A 2FIKB 4EOWH 4CGTA 5IHUH 3V0VB 3UTSD 4PJFA 3CPLA 5GGTA 1T4KA 3KNBB 3RWJA 4XNZC 4HUXB 1DQJB 4HWBH 3LKRB 5HHOD 1R24B 4U7KA 4U0RC 5I1IH 2GQHA 4EBQH 3EFDH 2HKFH 1G7PA 3DX6B 1QHPA 2XQYG 1P1ZA 4XCFL 5CD5C 2B1AL 3EYQC 1BQHA 3BPLC 4PJCB 5EN2A 2BVQA 1K85A 5I1JH 2HFFB 1V5JA 3QQ9C 9CGTA 3BPOC 4HHAB 2CGRH 3X3GL 1KFAL 2JIXD 5E94B 1C1EL 3IVKB 2VDLH 3D5OF 1EA9C 5A43C 4JQXC 1YQ2A 4UILL 4W68A 1RIVL 1P2CA 4X7FC 2E7BA 4KK5C 3EFFB 4N1CA 4S2SA 4I0PB 1KB9K 2AEIT 1CFQB 2A74B 2E6PA 1C7TA 1MCOL 1A6UL 1BIIA 2W0KA 5DFTA 2NCMA 1OGAE 1FNLA 3NH7L 4H1LH 4BKLA 4PTTA 4JFQA 2F19H 3KHOA 4XBEL 4OIBA 3O3AB 1S7RA 2P8MA 3JV6B 4CKVX 5D72H 2V7NA 4ODVL 4HJGB 3JBG7 4YBHA 5D5MA 4NO0D 4M1CD 3VGAC 3PGFH 5GISL 4TQEH 4LLYB 1FNHA 5ECJE 2Y36H 1Q9LA 3GGWA 1WCQA 1BZ7B 1QLRB 2QQKH 3OG6B 1JRHH 4LVEA 5C6TH 4WI6A 4X99B 5IGXH 4JHAL 5TPWH 2R2EA 3L5HA 3WS3A 3ARGA 1RULH 4NRZB 1QLEL 2ESVE 3I3EA 3HS0B 1F00I 1BPVA 4TVSa 3HB3C 2FL5A 4DOHE 3EUUA 3N9GH 4QRRE 2NYYD 2JELL 4Y2DB 4GXUM 4N0CC 5BO1L 1TZHA 3WJJA 5EO0A 3DGGA 1AP2A 5ADPL 4QGTA 3JWDH 4ZS6D 3MXWL 1W0VB 1MRDH 1T83C 4M5YH 3U79A 5J3HD 4UBDC 4U6YB 2O5ZL 1J0YA 1JWSB 5ETUA 2HVKA 2NY2C 5L2KE 2DQTL 2XQBH 3VD4A 3K74B 2WM0A 5DQJA 1X5LA 3OKMA 4LNRA 4KVCL 1WFNA 2EXYC 2PN5A 3PHQB 3TZVC 1VFBA 3BD3A 2CDEB 2X4OB 3O9WA 3VCLB 3MJ7A 3MREA 1NLBL 4XWOC 5DJYB 1AI1L 4OCYH 4TSCL 4H1LG 1FJ1A 1QRNA 3A67H 3EHBD 3QHFH 3KYMA 3QNYB 5DUML 5C86A 1F13A 1JGDB 2Q86B 3P11H 4BQ8A 3WS6C 3HMXL 3IKKA 4DZBB 3L1OL 1BQLL 4KVNH 5C07E 4RIRB 5K9OA 2ZUUA 3SDYL 2AK1L 4XZUB 1HINH 3KVQA 3P4MB 4XHJC 3V6OC 4QTHB 3RDTA 1F4AA 4XNXH 5I15L 3DX7A 4Y16B 3PP3H 4K94L 1LP9B 1AE6H 5CJ5A 1UYWH 1FZMB 5CCKH 1FVCA 4KH2A 5T3ZL 3G6JB 2R29L 4CDGC 5FUZL 1IGMH 3KLAA 3RHWK 2Y7QB 4ZXBB 3HFMH 4JRYD 3UTQA 4LIQH 1WBZB 5SWSA 2W9EL 2D4FA 2CKNA 4OCMC 1K9TA 1LO4H 3HC4H 1U8HB 4TTD