4BZ1L

Structure of dengue virus ediii in complex with fab 3e31
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
218
Chain Sequence
DIVMSQSPSSLAVSVGEKVTLSCKSSQSLLYSSNQKNHLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTINSVKAEDLAVYYCQHFYIYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFAPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords ENVELOPE PROTEIN
publication title Structure of Dengue Virus Ediii in Complex with Fab 3E31
rcsb
source organism Dengue virus 4
total genus 46
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bz1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4bz1L01
3NIFF 1K3IA 1Y0LA 4QRRB 4XCYA 5F9OH 3MJ7A 4U2YA 3CH8A 3LB6C 3UAJD 4PJEB 2D31B 5CJQL 4LLYB 4ERSH 1I8KB 2BNUB 3AMKA 3PP3H 5JW5A 3A6CL 4HK0B 1Z6JT 1CFSB 1S78C 4OCSL 5DD6B 2EDHA 3BKCH 5F7FA 1PZ5B 3AM8A 2OP4H 1ORSB 4ELKA 2PO6C 1FYTD 4YBLB 2OTWB 2ZSWB 1H0DB 3QUXA 4GKNA 4BK4A 1TZHB 3GHEL 3CXDH 1T1YA 5CLWA 2JCCA 2YA2A 2IG2H 3HAEG 3VWKA 4PGEB 3VXMA 4KJYA 5CEXB 1KIQB 1Y18B 5H35A 2WBJD 4M1DL 3GRWA 4JRXD 3P3YA 5AG9A 3JSSA 1NFIB 2ZJSH 3UTSA 1YEFL 3RIFF 2H45A 3ULVL 4U1IA 1OOAA 1UZ8A 4TQEL 1JBJA 3WDIA 4PGCA 1O7VA 1FVCB 4CADA 1PD6A 4NNXB 1UXSB 4TSBH 2F5AL 4PJBF 2F54B 4QRSA 1F4AA 2VL5A 3W5NA 5DD0L 4KI1A 3CFKA 3VXRD 1KFAL 1X5LA 3BOVA 5GIRB 2E6JA 1NAKL 1S9WA 2YPLA 4FXLA 2Y5TA 1JGDB 4NBZB 4QXTA 2VIRB 1XF2B 4JM2F 3ZL4H 3MRMB 3ULVF 4U6VH 2GT9B 2HN7A 2WP3T 2X4NA 5HGHA 3QG7H 3TO2A 4PG9B 1I3GH 5FYLD 2K7PA 4YDVA 5D7LB 2DRUA 7CGTA 2X4UA 5T3ZE 4XCNA 4M8QA 1WIOA 3MLUL 3WD5H 2ZCLL 4P23C 1FC2D 1SHMA 1XGUB 4FFWC 1RV6X 4M3KB 5LJYH 2CLZB 3QDAA 5CGYD 2WK2A 4YAQB 4P5TD 4LLDA 5F88A 1F2QA 1QSED 4MJ6B 4XMPL 1DBKH 1H5BA 3GMQB 2O5YL 2Y36H 3TPUA 3HR5A 2IAMC 5ESQA 3FCTB 5IVZA 3WO4B 1F3JB 1WVZA 1ETZA 1VCAA 3KYKH 1GGIH 5TF1H 4KUCD 4R4NC 3FOMA 3NCYP 4F7CA 4HIHB 1OPGH 2VQUA 5BRZD 3B5HA 4FQXC 3VXUB 1ZLSL 5KVEL 3V0VA 5J13B 3BJ91 1PW3A 3L5XL 1UWEL 3C6LD 3GMNA 3ARGC 3WL9A 4NKMB 4KHXH 1UQSA 4M61A 2EE6A 4IRJC 1VFMA 3H9SD 4H8WL 4XP1H 1TFHA 7FABH 1OARH 2QJDA 4XCEB 1JZ6A 3IFPA 4LCCA 1BIHA 1BAFH 3RWCB 2NZ9D 4JO3H 4NO3A 4I2XA 2AXJA 3W9EB 1N5AA 1CLCA 2ICEB 1HIML 1XGRA 3TBVA 2E27H 4FQLH 2VLRE 2YD1A 1DVFB 3R06B 5J89A 1PVHA 4BFGA 5CGMA 3WXWL 2B1HL 5CJ8A 5I1IH 3QI9D 4K94H 3ZE0F 4MD0A 2B2XL 2CKBA 1R6VA 4LLVB 3SE4C 5LXGL 5IHUH 4RDQG 2Z4QB 3INUL 4POZD 2W07A 2YD4A 4YJZL 4OD3L 3V7AG 1D5BA 1TVHA 3GI9L 5E1AA 4R7DA 3HE6C 4W4OC 4NT6A 5TQ2H 3W0WA 4H1LG 4HUUA 1CE6A 3DOSA 4QHUA 4JANB 4UNVA 3QUYD 4G9DA 1HCFX 2IC2A 3UZVB 3U7YL 4L29B 4R26H 1FL6B 4X9GA 3ULUF 5DHVB 4P46B 1JPSL 1F90L 3U2SA 1UZ6E 4XNZC 3BP6B 2JTDA 5D1XC 4Y2DD 4N5EC 3ZDYF 1FZOA 1S7WB 3VJ6A 5KJRH 5GHWH 1YNTB 3JZ7A 4GMTL 4MNHA 1TTGA 5IM7A 3JWOL 1BEYH 4F80A 4LGPB 4JG0H 3SCMC 4ZUSA 4YO0A 1KC5H 2EDTA 1VFUA 2G2RB 4FABH 2GCYA 4GG6A 1RURH 3DRQA 3UPAA 5EFIA 4K71C 4F2MA 3T3ME 3L95A 1BX2B 2R0KL 3V6FA 2R29L 2B4CC 2R39A 5I0ZA 4CW1A 1JGLL 1T2XA 4QHLB 5B8CB 2HA1A 5E7FA 1KCUH 4NQDA 4UAOB 3U46A 2DYPB 3O45B 1DLHB 3MLTA 5GGTA 3SE8H 1NFKA 3V4PH 4NKIL 4NM8H 4PR5A 4XBEL 1PG7L 1NCAL 4BA8A 5IGXH 1UGNA 5D96B 5JIHA 4LL9A 4RGNE 3QDJA 1S8DA 5IESL 4YHLH 3MFFA 4OFKA 1BJMA 1BVLA 3ZKND 3MLSL 5CD5C 3LEYL 1R3LB 3EYSL 2ITCA 3KPLB 2NR6C 5IFJA 2DQDH 1V3KA 2W92A 4KKLC 3HI5L 1Q0XH 2BRQA 1A21A 4CU8A 2X4QB 5C6TH 3QZWB 5FO9B 2A9MH 4P2OA 2P4AB 3RWEB 5L2KB 4Z7VE 1S9XA 2JK5B 4Z5RB 4OCRH 2DQUH 4MA1B 3MJ6A 5FHBH 3FHAA 3L1OL 4HXAL 1MFAH 1ZAGA 4ZXBC 1UA6L 1A6UL 3MLWH 4H25B 2HT4D 4MX7B 4YR6A 4DWHA 3SBWA 1CGWA 4FG6C 4U1HB 3C6SA 2FHBA 2ESVA 4MLSA 4LCIL 1DEEB 2D0HA 4HWZB 3TN0A 4QHKJ 5T1KD 3HPJB 3MXWL 1K3ZA 4KAQH 3B9DA 1A7RH 3O4LB 3OKEB 3HLAA 5FK9B 3CDGB 5JTWA 4YHKL 5DK2A 4P99A 1XIWD 3C2AH 1DBAL 1KCKA 5IW1B 4GXUN 4BSVB 1JYXA 1RAMA 3WS3A 1H15B 3OMZA 3QJFB 4LARH 5T3ZD 4XZUA 1CBVL 1NLBL 1YQ2A 4LIQH 1J5OH 5DK0A 3BEWB 2OR7A 2NY3B 4G6AD 4PJHF 5HYSG 5HDBF 3L3DB 4JDZA 1NMCB 4TQEH 1XZ0A 3MRHA 1MAML 3VFSA 4ORZC 1M05A 3M8OH 3LY6A 5J4MA 1DANU 2JCCE 2AXFA 3ARFB 1MVFA 5F9WB 3E1F1 2ORBL 4WWKC 2I26N 1NSNL 4XCCL 5DD0H 5IMKA 3VFWB 2DWDB 2NW2B 1KELL 1EJ6A 2H1PL 4ZUTB 4LSTL 1NCCH 1X5IA 2DL9A 2CIKB 4KKNA 3N1GC 5GS2D 1G84A 2ZWLT 5H2BA 5KSBF 3PGFH 2GSIA 5ICXB 5CMAB 5DJ2A 1DSFL 1HEZB 5FF6B 1XEDA 5DLML 1MCDA 4DCQB 1L4IA 1RIVL 4H20L 2NXZB 2NCMA 1QEWA 2V9TA 1T0NA 4KJPD 2VLRD 3C60A 3P4OB 1I8LA 4JM4L 5JNYA 1F4YL 2DTMH 4IJ3B 3WFEH 3TVMA 4PYHA 1H3PL 3DMMD 2E6PA 4KK9C 3CMGA 1ED3A 1NUFA 1W8OA 3WEXB 4ELMA 2BC4A 4NZUH 1KEGH 3LQMA 4YPJA 5HGGS 5ID1B 3TP4A 1RFDL 3K4AA 2X4RB 1MQ8A 3BT2L 1TJGL 1CFQA 3OHXA 4G5ZH 5DRZB 1NBQA 4JVPA 4JPWL 3O6LH 4NSKA 5IQ9B 2VXVL 2FR4A 2Q1EA 1NAMA 4OIAA 4HG4J 3MRPA 3QUZB 1C5BH 3IS1X 5I15L 2Q3ZA 4PJ9B 4JN2B 1MQKH 3OB0K 5EZIL 2D7OA 3T4AB 3S96A 2HWZL 4PJ8A 3UAJC 5HDLA 5SWZA 1NGZB 1YMHB 3KPTA 4ONGL 1JNNH 3ORJA 4FXKB 3O3DA 1A9BB 3KYMA 2W0FA 4HH8A 4QTIH 3ULUH 1T6WA 2VDRH 3SDDC 3O2WL 1TVBB 4QHNB 2QV2A 3U6RB 4MMXC 3ARQA 3G5YB 4HXBL 5EBMB 5C86A 1JP5A 3IU3B 4CKVX 4YH6A 2R1WB 4PJAB 5LXGH 4OLUL 1U0QA 3JTTA 2KZWA 4RX4A 3T0EE 1FGVH 4J6RL 3D9AH 2K3TA 3GSXB 2PTVA 4S0SD 2WUBL 5E6IA 1XCTA 5FHAH 1MFEL 3RHWK 4I2XE 3IF1B 3L5HA 1IKFL 1HILB 3J8F7 3EO9L 4UQ3B 3HFML 3OAUL 4FFZH 4G9FE 1NAML 2VH5L 5HGAB 1WCBB 3PV6A 3PWUB 1E4XL 1FH5H 5K9JH 1WIPA 4RGND 1FFNB 2VL4A 2VR9A 2CJUH 2ZCHL 3BPCA 1U36A 1YY8A 4WU5B 3BAEL 4JZNB 3TBWB 4XXDA 2ENYA 3WJJA 2NNAA 2FWOA 2HJKB 1PBYA 4M5ZH 1VESA 4ZTPH 2A6DA 3C5ZD 1ZLUK 4O2CA 2VDOL 1AXSA 1FN4B 3RNKA 5C3TA 1V3LA 3DX7A 3PWVB 4JFFE 3HI1B 1H3GA 3GMLA 3HA0A 4UINH 1A2YA 3FO9B 4OLYL 2X1WL 1EJOH 1JNHB 4NN5B 4QRPA 4X6FA 5DUPH 2NTFB 5GS0L 4N8VG 5HHMB 5TE7L 3SKOA 4YX2L 4D8PA 3PNWA 5KVMC 1RIHL 5CGYC 3OXSB 1MPAH 1IBGH 5EUOA 4EJ1C 3CZFA 3HE7D 2MQ3A 4JO4L 3PP4H 3VWJC 2I9TA 4PTTB 4LNRB 3HZMA 1DBBL 4F58H 5BOZG 4X7TB 4ODXA 4JFXA 3WKMH 3CXHK 5AYQA 4K3JL 2AJYL 1OAXL 1NGQL 3UEZA 1AXTL 5SX4I 4KKCD 2I9LA 1F4WL 4O4YH 5CP7A 1T04A 5GXBB 5I1KL 4P2YA 2Z31C 1BQHG 4OGAD 1XF3A 5EO1B 4OSUL 2GY5A 4LHQB 2CRIA 2Z91B 5CGTA 1CF8H 5JO5A 1YEDA 1T4KB 1BIIB 4JFPA 4Z0XA 4JDTL 4U1KA 1KLFA 2F53A 3WFHB 3DX9B 1KB9K 3L5WA 4HFWA 1MVUA 2NZ9C 1CGSH 4HZLA 5DVNA 2YMXL 1M7IB 2X4SB 3C08L 4RA3A 1ZT7B 2ID5A 4XPFL 4OGZA 4IM8A 3SJVB 1J0YA 4U1LA 1XCQA 4QXGL 1ACYH 4Q6IA 3QI9C 4JKWA 5I16A 1IAIM 4LSRL 1DUZA 2HMID 4YHKH 3UTSD 5C0BE 4X6EB 2CPCA 2XTJC 4LQFH 1RHHA 3GSVB 4MAUL 1H8SA 3HG1E 2Q86A 3MOAH 1B4JL 4E5XA 1K85A 1A6TA 3F5WB 4PV9B 3SEPA 1XF4A 3QIBD 2DQGL 5T33H 5F70A 3AY4A 3NH7H 3VE0A 3S5LB 4WW1A 2BNQE 2X1XR 5GS1C 5DYOA 5FYJE 2FATL 2ESVE 2OI9B 5D5ME 4YNYB 3R1GL 2EDWA 4XRCB 2Y72A 5IV2A 3NZ8B 1G9ML 3UBXB 3H42L 4ZO8A 3RWGA 2EC9U 4M7ZC 2EDNA 4Y2DC 3L3GB 1LO0H 2YBRB 4BZ2H 4HMCA 3HC4L 2OQJB 1XR8A 2DF3A 3MXVH 2V6HA 2P7TA 1DDHA 4X4ZA 2CLVB 1Q72H 4PJIB 5JW3H 1OAKH 2JJSA 3QXTA 3NPZB 3CSYA 4LSTH 1OTSC 3CVHH 2NY6B 4J8RA 3STLB 4G6KL 5JA8B 5E94B 5CBEA 4DK3A 3Q1SH 3DUSB 2DJSA 4J3WA 4YGVA 5IBUB 5ACMA 1GC1H 2XWTA 4LGRB 3ARVA 4LPTA 1IGFH 3LAFA 1I1AA 4UQ2A 4N8PA 4IMLA 5EN2A 3GSOA 3L3KB 4K8RH 5ISZB 2EZ0D 3KLDA 2XYCA 2UV3A 3N50A 1IAKB 4PJ7E 1HHIA 1RHFA 4JY4A 3O8XB 1T7WA 4YDLB 3OGCA 1NGXA 3WJLC 3OJ2C 1N6QL 2YZ8A 4PRIE 1N8ZB 5EU5B 3RP1A 4Z7QF 4HWUA 3EJYC 5IVXE 3TT1L 3V6ZA 3EO1B 2Q8AL 5DO2C 2XICA 1ZT4A 2ADIA 2GUOA 3L3IB 4ORGB 3E8UH 2OXHA 3ZKNC 3QDME 3NTCL 1RFDH 4HIEA 1KF9B 4NKOA 5JIIA 8FABA 3T0ED 3C5JA 4Z6AT 3KPSA 5HGDB 1I7UB 2QADB 3RBGA 3QNXA 2DM3A 1TITA 4S0TD 1ZSDA 4MAYA 4HKBA 1BPVA 4OLXL 4PJDF 3DSNA 2VXVH 5E70A 4XNYL 5KG9B 1A7QH 4UTAH 2Z93B 1HXYA 3DROB 2GITA 2R0ZL 4OM0L 4ZNEA 3VXSE 3AREC 4RZCB 5TPWL 1I85A 1KXVC 5CBAB 4ZS7H 1QLFA 5F7EL 2WWMD 2VUOA 1ADQH 1BQSA 3MSPA 2V2XA 1J9CT 4JR9H 2YC1A 1D3CA 4Q9BA 1J87A 3LMJL 4ZD3H 2H3NB 1YMME 4Z7WE 4Y4FB 4HEME 2BXYA 5T1DL 5DHYA 3F58L 4U1JA 1TNMA 2EXYC 1CVSC 2CLRA 3T0BA 3B43A 4OLUH 3PABB 4JFFD 3BZFB 3VCLB 5F96H 1EK3A 1IZJA 4Z18A 1F97A 5HI4D 3W2DH 4GXUM 2V5YA 2HFGH 3ESVF 5EIIA 3T77B 4XPHL 1NMBL 4ODUA 3BP4A 4BQBA 1RK1A 1YEGL 1WTGT 4JKLA 4QXUL 4KRPD 5JDJA 3S8WA 1VKXB 1QFHA 5MEPB 1FFOB 1FLRH 1MIEL 2HAZA 2PYFA 5F3HA 5C0CA 5IWLA 4APQA 1S7VB 1WFUA 3I50L 4X9BA 3PV7A 1BOGA 4OF3A 1EO7A 3VFPB 1ORQB 2D7TL 3D2UA 1L6XA 1MUJA 3EGSB 4LU5L 5D2LF 4OLVH 3UTQB 2E7BA 3EOYG 5ANMA 5I75B 4MB4A 4UU9B 5HYIA 1YEJH 4Y19A 3HN3A 1ONQB 5BXFA 5L8LB 3LQAL 4L8BB 3RVWC 1NCDL 4H1LH 1I9RL 2CDFB 5KS9B 1LEGB 1RZIB 1T20A 1CI5A 1QLRA 4G3YL 5E5MA 1A4KA 2G75A 3H3PL 2WAHA 5EZOH 4R2GD 2VDKL 3QIWD 4ODWA 4EN3B 1ZS8A 4JGUA 2YUVA 3CAFA 1DFBH 2VOTA 4HUWA 4XVTH 4CVZA 1K8DB 4KJWC 1P4BH 2QQQA 4GRLD 1HQ4A 3QDJD 5DJXA 5GS0H 3K8MA 5TE7H 3DNKA 3BEVB 1WAAE 4P4KC 1FCGA 4ZYKB 3UJIH 1FAKT 3PGDA 5BQ7A 1TQCC 3MV7A 4ZUVA 5FYKE 1G9NC 1QA9A 4YHIB 2AXHA 1UENA 5FUOH 5SWSB 4JQVC 2R1YA 1XGYL 4FQ2H 5DEZA 4FFVD 3HI6L 1HOCA 3QWOB 1T89C 4JHWL 5C0BD 1WWCA 2L7JA 5IMLB 3VRJB 3SPVA 4X4ME 3VFVB 4NGHH 3HG1D 3Q5TA 4FNLL 5D7IE 1F4WH 1LNUA 1I8IB 3RU8H 3O11A 4YUEH 1B90A 5I1JH 3SDCC 3SDYH 2APXA 3ZDZE 2BNQD 1QD0A 1TJIH 3P9LA 1HH9A 5FYJD 3ARTA 3OX8B 1PKQA 1Q1JL 2ESVD 2PO6B 2HKFH 5I8KL 2NY2D 4PB0L 4KRNA 5F97E 4Y2OA 5F7HA 2IGFH 2X4PA 2F58H 2FZ3A 1TZGH 3EFDL 1PKOA 3TYFB 4DJMA 1FQ9C 1C12A 5KOVC 2CH8A 1GSMA 3HMXH 3OJDA 2VXSL 4OFVA 4DW2L 3D0VA 2FX9L 3C08H 3EYUL 3RWHB 1YYLH 2DN7A 4AIZB 4K7PL 1QO3A 3FQXA 2DQFA 1GZPB 1IQDB 1MFCL 2HJLB 3L3HB 4OIBA 3H9YA 2IPUK 4G8GB 4KQ3H 3T0EB 1LK3L 3FTGB 4NUGH 3HPLA 4PGJA 1QRNE 4BJLA 1B4JH 1U8NB 3QXDA 4U6HA 1N7ML 4X7EC 3FO1B 1AO7A 2F53E 2BHZA 4QWWC 5J6GB 1SM3H 4GBXD 3AVEA 4G9FB 2RB8A 4ZFOA 1U8OA 5KSAC 4Q9CA 2NY0B 3R1GH 4HC1A 1CXLA 1GGCL 2J3SA 3B3IA 4PRID 4BSWA 2AP2A 1HH6B 4Y1AE 4ONFL 2P44B 3MGTA 1IQWL 1XMWA 4M7LL 3MNVB 3U36A 1HXMA 2QQLL 5E99H 1QSZA 3QDMD 3ARBB 6FABH 5IHBA 1T21A 4LASL 4R7NA 1YPZE 2WANA 4CDGC 5F3BA 3QZWG 5FOBB 1FYHB 2PCPB 5AUMA 5FGSA 1R3IH 1YY9D 4LRNH 3C5ZC 3O2DA 4TTDD 1NC2A 4LCUB 2VAAB 1I7ZB 1IGTB 1EXUA 2OYPA 3N1PC 5J1AA 1HHHA 2GQHA 4XMKL 3T8XB 3VXSD 3UYRL 2J5LC 2IAMB 1Q9WA 2AXGA 3IDIB 2JB6A 1MH5A 5E8NB 3V5KA 3QEUB 4XP9L 3BW9A 5LAXA 1JPST 1WZKA 1KB9J 4ZDHA 4U1SB 2LU4A 2V2WA 2X70A 4YXKH 4LLMB 2DQHH 4HC1L 1KJMB 3HE7C 2FIRT 4PP1D 2Y23A 3ARGB 4U1MA 5HHQA 2O5XH 4OLZL 3ZTJH 1NC4A 2IF7A 3NGBB 1NGPL 4QRUB 4Z95L 1BD2A 3MRFA 2D0FA 3U9UA 5BV7H 4NHCL 3GSNL 1LP9A 2GSGA 3NTCH 5A16A 3N85L 2E8ZA 2EO1A 4Z7NF 4WDIA 3ZT7A 5DD1L 1CGYA 4GRWF 2QL1A 2EKJA 3EOBB 1QBAA 4R4FH 1JGVH 5EBLB 3LOWA 3O2DL 3FQRB 1NANH 3MRRA 2BVYA 3S3JA 1C5DA 3LKRB 2Y06H 4O5LH 2AK4B 5IW6B 2FEEL 3VI3E 5C8JA 3X13B 3QUXC 4G6FD 4WO4B 1SYVA 3MREA 3CK0L 1GAFH 4PJEF 2FD6H 3LEVH 5KZCB 3VWKC 3QNZA 1QNZH 1MWAL 2YA1A 5DJYA 4ZUWB 1S7UA 1K4CA 4Z7UA 3TBTA 2A74B 1MCWM 4N0FB 1QR1A 5E6ID 2KDGA 1U8JB 4JHAL 1KIPB 4IRZH 4KK5D 4ZOAA 4AEEA 4WEBL 4MNGE 5IQ7L 3BPOC 1IGYB 5D1XB 4X6DB 5GJSL 2DQJL 5E08H 5KSUA 1YYMH 1CDBA 2ADJB 3P4MA 4QXUH 1JPFB 3EAKA 1F45A 4M62H 3SCMB 5MP6L 3QFJE 5D1QD 4LEOA 3MROB 1FO0H 3FMGH 3G5VB 1X9QA 3CFCL 1VPOH 4GG8B 5GGRA 2PF6A 4XNXH 4LMQI 1DJSA 2R2HB 1OTTD 3P77B 2X10A 4LU5H 4PY8J 3EDFA 3RJQB 5I1GH 1JI2A 3X17A 4CJ0A 1FG2B 5BS0E 2VUYA 2IADA 3QEHB 5C0JA 3MUZ1 3I75A 3QXAB 5INCA 2X6MA 3BISA 3IETA 4TVPE 1K4DB 2CQVA 4HX1A 1J8HB 1WZLA 2X2YA 2ADFL 2EEBA 1OSPH 3EDJA 5CEZH 4A2MA 2RJMA 2JLLA 3CX2A 4HUMB 1N0LA 4YDJB 1H5BC 2QHRH 4IHOA 3DUHA 4S10A 5TDOA 4K9EL 3RL2B 2EZ0C 5ANME 1T3FB 1UCTA 3OXRB 4GAGH 4PRBA 1NUGA 4OCXL 1U8IA 5HHPB 3FRUB 3FN0L 4R97C 1ZT1A 4XB8A 2EH8H 1H3VA 4Q7DA 3ZTNH 3NN8B 4JFZH 4P3DB 3AS1A 1K9TA 3DO7A 1C5CL 5E2UH 4BH7A 3ALXA 4RSVA 4DN3H 5DQDH 1BQLL 4N9GB 3T1FB 1YC7A 2P5EB 2IBZX 1I9JH 4ZXBB 5HGBB 4KC3B 1AE6L 2F53D 5K9KB 25C8H 4QT5A 4LCCC 4G7YH 2BDNH 1ZHNA 2B0SL 4S2SB 4Y4KD 3OPZH 3GMMB 4R4BB 4LHUB 4QOKB 3IAQA 5C0FB 1Z9OA 3VRLF 2P49B 2X9XA 2P5WA 2NZIA 5CWSB 3L9RB 1LDPL 1MHCB 1VEOA 3VXQA 3C8DA 5IIEB 2MNUA 1BZ7B 5AWNL 4Y1AD 5DF0A 3REVB 3LDBC 4LF3A 3BWAB 3PQYE 3HUJA 4MQXC 1EH9A 1YMMB 2C3XA 4Z7WB 2WWMC 1KLGA 1TZIA 1JF5A 2OL3A 3L3OA 1WICA 2IPKB 5DJ8A 5HI5C 1Y6MR 5I1LB 2DQEL 1KB5H 3D0LA 1GCFA 5DA0B 3S34L 1IM9A 3DXAE 1MCFA 4MA8H 1MHHA 3X14A 1HSAB 3S88L 2AERT 5DFVD 5FDYA 5ITBL 1J7VR 4JY5L 2DQCH 4KRLB 4OD1H 4PY7A 3IJHB 1XR9A 5E2VL 4X5WB 1DL7H 1R24A 5M94B 2EDOA 2R2BB 4WW2F 3X3GH 3QIUA 4JAMB 4HUVA 4NZRL 1VHPA 1J0IA 3P9MA 4KRPC 4M93C 4WWKB 5I9QB 5L6YL 5T5NG 3FO2A 2FH8A 3SDXF 1IGML 5H94B 1X5JA 2LAGB 4WV1B 4NO0B 1M7DA 4I77L 1BF8A 3BYYA 1R3JA 4URTB 4TNVK 4ZUUB 5IKCA 1BM3H 1HYSC 3PWNB 4HPYH 2OL3L 4I3SL 4YIQB 2RR3A 3U7WL 4XC3L 2HLFD 4CBPA 2VMFA 4AMKH 5KVGH 4GAYB 2VABA 3M17A 1OM3H 4GRMA 3MUGB 3D69A 4AEHL 1A22B 4MJ2A 2HRPH 4PJFE 4L9LA 1F58H 5TH2A 5J12B 3C9NA 3BDYL 1U8MA 5F71A 3GSRB 1ODAA 3IB4A 4A6YB 1JGUH 3U4BL 1G0XA 4NP4L 4DVBB 4ODVL 4E41A 5AD0B 2BCKB 4M8VA 5MEOA 1EGJA 3IU4L 2YRLA 1G7HB 1HQRB 3EYQD 5E56A 1HYRC 2IH1B 1A7OL 4GRWH 1OP3K 4WUKL 2ZUVA 4NC2B 3KPSD 2OMBA 1DQDH 3MCLL 4L8SA 2XI9A 1K8IA 1N3NB 1QR4A 3OKDB 4MAYD 3LRSA 4JDVA 3WHXA 3P11L 3NCBB 1R5VA 1T03H 3G6JE 1OD9A 2A0LD 2ICWA 4HWNA 5FO7B 5CZVL 1S3KH 4YEEA 2ATKA 3S5LG 3HNVL 4P2OC 1AJ7L 4QYOB 3MCKB 3VG0H 2X1OA 4HIXH 4LSSL 5D1ZD 4DVRL 5C07B 3WE6A 1T80A 1IT9L 3TFKD 3DURB 3E2HB 3O0RH 4NKDA 3UBXG 3QFJD 3TBSA 4HJJL 5HHXL 1LO2H 3SBWC 4ONHA 5TFSL 4FQJH 4JJHA 5BZWB 3SDDB 3K4ZA 4GQPH 4I9WE 1RJYB 4F7EA 3TBYB 3TN0C 1NCBH 1OP3H 3KYNB 4LEXL 4Y5YA 4HJGA 1AD9B 1CLZL 2OJZL 2VTFA 3HC3H 4U0RC 1EGJL 4N0UE 4JO2L 4H88L 2PYEE 2AJSL 3TV3L 3LPFA 4R0LA 1SEQL 4ZODA 3MRIA 3WNOA 5IBUG 1F11B 2VXTL 1D9KB 2R4RL 1MAJA 2I07A 1QRNB 1TENA 1QSFA 2FBJH 4PRHE 5JXEA 3HS0A 2V17H 3MA9L 1AIFA 2IBGA 3MRNB 4X0KA 1U8PB 1B9ZA 4RWHA 4KKAD 1RI8A 2RQ8A 4PUBL 2R23B 4I0PB 1Q94A 3B5GA 4U1GC 5HHOB 3D2UD 3EZJB 2ZUQC 1CG9A 2BX5A 5EBWA 3DV4B 4JREB 1JTTA 4F37F 2MQCA 5F7NC 4HF5L 2A73B 1RZFH 2AV7A 2F8OA 5D9SA 5DEGB 2DJ4A 5JW4Q 1JZ8A 3WIIH 3RX5A 2YD5A 3I2CH 3IJSA 1AD0B 2APBA 5IG7A 5C1MB 4XC1L 4ETQA 1ZWIB 1DUYB 3QQ3B 3KPQA 4FFYL 4HJ0D 5KSVA 4YWGH 5GGVL 4GKOA 3TJHD 2P46B 2WQ8A 3H7BB 5ESAB 3BN9D 5E2JA 4N5UA 2CK0L 5BZDB 3OSKA 5D70H 1MHPH 5GRXG 2DJUA 4ODTL 3MV7D 4OD2B 3ZLQC 4TTDC 4LLUA 2I5YH 4XNMA 3C60C 4L4TE 2CR3A 1I8LC 5DVLA 3VWJB 3P0YH 3WKNA 3T2PA 3CVHA 4AH2A 4LIQE 1KNOA 3DI3B 3PQYD 1JYVA 1UJ3A 3WDHA 4Q2ZA 3ULVE 1N4XL 4RISH 2BY0A 3JV4A 3OJVC 3DUUA 1AQKH 5IK3B 5DS8B 5DVMA 2Z31B 4ZO9A 3NVQA 4S1RH 3GJEB 3RI5F 3DXAD 2BSSA 4PP1C 3RGVB 1NDMA 2GJ6B 2Q76A 4S1SL 1C5CH 1XH3A 4U0QB 1SJEB 4OM1L 4QGTA 5D71L 1RPQA 3LKPB 4M43L 4NO5A 4QXWA 4XMLH 3HZYB 3OAYK 5FA3B 2WBWB 1P7KA 4WCYL 4XVSH 5IB3A 3O6FA 5TDPB 4XNUL 1DBJL 1JMXA 1C1EL 1J1PH 3LHPH 4PJ8C 2GJJA 4C55A 3GBLA 5I8CA 2QTEA 3GFUA 2DLHA 3V4UL 2VZTA 4UBDD 1LDPH 5DJZA 1DBML 3PIQA 1NPUA 4P2QA 2ATPA 3B83A 1Z5LB 1HCVA 1OSZB 2XTJB 2C1OB 3CH1B 2IH3B 4RQQB 3SDAB 4X80L 4RRPG 3IAGC 2Q7NA 1MFDL 4EEEA 1QVOA 1MCCA 1OQOA 2ZNWA 4NNYA 1L6ZA 4X99A 3U1SH 4ZFFA 5DHVH 4BUHA 2VLJE 5GS1B 1JZ2A 5C0GB 1GGTA 2GJZB 3OAYH 4M7JL 5E6IC 5JIPA 1ADQA 4O02H 4HV8B 1A1NB 1RZGA 5DUMH 4OZIA 4KK5C 1IEAA 5GGUB 1N64L 3BDBA 4KROC 2OZ4H 3TJEL 3BKYL 1YNKH 5MEQA 4FS0A 4KVNH 3BZ4A 5CHNB 4HBCH 2GW5A 1DQMH 2I60L 1CGTA 3U0WL 3PWJB 1A1MB 4MQ7B 4ZOCA 4CRPA 5HI3D 2EYRB 4GH7B 3K46A 1KEML 3QCVL 5E4IA 4DTGH 4NOBA 5DWUH 2DWEB 4YQXH 4KHTL 1IKNA 2BVOA 4XBGA 2K7QA 2BMKA 3IFLL 3O81A 2ADGB 5BVPL 4GW1A 1EMTH 4K3EL 2BSTB 4PJGB 5BS0B 5ILTL 1OTTC 4OAWA 1NC2D 1XGQA 2AEQH 4U3XA 4X8JB 3ULUE 12E8H 3KLAA 1XAUA 4Y4HA 1CDUA 4GXVL 1JHLL 1VGKA 1WTLA 4RAVB 4KKBC 1U92B 2KUTA 3VXNB 1QKZL 2N1KA 1EFXD 3CLFL 3EOAB 4I3SH 5HPOA 4M7KH 5DGQA 1RULL 3C2SA 4XC3H 3ZDYE 2HKHH 1WT5A 3MOBL 3CFBA 3BYTA 4OZGE 5DC4B 1ZKAA 4B50A 5FGCB 1DEDA 4PJCB 3HC0B 1RD6A 2QR0B 2GTWA 1A5FL 4MZ2A 5EG6C 1J12A 4MSWB 4I9WD 1AY1H 5EU3A 1QFWM 1W72B 1MELA 3TYGH 1OB1B 4LVNB 2IQ9H 1NC4D 2F74A 2YOCA 3MRJA 3F6IA 4U4BA 4RMSA 3KDMB 4X83A 4Y5VA 1BHGA 5K9OB 5L9DH 1BD2D 2GIYA 2PYED 3KPRE 1I7TB 4ISVB 1IARB 4XPBL 2CUMA 2BSRB 1OT1A 2DB8A 2DAVA 5KTEL 4L8CA 3D39A 1GL4B 2CIIB 5D7JB 3MV9A 2HVJB 5JOFA 1P4IL 4PRHD 3P11H 4KMLB 3ZE2F 2VDNH 1T7YA 3TO4D 5T5NF 5CZVH 4DZ8B 5IJVA 3GK8L 3A6OA 1C16B 2OK0H 2XKSA 2YD9A 3BQUB 5TE4L 3MV01 5DDHA 2SEBA 4M3JA 3QUKB 2AEWA 1E6OL 1Q8MA 4WI2A 2DD8L 4OZ4A 2NY5L 4OF6A 4Q6IC 1S5HB 3ALWA 2J6EA 1A3LH 3PJSB 3CU7A 2XN9A 5DQ9B 4B53A 2ZPKL 1MREH 5LBSL 5CEYA 4ODSL 5CKGA 1IL1A 1QZ1A 3FQUA 4M6MH 1KN4H 1P5UA 3AY4C 3MA9H 4L3CB 3T4YA 3D85D 1YN7B 2J2ZA 3HMXA 2V5SA 1D5ZB 5F44A 4KTYA 3VGAC 3EZ8A 2ARJB 5DFVC 2XXMB 4L4TD 4FP8L 2GFBB 4P2RE 1FG9C 3VFNA 4LCWE 3W39B 1S9VB 2Y7QA 2Y5EA 2DLEA 3ZKMC 3ULVD 3STZA 3DVFA 3SQOL 3MJ9H 4XP4L 4X4YB 1F4XL 1YNLH 1FBIH 2MHAB 2JJSC 1BQUA 4LPVA 3U0TA 4ZO7A 4MD4A 4LKXB 3UCRA 3UTTA 2J6EL 4PJHE 3FT4B 3QUMH 4FQQB 5HDBE 4OBRA 4K2UH 2UZIH 2VXUH 1BVKA 2PXYB 2J8UB 4NZDA 3WN5A 2D7MA 4PJIF 1G7LA 4P4KB 4NOFA 3MRQB 2HLFC 1A9EB 1T5XB 1TQCB 2DM7A 3FFCA 3UZQA 5EOTA 3CFIC 1GVIA 3CLEH 1V7MH 3TCLB 5FA4A 5ADOL 3NFNB 4OGXL 5CIPB 4YFLI 4BM7A 4JPKH 4WUUA 3MA7A 2WNGA 4M1CC 4X98A 1NDGA 1JK8B 5FCUH 4Z77A 2IBBA 3IKKA 3FQWB 4UB0H 1V7NH 2FGWL 3MBXH 2JE8A 5KSBE 1Q9KB 2B39A 1TXKA 3SDCB 3ROLB 5F1IA 4RIRA 4X6CA 1X5ZA 2VLJD 5DR5H 5HXMA 4M7LT 4MAYC 2DI7A 2JB5L 4AENA 2XPGA 4MNQA 5D71H 1UACL 4L1HA 3HZKA 4WCYH 4KTDL 5D1ZC 4XNUH 4HWEL 4W81A 3EFFA 5IT2L 2FX7H 1WBYB 4MCYB 2EDJA 2EKSA 5DMGC 3TFKC 2HFEB 5AZEH 4LSPH 1KCVH 2AJZA 5FKAB 5ALBH 3RDTA 4WI8A 2BZDA 1OGTA 3LSOA 4J3UA 4U6YA 1JYNA 4QHKI 1CQYA 4IDJH 3WIHH 3ULUD 5JMOC 3P30L 4YXHL 4AIOA 5E8OA 1JF1B 5EU6E 4GW5B 5IB2B 2BRRL 1IC5H 1LE9B 2R0LH 5KSAB 5E0QA 1EEYB 4EI6B 1NCWH 1HDMA 2UWEA 3IDGB 2APFA 2PTTA 4E42B 1I75A 1G6RB 2BNRA 3VDBA 2Q20A 2G5BA 4UDTA 3VFMB 4AL8H 4EDWH 1D5IL 3TJEH 5IWLC 4N8CL 1P9MC 4APQC 1S7XA 5L7XL 1G1CA 3QEGH 1MIML 2X4OB 2ZG2A 4FQ1H 3PHOB 2YXFA 3MACH 1FIGL 1LQSR 2DQTH 2P45B 3KPRD 1RUPH 4NRXB 3DHMA 2CDGA 4JQIL 4EI5D 3B9KA 2CDEA 1ZGLB 3RZWA 4IBLT 1Q9LB 2BY2A 2R69L 2XWBA 4LLQA 4X6CF 1BBJB 1EZVY 3MZTA 1FO0A 4DOHE 4LCYA 5EA0H 1A7BA 3IDJB 4UT6L 5C0EB 4AQ1B 4HJ0C 4TULH 5EU7C 4GKSB 4GXVH 4LHUG 4BKLA 2X5PA 4PJBB 1YEKL 2BHUA 3BN9C 2CXGA 2F5BH 1E6JH 1P7QD 3ULSA 3FFDA 4KMTH 5KS9F 1CFTA 1LEKB 2AJ3A 4MJIE 5KVFH 3B6SB 5EWIH 3EJZC 2CXKA 1XGPA 5TJWK 5J6HA 3P73B 3MRDB 2GAZB 2BVTA 3GMPB 1FE8H 4OUUA 4JM2B 1G7QA 4YC2B 1EUTA 4PTUB 5JLZB 2P24A 5JR1L 3I3BA 1QLEL 3BGFC 5GS2H 1Y0LB 4J7RA 4C56A 5GRUL 3D87B 1WFOA 3QPXL 5ITFA 3MRKB 3MGOA 3NCYS 4J1UA 3ZHLA 3DBXA 3K81A 1RVFL 5JW5B 1P4IH 3EYVA 3NABL 4XT1C 3FB6A 5GGSA 3T2NL 4G8EB 4LKCA 4ELKB 4IOFD 3LD8C 4P2RD 3OZ9H 3QUXB 1IVLA 4GKNB 1JGEA 1T1YB 4MCZB 3KXFA 5LQBL 3S9DB 3TA3A 4XAKE 3VWKB 2CUIA 2V7NA 2NY1D 1MSPA 3Q2CA 4KJYB 1EEUA 1OAZL 4K3HA 5H35B 1VFAA 4XVJL 1TLKA 3FT2A 5DRWB 2WMPA 4XVUD 4DN4L 4F33B 3BPOB 4TSCL 4RNRA 3O9WD 4NHUA 1RZ7L 4L5FH 4FZ8H 4U1IB 4YHZL 1UZ8B 1IRAY 3DARA 3PWPE 4OT1H 4PGCB 3OJMB 4JFEA 5DC9B 4K94C 4DKEH 1KCRH 3R4DA 1SJHA 3FAWA 5L2JA 1FZKB 4OLEA 2A77H 3FB8A 4V1DE 1DQQB 4GUPA 4NQCA 2JIXA 4NWUH 4NCDA 2ZOKA 1Z3GL 4PGDA 1S9WB 4XCFL 2YPLB 3BHBA 2Y5TB 5C0DA 4RFOL 2HN7B 2X4NB 5CUSL 3REWA 3TO2B 1U8QB 4J12A 3QJHA 4NQEA 2E7MA 2F15A 3L6FA 4YDVB 2LVEA 4O58H 4P5MA 3MR9A 4XCNB 4M8QB 4MJ5A 3VFRA 2IPTH 1CD0A 1ZVYA 1YJDH 5DRXA 1NJ9A 4JFYA 1QACA 3QQ9C 5E03A 4LLDB 5FYJU 5F88B 2P42B 5C08A 1G7IA 3HE6A 4W4OA 1H5BB 3FKUS 4CVWA 1IAMA 4K3GA 2CGRL 3HR5B 1EAPB 5ESQB 5IVZB 3T1WA 2JELL 3ARDD 1I3VA 1ETZB 3S4SG 2Y6SD 5IMOA 5JHDA 4GMSL 5EORH 3GBNH 3FOMB 4F7CB 2AABH 1WZ1H 2QKIA 4YLQT 3U82B 3LIZL 1ZANL 1ZA6A 4LAQH 1QFWH 3GMNB 3WL9B 4GS7C 2OS7A 1U2CA 1UVQB 1UQSB 2VRAA 1B3JA 4M61B 4UILH 3V0WL 1RUQL 3CFDA 3MRLB 3QA3A 4MB3A 1HKLL 4D3CL 1JHKH 2FGWH 3NAAL 2Q6WA 3MTRA 5EZLB 5EU6D 4OB5H 4LCCB 5KBNC 1XF1A 2BFVL 3FQNB 1N5AB 3UXFA 3FFCE 3BVNA 1XGRB 3TBVB 1KLUA 35C8H 2JB5H 1Q0YH 1KJ2H 4D0CB 4MD0B 2X44D 1DCLA 1P7QB 1L7IL 4HS8L 5D7SL 3LDBB 4UV4H 4MWFA 4Q9QL 1AGFB 4Z7QE 1D5BB 1TVHB 4L1DA 3L3JA 2IANE 4R7DB 4DAGH 3W0WB 1RUAH 4L3EE 1CE6B 2BNUA 1AGCA 1KJ3L 2QSCL 3V9FA 5CS7A 3O2VL 4G9DB 4NQTA 1B0GA 1ORSA 2Z92B 4PJDE 4KZEL 4CMMA 4OLWH 2W9DL 3N0PB 2ZSWA 1MCWW 1H0DA 3U2SB 3HNTL 3MV8E 4HHAB 5FO8A 5T5FL 1W0WA 1E27A 3MLVH 3P30H 3CGTA 4FRWA 1FZOB 3VJ6B 4DEPC 4MNHB 5CEXA 1TCRA 5IM7B 4MYWB 1AH1A 1MI5E 4ZUSB 4YO0B 2CUHA 3CFEA 4MJID 4R90H 4WIQA 2GCYB 3HRZA 4GG6B 3DRQB 4LCWB 3ETBF 1NFIA 2B4CL 5EFIB 2O26U 4F2MB 5FECA 1PDKA 2GK2A 2D03H 1QFUH 3L95B 1F00I 2X9WA 4OZHA 3V6FB 5JQ6H 1MFBL 2VQ1A 1CK0L 4YDIH 4NNXA 1UXSA 1FNAA 4OQTL 4TSAL 3ARRA 4PV8B 3GB7B 4PJHB 2UWEE 3S37L 3MLTB 5HYJE 2HTLD 4YDKH 2APVA 2DLGA 4C4KT 2V7HB 2XZAL 3BZDA 2GT9A 4X6BB 1IGIH 1LEIA 1S8DB 5LCVH 5D6DA 4PB9H 4PG9A 4JFDE 5D2LE 5EIQA 4S1QH 5IB4B 1BVLB 1J10A 3SKMA 4XX1G 2ITCB 5FUCE 2VZ3A 3WXVH 1ND0A 1W2KT 3T3PE 1L7TL 1DLFH 2IQAB 5T3XH 3PUCA 5IFJB 1SJVA 1KTKE 5C09E 1U41A 4YAQA 5GS0D 4TVSa 1NGWB 1ZTXL 5HDQH 4MJ6A 2WZPD 4P2OB 5B4MC 3PWPD 2VDPL 4RMQA 1S9XB 3X11A 4YHYC 1RZJH 1X4ZA 5GRUH 5H8DA 3VFOA 4K7PY 2AQ2A 1CDHA 3SY0B 3HAEB 4AG4H 2A6JB 2XTLA 3T08A 4MMZC 1FNHA 4HIHA 4I0KA 4M1GL 3VXUA 3C6SB 2PNDA 2EH7L 4V1DD 4LDLB 2HT3C 4IIQC 5LWYL 3TN0B 3FOLB 4FXGB 1M6OB 4TUOB 4XWGH 5LQBH 5DK2B 4OJFL 3O41B 5JA9A 1KPRA 3RWCA 3WS3B 1YEEH 2GKIA 4FMFA 4LDOB 1IEHA 2G60L 3BPNB 3DECA 3OG6B 4CDHA 3CCHB 1DVFA 1F02I 4JHBA 1HZHL 3IFOB 1J05B 4HWBH 3F7VA 1XZ0B 3CUPA 4LLVA 3MRHB 1MCSA 3VFSB 3ULUC 1MCHA 2ZUQB 1M05B 3TZVA 2A38A 2N7BA 5T1LD 3KXFE 3QIUC 3NCCB 4OZFG 1WLHA 2CD0A 1FL5A 4EUPA 1B2WH 5IMKB 1WGOA 5JOPE 1RUKL 1PX3A 2AEPL 5E24E 2J4WH 1FL6A 5DHVA 4P46A 3GEWB 4XCFH 5F6HI 3T0DA 4U6TA 1BFVL 1HHJA 1M1SA 5H2BB 3QB7C 1U93B 2FIKA 3UTTD 2VZUA 3K4DA 2GSIB 3K2UL 5AZ2L 2OZ4A 3LS5H 2BJMH 4XP6H 1N0XH 1S5IL 1TJHH 1FYTA 3V6OE 4EI5C 2KQNA 2ZUSA 4ZS6D 1NFDF 1QEWB 4A6YL 5HY9A 3FFCD 1T0NB 3ZKXB 3RWJB 5JNYB 1IM3B 3THMH 2DOCA 3TVMB 4NNPH 1MY7A 5FM4A 1ED3B 5GZOC 4NN7C 5B38G 3D3VE 2WBJA 4UIKL 4PS4L 3SGEI 1Q9OA 3BIBX 4UT9L 3V52H 1PLGL 2H32A 3C87A 5J1SC 1EBAA 3VRIA 4GMSH 5TE6L 1KN2L 5B8CA 2NX5E 3OHXB 4UI2A 4L3ED 5E2TL 5DVKA 2G9HA 2DYPA 5JHLH 3O45A 8CGTA 3MYZA 1ZMYA 1HE7A 4L8SC 2CMRH 1JWSB 3RPIB 2DDQL 2FR4B 3RL1A 1NAMB 3A0OA 2P8PB 4QEGA 5B39G 1RUQH 1H8OA 3MV8D 3QHFH 1GIGL 4AEIL 5JORA 3EW3B 3NAAH 4NM4H 4PJ8B 2H6PB 5J11C 2DL2A 4PLKD 3VXRA 1TTUA 3RUGA 1R3LA 5HVFB 1T2QH 5SWZB 1MY5A 2FH6A 3MLYL 3RJDA 1MI5D 2ZUXA 4LPUA 4HUXA 3O3DB 2W0FB 3OR6B 1F6AB 5ECJE 3WSQH 3GSWB 2V2TA 1CDGA 1JJUA 1RUMH 3RAJH 2X4QA 3QZWA 1E0OB 3FZUD 3RWEA 4Y5YC 3GI8L 1BGXL 1TETL 2COQA 2AJVL 4Z5RA 2H2SD 1DANT 2NY1C 1O5DT 4PG2A 3QCTH 1YC8A 1KT2B 2YKLL 4JQXA 4P5TA 4H25A 3LKNB 1KJ3H 4R0LC 1QSEA 2YR3A 4Z7NE 4KQ4H 2ICWI 1XCTB 3QAZC 1DEEA 4XVUC 4L4VE 4HWZA 4GRWE 5JXEC 4KROB 1MCPH 3RWFA 5HYJD 3UJTH 4D9LL 3O4LA 3VD4A 3GBMH 3PV6B 2F19L 3BRGC 3NA9H 3QCUL 1NUDA 2HLAA 1QYGH 2CO7B 2RHEA 3QDGE 1A6WH 1A3QA 4XAWL 3OV6A 3UPRB 3FRPG 3E6HA 3I9GH 4JFDD 5I1HH 3DSFL 1FZMA 4QRRE 4BSVA 4UUJA 4XXDB 4PJEE 3SO3B 3C6LA 5IOPB 5GRJH 1N5YH 3SKNB 5EU4A 1U8HA 3MBED 4MXWL 4Y89A 2C26A 5C09D 3MRBA 2A6DB 4HPOH 4RWYH 5JXAL 4O2CB 5FYLL 3RNKB 4YK4C 1FLTX 3UC0H 1OAYL 3DX7B 4EXPX 3FO0H 3DV6A 3GMLB 2FX8L 1FJ1A 4M6NH 5FAAA 1NEUA 1A2YB 4OKVB 1T2JA 1J86A 2NW3A 3ARFA 3GNML 4OQTH 4X6FB 4QRPB 1A7NL 1CT8A 5MENB 3SKOB 2R2CA 3RUGF 3HCVA 3BH9A 4D8PB 5I1EL 2NW2A 4HLZG 3L7EA 5JMRA 5GRVL 5EUOB 3MJ9A 3CZFB 2I9TB 2EYSA 3HZMB 3PGCB 2R15A 1G9EA 3DYPA 1IZKA 4ODXB 3QUYA 1HEZA 3ARDC 2Y6SC 1UJ3C 4DCQA 1JPTH 3DETD 3QUMA 4MDJA 4X5XA 2DQIH 1UYWL 5IROA 1GC1C 1RMFL 4CJ1A 3GUTA 5CP7B 1RY7B 1JFQL 1T04B 2VISA 4NCC1 3O6ML 3S36L 2F54E 1IC1A 5IFAL 2DLFL 1CLOL 2O61A 4K8RC 5FOJA 3V4VL 1XF3B 4JFQB 2VDQH 3IDNA 5FKPB 5C0RL 2QQNH 3HNSL 5JO5B 4JFPB 4Z0XB 1W0YT 5I8OH 2B1AL 1MJUL 5EOQL 2J1KA 3BE1H 1INDL 4KUCF 3BUTA 4U1NA 4HS6A 4G42B 3O6FC 4YHPA 3SQBA 3KXFD 3L5WB 5I19H 3K3QA 4HFWB 2X4RA 4RGOL 1I7RA 5D8JH 1MVUB 5D7LE 4HZLB 2VYRE 3FL7A 2BY1A 4KJQD 1FGNL 2R4SL 5IQ9A 3SKJL 4U1LB 1XCQB 1AKJD 3WFCL 4Q6IB 5CILL 3U30B 1KBGL 5I16B 1F5WA 4F9LA 1DUZB 2IANB 4JN2A 4PJ9A 3WFBH 3F7YA 1DQLL 2Q86B 3O4OB 1LO4L 4R8WH 1YMHA 5ERWA 2MCPL 5AYUH 1U2HA 4FXKA 1IAOA 4J4PD 1A9BA 1D6VL 3VGAB 4NZTH 4QHNA 3U6RA 4F57L 4WY7L 3G5YA 4NQCD 4N0YL 3BFOA 3IU3A 2JIXD 2R1WA 1QRKA 2C3GA 3VRLE 5IV2B 3RWGB 3QO0B 3KPNA 3D3VD 5HHNB 5IFHL 5I76A 1FSKB 3ELAT 3OAZK 2WUCL 2A1WH 4ZFGL 2VDML 4LSQH 1ZHLA 1DDHB 2P7TB 3WIHA 2XQBL 1PZUB 2YWYA 1IGJA 5A3ID 3TH4T 1CXEA 2A2QT 1IKNC 3VXTA 1CTOA 4HQQL 5I0DA 1HILA 3PL6D 5K33A 5CBEB 4LBEB 5EO9A 1KPUA 5DMIH 4JG1L 1JNJA 4QNPF 4PJ5E 4DFIA 2XWTB 2ZZUT 5ALCH 2MTPA 1BBDH 4PY8I 4XB7A 3ZO0A 1I1AB 1SBSH 5KOMC 4UQ2B 4BQ9A 1YQVH 4NQSB 4IMLB 5EN2B 1E28A 3TBWA 1BJ1H 1VACA 1U6AL 3MMEA 3U0PB 3MZGB 1FNEA 4JY4B 2VB5A 5SWQA 5BW7A 1WT5C 4W6WB 4A6YH 2B20A 2HJKA 4PJGF 3OAZH 1XIWA 4PJXF 2UYLA 4P59H 4P49A 4YPGA 4PLJD 5FYKH 5HDOA 3UTZA 3GSUB 3PWVA 4PBXA 3PHQA 3V6ZB 1ZT4B 4TPRH 3FO9A 4XHQA 2GUOB 4DGIH 5E8DL 4Y5VC 1AP2B 3KAAA 4HIEB 4NKOB 1JNHA 1GGYA 2FL5B 3C5JB 2XA8L 5DI8A 4PJCF 5I8EB 4HKBB 3OKLA 1U95A 2H2PD 4J3TA 3BSZH 3HR6A 4L4VD 4FQHA 5KANI 1YECL 3IDYC 5DMKA 2D0GA 4EZMA 1HXYB 2GITB 1YUHA 1VFBA 4PTTA 3RVVC 2ZUYA 4W6YB 1NMAL 5DGRA 1AQDA 3QDGD 1UM4L 1KIUA 2WWKO 4QRRD 3S35L 5LGJA 2V2XB 2YC1B 3SOBH 1RZKL 4HKXB 5AAMA 1KOAA 4G6JL 3MPCA 2FSEA 3GHBH 5LVEA 4BZ1L 4C57C 2Z91A 5FCSH 2CLRB 5SV3A 3L5JA 1SMOA 4DQOH 2CK2A 2EC9T 3OWEA 1CU4H 2XT1B 5T3ZL 4PFEA 4F8QA 3D25A 3MC0A 3WCYA 1QPXA 1PYWA 5IBTL 1MEXL 3DX9A 5B3JF 2VLRA 1XFPA 3QHTC 5EIIB 4P9HH 3UTPE 1WWBX 2NMSA 3BP4B 4ODUB 3B2VL 3BPLB 3DMMA 5I30H 4QY8A 2X4SA 4J3SA 2R8SH 1MCOH 1ZLWK 1RSFA 4PRDA 4K3DH 1T89A 4NC1E 1QBMH 4UV7H 1ROWA 2PYFB 5C0CB 5F6IC 5F21B 4APQB 3RVXD 1CE1L 1JV5A 1UWXK 1YDPB 3VDAA 4WTXA 2F19H 1BOGB 3QCUH 1MUJB 1I1FA 5L2KE 5C9JA 1ZGLM 3DSFH 2XKNA 1F6LL 3CX5J 3DO3A 1UKQA 3QRGL 4G43A 4Y19B 5ICZA 5BXFB 2F54D 4CNIB 1T1XA 5F9AC 4TTGA 2IALB 1A3RL 3HMWL 4F8TA 1QLRB 2DM4A 4D2NA 5E5MB 5F72S 2G75B 4OIIL 1OAYH 4UT7H 3NZ8A 5ICYA 3O4LE 1KENL 4ZQKA 1ZLWH 2C1PA 3IXTB 3L3GA 1ZS8B 2YBRA 1NL0H 2EDDA 4HUWB 3TLRA 1TPXC 2OQJA 1K6QL 1G9NL 2ZG3A 1HQ4B 1FNSL 5DJXB 1UWXH 1EVUA 2CLVA 4UNUA 4YGAB 3WN5C 1FDLL 4QRTA 5D7LD 4ZS6C 3PGDB 3MRGA 4ZSOB 4ZUVB 5DD3L 3NFPA 3X12B 4F7MB 1QA9B 1FPTL 1OVZA 3STLA 4KI5C 4PP2B 2R1YB 1G7PA 4RBPK 1T1WA 4EOWL 1H9VA 4JPIA 3BMWA 2R56H 4FTVE 4KZDL 2VLLA 3B2UD 1RIUL 2NX5B 5IVOA 1FAIL 3UJJL 3SPVB 2B5IC 2WINA 1PJ9A 1P1ZB 5TQ0H 4Z8FH 4X5LA 1DQTA 1RMFH 4U3HA 1IAKA 4XWOD 5JQHC 4IMKA 3O8XA 3TH2T 4Y8AA 43CAA 1WWWX 4LSDA 3VXUD 4JHZA 1G7MA 1HWGB 1N8ZA 4JRYE 5EU5A 3VU2A 3G04A 3EO1A 2X4PB 1EBPA 1LMKA 2J8HA 2FZ3B 4TUKL 1W0VA 1EO8L 4JO1L 1C12B 3EYFA 4RBPH 3B4NA 3OJDB 2M2DA 1B0RA 1MJJA 2OR9L 1EHLL 5BV7C 1QFPA 5K9QG 3FQXB 1MF2L 2DQFB 3RDTC 4Z7VA 5DZNA 3AU1A 5CILH 3MCG1 5KG9A 4HT1H 2A9NL 2XRAL 4JB9H 3FZUC 5I74C 3HPLB 4YE4H 4WHTA 1KJ2A 1T0MA 2H2SC 3CVIH 1X4XA 2ED8A 3IYLW 4KPHH 1D5MB 5CBAA 1AO7B 1WBXB 2MCPH 1GYAA 1G6RL 2UZXB 1CR9L 4ZFOB 1U8OB 2H3NA 1FV1B 5EOCH 2FJHB 1P2CB 1IE5A 5FDWB 2Y07H 3VH8B 4R96A 2VQTA 4Z78B 5DK3A 4BSWB 1P5VA 1EX0A 4P46D 3MGTB 2LV4A 4AIXA 1F3DH 4LOUC 3GSNB 1EA9C 1DE4A 4GSDH 1SY6L 1F6FB 1TDQA 5FUCC 3QWRA 3JWDH 3M45A 4M5YL 5F3BB 2DBLL 5AUMB 1VKXA 3RWDA 3B9KC 2ICCA 1BFTA 5I1CL 1NANI 4OCWL 2IEPA 4TVPH 5BJTA 1EXUB 4IRSD 5J1AB 4OGYL 1HHHB 4S11A 4PJAE 3WS6A 4IOIA 4XPGL 2JB6B 4F9PA 1MH5B 4C54A 3RQ3A 2XQYK 4LSUL 4MXVE 4ZAKB 4HG4K 3IXAB 1BJ8A 1N6UA 1ONQA 1MWAB 2WBKA 4ZDHB 3FT3A 1W72H 1TTFA 4N0CC 4OF8A 1RZIA 5IF0B 2DYPD 2P48B 2R0WH 5D72H 1EEQA 5ADPL 1IC7H 4MVBD 1B88A 3AXLA 4MA7L 4CL7A 1MJ7L 3VI4F 2DLIA 2VN4A 4U1MB 1IAII 1S7QB 15C8H 2BXZA 5HTSA 1VGEL 1YEIL 3IGAB 5HVGB 1CL7H 3QIBA 3U9UB 3LN5A 1LP9B 3BKJL 2GSGB 4XP5L 4E9LA 2QQKL 4PRAB 3MJGX 3KPMB 3DETC 1MFNA 3RX7A 4JRWA 4WDIB 1IGCH 3TWCH 3UTPD 2DI8A 4ZYKA 2EDFA 3CFJA 3ARWA 4YXLL 5F9DC 3AS0A 1A7PL 2N56A 5EC1A 3DRTA 2FB4L 3MRRB 2NY7H 3MLZL 1C5DB 1RJZA 1R3KB 3C8HA 1AGBA 4M03A 5C8JB 3QO1B 5IMLA 4Q9RH 3VFVA 1UM4H 5L2KD 1BJ1J 1X5YA 4G6ML 1MRDH 2W9EH 5I73C 1N2RA 2VLKB 3TA3C 3GRWL 4UIMA 3OKOA 1GHFH 4FZEL 4K23L 5GS3A 5HHME 3BIKA 4Z7UB 3TBTB 5HD8D 1OL0A 3LRGA 1P4LB 1QR1B 2AI0H 3OX8A 4ODHL 4JKPH 2ZKHL 1YEHL 4ZMAT 4PGBA 3JTSA 3ZE2E 1CZ8L 4YBQD 1FL3B 3O4LD 2JCCF 4X8XA 3KLHD 5E4EB 3QEQE 1WBZB 4EBQL 2A6IA 5KSUB 4DEPB 1AHWC 3GIVA 2X9YA 3P4MB 4OBSA 3RWHA 4AIZA 2FJFB 2G5RA 4LEOB 1CGUA 1MCKA 3AC0A 5J9PA 5FUZL 3L3HA 4Z0BH 2E3VA 2YUZA 4HKZB 3T0EA 4U05A 2NY3D 5HYQA 1A6AB 2FECI 2PUQT 4Y16B 4JPVL 3GSQA 5CJ5A 4KWUA 1I1YB 5DJCB 3FO1A 3D18A 4HWBA 1OAUH 3O3UN 3NACH 4NJAL 5C0JB 5J6GA 1VEMA 3ARFD 3I75B 4G9FA 4HUKB 5C6WH 2ZSVA 1EVTC 5A3IC 1J1OL 3IETB 3LPGA 4PJ5B 3HMWH 3M1BA 4HX1B 4V2BA 1F8TL 2AGJH 3SJVE 3VFGL 2BVQA 1FRGL 3EOTL 4M48L 4WI9A 4CMHC 5C0NC 1HH6A 3FB7B 4FQCH 4NQXA 1LO3L 4WW2B 3MNVA 1UM5H 3T2QA 4IHOB 4GFTB 4O9HH 1U3HD 1H8NA 3P0VH 4UDUA 3GIZH 3WFDH 5EPMA 5I1AB 1CLYH 2BVPA 3K8KA 1A6PA 1OCWL 2KBGA 4HCRH 5CIPH 2C5DC 2O5ZH 2AK1H 4JN1L 3SDXB 1CD8A 4JFFA 1U8IB 1J1XL 2NXZD 1ZT1B 2HH0H 3T65A 3DO7B 4ZTOL 3H9HA 5GQBA 3H6JA 3T8XA 4BH7B 1U91A 3IDIA 4YHYB 3IDXL 1PY9A 5ESVB 5E8NA 3TT3H 3QEUA 4QF1A 1A6VL 2RCSH 1OTUD 4POYA 4IRSB 2VN7A 1PG7X 2YPVH 4PJIE 4U1SA 3QH3A 1P84K 2H2PC 2CKBL 2P5WB 3KS0H 2ZCKL 3VXQB 3RTQB 4ZFZA 4WFEE 3NFSH 3ILQD 3EIFA 4QRUA 2X1PA 3QUZD 2X89A 2R9HD 4JKMA 3LS4L 4PJ9D 4LF3B 4KK6D 5E00A 1B6DA 4JO1H 4JZOB 1KLGB 1JRHH 2OL3B 3L3OB 1FHGA 1UCBH 4JVWA 2LVCA 4KUZL 4XI5C 5ISZE 3DIFB 2YEZB 3IT8D 3VFTB 3FAXA 3ILPA 3QIWA 5KN5B 2AJUL 5DZLA 3D0LB 1IM9B 1A4JA 1OGAE 4XTRD 3QR2A 5EBLA 1MHHB 4GRLA 4X7SL 3LKRA 3X14B 2AS5M 1WEJH 5J8OA 3RIFK 1PFCA 1P69B 3LH2L 4L8DA 4YBLC 3RGHA 1NBVH 1IFHH 1M7XA 3JV5A 1XR9B 4WO4A 1R24B 2HFTA 1GGBL 4DGVH 3QIUB 4HUVB 2OJEA 3IFNH 2NYYC 3FQTA 3P9MB 1R3HA 5C0BA 2M26A 2QLVB 1T5WA 4UOW1 1UEMA 3HG1A 4NRYB 3RVXC 1HSBA 1KYOJ 1IGYA 3NZHL 4X6DA 1R3JB 3P40A 5CJOL 5CJQH 1N6VA 5A40E 2BNQA 3A6CH 5IBLD 1UWGL 4OCSH 4MD5A 5D5MA 4XNQA 4JZJA 3C5SA 1JPFA 4HFUL 5GGTL 1PSKL 4BQ6A 3WDJA 3TIDA 3WLBB 2VABB 4GG6F 2YD7A 3E3QE 3RKDC 4GRMB 3D69B 3GHEH 3QPQD 5GGQL 3G08A 4I48A 4Q58C 4L9LB 5TH2B 3C9NB 2R2HA 3D48R 2X41A 1EEZB 4NN7B 1DP0A 4E41B 5CJBA 3RA7L 1JI1A 4OV6F 1R0AL 3VW3L 5MEOB 1FG2A 4FN0A 1CDCA 3BD5A 5I66A 4M1DH 2HG5A 5D6DC 5EOCJ 5MHSE 5A43C 2A83B 3RX8A 2EE2A 5KW9L 3CMOL 1YEFH 5HJ3B 5HHMD 5GZND 4FTVB 2GY7B 5FV2A 3ULVH 1CXIA 3LRSB 4JDVB 3WHXB 4NDMA 4MDIB 1R5VB 2E9WA 1F3DJ 4HEPG 1NEZA 2ICWB 4GBXA 1CIUA 1JPGB 2OM5A 4GAFB 4PJ7A 1HNGA 1QTYT 2F5AH 4P3CL 4YDJA 32C2B 1CD1A 3DVGB 5FYJL 3OXRA 4PRIA 1KFAH 2YA0A 4MJ4A 4JRYB 4NKDB 3TBSB 1NAKH 4ONHB 3FRUA 5IVXA 3CPLB 2DI9A 5KS9E 2B7DT 2WP3O 4P3DA 1ZHBB 5J13C 1U3HB 4NC0B 3QDMA 3ZSSA 4Y5YB 3FB5A 4HJGB 1NLDL 5IMMA 3MLUH 5GISL 2ZCLH 4HULB 1OY3B 4PBWD 5J57B 1VADA 5CSBA 3DX8A 4Z7OF 1AXIB 4R0LB 5HHVL 3DVIA 5DRNA 2J88L 3MRIB 3VXSA 3S6CA 4XMPH 2PR4L 3NCEB 3X3FL 1QSFB 5C0FA 2O5YH 1AIFB 1DVFC 3SJVD 5SWSE 4LVHC 3DX6B 1BZ7A 5T3XE 2D4DA 1Q94B 1JNLL 1JTPA 1CG9B 1YMMA 4WWID 4Z7WA 5EBWB 3TZVC 1ZLSH 4HIIA 1E4WL 5A1AA 5KVEH 2IPKA 1X44A 4H0GA 3ARYA 3ARPA 3L5XH 1UWEH 2OSLB 1NUNB 2AV7B 5D9SB 4XPTL 4H8WH 3IJSB 4HH9B 4O51A 5IG7B 2OLDA 3KR3L 4P46C 4ETQB 3IJHA 4PD4J 2OTUA 5L8KB 3VGBA 3SGKA 5KSVB 4LP4A 3O6KL 5ID0B 3PDOA 1HIMH 4G8FA 2BOBA 2F9BT 3S3SA 3QFDA 3N9GL 4AT6A 2VDLL 3RKPA 3WXWH 2B1HH 2BK8A 4L3AA 2MWCA 3TNNA 2B2XH 1PEZA 1JHTA 3VFGH 2KL6A 4LLUB 3CDYA 4XNMB 3INUH 3Q6FA 1CICB 2NY6D 4G8GE 4OD3H 1MCJA 3GI9H 4WFED 4P3WA 1R5IA 2VC2L 4YZFE 3CVHB 4Q6YA 4AH2B 3V8CA 1KNOB 1M71A 2WBJC 1UJ3B 4Q2ZB 1UH2A 4XPAL 4ETYA 5ISZD 1UFUA 3U7YH 2LAAA 4QHMA 5B8CC 5BMFL 1JPSH 1F90H 1OQXA 4UAOC 3O8XD 3MUGA 1DZBA 3V7MA 4MVBC 3OKMB 5HVHC 2BSSB 1NDMB 2Q76B 1WK0A 4XH2A 3LN4A 1G1YA 4GOSA 1T1ZA 2KH2B 1FP5A 4UTBL 4ELMF 4GMTH 5CZXD 5AD0A 5D1QA 1WAAA 3JWOH 1ZOXA 1IC4L 3DTXB 5D96C 4RFNC 4CN6A 2UUDK 3O6FB 2IH1A 1FNLA 3NPSB 2A6KA 2MPAL 5I8CB 1S7TA 2AJXL 5F7KC 2QADD 1EZVX 1I9EA 1PGRB 4EVNA 5E9DE 4WTZA 4X4MA 3BIAX 3T04D 3ZDXF 2R0KH 1Z9MA 2R29H 2XWJA 4IEFB 5HBBA 2XY2A 5DZOA 5D7IA 1JGLH 3PIQB 4JGJA 5CSGA 4P2QB 5FO7A 4BUGA 1NKOA 1U3JA 5F1SA 1J88A 1GOFA 4MS8D 2NY4B 1QVOB 2YK1L 4PG2C 3W81A 1HWHB 3H0TA 3BDXA 4NNYB 3OKKA 4JQXC 4X99B 4P5TC 1INEL 3F6LA 5JIKA 2E8YA 4GAJL 4NKIH 5E2WL 4XBEH 1PG7H 2UUDH 1NCAH 4JJ5A 1RZGB 3QEQB 4Y4FD 4OZIB 1IEAB 5IESH 3TBYA 3LH2H 4P5KA 5C70A 3MLSH 2XZQL 3LEYH 1AD9A 3EYSH 5MEQB 3KLHC 3BZ4B 4J2XA 5DTFA 2W9LA 2XFXB 1I4FA 5DSCB 3HI5H 3RZCB 4CVXA 1X6LA 3S97C 5MHSD 3QWRD 1F11A 2HT2D 1MRCL 3C6LC 4A2LA 1D9KA 2YN5A 5FXCH 4Y5XA 3KS0J 1QRNA 4NBXB 2BMKB 3KPPA 3U9PL 2W38A 1S7RA 4GW1B 1U8PA 3L1OH 4KU1A 4HXAH 4LQ1A 1XGQB 3U48A 3GKWL 2R23A 2AK4E 4Y4KA 2HTKD 1UA6H 1A6UH 1NMCC 3KLAB 1QG3A 4Y4HB 1JVKA 1QHPA 1UWGH 1WFTA 5EC2B 4LCIH 3RWIB 1RK0A 1LD9A 4D9RE 3ARFC 2X05A 3MXWH 5DXWA 3WO3B 4NJ9L 4Y1AA 4BSJA 3KJ4B 1ZLVK 5EDXA 4WU7A 2GTWB 3K1KC 4LPYA 3G6DL 5LGHL 3LKOA 3G6AA 5INDA 4POZC 5BO1L 5EU3B 1P84J 5IVNA 3QT2A 1DBAH 1DUYA 4MQSB 1YPZA 3A6BL 5D7IF 4R3SA 4EN3D 3GJFK 2W0KA 4X6DE 4Y5VB 4YHOL 1CBVH 4TRPL 1NLBH 3QUYC 3A67L 4KTEL 4I4WA 4F3FB 5IROC 4L8CB 3D39B 2NXZC 1H3TA 3MV9B 5JOFB 4OD2A 1MAMH 5EUOF 5DC0A 3O3EB 1AGEA 4NFCA 5SWSD 4IJ3C 5T3XD 4TNWF 5IJKA 3BKML 3HAEH 5IJVB 1U8KA 4B5EA 4RCAA 1ZLVH 2JKXA 2ORBH 1RU9L 4XCCH 1NSNH 5I6XC 3VH8G 2Q8BL 1KELH 4BZYA 2H1PH 4F15C 3MLXL 2SEBB 2QSVA 5EUKB 5IK3A 1X6NA 4XBPB 3GJFH 4I5BB 5GRZA 2AV1B 1S78D 1CS6A 5JDSA 2NXYB 2VE6A 5C0AB 4NKQB 3OR7A 1J8HE 1DSFH 2PO6D 3ILQC 4YHML 5DLMH 3LKPA 1KCSL 5FM5M 4F9LC 4PJ9C 1RIVH 4KK6C 4MB5A 5FA3A 5GJTL 4H20H 5TDPA 1TVDA 2XN9B 3BP5A 1OGAB 4P9ML 4JM4H 5CEYB 1F4YH 4KY1L 5DMJB 1P53A 1H3PH 3LEXA 3LPWA 1UH4A 4IDLA 4ALAL 3P4LA 1B0WA 3NCJL 3T4YB 4OCMC 1MCRA 4NZJA 2Z35B 4G8GD 4X7CC 1FORL 1A0QL 3K74B 2IFFL 3BT2H 3VFNB 1TJGH 4NQUA 3SDAA 1JZ3A 1BOYA 4JPWH 2Y7QB 2P5EE 1UM6L 4MNGA 1KG0A 2GJZA 5I15H 3ZYOA 4G9FD 5EZIH 4AY0A 3U0TB 5IEKA 5D1ZA 4QOKE 5GGUA 2NY0D 4MD4B 2EEDA 2HWZH 4JCLA 1G0YR 1AC0A 4YFLF 3QFJA 4ODBD 4ONGH 2QSTA 2HT4C 3CC5A 2PW1A 1L9MA 1BVKB 3AB0B 3N9GH 3DYOA 4MQ7A 1DTUA 5MERA 3ARBD 3O2WH 3U79A 2DWEA 2JJTA 3F65A 1RZKC 4HXBH 4P23D 5EOTB 5C0IA 3V8OA 5CCKL 5DD5L 5BW7C 3K2MC 2ADGA 3QPQC 5FA4B 4M9OA 5BS0A 1XIWC 4LVOC 3VA2C 4WUUB 3MA7B 4H26A 3SGJA 5L88L 1EPFA 4X8JA 4J6RH 1EERB 1NDGB 4EDXB 3MOQA 2B5IB 1S7SA 2WUBH 4Z77B 2YZ1A 3RNQA 3SE9L 1A14L 1MFEH 2IAMD 5E6ZA 3EOAA 1IKFH 3EO9H 2FDBP 3HFMH 3OAUH 2Z8WC 4G6AC 3AROA 5F1IB 4R4ND 4OCYL 5IEHA 1NAMH 5GZNC 2VH5H 1P9MA 4X6CB 4DKFL 3UO1L 2QR0A 1E4XH 4ZG1A 5B3NA 1EO5A 1MRFL 3VI3F 4AENB 2XPGB 4MNQB 2BVEA 1W72A 2YD2A 2ZCHH 3HZKB 4GQ9L 3ARGD 3KJ6L 5DT1L 3BAEH 2VXQL 3KDMA 2X89D 3TNMB 3ZHDA 4ISVA 5F9OL 3JUYA 3T09A 2EKSB 5D2NB 2VDOH 3QNYA 3TIEB 2AJZB 4ERSL 4OCNC 3EYOA 3RDTB 2N7AA 4ZPTA 1OGTB 5I2IA 1GRWA 4PRPE 1N59A 2ITDB 2V5RA 3LSOB 3BKCL 4OLYH 2DKSA 2OP4L 4WI7A 4U6YB 5DUBB 4DZ8A 2AK4D 5D93C 3OKYA 5EH1A 1C16A 1BVZA 3CXDL 3VD3A 4YX2H 1MHEA 4WO4D 5DURB 2IG2L 4KJPC 1RIHH 4PRNB 2XXCB 4XGZA 2ZP0T 5KZCD 1KJVA 2WM0A 3DMMC 1HDMB 4JO4H 4G80A 2PTTB 3D6GA 2BNRB 1DBBH 3OQ3B 1X5HA 1K2DA 3PQYA 2G5BB 1WFNA 5EO0A 2PKDA 4K3JH 4ZPVB 2AJYH 1OAXH 1NGQH 5IHZB 1AXTH 4HBQA 1S7XB 3QULA 2ILLA 4K7PX 1OAQL 4HD9A 5D1XD 4N5ED 1EIBA 5DQ9A 5I1KH 1MLBA 3V5HB 1ZVSA 3EKCA 5C07E 3DXAA 4TSBL 4OSUH 2CDGB 3SCMD 3B9KB 1IJ9A 2CDEB 3EDEA 5J0BA 1YN7A 3K7UA 1D5ZA 4JDTH 3RY6C 3G5ZB 2OI9C 2ARJA 1O7SA 4JY6B 4OF0A 1F2XK 1NGYA 2KZ1B 4OFIA 3Q0HA 2ZUTA 3WYRA 2YMXH 3ZL4L 3W39A 3O3AA 4U6VL 4BKLB 3QG7L 1QBLL 4XPFH 1GGUA 3U4EA 4K7FB 1I3GL 4QXGH 3NOIA 1SEBA 2C7UA 3ULSB 2MSPA 3FFDB 3WD5L 1CFTB 2AJ3B 4LSRH 4JRXE 5E8EA 1XGPB 3ALPA 4EKXA 2EE9A 2NY6C 4MAUH 3ET9F 5J6HB 1JWUA 1J8HD 5AAWA 1G7QB 3I85A 1YJDC 2P24B 1C08A 2DQGH 1A1OA 3NIDF 2Y36L 2PXYA 2J8UA 5HHOE 4P48A 4C56B 4PJFA 2FATH 5C3LD 3MRQA 3KYKL 4J1UB 1A9EA 3DBXB 5TF1L 2X1QA 4IMKC 3O8XC 4YDLC 4AQOA 1G9MH 1OPGL 2ZOLA 3H42H 4MLIA 3EYVB 5I17A 3FB6B 4HCRA 3NFNA 5CIPA 5GGSB 4RGNC 4X4XB 3HC4H 1WJ3A 4KHXL 4P23B 4I13B 4XP1L 5I73B 4HW6A 2Q8BH 5E9DB 7FABL 1OARL 2V7NB 4WJ5A 1E4KA 2P5ED 3OKNA 4G6KH 4ZXBD 3JV6A 3ROLA 1BAFL 3G6JA 3MRCB 2QADC 2HYMA 2OX5A 1VFAB 4JO3L 4MGXA 2I25N 5AEAA 2E27L 4FQLL 2QEJA 2HFFA 2Q7YB 4LHUD 4QOKD 1SMAA 2EECA 1EFXA 4RNRB 5I1IL 4K94L 1CVRA 4D94A 3MX0A 1BWMA 5F1NB 5IHUL 1OW0A 1F42A 4FQXB 4ZFOL 4JFEB 1ES0A 1N6QH 1SJHB 1YMMD 4JLRB 3QQ4A 1RJLA 4N90E 5TQ2L 5C2BL 3FB8B 3TT1H 4G8IA 2Q8AH 4IRJB 4N0UA 3NIGE 1Z2KA 2ZOKB 2PYEA 4QO1A 2IJ0C 1QFWI 2GJ6E 4R26L 4U6XA 4KKCC 4J3OC 4PGDB 3BHBB 2DLTA 3G5XA 4HGWB 1C7TA 3REWB 3TC9A 4OLXH 4PRHA 1JF1A 3W9DA 4NQEB 5KJRL 5GHWL 4OGAC 4P5MB 1OF2A 4XNYH 3MR9B 2EIZA 3TO4A 1BEYL 1T22B 4MJ5B 1EEYA 4PJFF 3VFRB 4OM0H 4EI6A 2R0ZH 3GMRA 1KC5L 4WWKD 1NJ9B 4JFYB 5TPWH 4FABL 4CU6A 3W82A 1RURL 4PLNC 2R1XB 4XX1E 3LVEA 3MNZA 1G7IB 5F7EH 3WUWA 4NO0D 2HTKC 3HE6B 3LV3B 2XTJE 1QFOA 3WS6C 3LMJH 5J7CC 1L0XA 2AW2A 4F9PC 3IDMA 5T1DH 4RMVA 3F58H 4NRXA 2YN3A 5IMOB 5JHDB 1T7VA 3H9ZA 2EDEA 5CCKH 2QKIB 5A2FA 1KCUL 1Q9LA 3EUUA 4XNZB 2HMIC 5IB1A 1BBJA 1JWMA 4DGYL 5HPMB 4PRPD 1INQB 2EYTA 3SE8L 4OFDA 3V4PL 4KXZH 4NM8L 4X9IA 1NMBH 3IDJA 4XPHH 1OLLA 3FONA 3PWLA 3PHSA 1YEGH 4GKSA 5IGXL 3QIBC 3CFDB 1U3YA 3QA3B 3WV0A 4QNPE 4YHLL 4PJBA 3D85A 5FYKD 3U7AA 1MIEH 3IDUA 4L4TA 4K71B 3I50H 1LEKA 2D9CA 4O00A 3B6SA 2DQDL 3BVNB 2D7TH 1KLUB 3NBNA 2C3WA 3HRPA 1Q0XL 2GTZA 3GMPA 4JM2A 4PJGE 4XXCA 4PJXE 1VSCA 5C6TL 2VWEE 2A9ML 1LP9F 4MWFB 5F8QC 3LQAH 4FQIL 3V2AR 5IB5A 1NCDH 3ARXA 4OCRL 1ZE3C 2DQUL 1I9RH 4OUOA 3LQZA 1W8NA 5FHBL 5L0QC 5C07D 1MFAL 3L3JB 5D6CB 3MRKA 4G3YH 4CAGA 4UOW0 4GW4A 3MLWL 3H3PH 1AGCB 4HDIB 2VDKH 1RZJC 5FGCE 2HRLA 4PJCE 1KUMA 4G8EA 1B0GB 4P4RA 2L4OA 3SDDD 4CMMB 4KAQL 2CKNA 1PG7W 1A7RL 3OB8A 4Q97A 4I3RL 4MCZA 5FO8B 1W0WB 1DN0B 1E27B 1UB6B 4F7PB 4OFYD 4NYLA 3C2AL 2X40A 1TCRB 4Z7UF 1XGYH 4LARL 4QKXB 1FVDA 3HI6H 3CFEB 5DRWA 4JHWH 1KTLA 3F7PC 1D9KD 3HRZB 4LIQL 1J5OL 1QRND 4F33A 1A6ZB 2D9QB 4FA8A 4FNLH 4NUJB 5FECB 3T0EC 3BRFA 5JZ7D 1OAQH 2VLJA 4I0PD 4OZHB 3M8OL 1KIRA 5F7MC 3MNWB 2VQ1B 5HHOD 2MCG1 5DJ6A 3UX9B 4IIQA 1Q1JH 1FZKA 5I8KH 4W70A 5EULV 4I18A 5B3JE 3DPBA 3ZSTA 4PB0H 2RFXA 1DQQA 4HS3A 1KXTB 2NY0C 5IUSA 3EFDH 1NCCL 1RZ8B 3C8KB 5F7DA 1BZ9A 3P4NB 2VXSH 4Z9KB 4DW2H 2FX9H 3EYUH 2ERJC 1QBLH 3PGFL 4K7PH 3S7GA 1D5XB 1U8QA 1LEIB 2RBLA 1MFCH 1QHOA 5CINL 1ITCA 4ONOA 3SKMB 3ARBC 1ND0B 1G7JA 1BECA 2XZCL 4X9HA 2EEAA 3MUHL 1LK3H 1UKTA 3D5OF 2KPNA 5HI4C 4U7SA 3RIAK 3L7FB 1A8JH 1PQZB 2KQMA 1N7MH 2DTML 3WFEL 2LU7A 1CDIA 5T1MB 3VWJD 4U2ZA 4OZGA 4GKZA 4NZUL 1EAPA 3X11B 1KEGL 4RFEA 3VFOB 3UZEA 2R2EA 1GGCH 1NFDB 3QXWA 1KPVA 5A2JH 4N90D 4G5ZL 5JPNA 4KH2A 1CDJA 1WISA 3O6LL 4ONFH 1IQWH 2Z31D 4M7LH 3MJ8B 4WI5A 1EHNA 1GPOL 1LK2A 4QCIA 1EHXA 3KPRA 2QQLH 3RGVD 2GJ6D 2J12B 1C5BL 4HKJA 1UVQA 3NGBC 5DEFA 1MQKL 4LASH 4EI5A 3MRLA 3V0AC 4DUWA 5A2KH 4PBVC 5EZLA 2J8UE 3BMVA 4PRPB 1KPRB 1URLA 1JNNL 3FQNA 2YD3A 3I3DA 4R2GC 2EIEA 4XMKH 3QIWC 4BQCA 4QTIL 4RAUB 3UYRH 3ULUL 5KANG 1LWRA 3VD5A 4D0CA 2C9AA 4HSQA 2VDRL 4LVHB 1D6EA 4GRLC 4XP9H 3F7VB 1P7QA 3FN9A 2XG4A 3CUPB 3HUJF 1I8MB 1AGFA 2XTJD 3HZVA 4WO4C 3TZVB 3SDAD 4HC1H 3FHQA 1FGVL 3D9AL 4FFVC 4IS6B 5I71C 1FL5B 4EUPB 5C2BH 4OLZH 3OGOE 5FHAL 1NGPH 4Z95H 2VERN 2XNAB 4NHCH 2Z92A 3GSNH 4EQ2A 4FFZL 1NBYB 3N85H 4HHAA 1HHJB 5DD1H 1FH5L 2FIKB 1CYGA 4JGMA 2DICA 5K9JL 3SGDH 4Z76B 2FHCA 2CJUL 4OZGF 4HK3N 1MNUL 2YPKA 2EDRA 3O2DH 2NY2C 2QHLA 1FYTB 4JZJC 5EB9A 1R5WA 4P2RA 3S4SB 3W5MA 4M6OL 2HJFB 4RGMC 4WHDA 5HY9B 4M4PA 1OTSD 4LCWA 4M5ZL 4ZTPL 3CK0H 3LKSA 5BS0D 3QBTB 3NIFE 2X7LA 1MWAH 2WBJB 3JVGA 1UB5A 4UINL 5ETUA 4YHNA 4JRXB 1Q9OB 1T83A 4TVPD 3OBAA 2H32B 1EJOL 5DUPL 4JHAH 3VRIB 1E4JA 3T0XA 4WEBH 1UT9A 2H9GB 3LCYA 2AQ3A 3O9WA 1NBZA 4PV8A 5IQ7H 3GB7A 5TGBB 2G9HB 4PJHA 4DGYH 5GJSH 5HVHB 2VR5A 2DQJH 4M02A 1MPAL 3RL1B 1QQDA 1IBGL 3QG6A 3PP4L 2OBGA 2V7HA 2QSQA 3ARSA 3EJYD 4GBXC 4O2FA 4RFNB 2E6QA 4X6BA 5MP6H 4D0BA 4F58L 2Y1VA 5E8PA 5JORB 5DO2D 1GOHA 3WKML 5IB4A 3CFCH 3RHWF 3VXRB 3RUGB 5C71A 1XT5A 4O4YL 2IQAA 3MUJA 4NRZA 1REIA 5K59F 4HUXB 3ZYZA 1OWWA 4OF7A 3MFGB 3P0GB 3HB3D 5D7JD 3WIFB 2V2TB 2Z0BA 1NGWA 3AUVA 5DJ0B 1JZ5A 1ZHKA 3VD7A 5KSBA 1CF8L 4DZBB 3VI4E 4FQIH 4QTHA 3ARED 2P8LA 3KWWA 1FVEA 2FYYB 1YY9C 4PJBE 4U33A 3SY0A 4CUCA 3BO8A 3HAEA 4P5TB 2A6JA 2ADFH 1CGSL 3KYAA 1QSEB 3BQUD 3CIQA 3FOLA 4FXGA 1ACYL 1FFPA 2VITB 3RWFB 1M6OA 2FJGB 3ARDA 3GJFA 2EXYD 4K9EH 4TUOA 4I3RH 3VXPA 1U58A 2GK0A 5CSZB 2IPUG 4YEFA 2HLAB 5BRZB 1CD9B 4LQFL 4OCXH 3E6HB 3VFUA 3MOAL 1SYSB 3O41A 3FN0H 1FZMB 4UUJB 3GMOA 3C6LB 3WNPA 3MYJB 5T33L 1AR2A 3NH7L 3CCHA 2FO4B 5EU4B 1U8HB 3MRBB 1BQLH 3H9SB 3IFOA 2GYSA 4LLAA 2ZUUA 4I8DA 1J05A 3PDGA 1J0HA 5EU6A 4OFPA 5ENWA 1AE6H 3DV6B 4LLWA 2B0SH 1FJ1B 1HHKA 1LO0L 4LMQE 4BZ2L 1TIUA 5H37G 3SGKC 2NW3B 2V5MA 5KAQF 2Y4SA 3MXVL 1HI6B 1CT8B 3QI9B 3VXME 1Q72L 3V95A 3VXOA 1CFNB 3HCVB 3BH9B 3RVWD 5I9QC 5JW3L 1OAKL 2DMCA 3VGFA 5AWNH 3CVHL 3ZTJG 3L7EB 1II4E 4D0DB 4WV1C 3Q1SL 2UZYB 3UTSE 1FZJA 5C2UB 4S1DD 4NIKB 2EYSB 3ARUA 1GC1L 1U93A 3T2OA 1IGFL 3QUYB 2DQEH 4KJWD 2LABA 5CINH 4NO2B 4PGZA 3S34H 2PXYD 4K8RL 3MO1A 3QUMB 4MDJB 4X5XB 3BESR 2EDKA 1ZVHA 3GUTB 3S88H 2VISB 2XZCH 4P4KD 3IVKB 5ITBH 4JY5H 3KNBB 4M7ZB 3QWQB 4Y2DB 5E2VH 2O61B 3RWJA 3ZE0E 3BZEA 1IM3A 2X4TA 3AS2A 3IDNB 5J12C 1Z9LA 1NQBA 2VKXA 2NPLX 2YPLE 4NZRH 2K1MA 5D1QC 5L6YH 4MJIA 4U1NB 5I6XB 4HS6B 4HGMA 3E8UL 4YHPB 4F15B 1BLNA 1I7RB 1IGMH 5F89A 1S9YA 3PE9A 3ZKQD 3F12A 3SDCD 4I77H 4PJXB 1JWSA 3RPIA 1GPOH 1CXHA 2UVEA 1A7QL 3VG9C 2XACC 4H5SB 2P8PA 4LK4A 4UTAL 3BRDA 2OL3H 2C4FU 3LKQA 4PYGA