2HT2C

Structure of the escherichia coli clc chloride channel y445h mutant and fab complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
b'VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Synergism Between Halide Binding and Proton Transport in a CLC-type Exchanger.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 37
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht2C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht2C01
3WDIA 4ELMF 5DDHB 3AREC 3L95A 1I9RL 3NCJL 4TUOB 1LE9A 4LSSL 4D8PB 3JV4A 5ISZE 1X5AA 4RAVA 4Y1AB 3HB3D 1ZWIA 5GJSH 3MV7B 4WRLA 4JREB 4M3JA 2IAND 4LF3A 3SDCD 4QOKD 2WIMA 4EN3B 1GIGH 2DDQH 2WM0A 3ARSA 3HZKB 5F21B 1TZHB 1NMCC 3C5JB 1KC5L 1FV1A 3QXTA 2EO9A 1A6UH 3LPGA 1P2CB 3FFCD 3U79A 1MJ8H 3F8UB 1ZT4B 3MRHB 4FP8H 1J0IA 4JR9H 4O2CB 5C08E 1R0AH 4AQOA 4MQSB 5CCKH 3V8CA 2VQUA 3IF1A 3DLQR 2Y5EA 1BX2A 3VFPA 4QGTA 1NJ9B 4ONFH 3SCMD 5D5MF 4R7DA 1JNJA 3IDGB 5IEHB 1HH9A 1TTGA 1ITCA 25C8L 4YGVA 1WSST 4M6AA 4M5YH 3NZHL 5EBLA 3CMOL 5HYSB 3JTSB 1CD0A 4QXUL 4HBCH 4O9HH 3OR7B 4S1RL 4P2CG 5JOFB 3RGVD 4GSDL 1JV5A 1OW0C 2CDGA 2UWEA 4OB5L 3TP4A 2GYSA 2EXWC 3UEZA 3MROB 2VIRA 2CKBH 1QNZH 1A4JB 3ZSTA 4FXLA 3KHOA 4LEXL 3C6LD 1BLNA 1IL1A 4L3ED 3BUTA 3EO0B 5F1KC 2YPLA 1TQBB 4QRTB 5GZND 2GQHA 4BSJA 4TSAL 3QJHA 1NGZB 2XXCB 1A2YB 1IC1A 3IS0X 4FXGB 4P46A 3BW9B 2KBGA 1IAOA 1JF1B 4J3SA 4A2LA 1MIML 2NCMA 3KLSA 1ETZA 2GAZA 2VZVA 2QQKL 3P73B 4OCYL 1R3HA 4UU9B 4ERSL 5GRJL 4AEHL 4S1QL 1RIHH 4MS8D 3VMNA 4MB4A 3VFSA 3GBLA 3TJEH 4RA0C 1RUPH 3ZDYF 1GOHA 4I0PD 4OD1L 3CIQA 4FFWD 4AEIL 4TUJB 4E5XA 3L3IA 3DXAE 1Q9KA 4CBPA 4OLYH 3T3PF 3ZKND 1JL8A 3FT4B 4I8DA 2R0KH 4PJ7B 5EORH 5C0AB 1W72L 4P49A 2GEEA 3X12B 1JFQL 2Z8VC 4H1LH 4TOYH 2A6DA 3I02B 3RNKB 3O3EA 5M7QA 4ZOEA 3GGWA 3OAUL 5E9DE 3DIFB 5M94B 4RGOL 3VCLB 2P5WD 5F1IA 1H3WM 1ES0A 1KPUA 4JJ5A 4XNUH 5FYKL 1P9MA 1GH7A 1TVHB 3ARGA 1NFDF 4Y5YC 3V4PH 4XB8A 1X4YA 4O5LL 2R4RH 2B4CL 5E8PA 1N2RA 5DFVC 4U6VL 3JV4B 1RD6A 1M4KA 1P53A 1FJ1A 1ZWIB 4XAWH 2CQVA 3EDDA 3ILPA 4Z7NE 3RKPA 3IFNL 4LF3B 1RU9H 7CGTA 3ELAT 3TV3L 1ZHBA 4K23L 7FABL 4FQHA 3HRPA 4HZLA 5F6HJ 3KDMB 5E08L 1WFTA 2BHZA 3LZFH 5F9DC 2PTVA 3U0TA 3ZKMC 5C0AD 1VKXB 1ADQL 3BPLB 2OR7A 4HMEA 4TVPD 1I9RH 3NCJH 4LSSH 2BVPB 3BKJL 2BXYA 4YDIL 3MUJA 1MCLA 4F58L 1BX2B 3VFPB 5HHMB 3OJDB 2XTJE 2WNGA 2VDPL 1HH9B 2BY1A 3P11L 4YGVB 5C0CE 2G9HB 1J87A 5EBLB 4FHBD 3O45A 1KC5H 3I75B 1UM5L 5DGQA 3HG1E 3Q3GA 5FYJE 5EU7E 4PJBA 5C09A 5HYJB 1JV5B 3VXMD 3S98A 4P9HC 2V2XA 3QIUA 2VIRB 1BVLA 3EFDL 4O4YL 1CICA 25C8H 3T0EE 3IXTA 3O2DA 1JRHI 3SQBA 4YFEA 1QLRA 2IAMA 1UXSB 3NZHH 4K7FB 4OZGB 3CMOH 3WFZA 3B2UC 3QEUB 4QXUH 2IANE 4X6CA 4QOKE 3QHZL 4S1RH 2YD5A 4P46B 3ULVE 4KVNL 4GSDH 1G7MA 1IAOB 4OB5H 3VG0L 5E8EA 1DTUA 5HHMD 5J56B 3EOTL 1ETZB 2GAZB 4OFVA 3L7FA 5K33A 1I85C 4MNQA 4G7YL 3WKNA 3MXWL 4LOUC 3LEVL 3FFCE 3VFSB 3WFEL 5EO0B 2HA1A 1J12A 4DCQA 3BPCA 4HS6A 5BZDB 4LEXH 3L3IB 3C5ZC 4BKLB 1Q9KB 5EO9B 1AH1A 5TF0A 5DGRA 4TSAH 4NZRL 5HYJD 1Z5LA 1QA9B 3G5YA 1EHNA 2DI7A 5KSBE 5GRUL 2A6DB 3O3EB 3O4LB 3KNBB 3VE0A 1MIMH 3L6FA 1JPGA 2QQKH 4OCYH 4WDIA 3QZWA 5F1IB 5FA4A 4JVPA 5GRJH 1KPUB 4AEHH 2X4OA 4S1QH 1MHHB 2LVEA 3LSOA 3Q0HA 4OD1H 4AEIH 3TC9A 5C71A 5E8PB 1N2RB 4QRSA 5DJYA 4CJ1A 4LVOC 1W72H 1NEUA 1JFQH 1FJ1B 3C9NA 4Y2DA 4GRMB 4L3EE 4U0RB 3OAUH 4RGOH 1ZHBB 3H7BA 4WWKD 5J12C 4PLKC 3BWUC 5IB2B 5FYKH 2CK2A 5CZXD 3U0TB 4KTDL 4O5LH 2I9TA 2B4CH 2UZIL 3MBEA 4U6VH 1QR1A 3O4LD 1UJ3C 1WCBA 3B5TA 1LDPL 3RVUC 3IFNH 5I1HL 4Y8AA 4HS8L 4D2NA 3TV3H 4UNVA 4K23H 7FABH 4X6EB 5E08H 3ARUA 3EYOA 4HGKC 3O45B 3L3OA 1DFBL 4DKAA 3IU4L 4XBGA 4WO4A 3Q3GB 1AHWC 5C09B 3ZT6A 2P5WE 4OZIE 2EO1A 1ADQH 3T0AA 4QO1A 3HUJE 4EXPX 2VC2L 1A0QL 2XXMB 2V2XB 1CZ8L 3QIUB 3BKJH 2PYEB 4LBEA 4YDIH 1BVLB 3ES6A 4F58H 5C6WH 2Y6SD 1HZHL 1MHEA 2FD6L 2VDPH 3RAJL 1UT9A 2CXGA 1CICB 3P11H 5DJAA 3D6GA 2IBZY 5D93C 1BOYA 4F9PA 2IAMB 3B6SA 3PABA 4Q58C 2CPCA 3BUYA 1QRNE 1R5VB 2CO7B 2AV7A 1N5YL 1VESA 3LDBB 4ENED 1IM3A 2XN9E 3WHXB 4JO4L 4MNQB 4BSWB 4PJ7E 5C0AE 3RDTA 2CD0A 3EFDH 1EERB 1T6WA 4DCQB 3TNNB 4HS6B 4O4YH 2MHAB 1U3HB 3UPAA 5F3HA 2YD2A 4X80L 1VERA 4ZOBA 2WP3O 5JHDA 4ZOCA 4GKSA 3ZHKA 2GKIA 1Z5LB 3QHZH 4X7SL 4PLJC 5IR1A 2V5TA 4KVNH 2PYED 3VE0B 4GRWB 4P5TD 3VG0H 5K9OA 3L6FB 4P4KA 3EOTH 1JPGB 4RWHA 5IGXL 2P49B 3CH1B 3QZWB 4NM4L 4G7YH 3ARBA 3MXWH 3WFEH 3LEVH 3B9KB 1MFDL 3VXME 3LSOB 1KTRL 4M93B 4QRSB 4KMLB 5DJYB 4Z0BL 2DOCA 3WUWG 4NZRH 4YIQA 5CD5D 2FSEB 1ZLWH 3F7PC 3CVIL 3C9NB 1BZ7A 5KSAA 5GRUH 1MY5A 4MNQD 5I1LA 5MEQA 2V6HA 4I2XE 1I7TA 4DZ8A 1WIPA 3KPSD 1U3HD 4HJ0D 3H7BB 3DHJA 4LSDA 4P23D 5HHME 4PJAF 1NSNL 3EJZC 3RI5F 4YBQD 1P9MC 3KLDA 5GPRA 3LY6A 3ARGC 4XI5D 2F19L 1H8NA 3MBEB 4LCWD 2L0DA 5HDQL 1WCBB 1CGXA 5IFJA 4W4NA 4RFOL 1T7VA 2D3VA 4HMDA 1HYRC 1TJIL 3DUUA 2VKWA 3B9KD 2XZCL 5DO2D 4JFXA 4A6YL 2HJLA 5CP7A 1H15A 3EYOB 1BBDL 4XBGB 3PDGA 5GISL 4KTDH 3CK0L 2YUWA 1O5DT 1JN6A 3FAXA 4RMWA 2UZIH 3WIIL 3CFEA 1RIVL 5F70A 2BY3A 4XWOD 3ES6B 4OZGE 1FDLL 2DQTL 1LDPH 4DOHE 1BREA 5K9QI 4G6FB 1CK0L 2HT4D 1MHEB 2R0WL 3TH3T 1T7ZA 1CD8A 1XCQA 5I1HH 4HQQL 1ZGLA 4HS8H 4Z76A 5BV7B 1YY9C 5DJAB 5IBUB 4HMCA 1RSFA 1GGTA 1SY6L 1UCBL 1H3TA 1UWEL 3KPTA 4FZ8L 1I9IL 4PJHA 3DROB 5SWQB 1DFBH 3NCFB 3IU4H 4W70A 2AV7B 5KS9A 1JTTA 2Z93A 4ZFOA 2VC2H 1CZ8H 2YR3A 5GS1B 5J4MA 2KQMA 5DMGD 4R3SB 3RDTB 2AK4A 2XOTA 4GQPH 4JFEA 1HZHH 1TCMA 2FD6H 4LVHC 3RAJH 1KFAH 2RFXB 3O4LE 1KPVA 2EYSB 4X9GA 4Z7UF 1YMMA 5I8KL 5JHDB 4GKSB 3AY4A 2AJXL 2C1PA 2HN7A 3GSOA 1N5YH 5IR1B 2V17H 4X8XA 1KJMA 1WQVT 3QDMD 1J0JA 1PAMA 4G6FD 4JO4H 2D9QB 4IRJA 2YD7A 2WBJA 1NDMA 3SKJL 4EDXA 2CRYA 4P9HL 1QP1A 4UI2A 4DEPB 5L7XL 1F4AA 3MOBL 4ORGA 4X80H 1I1FA 4LCCC 1U2CA 5JDSA 1HKLL 2J6EA 1MFCL 5A43C 1BZ7B 4X7SH 3CUPA 5KSAB 1TFHA 4NKIL 5CKGA 3FO9A 2A6IB 5CLTA 5IGXH 2EDLA 5E4EB 1OLLA 4JKWA 4NM4H 4D94A 4KK6C 5FUCC 2RCSL 4GW1B 2LTQC 1MFDH 4HCRL 4YGAB 4Z0BH 3D0LA 3BKCL 4WI4A 3TZVA 1WAAF 1SJXA 1NFKA 3OG4B 3CVIH 3R8BB 5IFJB 4KUCF 3GMLA 5I18L 5IOPA 3T09A 3DUUB 2QADC 5B8CA 4NO5A 3SKMA 2HJLB 1H15B 2NR6C 4YLQT 2VLMD 5JTWA 5JA8B 1NSNH 5GSVA 2OZ4A 1JN6B 3FCTB 3VXTA 3DMMC 2F19H 1GPOL 2FGWL 4ZUWA 4OV6F 2X4PB 3PV7A 3CFEB 4TPRL 1UM6L 5HDQH 4RFOH 1DQJA 4OZFH 1KPRA 3AS2A 3B9EA 4DN4L 1XCQB 4P2OC 2ADFL 1F45A 1TJIH 5A2LH 4Z76B 5HXMA 1ZGLB 2R1XA 2XZCH 4BQ9A 2EKSB 3OB8A 3FB8A 4D0BA 3S3PA 1R3LA 4A6YH 4XMLL 1GZQA 3INUL 3TBSA 5IESL 5DQ9A 1BBDH 1T83A 1IAIM 4ZQKB 5EZLB 2E6QA 4YX2L 5GISH 5KS9B 5D1ZA 3CK0H 3KPSE 1T80A 2XFXB 2Z93B 5I8EA 4YFLI 5C3TA 2VXUL 3WIIH 1RIVH 5DUBA 4U1MB 5AG9A 5KZCD 4R90L 1FDLH 2AK4B 2DQTH 3S9DB 5IMKA 4JFEB 5KSUA 1CK0H 2R0WH 2JK5A 3MV8D 4HQQH 4LCWE 4PG9A 3SDXE 1I1AA 1YMMB 3RWHA 1W8NA 2QLVB 1SY6H 1UCBH 1UWEH 1P7KA 1FC1A 1I9IH 1NGYB 4FZ8H 2WSKA 1XIWA 2HKHL 4TNWF 2H8PA 3PP3H 4YBHA 4CL7A 4IHOA 2C1PB 3WJLA 2HN7B 5MI0B 3GSOB 1Z9LA 2NYYD 4IM8A 2I24N 1FNLA 1KJMB 4EI6A 5EUOA 1PDKA 4IRJB 1HWGB 3V9FA 2WBJB 2H26A 3ARDD 3SE8L 1DVFA 4EDXB 3TCXA 5IJVB 2YSSB 4GMTL 4TYUA 3UTQB 1PQZA 2M26A 4ORGB 1TJHL 1I1FB 3AB0C 5I8KH 1RZKC 3MLTA 4PRPD 1QZ1A 4U33A 2F9BT 4HFUL 2PN5A 5IVXF 4P3CL 3RUGF 3BP7A 3KJ4C 4EQ3A 3MRKA 3GMMA 2AK4D 4HWBL 4JFED 4J7RA 4ONGL 3VXPB 2KPNA 4ZNCD 3SKJH 4Z7WF 4P4KC 4P9HH 1ORSB 1U8IB 2P5EA 5L7XH 3MOBH 3ARBC 4IIQA 4KFZC 3D0LB 4HDIB 4MXQD 2EZ0C 3QPQC 3TZVB 1HKLH 2NX5A 1MFCH 1R5IA 4F8TA 1WUNT 2K7QA 2ZP0T 3V5DB 4XP1L 3WLWC 4KUZL 4NKIH 2P24A 5E8DL 5IOPB 2WBJD 2DJUA 3MUY1 5JORA 5B8CB 3MCKB 3P0YL 4KKLC 4OI9A 4FXKB 4NO5B 3SKMB 2OK0L 2I9LA 1HSBA 2RCSH 1Y18B 3LMJL 5C0FA 1XGQA 1P1ZB 5K59F 3QDME 2NLJA 3WN5A 2D2OA 1I7RA 4HCRH 2FX7L 2H2SC 5GGVY 4YEEA 2J8UA 3QRGL 2VE6A 3VXTB 3WDJA 1MCCA 3BKCH 4S1DD 4ZUWB 2AXJA 5JXAL 3AROA 5I18H 3HE7C 2FIRT 2XKSA 2V5YA 4HWNA 2R1XB 2O5ZL 1JGLH 1UG9A 1R3LB 4OD2A 3TBSB 1B4JL 5DQ9B 3DETC 3WS6A 5T3ZD 4M02A 4NFDA 3CFBB 5D1ZB 5EFIB 3NFNA 1HKFA 5EBGA 4MLIA 4WW1A 5I8EB 1GPOH 2FGWH 1DN0B 3KJ6L 1F00I 2HWZL 4TPRH 3AXLA 1UM6H 4GRLC 5I74B 4GQ9L 4F7TB 5IMKB 4KJPD 1TJGL 5KSUB 4JO2L 2Q87A 5DJZA 4XBEL 4DN4H 5FFLA 2ADFH 4ODWA 1I1AB 4I3RL 3RWHB 3FQTB 4AM0A 5KANG 4H1LG 4KJYA 4Z7QE 1P7KB 2XYCA 3MNZA 3INUH 5DRNA 3MC0A 5IESH 3BIBX 3FZUD 1F42A 4FQQA 5LKNA 4RFEA 1LMKA 4YX2H 3GDBA 3VXUE 4IOFD 4QHKI 2MMXA 5EUOB 1R24A 2VLME 1KXVC 2VXUH 1FGNL 3QB7C 2H26B 1DVFB 4KKAC 4R90H 2YA0A 3F7QA 3ZE1E 1A9EB 3HA0A 4OF8A 4X99A 5D96C 1PQZB 4JE4B 1J88A 3H9SD 2CH8A 3MLTB 5CSZA 4WVRA 2HKHH 3PHSA 4YPGA 4KJWC 2Q7NA 2VL5A 3U46B 1D5BA 5EU4A 3FQRB 2Z9TA 3BP7B 4MSWB 3RWFB 4LGSB 3MRKB 5DVOA 3GMMB 4OUOA 4NBXB 2D7MA 3SE8H 3S35L 2PTTA 4OCXL 4GMTH 5F7LB 4YFLF 4MNHB 5EIQA 1I4FA 2I27N 1TJHH 4IIQB 3KG5A 4GKOA 1VADA 3B5GA 1R5IB 4Y88A 4HFUH 3MV8E 1MCWW 1X3DA 2D0HA 4MWFA 3CCHA 3VMPA 1CU4L 4P3CH 5BQ7A 1J1XL 2P24B 2P8MA 4X5WA 1DVFD 4PREA 4HWBH 2I9LB 1I3RA 4ONGH 1HSBB 5C0GA 2DL9A 5D7IA 2D31A 3QDJD 3VGHA 3VFMB 1MCEA 4ZUUA 3WN5B 3SEPA 1I7RB 3MJ7A 4LLWB 3V0WL 2G60L 3NFSL 4WUKL 3KPNB 4FFYL 4ZUSA 3O6KL 4F7PA 3T0XA 1OP3H 2QR0A 2VLRD 3WL9A 3CZJA 3RVTC 4QXWA 2E9BA 1D5XA 4XP1H 4PRPE 4KUZH 4Z77B 1DQQB 5E8DH 3P0YH 2Z8WC 2PW2B 4L8DA 2OP4L 1KCKA 2OK0H 4J1UA 2OI9C 4ZPVB 3LMJH 1YC8A 4LSTL 4HKBA 2FX7H 2FWOA 2ADIA 2WUBL 4PJEF 4WW1B 3QRGH 1QTYT 3RWIA 5CHNA 2Q7YA 4QT5A 1S9XB 2YOCA 1CDGA 5DMJB 3ARED 3TBTA 5JXAH 2Y07L 5A2KH 4MLSA 2O5ZH 3HHRB 3OXSB 4AIXA 3MNZB 4HIEA 2P7TA 1B4JH 1EO5A 3P4MA 4GKNA 5A3IC 5J6GA 4B7IA 1KIRA 3E8UL 4RFEB 5C1MB 2NY0B 3QH3A 5INDB 1AR1C 1T83C 2HVJA 1R24B 3O0RL 3KJ6H 2HWZH 3OR6A 2BMKA 5F9JA 3IAGC 1PG7W 4GQ9H 3D2UA 1TJGH 4JO2H 1QVOA 4XBEH 2FEEL 3FTGA 5EUKA 1E4XL 1QLFA 1LO0L 4I3RH 5EC2A 1A3LL 2FLRT 5SX4H 4YPGB 2VL5B 2NMSA 5F8QC 4F37F 2EDOA 2YD4A 1KCVL 3LKRB 1XIWC 4L5FL 2C3HA 2IPUK 3MX0A 3QQ9C 5GGSY 5BW7C 2CMRL 1IRAY 4YDKL 1FGNH 4I13B 5FA3B 4RBPK 1WZKA 2PTTB 1FVDB 1CGTA 1D7FA 2EXWD 4H0IA 4A6YB 4N0UA 2JB5L 3K2UH 1HNFA 1I4FB 2WP3T 1AQKL 4G6AC 2Y9RT 4LSUL 3BAEL 4R7NA 1VADB 2E7LC 4U1GC 3QG7L 4DWHA 4FFZL 3CCHB 2ZUVA 3UTZA 2HLFD 5BQ7B 2UY7A 5D2NC 2E5EA 2P8MB 4X5WB 2RGSA 4PRAB 3CDFA 4PREB 2YD8A 5IEKA 2QEJA 3MRIA 4ODBD 15C8L 5D7IB 1JJUA 2D31B 3S35H 5GRYA 4OCXH 4M00A 4ZUUB 4LQFL 1HNGA 3W2DL 1MPAL 4WFHD 1F6AA 4ZUSB 4NQDA 2I60L 2AJVL 3WL9B 2AJZA 3Q5TA 1CDBA 3DVFA 2K3TA 3NIDE 1RZKL 3UAJC 4YDLC 1CU4H 1J1XH 3H9SE 3CMGA 4YAQA 4KXZI 4X7CC 2A74A 3SE9L 1U8NB 4NN5C 3S3JA 3O2DH 1S9WA 4J1UB 1VFAB 2NW2A 5TQ2L 3RNQB 4R9HA 3VU2A 1AD9A 4HKBB 2ICWB 2FWOB 2ADIB 3V0WH 2G60H 4QHLA 1I3GL 1MQKL 1CWVA 1RUML 4WUKH 5CHNB 2EDWA 2Y7QA 4FFYH 4PG2C 4QT5B 4QTHB 3O6KH 4W6YB 3SGDH 2OTPA 2CDEA 3O3UN 3DI2B 3C60A 5DFVD 3TBTB 1MCKA 1RI8A 5H2BA 2OLDA 1F3JA 1FL3A 2OP4H 4ZDHA 3RKDC 3RRQA 5ACZB 4U7SA 4HIEB 1D5ZA 2X4TA 3P4MB 4GKNB 4Q6IC 1C16A 1KIRB 4HUWB 4LSTH 3U30B 5JXEA 2WUBH 4X6BB 3LV3A 1E27B 3QDJE 1H3GA 1VA9A 3ZKMD 2BMKB 5F9JB 3O3BA 4IRSC 3D2UB 3VFVA 1QVOB 2Y07H 4LL9A 3FTGB 1QLFB 4KAQL 4E42B 5I9QC 1BQHA 1IQWL 2VLRE 4G43A 5IW3A 5JQ6L 1BECA 5EC2B 4G8EA 5ID0A 3KHQA 1YJDC 5T1MA 2G5BA 4U2ZA 3E8UH 3VXSA 1GGYA 4IRZL 3KPLA 4RAHA 3UYPA 4Y89A 1MREL 1V3KA 1CGUA 2YPVL 4PGDA 3O0RH 2JIXB 4OUUB 2VLLB 4V1DE 5T33L 5DK2A 5ILTL 1PYWA 2CLVA 4HJGA 2W38A 1YNKL 3I85A 5HGHA 2Q8AL 1ZEAL 1LHZA 3QIBC 4N0UB 1E4XH 4FN0A 1LO0H 4O51A 4PJIA 2FEDC 4R7NB 1A3LH 4PJ9A 1CYGA 3W0WB 4YWGL 1WT5A 1S7VA 1EEQA 2VR9A 3BRDA 1A6VL 1I8KA 1O7VA 3NN8B 1KCVH 5ICZB 3B2UD 4L5FH 43C9A 1GSMA 3FONA 3VH8A 5IEKB 5E2VL 2GJZB 2CMRH 4YDKH 1K4DB 1BF2A 5DRZB 1K9TA 4LVOB 1KULA 2FRGP 4DN3L 4AK1A 2JB5H 4YDVA 2A38A 1ZS8A 1AQKH 4LOUD 4ZFOL 4LSUH 3BAEH 4Z7VA 4GG6E 3QG7H 3QUYC 1MUJA 4FFZH 4NQDB 2R29L 1T1WA 1F13A 3C5ZD 4K94C 5GZOC 2AJZB 2JIXD 3HNVL 2XZQL 3GI8L 4LHJB 3Q1SL 1N6UA 2A74B 4TVSa 3GJFA 1SJEA 3X13A 3D25A 15C8H 1YPZB 1OAKL 4KU1A 5JUEL 1IGCL 2EDBA 2Q3ZA 3L5HA 1AQDA 4RQQA 4K7PL 1AD9B 1LVEA 5C70A 5IIEB 1G9EA 4LQFH 4Y16A 3FB5A 2GIYA 3W0WD 3W2DH 1MPAH 1I8MA 2VR5A 4ZUVA 3QQNA 3HAEG 5DWUL 4FA8A 3C09C 4AJ0A 3EBAA 2I60H 4N8VG 2CDEB 2Z92A 1VEPA 5AZEL 1RZKH 5TE6L 3RIFK 3RL1A 1F3JB 4MDIA 1EFXA 1FL3B 3SE9H 4EUPA 1SVCP 4ZDHB 2NTSP 5A2FA 2X4TB 1X5HA 4LRIC 1C16B 5TQ2H 2C4FT 3BQUB 4PLKD 4Z7NF 1I3GH 1MQKH 1RUMH 5D7LB 4M4RA 4L3CA 3T65B 4PJGB 1IEHA 1J11A 5FDWA 4HBQA 3O3BB 2UUDH 3TCLB 5B38G 4WFHE 5HVWA 1IM9D 5JLZB 5L8KB 3BP6A 1WK0A 5DD6A 4JFQA 2R9HD 4P5MA 3GMOA 1RIUL 3ZYOA 4O02L 1BQHB 4G43B 3N06B 3RVUD 3HPJB 1FL5A 2FB4L 5T1MB 2ATPA 4N0YL 2PO6C 1ZA6B 3S7GA 3VXSB 3CDCA 3MFGB 3KPLB 3TBWB 4NN6C 1WTGT 1G7HA 1RK1A 4C56A 1M05A 4PGDB 1W0WA 4MJIE 1Q9LA 5DK2B 5IHBA 4F57L 3VFOA 1PYWB 2CLVB 1KOAA 4HJGB 1J8HD 5HGHB 1AKJD 1ZVYA 2OZ4L 1L6ZA 1XF3B 2A73A 2F53B 4O51B 4KAQH 4PJIB 1JWUA 5JQ6H 1IQWH 2ZNXA 2H6PA 3BQUD 3O9WA 2JTDA 1OTTC 1IKFL 1S7VB 4U1SA 1I8KB 5KVDL 1J0KA 5D7LD 4HH8A 3NPSC 4IRZH 2VZ3A 2C9AA 2HFEA 1MREH 1YY8A 3OZ9L 3RHWK 4YHYB 2YPVH 2BOCB 4JQXA 5I71C 4MA1B 5T33H 1CBVL 4NQEA 3SN6N 5ILTH 1U8OB 2CO6B 5H37H 1VCAA 1YNKH 2WIIA 2Q8AH 1ZEAH 4PJDE 5LGJB 1OF2A 3ULVF 1ZS8B 1TNMA 1K5NA 4N8CL 5ACMA 3SKNA 4N5UA 4XP9L 1MUJB 2DQIL 4YWGH 1UZ6E 1A6VH 5JIIA 3HNSL 4L4VE 1FE8L 1RV6X 1TIUA 4XNQB 3GJFB 3HN3A 5E2VH 1JWSB 1BD2D 1SJEB 4PLJD 3TWCL 4YHIA 3X13B 3D25B 1CIUA 4NWTL 1NFDA 2F53D 3U4EB 4ELMB 4DN3H 5HHVL 1QFUL 4RGNC 4RQQB 4Y16B 5I76B 3F7VA 3FB5B 3PWUA 3WFCL 5KSBF 1I8MB 1CI5A 4ZUVB 4NP4L 2CUHA 4W4OC 2KKQA 2R29H 4EKXA 2F74A 4PRHB 1K3IA 3RL1B 3HNVH 2XZQH 3GI8H 3HI1A 4E0RA 4MDIB 1LP9A 3Q1SH 4EUPB 4CU6A 1OAKH 3P9MB 5HHXL 5IM7A 5JUEH 1IGCH 5C7XL 3QO0A 3EOAA 4K7PH 2OCFD 2W9LA 2ADJB 1CF8L 3VFGL 4OJFL 4XXCC 5DWUH 4J3WA 3LRHA 4TULL 4L3CB 3EJZD 2JJTA 1OAUL 1U91B 5D5MB 5FDWB 5AZEH 4LNVA 5C86A 4WUUB 5TE6H 1L9NA 3T1FB 3BP6B 5CZVL 4JFQB 5DZNA 1G0XA 4P5MB 3GMOB 2JJWA 2VABA 2GY5A 3C60C 1KIPA 3EGSA 4IS6B 3BGFC 3IB4A 4H0HB 5LGHL 1A1OB 1E6OL 2BNQE 1M71A 1FL5B 3HR5A 3WDHA 3VDAA 1JUFB 4F7MA 4WI9A 5C2UB 2FO1A 35C8L 3QXDB 1G7HB 4KDWA 4U1JB 4PRHD 1M05B 1W0WB 5I16A 3RL2A 4WU5B 1VB9A 4QRRA 2XI9A 1X5GA 3RY6A 3VFOB 1T03L 4XP5L 1RIUH 4O02H 4OZIF 5BOZG 3O9WB 2BERA 3HUJF 2FB4H 4R8WL 5GRXG 2APBA 1YY9D 3NGBB 4JY5L 3UTSE 4N0YH 1YEKL 4KDTC 4ZS6C 3ZT5A 5D2LA 1QSFA 2HFEB 3ISWA 1IBGL 4LCCB 4WUUD 4KQ3L 1M7DA 4JFPA 5A2IH 5D7JA 1HCFX 4F57H 1IGYA 1OGAD 2WIIB 5DK0A 2E6PA 4WTZG 2OZ4H 2R15A 5IF0A 4JM4H 1OTUC 5HHOA 1U2HA 3MCLL 4XP6L 4JFDE 4WHYH 1IKFH 5IB4A 4HJJL 5KVDH 1YPZE 5GRVK 2LTQB 2NY2C 2J2ZA 1KIUA 4PJ9C 1YJDL 1GGBL 2EDXA 2F15A 2BVOA 3OZ9H 4L9LA 4WHDA 1MCQA 1NCWL 1UKSA 3LKSB 4G8GA 2B5IC 3E6HB 3KYOA 3WXWL 1CBVH 3WNKA 1NFDB 3BJLA 4OZ4A 2FL5B 4NUJA 4G9DA 4QWWC 3BKYL 3NFPA 2XKUA 4N8CH 5D6CA 1I1RA 1PX4A 5L2KB 1J8HE 4XP9H 2HMIC 2DQIH 1FNAA 4MA7L 4RX4D 5I73B 4WHTA 5IB3A 2Z31C 3JWDC 4OGXL 3HNSH 5BS0D 2IQAA 2NXZC 3PWJB 4JPWL 3HI1B 4K3HA 1CLCA 4E0RB 3ARPA 4NN7C 1JBJA 1FE8H 3WUZA 3TWCH 4NWTH 4YC2B 2V2WA 1NUDA 4NO3A 5IM7B 4PJGE 4U6HA 2APWA 5HHVH 1INQA 1QFUH 1JNNL 3QO0B 4J3TA 3EOAB 5ESQB 1WWWX 4DZBB 3WFCH 3FQWA 2X4QB 4KK6D 5SX5K 4H5SB 4NP4H 5GS2D 5TGBA 4Y4KA 5ENWB 3KPMA 5MENA 3KGRA 4JY4A 1I3VA 2D0GA 2UWEE 5J7CC 3D1MC 5F7YC 4K94L 4OI7A 4KJQC 2XY2A 2DRUA 2VABB 4MX7A 4CN6A 4RRPA 1KIPB 3EGSB 4KRNA 2R23A 4OZHE 5ICYA 3UC0L 1M71B 1MAJA 2M1KA 5HHXH 3HR5B 2QADD 5C7XH 3IT8D 3KPPB 5L2KD 4RMUA 3CX2A 2FZ3A 1BD2E 1LK3L 2YPLE 4F7MB 3CVHA 1CF8H 1V3LA 3VFGH 5IVOA 4OJFH 1MCFA 3L5WA 1XGYL 4TULH 1UWXK 3BZDA 4QRRB 2BNRA 4OF5A 1OAUH 3EYQD 3O3AA 3QI9A 4M4PA 1G1CA 2ZG2A 3DMMD 2AABL 5CZVH 4MD4A 4PJXA 1PZUB 4KK5D 4ISVA 3TT1L 5LGHH 1E0OB 3P4NA 4F15C 1E6OH 2XY1A 4P2OD 2F58L 1CN4A 1S9YB 5FYLL 1ZHNA 5IWLC 4D0CA 1QSFB 5L2JA 35C8H 3O8XC 1UH4A 1M7DB 4IBLT 1S3KL 5D7JB 1T03H 1U9KA 4XP5H 2VUYA 1NAKL 5C3LD 4RFNB 3IDJA 5IF0B 4FQ1L 4UT7L 1LNUA 4NM8L 4QRUA 1T7XA 4MHHG 4YNYA 1CFSB 1MWAL 1S7TB 4R8WH 3TO2A 1HYSC 5IB4B 4JY5H 1B90A 1YEKH 1FO0B 4ELME 2J12B 1IEAA 1FZOA 4QRRD 4LRNL 1LK2A 4L9LB 4XCNA 1IBGH 1JPTL 3HLAB 4HXBL 4KQ3H 3WNPA 2ITCA 3KYOB 1EGJA 3C5SA 5FGRA 2CUIA 3GJFK 4NUJB 3MRPB 4JQXC 3BP5A 4PRHE 1U8HA 2APTA 5CINL 4G9DB 3ZLQC 5KANI 3NFPB 3MREA 1A6AA 3UDWC 3MCLH 4XP6H 1ZSDB 2LFGA 3O4OC 3W9EB 1OT2A 1JI2A 1QSFD 2ILLA 4WFGD 4WHTB 4HJJH 3TH2T 4CNIB 4HWUA 2IQAB 1YJDH 1GGBH 4P4RA 2BVTA 1EHXA 4PY8I 2IQ9L 1NCWH 4PRNA 4H20L 3WXWH 2V2WB 3M17A 4NKOB 4LPXA 4U6HB 1INQB 2X4NB 4YXKL 3HE7B 4FQXA 4PBXA 1F11A 2VXVH 1DBJL 2BNUA 4CADB 3VI4F 5CSGA 5TGBB 4Y4KB 1OGAE 2YMXL 1UB6A 4MA7H 4JY4B 3AFLA 4HZAA 4PJ5D 1L4IA 1A6ZA 3THML 4OGXH 3DARA 5L88L 2DLFL 3QPQD 4TNVK 4MX7B 3BOVA 5IB1A 5IMOA 3KYNA 2R23B 3QXVA 2ADGA 5ICYB 3PIQA 5D1XC 1JNNH 5BRZA 2FZ3B 4HAFA 4PRIB 3CVHB 2PCPA 4M7KL 5I1IL 1ZVHA 3L5WB 5DURB 2QL1A 4X6CE 2R2BA 4XPFL 2BNRB 2H2SD 3O3AB 5DJ8B 2BP3A 2WWMD 4OLWL 5DJ2A 3JUZA 5DC9B 4LNRA 1HXYB 4MD4B 5DHVH 4FTVA 1IJ9A 4K94H 4PJXB 4PP2B 2JJTC 4X8JA 4Z5RA 4DAGL 1QYGL 5F7HA 3GBNL 4JDVB 5HDLA 3PHQA 3HE7D 3TN0A 3UC0H 5JOPE 5BS0E 2IBGA 5ETUA 5IG7A 3G6JE 3PP4L 3JXAA 1LK3H 2HP4A 1GGCL 3ARTA 3DETD 5L2JB 4ODUA 3DUSB 1XGYH 2LABA 3A6CL 1WVZA 5DC0A 4JZNA 4ZG1A 3TO4A 2MFNA 5FUCE 3CFDA 4QHKJ 2AABH 5IK3A 3IDJB 4GRLD 3TT1H 4OT1L 4QRUB 4JAMA 4PRID 3TO2B 1QFPA 2F58H 2A6KA 1M7IA 2VN7A 5FYLH 1IEAB 4PJFF 1FZOB 1A7OL 2EEDA 1LK2B 2GJ6A 2VLKD 4XCNB 1A7QL 3SDXF 5L2KE 4IDLA 2BSED 1JIBA 1S3KH 2MKLC 4CJ0A 1NAKH 4P57B 4FQ1H 4UT7H 4HK0A 3RVVC 3O6FC 4NM8H 5IV2A 3VXQA 2JB6B 4HV8B 1ZV5A 1RJYA 4L3AA 4D9LL 1MWAH 2VISA 2F54A 4FRWA 2MKWA 3TESA 3ZTNL 1CFTA 1QBLL 4EOWL 4LRNH 3RPKA 4KJWD 4PRNB 1JPTH 4HXBH 1D3CA 4MQTB 3EZ8A 5HYFA 2APXA 3FQXA 3M17B 1ZLUH 4LCUA 3MRQB 3BSZL 4GJTB 4PB0L 4PJAB 3EYFA 3QZWG 4FQXB 2WANA 4OFPA 1F11B 2NY7L 3BN9C 2BNUB 5CINH 2KUTA 1WAAA 4GAFB 2K7PA 1UB6B 3BIAX 2PXYB 2XQYG 3MRMB 2OI9B 2NZ9D 3IU3A 1A6ZB 4E41B 3O11A 4ELKA 5KG9A 1UYWL 4PJCA 5MEOB 2IQ9H 1KGCE 1SJHB 4H20H 4WNQA 5C6TL 5IMOB 3CSGA 2VLJA 3KYNB 4NQCB 1DUZA 3QFJA 3MLWL 1FBIH 4WV1A 4YXKH 5BRZB 2B2XL 3OV6A 1DBJH 3U7WL 2PCPB 1DZBA 4HIXH 1HQRA 2YMXH 2R2BB 3VGFA 3THMH 2HT2C 3MYJA 4K8RC 1D5MB 5L88H 2DLFH 4BUGA 2IF7A 4NO2A 4FTVB 3WS3A 4X8JB 4Z5RB 4KGLA 3JWDL 1B2WL 2VDML 5MHSD 1CDHA 1Q38A 2VAJA 4R4BA 1FNGA 5ETUB 4NHCL 3UTTB 2PXYD 4M7KH 5I1IH 3M1BA 3FL7A 3ARZA 4ODUB 4QEGA 4E41D 4MB3A 3OAZK 4JZNB 3DX9A 4XPFH 4V2BA 4OLWH 1OM3L 3HZVA 4DQOL 2DICA 3CFDB 5DJ0B 3BD5A 4Z7UB 4NQCD 3T2QA 5IK3B 5T5FL 1UXWA 1MVUA 5T1KD 1QYGH 4DAGH 1NMAL 1CE6A 2X1WL 3QI9C 4PJ5E 3ARQA 3GBNH 4JAMB 1HSAA 1W0VA 2WQ8A 2YC1A 3IS1X 1WLHA 3PP4H 2VMFA 1GGCH 5A3ID 2XWJA 2GJ6B 3V6OA 3A6CH 5I6XC 1BAFL 1ODAA 3QIWA 5IROA 2F5AL 1WC7A 3EFFA 4M7ZB 2SEBA 5EZOL 5BXFB 4XPAL 3LN5A 3MOAL 2W0PA 1ZLVH 3PNWA 1AR1D 3U7AA 3S37X 1GAFL 5JW4R 3BPNC 2H32A 5D2NB 3R1GL 1AGFB 1H3VA 5IV2B 4OT1H 5IVNA 2AERT 1CFVL 2OQJB 3UTTD 1RJYB 3QWQB 4Q97A 2O5XL 2D7OA 4Y2OA 2VISB 2F54B 5IVXA 2IH1A 3RUGA 1AIFA 4XNMA 4X5XB 1CFTB 3OKLA 1A7OH 3MRCA 3C8DA 1GVIA 4M62L 2BX5A 4BFBD 1A7QH 1CXKA 1WFOA 3MLUL 2FO4A 3BO8A 1MLCA 1XH3A 3B43A 1Z0MA 4GAJL 4KHTL 3LB6C 3EYFB 4YFDB 1LDSA 3Q6FA 4YDLB 1JZ5A 1A1NA 3WNMA 3H9ZA 4EIZC 4BFGA 3MR9A 3LN4B 1T1ZA 3SDDA 3QUXC 3G6AA 4GLRH 3VRJA 4D9LH 1IAIL 1X5FA 2UZYB 4G6AD 5F9OL 4BJLA 3ZTNH 2P44B 4ELKB 3MNWB 5KG9B 1QBLH 5CP3H 3UYOD 4EOWH 1QFHA 4PRIE 3TNMA 4WNQB 5CLWA 4M43L 2VLJB 1DUZB 1O0VA 3BSZH 4PB0H 4LP5A 2VLKE 3FJTA 1ONQB 1EAPB 4RAUB 1OCWL 2F54D 5HD8C 4PJHE 1CDJA 3RTQC 3IFPB 2HTLC 1DLHA 3F58L 4GS7B 2WUCL 3L3JA 3KYMA 1ZK9A 4CMMA 3BZEA 1T1YA 2W1NA 6FABH 3RVXC 3GIVA 2J5LC 4WW2F 4NO2B 1UYWH 3WS3B 4BH8A 1BEYL 1BVKA 5C6TH 3B2VL 5IMMA 5IB5A 3STZA 1RZJC 3GHEL 3KVQA 2FBOJ 3OGOE 1OOAA 3IJYB 1FNGB 3FOMB 3MLWH 4KI5F 3TT3H 1NC2B 4UDTA 3U7WH 3ILQC 3M1BB 3ESVF 5H37G 4LKCA 3VFTA 3DX9B 2XTLA 2DWDB 1Q0XL 2QBWA 4JHBA 4OCRL 3IRZA 4C57C 3HE6A 4QLRA 1ZXQA 4WIQA 3OKYA 3HZVB 3MUHL 2VLJD 1MVUB 4GH7B 3SKOB 1B2WH 2VDMH 5C0EA 1T22A 2YA2A 2P8LB 5E99L 1HSAB 1W0VB 4XWGL 2YC1B 5J1TC 1U0QA 4NHCH 4X9FA 3RKDD 4POUB 1BJMA 2D4DA 4RWYL 3TN0C 4U3HA 1IZKA 3ZTJH 4Q6YA 2XWJB 1BFOB 2Q20A 4IJ3B 1MLBA 2MCG1 1WC7B 3EFFB 2SEBB 1TVDA 3LN5B 1LILA 3D18A 5HGAA 5LAXA 1OM3H 2FYYA 4DQOH 4P2QA 2H32B 5T5FH 1NMAH 3TO4C 2Z8RA 4IRSD 1T0PB 1CGSL 2AJYL 3EO1A 4X5LA 4XNZB 1NC2D 4Q9RL 3TF7C 5EU6D 5JIPA 4QNPE 5IVXB 2IH1B 3RUGB 1AIFB 4XNMB 4PJAE 1AC0A 1LEKA 2CRZA 4G6ML 3OKLB 4X6DA 1OY3B 3MRCB 4K55A 2ZSVA 3NA4A 1BAFH 4PGEA 2F5AH 5EZOH 2FO4B 1E4WL 5H8DA 1MLCB 3MOAH 1XH3B 4Z7WB 5L9DL 3NZ8A 5J13C 1GAFH 1EAJA 5ESAB 3Q6FB 3MMEA 4E41E 3CH8A 3I6LD 3R1GH 5ELIA 3MR9B 3RI5K 5FEBA 1T1ZB 3SPVA 1CFVH 1KIQA 1AI1L 3SDDB 5LXGL 2O5XH 3G6AB 2JF1A 4NQCE 5HGBA 1FFOA 5IFAL 2XA3A 2FEDD 2VZUA 2VDLL 4KKCD 3X11A 4M62H 3U36B 3MLUH 4J2XA 5IW6A 1A6PA 4GAJH 4KHTH 4O2EA 3VD3A 4E9LA 2F5BL 5EOCJ 1G84A 1MSPA 4U6YA 2V5RA 3FKUS 1DLHB 1DP0A 4HC1A 4UTBL 3L3JB 3KYMB 4CMMB 1S7RB 1IAIH 3S8WA 4WTXA 1UQSA 3GIVB 5F9OH 4AIOA 2R2EA 3QUYD 4N0CC 4WCYL 3BN3B 4BH8B 4XH2A 5GZOD 3MLYL 4KVCL 4M43H 5DA4A 5IMMB 5IB5B 3N1QC 3KPRA 4GKZA 4ZAKA 1EDQA 4MA3A 4G42B 4H25B 5E6YA 3GZKA 4JG0L 4Z7UE 4PV8A 1OCWH 3MRJA 3CXDL 2C7UB 4JGMA 3RX8A 4WV1C 3F58H 2WUCH 4LKCB 3VFTB 2DIJA 4LDOB 3HE6B 2FX8L 1QSEA 2JJVA 4DGIL 1BEYH 4G9FD 3SGJA 2Q6WA 1TPXC 3ARFA 1YUHB 3B2VH 4UAOC 1IGIL 2ZUSA 3GHEH 4FABL 2FJGA 3BIKA 2XQBL 1S7QA 9CGTA 4Y5XA 2PUQT 5D1QC 5HYIA 5FYLD 2OL3A 5D2NE 4N9OB 5I17A 4MXVE 1KCSL 1JYVA 2OSLA 4OCRH 1Q0XH 2GTZB 3TA3A 1KCRL 3L9RA 5DHYA 5HGAB 5HI3D 2FYYB 5DMKA 4LLVA 3D69A 2H2PC 4PJ8A 8FABA 3H0TA 4K8RL 3EO1B 5GGSA 5E99H 5JPMA 4XWGH 3UPRB 3GRWA 5AZ2L 4I18A 4QXTB 3BGMB 1FCCA 1N0LA 1FYTA 1LEKB 4RWYH 2CR6A 1AGCA 2ZSVB 1RHHA 2Y5TB 1QSZA 3T0VA 5JNYA 4OQTL 2NX5E 1OP5K 4PGEB 3GNML 1EZVX 2PO6D 3OJVC 3NPZB 4HX1A 4MCZA 5C07A 2HLAB 3NZ8B 4APQC 1RZGA 2F8XC 2OBGA 2ZG1A 4X7EC 3S4SB 3GIZH 3MPCA 2MCPL 4ONHA 5FM8A 3B9VA 4N5EC 2AJYH 1CGSH 3SPVB 1KIQB 2B8OT 2DQDL 3JBG7 3H3BC 3SOBL 4LDEB 4Q9RH 2EDNA 1XAUA 1FFOB 4JLRA 3D3VD 4RGNB 4G6MH 1JTOA 1MNUL 1BP3B 4L8SC 1X7QA 4CVXA 1E4WH 1FC2D 5IW6B 1NC4A 5L9DH 4NC1C 2BVEA 1KLFA 2HT3C 1U92A 1NDGB 3QWRD 2NXYC 3L5XL 1AI1H 5LXGH 3MGOB 2RR3A 5IFAH 1AGDA 4OSUL 1M1SA 4GW4B 1HN1A 2ARWA 4JM2C 2R2EB 2VDLH 3ULSA 3U1SL 4R0LC 5LQBL 5EU6E 5GS0D 3IAQA 3P77A 3FO2A 4NNXA 3LD8C 1NBQA 4OBRA 4GKZB 4Y5VC 4GG6F 2BOBA 4KZEL 4MA3B 1VSCA 3L1OL 1N26A 3OHXB 4PJEB 3A6BL 1IQDB 2F5BH 4RDQG 4PV8B 3OQ3B 2NY1B 4RGND 4UTBH 5IVZA 1EGJL 1JHTA 1IKNC 3I6LE 1KLGA 1QSEB 4OLEA 2GSIA 4WCYH 4OIIL 5JW4Q 2R1WA 2Q6WB 3ARFB 3MLYH 1FQ9C 4KVCH 2J88L 1OARL 3S36X 3MJ8A 5HVHB 5IMLB 2FJGB 3RX7A 4PBWD 1IAKA 4WGVB 4LLUA 1KCUL 4LPYA 3KLHC 1XGTB 4JG0H 2OL3B 4QRPB 3CXDH 3FQUA 4G8IA 1KTLA 3TA3B 2OYPA 3BGAA 3L9RB 1NBVL 2FX8H 5DHYB 3RZCA 1J1OL 4I3GA 3VD5A 5DMKB 4U1HA 4L1HA 5JW4N 4IOIA 5GHWH 5F3BB 3D69B 5CAYB 8FABB 5GGTA 1F6LL 3H0TB 1FP5A 1IGIH 3QWOB 5C08A 2JCCF 5GGSB 4FABH 3RBGA 5EBWA 2XQBH 5E6IB 4Z7WE 5HVGB 3EYVA 1FYTB 4AG4L 2NY1D 3PL6A 1RZJL 4GBXB 1AGCB 1BQSA 5JNYB 1J5OL 1CFQB 4ZUTA 1VFMA 5A1AA 1PKQE 1RULL 1KCRH 4MCZB 1BJ1J 2EYRB 1RZGB 3ET9F 2NY2B 3QHFL 3ROLB 2OMNA 4ONHB 3VD7A 1WEJL 1ZOXA 4K8RH 2MTPA 3JSSA 5F1SA 2DM7A 3SDAB 1IGJA 5AZ2H 3M07A 1B0GA 4QRPD 5DVLA 5K59E 3MRGA 4JLRB 1P7QD 3PDDA 1G6RL 4TN9A 4G9FE 5DVMA 3WIHL 5CBAA 4X4YA 4FQIL 3TA3D 3DJ9A 1JZ7A 1X5XA 5FYJU 3TEUA 1A5FL 1AXSA 3GNMH 3EDJA 4ZS6D 3QUZC 1F3DJ 4MYWB 1NC4B 5FYLE 3VGEA 3AS1A 2NPLX 1EHLL 5EH1A 5CEXA 4JHZA 2MCPH 1U92B 5FF6A 4UT6L 2ARJB 3TIDA 5E6ID 3KR3L 3ZE0E 2DQDH 5D6DA 4GBXD 3SOBH 3UBXG 1SMAA 1AGDB 1E4JA 1NCAL 2E3VA 1OTUD 2X1QA 2NY6C 2NZIA 4OLUL 1B0RA 1PEWA 1MNUH 3DXAA 4OTXL 1KG0A 1OLZA 4PJDF 3T08A 2NY2D 4ZXBA 2JJSC 3FO2B 4NNXB 3OAYK 3GEWB 3RWGA 4UUJB 3QDGB 1A4KA 2FNBA 3SDAD 3VA2C 4MHHI 5DEGA 1CTNA 5F44A 1MCNA 3MRFA 1FZMA 3L5XH 5IVZB 1NUFA 3OF6D 4MNGB 4OSUH 4QWWD 3IDIA 2GSIB 2HMID 5MERB 4C54A 3U1SH 3BH9A 3X3GL 2Z31D 5LQBH 5TDPA 3MJ9L 3D3VE 3QNXB 4HKZA 2NXZD 5ISZB 4KZEH 1ZAGA 1IAKB 3L1OH 1PEZA 4L4TE 1I8IA 1EO8L 3A6BH 4GAYB 5IBTL 1HHKA 1UWGL 4ZAKC 1A6TB 4G8IB 1NCCL 2ESVD 4AH2A 3IDXL 1KTLB 1EGJH 4KKBC 4J3VA 3RZCB 1XMWA 1H0DB 4U1HB 4O2FA 4IOIB 4X4ME 4OIIH 1EVUA 4F2MA 2J88H 3CZFA 3QDGD 5C08B 1OARH 3T77A 2EDJA 3WD5L 4KV5E 4YE4H 5EBWB 4NUGH 3S96A 1EVTC 1KCUH 3EYVB 3PL6B 3NCMA 3U9PL 5DSCA 1VGEL 3ZO0A 2ZCHL 5C0CA 4ZUTB 4Y5XC 1UZ8A 2GCYA 3VWJC 1NBVH 3IDYC 1J1OH 4TSBL 1WZ1L 4NZDA 3HG1A 1GC1C 5SX4I 5I66A 4RGNE 5ISZD 1CVSC 3GM8A 3B9DA 2X70A 2XZAL 3JWOC 2EE2A 4FQPA 3LH2L 2GSGA 1IGJB 4OV5A 1IGTA 2IBZX 4U31A 3WMSA 1XF4A 5CIPA 4AG4H 4OAWA 1RZJH 4X4YB 4NO0B 3MV9D 4HWZA 4ZO7A 1J5OH 2UYLA 4PYHA 1U8QA 1AXSB 3EKCA 2HAZA 1RULH 2ZUQC 3GSQA 5E2UH 3IGAA 2IANA 4K07A 3ECBA 4QOKA 3CFKB 2E7MA 3IDNB 3QHFH 5CEXB 5EIIA 1WEJH 1PZ5A 3TIDB 3WIFA 4P3DB 3AM8A 2XZZA 1HEZB 2ICCA 3FFCA 4BFIA 1EXUA 1U93A 1G6RH 3WIHH 3SBWC 3HMWL 4FQIH 3TVMC 4I0CC 3DXAB 4N0FB 1KG0B 4RCAA 3VW3L 2W9DL 1A5FH 5J8OA 4ZXBB 3SCMA 3REVB 2BCKA 4K7PX 3RWGB 1EHLH 1Q9OA 2ICES 5KSBA 3MV01 4WGWB 4UT6H 5DEGB 3KR3H 5E9DB 3MRFB 1ZGLM 4U7KA 1FZMB 1S7SA 4NO0D 4TUOA 1XF2A 3RGVA 1NCAH 1RZ7L 3IDIB 4OLUH 5FGBC 4X9IA 4XVUD 5F72S 4B41A 2AJ3A 4OTXH 1DANU 3KYAA 3ULUC 5TDPB 4QRPE 1D9KC 3WJJA 1SM3L 5ALBL 1NFIA 1P4LA 3PGDA 3OWEA 3AS0A 3CU7A 1TZHA 3B4NA 3C5JA 3TLRA 3C6LA 4MA8L 4L3EA 2E9IA 3VXOA 1HHKB 1P2CA 1VACB 2M8XA 3KPOB 4M61B 3HC4L 4TTDC 5ANME 3MUGA 4DVRL 4JCLA 4KRPB 4KROC 3QEHB 4DTGL 4O2FB 1TETL 4CU7A 3LN9A 3X3GH 2JELL 3T0DA 3MJ9H 4LPUA 2EEBA 3PE9A 4I0PA 1T2JA 4KQ4L 4QKXB 3S96B 5HYSA 5E9DD 2XTJB 1EO8H 5IBTH 5DSCB 1UWGH 2UWEF 3UZEA 5C0CB 5D1XD 3MUZ1 1NCCH 1UZ8B 3IDXH 2GCYB 5B3JE 3DTXB 4UNUA 1AR2A 1FLRH 2E8ZA 3MROA 4RISL 4OZHF 5AD0A 5BOPA 2DJSA 2UVFA 4R2GC 1CDUA 2GUOA 2P5WA 4OZIA 4MAYC 2V2TB 2X70B 4XT1C 1FFRA 1XGPA 2VXTL 3HUJA 4M8QA 3WD5H 3WNNA 3RPIA 4DFIA 4OV5B 2A9ML 5CEYA 4Y4FA 1P6AB 1XF4B 4UT9L 5ADOL 4ZNEE 3W11C 1A2YA 4U1NB 3U9PH 2E7HA 1VGEH 4Z7VE 3BW9A 4HWZB 5HPOA 2ZCHH 4KRPD 3T0EB 3N9GL 1BIHA 1U8QB 3P2TA 4IMKC 3GSQB 2FEEI 1E4XI 3B83A 3DECA 4TSBH 1WZ1H 3ECBB 1NEZG 4QOKB 2ESVE 2NY3B 2WLYA 4POZC 4RMRA 5EIIB 1K6QL 2XZAH 4Z8FL 2XTJD 2XN9A 3LH2H 5GS3A 2FHFA 4PJ7A 5C0AA 4BFIB 1EXUB 1LWRA 1U93B 3X12A 1NCNA 3V6FA 3QDGE 3C2AL 3RNKA 1UEYA 2BSTB 2QQNL 2WK2A 3CGTA 5CWSA 4NFBA 5FYJD 3VCLA 4LFHG 2BCKB 1QO3A 3ARWA 3VH8G 4PIRF 1KTDB 2YRPA 4MNGE 1Q9OB 43CAA 5KSBB 1TVHA 2CR3A 3UCRA 1JMZA 3FQNB 5FGCE 1QBAA 2QQLL 1OAYL 4RMSA 1S7SB 1XF2B 3PWPB 3RGVB 3O6FD 3BVNB 3T0ED 1XGRB 3HMWH 3VXMA 2R56L 5B3NA 2AJ3B 4PP1C 3ZMRA 3VW3H 1P4IL 2W9DH 2E8YA 3ULVD 1NFIB 1P4LB 3PGDB 2NY3D 3KDMA 1N8ZA 1REIA 3ZTJG 2X89D 3C6LB 3MV9E 5BO1L 1WBZB 4F7EB 1J1PL 4L3EB 2IEPA 3SO3B 3VXOB 4Q2ZB 3Q6GL 4I2XA 1VKXA 5CJQL 1IGMH 2C26A 4XX1E 1QHPA 4BA8A 1VFBA 2EH8L 2Y4SA 3MUGB 4HIIB 2BVPA 4BUHA 3CSBA 1UB5A 1RZ7H 3RWJA 1AXTL 3OJDA 4C56E 4HK3J 3OB0H 4GXVL 1A3QA 4YK4B 1SHMA 1YNLL 2IADB 3HMXA 1SM3H 5ALBH 2ENSA 4I0PB 4LASL 2G9HA 3I75A 4YBLC 4MA8H 4PJBF 3ME0A 1HQ4A 2YHGA 1MFBL 3PWPD 5HYJA 3LIZL 3ROOB 5B4MC 5I75B 1EZVY 1FL6B 3HC4H 3PWLA 5LJYH 4DVRH 1OD9A 3BDXA 4DTGH 4NNYA 5AD0B 4N8PA 3D0VB 1TETH 1NQBA 2GUOB 4XXDA 2P5WB 4OZIB 2JELH 5BVJB 3HCVA 1XGPB 3ARRA 3HUJB 4NQEE 2HT2D 3DGCR 4M8QB 1MQ8A 1CGYA 3RPIB 1UXSA 3LAFA 4HUMB 4K7FA 4KQ4H 4LLQB 4OZGA 4X6CF 3CFJA 4Y4FB 5CEYB 2G2RB 3QEUA 1GOFA 5INCB 2PNDA 4YHML 1KB5L 4XX1G 1FPTL 32C2B 4RISH 4JQVC 1QRNB 5EO0A 1EUUA 3E3QC 4J8RA 4KC3B 1FG9C 3G6JF 1JPFB 3M45A 3D85B 5BZDA 4WWKA 2I25N 2VXTH 3Q5OA 4BKLA 5EO9A 1GCFA 2XN9B 4J4PA 2A9MH 4UT9H 5ADOH 3RP1A 1MCOH 4OFIA 1QA9A 5L0QB 3V6FB 3LKOB 3EJYC 3O4LA 3KNBA 4XB7A 3N9GH 4LMQI 4NHUA 5TQ0L 5CWSB 3FB6A 2X4SA 1FAKT 3QP3A 1QO3B 3VWKA 43CAB 2D03L 1MHHA 1K6QH 2X40A 2CIIB 4Y4FD 2F8VA 3SDCC 4Z8FH 3H42L 1GC1L 1F4WL 5D7KE 4J6RL 3JWOL 3LEXA 1U58A 3QEQB 1C08B 2O61B 3VXMB 4GRMA 5FUOL 1M6OB 3C2AH 1U3JA 2WWKT 2UY6A 3IFLL 2DLIA 5FXCH 2WBWB 2QQNH 4OKDA 2XWTA 3RTQB 1QRND 1HDMA 2VR4A 2B20A 2BY2A 1N8ZB 5TPWL 3D85D 3IJHB 5IB2A 4YPJA 4DKEL 1HINL 2XN9D 2J1KA 5HSFA 3SCMC 4I2XB 2FCBA 3LB6D 2YS4A 1KYOK 4EQ2A 4DW2L 2QQLH 1OAYH 5GXBB 1VFBB 1FZJA 4JN2B 4M9PA 1FZKA 4X6FB 1UB5B 2QV2A 4NCDA 3RWJB 2R56H 3IDUA 1I1YA 3QUXD 3G6DL 5J6HA 3QUML 1P4IH 4JY6B 4LSPL 4LCYA 4BM7A 1LQSR 4X6EA 2HTKD 4JREC 1FSKB 3RU8L 5BO1H 5F7UA 1J1PH 4EN3C 2P47B 1HQ4B 3WJJC 3Q6GH 5CJQH 2EE3A 3O2VL 4ZS7L 3QEQD 2ZNWA 4R96B 4HHAA 2EH8H 3PWLB 2BRRL 5GZNC 2PYEA 5HD8D 4NNYB 1JCKA 3RTQD 4P5TA 2HTLD 1AXTH 1E6JL 4URTB 1N3NA 3OSKA 3NIGF 4XXDB 3HCVB 3F5WA 3MJ6A 4GXVH 1HWHB 5F1OB 3RVXD 1YNLH 4QRQA 5F71A 4LASH 3W5NA 1T89C 5KN5A 3QULB 3ULUL 3CFJB 4DOHB 4HGMA 4MS8C 4J3UA 1S5HA 1R5VA 1C12B 4HLZH 1MFBH 2G75B 3LIZH 4ZYKA 3BMWA 3KPQB 3OKNA 3ARYA 1ULVA 4HUXA 4H8WC 1JGDB 3ZKNC 5ERWA 3WHXA 4BSWA 1OQOA 4KHXL 3ILQD 4GG8A 2ZKHL 1MJUL 4J8RB 1IT9L 3TNNA 3KPSA 4G8GE 2MHAA 1U3HA 3VFRB 4WWKB 2IMNA 5SV4A 1TQCB 1LO4L 5T5NG 4L29B 4HS3A 4P23A 4PB9L 1T1XA 3EIFA 5FV2A 5AAMA 2HRLA 3QRFM 4YHMH 1KB5H 3W9DA 1HI6B 1TQBC 4LCWA 3D87B 1X44A 4WEMB 2ZPKL 4NHUB 5H94B 5JZ7C 3FB6B 1FPTH 2X4SB 3MO1A 3CH1A 3VWKB 1KJ2L 3PWPE 3B9KA 2Z35A 3MODL 1JHLL 2BHYA 3VRIA 3H3KA 3NA9L 3QYCA 5AEAA 4PLOB 3V4UL 5EU3B 1EJOL 2J8HA 1GYAA 2AXFA 3E2HB 1VGKB 3LEXB 5ABDE 1U58B 2FSEA 4XRCA 4TRPL 2HFTA 5DC4B 1FHGA 1MEXL 5J06A 5AG8A 5MENE 1D6EA 5TQ0H 1S9KC 2XWTB 2CKBA 1HDMB 3TYGL 4M48L 1PD6A 2XA8L 5E2TL 2D9CA 3JUYA 3VFWB 1JWMB 1A14L 2D03H 4J4PD 1SMOA 2YWZA 2EE6A 4CAGA 1T21B 1GC1H 1NKOA 3H42H 1RVFL 1F4WH 1YDPA 4J6RH 5C92A 5J0BA 3JWOH 1FZJB 4ZFFB 1FZKB 4G8FA 1MELA 4LLMA 1WISA 5HYQB 1I1YB 5SWZE 4JDZA 2QSVA 4NSKA 2N1KA 4RMQA 5FUOH 3IFLH 1A7RL 3OKOA 4OFDA 2B1AL 5GGRY 5J6HB 1MFNA 1RZ8B 3VWKD 1NANH 1UJTA 4LCYB 2BZDA 1PG7X 3EDEA 5TPWH 2XICA 4DKEH 1HINH 3K4DA 2R39A 1TPXB 2LU7A 4UAOB 3R0MA 4DW2H 4HHAB 4NBZB 3STLB 4XZUB 3QDMA 1KTKE 4P5TB 3MGAA 5D1QB 1N3NB 4Y19D 3BPLC 2NW3B 4LCIL 5DTFA 3IVKA 3G6DH 3QUMH 5FCSH 1XR8B 3F5WB 1KFAL 4LSPH 1X5ZA 4PJHF 1LO5A 4QRQB 4N0CD 4KWUA 5KVMC 3DROA 5SWQA 3RU8H 5KN5B 2MQ0A 3NBNA 5KS9F 1S5HB 3DX8A 2V17L 2BVYA 4ZYKB 3O2VH 4ZS7H 3OKNB 1CL7I 3O6LL 5EOQL 4HUXB 1U8LA 1ZHLB 2BRRH 5ERWB 5BZWB 1T3FA 5GS1A 1J18A 4GG8B 4R3SA 3Q48A 1E6JH 3MACL 4XCCL 5DF0A 2L7JA 1JZ3A 3KPSB 4BH7B 3QR2A 3GJEB 2QTEA 2RFXA 1TDQA 3MLZL 2EYSA 1P5UA 4P23B 1PFCA 4HS3B 5BCAA 3PGCA 1S78D 1T1XB 3ULUH 4PJFB 1I3UA 4GUPA 5C0BD 2DLHA 3W9DB 4LCWB 1TZGL 3SDXB 4AY0A 3KYKL 4CDHA 1GGUA 5D1QD 1AP2A 1CD9B 3MO1B 4P46C 3P4LA 4K7PY 5FYKU 2MSPA 4KHXH 2ZKHH 1NBZB 3QEQE 1MJUH 1IT9H 1VDGA 2Z35B 3VXUA 4WI3A 3U9UB 4LLYA 4L8SB 3VRIB 2ICWJ 5F7EL 4C4KT 1LO4H 1ED3B 4PB9H 4OGAD 2YBRA 2H2PD 3IDMB 3GSNL 1PBYA 2AXFB 5JW4M 4XRCB 3S5LG 3IKKA 5CZXC 4OF3A 2E7BA 1D6EB 2ZPKH 5EN2A 2CKBB 1CGWA 2A6IA 2VNCA 5E24E 5KSVA 1YMHA 3DV6A 2D7PA 3V4VL 5FO9A 1KJ2H 4NKQB 4GW1A 4QNPF 4BZ1L 2FDBP 1J05A 1N6VA 3MODH 4PFEA 5HHQB 1JHLH 4R0LB 4APQD 3NA9H 1NAML 1YDPB 3V4UH 1EJOH 5EZJA 4KK8D 4G8FB 4LLMB 4TRPH 4HIHA 1N64L 5HHNB 4JDZB 4NSKB 4IDJL 1MEXH 3OKOB 2PYFB 5GGTH 4HLJA 3SDYL 3TYGH 4M48H 3QDHA 2XA8H 4J3XA 4EIGB 5E2TH 4U0RC 3MV8A 3SGKA 4F33B 3U0PB 4KRLB 4ZODA 5A40E 1A14H 4OLXL 1U8JA 4JRYB 1RVFH 3FCTA 2CSPA 2HT3D 5GSRA 4H1LB 2X4PA 2EDEA 4WW2A 1DBKL 1G7LB 3QDMB 4GOSA 4OCNC 1A7RH 4G3YL 2DKMA 2B1AH 5DTFB 3IVKB 3ARDA 4K3EL 1S7WB 2YA1A 2EKSA 4JM2D 1LO5B 1IILE 1BWMA 3HC3L 3MFFA 4Y7MA 1X6LA 4ZQKA 4PRPA 5EZLA 2QSCL 3DX8B 4UQ3A 4BQ8A 2FHBA 1W72A 2XFXA 3UBXI 1J7VR 1I7ZB 1U8LB 4JHWL 1T3FB 4U1MA 5JW5B 4P2RB 3HAEH 4NYLB 3GB7A 4LCIH 1YN6A 3QIUC 3LKNB 1AO7D 1UC6A 2OJEB 3T0BA 4M7LT 4MJ4A 3VG9B 1NGYA 3PGCB 3LCYA 1GXEA 3DPBA 1CICC 4JRYD 4GUPB 5IHUL 4S11A 2IAMC 1B0WA 3O6LH 1U36A 5EOQH 1H5BA 1AP2B 3KLHD 3GKWL 4CN4A 3SY0B 3LDBC 2VDNL 2WZPD 5FOBB 4XCCH 3MACH 5IJVA 2YSSA 3VXUB 3UTQA 4LLYB 3MLZH 2FH8A 2EDYA 4FMFA 5I1DA 5I8CA 4MXVF 2YBRB 4Y19E 4D9RD 4HJ0C 4XGZA 2DLEA 3LHPL 1M7XA 4EI5A 1ADQA 2COQA 4BSVB 1TZGH 1O7SA 3VI4E 3KYKH 3OXRA 4P2RD 5CBEB 5J11B 4JFFB 5EN2B 4YBQC 5KSVB 3VGGA 1YMHB 3DV6B 4OM1L 3QUKB 2W91A 5F88B 5FO9B 3VXPA 3RY5A 3A6OA 4PJCE 4H8WL 3K3QA 2B1HL 3PQYB 1ORSA 1U8IA 3MRLA 1J05B 2A77L 3QFJE 3I50L 3BE1L 5F7EH 3CXHJ 1RY7B 1IFHL 4HDIA 5DJ6B 1MAKA 3SHSA 3GSNH 5EZJB 4L4JA 1ZT7B 4HIHB 3DI3B 4M93C 5H35B 3V5DA 3RBSA 3PXJA 2EDDA 4I0KA 1OGTA 3WYRA 5KZCB 4WEBL 1JGLL 4UOW0 2IFGA 2HYMA 1DBBL 3MCKA 5AYQA 4FXKA 4RDQF 2HG5B 4Y2DC 3VXUD 4D9QD 5ID1B 3V4VH 4ZTPL 5C0BE 3MV8B 1Y18A 1U8MA 1P1ZA 4BZ1H 3QUZD 2A0LC 1ZANL 2QSQA 4MMZC 2HT4C 1U8JB 3DURA 2J8UF 3RWDB 4UILL 1HXMA 3K8LA 2EDFA 4Z7OF 1NAMH 5GSRB 4MMXC 1WJ3A 3MOQA 4WW2B 3AGVA 4JFFD 1N64H 3N1PC 2W60B 1PJ9A 5FHBL 2R69L 4IDJH 3MBEC 3DV4A 5EG6C 4B0MM 5DXWA 4ETYA 3ARDB 5CUSL 3SDYH 1DE4B 2ERJB 3PQYD 5TFSL 4HUVA 4K3JL 1AD0A 4EEEA 5CIPH 2PR4L 3MFFB 3BI9X 1J9CT 3OKDB 5FO7B 4OLXH 3G08B 4TVPL 3H9SA 4B53A 4PRPB 5I1AA 4OCLC 3K1KC 4UQ3B 3CFBA 1WTLA 4Z78B 5EFIA 4QY8B 5KAQG 1W72B 4CDGC 4WO4C 1DN0A 1RZIB 1U42A 4M6NL 1DBKH 3PUCA 4F7TA 2XG4A 4PJFE 1JYWA 3GB7B 1HILB 2X6MA 1ROWA 1YN6B 3PGFL 4G3YH 4K3EH 2YK1L 1H8SA 4LHUD 1TMCB 4P2YA 3FQTA 3HC3H 2X4UA 2X5PA 5BV7C 2Q1EA 5DD1L 4X9HA 2QSCH 4NJAL 2FX9L 4F9PC 3QSKB 2NY4B 1AE6L 1H5BB 1OTSD 4JHWH 3V79C 4NC1E 3P3YA 1N4XL 3ALWA 4KY1L 1A9EA 4KI5D 4KKBD 2A6JA 3BJ91 3K81A 3QDJA 3RDTC 5HJ3A 5I8CB 5I1DB 1G0DA 3MLPA 3C8KB 4XGZB 2WLZA 2J7LA 3SE4A 4EI5B 3U46A 5FIEA 5IHUH 3FQRA 4Y4HA 5I1KL 3K8KA 4MSWA 1I7UA 4LU5L 3RWFA 2VLRA 3OXRB 3GKWH 3QHTC 2VDNH 1UGNA 5B39G 5EA0L 1UEMA 1TCRB 5FYKD 3ZKXB 3VWJD 3MRLB 4MNHA 1QOKA 1N59A 1CQKA 2J4WL 3FO0L 2VWEC 2DMCA 2ED8A 4LPWA 3I9GL 3FO1A 3DYPA 3HRZB 1DCLA 4DEPC 1V8HA 4UV4L 5DS8A 3TIEA 1YEDB 4R6UA 3LHPH 4JZJA 5CJXA 4YEFA 2NY4D 1OHQA 2BJML 5KTEL 1AO7E 4BELD 2P42B 3EHBD 1OGTB 2OTWB 3AREA 3VXRB 5KSAC 2IFFL 4JRYE 4OM1H 2J8OA 1QRKA 1NCTA 1E4KA 3FMGL 3P30L 5SWSB 4H8WH 1U8MB 4GLRI 5EOCH 3VFMA 2B1HH 5D9SA 2BVQB 3DURB 4LLWA 5F9AC 2A77H 4HULB 3I50H 3BE1H 1HXMB 2AV1B 4EI5D 3R06A 3KPNA 1IFHH 2DF3A 2OJZL 5HGDA 1RURL 1FIGL 4WI8A 3QCUL 1BQUA 1Z3GL 3T8XB 3BDBA 3DV4B 5FM4A 1DQQA 4Z77A 1L0YA 4D9RE 2DD8L 4WEBH 4NT6A 4GG6A 1DBBH 2PW2A 1YECH 2YXFA 4HUVB 1NGWA 3ZE0F 1K2DA 3TVMD 4ZTPH 1AD0B 2VO5A 5EU5A 3HZYA 4ZPVA 5ACLA 1UENA 4P2RE 5I1AB 3H9SB 1ZANH 5T1DL 4HH9B 3QT2A 1CLYL 4JHAL 4UILH 1WZMA 1S9XA 4OLVL 3WXVL 1MJJA 3A0OA 2EICA 3VXRD 5FHBH 2R69H 5JHLL 2BC4A 5FGSA 5SWSD 2CXKA 5CUSH 3OXSA 2D0FA 5TFSH 4K3JH 3WEXA 4RZCB 4FOMA 2PR4H 2X4UB 1OPGL 2FIKA 2ZUTA 1JNHA 4DK3A 1D9KD 4L8CA 4TVPH 3OX8A 3ZDZE 1UA6H 4X4ZA 3IRPX 5INDA 3QQ4B 4D9QE 1L9MA 2DL2A 3LRSA 3G5ZA 4M6NH 1MJ7L 3QAZB 4X6DE 5GIRA 4HSQA 4TTDD 2CUMA 3ZZ1A 3PGFH 2A6JB 2YK1H 3K2UL 3WFHB 3QDJB 3VFNA 4WI2A 4AIZA 5HJ3B 1MF2L 4JFFE 4PBVC 4R97B 4LKXB 4K71C 4DJMA 5DD1H 4LP4A 2QSTA 4Y4HB 4NJAH 2FX9H 3PQYE 4OKVB 3LKRA 1I7UB 1T6VN 4MXWL 2VLRB 3AY4C 1F3RB 1AE6H 1UVQA 5MI0C 1XEDA 3BFOA 3EJJX 3FT3B 4KV5F 4OZFA 4M1DL 5FA3A 4AENB 5F89B 4IMLB 4DKDC 1N4XH 4AEEA 4KY1H 4HUKB 1FVDA 3N85L 2X10A 4IRJC 4A6YA 2WBJC 1N59B 2OTUB 3KXFD 4MJIA 1IC4L 3WKML 4R2GD 4V1DB 6CGTA 1BFSA 3FO1B 4MAYD 1JE6A 5DS8B 3TIEB 1YA5A 4JZJB 5IQ7L 1MRCL 4Q9CA 4EBQL 2BXZA 5I1KH 4LU5H 5T1LD 4JKMA 3U48A 4PRAA 3AREB 3L3KB 5ESVA 3HAEB 3O2DL 4S1DC 4O58L 2WBKA 3QEGL 2ZUYA 4V2CB 5EA0H 1H3UA 2KZ1B 4UDUA 2X1OA 2H3NA 1J0HA 5D9SB 1NH6A 2ZCLL 1SY6A 1MVFA 4ZO8A 3IFOB 1EO7A 1R6VA 3KPRE 2J4WH 1N0XL 3FO0H 3R06B 3I9GH 4Y4HD 4POZD 3BISA 2DM3A 2DYPB 4UV4H 5HGDB 1NMCB 1OSPL 4KI5E 3FHQA 1T5WB 2BJMH 4PJDA 5KTEH 3TZVC 1WBXB 4JANA 1DDHB 1U3ZA 1U8NA 1XCTA 4NKMA 4NT6B 3T4YA 4GG6B 2IFFH 1BBJA 1NGWB 4HLZG 1K2DB 4TTGA 3FMGH 3GSVA 5EU5B 1VFAA 3P30H 3HZYB 1BFTA 1Z9SA 3NCBB 3RNQA 5B8CC 3GSWA 1IAII 3K2MC 5B38B 4KJPC 4V1DD 2ICWA 5I2IB 3LRGA 5E5RB 4JQIL 2OJZH 4QTHA 3EAKA 5FYKE 4LHUG 1MJJB 1RURH 1FIGH 3QCUH 1Y0LB 1TTUA 1Z3GH 2BC4B 1JZ2A 2DD8H 3QJFA 4JRXD 4Z18A 3MLRL 5ACZA 3WEXB 4ZSOE 2FIKB 1IGFL 1JNHB 4L8CB 1AGBB 4HUWA 2IC2A 3OX8B 1WWBX 5T1DH 4ZO9A 2DYPD 5C9KA 3P0VH 3QDAA 1CLYH 5EO1A 2VYRE 4JHAH 2KDGA 3LRSB 4X6BA 4NQTA 1E27A 3BT2L 1VPOL 1EEZB 3MA7A 4OLVH 3G5ZB 4U1LB 3TPUA 3WXVH 3L7EB 5D1ZC 1RJCA 5GIRB 4OCMC 5JHLH 2L7UA 3G04A 1T5XA 5C07E 3VFNB 3STBA 5I74C 4E42A 4AIZB 4KMQA 3G9VA 1S7UA 1I85A 2ZSWA 4C58B 4HCRA 1QFWL 1OPGH 1Q1JL 4XVJL 1WICA 1A1MA 1I1AC 2ENYA 5EULV 4WTZA 1Z6JT 3C5ZA 4BK4A 1R3KB 1TENA 3GBML 4PTUB 1UVQB 3WJLC 3J7HA 2JIXA 3UPCA 2P46B 2VL4A 4OUUA 2VLLA 1MJ7H 2Z4QB 5DJCA 4OZFB 2YUZA 3K4ZA 2KH2B 3KS0J 1Q9WB 3MLSL 1ZA3A 1DVFC 4MJIB 1MF2H 3VXRE 2GT9A 3W0WA 5B3JF 4K9EC 3CNKA 2FECI 4N1EA 1G7PA 1SYVB 5SWSE 4Y5YB 3NN8A 3LS4L 5EIVA 4MXWH 5ICZA 5BV7L 4WEUD 3ULUE 5ESVB 3OKEA 2GJZA 1OT1A 1K4DA 5DRZA 1J86A 2C3GA 3TM6A 4M1DH 2AK1L 3UTSA 1FVEA 4UDUB 4AEFA 3DOSA 3QNYA 4H26A 1A7NL 2H3NB 3N85H 4BZYA 3X14A 1I9JL 4Z7VF 5CMAB 4YR6B 1RK0A 1IC4H 3WKMH 4LLDB 5EDXA 5J9PA 3LEYL 1VENA 4IIQC 5IQ7H 1MRCH 4PJDB 3LPFA 4EBQH 3R0NA 2OX5A 4JANB 5CD3A 1XCTB 4NKMB 4JFDA 1IM9A 3T4YB 1MI5D 5AYUH 4DKFH 1BBJB 4O58H 4KZDL 3EJYD 3GSVB 1BIIA 1BMGA 3QEGH 1YPZA 4O00A 5DYOB 1UJ3A 1HHHB 4L4VB 1I1CA 4MJID 3GSWB 4ZFZA 4QCIA 3RIAF 4I4WA 4XNYL 2ZCLH 5IIEA 1RPQA 1H9VA 1FLTX 1E4KC 1EHAA 1W2KT 4NFCA 1N0XH 4AQ1B 1P69B 3IETA 3WN5C 1OSPH 1K3ZA 1ZLWK 3KXFE 1AHWA 4ETQA 1MCRA 2AAVA 4PV9B 3QJFB 1J8HA 4JGJA 3ZDXF 3V0VA 1AKJA 2AEPL 1ND0B 3P4OA 3CX5J 3FAWA 1MCSA 3BQUA 3D5OF 3FB7A 5EO1B 4GRWH 1K8DA 4JQIH 4FQJL 3WS6C 4KK9C 1RZFL 3FRUB 4TNVF 5D7LA 5DMIH 3MA7B 3T65A 2DQCL 3TPUB 2XKNA 4PJGA 1BHGA 3TCLA 5JLZA 2X4RA 1FIEA 3D39D 3G04B 2P45B 4HWBA 1T5XB 5HDBF 3GMNA 5ITFB 4AT6B 4X7DC 4L4VD 3DRQB 3MLRH 3V95A 3HPJA 4GXUN 1S7UB 2GFBB 3AMLA 2ZSWB 2IALA 1IGFH 1A1MB 4Y1AD 5FO8A 1ZA6A 1UCTA 3MV7D 3TBWA 4KTYA 3C5ZB 2VZSA 4EN3D 3BT2H 1N7ML 1VPOH 4OZHA 2BNQB 3SJVE 1Z9OA 1EJ6A 4YHLL 2NY0C 5DJCB 2AEWA 2D7TL 3JVGA 3CSYA 4PYGA 1BD2A 2HLFC 4JEGB 1XF3A 3GMQB 2F53A 1ZA3B 2ORBL 1FNSL 5DK3A 4OCSL 2GT9B 2CJUL 2O26U 1FAIL 3WBDA 1QFWH 1Q1JH 2Z8SA 4XVJH 3DBXB 1FFNB 1G7PB 3T3MF 4JRXE 1G9MC 1MFAL 3VGDA 4X83A 4OIAA 1DSFL 3GBMH 2BOCA 3ALXA 3OKEB 1FNFA 3UTSB 1FVEB 1U8OA 4UIMB 3QNYB 4H26B 1U8KB 4U1KB 3QCVL 3X14B 5LGJA 3MLSH 3WSQL 1RK0B 2W0LA 4C55A 2BK8A 3BHBA 5J9PB 3V52L 3QQ3B 5J12B 1V7ML 3HR6A 4DUXA 1H3XA 2BNQD 3LS4H 3NH7L 3ARXA 2IPKB 5BV7H 3NOIA 5CD3B 4XNQA 4JFDB 1IM9B 5EBMB 5HTSA 3SE3A 1JWSA 2VSCA 1BIIB 1YEEL 2AK1H 5IT2L 1UJ3B 2X1PA 1JF6A 3U4EA 3VXNA 4ELMA 5JZ7D 1JYXA 1A7NH 4I1NB 4ZFZB 4QCIB 4I4WB 1IC7L 3L95B 5I76A 4PUBL 4S1SL 1LE9B 2IG2L 1I9JH 4RAVB 4NNPL 3UTPE 3IETB 1X5LA 4S0SD 3LEYH 4XC1L 3BMVA 3BRFA 4OLZL 5I30L 4PRHA 2MQ3A 1LP9F 1NBYA 1AHWB 2R0ZL 4ETQB 3UTSD 1KN2L 3UYRL 1J8HB 3D9AL 3MNVA 3V0VB 1FV1B 1HH6A 1AKJB 2QQQA 3X3FL 3O81A 4KZDH 1QG3A 1MAML 2J6EL 1RUQL 3P9MA 3P4OB 3JWNC 5DD0L 4XNYH 3H2WA 4YHPA 3FB7B 2ADJA 3IF1B 2JCCE 5BMFL 1K8DB 4S2SA 1KELL 1V3JA 5D93B 4R7DB 5F93C 2XKNB 2AEQL 5D5MA 1U91A 3JV6A 4JFDD 4WUUA 2X4RB 3T1FA 3E3QE 3GMNB 3NMEA 5T3ZL 1OGAA 5IKCA 4IS6A 2YPKA 4XMPL 1SEQL 3GMPA 1A1OA 4S0TD 2AEPH 1P84K 3WLBA 2IALB 1RFDL 3D48R 2CGRL 2CDGB 2UWEB 2JJUA 5DEFA 5FO8B 3JV0A 1MI5E 1JUFA 4M6OL 3K7UA 4FQJH 3QXDA 3J8F7 1RZFH 4U1JA 4OZHB 2DQCH 4WU5A 3U30C 5D70L 2B39A 3CSYB 2E7CA 5T5NF 1BLNB 1IL1B 1BD2B 4I77L 4Z95L 2YPLB 1FFPA 2YN5A 2XACC 3P9LA 3QJHB 1RQ5A 5I19L 4JM4L 1GOGA 3WFBL 4WFFD 2R2HA 5D2LF 4U3CA 1R3HB 4RX4A 1N7MH 2ZOLA 4LCCA 4YHLH 5BS0A 3DX6A 2D7TH 4E5XB 3G6JA 1A02N 2AQ3A 2EKJA 2ORBH 4HG4J 1FNSH 3BHBB 4OCSH 2CJUH 1FAIH 1CTOA 3D39E 4YZFF 3PP3K 3GGWB 5LG1A 1U3YA 2XIDA 1MFAH 4LVEA 4ERSH 1ES0B 1DSFH 4JJ5B 4YH6A 1IAMA 3LKSA 3ARGB 4Y1AE 2YPLD 3E6HA 1IMHC 3MV7E 3BRGC 3VXNB 2FL5A 2HJKA 3P9WB 4P46D 4LAQL 3QCVH 4IEFB 1SVZA 3WSQH 5L2KA 2QHRL 3ILPB 1MCWM 3V52H 1H3PL 1V7MH 4KDVA 1ACYL 2DQHL 1NBYB 3NH7H 3PWJA 3N50A 4FQHB 4HZLB 4K9EL 3PV6A 3MNVB 3DMMA 3GSXA 1HH6B 3LVEA 1V7NL 1YEEH 5IT2H 2DBLL 3EO9L 5ESQA 1IC7H 3GO1L 4YHPB 4PUBH 4DZBA 4S1SH 3WFDL 2IG2H 5HI4C 1W0YT 2R9HC 2X4QA 4P2OA 3RX5A 5DUML 4H5SA 4S2SB 4NNPH 3S4SG 5ENWA 3ZYZA 2N56A 1OVZA 3G9AB 4XC1H 2EC9U 1MY7A 4OLZH 5I30H 3JV6B 3ARGD 1CL7L 2W0FA 4CN1A 1H8OA 2R0ZH 4N1HB 1KN2H 5CGYC 3UYRH 3D9AH 1OGAB 5IKCB 3MRBA 2YPKB 3X3FH 3GMPB 1MAMH 2J6EH 1RUQH 4PJBB 3WLBB 3W81A 1F5WA 4YHZL 3KPPA 5DD0H 5DEFB 4LVHB 1KXQE 2VQTA 1HOCA 5BMFH 4RBPH 1KELH 3BQUC 1G9NC 1NPUA 2DQJL 2AEQH 3HTLX 3WCYA 5JXEC 4PJXF 3IXTB 1FFPB 1QLRB 3P9LB 4HFWA 2AP2A 5T3ZH 4X6CB 1UM5H 2E9WA 4XMPH 1SEQH 4XVTL 1SJVA 3GKZA 3H9YA 2R2HB 1G7MB 1RFDH 2CGRH 1TNNA 5F96L 2LAAA 4EDWL 1S9YA 1FRGL 5E8EB 3T4AA 4M6OH 5E56A 3L7FB 3U4AA 4K3DL 4U1IA 5TH2A 4RNRA 5HYSG 1G1YA 1WV7T 4M1CC 2ZOLB 5IHZA 3ESUF 5BS0B 2YD1A 3DX6B 3BPCB 4TVPE 3BPOC 1C1EL 5D70H 4UIKL 3G6JB 1AGEA 3B9AA 5KVFL 4I77H 4Z95H 1JYNA 1CG9A 5C09D 4BYHA 3JVGC 5I19H 3CLEL 3G5YB 4EZMA 3WFBH 1CFSA 2OXHA 3QIUD 1ORQA 1S7TA 2APFA 1JGUL 1II4E 1FO0A 1GGIL 4WDIB 5FA4B 4PJ5A 2X4OB 1WT5C 1CICD 3HLAA 1NCDL 2IAMD 4I48A 1RJZA 4RGMC 1CXLA 4MZ2A 2HJKB 4OIBA 4YHYC 3MRPA 4MA1C 2VXVL 2QADB 4MCYA 3TBVA 1ZSDA 4Y2DB 3W9EA 3UJIL 3HS0A 4N68A 4CNIA 1IEBA 1GJIA 4TSCL 4BQ6A 5JOPD 3MV11 2Q86A 3PV6B 4WFFE 4JO3L 1G9ML 3DMMB 3GSXB 5TDNA 1T04A 1EBPA 2I9TB 1UKTA 4NKOA 2X4NA 2QHLA 3SE3C 2FJHA 3HI5L 3HE7A 4LAQH 5GGRA 1QR1B 4CADA 5I1EL 4P2OB 2KL6A 3QISA 2QHRH 3NCCB 1S9VA 4UOW1 1XGUA 4PGBA 3CXHK 3Q2CA 1H3PH 4Y16C 4CW1A 5HYJE 3SQOL 1ACYH 2DQHH 2W0FB 4K9EH 2X7LA 3B8YA 2LAGB 3L3OB 4U0QB 3MRBB 1L0XA 4WO4B 3LPWA 1V7NH 1QLEL 4GRLA 2DBLH 3EO9H 1C5BL 3GO1H 4Y2DD 1Y6KR