2HT2C

Structure of the escherichia coli clc chloride channel y445h mutant and fab complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Synergism Between Halide Binding and Proton Transport in a CLC-type Exchanger.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 37
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht2C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ht2C01
3RWIB 3BJLA 3VE0A 3O41B 3L5XL 2CLVB 5D70H 3CAFA 2PCPA 1I7RB 2FWOA 3K4ZA 4R7DA 4WDIB 5DJ0B 4V1DD 1ZE3C 1BD2D 4YWGH 2HFFB 5F88B 1HI6B 3HZVA 1AD0A 4EOWL 1E6OH 4JN2A 3CCHB 1ZV5A 3BO8B 4F57L 5IVXB 4L3AA 4UB0H 3ULUL 1I1YB 3C8DA 5JXEA 2AV1A 5I2IB 3QXAB 4Q9QL 3CFEA 5JPNA 2OXHA 1J0IA 1U8OB 1WIUA 2HWZH 3S4SG 2KPNA 4LPVA 4ODHL 4JVUA 4DVBB 1DFBL 1DBAH 1S7UB 4M5ZH 3O4OC 2YBRB 4X7CC 1EO7A 4FTVA 1I9JL 5J6HB 2QTEA 4BFBD 3CVHH 1G7HA 4ZXBA 5HY9A 1NSNH 1MELA 3VFSA 2KL6A 4O5LL 5AD0A 2KZ1B 3VH8A 5L88L 5IKCB 3HA0A 1E6OL 5KAQG 3I2CH 2Z31D 3SKJL 5DURB 5FO9A 1MSPA 1GAFL 2NY0B 4MNQD 4UB0L 3HZMB 4JHWH 5I75C 4Y5YA 1RIHH 1YY9C 2A83B 3O2WH 1MFDL 3TV3L 2XV6B 3PV6A 2IALB 2IC2A 4URTB 1LP9E 2H32B 2V9RA 4V1DB 2OYPA 1BD2B 5L6YH 4RWYH 5GPRA 4BYHA 2NTFB 3MA9H 3VD3A 3W81A 5L8LB 3LEVH 3HNVL 2DBLL 1XGRA 1EERB 2ZKHL 4UTBH 4JEGB 2EC8A 3VWKC 3RPIB 2BRRH 5JORB 2FEDD 2COQA 3A6OA 4ORGB 2EECA 3E3QE 3LN9A 4NM8H 2CLZB 1C1EL 4OGZA 2V9QA 5L2KA 4I13B 5F21B 3NFSL 4I3RH 1UYWH 1R24A 3IKCA 3O9WD 5HYSG 3I2CL 4AT6B 2BOCA 4Y89A 5F1OB 4HKZB 4Z95H 1KJMA 5ICXB 4KPHL 3NCMA 4UNUA 5IP4A 4H5SB 5C0AA 4U1KB 4JHWL 1GHFH 4ORZC 1S9KC 2XOTA 5IV2A 4WFGD 2DQUL 3U36B 4KZDH 3GSQA 4XTRC 4CNIA 2ZG3A 5D7KE 4YIQB 1O7VA 5KN5B 5DMGC 1TVBA 3O3DA 1H0DB 5L6YL 2AXGB 4MA3A 4DUXA 4JY5H 4UTAH 3MV7E 1BHGA 3Q1SH 3RZCA 2Z31B 3JWOH 1CDIA 5DVKA 2L7UA 3VG0L 4P2OC 4MNQB 3PWLA 2J8UA 4NM8L 1B0WA 4NZDA 3FQXB 4PBXA 1KJVB 1ULVA 4NN5B 4HK3J 2VITB 4F2MA 1KEGL 5DMJB 3EZJB 5KTEH 1Z5LB 2ATPA 4X6CA 1OGAE 1RZKH 3GMMB 1U8JA 5DSCA 3ECBB 1AXSA 5D96C 1EHLH 3V4UL 4P4KA 3WLWD 1INEH 3CX5K 3VFOB 4GG6E 1U8NB 1WCQA 5EZIL 5F7WC 5JNYA 3VXNB 2NX5B 3KNBA 3DVNB 1DUZB 2GKIA 1Q0XL 4U0RB 4WHTA 4TVPD 5EDXA 3UTTA 5I30L 5TE6H 3GHBL 2OX5A 4QGTA 2J5LC 4XHJC 3Q1SL 2K3TA 4KH2A 4L8BB 3OXRA 2HT4C 2CIKB 1RD6A 2NW3B 3SDDD 4B7LA 3ESVF 3P73B 5DZNA 4Y2DD 4QRRE 3P4MB 3QRFM 1FDLL 3RWDA 4EQ2A 3T2NH 4L1DA 4BFEA 5C0EA 5CIPH 5IHLB 2J6EH 2AKRA 5KTEL 1KCSL 5C7XH 1CWVA 5IBTL 3TLRA 4Y19B 5IB1A 1RZKL 3LQZB 3S7GA 3SQBA 3PNWB 2EO1A 2ZNXA 2NY6D 4WHDA 2VWEC 1MWAB 1F8TL 3GM0A 1HKLH 3GKWL 2Q8AL 3PHOA 3DOSA 4GSDL 4NKQB 3OG6B 1CE1H 3X3FL 2RAMA 1OP5K 5TDOA 3K1KC 3LZFH 3Q3GA 4HD9A 1FVEB 2ATKA 2FHFA 1HZHH 2BNQA 3MRDA 3QIUA 2GY5A 3GJFB 1UCBH 5F7LB 4U1GC 1BQHB 3QUXA 4XT1C 4N5ED 4OQ1A 3RWHA 1MHEB 3DMMC 1WEJH 3QRGH 4NQXB 3VGAB 1P7KA 4PJ7E 2EE2A 3LAFA 4JKPL 5B8CC 3HI1A 3FFDB 1FJ1A 2QV2A 3L95B 4O02L 4PJ5E 3B83A 2EDRA 3IJHB 2R4SL 3ARVA 3MODH 3RGVC 4KTYA 4IS6B 4S1DC 1DR9A 5C07E 1WC7B 4N8PA 1PQZA 2FO4B 5B4MD 5ERWB 2YPKB 2YUWA 1RV6X 1CE1L 4Y1AE 1S7WA 1FFOB 3SDDB 5EUOF 4H8WH 3IFNH 4Z76A 3U4BH 2V2TA 2ARWA 2RFXB 4Y2DB 2QQKH 3MNZB 1BOYA 5ALBL 3DUSB 4X4YB 4Z18A 5DMKA 4JO3H 3QXVA 2VLRE 1AO7E 1D9KA 5GS0H 4H26B 4LL9A 5DD5H 1MUJA 3DXAA 3S35X 2IQAA 3IAGC 3ZYZA 3HAEG 5DC4B 2NY6B 4XP1H 2X09A 4YAQA 4WFHE 4F7MB 4DWHA 4JQXC 3MLYL 2HT2D 4FFZL 5DQJA 4HFWA 2FR4A 1FC2D 2J4WL 3GMLB 4XB8A 2YD5A 3DX6B 4X98A 3O3EA 2YZ1A 1B2WL 1N2RB 3DX8B 4JM2F 4NZJA 3MODL 1JHTA 5IMOA 1P6AB 3GKZA 3TO2A 4P3CL 4PGJA 2Y07L 3KYMA 1OAZH 4X7EC 4X8XA 3TEUA 1J10A 3F58H 1OP3K 1JWMB 3ULVE 3IFNL 5TDPA 3HR6A 1U3HA 1CFQA 4RAUB 1NFDA 4BKLA 3SBWA 4JO3L 5DK2B 3DIFB 4KRPD 2Q6WA 1PLGH 2YPVH 3QH3B 1E6JL 1P53A 5HHOB 5EZJA 5KZCD 2BCKA 5DD5L 1KCRL 3QHFL 4QRQB 3QT2A 1KXVC 2Q86B 4J4PD 2FEEL 1ADQH 2ORBL 4P49A 2OL3L 4JO2H 4PJAF 4X4ME 1S9YB 2CK0L 4OI7A 3H9SE 3JVGC 1ZOXA 4GAJH 3BE1H 1E28A 3QCTL 3BD5A 3QJHA 4F33A 4D3CL 5MI0B 2BOBA 4DQOL 1A1OB 3UXFA 1T83C 4JFOA 5F8RC 1MRFH 5DD6A 1BP3B 5B38B 3AB0C 3MO1B 4G43B 1WZ1L 4PJHA 2BVOB 1OAZL 3MOAH 4GRMB 1R0AL 4ZAKA 2EEBA 5CZVL 2V17H 4LF3A 3HMXH 2NY7L 2V5YA 3F58L 1T89C 3IDJA 5EOCH 1JWSA 3QDJD 3KPMB 1V3KA 1HIML 3BAEH 3GBLA 1YYML 1MI5A 1V3JA 1WLHA 2HH0L 3KAAA 4GBXD 3UO1H 1DDHA 1KC5H 2X6MA 1CXHA 1UM5L 2F54E 4X6EA 3OXSB 5FA4B 1I75A 2X9XA 3KPRA 3P0YL 4NC2B 3L6FB 3GUTA 4Q58C 5A1AA 5FYKD 2R0KH 3SDAA 5D8JH 1H5BC 2FL5A 3B3IA 1YNLH 3S35H 3STLB 4W4OA 1SY6A 3BE1L 3QQ4A 4MGXA 1IC5L 3VWJC 3UZQA 1YMHB 2VL5A 1HSAA 5T1KA 1JHKL 3E2HB 1FZJA 1G7LB 1MCEA 1YPZA 2V7HB 4KRPB 3FAXA 4KI5F 1EH9A 4FQXA 5LXGL 4GW1A 1TJIH 3LRHA 1LEKA 5KZCB 3HPJB 1MCRA 1A47A 1FGNH 3OX8A 5FOBB 4M1CC 4BSVB 5J9PA 2B4CL 5EOCL 3FB7A 5E4EC 5I17A 1QYGH 1LEIB 1KPVB 1RZJC 5BVPL 4TOYL 3DTXA 2ZUWA 4Y5VC 3N1PC 4P4RA 2PTUA 2OL3B 1SHMA 2LU7A 4OFPA 4KVCL 1NAML 1PFCA 1MCWM 1ZVSA 5EUKB 1DL7H 4HWNA 4JM2D 3QQ9D 2AV7B 3C6LD 1FPTH 1I1AC 4P57B 4FZ8H 5B39A 3VG9C 3ESUF 3GGWB 1Q94A 4P46A 1CIDA 4YPGB 2FIKA 5CZKA 3VI3F 4IRZL 4HUWA 4YFDB 1LEGA 3QDJB 3C5ZA 5BOPA 4G6JL 4JAMA 5SWZD 3WUWA 2EEDA 2ICCA 4NKDB 4ZDHB 3VXUB 2DM7A 3F12B 3FONB 5IBUG 2WUCL 1MCIA 1VACB 4WWID 4PGEB 2YD7A 3KPTA 1IEBA 1TJIL 3P30H 4O2CA 3WD5H 1IC7L 1FGNL 1E0OB 1YY8A 4G6MH 4X6FB 5DRZA 1IE5A 1JMZA 1MCWW 1S9XA 4RMQA 3WXWH 5HHQA 4H88H 2X70A 2O5XL 1SYSB 3A67L 1KN4H 2VDNL 4HGWB 1GPOH 5BMFH 4H1LB 5EUOB 5D1XC 1YYLL 1I8LC 3TIDB 2DLFL 4M62H 1JN6A 4CN4A 1UKQA 5HD8C 1YEHH 1IGTA 4M7LH 5C70A 4JFYA 3SDXF 1CDBA 2HKHH 2X89A 3SDYH 2W92A 1RAMA 1G0DA 4XXDB 4OAWA 1J86A 3MRRB 2IJ0C 1SJHA 1X5KA 2R1XB 4P2RE 3IETA 2WWMD 4GUPA 2D31B 2VZ1A 4D0DA 4QCIA 3UZVB 2LTQC 1MREH 2OTWB 1A6UH 5CSZB 1KCKA 4KQ4H 4ELKA 8FABA 4JRXA 2HJLB 2AVGA 4JM2B 1N5AA 2N7BA 2HFGL 4LRNL 5TQ0H 3QPXH 2VO5A 4WJ5B 3C6LB 2IPUK 4UILH 1KFAH 3SE4C 5BW7A 1NKRA 4GKSA 1UA6L 4W68A 5IB2A 2XTJD 1NAMB 3WNOA 3MLUL 3MJ8B 4XCNB 3ZDXE 5FO7B 1DJSA 1KN4L 3V0VB 3O8XC 4LLVB 1A6WH 4FFYH 5FIEA 2HRLA 4XBPA 1NGPH 5SWZB 1M7IB 1U8QA 1VENA 4L9LB 1BIHA 1AFVL 1MVFA 2FX9H 4OZHE 5GS3A 3ARED 3OJDB 3PHSA 2B20A 4KTDL 3T0BA 4KI5D 5I76A 4A6YL 1NC2A 5H35B 3EBAA 3RNKB 3OV6A 4K3GA 5E5MA 2FECL 4NNPL 3MLTA 4TUKH 5LWYH 3MJ7A 3SJVE 4MJID 4PJAB 5IMMB 4PRBB 3EDJA 3EJZD 5E8EA 1BFSA 1HK6A 3J8F7 4N8VB 5DK3A 3QIWD 1B0RB 1TJHH 1JGUH 1F13A 3AVEA 4LDOB 3P0VL 1MREL 5MP6H 4W6YB 2XIDA 1FGVH 1CE6B 3HUJF 4KQ4L 4Y4HD 4ODUB 1RHHB 3BPOC 2GTZA 5DJZB 4F15B 2GT9A 4KJYB 5HGAA 3EYUH 2BVEA 3GEWB 5I19H 4K3JH 3CDYA 4QXGL 3ARDA 4HJ0C 1M7DB 1IKNA 5D9SB 3BUYA 4PYGA 1A6WL 4YFLF 1NGPL 2EDEA 3RFZC 4ZTOH 4BFGA 2C3XA 4F3FA 3F6IA 3ZHDA 4JFQB 4NRYA 1QR4A 5E9DD 1L0YA 4JGJA 4D0CA 1XCTA 4GBXC 5DT1H 4QOKA 2XZQH 5J3HD 4TUKL 4XMLH 4HCRL 3QNXA 3P9MB 5HSFA 2XTJB 3V52H 3OTTA 1BZ7A 3L3JA 3ARYA 5DFWH 3QO0A 5CGYD 5T1MA 4D9QE 1UQSA 1RZFH 3K2UH 4JPIB 1OTSD 2Q3ZA 4N0CD 4OV5B 5F7EH 2F53A 4U1JB 1W8OA 5C2BH 5GZOD 3EYUL 4OFDA 4KXZH 3L3GA 5FUOL 5D71H 1J0HA 4FQHA 1S7XB 2BY3A 3I6LD 1KIQB 4ZFGH 1J0ZA 1J8HA 1JYNA 4MJIB 4Y4FC 4A6YB 1NLBL 2DQTH 2OZ4L 4LCYA 5FA3B 1U8MB 2P24B 1T21B 3MPCA 4CN1A 3E8UL 1T4KA 1I7TB 1NJ9A 1XCQA 4J8RA 2VH5H 4TPRH 3VXMD 35C8L 3MRHB 1JPFA 1T6VN 4MJ6B 3HE6A 5ACZA 1I3UA 3L1OH 1BJ1H 2OTPA 2D9QB 2XZQL 5MEQA 2OM5A 2R2HB 2VDOH 4L8SB 4LIQH 3RKDD 4R0LA 2QKIA 3WBDA 1U93B 1P7QA 2YD9A 3WEXA 3GSXA 2DWDB 3D0LA 3EDDA 4DN4L 3GSVA 3JV6B 3K2UL 1JZ7A 2BVPB 2OSLB 4BK5A 1PVHA 2VDMH 3NTCL 4C83B 1F42A 4M6NL 4NBZB 3QIBA 1LD9B 4MVBD 4UAOC 3VXRA 2B39A 5E9DB 2V5SA 1DLHB 3BH9B 1NBVH 4E5XB 1WFOA 1S7RB 1HHKA 5CWSA 3RUGF 3MREB 2P8MB 4EN3D 4N0RA 1DQTA 3PL6D 3RVVD 4NKMB 3CFJA 3KXFD 1DANT 3QULA 2A74A 1ZGLA 1SEBA 4LLWB 3G04A 3L7EB 3QFJD 4G7YH 4R4NC 1R3JB 1S7TB 2UVEA 2YK1L 1FNGA 1QPXA 3RL2B 3L1OL 1QSFB 1FNSH 3K7UA 3ZLQC 2VDOL 5GGVH 4LKCB 4HT1H 3QUMB 2WBJD 5KSBF 1JRHL 3VGEA 4QY8B 2N7AA 2Y06L 2ZOLA 3V6BR 3CJJA 3SDXB 1I9EA 1RQ5A 3RWCA 5HPMA 1TIUA 3TVMC 3Q6FB 5A2IH 3NFNA 5C08D 1OAQL 3C87A 1OP5H 3VXMB 4KJQC 4U0QB 5FCUL 4K3DH 4U1LB 4POYA 5JOPD 2XN9D 4JJHA 5D1ZA 4LVNC 2AW2A 5HGDA 1GIGL 2D7QA 1I85C 1UH3A 3CSYB 5FB8B 2IEPA 2PYFB 3QDHA 4I1NB 1FE8H 4HX1B 4WUKH 2DL2A 2X4PA 2KZWA 4KHXL 4U7KA 3NIGE 4ONFH 5D93B 2FJGB 3IFPA 3ULUE 1NC4D 1I7ZB 5ICYA 5GGVL 4ZPTA 4L3EE 1JZ4A 1U9KA 2VR5A 4YE4H 2CSPA 3VFPB 4Y5XC 2NZ9C 1DQJA 5DDHA 5CGTA 3FOMA 1N5YH 3MRGA 5HJ3A 4EN3B 3PL6B 3KXFB 3TA3A 4K7PX 3BDBA 5GS1C 3ARZA 4ODVL 3THML 2XFXA 4MA8L 5T33L 1A14H 5I6XB 1R3LA 1UGNA 1W0WB 2PW1B 1LGVA 1NDGB 3HUJB 1KJ3H 2QBWA 1SY6H 1G6RL 4ZUWA 4R97B 4V2BA 1IM9D 4MNHA 4Z7WA 2WBJB 4NN7B 1A0QH 1JIBA 4AIOA 4WUKL 3SDCC 3LDBB 4YR6A 5T3ZL 1H3VA 3MV8A 1CLYL 2Q76A 2H9GB 4TSAL 1MRCL 3CVIH 3FRPG 3SGKC 1ZVHA 4IMKC 4NQCD 3TGXA 3BGMB 1Q9WB 5C08B 3H8NA 3X14A 4AENA 5D7IE 3WJJA 4APQD 4NNXB 1I8MA 5GHWL 1GGBH 4KROD 3V9FA 3P4OA 1MFEH 1NH6A 3OQ3B 3RPKA 2ADJA 3ZTNH 3D18A 2XQYG 4C56A 3VXQB 1DANU 3EOTH 4XPAL 3RU8L 4QXUH 3HE7C 1OVZA 1KEML 4K9EL 1R5IA 2NX5E 4YDIH 1UM6L 32C2A 5IQ7L 1DQQB 3MRFB 2X4NB 3REVA 2XPGA 4MJ4A 3AS1A 4UOW1 3U1SH 4HKJA 1MCPL 5EFIB 4POZC 3P77B 5D7SL 1NC4B 2DB8A 2VQ1B 4N90D 1HXYA 2YD8A 4LP4A 4RDQF 3PWPA 5DJCB 4ODBD 4ISVB 2FH8A 1YQVH 5SWSA 1A3LL 3ULVC 2JF1A 3TT1H 2P8LB 3IDMA 1DTUA 3VXSA 3T08A 4QRPA 4NQSB 2B1HL 4G8FA 4X6DB 4I0CC 3LEXB 4PJFF 3ZT6A 4Y19E 3T4AA 4IRJA 5DEFA 1X3DA 2IMNA 1G7PA 3EOAA 3NACH 1CG9B 4ELMF 3U4AA 4HIIA 5E6IA 4KY1L 2JIXA 4QXUL 1K8DA 2OCFD 1YN6B 4RRPA 1T2QH 5FYKU 1G6RB 5ECJE 3ET9F 4EUPA 1NBYA 1F02I 2FH6A 4YDJA 4EZMA 3B2UD 4K7PH 1QQDB 1J05B 4M1GL 4EVNA 4X7SH 1K4CB 2GITA 3RWJA 2YA1A 3V7AE 1NBZA 4HIXH 1XF5B 3PIQB 2DKUA 3JWDL 3TBVA 4APQB 4HS6A 4F9PC 4LLQA 4OLEA 2BY1A 4KROB 3OKOA 1YQVL 1BQHG 1LE9A 5F7DA 5CMAB 2R0LH 1JJUA 1Z0NA 3BGFC 5DUML 4LSRL 3IJSA 3L9RB 3VCLA 3QEHB 2UWEB 5C09B 1GGIL 1J9CT 3OKDB 3V79C 1HHIB 3IF1A 4MZ3A 1YJDC 4YGVB 4AMKH 3MZTA 4ERSL 5CEXB 3EHBD 4KKAD 3CFBB 1T0PB 3HG1A 3MBEC 4KKNA 4CU6A 4PR5A 1ZHKA 1J0KA 3WS6C 4CL7A 3WNLA 2AJUH 5EOTB 4PJBB 3GK8H 1SVCP 3T0VA 1DE4B 1ZT4A 2PO6C 5KSBB 4UQ3A 1WBYA 5TGBA 1AQDB 4U1MB 5KOVC 1CFNA 4BQ8A 1JGVL 5EN2B 3VFTB 1NUDA 2IADB 2VUYA 3W11C 3O2DA 5BO1L 1W72L 5HYQA 4NQDA 4KK9C 4YHOH 2UYLB 2A9NL 3QEUA 4IDJH 1FYTD 4HV8A 4JG1L 2EH7H 5E6ZA 2V5TA 3OGOE 2IAMC 2IFGA 4R4BB 4K2UL 4E41B 4LEOA 4NZUH 4R2GC 2XKUA 3TPKA 4JHAL 3TFKC 4DEPB 12E8H 1QHOA 4O00A 4PRDB 2VLJA 4X4XB 3CDGB 5DD0H 1I9RL 3N1FC 3S88L 4XH2B 3OHXA 2CDFA 3KYAA 2PTVA 1IQDB 3I9GH 1UKSA 1FSKC 1UXWB 2E8YA 2LV4A 5D7LD 1JI1A 1ZHLB 2F58L 3BPCB 3A6CL 5EPMA 3B5HA 4XPFH 4XCYB 3X11B 4PLKC 1V5JA 5GRZA 3NN8A 4P2QE 1MCBA 3C8KB 3SO3C 3BZEB 1FG2A 1CFVL 3WSQH 3LCYA 2HT3D 2OBGA 3RDTD 4M5YL 3MGTA 5HHOE 3DSFH 4YHOL 3VRIA 1DCLA 1XT5A 1VFBB 2EH7L 3QNYA 4JRYD 1FFNA 2JELH 1MQ8A 1GZQB 4E0RB 5I1LB 3HPLB 3QSKB 3ILQC 4XP4L 3SE8H 4NWUH 3U2SA 1Y0LB 3STZB 4GFTB 1WIPA 1PY4A 5FYLD 3T0EE 4FXKA 1MQKH 5GRXG 3RVXC 1HHHA 3DHMA 4HIJA 4FFVD 5B38G 1XFPA 3PDDA 5SWQA 1KT2B 3QO1B 1FYTB 3WNKA 3WFCH 5BVJB 2P7TA 1HDMA 3OPZH 3QDMD 2BVQB 1IVLA 1F4WH 2VE6A 1W72B 2Y5TB 4PRNB 1D6VL 4RGMB 5HVWA 3OR6A 3BPNB 2QSCH 1GJIA 2R29H 1VGEL 4P9HL 5JHLL 4NO0D 5CEYA 4QRUB 3UTQB 2R23B 1UZ6F 3LN4B 5AZ2L 4LDEB 3C08L 3RP1A 1CR9H 2PYEA 1CXIA 4LCIH 4Z7NF 2W65A 5D7LB 4WW2F 5GRWA 1NGZB 5CD3B 2HG5A 3S34H 1KB9J 1OQXA 1N4XH 3R8BB 4DGYL 1I1RA 2BX5A 5F7UA 3L7FB 5DI8B 1MQKL 3UDWC 3TH4T 5FK9B 1PAMA 4ZUTA 4U2YA 4B50A 5IJVA 1VCAA 4P2OA 3B9EA 3P9LA 2X4SA 1HILA 4I2XB 4TQEH 2X2YA 3ARGC 4JRYB 4PJFB 4M1DH 5JR1L 4Z7UB 3IB4A 5GIRA 4X4ZA 3EDFA 4OFKA 4M9OA 3KYOA 4NCC2 2MWCA 3QJFB 3NOIA 2XNAB 1IL1B 3FO1A 1U8LA 3KJ6H 3TCLB 4IRSD 5DYOA 4PY7A 4UT7H 2GAZA 4S2SA 2FCBA 3WO3B 3BD4A 3FQTB 1LK3L 4FP8H 4IOIA 1NCUA 1S7SB 1K9TA 3LH2H 4KKCD 3MV9D 5DJYB 1JFQL 1WFNA 3HZKA 1U6AH 4GKOA 3H9ZA 4P5TD 4RMUA 1A7NL 1YNTB 4YXKH 3LRGA 2WQRA 1GYAA 1U8KA 2PXYC 5E94B 4NBYB 5D2NB 5E8OB 3GMPB 4OF6A 3VXUE 4RFNB 4QRTA 4YBLC 4KGLA 3REWA 1A6ZA 4RISL 4NO0B 3U7WH 1OM3L 1F6LL 1Q72H 1WBXB 4G5ZH 1DBJL 5FYKE 1G1CA 1A6TA 2NY5L 5ACLA 1H8NA 4KMTH 3CXDH 5GSRB 3TBSA 1ERNA 1J0YA 2A6JA 1J5OL 5B21A 4TNVK 2ITCA 4WCYL 4M02A 5E7BA 2FDBP 5EUOE 4H1LG 1G7JB 5JZ7D 3MRNA 1LO5B 2ICWB 1LILA 3EUUA 1YEEL 1M05A 2VDRH 1TVHB 3N1GC 2YD6A 5CD5C 3R4DA 5GGQH 5GJTL 1CD0A 5GGTA 2AK4A 4H20L 4HS8L 5C0JA 5CUSL 4HIEA 1IQWL 5F1NA 3HZYA 2ID5A 2A6DB 5D6CB 3QI9C 3TCXA 1BFOA 4UINH 3OB8A 5LVEA 2XT1B 4IRSB 4MX7A 4BFIA 4JY4A 4G5ZL 3H0TB 2ZJSH 3QEQE 4M61B 5B8CA 4Y88A 3OF6D 1DQDH 4OUOA 5I1DB 4OB5H 3OJMB 4NCDA 2DQGL 3KPNA 3EO1B 3RGVA 3MRKA 4PRPA 3B5GA 5EO0B 5J1SC 3HI5L 3EOBA 5SWZE 5I1IL 3EYSL 3WNNA 5L0QB 3D39B 4MD0B 2G60L 3FB8B 3ZDZE 3DRQB 1LO0H 5E08H 3W9DA 4PG2A 3TBYA 1IGJA 2VLMD 1WCBB 4AH2A 1WGOA 4PRHB 3F7VB 3JSSA 3MRJA 1QRNE 3EKCA 4XCEB 5D1QD 3FQWB 1VPOH 1LHZA 2CUIA 3G5XB 1AI1L 4MD5A 3BN9D 1HEZB 4NC1E 3O6KL 4N8VG 3U30B 1HH9A 2E9BA 3QDGD 4LKXA 2HTLD 3V0WH 4ZO7A 4ZUSA 3KYNA 3QQ3B 4JQXA 2YXFA 4UT6H 1G9NH 1NUNB 3DROA 4QHUA 3BZFA 1F2XK 4WW1A 4ZFZB 4G8IB 5HI3D 1OWWA 3ARBD 3D25A 3NGBC 3PHQA 2IG2L 4P9ML 3QFDA 4S1QL 2XZAH 5JDJA 1OCWH 3CZJA 4Z5RA 5B3JE 2HVJA 4NUJB 4L3CB 5J6GB 1N0XH 1U92B 2WNGA 1WWAX 1HYSD 1D6EA 1X4YA 2WQ8A 2R69H 4GRLB 1KELH 3K3QA 3CMOH 1I7UB 2WIMA 1IAKA 2KBGA 1NMAL 3F5WA 3WLBA 1CTOA 2A6KB 1A7PL 3DLQR 4QT5A 3ZMRA 1R3HA 4EUPH 1JHLL 4ETQB 4Q0XH 5DHXB 3SKMB 3QYCA 1A2YA 3NCCB 3LMJH 2XY2A 4S0TD 3ULUC 2BMKA 4KI5E 5GGRY 3RJQB 1IGMH 2ITDB 3V6OC 3UJIL 1T83A 1UB6A 5D1QB 2HKFH 2KH2B 3IVKB 4MXQC 4JJ5B 2LU3A 1KN2L 4JDVB 2F5BH 3WMSA 5EIQA 4L4VD 4P5MB 4U1HB 2X4UB 1ZTXH 3DV6B 3QDGB 5IEKB 3PP4L 1A9BB 4JFEB 4OCRH 4LPWA 1JTPA 1CZ8L 3FB5B 1MAKA 4Y16D 4FS0A 1CGUA 5I0DA 1FG9C 3ZE1F 1CICA 1H3PL 2VR4A 3PGCA 2BJMH 5JLZA 4PY8I 3MTRA 4L1HA 5IF0B 5DR5L 3T09A 2NW2B 3O2DH 3VI3E 5F3BB 1S5HB 4CVZA 4P5TC 4NDMA 3NA9H 2APBA 4PGCB 1H5BA 3AXLB 5SX4I 1BOGA 1UH2A 2K7PA 4OLZH 2H2PC 5E9DE 1FL3A 1U8PB 3VWJA 2I60L 4RWHA 2VJXA 4L4TD 3H9HB 3HS0B 1AD9B 5HHNB 3JTTA 2BSSA 4NO3B 3R1GH 1CGYA 3RIFK 4U0RC 1RY7B 1FFQA 3W0WA 4GAYB 5E2VL 2G9HB 3O6ML 2EDWA 1QSFE 2CLRA 1RK0B 1WIOA 4HS3A 4PGZA 1DBKH 1JMXA 4JG0L 1HQ4A 1QO3B 5J12B 5BV7L 1MJUH 2BFVL 3HCVA 4OGXL 4PJEA 3OJ2C 1OPGH 1GOFA 3I6LE 2GW5A 1KXQE 4PGBB 4JCMA 4EIGB 5FO8A 3ZL4L 1UJ3C 4XWGL 2BVUA 2GIYA 2DAVA 1U2CA 1F11B 4L4VB 5CIPB 4JM4L 5HVHB 3F62A 1MHHB 3VXME 4GXUM 43CAB 3RHWF 4PTTA 1TNMA 4Y16B 2FYYB 3LQAL 4OSUL 4PB0L 5IVZA 1XGYH 4KGJA 1NAKL 4G9FD 2ZUSA 3UYPA 3TZVD 1ZHBA 5DRWB 2XYCA 1QLFB 1QSVA 2VSCA 4QTHB 4O2EA 3R1GL 3EO9L 4Y4KA 1Y18A 4PJXE 1G9MH 1TFHA 4GRWF 5EH1A 3BIKB 1RZIA 4RAVB 1DBKL 4JFFD 5KS9A 1QZ1A 2I9LA 1U3JA 1BAFL 4OCLC 3SGDI 2WAHA 2Y7QA 3OKNA 1I8LA 2AJYL 3QA3A 1NFKA 3OR7A 4GAGL 1XR8A 1RHFA 3I6GB 3WIIL 4KVNL 3B9VA 5ISZA 5INCB 4Z7OF 2E9WA 3JTSA 1WFTA 2GSGA 4JFZL 3V4VH 1RU9H 3PWVA 4I0KA 3AM8C 4U7MA 2EE3A 5K59E 1MJJA 3HUJE 2NY3D 5I16A 2VISA 2M2DA 4H25A 3LRSA 3BWUC 2NY4D 4NT6B 2P43B 4G7VH 1RJZA 1T04B 4LK4A 4KTEH 4XNXH 3ARPA 4Z0XA 3R0MA 3SE4A 1CLOH 3CU1A 1X6LA 2Y23A 1T7YA 2C7UA 4HMEA 4NNYA 1X7QB 4YX2H 4PJIF 4YHNB 3O8XA 5DQ9A 1UG9A 5E2TL 1FLTX 4PGDB 1Y6MR 5IM7A 5L8KB 3S37L 5DHYB 3VFVA 4FQ2L 5JIPA 2CMRL 2E6PA 5CEZL 5JOPE 3S4SA 4RNRA 3LS4H 1U58A 1RZKC 3TZVB 1T7XA 1NCAH 5KVEL 3BISA 3MCLH 4AL8H 1FVDA 4OLXH 4U6XB 2RCSL 3MMEB 2J8UF 4JFFB 2IPKB 1C08A 4AM0B 2Y36L 4K8RD 2VXUL 3SHSA 4JN1L 1MRDH 3PDOA 5JXED 1N64H 4X9FA 3HR5A 2AEWA 4QKXB 3RNQA 4X6CF 1TTFA 4KV5F 1K85A 4X6DE 5FUCE 1KUMA 4ZFOB 3QZWG 5DJ8A 2FEEI 4HEME 1O0VA 1HQRB 2KQNA 3T0WA 5DK0B 3KLAB 3IS1X 1CS6A 2NY3B 4FG6D 1NUFA 4NO5A 1ZWIA 4FTVD 4HGKC 3FO0H 3AFLA 1LP9A 5F1KC 4O4YL 2DLEA 1PGRB 4XGZA 3GSUA 4LRIC 4ZXBD 2J8OA 2NR6D 5IW1A 5ID0B 1NLDH 5DJDA 5IG7A 2Y1VA 4OLUH 3QCVH 4QXTA 3T0EC 3VFGH 3MCLL 4OV6F 2XRAL 2NTSP 4EI5C 1IC4L 4I0PB 5D7JC 4OD2B 5C86A 1C16A 2BNUB 1T3FB 1ONQB 4JCLA 2ARJB 4D2NA 4UV4L 5T3ZE 4NCC1 3GI9H 5EU3A 1T66D 2EICA 2WWKO 1HXMB 1NGQL 5FYJL 5CAYB 5C0NC 4WTXA 1MNUH 1ND0B 5HYSA 3DRTA 2H45A 2MTPA 1MPAH 2UWEE 1QUNA 4XCFL 5C09E 1U36A 3LN5A 1E4KC 3VRLF 4R7DB 5F97E 5FYJD 4U6VH 4UBDD 2AQ2A 3HZVB 3RTQC 1AIFA 1AD0B 5KVGL 1CDYA 4Y4FA 1SBSH 5DRNB 3QWOA 4N90E 2E6JA 1PZ5A 4X7TA 5DGRA 3ISWA 4PJBE 3PUCA 5KSBE 4G9DB 5FF6A 1NLDL 5L2KD 4TTDD 3CFEB 3E2HC 4O9HL 5IW6A 5JPNB 3MV7A 1K8IA 4HH9A 4I3SL 2JTDA 3FB6B 1ACYH 1GC1H 1KCUL 1BX2A 2FNBA 1X5HA 1AGBA 3SGEI 3QWRA 4E41E 3BRFA 4FTVB 5GS0C 4QNPF 1TJGL 5EC2A 4PY8J 4WEUD 4MCZB 5ESQA 4ZXBB 3LB6C 5DA4A 5HY9B 1OGAA 4PV8B 5ICZB 5DWUL 2B0SH 4CMMB 1J1XH 3B43A 3VW3H 1LMKA 4A2LA 5F9JA 4HDIA 1BJ8A 1DQML 4WVRA 3DX7B 4GG6A 1UWXK 2WP3T 4OIIL 3RZCD 1SBSL 2CJUL 2X9WA 2AJZB 4GRWB 3F7RA 5FO9B 4ZQKB 5GJSL 4UZGA 4Q2ZB 1G6VK 4KC3B 4Y5YB 5MERB 4QF1B 4K94H 3G6JB 3TJHD 3MCG1 3G9AB 4FQCH 4EBQH 5K9OA 1VEMA 1GC1L 1N7ML 3D69A 3ZKND 4GXVH 3EYVA 1CLZH 1FYHB 5A3ID 5EBLB 4QRRA 1S9WB 4P4KD 5IIEA 1ZANL 3BESR 1D5IL 4LVOC 4N1EA 3TVMA 5T3XL 2APXA 2X7LA 5L2JA 4BH7A 4U6YA 4QTIH 5L2KB 5DHVA 5E03A 4OZIE 2MFNA 2GHWB 4NZTL 2EZ0D 2IF7A 4NJ9L 1KB9K 1FYTE 5HDBF 3F6LA 3TH3T 3IDIB 1CK0L 1NFDF 2DMBA 5C0FB 1FO0L 3R8QA 4PJIB 3E6FA 1DEDA 2DS4A 1M1SA 1RI8A 4K94L 1I9IH 3GSNL 4CNIB 4FQCL 1K5NB 4EBQL 3B9KD 4OCYH 2WM0A 2AEQH 1GGCH 2AJXH 4OGYL 1JE6A 3O3DB 2HVKA 2EO9A 2FBOJ 4Y5XA 5DRXA 2WIIA 3C5SA 1UM4H 2R1YA 4PJ7A 3D85A 2VXVH 4Z77B 4JLRA 2D7MA 5D7LE 4MCYA 4NKOA 3P3YA 2NPLX 4XC1H 4PJ5A 4XPGH 4EEEA 5GS1A 3PWLB 2J8UB 4I77H 4AK1A 1KJ2A 3RX8A 5I15H 1BWMA 4RDQG 1XGUB 4XCCH 2IBGA 5A43C 5C07A 2P49B 4HWBH 4LSQH 2LQRA 4IOFC 4JPKL 4L9LC 2A73B 3TYGH 1C5BH 5KG9A 4QHMA 2BNQD 3QIUD 4HHAB 1BPVA 4FQQB 1RFDH 4Y1AA 5KSUB 3TN0C 3QUXD 2FECI 2I07A 2HFTA 1A1MA 2DN7A 4G3YL 4I2XE 4KHTL 1CCZA 4JRYE 4NGHH 4PJFE 4RMVA 1AXSB 5CJBA 3SDCA 4P4KB 2VDQH 4Z7UE 1VEOA 5IFHH 5I0ZA 3SGKA 1JP5A 2VR9A 2XY1A 2YEZA 2VLRA 1KGCD 1HNFA 4IMKA 4PJCA 3MRMA 4GKNA 3AGVA 1HOCA 3KNBB 1U8IA 2IQ9L 4GS7C 2PETA 1MAJA 2P5WB 4IOSD 1C5CH 1J87A 1RZJH 3INUL 5H2BA 4FFWC 4BSWA 1Q9LB 1Z3GH 2Z0BA 3HE7A 2QL1A 3P11H 1BBJA 5HYJB 4LMQE 5SX5K 2OI9B 1R3KA 2C1PB 5I15L 2X41A 3BZ4A 1YPZF 3TJEL 5D2NE 4HWBL 3RWEA 5C0EB 1BZ9B 4MWFB 4MAUL 4M7ZB 3EYFA 3BPLB 3B9KB 1D9KD 1FO0B 4X5XA 3BDXA 5BJTA 2OTUA 3DXAD 2C26A 3GSNB 5IROC 3FRUA 4Z0BH 2QQLH 5CLWA 5ALCL 1TCRB 3CZFA 3I02A 4KK8C 1ZHNA 4AY0A 3T1FA 1RMFH 4XAKE 1KIUA 5TDOB 4DZ8B 5CILH 5HVGB 1YEIL 4D9LL 5IMLA 4X4MA 3IS0X 1MFBL 5EU7E 1BGXL 3CH1B 3NAAH 1Z3GL 5CGMA 3H9SA 2R2BB 3LSOB 3MRDB 4MJ5A 4Z7QF 1JL8A 2DJSA 2GK2A 3CFKA 4NQUA 1Y6KR 3BP6A 5I8KH 2IANE 2XWJA 1B88A 2NY1C 2ZOKA 3DGGB 2MPAH 1EUTA 1U3HD 3MLSH 3VRJB 1KOAA 1AKJA 3M1BA 4JGUA 3P4NA 3HI1B 4FN0A 1FJ1B 2OJEA 4OGAD 5DTFA 5E2JA 1JNLH 2DQDL 3NPSB 1YEDA 3UJTH 5K9KA 5FGSA 4F9PA 1NDMA 4GMTH 1T6WA 3VMOA 1PEWA 2DIJA 4CVXA 5C6TL 3KPOA 4XZUB 3IXTA 5GXBB 3UZEA 4Z0BL 5GRUL 2VXTL 5DJAB 1GXEA 3QUKA 4N0FB 1M6OA 4M6OH 1V05A 4FQLH 2F54A 1S7WB 1FZKA 3RZCC 4Z76B 4KDTC 4HGMA 2V2TB 2YR3A 5DS8A 5GGUB 5C0GA 3O6FD 2CGRH 3MBEA 2W0KA 1VADA 4M43L 3D39E 3WS6A 5IB3A 4M48H 1EDQA 4D8PB 1AGCB 4ZAKD 1MUJB 5BXFA 2OR9H 4WEBH 4XHQA 2PO6A 4LLYA 3BOVA 4DKEL 4PRHE 5CCKH 1YNKL 2VZUA 1I1FB 5IFJA 1MI5D 1BBDL 2CKBL 2FD6L 1MFNA 4RGOL 1IAOA 3UBXG 4JPWL 4MNGB 1CQKA 1F4XH 3HMWL 1JHTB 2IAMA 3KPRD 1NANI 5IMOB 1EZVY 3FT2B 1F6AB 1VFAA 3SDAD 1V7ML 1JRHI 4XMPH 1WK0A 5KW9H 1YZZA 3V8OA 2VYRE 3LKNB 3OBAA 1U3HB 1CFQB 5BCAA 1NFDB 3ORJA 1EHAA 4HPYH 2Q87A 1TQCB 5EC1A 2Q6WB 1NGYA 4FQXD 5E7FA 3WNPA 5JXAH 1CGSH 1W0VB 3ILPA 1XAUA 5HYFA 2OR9L 4WEBL 4QHKI 3DECA 2I24N 4ZNCD 1BM3L 2O5ZH 3NCBB 4HC1L 4U6HA 4DAGL 3SPVA 5C92A 1E28B 3QJHB 4F33B 5KSAA 1BQLH 4UQ2A 4R4FL 4FXGA 4UI2A 5EORL 1EIBA 4JFOB 3O6FB 5DD6B 3X13A 3OGCA 1FNEA 1UVQB 5D93C 4P3DB 4OTXH 4EIZC 3GIZL 1RK1A 4XMPL 3LKSA 5K9JH 4P46D 5J06A 4LF3B 4MS8D 4ZS7L 3IDJB 3WFEH 3SEPA 5MEOB 1JWSB 2VZVA 3C5ZD 1NCDL 4X80H 1N6QL 3OAUL 1G7QB 3FJTA 5F9OH 4HSQA 5DD1H 5JXAL 5HGBA 1CGSL 3KVQA 3V6FB 4I48B 4WI3A 3SKNB 3FQNB 4BH8A 1KLGA 5IUSA 3GUTB 2CDEA 1KTDA 1CD1A 3QDGE 3FHAA 5IESH 5I66B 1INDH 4JFEE 4K23L 2EEAA 3QG7L 3SDAB 1MF2H 4UU9A 5FHAH 5E8NA 1SMAA 4LCCB 1BFVH 5ESAA 1OTUD 4NN7C 4LPCA 1MJ7H 2VL5B 1ZK9A 1HSAB 3LDBC 1FZJB 4EXPX 1YPZB 5C0RH 4F7TB 5I18H 3WS3B 1I8IA 4S1SH 1ORQA 4UDTB 5L7XH 3L3OA 3WFDH 4PRAB 4ENED 5K9JL 4K07A 3KLHC 2E7LC 1DSFH 3L3KA 1IM3B 5DMIL 2VN7A 2X89D 2X4TA 3N9GH 4E42A 3FB7B 4YHLL 2NY2B 1HH6B 4HKBA 1T5XA 4YDKH 4OZHA 5KVDH 4OQTA 3IU4H 1IEAA 3PGDA 5ETUA 1AGFB 3WO4C 2EDJA 3ZKMD 5C6PB 5F7MC 3VGHA 4JRXD 3T3PF 3TO4C 5GGSA 4LAQH 3EO0A 1MF2L 4XNQB 3SJVA 3MR9B 4N0YH 5FHAL 1Q94B 4P46B 4C59B 1CT8A 4XBGA 3C60D 2FIKB 1BFVL 3AROA 4HUWB 1MCHA 3C5ZB 1RULL 3M17B 2W0FA 1AGEA 5ESVA 5HDLA 2E6QA 1HCFX 5I18L 5FKAA 4LQ1A 4L4VE 1H15A 3NCEB 4M7KH 3LS5H 3SBWC 1D5MA 1PG7H 1NC2D 1H3GA 5EOQH 4ZFFB 1Q38A 4JO1H 1S7VB 5IGXL 4NO2A 1J8KA 1OAUL 5KVDL 2VC2L 3MBXL 2DQFB 2AJ3B 3KR3H 5FYJU 5DHVH 1KTLA 5IHZB 2P44B 3D9AL 4LLUB 5IB5A 3JV4B 4CDHA 4I4WA 3MUGA 3BKML 1MHCA 4MXVF 1SJVA 3D0VA 1EMTL 4HG4J 1LDPL 1JN6B 5FHBL 5CLTA 5I1JL 4YJZL 4PJGF 4PP2A 3ARDD 4WFFD 3FMGL 5DZOA 2UY6A 5H8DA 1V8HA 1AHWA 4ZAKC 4DKFH 1SJHB 4K71B 3LEYH 1FNLA 3IETB 5AYUH 4GUPB 2YMXH 3UEZA 4D0DB 1PKOA 4Q9RL 2YD1A 1T0MB 4H0IA 3RX5A 3C2AH 4XMKH 5F1IB 3GRWL 3LS5L 4ELKB 8FABB 3WFBH 3BUTA 1N5AB 2C5DC 4DTGH 3RWIA 2YRPA 1A7OL 1JZ3A 4HK0A 1P69B 4C4KO 2CQVA 4K9EC 2CLVA 5DD3H 3DSNA 4WTWA 4TSBL 4XPBL 1I7RA 1KJ2H 3QI9A 3C60B 3NCYP 4WDIA 4JZJB 1E4XH 1XEDA 2HFFA 4XX1G 5F88A 1Z9OA 1HI6A 5F96H 4W4OC 4XBPB 2DIBA 5EWIH 4PBVC 2F53D 4KAQL 3Q6GH 4LSUL 5ENWB 3RI5F 4JB9L 1PBYA 5I76B 2XACC 1NC2B 5I1KH 2P5EA 2R0WH 4P0DA 5E5MB 4WI5A 2EIDA 3NPZB 2R0ZH 1FZOA 1UWXH 3LIZH 3MJ7B 1J8HD 5ITFB 2R9HC 2YMXL 1FFPB 4TULL 3N0PB 5E8EB 1VFOA 1J88A 1HN1A 1QBBA 2BY2A 4HXAH 2GCYA 1S7UA 2GTZB 3HE6D 2DQCL 2GT9B 1NBQA 1CIUA 4Z7WF 1X5ZA 4Y2OA 5J6HA 5HGAB 4EDXB 4JFFE 3BWAA 4GQ9L 4HIHB 4RIRB 1P7QD 3ARDB 3U79A 2X10A 3BUYB 4HUNB 4OLVH 4OM1H 4DW2H 5F96L 5DO2D 5IKCA 3JWDC 4W70A 1UT9A 2HLAB 5EU6E 2B8OT 2I9TB 4NZRL 2FX7L 4HAGA 4KK6D 3ULVH 4YBQC 2MQ0A 3QIBD 3AUVA 4B0MM 3AS2A 3VXRD 4K3HA 4WFED 2NNAA 4D0CB 1A3RL 1HWGB 1XCTB 3HZMA 3DVIA 4P59L 2MCPL 4AJ0A 4L8CB 4LOUD 2A83A 2Y6SD 1OB1B 2I26N 3GNMH 3LIZL 1RJCA 5GS2D 2H32A 4DVRL 3ZE1E 2E8ZA 4LMQI 3QO0B 1UQSB 4JO4L 3S6CA 2XZCL 2Z8VC 1ZEAL 5TE4L 3V4PH 2F53B 2DKSA 2ICEA 3RPIA 2DLIA 4O51B 4R90H 1IZJA 4QHKJ 2BDNL 2JB5H 2CLZA 4R8WH 5TFSH 1GH7A 3K46A 3UTPD 4OLYL 4FQHB 2AEPH 1J8HB 1AR1D 4ODXB 3BSZH 4PRIE 1H8SA 2DTSA 4I9WD 4LCYB 4AT6A 5E56A 3BVNA 5C8JA 4KKLC 1T4KB 4L3EA 1UZ8B 3AAZA 1I3RB 5D2LA 2NYYC 1KNOB 4H5SA 5CEZE 4U1KA 4HW6A 4XAWL 4AYFA 4TRPL 4YGAB 5EU5B 1FRGH 1P4LB 5MEQB 4YXLL 3GJFK 2ICWI 2QKIB 4R0LB 3BIBX 1P7QB 3HFML 5KN5A 4TUOB 1D5XB 3WEXB 3GSXB 5AYQA 1CBVL 5BW7C 25C8L 3GSVB 2AXGA 3FZUC 5CSBA 1NGXA 2VLLA 1E4WH 4N68A 3D1MC 3SOBH 4KJWC 3WXVL 2FX8L 7FABH 1JBJA 1FAIL 5EBWA 2Z31A 3VD7A 3M8OH 1T2XA 3MX0A 3WCYA 1F90L 1W2KT 1DVFB 3FQXA 5JQ6L 1HHKB 1KJVA 5CWSB 1K4DA 4RGNC 1V7NH 4LPXA 2ZWLT 2DMCA 3NABH 4OLWL 4OFYA 3FRPA 4FTVE 2AEPL 5CJOH 1Z5LA 1CL7L 2DI7A 4ONGH 5SX5H 1EAPA 3TA3D 3QULB 2A74B 5E1AB 1ZGLB 4G8EA 1YEFL 5D7IA 1UXSB 4JQIH 3GMMA 4MXWL 2H6PA 1R3IL 1S5IH 3CGTA 3RY5A 3VFOA 4EXKA 3B2VL 1PG7W 3HAEB 3VFRB 4Z8FH 4F8TA 1ZA6A 4GRWE 4AG4H 3VXNA 2NX5A 3DVNA 1DUZA 4ZO6A 2D03L 1AXTL 4PJGB 1BIIB 5CHNA 4YHMH 3RVWD 2ZPKL 5SV3A 4PP1D 1HINL 3G6JE 3RWCB 2VUOA 2HJFB 4L8BA 3HNTH 3NFNB 2CIKA 3CSBA 4HF5L 5F7YC 5FYJE 3WYRA 2GJJA 4Z7OE 3FFCB 4F9LC 1G7IB 3P73A 1XR9B 2YUVA 3P4MA 5GGSY 4S0SD 2A1WH 1UJ3A 4BJLA 1QPPA 1T7ZA 2RB8A 5HGDB 1TITA 4NRXA 4YXHL 4Y19A 2X4PB 4JQIL 5L2KE 4LVHB 1JK8A 4PS4H 3ARFB 3PNWA 1B0GA 5DC0A 5EU7C 4XPHH 4HXBL 3GBNH 2JCCB 2OJZH 4OBRA 3AS3A 5J11B 4DUWA 3M45A 4ZPTB 2YD4A 3PWPD 5I71B 4AG4L 4PFEA 5FUZH 3C9NB 3EYQC 4G6KH 1DQJB 4PJIE 5DDHB 5LCVH 5JW3H 5HJ3B 3O4LA 4G6FD 5IBLC 3TA3B 4MQXC 2Z91A 3GJFA 4BZ2L 1KULA 1BQHA 1B4JH 4IRJD 1MHEA 4CUCA 4NQXA 4J12A 4FABL 3W2DH 3I6KB 3EJYC 1ZSDA 4XP6L 5FM4A 3FFDA 3FO2A 1P5VA 1YEKL 4PREB 4Z7WB 5E6ID 4ALAL 1IRAY 2JIXD 2P1YA 3IJHA 5TJWK 1QFHA 4JFHD 4WHCA 4PLJD 1QVOB 3AM8A 5HI4D 5E2WL 3QUYB 3CPLB 1KB5L 1WC7A 4XPHL 2FO4A 5EG6C 5IFAH 1FV1A 2YPKA 4AENB 3X14B 2NXYC 1B6DA 1WAAE 1I8MB 3B9DA 2B1AH 3IDYB 3P4OB 5CSGA 5FUZL 3MNZA 5AZEH 3DUSA 5IHUH 5LCVL 2ADJB 1XH3B 1AY1L 3D18B 5JW3L 1DEEA 1QP1A 3I50H 4F80A 3JWNC 5IR1B 1R5VB 3KPSD 2GJZB 4H26A 4FNLH 4OBSA 1R5IB 2HRPH 32C2B 2P5WE 2NY5C 3U30C 3ZKQD 2YSSA 4DZBA 2XPGB 3HI6H 2AP2A 4JY6A 5T3XE 1LQSR 3HG1D 4F7MA 2WUBH 2O5YH 1M4KA 1HXYB 3C6SB 3HNSL 5HYJE 1EHXA 3PWPB 3DX6A 2JJSC 3L3IB 4OJFL 2FJFB 1N2RA 2VERN 3IDMB 3B9AA 5I73B 4IEFB 5C0CD 5IB4B 4OCSL 1MAMH 1AXIB 4G8FB 4NQDD 3GBML 5JMRA 2BSRB 4XVTH 1WBZB 3T4AB 4ZUUB 3T65B 1NCBL 5DEFB 5IWLC 2APFA 1JGDB 4P2QA 3MQIA 4GRLC 2EYTB 4RAUA 4YHZL 1G7PB 1UACH 5DK2A 3DIFA 3ZZ1A 3MRPB 5E6IB 3I50L 3QH3A 2VLJD 1K8DB 5HHOA 1MIEL 3CLEH 2HRPL 3D2UA 2WWKT 4XC3H 4QRQA 5D1ZC 4WI2A 2Z93A 3ZHLA 2EH8L 4HBQA 3O3UN 2D3VA 2G75A 1S9YA 2GITB 1T5WA 1ORSB 3RWJB 1K6QL 1IGIL 5IHBA 3D3VB 4LRIA 3TBVB 4X99B 5EIIB 1QBLL 3BKJH 5D5MB 3OKOB 2CUHA 4DKDC 3T0EA 5F7DB 2F5AH 3F7YB 3LD8C 4EI5A 5CJQL 1TPXC 3IJSB 4G43A 5D7JA 5I74C 3VCLB 3KPSB 3K1DA 2BVOA 3GMRB 4GLRI 4GRMA 1MAML 4AZ8A 3IKKA 3S9DB 1YEGL 4DGVL 1A4JA 1WV7T 2XG4A 4PG9A 1YY9D 1RUQH 3DETC 3CUPB 2GYSA 2DM2A 3GSRB 3H3PL 1OAYH 4YEFA 3HC3L 3T8XB 2ESVB 1E4KA 4UV7H 4XWOC 3MC0A 3H7LA 1DLFL 1NGWB 4F7PB 4UQ3B 2L7JA 5I8OH 5FA4A 3L6FA 3EOYG 3K74B 4KKBC 2CR3A 5C0CB 3VWKD 1QR1B 5K93A 3STLA 1OTTC 2Z35B 2ZSWB 4PD4J 4HV8B 3V8CA 1RJLB 3NCJH 3A6BL 2FSEA 2Q7YB 1YMHA 2AI0H 2MOVA 4B41A 1X5FA 3HC4H 4FQPA 2ICWJ 3WJJC 2V7HA 3EGSB 3B8YA 1IT9L 1UWEL 1LK2A 1FBIL 4OZ4A 4P23B 3EFFB 2PW2A 1G7MB 3HPJA 3FTGA 4U1SA 2XWBB 3RA7L 4OF3A 2JKXA 2RGSA 2W9LA 2CDFB 2UZXB 4MNGE 4BSVA 1U2HA 3RKPA 3O4OB 1H3XA 1LEIA 3PGFL 2PYED 2IPTL 1SEQL 3X3GL 5KBNC 4NP4L 1AGDA 2LE9A 4XTRD 3D87B 4OCWH 1NCCH 5DMGD 5J12C 2XKNA 3W5NA 2OL3A 2Z8SA 3GI8L 5EPMB 5CBAB 2ZUQB 4MQTB 4LSVH 1JTOA 3BHBB 3KDMA 5HDQL 3K81A 2AV7A 3EIFA 5EO1B 4LSDA 4P57A 1AJ7H 3MGTB 4ZOAA 5CZXC 4N5UA 1O5DT 4P2OD 5GGRB 4YPGA 3VRIB 4D0BA 3HN3A 5I75B 4HJJH 2PUQT 2OK0L 1FLRL 3V95A 4UNTA 2AI0L 1U3ZA 1BMGA 1XIWC 2J1KA 3HC4L 4LARH 2H32H 4NKDA 5FM8A 4ZDHA 3VXUA 3FONA 4LCWD 2JK5B 1VACA 3U2SB 3L5XH 1X4ZA 1TQBB 3WHXB 2X4RB 5FEBA 2HAZA 3VWKB 4PIRF 1F4YL 5LGHL 3DPBA 1OAXL 2IH1A 4GOSA 4EOWH 5TE7L 1NCCL 1MJ8L 1I3GL 1YUHA 1BVKB 1HDMB 2Y72A 4F57H 3OB0H 4H1LA 1JNNH 3ULUH 2CRZA 4XHJD 2NCMA 2R8SH 2VNCA 4Q9QH 3LKOA 3T77B 3VFWB 1AJ7L 2HT4D 5J1AA 4TNVF 5CEYB 3TH2T 4WO4B 4HJJL 2DWEA 3MRRA 4ODHH 2PYEB 5HHPB 1DFBH 2R1XA 3ARXA 1PYWA 2EXWC 3LV3A 2D31A 4YLQT 1XF2A 5E6YA 2HG5B 4MA7L 1I9JH 3OMZA 5CSZA 2HJLA 5TPWH 1FL5A 2V2WB 3QEQA 4O5LH 5BV7C 4ZUTB 4MAYB 4PB9L 2DLGA 1L7IL 5L88H 1NAMA 3L5IA 2WV3A 2H3NB 2BNRA 5ILTL 5FO7A 1L7TH 2X4SB 3SKJH 2IGFL 2QADC 4LLVA 5C0BD 5J8OA 1GAFH 3VFNB 2AK4D 4PV9A 1JGEB 5GIRB 1JNNL 5SWZA 4L9LA 5F9WC 4LCWB 2OXGA 3KYOB 1WTGT 3GHEL 3QISA 2R8SL 1Y6NR 1MFDH 1U91B 3OJDA 1MFCL 2YS4A 4YDVB 3TV3H 3TPUB 2GUOA 3FO1B 3TN0A 5DYOB 1OSZB 4WGWB 3DMMD 2HN7B 2GAZB 1QRNA 3LQAC 4PY7B 3RNKA 5JHDE 1JV5B 4IOIB 3ZTJH 4JDZA 5BZDB 3HNVH 2DBLH 4PRBA 1X5AA 2EIZA 2ZKHH 3QXUA 4PUBL 3VJ6A 1KSRA 4WUUB 4N8VA 1ZT1B 1YA5A 4HUVB 3WDIA 4Z7QE 1AC6A 3RGVD 1CE6A 1IGYB 1UJTA 4XNZB 4ODUA 2X1PA 4S1DD 4QGYA 5DJZA 1C1EH 5TPWL 3RJDA 4HG4K 1AQKL 4QRTB 4KJYA 3NFSH 3QUZB 1BREA 1G84A 1X44A 1M7DA 4XPTL 1L7TL 1OD9A 4PJ9C 3MYZA 5DQDL 4ZS6C 4KPHH 1F58L 3VXOB 4LLMA 1EJOH 4LPUA 3MOQA 3SCMC 3TBSB 4G8GD 2DQUH 3KPLA 2Y4SA 1JF1B 1MWAH 4POUB 3I3EA 4WI8A 5IROA 4I0PC 1M05B 3P9MA 2FBJH 3MLVL 4PJEF 4CU8A 1TZIA 3S96B 5BS0D 3U9UB 5C0BB 3VG0H 3MLXL 2AK4B 1G9MC 2C1OB 5CP7A 3GJFH 4Z78A 2GTWA 4U1JA 1YQ2A 1YMME 4WENB 3WE6A 5C0IA 3BEVA 3FN0H 3LPWA 1KEGH 4U1GB 4MX7B 3DMMB 3QXDB 1GOGA 1LO2L 5SX4H 3K0WA 1S7XA 2PN5A 3OL2A 2VLKD 1KIQA 4X9GA 3O2VH 5B8CB 4A6YA 4UT9L 3V4UH 5GRVL 2P24A 1EJOL 4P48A 5ADPL 5EZIH 1I7TA 5KOMC 3RGVB 5HHXL 5EBMB 4NSKA 1MWAL 3MRHA 4MJ6A 3TC9A 3EOBB 1Q0XH 3B8SA 5KS9F 4JRWA 4KJPC 4L8DA 4ODTH 2R2HA 4L8SA 4CADA 5I30H 3AU1B 3GHBH 1VKXA 2FBJL 4XBEL 3TBYB 1IGJB 4KDTA 2DWDA 5DJ6B 1S8DA 1ED3A 3JV6A 1G1YA 2BVPA 2OSLA 4C83A 1FDLH 4G8GB 1LD9A 4MD5B 3FN0L 5E9DA 3ZKXB 3BH9A 1KCSH 4E5XA 5IBTH 2V6HA 1RZ7L 5HI5C 4LKXB 3DYMA 4ZOEA 4ZUSB 3MREA 3O2VL 4QHUB 5BQ7B 3BZFB 1QFUL 2ED8A 4TNWK 3GB7B 2HFEA 1F8TH 4TVPL 5BS0B 3GKWH 1FZMB 2Q8AH 4LLWA 4UOJA 3L7EA 4GSDH 3QFDB 2YKLL 3RVTC 4HCRA 2PNDA 3X3FH 1R3JA 1S7TA 4HUUA 3L3HB 3RL2A 4HEPG 1QSFA 1MIML 4ODTL 2HVJB 4LKCA 3PWJA 1JGLL 3U83A 3O9WB 3GZKA 1ZXQA 4NM4H 3FT3A 4L5FL 1TETH 3RIFF 1F4HA 4QY8A 3VWJD 4WGVB 3FT4A 2VLKB 2GJ6A 5HGHB 1IAKB 4J1UB 3SGDH 1MCNA 4QT5B 4JKPH 4YHKL 1T0NA 3QEGL 5E70A 3O45A 4GW4B 3NCFB 4O02H 4GMSL 2ZCKL 2ENSA 4M1CD 4WV1B 1HHGB 2R4SH 2OZ4A 3W0WD 4U1LA 4JE4B 1LNUA 3LHPH 5F93C 4OF5A 4HWEL 3C09C 1KCVH 1JVKA 5FB8A 2PYFA 5E24E 4HX1A 5T5FL 3KPPA 3AB0B 4PJXA 1J8HE 1EEQA 2FJGA 4QEGA 1I1AD 1PEZA 3N85L 1J1PL 5ALBH 2W9DL 5E4IA 1QFWL 3G5YB 2YC1A 5JW5B 4NM4L 3UTZA 3DNKA 2OP4L 1TETL 3VFPA 1VERA 4FQIL 2G2RA 5AG9A 4EN3A 2DRUA 3T3PE 3PL6A 1IGCL 1WT5C 5HYIA 3MOBL 5GZNC 5LAXA 2G5RA 3DBXB 3MLYH 2VAJA 2ZNWA 1T7WA 4FFZH 2J4WH 2DM3A 1W0WA 1AE6H 2PW1A 4KXZI 1B2WH 1ZLVK 1NDGA 4KMQA 4NDMB 3HUJA 5F6HI 1S78C 3ZT5A 4C57C 1N3NB 4X5WA 5EZOL 4P3CH 2WBJA 3JXAA 2Y07H 2EDOA 3LHPL 1P4BL 1FL3B 1CTNA 1KCVL 1GZPA 1L4IA 3W39A 4JFPB 5D1XD 4MD4B 5CKGA 4PG2C 3WNMA 2NQCA 2H9GA 1YECL 5I1HL 1ZVYA 1GC1C 5HD8D 3BGMA 1Q9WA 5ISZD 2E7LA 3HRZB 3BH8A 4U4BA 3T3MF 4NNXA 1E6JH 2MNUA 3UX9B 2G5BB 3L5HA 5E4EB 3W0WB 1KCRH 3HC0B 3QHFH 4XNYL 1JZ2A 4HUKB 3OKYA 2CLRB 2HTKC 3MA7A 2LFGA 2ORBH 2AXHA 2OL3H 4Y5VB 4MHHG 5EZLB 2CK0H 4PJEB 4MMXC 2OI9C 3MNWA 1DQQA 3QCTH 3RWFA 3MRFA 3G5VA 4PJGE 4D3CH 1NKOA 2WLZA 3TO4A 3FO9B 4DQOH 3O6LL 4KZEL 2NXZC 1AE6L 4NWTH 5EFIA 1I1AB 1MCSA 3P77A 4JKLA 2AJSL 3VG9B 1NC4A 3O3AA 3TBTB 3RRQA 1WZ1H 3SE3C 3DARA 5DJCA 1OGTB 1R0AH 3FFCE 4KFZC 3O8XD 2P8LA 2EDDA 5CZVH 4K94C 2NY7H 1J7VR 5IVZB 4JVPA 1Q0YH 2A0LC 1HIMH 4X6DA 1YYMH 5FYKH 2HH0H 1JF5A 1KPRB 4GG6F 4DCQA 1UM5H 4MMZC 3P0YH 1CG9A 2AXFB 1RUAL 1RZIB 2JCCE 5KS9B 4N9OB 4H1LH 2W9EH 1YN6A 4DN3L 1KLFA 4R7NB 1G6RA 2BSTA 5EU4A 5D1XB 3OKNB 3OKKB 1IAIL 4C4KT 5DA0B 3QA3B 1IC5H 3OR7B 4NWTL 2DL9A 2XKSA 2XWTB 1XR8B 4X7FC 1JHKH 1NFIA 1MVUA 5ISZB 4MB4A 4APQA 3PWVB 5LXGH 4HJ0D 3VFUA 4XI5C 4NFBA 4P99A 1MJJB 5I16B 4HWZA 1MEXL 5GRJL 2VISB 3L9RA 4H25B 3LRSB 3SGEH 2B4CH 3QEHA 2UWEA 5C09A 2D7TL 1Q0YL 4Z7WE 1RJZB 1HHIA 4IM8A 3OJVC 5BVPH 5FYKL 4YGVA 4TOYH 4Z0XB 5CEXA 5JDSB 1CICC 1JWUB 3CFBA 4KVCH 1FP5A 1NAMH 5F8QC 5EOTA 3BW9B 4PJBA 5JUEH 1DE4A 2Z4QA 3KPQA 2W9EL 4S1RH 3O8XB 4U6TA 4MLSA 3U4EA 4Y7MA 3VFVB 4IRZH 2IADA 4JZNA 4XNUL 4G6JH 4R9HA 3CLFL 1U58B 2UYLA 3VU2A 2WUCH 3IDNA 4HFUL 4DKAA 4U33A 4R4BA 1FVDB 2IH3A 2LAGB 1IC7H 4E41A 1GOHA 4Y4FD 4MDJB 2ERJB 3GJEB 2CXGA 3CDGA 1XF3A 3LPFA 4PJ8C 2EXYC 4XH2A 3T0AA 2BRQA 1IQDA 2O5XH 1KPUA 3A67H 2VL4A 2VDNH 4XP9L 5DLML 4YFEA 3RNQB 5CJXC 5F89B 2M1KA 1YYLH 4J3OC 1TTGA 2DLFH 4LGRB 3UYRL 1ZHLA 4LQFH 3BPCA 3QHTC 4BZ1L 1VFUA 5JUEL 5KJRL 4N0UA 4XCYA 4S1RL 4PJDA 3X11A 4R96A 5A2KH 1EGJL 4PJCF 3EJJX 3C8KA 4Z9KB 3BZEA 4NO5B 1ZWIB 1ITBB 4F7CB 2A77H 4OIBA 4NPYB 4XGZB 4X0KB 5IW1B 4IIQB 4JFHE 2QJDA 4NKIL 4RRPG 3VMNA 1VFBA 4GBXB 5DUPH 1PSKL 5D6DC 1OW0C 4LRNH 3UC0H 2HFGH 1CGXA 1C16B 1QSED 5I1LA 4DFIA 1XGPA 4X9BA 3D3VE 4Y4KC 4U31A 2BVYA 3OKLA 3O3BB 3MRBA 1EV2E 1UA6H 5D5ME 3STZA 5FDWA 3BXNA 4ZNEE 5H94A 4R4ND 3MLUH 4OZIA 3MRIA 3TBWB 2MSPA 3DRTB 1ES0A 3O81A 1RUKL 3KPSE 1FVCA 3AC0A 4PD4K 3ULVF 1KT2A 1AFVH 3QO1A 1FYTA 2FB4H 1NMCB 1NMBL 4LQFL 4BQBA 4WU5A 4KTDH 4A6YH 3ZO0A 4QRRD 3WIFB 1CFSB 4HQQL 1W72A 2D0HA 3K4DA 4LBEA 4Y4FB 3KHQA 4PRNA 4WHYG 5FECB 4NNPH 3TVMD 1PZ5B 2ESVE 2WZPD 2A77L 4JZOB 1N26A 2SEBA 4LCCC 3IFOA 3QAZC 2FGZA 4KJQD 3TWCL 3UTQA 2R23A 4MLIA 5EA0L 5DUPL 3LN4A 3P0VH 3QQNA 5C0CE 1F45A 1NGZA 3UC0L 5CD3A 1AGBB 5IJKC 1QLRA 1U41A 4RQQB 4JFXB 2ZSVA 4QXGH 2NY2C 5EO9B 5EC2B 3WIHH 3BZDA 4JVWA 4X8JB 4XVSL 5HDOA 4QYOB 3RY6C 2FB4L 1MLCA 1OLZA 3AY4C 4I2XA 5F6HJ 4JRYA 2NZ9D 3UTSA 5A2FA 1L9MA 4Z7UA 4DGIH 4Y8AA 1L6XA 3D85D 4HH8A 4Q6IC 1QSEB 1EO5A 1DBBL 2EIBA 3UAJC 3QJFA 4PJ5D 4HCRH 3WHE0 2XNAA 1IL1A 2DM4A 1S7QB 1QLEH 4N8CL 2YPLD 4ODSL 3FOLB 3VI4E 5C07D 3QUMH 3FQTA 4S10A 5BRZD 5DJYA 5K9OB 5CJ5A 2CKNA 1MCJA 3D69B 4Y1AD 3EYVB 3IXAA 5ANMB 3QG6A 3NH7L 1YNTA 3SDCD 4AIZA 1QD0A 3EFDH 5E8OA 3V0AC 4NQEA 3GMPA 2AAVA 5FUOH 2YOCA 2VLRD 4Z7VF 3WIHL 2X7LB 2PR4L 3EAKA 2XICA 1NLBH 4BH7B 1G0XA 2OZ4H 4NRZA 4WNQA 4F9LA 1WBXA 5DHVB 3E8UH 1ZGLP 5F6IC 5D72L 5E00B 4CAGA 6FABL 3GIVA 1DQLL 1U8HB 4DGIL 4WFHD 4EQ3A 35C8H 5E0QA 4LVNB 3PXJA 5GSRA 3HE7D 3DV4B 5E8DL 2CD0A 1VA9A 5DEGB 2CH8A 3DYPA 4NJAL 3KS0J 1P2CA 2KKQA 3E3QC 1QLEL 3MNVA 1JCKA 3KWWA 1G7JA 5GGVY 4DN4H 4K71C 4Q9CA 4POZD 5IK3B 3QUML 3QCUH 4R26L 1TVHA 4J3XA 3NTCH 5KVFL 2JJTC 2C3VA 4M6NH 3UPRB 3ULVD 2IANA 4Y5XB 3AREB 5DRXB 4LSTL 4YO0A 2WIIB 3A0OA 2R1YB 2FO1A 2VZTA 1F00I 3D85B 4RZCA 3EFDL 2P47B 1HCVA 5M95B 1EVUA 1EUUA 4PJ5B 4MQSB 5D6CA 5GS1B 1KJ2B 2ADIB 5INDB 2YPLB 3QIWB 5C07B 4BZYA 3H0TA 2R4RL 3DX9B 4M61A 2F8XC 5BRZB 5KG9B 1QFPA 4Y4HB 5I1DA 3H9SD 2YK1H 1NANH 2HJKA 3PJSB 1OSPL 5J7CC 2VZOA 3EO1A 4TSCL 5EO0A 3NFPB 4YNYB 1JRHH 3HB3C 3SDCB 5IVXE 4AIXA 1MY5A 2ZCLH 2Y06H 1AKJD 2YEZB 3D39A 4LCWE 2VLRB 2AK1L 4MD0A 4PJCB 3MRMB 3QCUL 1IARB 3FB8A 2GI7A 4J6RH 3DRQA 1HOCB 4CW1A 1WCBA 2IBZX 4PRHA 3F7VA 1YJDL 1OAQH 2BVTA 5H2BB 4XCEA 5FKPB 3FQWA 1MH5B 4BSWB 5JW4N 5FCUH 3MLWL 1KACB 4GG8B 2DTMH 1ZLUK 3SQOL 3V5HA 4WUUE 4LHJB 5JMOC 2F54D 1R3KB 1KIPA 1A9EB 1V3LA 1GIGH 2ED9A 2A38A 2D4DA 4K55A 1N8ZA 5I9QC 4IMLB 3QQ3A 3MBED 1B90A 4KHXH 2UY7A 3EYFB 3ZDXF 3CK0H 4ZFZA 2JJSA 1L0QA 4HPOL 4N9GB 4X5XB 1P6FA 2PO6D 2ZCHH 5BJTB 3RWGB 2E9IA 2VXQL 1JZ6A 4OZHF 2B2XH 3W11D 2ZCLL 3BP4B 5E99L 2VDLL 3CZFB 3I02B 4KK9D 4MHHI 4NUJA 4L3CA 4WU7A 1ZHNB 4J6RL 4K3EL 4WY7L 4MQ7B 1U92A 3MCKA 3T1FB 2XZZA 2IAMD 4C54A 5IWLA 5C0DA 2NZIA 4V1DE 4GRLA 4B53A 4ODVH 1BD2E 3RZWA 3THMH 4MA8H 4R2GD 5T33H 3H9SB 3TFKD 2UZIL 2O61B 2DTML 4MJ5B 2A6KA 1G6RH 1UB5B 1FC1A 3CFKB 4ETQA 5DJXA 5C0BE 4JREB 1F3JB 4RFEB 5J1TC 3H42L 2AK4E 3SY0A 2EDYA 1AKJB 3P4NB 1T1YA 4GW5B 4OT1L 2OJEB 5T3ZH 1CLYH 3MJ9L 4YEEA 5K9KB 4K7FB 1R5WA 4TSAH 3CK0L 1MRCH 5F3HA 2ITDA 3BEWB 2ZCHL 4RMRA 4G6AC 4OZGA 4PLKD 1ZLVH 1MHPL 4CVXB 3BGFB 3IVKA 5DVLA 4J7RA 2B2XL 5GHWH 3NZHL 4CMHC 4JDVA 3I75B 4YQXL 1FZKB 4U1HA 1C7TA 4XPAH 2BHZA 2CUMA 3RU8H 5DS8B 1KEMH 4K9EH 3RAJL 1UM6H 5IQ7H 3BQUC 4HZLB 4JFEA 1VADB 3FB5A 3GO1L 3QFJB 3V6ZA 1II4E 1MCPH 2IFFL 3ILQD 5BXFB 5D7SH 5GRYA 2PO6B 3M07A 2E27L 5ADOL 2YD3A 3KJ4C 1DVFC 4LEXL 4K7PY 2NW2A 1KG0B 3RVXD 1S5HA 2BC4B 5F3BA 4MNQE 3N06B 1A3LH 1CL7I 1ODAA 3MACL 4U7SA 5KSVA 3DO7A 4JR9L 3PG2A 1EEZA 4HWUA 5HVFB 4KDWA 4G8GE 5AEAA 4Z7VB 1VGKB 3X12B 2KDGA 1IAOB 1IGFH 1U8PA 2B1HH 2IAMB 2FGWL 3PABA 4O58L 4DK3A 3WL9A 1VFAB 4UUJB 1A7QL 2F19L 2GK0A 3H9HA 43C9A 5BS0E 2DDQL 3QDAA 2ADFL 2XN9B 4KY1H 2NMSA 1OAKL 1FSKB 2YUXA 4GAYA 2G9HA 4QO1A 4WWKC 1GVIA 1A7BA 1RK0A 4M1GH 5A16B 3MUHL 1QO3A 1A5FH 2XXMB 3L5WA 2DQJL 3JWDH 1J12A 4X6BA 2P48B 2VLKE 3RVUC 5A2LH 2X1OA 4HAFA 3SPVB 5DUMH 4LSRH 3U46B 2ZZUT 4L4VA 4WFGE 1GGIH 2X4OA 4FXGB 5C3TA 1IGFL 1MHHA 3ARGD 2WINB 1T1WA 1TZHB 3QZWB 3X13B 1QOKA 1EXUB 3ARFC 1MOEA 4Y16A 1XIWA 3VXTA 1ZT7B 2OMBA 4ERSH 4U49A 4WI7A 1XF1A 2D7PA 1FH5H 4QRSB 3LKSB 5J11C 4ZOBA 1QLFA 3OZ9L 1IM9B 4QTHA 1Z2KA 2YWYA 1JGVH 4RAVA 1Z9LA 1FIEA 1WITA 5LKNA 5BO1H 1A5FL 1W72H 4NQCB 1KLGB 1TZGL 2A9NH 3TNNB 2X4QA 4JG1H 3ROLB 2PXYD 4UU9B 4K2UH 5E8NB 2VN4A 3I6GA 5INCA 2AGJL 2CR6A 3ES6B 5ESAB 3RUGB 4JHAH 3GSWB 1I9RH 4LHUD 4LSSL 3S88H 3MROB 3QUYC 4HULB 4TVPE 1I8IB 1U95A 4YUEL 4LNVA 1D5ZB 4LNRB 3L3OB 1FH5L 1T04A 1A02N 3L3KB 1JUFA 1Q1JL 2F58H 1UKTA 3A6CH 3LKQA 5CINL 4WI9A 4HKBB 1T5XB 3ULUF 1BLNB 4UIMB 1C12B 4OZHB 4G42B 1IEAB 1CN4A 2DQIL 5D2LF 1JPTL 1CFVH 4KUCF 3VGFA 5CD5D 4M5YH 3ARGB 4YHNA 2Z92A 4PGDA 4B7IA 5ID1B 5GGSB 5DHYA 4FZEL 3QI9D 4XBGB 5F7FA 2V7NA 1DUYB 1FL6B 3GM8A 5GISL 2F74B 5DVMA 4XP4H 4ONHB 5HHMD 3DI2B 4FQ1L 5T1DH 2W0FB 5ESVB 2EDLA 1SM3L 2VAAB 5I73C 1CD8A 1JNJA 1QA9B 3T1WA 3BI9X 3MMEA 3J7HA 5FKAB 4JFFA 1JPSL 5TDNB 1H15B 1D5MB 5LGJB 1IKFL 2P5ED 4OD3L 2PXYB 4YBLB 5EU6A 5D7IF 4JFDD 1D6VH 5F9DC 1E27B 5IB5B 1WWWX 4PJ9A 4LHUB 1HQRA 1LO4L 1VGEH 5DK0A 1MHCB 4J3SA 4P9HH 5JHLH 5KSAC 2EIEA 5AUMA 3D0VB 2IMMA 2MHAB 1CDUA 4P2CG 2VABA 5AZ2H 5MEPA 3GMNB 3SCMA 3C08H 5KS9E 5FYLL 3ALPA 5ID0A 1T03H 5F7KC 1UC6A 1WISA 3QPQC 5T1DL 2C3WA 4I0PA 1OARL 4UIKH 4DGYH 1A6AB 4OD2A 4YHYB 5ISZE 2BNUA 5DURD 1ONQA 5CBEA 2ARJA 2XA8L 3U9PL 1PX4A 4X9HA 4MA1B 2Y5EA 1ND0A 4KK5C 1HHJB 2QHRL 4HK0B 3GDBA 2Q8BL 3I85A 4PRIA 1MLBB 3GMQB 5JR1H 3QI9B 4QWWD 1P4IL 1QKZL 3CFCH 3LQMA 1GGUA 1V3MA 5HHMB 3NVQA 3PDGA 5CS7A 3LKPA 5DRNA 1QACA 5BZWB 4OF7A 4CN6A 1LK3H 4YK4C 4AEHL 3ETBF 3EDKA 2QSQA 1LO3L 1C5DB 1JFQH 2H26B 3S3PA 2P5EB 1T03L 4G9DA 1YC8A 1FZOB 4HBCH 2M26A 1A7NH 1RIVL 4UIKL 1J11A 4JFDB 3ULUD 3MLZL 3FB6A 4P23C 4L3ED 3RDTB 4RISH 1T1XB 2GCYB 1OM3H 4KUCD 1LDSA 4MXQD 1U0QA 3MFGB 4YHIA 1DBJH 4JQVA 2UVFA 3MJ6A 4XXCC 2NY5H 5D70L 4MCZA 3BWAB 4PV8A 4NBXB 3ZDYF 4BQCA 5ICZA 4CMMA 3CFCL 4YWGL 1NPUA 2ZUQC 4ELMB 1J5OH 3DX7A 1A64A 2R2CA 4WCYH 2DLHA 3V5KB 3HMXA 4CJ0A 2AJZA 4ZQKA 2NNAB 4XVUC 1YEEH 3NGBB 4Q2ZA 3VA2C 5MERA 4QF1A 4LASH 5GJTH 4ETYA 4OFYD 4HBCL 3G6JA 3QDMB 4H20H 5E8PB 3QDJE 4M6MH 4HS8H 2HWZL 1QSZA 3RBSA 4L9DA 1JYVA 2H2PD 2L4OA 5CUSH 1TQBC 5H37G 1IQWH 5EBLA 1DBAL 1S9WA 4M5ZL 1CXLA 2ICEB 1WICA 3VFMA 3CVHL 2NX5D 1NSNL 2J7LA 4I5BA 4MDIB 2DQGH 5I1CH 4YPJA 3EYOB 2J3SA 4HLZG 4ZPVA 3O11B 3HI5H 3G08A 2QQNH 1AHWC 5I1IH 3BVNB 3EYSH 4KDVA 3Q5TA 5C8JB 4L3EB 3AAZB 5D2LB 2G60H 2QSTA 4F37F 3IDIA 5C0FA 4WO4C 3T3ME 4PJIA 1RIHL 4LASL 1WUNT 5JO5B 3O2WL 4UDUA 1FN4B 3UTOA 5EB9A 1NEZB 3L5JA 1K5NA 3AMLA 4M6ML 1BVLB 4HMCA 2CDGA 4Y19D 3R06A 4RWYL 1AI1H 2HMIC 4NQVB 1NGXB 2VLLB 3MA9L 3O6KH 3LEVL 1F3DJ 2N4IA 4UTBL 4Z77A 5EBWB 5I8CA 1WT5A 3IT8D 5LQBH 2BRRL 2AXJA 4MAYC 1XF4A 1QG3A 2DQHH 3MV9B 3NZ8B 1K4DB 1L0XA 1XGUA 4LDLB 1HNGA 3PWNA 3E6HB 4P5TB 5I1CL 4P9MH 2IG2H 4I3RL 1UYWL 4S1QH 3O4LD 2A73A 1ZLUH 1LE5A 4P5KA 5JTWA 1XZ0B 3UMTA 1EAPB 1MCOH 2QQNL 4HHAA 2A9MH 4G8EB 4Z95L 1A7RH 4FQQA 1WAAA 5D7IB 3MRLB 5KSUA 2DYPD 2H6PB 3TT3H 3BN3B 1TVDA 1JPGB 1GHFL 3QXWA 4LAJH 3UCRA 5HTSA 4FHBD 1QSEE 2GFBA 3H7BA 4KZDL 1T1ZB 1ZA6B 4E9LA 4CVWA 2HLFC 1NMAH 2P5WA 4PJAE 3GSOA 1A7PH 5CHNB 3ZSSA 1JHLH 4JY5L 3UBXB 4XNZC 4UTAL 1Q9LA 3CVHB 4OZFA 4X7DC 4YC2B 3JWOL 5LQBL 3QUZC 5HYJA 3MRCA 3WV0A 2CIIA 2DQHL 1DN0A 2C1PA 2X5PA 4U3XA 5ANME 3PQYA 3ZSTA 1R6VA 5FXCH 1A6VH 4L29B 1OWRM 3UJIH 2XI9A 2NY0C 1UJ3B 1BZ9A 4MWFA 5MEND 3B9KA 3SE3A 1FO0A 1MCOL 4NRXB 5E2UH 2A9ML 5JIKA 1KN2H 1A7RL 3VDBA 4ZMAT 4YDLB 1JK8B 3TT3L 4GLRH 1YC7A 3GSNA 1B0GB 1EHLL 4QWWC 3HTLX 1INEL 1KCLA 2XG5A 3PP4H 1TCRA 3JZ7A 1CZ8H 3UJJH 5T1LD 4OUUB 4YHPA 1H3PH 3DUUA 2XTJE 4DZ8A 4WW2B 5TE6L 5DR5H 3O4LB 3CH1A 3MFFA 2PTTA 2R2BA 2Z91B 3LSOA 1PKQB 2X44D 2DYPB 2VMFA 5I8EB 2ADGB 2GQHA 3DGGA 1CI5A 3VRJA 4P2QD 1A6VL 1ZSDB 3SGJC 3GMOA 3T2NL 2H2SD 3G9VA 2I60H 3DVGB 3FO2B 2J6EL 5C7XL 5HHOD 4JANA 4MJIE 1FAKT 5E2UL 4AQ1B 3D2UD 3WJLC 5SV4A 2YPLE 3TYFA 3G5ZA 4XZUA 3RIAF 3MV01 1CVRA 3MRQB 1A4KA 5BRZE 8CGTA 3VXPA 1HKLL 5DJAA 3IJYB 2LABA 2LVEA 5E2VH 1A1NA 3BGAA 1FV1B 3O6MH 4N0FA 3UJJL 4R6UA 5GSVB 4JG0H 4ZUVA 2Z31C 3S37X 5GGUA 3T0ED 5BV7H 2BFVH 3LZFL 4OGXH 4EI5D 1WZKA 3ARBB 5D7JD 1DEEB 4F7EA 5MENB 1HZHL 1T2JA 4PJCE 4D8PA 2UV3A 1F5WA 4NN5C 1AGCA 4MZ2A 1D3CA 1SYVB 3ZL4H 1UCBL 4XWGH 1AC0A 3ZKXC 5IEHA 2YSSB 4HWBA 4DZBB 4JM4H 4U2ZA 4MYWB 5JOFB 5C0ND 1WEJL 3QRGL 4JY6B 1I1FA 1JPST 3FQRA 3UROR 3V5DA 3LQAH 4OSUH 4PB0H 3X17A 5T1LB 1YN7A 1NAKH 2FEDC 4MNGA 3RTQD 1TDQA 3HLAB 3FT2A 1F6AA 1T20B 1RZGB 3EO9H 4KRLB 3BP5B 4PJ8A 4NYLA 4RSVA 3O9WC 1TLKA 4H8WL 5JPMA 4BSJA 3U4BL 3LKNA 1H8OA 2QQKL 4P2QB 1BAFH 1VDGA 3ZDZF 4HJGA 1SJEA 5CJXA 4QHNA 1K3IA 3SDXE 2AJYH 5GS0L 3U0PA 1W0VA 4GAGH 3D2UB 1JI2A 3WIIH 4KVNH 2Z93B 4WV1C 4XRCB 4JFZH 3ME0A 2G75B 4XP1L 5GS0D 1T5WB 3FN9A 2JE8A 3LB6D 2VB5A 1F97A 3T0EB 2W38A 5D6DA 3O6FA 4EI5B 1OW0A 4U3HA 5D7JB 2DI9A 1QFWI 3W5MA 1UVQA 4DOHB 4P3DA 4I18B 3FCTA 2JJVA 5J57B 1A4JB 2Q7NA 4PG9B 2MCG1 5IMKB 5MEOA 4NHUB 5B3JF 5E2TH 3VXUD 1N59B 1G7QA 3S37H 4ZFOL 1PLGL 2YPVL 3WLWC 4FQ2H 4L4TB 3VGAC 2CMRH 5CEZH 2FZ3A 3V6FA 4I48A 3SKNA 3FQNA 3KXFE 1HE7A 3RTQB 2CRYA 3IDGB 1MCQA 5MHSD 5I66A 2R1WA 2P8PB 1ADQL 2CKBA 5KVEH 4JO2L 4K8RH 2XQBH 3QFJE 4GAJL 2RCSH 4LCCA 4KWUA 1ITCA 1B3JA 2FSEB 1FHGA 2WK2A 1X4XA 2Y36H 1QFOA 1RJYB 2VXUH 1MRFL 4JN1H 4PLOB 3SDDC 4F7TA 1Q9KA 3WS3A 1LK2B 4Y2DC 3U0TB 3MOAL 4OZ4B 4UDTA 2PW2B 4PRAA 3FTGB 3OKMA 4U1SB 4Z7VE 1JTTA 1IM3A 2V17L 3HMXL 2E7HA 5IJKA 3BIAX 3FAWA 5HXMA 5C08E 5FM5M 1HH6A 1K2DA 5IOPB 2YRLA 2R2EB 1AGDB 3BAEL 1FORH 2NLJA 2NY6C 5GQBA 3RY6A 2XKNB 3UO1L 1AGFA 1KC5L 2XN9E 3AY4A 1Z9MA 4G9FB 3OAYK 4HC1A 4O4YH 4ZSOB 5B22A 5JHDA 3KDMB 1EHNA 3QEQD 3MUJA 4GRWH 2R0KL 5D8JL 3OKEB 4K8RL 4Q6IA 2P45B 4XNQA 2XRAH 1TXKA 2XQBL 3DURB 3PXHA 3MR9A 1IC4H 1YNLL 3S35L 4U1IA 2X1QA 3MYJB 3WN5B 2BNRD 3CFIC 4D0BB 4LVEA 4UV4H 3S3JA 3M17A 3HKFA 4IOFD 4N5EC 1NGQH 5FYJH 2H2SC 4XCFH 1INQA 3TN0D