1OO2A

Crystal structure of transthyretin from sparus aurata
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
RCPLMVKILDAVKGTPAGSVALKVSQKTADGGWTQIATGVTDATGEIHNLITEQQFPAGVYRVEFDTKAYWTNQGSTPFHEVAEVVFDAHPEGHGHYTLALLLSPFSYTTTAVVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transthyretin
publication title Distinctive binding and structural properties of piscine transthyretin.
pubmed doi rcsb
source organism Sparus aurata
molecule tags Transport protein
total genus 25
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1oo2A00
4N85A 5HJGA 1KGIA 2QGEA 2ROYA 1OO2A 3P3UA 3I9PA 5AL8A 4Y9GA 3IMVA 3GRBA 4TL5A 4I87A 4L1TA 5IHHA 1TT6A 3TCTA 1E4HA 3KGSA 1ZD6A 1G1OA 4FI8A 4FI7A 5FO2A 5AKVA 1SN0A 1DVUA 3P3SA 2FBRA 3IMTA 2QGDA 5L4FA 2QGBA 3OZLA 1F86A 3CN3A 4TLKA 3GRGA 1DVQA 4WO0A 3A4DA 4Y9CA 4PVMA 5DEJA 4HJSA 4MRBA 3BSZA 4DERA 3IMRA 2G4EA 3NEXA 4TNFA 4AC2A 1IJNA 1TTRA 1IIKA 2G3ZA 2H0FA 2ROXA 3Q1EA 5K1JA 2G4GA 2GABA 3CN4A 4IKIA 3I9IA 1GKEA 3D7PA 2NOYA 3GLZA 3KGTA 4TQPA 4ABVA 1GKOA 2PABA 5AYTA 1TTCA 3ESPA 5AKTA 1DVXA 3IMUA 4I85A 1SN2A 4PWFA 4DEUA 4ACTA 4YDNA 3W3BA 4TNGA 3U2IA 1IIIA 3BT0A 4Y9BA 4DESA 2G5UA 5AKSA 1FH2A 4TNEA 5TTRA 1BZ8A 3P3TA 4PVLA 3ESOA 4WNJA 2FLMA 3GPSA 1TLMA 4IK7A 4PVNA 5AL0A 3CN1A 5E4OA 3CBRA 4MASA 3CN0A 4PWHA 4YDMA 1IE4A 3CXFA 3NEOA 3B56A 3IMSA 4FI6A 3DIDA 3CFNA 1BZEA 3SSGA 4DETA 5CN3A 2WQAA 3GS0A 5JIQA 1F41A 5L4JA 1BM7A 4QYAA 4IKKA 4TM9A 5CLZA 1TTAA 4ANKA 2B9AA 1TSHA 1E5AA 4PWKA 4TQIA 1DVYA 3NG5A 4WNSA 4TLTA 3CFTA 1ICTA 5FW6A 4DEWA 1FHNA 4IKJA 4D7BA 2H0EA 3IWUA 2G3XA 4L1SA 5DWPA 3TFBA 4HISA 2G2NA 5K1NA 5EZPA 1DVZA 2F8IA 3DK0A 2IGLA 4TQHA 3HJ0A 2F7IA 3CFQA 3A4EA 5FW7A 4ABWA 4HJTA 2H1XA 1U21A 4TKWA 4TLUA 4TL4A 3IPEA 5CNHA 5JIDA 4PWJA 5CR1A 1QWHA 1THAA 3NESA 3IWVA 2G9KA 5EN3A 1ZCRA 2TRHA 3DJSA 1BMZA 4Y9FA 3DK2A 3U2JA 2TRYA 4HJUA 2B15A 3CFMA 2B16A 4PWEA 5E23A 4ABUA 2GPZA 5L4MA 3GS7A 3QVAA 1TZ8A 4QRFA 2H0JA 2H4EA 1Y1DA 3DGDA 3FCBA 3M1OA 4TQ8A 4PMFA 4N87A 1X7TA 2QGCA 4HIQA 2B77A 5A6IA 1ETB1 1X7SA 4PMEA 1RLBA 3ESNA 3DJTA 4PWIA 5CM1A 3FC8A 4PWGA 4TLSA 2QELA 4AC4A 3DO4A 5CLYA 5CLXA 5E4AA 3IPBA 1DVTA 3OZKA 1SOQA 3DJZA 3CN2A 4I89A 5JIMA 1BZDA 5FW8A 1TYRA 4IK6A 3P3RA 4N86A 4IKLA 4MRCA 3A4FA 3NEEA 4Y9EA 5L4IA 2QPFA 2H6UA 1ETA1 1SN5A 1KGJA 4Q14A 4QXVA 1TTBA 3GS4A 3IMWA 3D2TA 1Z7JA 3DJRA 3KGUA 4KY2A 1TFPA 1E3FA 2G2PA 2B14A 4IIZA 1QABA 4ABQA 1THCA 4PM1A 1DVSA 5BOJA 1SOKA 3I9AA
chains in the Genus database with same CATH superfamily
5JMRA 4UZUA 3RIFK 5I71B 3SQOH 3G5XA 3ZHDA 2DH3A 2QQLL 1ORQB 5IFAH 1M7UA 1DQQB 5DFWH 4ONFL 1S9VB 1WBYB 4YC2C 4XN9A 5CJQL 2JB5H 1H15A 1NIBA 1MQKH 2IWGA 3RU8L 1ZSDA 4AEHL 3S48A 3QUMA 1ZANH 3ZTJH 3MCYA 2Y07L 3LDBB 3FB7A 5L6YL 4XC3H 2AAVA 2BP8B 3LZRA 4MVBD 1CTNA 4BSJA 5J6HB 1DEEB 1R3LA 1U8KB 3DVGA 1Y6KR 4IU3A 5FYKU 3CSTA 5D7SL 4HG4J 4HJIA 5E94A 4G9DB 3FRUB 5IVNA 4XHJD 5KVGE 4D9LH 2CIIB 2ZZUT 3AMLA 3QAQA 3KR3H 3OMNB 4LEEA 3RUGE 5C7XL 5GZOD 5IW1B 3UZVB 4AQAA 2AJUL 3FFOA 4GJTB 2D03H 3MRLA 3IDXH 4Y16A 2J8UF 5IGXL 5HI5C 3KDMA 1KUMA 2VKWA 4HPYL 1LWRA 5JOEA 4M6MH 3G6JB 4LLMA 2J73A 3D5OF 4AX3A 4I3RL 4S1SL 4U1SA 2FHFA 4K55A 4Y2LA 1N10A 4ZO6A 1U3YA 2A38A 1DBMH 1F90L 1HSBA 2PYFB 3BAXA 4PJCA 1FNLA 2NZ9C 4JFDE 2E9IA 3GXMA 1Q0EA 5IJDC 5EO0B 4EI6A 3K6OA 1DQLH 1MDAA 3L9RA 3X14A 4GG8A 3VFWB 3LH2H 1WFNA 2VDKL 3QUZA 3VFOB 1F6AA 3T6QC 4GI6A 1SEBA 1SM3H 2WBXA 5JYMA 1H3WM 1OP5H 3WIIL 1MCOL 5CEXA 3EOTL 4AQ8C 3QPXL 1HESA 3DJZA 2HKHH 4KKCD 3JTSB 5BZWB 4IBLT 1GGTA 1FCGA 4C83A 2Q20A 3ARTA 2GEQA 3AMKA 2Y5EA 3FQ2A 1U8JB 3NJIA 2DMKA 1MFAL 5D5MB 4K5NA 1TZIA 5A7BA 5GZNA 4PJ8B 1YYLL 4M8UA 5DTFA 5TDPB 4YHNB 3WKYA 3INOA 3WHE1 2QQKL 2D31A 2YRPA 1D7FA 4NP9A 3KBHE 5JORA 5ALBH 4DGYH 3WFCH 4C55A 3OAZH 1NC4A 4KQ3L 3MKGA 4AE0A 5DO2D 3MOBL 1JTTA 4LAQH 4JO8A 1AGDA 4E5XA 2CMRH 1NEUA 2AXFA 4KO7A 2FWLB 3EFOA 3CZFB 1SDYA 4D9RD 5B39B 2AJZB 1M3IA 1NAMA 1NUDA 3SE4C 3L1GA 1NLDL 1WG3A 2QBWA 1JUFB 1UA6H 2VLKA 1LQBC 3MYJA 3MRIB 1DJYA 3GMRA 5IEHA 4KJWD 3MMEA 1AS6A 5D7HA 1XH3A 1I7UB 3GIZL 2R9HD 2K78A 2OXHB 3EJZD 1A3RL 2GJZB 5EOCJ 5FPIA 4YHKL 3QDMD 1H3XA 2J57A 5I2IB 2D0FA 1BBJA 2DQEL 4JRXE 4MJIA 1LEGB 3LXUX 5KBPA 3GS0A 3JZ7A 3K6IA 4RFNC 3S5ZA 5L4JA 1BM7A 2CKBB 3EH3B 4LLQB 1CGXA 3SGDI 5AVTB 4ZNEE 2JIXA 1LP9E 4K2UH 1RJYB 5EU7E 1EGJH 4JFZL 4LQFL 3FF8A 4NKDA 3T3PF 4B9JA 4PS8A 1HAUA 3WKQA 3MNZB 4OIIH 2FX9H 5HGAB 1YEJL 1NCAH 5F70A 4JO1L 1W0WB 4N1HB 4Y8DC 3UBXG 4EUPB 5HGHB 4HZLA 5D7JA 2EUZA 1AIFA 1UUNA 1AMXA 1ASQA 3D39A 3NFNB 5AW5B 2RCSL 3TU6A 3O9WC 3S3JA 2F74A 3J2PA 3DOSA 1ZHKA 2X4TB 4GYBA 2FGWL 3GMOA 4YGVA 2W60B 4PV8A 3BWAA 3D07A 5HDRA 3KPOB 1VIWA 1RK0B 4QKXB 5D1ZB 2VQ4A 4E0RA 2LU7A 4ZK8A 5IIEB 3MLTB 1JNNH 2R2BB 5LN8A 2O5XH 2A6KB 2H9GB 4UM8A 5GJTL 2YPKA 1JXFA 2NY0C 3GYRA 4TUJA 5A2BA 3T4AA 5K39B 1ZOXA 2MNWA 2YUVA 5AFAA 4ZMAT 3IMVA 4I87A 4UINL 3HHRB 5B4MD 3SPCA 1QLEL 2OTWA 1TQCB 3UOAB 2R8SL 2YZ8A 3QR1A 1I7TB 5C3TA 4FFWD 2JI1A 2AKRA 5ESVA 1BREA 2WP3T 4XOCA 4FQIL 4HSAC 3D4GA 1QPXA 2DLFH 2O6FA 3OPZH 3UZQA 5DEJA 5I5JA 2OX5B 1YYCA 5AD0B 3DO7B 4KVNH 4PN6A 5C6PB 4KZEL 2FIKB 3BFOA 2XNAB 4GXFA 1NIFA 4EE2A 2XWEA 2UY6B 3QEQD 1YYMH 1XAKA 2VMJA 5D96C 1F42A 3HHSB 2HT2C 4WK0B 4DEUA 4YDNA 4OZGF 1WZLA 3WFDL 2Q3ZA 1EO8L 3K4AA 1P4UA 1RMFL 2YWYA 1JGEB 2R2EB 1NCHA 1J8HE 1CFNA 4G3YH 1OWRM 5BJTA 4N8VB 4H1LG 2WY3B 4X7CC 4A2DA 3KM1A 4NRZA 4X4MA 1QVOB 5E4EB 4Q2ZA 4JRXB 3MSPA 1KJ2B 3H2WA 3NGBB 1TSHA 4XO8A 4DK6A 4G1EB 1M4KA 8FABA 1P6FA 4BFIA 4E9SA 2B08A 5HYEA 2K3HA 3UG3A 2GSGA 2HRHA 3GSRB 1LP9B 1RZGB 3UTQA 1GGBL 5C07B 1UD2A 5KG9A 1PKQA 2WBJD 3DARA 1U2CA 4WSGA 4AYSA 2VC2L 1N7ML 3KYNB 5A6LA 2FH8A 3LS5L 5KEZA 3QIWD 1KIUB 4XWGH 4U4IA 2NQDA 4GAFB 4AEEA 4CNIB 5L9DH 3OXRB 5HI4C 3MUGA 3D2UD 1SEQL 5B38A 1RIUH 3KWVA 2C3GA 1FC2D 1E9QA 1SJMA 4HC1A 2PO6A 4G72B 4NQQA 5J5EA 1MCBA 4JGNA 5D93C 1KFAL 2VDRL 3BAEH 2XV6B 1Y1DA 2VDMH 2WKLA 3H42L 2RHEA 5FYJE 3GNML 3PLYA 4HIXL 4BFKA 3P0YL 3I6GA 4PJGE 3DTXA 5EFIA 1I1AB 2E9WA 4F9LA 5KS9F 3V0GA 4KHXH 2JXMA 1TTGA 4FAAB 4EN3B 3FT0A 3CDCA 5E8OA 4APQC 5TGBA 4HVBA 1YEHH 4OGYH 5J8OA 5ISZA 3LV3A 1QQDA 3TFKC 3MJWA 3OG6B 4KK5C 1KJMB 3CZKA 2BNUB 1EA9C 3MA7A 1LVEA 3WTUA 4ETYA 2Z8WC 3K80A 4I18A 3WIHA 4XN1A 4NN7C 1J9SA 4HXAL 1F4HA 4KY2A 4R96A 2GTWA 5EUOB 4O2CA 1UXSA 3QIBB 2BMKA 5AVXB 2EDLA 1JF6A 1WA2X 3KPPB 1XF5B 3DV6A 3POHA 4M1GL 1U3JA 4CN4A 5I15L 3AU1A 1MWAL 5MEOB 2NTFB 2Q87A 5L8KB 1ZD6A 4HIJB 1FO0H 4MKTA 4YHPA 1WC7B 2JCWA 4QHMA 2ZCHH 1FSKC 1UWXH 3MRBA 1MFNA 4NPYB 5E9AA 5E2WH 2CRIA 1OSZB 4ICXA 4JDZB 1LNUA 3CV5A 3QORA 1Q8MA 1TVBA 2ADJA 2AEPL 2NT0A 5I6PA 3T8MA 3VXNA 1NMAL 1QBML 4L8BA 1DO5A 3OAWA 4TVPH 5AYTA 1QO3A 1J0IA 1T22B 4OF3A 2LU4A 3NOIA 3OGCA 4IRSC 1BOGA 2YA2A 2NPLX 5SWSA 3WS3B 3OSKA 1GZHC 3CPLB 5SV3A 3JTTB 1K2DB 1U8IA 4X9HA 3UAJD 4KZDH 4Z3HA 4PBVC 5F8QC 4XI5C 2BVEA 4HU2A 3ZYOA 4XCCH 5K9JL 1JZ4A 4WVRA 2KUTA 5EIIA 4PCSA 4KVCH 1P7QB 5HVHB 4X8JA 5I0VA 3RZCD 3MJ7B 1EX0A 4EQ3A 5DJ2A 3R06A 4LASH 3DNKA 2IMNA 4UI2A 1IAMA 2VMCA 3Q48A 4NO0A 2WBKA 4K7FB 2P46B 4MJHA 3KE0A 5CEZL 1RERA 1VFAB 2NY3B 3BKCH 1N68A 3QRBA 2FO1A 4M48L 3OKNA 1XCTB 3IDJA 4XVUC 4Z76A 2PW2B 3MTXA 1CD9B 2ETWA 4JHWH 3SDDC 4TL4A 4GAYB 5DEGA 3LZFL 1TJHL 4HHGA 1ZE3C 4BWWA 1MHCB 3M1BB 2J12B 4LSQH 4PJ7B 1EFXB 3CFMA 3MCLL 3FU7A 5FV1L 4LEXL 3HC3H 3K71A 1N6UA 5F9JB 4L1LA 4P9MH 3HE6C 4K94C 4Y4HD 5FUOL 2HVKA 3ZU8A 4PMEA 2QFRA 2H3XC 4PRAA 4KDTC 4PJGB 3F62A 4XWOC 1NCIA 4XPTL 3UYPB 4DN3H 1GSMA 4QDGA 1UD5A 5ESAA 1DANT 5E7BA 3O41A 1FBIH 1IAOA 1R24B 3OLIA 2WXPA 3H6JA 3C5ZC 5E1HB 4ZMPA 1OT1A 1KYOJ 1XGZA 1T89C 5I1KH 1WTGT 4ZI8A 3KBEA 1MCEA 2G2RA 3BWUC 3MZGB 4YN3A 1HQ4B 2AK1H 4QOKA 1QA9A 3DX9B 4GBXB 4CUCA 1UWYA 5E8PB 2J21A 4ENZA 4OM0L 5IR1A 4LVEA 3RE0A 4FXGC 5GGSA 5GS0C 4ZMQA 4GG6A 2NDGA 2XN9E 1QWNA 3W39B 4X80H 2NXYD 3VXSE 1SY6A 3FRPA 4ZXBB 2IBZY 3V4VB 1DFXA 3OX8B 4PY8I 4P5MA 3TH4T 4KPHH 4MRBA 1A1NB 5C92A 4A04A 4ZTPL 4KV5E 1AD9A 1SZNA 4GQRA 5F1NB 2ZPKL 4UU9B 1NFIA 3NA9L 5C0AD 3RY5A 2EDRA 3E2HB 4XP1H 1JZJA 1NICA 5KW9H 5K93A 2DEWX 4XBGA 1DCLA 1BAGA 3VFRA 5C0JA 1SBSH 4WW2F 3AG3B 3EYSH 2V3EA 1RD6A 4MCZB 4U49A 3GSNA 1RZ7H 1OGTB 1FNSL 3L13A 4AQ8A 2CM5A 4KJQD 2AMUA 2K6YA 4DUWA 1DUYB 4XCFH 4A7GF 4ODHH 3ECQA 3X2QB 1WE5A 3STZA 1S9YA 3Q5YA 5JXAH 4KMQA 1F11B 4M7KL 3L45A 4P57B 3SQBA 2W59A 3QP3A 3RX5A 2RGSA 4PJ9C 1T66D 5IHZB 2NW2A 2DQUH 2ENQA 1DBBH 3O0RH 4HMDA 4MDJB 1CFSA 1CLVA 3MLXL 4IMLA 4PRDB 3QDGD 1XVSA 3ESVF 3EHBC 1ZA6A 1CFMA 1IKOP 4N5EC 4LHJB 1E4XI 3INUL 2CJTA 1QSFD 2NY4C 1I8IA 1A3ZA 3X3GH 3BUBA 3BKYL 4M9PA 4I3SL 1Q1PA 3PDDA 4K9EL 4ZUWB 4LEBA 1HKLL 4NJAL 1QWHA 2JQZA 3NRFA 2CXGA 2WCGA 1D6EB 4IU2A 4X0NA 5F6IC 2A9MH 4ONFH 4AY0A 5I6KA 3VFSA 5CJQH 1WUNT 4Z7VA 4H26A 4XX1G 4IBQA 2BNRE 2XSKA 4MJ2A 2WXIA 4PY7A 3VWKC 2YGVA 3RPKA 5C97A 4IJTA 5JW5A 2G75B 4PRID 5IQMA 5ID1B 4AQEA 2NNFA 3DV4A 2X1WL 4IOIB 5FF6B 5LQBL 2JMRA 15C8L 1CL7I 3D0LA 1W15A 2IFGA 4KKLC 5F44A 2FJHA 2VXSL 4MA8H 4X42A 4XCEB 2V2WB 4JM2B 4J4PD 1Q0XH 1A6TB 2XBTA 4IKLA 5D7SH 1OP3K 1CPUA 1XXFC 1F2XK 1U8OA 5HYSA 3IRCA 4MD0A 4N8PA 1KLUA 4P99A 1E3FA 4AH2B 5C7XH 3TGXA 2QVFB 3EYOB 3X3FL 3KYOB 2HT4D 4WKZB 3TO2A 2EAEA 1OGPA 2D3LA 2YMXH 3JWNC 3QNYA 4NRXA 4LHUD 6PAZA 5BXFB 4JFFD 3L5HA 2KQMA 1FNEA 4OF6A 5FKPA 1KIPB 4I3RH 4FD0A 4CSTA 1A7OH 1H0DB 3T1FA 2Z8VC 1HILB 3V55A 4P2RA 4E36A 2X4PB 2X2UA 1DVQA 3GSOA 3VXSB 3BPLB 4PVMA 1W72B 3NEXA 4IGBB 3ZRCC 4XZUA 3FFCD 4XMTA 3BUTA 3ALXA 3O9WA 3IAQA 3NSDA 4PPTA 3L4ZA 4JDVB 5J12B 1RURH 5T3ZL 1F13A 1JPEA 4HIIB 2H1LM 3S36L 3EF7A 2BIMA 3DROB 1Y6MR 4XP4L 3BQUD 1PF3A 2ITDB 5EH1A 4HPOL 2AQ3A 4DFIA 3RVXC 4I0CC 4BBWA 4A2LA 3H4HA 4YL9A 5LWYL 4CVXA 3R8QA 1XF4A 5CEZD 1UT2A 4GEIA 1J0KA 4OF7A 3QPXH 2GC4C 1JHTA 5KVDE 3P11H 4JQIL 4I0PB 1MHEA 1NGXB 4HKBB 5LHDA 3HN3A 4PG9B 5EEUA 1T80A 1KGWA 4QAMB 1T0NB 5C8JB 1G1KA 3UTOA 1QFPA 5TQ0L 2WN2A 1WFUA 5C0BD 5T1LD 3ULUF 2IVFC 3ML9A 3IXAB 4U6VL 4XXDA 3GBDA 1T0OA 3HUJA 3RVWC 1MFAH 4P2QA 4WEBL 4PW9A 1HWGB 3UCQA 4IEFB 1YYLH 4L1SA 5EZPA 1EXUA 1I1CA 4CGUB 2LHAA 4RMUA 3HJ0A 2BNQA 4DUVA 3NIFE 3L5XL 1FPTL 5F3BB 4Y8AA 3RVUC 4NNYB 5DF0A 4L8DA 1ZLEA 5EU6B 2OYPA 2WZPD 3B2DC 1Y0LA 1NDGA 3PE9A 2ISDA 3MOBH 4U1KA 43C9B 3D8MA 2NYYD 4C54A 1T1WA 4LSRL 1KGUA 4QR7A 1T03H 1JFHA 2ZCLL 2AS5M 2WVTA 5I71C 1JIBA 4BFGA 2CGYA 4MA3B 3RLSA 4HUNB 1TDQA 2HJLA 2X4RA 4MA1B 4NP4L 1C9SA 3UBXB 3Q13A 3VI3F 5CLYA 1HNGA 3H2QA 2KS0A 2ZX8A 1WGVA 3REWA 1DQJB 4N0FB 1Z9PA 4A66A 4QRPD 1E4XL 5DRWB 4NT6B 3FCUB 3LDBC 4JRYD 1U2HA 4HGWB 3ZRFC 2CBQA 5ICYA 4LLUA 1LDSA 4PR5B 1TLKA 4YO0A 2EUVA 2IGTA 5DSCB 1GIGL 3LD8B 4OY9A 1AS7A 3RIKA 3VU2A 1NCTA 3VFMB 2YXVA 5F7HA 1XGQA 3LZOA 2VO5A 1UZ8A 2DBLL 4BFBD 3MREA 5F6HJ 2OL3A 1ZHBB 4LQFH 2ZCZA 4AZ8A 5J0BA 1CL7L 5EBMB 4O9HL 4NSKB 4U1HB 1YQVL 1O7VA 4PS7A 5I9QB 1JGVH 4JO1H 4BSWA 4JKMA 1LO4H 4HIHA 4JG5A 3EDEA 3FAXA 3VRIA 1A6WH 5EG6C 1O7DC 3ASWA 3BP5B 4XP6L 3S3CB 1HHKA 1GKOA 1KXVC 2DWDB 3U4BL 4ZRGA 1XR8B 1MCRA 3APFA 3V95A 1OAYH 2YAPA 1PSKL 3TO4D 2FGWH 4NC1C 1JNLH 2IDTA 2QMKA 1KPRA 4MJ6A 1G7MA 3QYMA 4OKDA 1U95B 1OAZL 1R5IA 2Z9TA 4WJKB 1QFWH 3CZJA 4OJCA 5HJBA 3SJVE 2EDFA 2IV9A 2WUCH 4H7VA 2DJ4A 2XXCB 4HZAA 4U4BA 4E9TA 5IOKA 1EEYB 1W0VB 4UQ2B 3US1A 3OXSA 2XG5A 3AG1B 3I9GH 4N2FA 1TYEB 3W56A 5GJTH 4MCMA 5CUSH 4JN2B 2SEBB 5EHFA 4Z7UA 5EN2A 1AQDA 5ANHA 1N5YH 2JV6A 5HXMA 3MCG1 4G6ML 4BZ2L 3H7BA 3U6RB 3CSYB 5GSVB 2IDFA 1MHPH 4KK6C 5CJ5A 4UINH 1WBXA 3MJ9L 4NHUB 3NIFB 4C56A 3LEYH 1QLEH 3NJNA 2R8SH 2QT6A 3E1F1 2FSEA 5C6WH 3QG7H 1CDUA 4EDXA 4PJ8C 4YBLB 1YPZF 4LEOB 4FABL 4YIQB 2GPZA 2BM3A 4IBSA 3CBJB 4NCC1 5EF2A 5K1VA 3ILPB 3L3IA 4FDWA 1IGML 5EC2A 6FABH 5DUML 3I84A 5IF0A 3WYRA 1I3GL 1IM3B 4KZEH 1BEXA 2OMWA 3QQDB 3BCDA 2CO6A 4TLSA 4FJZA 4IRSA 5IEKB 1WZ1L 1BMWA 5G4OA 3FN3A 3S3SA 3RI5F 3KPLA 5DQ9A 1GZHA 5KZCD 2L4OA 4R3SB 1MCNA 1TPXB 2F5BH 4Z77B 4NZFA 5DS8B 1YEFH 3WFDH 1EO8H 1RMFH 5FM4A 1TJMA 1F58L 3HC4L 3D2TA 4LK4A 1TR7A 4OFYA 4UV4H 4JLRB 5LBSA 1Z9OA 2V33A 4XGZB 7PCYA 2ARJQ 1WDAA 4N85A 4JHUA 3VD5A 1ZHLA 3ALWA 4G9FD 1E7UA 3W37A 1A14H 1TJXA 5T3ZD 5TE6L 2EDJA 5E8EB 3UAFA 2Z31D 5DC0A 3V6OE 2WLHA 2ZOKB 5EZLB 2FATH 2DD8L 3F12B 1VERA 3U36A 3ULUL 3IDMA 2L7EA 2CK2A 3MRQB 5DHVH 1T5XB 5EBGA 5EZJA 2OZ4A 1CCZA 1VFUA 2R0ZH 3MZTA 1P5UC 1VLXA 4PJ5E 4JY5L 5DJ0A 3SDDA 3I85A 2VC2H 3NPZB 5DFVD 3LS5H 3T0WA 4F92B 5IMLA 2VGLM 2X28A 4G42A 5KOVC 1RPQA 1LTXA 1U9KA 1RIHL 3V8CA 1JXGA 1GKEA 1QASA 4Z3IA 5JDSB 1M7DB 1SEQH 5LXVA 3BYYA 4NWUL 2Z0BA 1KYDA 3NMEA 2H47C 2GBAA 1FH5H 1ND0A 2Q3XA 1E0OB 4JUTA 4PJHF 3KWTA 3HE6A 1KFAH 4C47A 1D3CA 2VDRH 3H42H 4W4OA 3GNMH 4PJEF 4Z7WF 4KDTA 5FLUA 4OIAA 3S5LA 4QJ5B 4WWPA 2ZAHA 4GI9A 1JWSA 3DBXA 5PCYA 3C5ZA 3MNVA 5I0YA 2E47A 4L8CB 5GRYA 3ZJAA 1Q9LA 1T89A 2WNXA 1TQUA 3OKEA 1AZNA 2Z64C 2X6AA 1OM3H 4F57H 2PUQT 4AMKL 2F58L 4J3UA 3PHOA 1NBZA 4Y7OC 3ARXA 3ERXA 2I26N 4Q4EA 5SWZD 3UCRA 3UTPD 1NFDF 5D1ZC 3RBSA 4FXGA 3STLA 5FFLA 3S9DB 2CLZB 3IFLL 2NR6D 4Z18A 4M1GH 3DXAD 4ELKB 5I15H 4JX0A 1S7VA 3BAIA 3IF1B 3T0BA 3PREA 4C4BA 1ZT1A 5I1JL 3BH8B 1F4YL 1VCAA 1T5WB 2BW5A 1IU1A 4ATWA 3DSFH 4XBEH 1KTJA 1IM9D 2VDNL 2QVKA 1LDPH 3RG1C 4MAZA 2ZKHL 4LSVL 1KEMH 2CSPA 3TN0A 1BIIB 4MNHA 3MROA 3VW3L 1VHPA 1NH6A 1F8TH 2ZUWA 1AACA 3BH9A 4LF3B 4F5CA 3TF7C 3DX6B 2O5ZH 3TBVB 3VFNB 2CUHA 4U6YA 4XCYB 1QBMH 3QXVA 5D7LE 1T1ZB 1TQCC 1ZT4A 2J5WA 1AFVL 4DO5A 3CG8A 2Z93A 3H3KA 4AENA 5C0DB 2HH0H 2JJSC 1LHZA 3Q6FA 4WWKD 4XX1E 4JVPA 1L9RA 1ED3B 2F53D 3D30A 4CJ0A 1TZGH 1U0QA 3C8DA 1NPNA 2Y3NA 1U2YA 3OB0H 4ANUA 3LEVL 1EUUA 2W81C 2HTKD 5FO9B 2BY2A 2FNBA 1WA1X 4KXCA 3PUUA 4BA8A 1N5AB 2X53A 1W80A 3QFJD 4PJ9A 3DRQA 1DQDL 2DYPA 1UB5B 2Y23A 4H0IA 1IAKA 5GGUB 3O2DL 3QJHB 1DZBA 1T3FA 2R1WA 4R4ND 4L1TA 1A6VL 4X9GA 4BZ1H 1OE2A 1PD6A 2L7QA 2HFFB 1OP3H 3R8BB 5I6OA 3F58L 3FH8A 3VQLA 5JQ6L 1JZDC 1CGTA 1JV2B 1RZQA 4JFHE 4NYLA 3BVUA 2JVUA 3KPSE 4P59L 5E4EC 5CEZH 1FFOB 1ZLUK 2C9SA 4U1MA 3NGBC 1PVHA 1OGAA 1L3NA 5K1JA 2DDQH 4QRTB 3UJJH 1TJHH 3GLDA 5EU7C 3ATDA 4E41D 1XB8A 2VH5L 3P0VH 5IV2B 5MP6H 3FHAA 3VWKA 2B8OT 4R8WL 4OGZA 2PW1B 3HHMA 3L3HA 4NO2A 2DN7A 3W3BA 4LEXH 5A7EA 5KSBA 1UZ6E 3V0WL 3US0A 1SY6H 3ZL4L 3QWOA 1OAUL 2ZUTA 3QDJE 2D9CA 4XN2A 5DHYB 1DBAH 1OPGL 4XN5A 5I1GL 3ESUF 2HMID 4GKZA 4PJ6A 4XPTH 3F7VB 4U33A 2ZWYA 4X4KA 3TBSB 5BQ7A 4PH8A 3UTTE 2ITCA 2PPFA 3VCLA 3B6SB 2NX5E 4UDTA 3UTSA 4PP1D 3BJLA 4FP8H 1OW0C 1I1AC 2ZWSA 4ZFGL 5AW0B 5CWSB 5MERA 1T1XB 1RP8A 2W0FB 3EGXB 4OD2A 4EN3C 2HVJB 4FQLH 1XZ0A 3Q5TA 5EU3B 5IHUL 3PHAA 1AXIB 3HEIB 1U8NA 4OM0H 3ZPDA 2ZOWA 1E5YA 2IAMD 3C6LD 4YBQC 1JYXA 4IHOA 1QG3A 1SUHA 5T5NG 1MVFA 3UAEA 1SDDB 2V7HB 4H88H 1GY2A 5EN3A 4JGJA 5FUZL 4B7LA 1PX3A 4CN1A 1UWGL 4OT1L 5CFHA 3QIBC 1I1FB 1SNRA 2EXSA 1IGFL 2ZF8A 1AO7A 1MIML 5FR3A 1KXTB 3VQ1C 3EJUA 1DR9A 1J9QA 4D3CL 1KB9J 1URIA 2VXVL 2ZPKH 4H8PA 1MPAH 2GSIA 1FNHA 1KBGL 2FEEL 3PNRB 3NA9H 3QRLA 2VM4A 1F3RB 5D7LB 1GJUA 2CUAA 2LLLA 3LKPB 4W9GC 1N67A 3QS3A 1WAAA 3EH5B 1RVFL 1S8DB 1FNSH 4A6YB 2PCFB 4RX4D 1IFHL 1NTDA 2Q7YA 2Y22A 4YE4H 3MV7A 3ULUD 1CDIA 5IB2A 2VXUL 3CDZA 3ZKXC 4M7ZC 2K8MA 4CMMA 3IJSB 3H0TB 1JF1A 3OKKA 2HUHA 2OCCB 2QQQA 3HMXL 3ZRSA 4Q9RL 3PHSA 2YSSA 4QWWC 1A6AA 3PGDA 4HUVB 2VRAA 1JZ5A 4N6RB 4XNYH 3UBHA 4E9WA 3ZT5A 1SN0A 1KTLB 3SE9H 3GGWA 4E2OA 1WBZB 5DZPA 1GTNA 3SE6A 3INUH 4NO3B 5FYKE 5HVHC 4ERSL 2X6UA 1LYQA 4Y2OA 3ZTJG 3MYZA 3NN8B 2AJSL 1KZYA 1P69B 2WJ5A 3BI9X 1UD3A 3H53A 4POZD 5CGMA 2GIXA 3ZE0E 5H35A 2PCPB 2ICES 5B3JE 1AGEA 3TBYB 4Z7OF 1HKLH 4NJAH 5JA8B 3V6FB 5JW3H 3LB6C 2VL5A 2WZ5A 4PRPA 3UGUA 4QRRE 4CILA 1IGJA 1QKZL 2NY3C 3HLKA 7FABH 1UOLA 3RL1B 3VXPA 2KZ1B 1EHLL 3R4DA 4XNXH 1DQQA 5LQBH 1MFBL 3EGSB 3PP4L 2CIKA 4N0RA 2B59B 4R4FL 2BDNL 4GP5B 4H8VA 4ZSOE 1NMBL 1XEDA 3BZEA 3M88A 5TE7H 3QO0A 3G5WA 2VXSH 3HPJB 2BP8A 3ZZQA 2XTJE 3QXAB 2GJ6D 3U2SA 2Y06H 3QWRA 4EKXA 1S7SB 1CXHA 1U8KA 3U1QA 3TT3L 5LNGA 4WKXA 4HEPA 4B9KC 4HSCX 5LGJB 5DXWA 1J86A 4J7RA 4KRPB 2OR7A 4G9DA 1MLBB 2XYBA 5MEND 1WCQA 2AC0A 1A8JH 2CIIA 2F6AA 5L0QB 2MTAA 4B5ZA 2NY7L 3GPEA 1IQDB 5IW1A 3UZVA 3HNVH 4R5TA 2IGFL 3WL9B 4L4VD 2CA3A 5F0PB 4G5ZL 4JBSA 4JGMA 5DMGC 4ODBD 2WLMA 4N87A 4GAGL 3WXVL 1U8CB 1RFDL 3UJIH 3GRWA 4KTDL 2Z3FA 5ERWB 1MXDA 5T3ZH 1UJTA 4QRUB 1K6QL 3CZGA 5J11B 4ZXBC 2PYFA 4DZ8B 4NFDA 4XOAA 3ZMRA 2BFVL 2YXFA 4IRJD 3T9WA 4G8GE 2W07B 1CFTB 2WIIB 4U1JB 3FO9B 2H6UA 3WE1A 5EO0A 1ULVA 1TVHB 5LWYH 5FO7B 2COQA 4JPVL 1AS8A 2A6DB 1E4WH 1XIWD 3LRLA 5EO9B 3NZSA 1S3RA 4NHCH 3VFOA 3VX0A 1A3LL 2FIRT 2YO3A 5BOJA 1K8IA 3L7EB 4XVOA 5JW4R 5DK3A 2E5EA 5IVZB 3ROLB 5TQ0H 5C0ND 1FLTX 5JW4M 4J3OF 5AAPA 1BJMA 3F5WB 5BZWA 4F20A 4D0DB 3S88L 1OLZA 2VDOB 4PCKA 1FLRL 5GSRB 5ADOL 2O6CA 3BAWA 5ECGA 1U8JA 1BSIA 4L8SB 4OLYH 2Y0SA 5D5MA 5EPMB 4J6RL 1WSST 4PJ8A 3ZE0B 1I8LC 4ZS6C 3WBDA 1UATA 2Y7LA 3C08L 3A5VA 1T6BX 4GSUA 1FJ1A 1BAFL 4YHNA 3EYVB 2VISA 1QUNB 4LSUL 3SKMB 1B0RA 1YDPB 3C09B 4HJ0D 3LZLA 4LSRH 4BFEA 5LUMA 5BVJA 2CJUL 3QUML 2VABB 5EOQH 1RSFA 4G8AC 4RBPH 3K5SA 3SYAA 1QRNB 3GUTB 4NP4H 3VGFA 3CZFA 3C60D 3RQ3A 4HUWB 3LTVA 2WQAA 4LSSH 2PLTA 4OBRA 4Y1AE 4Z7QE 2WLKA 3EUDA 5CLZA 3LHPL 1K5WA 1JUFA 3KJ4B 3TN0D 3VSUA 2R4SH 1DLFH 2X70B 2XTJB 2BVOB 4XPBL 1N64L 1I7UA 1R75A 2NYZA 3W2DL 1MUJB 1XF3B 3DX0A 3VSQA 1GIGH 3BX7C 3SDAD 2GJZA 3BVWA 3GLAA 4N2KA 1RZPA 3CFJB 2FQEA 2DBLH 3MBEB 3MV9E 1EERB 1MXGA 2CO7B 5I2IA 3VRJB 3L3DB 3LRHA 4YSUA 1LEGA 4Y2DB 4J2XA 5JOFB 2WWNA 1P5UA 4LLQA 4LO9A 3L4TA 1Q9OB 1CFVL 1A6ZB 1YQVH 3QVAA 3LKSA 2VDPB 4WHTA 1RJYA 4G80A 4AIXA 4N9GB 3QA3B 5ECJE 2XY1A 2B77A 2DI9A 2OI9B 3NCMA 4ES8A 3FO0L 3K2UH 3MNZA 3FMGH 1A4AA 3MTRA 2IH8A 5HGAA 1OV8A 3MBWB 4U7MA 5EU4B 4S1RL 4ZOCA 5CKAA 4JO4L 5JIMA 1W0WA 2VZ3A 4GXVL 3U4BH 4EUPA 5J9PA 1BM3L 4OQTA 3BPLC 4P48A 1MFEH 5D1QD 3NFNA 3VXQA 3K46A 4IGBC 1PSKH 1M6OA 4I13B 1HZKA 4G2AA 1R17A 2Q6WB 3MLSL 1WS7A 1JF5A 5T1DH 4JFDA 3T3ME 5L2KE 3SBRA 1NGZB 5J12C 1OAZH 3ZE1E 5FECA 4IIZA 4ZO8A 1NCBH 4FFZL 3W82A 2X4TA 1ZTXE 5D7IE 3E0GA 1PMYA 2W60A 1TEYA 2F8VA 2CWRA 4R6UA 4NIYE 5IHHA 1HHHB 4KFZC 3FUJA 2ICWB 1S7UB 4GSDH 4XT1C 3TP4A 5D1ZA 5SWQB 4GMTH 4S2SB 2QGDA 2PPDA 5IIEA 3MLTA 4NDMA 1JPST 2XA8L 4I0PC 1A1MB 1W8EA 2CRZA 2L0DA 3O3BB 4H20H 2XBZA 2R2BA 4MJJA 3ZDXE 1MWOA 3KLHD 2A6KA 4G6MH 5C08D 3B9KC 4BZ2H 2F5AH 1J1XH 4DEPB 3RDTA 5DS1A 5EEXA 4FCHA 4Q7DA 3H6AA 3E38A 3UO1L 5LBSH 3FSWA 1WFJA 2IMMA 2K4WA 3HB3B 5IT2L 4RGND 3EG9B 2AP2A 3X1EA 2GITB 5F21B 1BQHG 4FABH 4JDTL 4KJPC 3H8NA 4XNUH 5AW2B 5AKSA 3NTCL 1E5UI 1IGMH 3DVFA 3WELA 2YPLD 2PPEA 3MV8E 5JIPA 1I7TA 2HA1A 2BOBB 5HHMD 3EO9L 3HR5B 4WUUD 1Q9KB 2JJSA 3D85B 4UYQA 3QI9D 3QIUD 3RGVD 3D3VE 3T0EE 3VU1A 5AD0A 3DO7A 3GSWB 4LPVA 3CCHA 4WTZG 5AVYB 3T6XA 2FIKA 4Y1AB 2FLRT 4Z7QB 4TQIA 2UY6A 2VDQB 1F58H 4GINA 3LNDA 5LJYH 2MHAB 5IMKB 4MA1C 5IQLA 2AQTA 3HHSA 2YD0A 4J12A 1LEKA 2N7BA 5J57B 3DK0A 4WGKA 1E4JA 4TYUA 1BGXH 4GI8A 1D5ZB 4JDEB 4MYWB 4HH9B 5TE6H 4DTGL 2IWFA 1WEJL 3DRTB 4MXWL 4N8VA 5IBTL 2FEJA 1A4JB 3MV9B 4GIPD 1QVOA 5HHVL 1NCDL 2DD8H 4JRXA 4ZS7L 2X2IA 5F9OL 4G1EA 4PJFE 3ZYZA 5KTEL 1FYTB 1UOWA 3MRKB 4FJYA 5E2UL 2FT6A 5AW6B 4ZNEA 4OZIE 4U05A 3GSRA 3WN5B 3UTZB 1LP9A 1UQSA 1RZGA 2WLNA 5D1XD 1RIHH 1NCWL 1GYWA 1KTRL 3GMQA 2ODIA 1RJLB 1MG3C 3KYNA 2VLRE 1PX8A 1KIUA 2DPKA 4G7YH 5I9QC 4MS6A 3VDCA 4CNIA 1KBVA 4Z3JA 1HEHC 2Y1ZA 1FQ9C 3OXRA 4M61A 1JZ2A 4Y9EA 1V55B 2EDHA 2I5YL 2XN2A 1B9KA 3K6SB 3CVHB 4FLOA 3II3A 2K70A 3FU3A 5I18L 3T5WA 1D5MB 2ESVE 5L2KB 4R83A 4AW7A 4AJ0A 1PQZB 1R46A 1EEQA 4LZKA 4JRFA 1UACL 3TPUB 1I1AA 2P8PA 1IILE 5LLIC 4BH8B 4TTDD 2F58H 2F1AA 3W11D 3SDXF 4LAJH 3FQWB 4DO6A 1X4YA 3OZLA 3N9GL 4TLKA 2DYRB 1KJMA 2BNUA 3KYAA 1VPOH 3V5DB 2QV2A 3Q0HA 2YD9A 3ZDXB 3GMNB 2E27L 5KAQG 5IHWA 4WO4C 4X5LA 1MHHB 3QIBA 1UASA 3KPPA 2QVMA 1EJFA 3MLUL 1XF5A 4FXKB 4UOJA 5LCVH 2VDNH 1J18A 4WEEA 4P5RA 1SN2A 2IPTL 3NYKA 3AG2B 1FE8H 1B0IA 1AIZA 1KYFA 4DESA 4HWUA 5MEOA 2NTFA 1G87A 1V7NH 2FWUA 1X5ZA 4FQHB 4HIJA 5LXGH 1H6TA 2AABL 1WC7A 3PABB 2BRRH 4NPYA 1XGPB 3MV8B 5B1JC 4B60A 1SLXA 2GBTA 1OSZA 4EZJA 2G30A 3WAJA 3KLDA 1R3KB 4YBLC 5GJSL 5CN3A 1D2OA 4Y16D 3NVQA 4KK9D 3O4LB 3TASA 1AVAA 3D3VB 4KZCA 3T0EB 4A7TA 2HKFH 5DEFA 3GJFB 3LEVH 1PLGL 2Z8RA 4KI1A 4LESA 2XZZA 3IJ7A 3MV01 1IGYB 4N8UA 3ROOB 3JWOL 3WS3A 4NQDE 4BH7A 1IB5A 4ZO9A 3DX3A 1LXMA 1DQDH 3CPLA 4DCQB 1K2DA 4FQQA 1TPXC 2VJ0A 2H3NB 4XX5A 1WQVT 2IQAA 3MUY1 1T4WA 5JIDA 1J8HA 4WTWA 5E1IA 3WNJA 3ZKNC 4L9DA 1NLBL 3MJ7A 3D4CA 3QUZD 1N0XH 3OF6A 1EZVX 1MCHA 2LR4A 3SE8H 4JFOB 3B2XA 5E95B 1K3IA 5DLLA 1LO0H 4A7QA 4PJFB 2VXTL 2UZXB 2YD3A 4K7FA 1HHIA 4X8XA 1NANH 2EXYC 1HHGB 2QELA 4OZIB 1A0QL 3X1GA 4GB9A 1VFAA 5F1IB 3IGUA 2PW2A 1INQB 4HC1L 5FGBC 2AEQL 4R8WH 5EBWB 3D4YA 3ZLQC 2P4AB 1ZPLA 3V0VB 1TXKA 5DJYB 4YNYB 4U3HA 3CD4A 3B83A 4AYMC 3VD2A 4L0ZA 1MHCA 1MFUA 1OAUH 3M1BA 3P9WB 1Z9MA 1G4MA 3PIQB 1OPGH 2VRKA 1IRAY 4ZAKB 3VGGA 3ARBD 5F9JA 3ZR5A 2ESVB 4KKAC 1GGYA 4GUQA 3U4AA 1NC4D 4FI8A 4PJGA 3WU1A 2YBRB 2VR8A 1INDL 3O6FB 1R24A 2I07A 3OMAB 4Y9CA 5EC1B 2EC9U 5I73B 1SFHA 1TTRA 1OY3B 5KBDA 3GSXB 4ONHB 2VLKD 4E42B 3W0WD 4ZTOL 1J88A 2QKSA 3DX9A 3PDOA 4EOWL 5FUZH 5E8PA 3I6KA 1UWGH 1NCOA 4LOUC 4AL8C 1PD1A 4LIQH 2X4SB 3C9NB 3U4EB 2WNWA 4MAYD 3CFKB 1MIMH 2V9UA 2ZT9C 3JWDH 2CPUA 2QQNH 2VXVH 2YRBA 2UX6A 1ILUA 5TDNA 4ZXBA 1JXDA 1MJJB 3HG1B 3V4VA 3OX8A 1E65A 1D5RA 3RY6C 5CXPA 4GO6B 3NFPB 4BSVB 4JFEE 1HHJB 1CE6B 5F1NA 2EADA 4QXWA 3NJLA 3KG5A 4M29A 2JJWA 1RVFH 5HI3C 3WTVA 1KSRA 2WQ8A 4X6CB 1T7VA 1IFHH 4G8IA 4J3OD 3SCMD 5IJCC 1NCNA 1J7VR 5JW4N 3SBQA 2HLEB 3RVVD 3KM2A 4MCZA 3HMXH 4GRMA 4PBXA 5E6ID 3MHZA 4TSCL 2FR4B 1OGTA 4Q9RH 5A2KH 2G60H 3PWPE 2ZD0A 3PGCB 2XG4B 3WKML 4CA4A 1DUYA 4NZUH 1LO5B 4PUBL 1P9MC 1PZSA 4NOBA 1CGUA 4WV1B 3QQ4B 1YY9D 2B1OA 3UC0L 5IFJB 2IQ9L 3N41B 2WNGA 3QHTC 4PB0L 3VXUE 2AJSH 5H37H 3PXHA 1I8LA 3N91A 1MI5D 4F3FB 1J10A 3PPEA 2H8PB 4S1QL 3GB7B 3DHUA 5E4AA 4AJVA 3E6FB 4NI3A 3V6OC 2R39A 2UX7A 1R3IL 1QKZH 3MCKA 5CSZB 4NQED 4DPBX 4QHLB 4JJHA 4G6AD 4ZUWA 2WINB 4OJFL 3VSVA 1D6EA 5LKNA 3LKOB 1PNDA 2IADB 2J3SA 3IXTB 1F4XH 2FCBA 4DT2A 1OB0A 4NQSB 2BDNH 2X4QB 4EEEA 5E7FA 3ZE2E 4LPCA 1NMBH 3WTWA 5FCSH 4XVSH 3NIGE 2Z4TA 2P5PA 4LCIL 4LBEB 4WUKL 5ID1A 5D2LF 4Y9GA 3MUUA 4JS7A 3STBA 3ASNB 3FT1A 1H8OA 4IOIA 3HN8A 4M5SA 1TQSA 2WLZA 3LN5A 5FF6A 5IESH 1BFVH 2NNAB 4M4PA 4RVBA 1UWEH 4XMUA 4DQAA 3GJEB 2CLRB 4XCEA 2V2WA 4EPSA 3E9UA 5CD5D 1IKFH 4I88A 2XWXA 3O45B 1A7PL 4FQJH 4JQXC 4OLXL 2OA9A 1BXXA 5DD3L 4AH2A 5SX4H 3EYOA 4JY4B 2IFFL 3KYOA 4FG0A 4J3TA 1UOVA 3QJXA 3ILQC 1XX9C 3BVNB 5CBAA 2IPKB 5BXFA 5DJXA 2F18A 3AJ7A 3KLLA 4K5PA 1KIPA 2LW3A 5EUKB 4Z3FA 1OQXA 2D9QB 4UF7C 2JLPA 2XN9A 1VSCA 4GAGH 4CU7A 4E5XG 3VGEA 2E4TA 4KTDH 5G2NA 1ACCA 5HD8C 3NCEB 2NY2D 3CUPB 2R56L 3MRFB 4U6XB 3VXSA 4BE5A 1LMKA 1HL8A 1W72A 2E75C 4IGBA 2G9HB 1HNYA 4JGUA 2BFVH 3EADA 1A4KB 4RWHA 4DP1X 4X98B 4NB7A 2X4UA 4JDVA 4JFEB 5E2VL 4KY1H 4U1IB 5CU9A 1DDHB 3GSNL 4HIIA 1FZOB 1HZHL 1DBJH 3DURB 4JPVH 4QRBA 4AQ1C 1HU8A 3T71A 3PDGA 3QE5A 3NJFA 1TJGL 4Y1SA 1CBVL 5IJVB 4XMKH 5E2TH 1XH0A 4Q8BA 3CH1A 3C87A 2KPNA 3RWCB 4F7PB 2CLVB 1GSKA 2ZOUA 3PWPB 2BOCB 4POUB 5E6RB 3CC1A 2PWDA 4HKBA 4U1NA 4PG9A 1T0NA 5C8JA 3B9KA 3S88H 3NH7H 4HS8L 3T2PA 2KBGA 1FLRH 4JANB 3OLGA 5C2UB 1TCRB 2EDWA 3EYQC 1TO4A 2PWEA 2QSQA 3HI6H 3VXUB 4KKNA 4Y4KD 4Y19B 1T21A 2DMGA 2HXAA 5DZ9A 1ZS8A 4NKMA 1QP1A 4P5SA 3KCPB 3MJ8A 3L95B 4XZ4A 3SQRA 2EE9A 5EF0A 1EAPB 3WCYA 2AAAA 3N85H 5F3BA 4NNYA 1KIQB 1OCWH 2CJUH 3ZT6A 2RALA 4FN0A 4ALAL 3EJPA 1HIMH 4LPXA 1SXSA 3FB5B 4PJIE 3N06B 3FJTA 4M6AA 43C9A 4JHVA 3QXWA 5I19L 4WDIB 4X5RA 3BO8B 4M4RB 4LARH 3LXAA 3U48A 2HUEA 1NKRA 2BNRA 4CL7A 1RL1A 4BHUA 2CR6A 3BC9A 1C7SA 4IQHA 4MA3A 3ZE2B 1USQA 1MOEA 4I48B 3WMSA 1TT6A 1WVZA 3UBXA 5I1LB 1P5VB 4X99A 4XPBH 3HVNA 3PL6D 4N0FA 4R97B 5E2JA 4Y5YB 3W2DH 4IW4C 3WIAA 2BC4B 3HC0B 5DRWA 4NT6A 5IW3A 4PJAB 2YKLL 2R4RL 5EDSA 1EXHA 3VD0A 2E7CA 2PWGA 5DJDB 4IBVA 1B4LA 4JY6B 5DSCA 1RPKA 2AI0L 4Y5XC 3S7GA 3PWVA 3VFMA 2DV6A 4KAQH 4LPWA 5D4IA 2JE8A 2M2DA 3PUCA 4KRPC 1QFWM 4DVBA 3EDFA 3IRPX 2P7TB 1ZHBA 4Z7NF 3B7RL 2ZOOA 2MCMA 4OD1L 3TA3B 5L0QC 1L3WA 3HZYB 3FO0H 4PWHA 1I8UA 1KBWA 1JWMB 1QI3A 5EBMA 5DR5L 3CXFA 4U1HA 1GPOL 2CG9X 3GXIA 3HS0B 3K2MC 3L3GB 2FVNA 5CN2A 3QG6A 1MW3A 4H0HB 1SYSB 3SO5A 3Q01A 1MRCL 3OMIB 4CAGA 1S78D 3BP5A 3QAZC 4WGWB 1LD9B 3ETTA 1GZPB 2WXKA 1BQHB 3JXAA 1QSED 2DWDA 2WXGA 3ZY7A 4AYFB 2IDCA 1XR8A 2CH8A 4AK1A 1IEBA 5IWLC 4QGYA 5J11C 4FFZH 4G7VL 3CFQA 5T1KB 1YUHB 3GK8L 1QBAA 4PTUB 2GUYA 2K7PA 2YQ2A 3EW3B 1JCKA 3U2JA 4X7SH 4FZ8H 4JRWA 4N3TA 2ZUVA 5E00A 4X6EB 4QHPA 2UUDH 1U3HD 4KOBA 1QYGL 5SX5H 4NGHL 1EEYA 1W0VA 2XA8H 3SKJL 2DKMA 5I8OL 3BT2H 2F9BT 2EIJB 2QHRL 4NS0A 4WO4A 2ARJB 2WKOA 4QLRA 3OL2A 4JN2A 3CVDA 2SEBA 4OCRL 4ORGB 5I5RA 4WFFD 2CDFB 1AKJB 1SUJA 3CSYA 3D6GA 1ACYL 1HCYA 5GSVA 4CDGC 5C2BL 3HG5A 3QPQC 3NEEA 1S7RA 3NTCH 4NHUA 1UT9A 2VZUA 3T2NL 5JPMA 5FHBL 3V4PA 1Z7JA 2UVFA 4PJIB 5J7CC 4MQXD 1UFGA 4XNQB 4YIQA 1VZGA 5DZNA 2VDMB 4RISH 4J27A 3ILPA 3C09C 1CTMA 5F7YC 3FXIC 3Q8AA 1RULL 2XWRA 4HX1A 1IM3A 4DP5X 4FTDA 3BWUF 5J3HC 4H8HA 2ZCKH 4XMPL 5TH2B 1CD0A 5CKGA 3FF7A 4D9RE 2HRLA 3MLYL 4G6JL 5LG1A 1A65A 4NZDA 5DS8A 1F2QA 1EHNA 3ATBA 4GW5A 3KJ4C 3VH8A 2DIJA 3KBFA 4OGXL 1UOKA 3P02A 4XAWL 3CN4A 2YARA 3T0VA 2XTJC 2YA0A 1WEJH 3QJTB 4MXWH 4LPYA 5IBTH 2OL3L 4H2CA 4JLRA 2IIJA 3AS3A 1JGDA 5HHVH 2OQJB 1NCDH 4J3OH 4WNQB 5IM7A 2A4EA 4NENB 5KTEH 2EDYA 1FO0B 2YR3A 4WW1A 5E8EA 3QDME 5E2UH 1IEAA 3MBEC 5L88L 3ZTNL 5EZLA 4PRBB 3MRQA 1K4DB 2DF3A 4Y2DC 1NCWH 3QNXB 5FGBA 4EIGB 1E4KC 3WNPA 1GRWA 2A0LC 1WAEA 3MLVL 4YDIL 1RJZB 1JHLH 2JKTM 3AWFA 4BUHA 3RB5A 3QQ9C 1NOAA 4YE0A 2HT3D 5JDSA 4B5EA 4BFNA 4ODSL 1M7DA 4DK5A 2J88H 4TLTA 3SPGA 4ZFZB 3SBWC 1HS6A 3FUIA 2VN7A 3G08B 1X6LA 4Y5VB 1MJUH 3RL2A 3FT9A 4YHIB 1CDHA 2XDHA 2QL1A 5I18H 4JW3A 2G0KA 4UMSA 1C1EL 2LLNA 4S1DC 4XBPB 4WENB 2R69H 1I9IL 3CH8A 4TNVF 5JIIA 2B4CL 1UACH 3FBKA 2OJZL 2DB8A 4HPHA 4ZQKB 3VFTB 2JKSA 4M5YL 1YVLA 1XMEB 4KDWA 1FNGB 4L8CA 1X9RA 3SJVA 2J7LA 4WI0A 4P3WA 1UD4A 1CICA 2FLBT 3JBG7 2ALWA 4KO9A 1RUKL 2YD2A 5AG9A 2AMGA 1E5CA 4LHUG 3ZOAA 3VD7A 3K4DA 3ET9F 4M6OL 2CLZA 5IVXF 3ZYIA 1C8PA 4UBDD 5E9DD 2IPTH 4ELKA 3M86A 3IF1A 2WOYA 3WG7B 3CDGB 4QEGA 4D0CA 1ML0A 3BH8A 2EABA 4PEEA 1IBGL 1T5WA 1UA7A 4AZUA 3PWUB 3KYMA 4ZT1A 3FOLB 3RY6A 4LCUB 3HB3C 3ECVA 3EOAB 1NBYB 5AENA 2J8HA 5ID0B 1DQKA 1BIIA 3X13B 5IMMA 1ZT7B 4LF3A 3QRGH 5I1CH 3DX6A 3TBVA 3VFNA 3WE6A 2WWKO 1BV8A 4HJJL 4XCYA 2ZUUA 2BHFA 1T1ZA 4IBWA 6TAAA 1MFVA 1PLGH 4YHLH 4LCCB 2R2HB 3VFPB 5C0DA 3FB8B 2X88A 4M3HA 2WO4A 2YUZA 4XNZB 1ED3A 1D5BB 4PCTA 2EXTA 2ZAGA 5FKAB 5FWQA 3U9PL 5FO8B 3EXLA 1PY0A 5LNDA 1AR1C 1P9MA 3QEQE 4ELMF 5FO9A 1JPFB 1HH9A 1N5AA 1E2ZA 1IBDA 3DX1A 3MNWB 3ZQXA 3RFZC 4MQTB 3RWEA 4PCYA 1NLBH 2AXHA 3HE7C 4IM8A 1CUOA 1YNKL 2OZ4L 3HW7A 1XV8A 2BERA 4B6ZA 3P3TA 2A74B 1V7ML 2HFFA 4FLSA 3H3PH 2VXTH 1MFCL 4JHAH 3QDMB 3V6OA 1JV2A 1A0QH 2F19L 5K9OB 5DJ6B 3UADA 4G6FD 3BUIA 1FFOA 5EU5A 4F27A 1VKXB 1NANI 4JR9L 2GUOB 3P30H 2V5SA 3UPAA 2FHCA 4QRTA 3WN5C 3TBBA 3VMPA 2NY0D 1YEIL 5IV2A 5CZXC 4NUQA 4LDEB 2PW1A 4R7DB 3QZOA 4ZFFB 3NCJH 4ODWB 1ZSDB 5GGQL 5I28A 3DECA 1KT2B 2XTLA 2R0WL 3OKOB 3PU7A 4KNTA 4LLVA 5DHYA 3TBSA 1TU2B 4LMQI 4PJBB 4HJUA 4UILH 4OI9A 4KKPA 4JQXA 3FSOA 1I3RB 3DVGB 4F7EB 1BQSA 3B6SA 3NABL 4LU5H 4R26L 4N25A 1HXMA 1JRHL 1L0QA 1W2KT 2Y2WA 1DSFL 5CWSA 1T1XA 2W0FA 3BAKA 4N2BA 2HVJA 5T33H 3DO4A 1VRSA 4YOKA 1R33A 5EU3A 4MXVE 3CZUB 4QMEA 2X12A 4WCYL 1HNFA 4BGLA 1M9WA 3CJJA 1P7HL 2OMYB 1FVEB 1HT6A 1U92B 2V7HA 3NQKA 1NC2B 4UT7L 1OK0A 2MTPA 4I2XE 3C2AH 2HAZA 3BP7B 4LLMB 1I1FA 5I6XB 3L81A 4FXKC 3WKNA 5GISL 5D72L 4U1SB 1QZNA 2B1AL 3I74A 4HWEL 2OR9L 3DWTA 3WMPA 1CMOA 4R5VA 4PJCB 5HDBE 3PV7A 3ARED 4GSQA 5LGYA 4AQ1A 3LQZA 5D7LA 5DU7A 4QXTB 2J43A 3W81A 1QMUA 1T2XA 3NSYA 3HOGA 4WHYG 4KO5A 3R18A 1PG7H 5F88A 4TNFA 5KJRH 4TSCH 4A6YA 3T0EC 4Q9QH 2PCFA 2OMUB 4ADJA 4PLKC 3NCFB 5DZLA 4YGAB 3QEQB 4OCWL 3IJEA 3GZKA 5JIKA 4K3DH 3FOMB 2A5UA 4YDKH 3L5WB 2DTML 2X6CA 4HUVA 3F6LA 3G6JF 2FEDD 4HUMB 4DP7X 3LNEA 4AM0Q 5JLZA 2JTDA 1KTLA 4ZNCD 1WBZA 4APQD 3S3DB 4S1QH 1U8QB 4KO6A 4NO3A 5DYOB 4Z95H 1EDHA 1PZ2A 1TZIB 1RZJC 3BP6B 3KPSA 3VE0B 5I26A 3HMWH 1B3JA 2PCPA 5DTFB 3MRCB 1QEWA 3TBYA 3TYGH 4OJFH 3GXTA 2CCVA 3V6FA 5ILTH 4NUPA 3PFUA 4GLRI 3A47A 4HS3B 4XVTL 4APXB 3TV3L 3TLRA 4ENEC 2WBJB 5CJ8A 3VQ2C 5K1NA 2H32H 1AZVA 2YLHA 4N1CA 3RL1A 1AGDB 2WK2A 5BV7H 5FC9A 4WUKH 4K8RL 1EAOA 5K5YA 3UPRA 4M1CD 3EGSA 3D2UB 2Y36L 2X1XR 5HDLA 2B59A 4XVJL 3QDJA 1JGLL 4YFEA 4EI5B 2B3IA 2HX7A 1E8WA 5CGTA 5C1MB 3UXFA 5E23A 2WQXA 5IEHB 3HZ3A 1WAPA 4HK0B 5LAPA 3C6EA 4ZAKC 3UTTA 2CUIA 5E99L 1S7SA 2OFQA 4KITB 2NX5A 1ETJA 2V0AA 2AV7B 5IQNA 6PCYA 5D5MF 4UAHA 5C09D 4Y5XA 3MGAA 5DD3H 5FA4B 5LGJA 2IFFH 2J8UE 5GGSY 2XT1B 3O6FC 1EVUA 1MLBA 1XO8A 3VO0A 3ZN6A 4ZBJA 5I73C 4FFTA 4JHZA 1IQDA 3I2CL 1BYPA 4XI5D 4NEHB 1IMHC 2DIEA 1UGKA 3KH3A 3WN6A 3P54A 1AYOA 4NKDB 1FG2A 3SGEH 4QHKJ 5DUPL 5BRPA 3B43A 2R1YB 4DQOH 1RLWA 5JOPD 4E9RA 3B3BA 5ERWA 3ASOB 1CT8B 1WTLA 4FFYA 4IRZA 5D7JB 5IWLA 1G84A 1AIFB 3D39B 4JKPL 4DZ8A 5DUBA 2DQTL 1KBBA 3L4UA 5HYIA 3ZBMA 5C0RH 2K8QA 2HN7A 2W07A 3N6YA 3TJHC 4AGOA 1CFTA 5AW3B 4U1JA 3KMDA 3DOSB 2G4EA 3FO9A 3IMRA 1SJVA 1PEZA 3LIZA 3GZPA 1TVHA 4NWTL 1ZHKB 2HFTA 5C0AE 1N0LA 1DQTA 5FO7A 3FT3A 2A6DA 2GABA 4P23D 1SMOA 3GMOB 3ML8A 4HHAA 5EO9A 2HJFB 2AQ2A 3BPCA 2PABA 2ED6A 1T2JA 4ZQTA 3BWAB 4KHTH 4PWFA 1JZ8A 5IVZA 3ROLA 2W91A 4HS8H 2X0UA 4Y4FC 3NCCB 3HG2A 4FNLH 3JUZA 4YZWA 4ZUSA 1ZAGA 4LOVA 3F5WA 4YXHL 2BSBA 4WV1C 2EJ1A 1JZHA 3QUYD 1J1PH 4D0DA 4NFCA 4HCRA 5GSRA 3C6SB 5DA4A 3C5ZD 3QUXD 4RMBA 1BD2D 3KJ6H 3QDGE 1AJ7H 1OARL 4GO9A 2AZAA 2VW4A 4ALAH 3S97C 2WKGA 4K9JA 1GH7A 1KENL 2M1KA 1QSFE 4X6BB 1GS6X 2H0EA 2Q5BA 1YDPA 5I19H 2Z0UA 5BNXD 2OTWB 5KBLA 2W9EL 1FZJB 1RSYA 4QRRA 1JZFA 5AYUH 1WPCA 5BRQA 3PS6A 2VABA 2FZ3A 2A6JA 2K9UA 3UZQB 5J56B 4YSQA 2FL5B 5CR1A 3O3DA 3GUTA 1UHVA 4RQQB 3ILEA 1XEUA 1NIAA 3LY6A 4HUWA 1T04B 1FFNA 5INCB 3MO1A 4PRIE 3ZDYB 2AERT 1T4KB 3C5JB 4QTFA 1GXEA 2Z7YA 4FG2A 1IFRA 4Q6YA 4Y4HB 5EA0L 4IBUA 3N1FC 5CM1A 4TUKL 1MUJA 1XF3A 1NPJA 2NXZB 4W6WB 4DK3A 5I5IA 2NRDA 5FHAH 4NQUA 5BJTB 3JV0A 3OLDA 3CFJA 3MBEA 1WWBX 4NRZB 3T3PE 1QLEB 4Q2ZB 4XMLL 2CO7A 1ZJAA 3CIQA 2DQIH 3VRJA 1U30A 2XETA 4K7PX 2Y6SD 3QJSB 4Y2DA 2JJTC 4OLVL 3UJTH 4UIMA 3VTTA 1E4KA 5KVDH 2IJ0C 5D1ZI 1B4JL 3KDPB 2XKNB 1OAKL 1Q9OA 1JXKA 3GRWL 1A6ZA 3F84A 3K8MA 5DR5H 4UV7L 4JFFE 1U8MB 3PJSB 3KBPA 4P2OC 3IFPB 4N9GA 5IB4A 1GMEA 1PGRB 2PP7A 3EHBD 3G9VA 5AVWB 1KELH 3MBWA 2NXYB 5EU4A 4B9FA 1J9RA 3THML 4DAGL 2ZUXA 3T8VA 1NL0L 5E70A 4M93B 1WHOA 4BGDA 3FFCE 2J5LB 4MXQC 4WJ5B 5F9WB 4HJ1A 3DUHA 2X4NA 2YGOA 4HYTB 1NGZA 2ROXA 4RDQG 2P24B 5C0AB 2AV1A 2FWOA 2UVEA 1K85A 5EFIB 2P3YA 1TTCA 1R3JB 3K81A 1QYGH 1L9SA 4NGHH 1JNHB 3EBAA 2VZSA 1O5PA 3ARFB 2KZWA 2G5UA 4L2YA 2PTTB 1DANU 1S7UA 1HXYB 2ICWA 4H40A 5CEZE 3NJGA 5ISZB 2QHRH 1LP9F 2OXGB 3IFNL 2V5YA 5SWQA 3NZ8B 3KHQA 2Y5TB 1IC7H 3MA7B 4Y88A 1D5XA 4RFOL 4UT6A 4KKLD 4XBMA 1A1MA 2XCMC 4A37A 3O3BA 3VXRD 1AXTH 4M62L 2QADD 1G9EA 5C0BE 4K8RD 1UXSB 3NCWA 1ACYH 2DIBA 2CKNA 5FFOA 4OF8A 2XWZA 4UDUA 1NEZA 2R1XB 3DV6B 2X2JA 1J0ZA 3QDGB 4OUUB 3K2IA 1TQBB 3AU1B 3EG9A 5FHBH 3FQTB 3PWNB 3TCXA 1CLOH 2GITA 5CBEB 3VYOA 1UXWA 3WGVB 5D7KD 3UX9B 1YY8B 3MUHL 1TOXA 4PJDF 1KCRH 2BIHA 1RULH 2BOBA 3S5LG 1ACZA 1BXVA 3HR5A 3QORB 1Q9KA 1NPUA 2ADJB 3IWVA 1PCXA 3KPTA 3ABLB 3VXNB 1EVTC 4OZGE 3V9EA 3Q1SL 2C7FA 12E8L 1IAII 3CFCL 1F00I 2YMTA 3GSWA 5IB5B 4YUEL 3IU3B 4NM8H 2XIDA 1QO3B 1TZ8A 1U33A 2NUPA 2YXWA 4Y1AA 4XPHL 4BFRA 3IDGB 4Z3GA 1BOGB 5SWSB 4LXFA 2JSFA 2MHAA 1V3JA 4GY4A 5EUOF 5IMKA 4ES9A 3GBML 3MLZH 1U8IB 4E9YA 4QRPE 1RU9L 3HE7A 2WTOA 3ZKSD 3QT2A 4R97C 4ODTL 4JRYE 5KVGL 4Y5YC 1Q94B 4YDJB 4JDEA 1D5ZA 4RIRB 3RVXD 3GWJA 2CKBL 1HYSC 4HH9A 3DVNB 4OV5B 4FZEH 4KUZL 4BKTC 4X5WB 4L2LA 1A4JA 3MV9A 25C8H 3T3PB 2JQAA 1PZ3A 5DJ2B 2R29L 3M8OH 1TETH 4ODVH 1OAXL 4NO0B 1M56B 3MACH 5I8EB 3GSUB 4LHUB 3WN5A 3RBGA 4HWZB 4JFFB 2WWMD 3UTZA 4OQTL 2N7SA 4UOQA 4Z76B 5INDB 2OCJA 3TA3C 4IIQB 4YZFE 5HVFB 5CJBA 1BVLB 1L9NA 2W65B 4YC2B 1QBLL 1JGUL 3HS0C 3Q2WA 1UCBL 4JL1A 4HV8B 1ZTMA 1IZJA 3EO1A 2Z1PA 4KXZH 1ERNA 1IJNA 1I9IH 1P4BL 3FFCB 4KTEL 2B4CH 2E9GA 3CVHA 1DQMH 3K6SA 3L4VA 1S4IA 4X9FA 2KZKA 4IOFC 3GLZA 4ZZFA 3DOIA 1D5MA 5L2KA 2R0LL 1M53A 3LZPA 4M5YH 4ZMLA 4GW4B 5D7IA 4JM4L 3TPUA 2OMXB 5ESAB 2BIIA 4BH8A 3EH1A 4HT1L 4XAKD 1RUKH 4UB0L 3FQWA 2BJMH 1AG6A 3ABZA 1X5FA 2FUQA 4M6OH 2G2RB 4QOKB 1DVFD 1F6LL 4Z7AA 4MFHA 3EUUA 1QA9B 3V5DA 4JO3H 3GMNA 3NQIA 5IR1B 4IOSA 2F15A 3L4XA 3W57A 4O5LL 1IBGH 1RQ5A 4YXKL 4MB3A 2E3VA 3ZXAC 4FXKA 4KWUA 4PJ7F 1RZIA 1ZKAA 2Y1YA 1V05A 4YDLB 5DZVA 4YPJA 4EZKA 2NSXA 1YEKH 1HEZA 2H7WA 2M83A 4Z3TA 2K9FB 3APCA 4FQHA 1OTSC 3VG0L 1QACA 1DN2A 1I7ZB 1RUQH 1WZMA 2NT1A 1L7IH 2EVIA 3PABA 4OIBA 1NA8A 4P5MB 1YEWA 1XGPA 3MV8A 4MWFB 5FYLL 3TVMD 5DD1H 4YQXL 4XP9L 4RFEA 3ULVD 3FTVA 5KYWB 4YSSA 1U58B 3D3VA 3T0EA 3ALPA 3GBNL 3U9PH 2VXQL 1R34A 3GJFA 3ZIMA 2MIZA 1ASOA 1U36A 3SYQA 1IGYA 3ROOA 3L08A 4D9QD 4YHOL 1M42A 1MJ7H 2YIHA 2HX9A 2EE6A 4DCQA 4ZD3L 5C0CD 3STZB 2ATPB 2H3NA 4JO5A 2P45B 4JRYB 3CXHJ 3LN4B 1KJ2L 1YNKH 3SQBB 1ETA1 2XWJA 4MVBC 1V7MH 3LSOA 4PLJD 1ODUA 1TEGA 2MCPH 5EB9A 4MBOA 4NQCD 4UTAL 1TEFA 5DMIL 1ITBB 4CSZA 4NZRH 2WLLB 3S96B 4G9FE 4DH2A 2AVFA 2WQUA 5T3ZE 2DQMA 3JSSA 4W9HC 1IAIL 2IH3B 4PJXF 4DZBA 1YJDH 4JR9H 1YG9A 2FJGB 4HALA 2UZXA 4J3XA 4PJFA 5FIEA 3O6KL 1I8IB 1JV5B 5FO2A 1MQ8A 4OZIA 2A6IA 4I4WB 4K73A 3W1ZA 1XDTT 4K7PL 4GKLA 3QUKB 3AXIA 1EHAA 4IU2B 5EBWA 4WU5A 3QISA 1ZGLA 3MPCA 2VLRA 5DJYA 4Z7VB 4H26B 1VDGA 4YNYA 5EWIL 5GGQH 1CK0L 2XA3A 1U93B 2EIBA 4JKKA 5JW5B 5EZOL 4AK2A 2AZUA 2PKDA 3NACL 1DVXA 4Y5VC 4ZAKA 4ZFQA 1TTUA 2ESVA 3D34A 3CHPA 3F3HA 3NABH 3TO4B 5L8JB 4XPGL 1JRHH 2J6EA 32C2B 2FJHB 1F6FB 3SPHA 1DSFH 5DQDL 2BY1A 3DX8B 4MASA 1DBKH 4H2AA 1FF5A 1WFIA 4X4ZA 1R5WB 2O6EA 4CC0A 1IQWL 4RFNB 1P53A 2D3JA 1GYCA 3G5ZA 1MJ8L 4HWBL 5SWZE 2OYMA 3UTPE 2OV0A 4E42A 5D70H 4AUYA 1E9PB 4ILDA 3FCSB 4ONGL 1GGCH 3EDJA 3O81A 1FNEB 1G0YR 5GGTH 4D8OA 1TJIL 4HWNA 3DXAE 2X4SA 4KKCC 3C9NA 3U4EA 1KJ3H 1IEHA 5D72H 3UIYA 3CFKA 5AZ2L 2R59A 5MEQB 2EEAA 3ZVVA 5GQBA 1ZXQA 2A1WL 1KEGL 3EJSA 1AGFA 1MJJA 4XZUB 4FERA 1G1CA 3HG3A 3C75A 4BSVA 3ARVA 4GS7C 5CF3A 1CE6A 4JM2F 2QEJA 1OSPL 4QXGL 1LE9B 2XJLA 4H4NA 3VGAB 2XQBL 3EFDL 2SODB 3IDNB 3OB8A 2A9AA 1NCGA 1EEZB 3KEDA 4YEEA 5H37G 4B0MM 4X50A 1XTMA 2XACC 2X9ZA 2F53E 4OCWH 4KH2A 5KZCB 1XF4B 2FR4A 4NQDA 2Q8BL 3BZ4B 1JHKL 4Y4FA 4XNZC 1JL8A 2DLEA 3CQPA 4L4TD 3S6CA 5JMOC 3PPSA 4A39A 1RZFL 3LZQA 5EF1A 4Q14A 3MGTB 4WV1A 3QQ4A 3QFJE 5AKRA 5CGBA 1OIOA 2FO4B 3SBPA 5IFJA 1BVNP 4P2QB 5IUSA 4NZ8A 4YFDB 5AOLA 2F8XC 2R9HC 1PZDA 3H55A 3M1CA 1MREL 4F3FA 3D1MC 1EXUB 2Z31B 3HNTH 1G7LB 2H8PA 3GB7A 5DEZA 3F04A 3QB7C 4XPAL 1UH4A 3AAZA 3V7AG 3ARUA 1Y0LB 1NDGB 3LZNA 4QHLA 4RZCB 3AACA 3G5VB 1T1WB 1NAKH 2WINA 4TNWF 4WEMB 3V8OA 4PI2A 4LCVA 3LKOA 4E41E 2IADA 1XSKA 4N0YH 3IXTA 5FYJL 3RIAF 5DWUL 4KGLA 4NQSA 1SLVA 1EJ6A 2X4QA 4XVJH 5KYXB 1JGLH 2HJLB 4HLZH 3T65B 5CCKL 2XC8A 4FOMA 3KWXA 2QPEB 4LBEA 3QC6X 1PU0A 5KOMC 2XXFA 4FFYH 1PY9A 4IRZH 3DX4A 4XO9A 3GM0A 3EOBB 2ZWKA 2X4OB 5LG6A 1BFOB 2NNAA 4A2HA 3RGHA 3HLAB 1V3MA 5DA0B 3GJEA 5ICYB 2CLRA 4BQCA 5L4MA 3FH7A 2MQGA 3O45A 4KI5F 4YO0B 2C8NA 3WV0A 1QPPA 3KLAB 4F7TB 4YHML 2C9AA 3AUWB 5FYLD 2DY2A 2UXGA 2DOCA 1XGQB 3MODL 1UZ8B 1ICTA 2AHIA 1MEXH 3BVNA 3ISYA 5SWZB 4C59B 4P2OA 1ODAA 2IPKA 4K3JL 3V4VL 2CO3A 5DUPH 5EUKA 3UDWA 2H1XA 4FFVD 4TLUA 4I9WD 1GHFH 4Q0XL 3CUPA 2DQJH 4OZ4B 2VSCA 3OTTA 5A2LH 2OMZB 5JHBA 1LO3L 4FS0A 2G9HA 1EJ8A 4JKPH 1ZPUA 3QJRB 1A4KA 4M7JL 3BE1H 2XV2A 3EDKA 4AXWB 2Y5QA 2EIEA 1YNTB 4JFEA 4U1IA 4YDZA 1DDHA 1F4WL 2KKQA 1I8KA 1X5IA 4NWTH 4QNPF 2K7QA 3DURA 5ICZA 3SYCA 1XSJA 5C07D 1BX2A 2Z35B 3ISWA 2A9BA 4XRCB 1D9KB 5IJVA 4LSPL 3MA9L 5HHOD 4H8WL 4BHUI 3ULUE 3RWCA 5C70A 3NSFA 4F7PA 3PWPA 2KC0A 2EKJA 3QWNA 5HGDB 4JE0A 3UBXI 1T20B 4YXHH 2ZWZA 1EHXA 3QFJB 1EGJA 3VB9A 3N1MC 4QF1B 2YEZB 1G5AA 2DWEA 1TCRA 1UM5L 4P04A 3ETBF 4WFGD 4JFSA 1RP9A 4XTRD 3UEZA 4Z7UB 4FMKA 5EN2B 5DC2A 2N1KA 3VXUA 3WNNA 2X3BA 4IS6A 5FS5A 4NKOA 2HFGL 3H7BB 4Y19A 4BDVB 2FBJL 4G43B 1NGWB 4EN3D 1HI6A 3QH3B 4UQEA 1XQ4A 3L95A 1RI8A 1WRFA 1EAPA 1FZMA 2FSEB 1KIQA 4YBQD 3UGEA 2XZQL 2E6PA 3P40A 1R5VA 4X6FB 1TMCB 2WPGA 3FHEA 1WJ3A 2GJPA 1J5HA 4XE0A 5C0GB 5B3NA 1KCKA 3KLKA 4WDIA 5EC2B 5IF0B 3BO8A 4WY7H 3UAAA 3QIBD 1ZDSA 1V10A 4TQEL 2QPSA 4W6XB 2CO6B 2WBJC 3Q8FA 4IRSB 1JPSH 2APVA 3QW9A 1GW0A 3DO3A 5I1LA 4PS4L 3DDFA 4MNGB 5CZRA 5EA0H 2B5IB 1JFQL 4Y5YA 4EZMA 3WJLA 2BC4A 3HC0A 4CJ1A 4LP5A 3QZMA 4EI5C 2GJ6E 3MGOA 4UZGA 4PJAA 1PZ5B 5GGVH 3ULVH 5DHEA 3D25B 1GR7A 2YK1L 3NSJA 1YECL 5DJDA 3NIFF 5AEAA 4JY6A 5DJCB 1BVKB 1ZWIB 4KX7A 1ZHLB 2JI2A 3WIFB 3RNKA 2ZYRA 3QCVL 4JZOB 2EE2A 1B4JH 3IU4H 5MENE 3JV6A 4PRHD 1F45A 4W9LC 1ZLWK 2L3BA 3SE3C 3U36B 3GXDA 1MNUL 1W72L 5EZJB 4Z78A 3TA3A 1IC4L 2C5DC 2EACA 3HZYA 4G71B 3WEMA 4HFUL 4L4VE 3CTTA 1JWMA 4LLWA 2X40A 4OFQA 3IPFA 1JPGB 1TITA 5IMLB 3L3GA 1P7QD 2FAUA 4AYEC 1NL0H 1SXCA 2H6OA 3NFSH 1T1YB 2YPVL 4LRNL 5T5FL 4B9GA 1JE6A 3LKNB 5CJXA 4AYFA 5E1GA 5MEPA 3KD4A 3QYNA 3LB6D 5D7JC 2XWCA 3C8KB 1YMHA 3NSXA 4JFUA 1SOQA 1W9XA 1TMQA 3S5LB 2E6QA 2EVJA 4MMZC 5T1KA 1YUHA 1AH1A 4IDJH 3DC0A 3P3RA 1JVKA 4FHBD 3MNVB 4N8VG 1SMAA 3V9CA 4WTZA 2OYLA 1H3VA 1TTBA 3IMWA 4Z9KB 4X6EA 3KNBA 1N26A 4BYHA 4N2EA 2B14A 1EFXD 1GGIH 5K9QG 5KUKA 3PHOB 1NBZB 4QHUB 2VN4A 5JHLA 1BVNT 2QHLA 4O02A 5CSGA 4A2GA 3T0DA 4FXGB 2ARJA 3UAJC 5JUEL 1OAQL 1I75A 3FPYA 4Q74A 2W8CA 4ORGA 1S7VB 2CDFA 3U0PB 1ZT1B 3MI6A 2UZYA 1AKJA 3VG9B 2N01B 1RK1B 4OTXL 5T1MA 3RZCC 4MBRA 4AOFA 2TSBA 4EZLA 1OF0A 1P7BA 1H19A 3V0IA 3GMPA 3OJVC 4PJIA 2AXJA 4XNQA 3AQYA 2EYRA 4GBXD 2W5PA 5JR1L 1GC1H 3MXVL 1ZT4B 3Q1SH 12E8H 2WVVB 1E6OL 1AE6L 1BF2A 3N0AA 5I16B 1HFUA 1C5DA 4XPHH 4HCFA 4X6DE 4GMSH 4KROD 3SPVB 1E28B 2HWZL 4I1RA 3HCVB 4J3BA 3TURA 1A7QH 3K8KA 4L5FL 4ODTH 4L29B 5AVSB 3F7KA 1E6JL 4XO4A 2CKBH 2GJ6B 3DRQB 5IMOA 2QR0B 4ZYKB 4Y4HC 1BYNA 2YOCA 5B7EA 4KUZH 4WI9A 1E50A 1FHNA 2HRPL 2OQJA 2R29H 1ZTXH 2NXZC 4WNQA 4XXCC 1UM4L 2W92A 5EBLA 4NENA 1FO0A 2AJVL 4NYLB 2V4LA 2Y6TE 5MENB 3BQVA 5FX3A 1WV7T 3GO1L 4QRSB 4WF7A 2GY7B 1OB1B 4HBQA 4KMTL 4PRBA 5E8DL 1OOWA 3QNXA 3R0MA 1BZQK 1QLFB 3G5YB 2BK8A 3A6OA 4MA7L 4MHHG 3RJDA 1GTFA 4L4VB 5BO1L 1QBLH 1QHQA 1EO7A 5DMJB 1XXDC 2X1QA 3IT8D 1HJBC 3QJOA 4Z7WE 3AB0B 1P4BH 4PMFA 5I6MA 1PX4A 5CP7A 3SZ6A 2HYMA 1S5IL 4Y5VA 3G08A 2NXYC 4PGBB 4WSJA 4YHIA 3B2VL 3NZHL 1XH1A 2R0LH 3T0AA 3S3PA 5D1QE 4JFWA 4M93C 2J5LC 4IRJB 5F9WC 2HCZX 3UGXA 4WTXA 4G8FB 4QTHB 4FA7B 1NFAA 1XGTA 3A6BL 4ZQKA 1NFDE 5E08H 3L7FA 2YOAA 3BD3A 1XIWB 4UB0H 3EYUL 1FNGA 3V6ZB 3FN0H 4TULL 1XF2B 1MNNA 4WI2A 1RZ8B 3GKWH 1XZ0B 3ARFC 2OSWA 3A6CH 2CR0A 2UY7B 1U8NB 4UNTA 4O5LH 4YXKH 4IHOB 2OW7A 2WQSA 4XXWA 2Q9OA 4P2CG 1CLZH 3VACA 5C08E 1MF2H 4YPGB 5BUGA 1KNOB 4JM2D 2BS8A 3KPRD 3CDGA 4AV4A 1MCSA 4TS6A 1T66C 5JHMA 3VG0H 1GS7A 4RGNE 4P9HH 2G3ZA 3FOLA 4TNWK 1AO7B 1WIUA 5HYSB 1TQBC 3EOAA 1NBYA 3O8XD 5FYLH 3IMBA 3AUVA 4P2AA 3L5IA 3WXWH 3X13A 3MRJA 3QJUB 1ZT7A 2YPLE 2PTUA 1HC1A 5HHME 4GSRA 3BYTA 4WUUE 1N3NB 2VXQH 2I60L 3CC5B 1XH2A 2EDDA 3OGOE 1QRKA 3QORC 3OMZA 2R2HA 5BVPL 3VFPA 4X6DB 1SXZA 3BIAX 2D7PA 2XRAL 3FB8A 1ID5I 3TNNB 3C60B 3COOA 4NKQB 4S0SD 4LDLB 1AY1L 1D5BA 2JCCF 3MV7B 4ZD3H 2OJEA 1VFOA 5FO8A 1NCCL 2X09A 4TM9A 1JF1B 3MOAH 5G5DB 3TN0B 4MB1A 4FG6D 3MNWA 1KYAA 1W8OA 5IFHH 2V8MA 4NNPL 1IUZA 4P3CH 2IPUG 1NFKA 3FT4B 4N22A 1A5FH 1YN7A 2JTYA 3FCGA 4OJYA 2J6EH 4PGDB 4FJ6A 1LWHA 5C0IB 2H26B 3PHQB 2UWEF 2WB1A 4HJTA 3O6KH 4Y2OB 3QDMA 1LL1A 5K9OA 1M71B 5DJ6A 1KCVH 5A1AA 1ZJBA 3I3BA 4DPAX 4I0PD 1AGEB 1VKXA 2HT4C 3VB8A 2GUOA 2VL5B 3BSHA 1BOYA 5JQIB 1IGJB 1ZV5A 4UIKL 2WXNA 2ZXWB 4OKVB 3FQRB 1ZV2A 5D1XE 2GIMA 4NCC2 3POCA 1O75A 1U4FA 1BG9A 4M3KB 3VXPB 1CK0H 2PR4H 4IIQC 2KMWA 1ETZB 1AHKA 4R7DA 5GRUL 4QXUL 4KQ4L 2H2PC 4E9LA 4TRPL 4KJPD 4KI5D 4ZFFA 4ODWA 2Q76B 2CIKB 3PRZA 5GXBB 5D1QB 3CIAA 3AS0A 4HKXB 3ARWA 3BZEB 5EU6D 3ZMNA 5GHWL 2YFNA 1KT2A 2XWBA 3OKOA 3QO0B 3SOBH 2XVKA 1TU2A 3SKUD 4PJBA 5IQ9B 3U2SB 2DWXA 1BBDL 1I3RA 1NFDB 1OQOA 2HPOA 1UH3A 2XQYG 2FT8A 2IWKA 4PLOB 4WGVB 1MRDL 1THCA 3LRKA 5EULV 4TSBL 2EDTA 2ZSVB 3S8GB 3D0AA 1F4AA 2ZF9A 3C8HA 5IKCB 4MD4A 4HWBH 1IFGA 3VNYA 4Q97A 4ONGH 1UTDA 1PG7W 4B0MB 5HDQH 2EC8A 1TFHA 3FFDB 1HL5A 2OMYA 1BFSA 1QD0A 2F08A 1FVEA 3TCLB 3FUDA 4F33B 3KW8A 1U92A 5C08B 1FL5A 1NC2A 2WZ6A 4H8QA 1NKOA 3CK0L 3TEZA 4J8QA 5F71A 2A1WH 3BP7A 1H5BB 4TQPA 3AWEA 4ABVA 1MCWM 4RGNB 1L7TH 1CD8A 1F5WA 2WO2B 4M3JA 5AKTA 1OTTD 1NSNH 4YDLC 1MCWW 3RJQB 1HE8A 2FX7H 1KN4L 2XU9A 3NIDB 1W8NA 1BW8A 2XQBH 1JP5A 2YPLB 3EFDH 4WFHE 5HHMB 4QXTA 1C8QA 2VW7A 3KWWB 4WUUB 3PAYA 3TIEB 2XV3A 1VAHA 1JPTL 2APXA 1NMCC 3ZZSA 3K0WA 3RGVB 2NYYC 1JTPA 3DIVA 3D69B 4AITA 4KRNA 3LPPA 2Q8BH 1I9JH 1JHKH 1VESA 2OMUA 3GUFA 1CU4H 1CLCA 4XODA 5FAAA 1Z9NA 1K8IB 3QEQA 3LQAH 1P7KA 4WNSA 1SVBA 1H8SA 2D7NA 3FQNB 2KERA 1JERA 2AK4B 3FOMA 2D8KA 3L5WA 3TFBA 4G6KH 5F1SA 3P9LB 4K3GA 2F8IA 3GI8H 4LCWD 4Z7OE 3BRFA 1M2OA 3BUPA 1MREH 3F01A 3PWLB 3KHOA 1U8QA 5DYOA 2BHYA 2KH2B 5EOCH 4XPAH 3BP6A 3VE0A 1A9EB 1ASPA 2H4EA 1FJ1B 3MRCA