1OO2A

Crystal structure of transthyretin from sparus aurata
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
RCPLMVKILDAVKGTPAGSVALKVSQKTADGGWTQIATGVTDATGEIHNLITEQQFPAGVYRVEFDTKAYWTNQGSTPFHEVAEVVFDAHPEGHGHYTLALLLSPFSYTTTAVVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinctive binding and structural properties of piscine transthyretin.
pubmed doi rcsb
source organism Sparus aurata
molecule tags Transport protein
molecule keywords transthyretin
total genus 25
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1oo2A00
4DERA 4TQHA 2TRYA 4ABUA 5JIDA 4FI7A 5CLXA 1F41A 4KY2A 1QABA 3DO4A 1ETB1 1TFPA 1DVUA 2F8IA 2FBRA 1KGJA 5AKTA 1ICTA 3CN4A 3CXFA 1SOQA 1BZ8A 3FCBA 3NESA 4ANKA 5K1NA 1ZD6A 2FLMA 3DJRA 3DJZA 4IKIA 4PWHA 5JIMA 1BM7A 4TQ8A 1SN2A 2QELA 4IKKA 1KGIA 4DETA 5IHHA 2B14A 1DVYA 2ROYA 3IMVA 5FW7A 5BOJA 5CLZA 5AL0A 1E4HA 4I85A 1Z7JA 5DWPA 2GPZA 4PVLA 5CN3A 1TSHA 2QGEA 4ABVA 5A6IA 3D2TA 3I9PA 3DK2A 4QRFA 3Q1EA 4I89A 1BMZA 3IPBA 3IMTA 2B16A 4FI6A 4I87A 3A4EA 4PWKA 1TTBA 3NEXA 3CN1A 5AL8A 3CFNA 4ABWA 1IIIA 4AC4A 1G1OA 5K1JA 5CM1A 3ESPA 1TYRA 4L1SA 3M1OA 2G2NA 3KGSA 4Y9CA 4TKWA 3FC8A 3I9IA 2H6UA 5CR1A 1E5AA 2B9AA 3CFMA 2QGDA 1QWHA 2G5UA 3CFTA 4TLKA 3P3RA 4AC2A 4DESA 1TTCA 4PVNA 4TL4A 3W3BA 1Y1DA 3CN3A 4ABQA 4MASA 4QXVA 2H4EA 4N85A 1IIKA 4Y9GA 3IPEA 3KGUA 1X7SA 3DGDA 4WNJA 3TCTA 3OZKA 3CFQA 4D7BA 2QGBA 1BZDA 4PWGA 4MRBA 1FH2A 2H1XA 5AKSA 1RLBA 2H0JA 3B56A 3IMSA 3NG5A 1SOKA 1TTAA 3GRGA 5JIQA 4Y9EA 4YDMA 4IK6A 4PWJA 4YDNA 3P3UA 5DEJA 1DVXA 3A4DA 3IMRA 4N86A 4PMFA 1FHNA 1X7TA 5EZPA 4ACTA 1THCA 5L4IA 5FO2A 3QVAA 3DIDA 4IKJA 1THAA 4TNEA 1DVQA 3KGTA 4TLSA 3P3TA 3DJTA 4HISA 4MRCA 1DVTA 1TLMA 2G3XA 4TNGA 4TL5A 3U2IA 1OO2A 3D7PA 3GS7A 4IKLA 2G2PA 2G4EA 2G3ZA 2QGCA 4PM1A 4TLTA 1U21A 5EN3A 3CN0A 3SSGA 2ROXA 4DEWA 5L4JA 4PMEA 1IE4A 3HJ0A 3NEOA 3GS4A 5E4AA 1TT6A 4WNSA 4HJUA 5AYTA 1DVZA 3I9AA 2H0FA 1GKEA 3BT0A 3IMWA 3NEEA 2G9KA 4IIZA 4Y9FA 1ZCRA 3IWUA 2F7IA 4QYAA 4TNFA 3GLZA 3GPSA 5E4OA 5FW8A 3BSZA 4PWEA 4PWIA 4DEUA 5L4FA 2WQAA 3A4FA 2B15A 5E23A 4TLUA 3DJSA 5FW6A 5CLYA 2G4GA 4TQIA 2QPFA 4Q14A 5CNHA 3ESOA 1BZEA 1SN0A 4N87A 3P3SA 5L4MA 3GS0A 1IJNA 3IWVA 3U2JA 5AKVA 1TZ8A 2H0EA 2GABA 4WO0A 1E3FA 1ETA1 2PABA 1TTRA 3CBRA 3ESNA 4PVMA 3GRBA 1GKOA 2TRHA 1F86A 3IMUA 4HJTA 4HJSA 4TM9A 4PWFA 4HIQA 4FI8A 2NOYA 4Y9BA 4IK7A 3OZLA 3CN2A 1SN5A 2IGLA 3DK0A 5HJGA 2B77A 5TTRA 3TFBA 4L1TA 4TQPA 1DVSA
chains in the Genus database with same CATH superfamily
1IEBB 2CK0H 4ECNA 1AQHA 3TLRA 4IM8A 2COVD 4Y4FD 4MS6A 4X2UA 5F89A 4PRDA 1LEKA 2JJSA 4HFUL 4HIJA 5D4IA 2JKJA 2NY5H 4H1LB 2C1PA 3WS6C 4KX8A 4ZYKA 4M5YL 1VENA 3GJEB 3N41F 1IBHA 4QHMB 4X98A 3UTSB 2UXFA 5C09A 4J6IA 2NW3A 2YPLB 5F9JA 2QEJA 2JIXD 3D39A 4LQFH 3MV8E 5L8KB 4NDMA 1EFXD 5JHLH 1E65A 1MFEL 1X5YA 4Y2DC 1A25A 4JPWL 2EDQA 5KANI 4NX0A 2UXGA 4PJXA 1WAEA 1ZEAL 3IF1A 5JXED 1NBVL 4LPVA 4W6YB 3TBWB 1HDMA 3MRHA 3TN0A 4C55A 3VA2C 5JOFA 1RZPA 2EABA 2YAMA 2EKSB 4XXWC 3ZIYA 3BPCA 3WFZA 3AWEA 4GBXC 4M6NH 4J3VA 4PVNA 2CIIA 3KLAA 4J8RB 2ZUTA 2C4XA 3ZXAC 4AI7A 4BKTC 4X5WB 2ITDA 4L8BA 3CN3A 5IHBA 2BOCA 1JRHH 2EQDA 1TG8A 3EOTL 4JFHE 5IBTH 2BRQA 4ZO9A 2GK2A 1IQWH 3OAYH 3BW9A 2D31B 4DAGL 5C8JB 5ITBL 1DQJA 3GSVA 4RMVA 3DVIA 4DKTA 3UBXI 2O5XH 3C6LB 4JAMA 5E8NB 1DJSA 4ONFH 4OI9A 2BVQA 2KC0A 2XWXA 4B0MM 1SHWA 1MFCH 2JWYA 4LLQA 3A6CH 3BVTA 3MLTA 2EICA 3HEIB 3F6LA 4FLOA 3T9WA 4ACTA 4OAWB 4GFTB 4PB9H 3V9FA 2X4QA 1Q9OB 2F8VA 1RPUA 5DGQA 4U1HA 5I6OA 3D34A 1U0QA 1FIGH 4PJ5D 1G9NH 3EIFA 2ATKA 3FFCB 1L5GB 4AKPA 3EDJA 2YOAA 3K1KC 1ZVNA 2J6WA 2MIZA 3WNMA 4BSWB 1H6FA 4RDQF 1HL5A 3FB5B 3SDCD 1LQSR 2H0PA 1VLXA 3DURA 1EERB 4H0LC 1JGUL 3GXFA 43C9A 1SMAA 3VFNA 4BQBA 1KYOK 2QVMA 4G7VH 5HHOD 2DMCA 2F7RA 3N91A 3WN5C 5CLYA 2Z8WC 5TE6H 3IDIA 3LKPA 2P1YA 2CLRA 1I1FB 3LH2H 2XWCA 2WPGA 3CHQA 5HJ3A 4MA8H 4WO0A 1EEZB 1GZPA 3NA9L 4XP6L 3SN6N 2VDRH 5ELIA 1CICA 3CMGA 3RZCB 1FZOB 3L2LA 3HG1A 4BFNA 3NQIA 4ZUTA 2DKSA 1L0QA 4UV7L 1WWCA 4ICXA 5ENWA 5TTRA 1MFVA 3C6EA 2PW1B 4U3SA 4KXCA 5IIEB 4FZEH 4FI7A 2P49B 3IKKA 5CN1A 4M5YH 3W9EB 1J0IA 5L2KA 3EFOB 2AANA 4W9CC 2W59A 3B5HA 3S96A 3PL6B 4DP8X 1AI1H 1PY9A 3IDMA 3MRDA 3RUGF 4JDTL 2GK0B 4XAKD 2WWKO 5T8IA 3UEZA 1MLCA 3PWLA 4KO5A 2PCPB 1D5IL 4OQTA 1J8HD 1EAPB 5A2FA 1Z7JA 5FUOH 5D9SA 4PVLA 4K8RH 3KCPA 2VABB 3GJFK 1OAUL 4OSUH 3CXDL 1S78D 4YPGA 3V6OC 2PP8A 2DQDH 2VW4A 3MNZB 2B16A 5I30L 5M7QA 3SGDH 3JXAA 1OGTA 1TTBA 4ABWA 1VCBC 2GTWA 3M1OA 2ZJSL 3EOBA 3P0VL 3CLEH 4FXGB 5EOTB 2GITB 1DFBL 5EO9A 3S35L 4X6CA 5MP6H 1IAOB 2BSCA 2GCYB 3AS0A 3EO9L 3OWEA 3QQ4B 1T1XA 4OF3A 3ZKND 3E3QC 4NQCB 3LY6A 3JUZA 3VRIA 2NZ1A 2PYFB 4MASA 4HJEA 3FT1A 1GGIL 3BWUC 3C5ZB 1OLLA 2EACA 1OCZB 4OB5H 3VH8B 4U1GC 1BZDA 2OQJA 4PJ8B 4FNSA 4PJCF 1N67A 1UCBH 5L8LB 3VXUB 1UADC 2JCCA 1ADWA 2EDHA 3LH9A 1WV7T 1UM5L 4YO0A 1NWOA 1AKPA 1A7RH 3HHSA 1ZOXA 4I0PD 4U3SB 1YY9D 4ZD3H 1CJYA 1HKFA 1RUKL 2HX7A 4MB3A 1QLFB 3OC5A 4JRXB 1HHJA 5LO7A 3RZCD 1OALA 1VFBB 3B2UC 1EEYA 4QTIH 5CJQH 4WW2B 5B8CC 2I60L 3UIZA 1CBJA 5KYXA 2QGCA 1TLKA 1T7VA 1WH0A 1A7PL 3PWLB 4MYWB 1M7UA 1IGJB 4PJDA 4PTTA 3SSGA 4BWWA 3OHXC 3PIQB 3BIAX 3QWRA 1PZSA 2XBZA 3VVVA 3HG5A 4YSRA 4X5XB 5HXMA 5D7JA 4JQIL 5JHBA 2V0AA 2VLJB 2XA3A 3UYRL 2Y7MA 4WO4D 3LNHA 4G6JL 5TQ0L 5HI3C 4XPAL 4XAWH 1LK3H 3IM1A 2VR9A 4P4KC 4NBYB 3ARBC 1G6RL 3P02A 4J3BA 4AV5A 4P23D 3K2UH 3GNML 4L3EB 3GBEA 1UQSB 1OB0A 2FB4L 2WO3B 5I8EB 2EDRA 3CZEA 2Y7QA 2EVIA 3UBXB 1LEGB 3PRZA 4JFTA 1NLDH 2BW5A 4M02A 5TJWK 4H20L 1P1VA 3D3VD 3B9KB 4HIEA 2X70A 4NGHH 4R97C 1O9WA 3F3HA 4RGND 3GKWL 4UNIA 5HJGA 1EBAA 3QJFB 3APDA 1HYRC 1G7MA 1DP0A 5HHNA 1B0RA 5JW3L 3S88L 3FULA 1QKZL 1JD7A 4NO3B 5C0AD 3RVXC 5HHQA 1WZLA 1L9QA 1X5KA 5DVPA 4WI6A 1OT4A 1IM3A 3GQFA 4WCYL 5FYLH 3P4MB 3PV7A 3ARFB 2E7LA 2R0KL 3VXPA 1ZT1A 3GTVA 3RWIA 3OJ2C 3WJJA 4LHUB 1JI2A 3PJSB 3E8UH 4G8GD 4P5TB 4JRYD 5CLZA 3VFSB 3T09A 2Q10A 2Y36L 3RFZA 4RRPA 4B6ZA 3LXAA 1XF5A 4LNVA 3ZTNL 4CN6A 3P77B 1AGEA 5EF0A 4XN1A 1XVSA 1J7VR 4W9KC 5SWQA 3QRFM 4RISH 2ARWA 4JRXE 3WOVA 1FO0B 3CCHB 2NCEA 4F33B 1LILA 3QORD 3OKOB 2FWOA 2R1YA 3QJUB 3EO9H 4LCYA 4GG8B 4KFMA 4N68A 3TN0C 3WHXB 4ZS7H 4PRPA 4ONGH 2A0LC 3P0VH 4PV9A 4MMYB 3QISA 5J3HC 4F1SA 4WHTB 4BFRA 3TONA 4PGDB 3L3OC 5C0JA 5AKSA 3N3EA 1F5WA 3AT0A 3QDJE 3WFBL 5IROD 1UEYA 1JZIA 2HB0A 4V33A 4PRDB 1HNYA 2W81C 4S1DC 1ODUA 4JMNA 5AD0B 3FFOA 1HEZB 3ULUE 3QUMB 5DEJA 3PWNB 3JVGC 4XGZB 4PD4K 4RIRA 3QIWC 4NO5A 2V2TA 3KPSA 5AVUB 2WXLA 4GRWF 5EWIH 4BSVA 2CGRH 4FD0A 5EOCL 3WBDA 3GJEA 2X4QB 2R56H 5LG6A 3VGFA 4KQ0A 3HC4L 4WNSA 2QZ5A 2YMOA 4FNLL 3CH1B 1EMTH 4IIZA 4RGNB 3B1UA 1XF5B 1WICA 3CXHK 3TZVA 4OFKA 4NZFA 4MLIA 3QDMA 5JHDB 2WN2A 5IMMB 4MAYC 4AX3A 3Q5OA 5JDJA 4IEFB 3LH2L 1SJXA 4HQQL 1QBMH 1ETA1 1EO8L 3VWJC 1CFNA 1DUZB 5DC0A 4EIGB 3OF6A 4DQOH 1RI8A 4X5WA 3EYOB 3H56A 5KANG 4ZTPL 4EBQH 2WVTA 1E40A 2NY6C 4U3CA 3QO1A 2WUCH 1RK7A 2C7FA 3K0YA 3QQ3A 5IUSA 1UWEL 4IYKA 1LDSA 1XDTT 3LZQA 5AAMC 3IAQA 4Z8FH 5AD0A 4JHVA 2PWGA 4LLQB 4Z7VE 5IIEA 3L5WA 4F80A 1INDL 4PFEA 2W80C 4NN7B 2BVPA 2GHZA 2B59B 3CZLA 1I1YB 4N2NA 1NCAH 3MNWA 5C0IA 2OSLA 4MDJA 4O4YL 1DQIA 4AUYA 4FL4B 3AWGA 1RUML 3IJ8A 4R83A 1M7IB 1WEJH 4KK9C 2QGEA 4J3UA 2NYYC 2ALWA 4D0BB 2YHGA 3AXIA 3DRTA 1U8CB 3UTOA 4GRWH 4JE4B 2V2WA 1XZ0A 4LPTA 5MHSE 3I74A 1TQBB 1UVQA 4PG9B 1ACCA 3WG7B 2ZWNA 1B88A 5C0BB 4EUPA 3AABA 4F2MA 3IMBA 4F27A 2AF2A 3T0XA 2XZCL 4X6FB 2ZCLL 1G5AA 2NYKA 5GZNC 5L88L 3MXVH 4GEJA 4LSRH 3MRIA 1LP9F 2WMPB 1NGWA 3V9CA 3FOMB 1G6VK 1WP6A 1YYMH 3QWOB 5LBSH 3SBWC 4W4OA 3L3KA 2LU3A 5JNYA 2Y7SA 3EHBC 3S7GA 3DVNA 1BYPA 1SVZA 1J8HB 1UA6L 4I3RL 1TO4A 4BZ2L 1I7UB 3W81A 4D9RD 1J5OH 1TNMA 4AJYV 4XCFL 1TEYA 3SO3C 1MCWM 3QUYA 3L2MA 4F7KA 1EAPA 3PABB 3FB8A 1G43A 3B3IA 4LNRB 5A2BA 4P4KB 5L6YL 4FLRA 4OCWH 1AGFA 3ILDA 2AJUL 4KMLB 4MJJA 4KZDL 2BHFA 4KRPC 3KPLA 3QWQB 3T0EB 8FABB 3L4XA 5KBLA 3NA4A 3G08B 2E8YA 2QADC 4A38A 4GKSB 4KAQH 3CFCL 1IGFL 1EZUA 4BSJA 3MX0B 1NGQL 2GITA 4ZW3A 4HWBH 2OYKA 3CDYA 4YDKH 2X3AA 5AZEH 4WHCA 4IRZH 1E28B 1MRFH 3FTUA 2V9QA 2A77L 3SDAC 4W81A 2XZCH 5HVHC 1C08B 2YD4A 3FUFA 3OSKA 1CE1H 1TO5A 4UTBA 3OMAB 2PABA 2Y25A 3ATFA 4L4TB 3PPEA 5IBLC 3A6BH 5L9DH 1JV2A 2ZKHL 3II2A 4X6BA 4X80L 1ZJBA 2B0SL 3KBPA 3CDCA 3STBA 2FBRA 3BP6B 2YJLA 1VACA 4QT5B 1KIUB 3K2IA 1WC7B 3QFJB 4XN2A 3WJLC 2HTKD 1NCBH 4XX1E 3VFOA 4AZ8B 3QJZA 5I82A 5FXCH 5EBMA 3QJFA 2IPKB 1WTGT 2WLZA 2QDWA 4WEBL 3V6ZA 4LEEA 1GH7A 1R3IL 2IALB 5F7MC 2WP3T 1PLGH 1FFRA 4KX7A 4X6CE 3ZOAA 4F8TA 4DPBX 3BE1L 4RZCA 4S2SB 1BX2B 5ANHA 2JKNA 3C6LD 3GSUB 3ZIMA 3HNTL 5H2BB 2I69A 3EOAB 3W11D 5BNXD 1RUPH 3IMTA 4FFYH 1E2ZA 1RIVL 2BHYA 4I4WB 3DOIA 3WNOA 1U8OB 3MBWA 1AGEB 1NC2D 2XZQH 4YHMH 2FTAA 4RMRA 3RIAF 3WMQA 1MFAL 5EC2B 4OVUA 3IXAA 4ZAKA 5CCKL 4P57A 2H2SD 2R39A 3QZNA 4LOUC 3BAEL 3GBNL 1Y18B 1WGOA 3V0WH 3Q3GB 1V8HA 5EEZA 2VLJD 1PKOA 2X6UA 4C4KO 3TZVD 1MJ7H 3ILPB 3LVTA 3VFPA 1QHOA 1OZTG 2UX6A 3RDTB 1IAKB 5DMIL 1TJIL 3ZDXF 4CBPA 3MACL 2MNUA 4YLQT 1JG9A 4CN1A 2ESVE 3MUHL 1SXAA 3SYQA 2OXGB 4ZZFA 3LRMA 4AGPA 4JQVA 3CMOH 4YOKA 3KYOB 4H5SA 1IU1A 3WN5A 2CCLA 2J8UE 1RUMH 2H2PD 3KLLA 2FO4A 1E8XA 1MHHA 3SPGA 1P4LA 1M2OA 2GQHA 4G1MA 3ECUA 5BS0B 5IFAL 4NQTA 4PJDF 1JF1A 3BT2H 5SWQB 3PWVA 3M88A 1K2DA 4QO1B 2ZXCA 4P46B 1NLBH 2NY0B 4E0RA 2HRGA 4G9DB 1G7QA 2WN3A 4KRPD 4WWID 3TP4A 3S3CB 3SQRA 4Y4KC 4MWFB 5JW4Q 5FUCC 4DGYH 5ECJE 1QNZH 4WI0A 3R4DA 1NIAA 1QSEB 2L4OA 5IM7A 3B37A 3ZDYB 2JB6A 1G0YR 3AJ7A 3Q44A 2GJZB 3AACA 1PZCA 1X4XA 1I3GL 4DCQB 1GY1A 1LWRA 3Q8CA 4DGYL 2UZXB 3L7FB 5EF1A 1R3LA 1UUNA 4YX2H 1R34A 1AOZA 5DRZB 2NY5C 1RIUL 3KBFA 1N4XH 4EVNB 1A6WL 3O2DA 4RFOL 2D03H 2OZNA 4NO5B 4PCYA 5CLTA 2OFQA 1A4JA 4D8PB 4HMEA 3F7LA 3H9ZA 3QQ3B 4HUVB 1E90A 4ZMLA 2MTAA 3BISA 2R0KH 1DR9A 2Q76B 3BSZH 2WK2A 1P2CA 3QUYD 2ORBL 4UQ2B 3RLSA 4NQCD 4L37B 2A6KA 2YA0A 2IV8A 1N68A 3QH3A 1UTDA 2OV0A 3L4WA 2HVKB 4GP5B 1I1AD 3E6HA 5TE4L 3KWWA 5DUJA 5L0QB 3RVUD 1I1RA 4IU3B 1CDCA 2OMUA 5SWSA 3QIBD 4X7FC 2OCJA 2CO7A 2Q8BL 1P7KA 3L13A 1DSWA 1NAKL 4OGYL 4PWKA 1F4WL 1ANUA 2H26A 5I1KL 3C6LC 4L1SA 4K3DH 4TKWA 4MVBC 4OCYL 1A1OA 3EH5B 1OP5H 1LO2L 1NSNL 5DUBB 3TPKA 4YQXH 1AXTL 1KCBA 4DESA 5LUMA 1LEIA 4HG4J 4DKEH 4NDMB 4AGLA 2HT4C 4HALA 2RIKA 3F04A 3KYKH 1QFWH 1E8ZA 2BIIA 3VM7A 3RTQA 3VXRA 4YK4C 3KWUA 5I0YA 1C16B 4PJEB 3HOGA 5I17A 2Q87A 4PGBB 4UM9D 1ZJAA 3ZUNC 4KNQA 4JREB 1U8NA 2JE8A 2YUXA 1ES0A 1PSKL 1ZIBA 3B6SB 3LKRB 5I75C 2DQTL 3PXLA 4ODBD 4I8DA 3FCGA 5TDOA 1HQ4A 4HD9A 3QUXA 2FSEA 3MNVA 2QQNL 3DXAA 3GUFA 3O2DL 5ICUA 4PP2B 4E9YA 3T6ZA 2NY0C 5JW5B 4AIZB 1SMDA 1SLUA 1LHZA 2GSGB 2YBRA 4KK8D 3K74B 2P5WE 2FHBA 4QRUA 2BFVL 5D1ZA 2HG5A 5E9DE 3QUYB 4Z7WF 4JKLA 2R56L 3CN0A 4JFDD 1QSFA 2ODIA 3GS4A 4NWUL 2RFXB 2YRPA 4N2IA 1TJGL 4LESA 4AT6A 1UATA 2JK5A 1TZAA 4D0BA 5FW8A 5FO8A 1CYXA 2HTLC 2BIPA 1J11A 1HQRB 2VCOA 5DD3L 3BLKA 4MB5A 1JCKA 1O6TA 4N0CC 1KY6A 2EXYD 3BC9A 2PO6C 3MRFB 4MBRA 2AQ2A 5CEXB 4ZFZB 4GKZB 5LDUA 2FO1A 3RGBA 3GZPA 4HSQA 1XEDA 3VTAA 1S8DB 4OY9A 5KVGL 1IBGH 4L1HA 1SN5A 4Q89A 5KSAB 1QLRA 2YD1A 1NBYB 4N2FA 2R2EB 2AEWA 3HI6H 3WIHH 3TYFB 1TFPA 2EIDA 2A9BA 2MCMA 3J2PA 4ZUUA 4B9YA 1MI5A 1BOGA 1OIOA 1E8YA 1G4RA 2QZQA 5KS9A 4KKBC 3VXTB 2MJWA 2AXJA 3FNKA 5DRWA 4KRNA 5AZ2L 4Y8DC 4TVSa 1M6OB 2HVBA 2KDGA 2BXZA 5E0QA 2AJXL 2WQXA 1EV2E 3BT2L 4ODXA 2AK4D 4NQQA 4ZUWA 3ZLQC 1TVHB 3FZUD 4FFWD 4P59H 1F4WH 3ECBA 1RULH 5DS2A 5IJBC 2XG5A 4HH9B 4IOFC 4GUQA 3ME0A 3QSKB 3HAEH 3T6XA 3E3QE 4WNQA 5F7KC 4N4YB 2VJXA 1HNGA 3O6FD 5AW3B 4AM0A 3D4ZA 2DH2A 2CKBL 4LCWA 3D9AL 4NXSA 4PJBA 3UTTB 3IN0A 4E41E 2ZCLH 4ELMF 2OXHA 1KCLA 1QFUH 2HT3D 1SEQL 4YLBA 5FWRA 3TCTA 4NC1E 3N1QC 3HI5L 1A9BB 1SDDB 4U33A 4R7LA 1DQVA 1R4XA 1T03H 4Q7DA 1SUHA 4TPRH 3PQYD 5BZXA 1MJ7L 1GJWA 4J3OF 1WWWX 2A9CA 1KXHA 4B7LA 4GAYB 2FHFA 4EF3A 4ZX4A 3L7EB 2E5EA 4U2ZA 3IETB 3O2WL 3NCFB 4Q2ZA 1U8IB 3SDAA 2PP9A 3ALXA 1QVOA 4AEHH 2G3MA 5F7DB 1HH6B 2GFBB 1QBLL 3EOYG 5C07E 3RHWK 1CBVH 1ZLDA 1MAML 2MPVA 4QY8A 1SMOA 1JF6A 3VCLA 3T2NL 5BVPH 3GWJA 4YSQA 4YE4H 3RWGB 5J6HA 4PMEA 4YWGL 3BIKB 5B3JF 1Q9WA 4ATWA 4FQQB 2A9ML 3BT0A 3IMWA 1FV1B 2DEYX 3ZHDA 2BVOB 2H6PB 4JVWA 4ZZKA 2DLGA 3NK3A 4RAVB 2NR6A 4YSOA 3T6QC 1QFOA 2X7LB 4TLUA 5EEWA 1KTBA 3PWVB 3CNKA 3TA3C 3HS0A 3UTSE 3MLYH 3DARA 1FLTX 3RVVD 2Z31B 3UP6A 5MEQA 1KEMH 3EGSB 3S4SA 2OMNA 3TH3T 1HWHB 1ZK9A 3WMPA 4F92B 3FRPG 4TM9A 5L8JB 2MOVA 3ZTJH 1BECA 2G2RA 2IO5A 4EZMA 5GRUH 2JIXB 5H35B 2P43B 1X7QA 3MI6A 4PIBA 1CLZH 4FTVB 2GBTA 1KJ3L 1HXMA 2B5IC 3CZFA 1EHLH 4GW5B 2G75B 1N0XL 4HXBH 4NENB 4GO8A 4R4BA 4U1JB 3HUJF 2IQ9H 2CMRH 4JHWH 5CP7A 3OG6B 4BDVA 1TQBC 3FB7B 4JFZH 1JDDA 1OD9A 1WVZA 4LOUD 5J6SA 4ES9A 1BA9A 4J3XA 4DETA 2PKDA 4EO5A 1YEEL 4KKPA 5ACZA 5I30H 4XNBA 1G9NL 1KIPA 4BZYA 4GG6F 3D05A 2H8PA 1NBQA 2GCYA 3GEFA 3G5YB 2Z92A 4KK6D 2JELH 5EUOF 3RP1A 4WWKB 4M4RB 2CCVA 3UTPD 1ZSDA 4Y1AB 3W9DB 2EDJA 1BAFH 2QQQA 3L9RA 3ZGHA 1S7QB 2OJZH 2I7OA 3AAZB 3QEQB 2J12B 4XP1H 4JFFA 1JZJA 1OAYL 1UD2A 2BWDA 3V6OE 1TPXC 3OQRA 3IF1B 5HYQA 4H1LH 1S9XA 5B38A 5ABZA 5AAMA 4MZIA 5DJ6A 5F7UA 1BFSA 3FRUA 4PJFB 4BUQA 1O7DE 4PGEB 1QLFA 3V7AG 1U2YA 5ID0A 2Z31A 3LDBC 4N6QA 5D7JD 1MJUL 1LO3H 4HS6B 5AVVB 4DZBB 4H0IA 4F7EB 1EEYB 5LBSL 1JK9B 3BFQG 5GGRB 3O41B 3U25A 4HKXA 5C9JB 3LKSA 3RY4A 1IFHL 4X6DA 3Q1SH 2DTML 2GW5A 3MLPA 4JANA 4Z1PA 2Y1VA 3BDXA 4N8PA 4AVKA 5AVZB 4R7XA 4PGDA 2I7SA 3P0YH 4BQ9A 5C0JB 1F4XL 3HA0A 3WEMA 1O75A 3HW7A 1TVDA 3GJFA 1MCRA 2RCSL 4G9FE 1I1FA 4NZJA 1QSVA 4UQ2A 4AIZA 4BQCA 4RDQG 3B9DA 3BH8A 5I8EA 4NM8L 1YVLA 4S1RH 3BUYB 2D2OA 3NPZB 1Z6JT 5IZ7A 1RY7B 4ZPTB 1Z9OA 2IANB 2J4WL 4NCDA 4TNFA 5HHXL 2XTJD 4NC1C 4EZJA 2WZPD 4E9RA 3CHRA 2B15A 3QQ9D 2N7SA 3BZFB 4G42A 4M8QB 5EOQL 5EU7C 1YMME 2E3VA 1WFOA 4M6AA 4MHHG 3GD1C 1BZEA 1SN0A 1R3JB 3IT8D 4QKTA 3QIWA 3QUZD 4AK2A 5KOVC 3FFDB 2WZ5A 4JZOA 4PJGB 3RBSA 1JNNH 4HK3J 3WJMA 3IGAB 1W2KT 4KBPA 3W37A 4XNMB 1HCFX 2AJZA 4Y5YC 3NOIA 5AVTB 3DO7B 1HSAB 2O26U 4RWHA 2NT1A 5CZRA 4L0ZA 2P5EB 3V95A 1P5UA 3U48A 2EO1A 1E9OB 1XF4B 4WTQA 1HXYB 3DX1A 1JTOA 2YMXL 4BXSV 3O6KH 3QI9A 1DSYA 2KBGA 1D6EB 1CLOH 3WO4B 3VFUA 2ZOOA 4RESB 4XC3L 4E9XA 5CEZD 1NIFA 5D1XC 1R0AH 4GG6B 4QEGA 5DD1L 4A7UA 3GMMB 3RVTD 1QO3A 4FQ2L 4MAZA 1NLBL 2P7TA 3L5XL 2ZXQA 4FQHA 1J10A 4P48A 1JN6B 1OB1B 3T4YA 3B7YA 1KCSL 1IZKA 1XGTB 3TJHD 2YPVH 1A4KB 1Z9SA 2X09A 4PJXE 4PRID 2QHRH 1IUZA 2A7BA 1HOEA 5DJDA 3GSNB 3HI1B 4DVRH 2V3EA 3AGWA 2XT1B 4YPGB 2Y2WA 3KNBA 3ZZQA 1S5IH 4AQOA 1JRHI 4KJWC 3X1EA 3LKQB 4FQLL 3ZSTA 3NIGF 4XRCA 4A2EA 3MUJA 2MPAL 2QKIB 5J6GB 2W0FB 3ZKXC 5K59E 1VJSA 3MU3A 3MODL 3U1PA 2OMBA 4Y2NA 1K85A 4LSVH 1F8TH 5KVFE 1INEH 2AJZB 2DIBA 2IANE 1ZANL 3VXSD 3CFIC 1XIWC 5JIQA 3LEYH 1N3NA 4KRPB 3T0EC 3QZWG 2V9UA 3FT0A 1YEDA 2HFEA 1NKRA 1KNOB 3FQUA 1THCA 1B9KA 4BWTA 1V3MA 4P4KA 4NM4L 4HC1H 1AO7E 1KFAL 2FGWH 4A6YA 3V5DB 3TFKC 5LQBL 3LCYA 1KZQA 4LLDA 2G3XA 3T8XA 2BNQD 3VFGL 3F2LA 5D1QE 2DJ4A 4GMSH 1C1EL 1SFDA 4WGKA 1IBZA 3WFHB 2ISDA 2J21A 2KLTA 2OP4L 1MCIA 4G72B 2BSTB 1Q9KB 1ZCRA 1TQSA 1Z3GL 2D0HA 1CGSL 3VGBA 1QEWA 1NCWL 2ILLA 4IW4C 2FJSA 3CSPA 1NCHA 5AALA 3U9PH 1A0QH 3K81A 3LXUX 1IAII 3FMGL 5DJXA 5C0NC 1E9PB 5C6TH 1K8IB 5EU6D 4GUCA 1XZWA 2XXCB 2GY7B 4YUEH 5D71H 3FSOA 2RTTA 4AV4A 5J6GA 1NCBL 2MCPH 1P7HL 3QFDA 3PV6A 1TZIB 5JPNB 1AMXA 2OM5A 5E4EC 1YY9C 2HPTA 4HEME 1ZT1B 2IGLA 4I7ZC 3NPSB 1ORQB 3PHQA 3F12A 3ZDZB 4ZJ9A 5BVJA 3L5IA 3RGVA 3MXWL 3O6KL 4PR5B 2DQMA 2UXTA 4H20H 1DVUA 1UOKA 3IDXH 4OKVA 4XHQA 4RVBA 1AAJA 5GZND 5C0CD 3FTVA 2AV1B 1Q72H 2OZ4L 2EVGA 4KJPD 2CLVA 3O3EB 3VRJB 4QRTA 1FAKT 4K3EL 4JFFE 5J1SC 2QR0A 1CGVA 4A6YB 1JWSA 4OR1A 2Y6TE 5B1KA 1FRGH 4QKXB 1D7BA 5FUOL 4PB9L 2WXHA 2BDNH 2XZQL 4UQEA 3WN6A 4F8LA 4I13B 5ACZB 3MV9B 1AHWA 1TCMA 2CJTA 4YXHL 5FM8A 2EKJA 4ODWB 3NCJH 5T3ZH 3O8XD 1JPTH 2G2NA 1UOVA 3QZPA 4NM8H 4S1RL 1N70A 1UFGA 5BOPA 4FXTA 2O5ZL 3QHZL 2V33A 5H2BA 2GKIA 1WYJA 5IG7A 2X1XR 4A7GA 4P9HH 2JIXA 4H40A 4W4OC 3V0EA 4EE2A 1N6UA 3MGTA 4LIQH 4QAWA 2AABH 4P9HC 3I6GB 3S8FB 3MBXL 2CA4A 5IQOA 5GZNA 1W0WB 3L5HA 1XR8A 3EW3B 1CFVL 4JFPB 1F4YL 4FTVA 3CLFH 1BCIA 3MLXL 1AFVL 2CPCA 3UH8A 4FFWC 3GKWH 3HBGA 1FZJA 1MWAA 3AMLA 4FMKA 3FKUS 2Y0SA 2B4CL 2YMXH 3HLAA 1FYTD 3P3TA 3MRKA 5JXAH 2DM4A 5EU6B 3G5YA 4EOWH 2Y7OA 1A9EA 3X11B 2WBWB 4YZFF 4X7SL 3Q06A 3GSQA 1U8JB 3MRMB 2AXFB 1HAUA 1SOSA 2VC2H 3G5ZB 3U4AA 3O4LA 4MNQB 4ODHH 5DMYA 1NICA 4TVUA 5DI8B 1V3JA 5LNGA 4HH8A 4HWZA 4QCIB 1S5HB 2G4GA 4LBEB 2WIIA 1KJ2H 2XY2A 4MJ4A 2NR6D 2XN1A 1W16A 4N6RA 4M43H 1NPUA 3OB0K 2A74A 3MROB 1FL5A 2X4OA 1EGJL 2ZUVA 1DBAL 2BNRD 3CBRA 4P2QB 5DA4A 1S9XB 3ULVH 1GKOA 3K2KA 3CX5K 1E5YA 2BK8A 3QO0B 4UILL 1CU4H 1BF2A 3UADA 1XB6A 3TJEL 4ONOA 5GRYA 4IJ3B 2Y72A 2YEVB 3G9VA 3WEBA 5IB1A 3QG7H 3HUJA 1GS8A 2BW4A 1A1MB 1P84J 4UT9A 1PZ5A 5ANMB 5C08A 3NCBB 1GJIA 3KWWB 2WLKA 5DZJA 4QGTA 1SN2A 2O1AA 2VM3A 1DUYA 3M86A 1QFPA 3SBQA 4P99A 3S36H 3VGHA 1N2RB 4Y5VA 1SHXA 1NPNA 2XV0A 2H3NB 5C0DB 4GAGH 5CGBA 5FLVA 3CV5A 1TEFA 3MCYA 1E5ZA 3GJFB 4FMVA 2JF1A 4XNXH 3OPUA 2OTUA 4F2EA 3GLEA 5DEZA 4HUVA 4LU5H 4O2EB 2VOTA 3EG9B 3JYBA 4EI5C 5IJKA 4NRYA 4Y5YA 4HLJA 1NGWB 5E8DH 3BRDA 4ZPTA 1L0PA 4OLZL 1JPTL 3O4LB 4MNQA 3QWOA 1E4KA 1E3XA 2AXGB 1U8LA 2ZYRA 4XCCH 1PJ9A 1U3HC 4YXHH 4N2KA 1EEQA 1AHKA 3LRSA 3GSVB 3QIWB 4YHYC 5AW4B 2EYSB 3WNNA 1F1DA 3ARRA 3LEXB 2VN3A 5HD8D 4XNMA 3HZKB 3V79C 3VB9A 4O5LL 4A04A 3M17A 2G5RA 2LLLA 3FFCD 3RU8L 4NWTH 1AI1L 5F89B 1L9MA 3MOBL 1GSKA 4ONFL 5I73C 3VSVA 1EEUA 3M1BB 1FZMA 4OT1H 2Z9TA 4HHWA 4PJGE 4O02A 3GMPB 3FU8A 1KXQA 3HBQA 1MWOA 1J48A 2VDNB 4G43B 5ERWB 5L4IA 4JG0H 4F9PA 2NXZD 1ORSA 1MNNA 1H5BC 3BRGC 4HUXA 3VX0A 4ZOEA 1ULVA 2ZXAA 2GK0A 3MA7A 3MLUL 3QWRD 5ILTL 1MCOH 3WKNA 3QUKA 3V0GA 3LX9A 3K1DA 3ZE1E 1X4YA 3GHEL 5TDOB 1G7HB 4PLOB 4AYMC 1IT9L 4CADB 5JQIB 5CD5C 2DLHA 4JPWH 4TNWK 2XN9E 2ZXBA 4OLWH 4TTDC 5JUEL 4ZW5A 1A4KA 4OLUH 2QSQA 1S9KC 4Y19B 1T66C 3E9UA 4G80B 3R4RA 4N8CL 4A2LA 1Q9KA 2GBVA 3QCUL 4UILH 3LHPH 4XO3A 1GYAA 5HHPA 5E6IA 1DBJH 5JR1H 3OR7A 3DPBB 3GXMA 4H7VA 3U2JA 4PVBA 1IAOA 4KJQD 2HJLA 4JPIA 3CG8A 3UL4A 1FLRL 3BKMH 1F86A 4L29B 1EVUA 4HYTB 1QYGH 5C09D 1KJ2L 2PYFA 3GLAA 2AQ1A 3B3BA 5KBPA 3C60D 5DSCA 1OAJA 1ZT4A 4PGCB 2P8MB 3TVMA 5FUCE 1NBZA 2VB5A 5CR8A 4F5CA 1TMQA 3FTSA 1X5JA 4LKCA 5JDSB 4KJWD 1R75A 4M7ZB 1NCCL 5HHVH 1KGJA 5SWSB 3SJVA 1TUPA 3DHPA 1BYOA 4NQEE 5FFLA 5FKPA 3F5WA 2W9EL 5FYJD 3HE7C 5T1KB 2F9BT 4ZPVB 1WCBA 1ZHNA 1ZLUK 1SDAB 4R26L 3D25B 4QWWD 1ACYL 3U83A 2HRHA 2N7AA 3ROLA 3OGCA 3HNSH 1GGYA 1SF5A 2J20A 1TJHL 3I02A 5CIPB 3U7YL 3FU0A 4ZMAT 1RSYA 3MBEA 2J5LC 2NX5D 3IGUA 3BYYA 1YY8A 1FUNA 5H4YA 5AVYB 2GBAA 5KAQF 3F62A 1YN6A 2FLRT 2I60H 3CFNA 4DFIA 2E7DA 2RHEA 4B3EA 4PJ7F 3IDJA 4WWPA 3T4AC 3KBHE 4B53A 4L3CB 2RD0A 1I8LA 2B9AA 3LHPL 3OM3B 2OXHB 3Q8BA 4Q9QL 5DYFA 3ROOB 2M2DA 3QFDB 1NUNB 2DQJH 3VXQA 5IROA 2HH0L 3DBXB 4NO2B 4JO1L 4N2CA 4W6XB 4J1UB 3TH2T 4ZAKD 1ZTXH 4HIXH 2UWEE 1CGXA 4R0LB 2QQNH 3C6SB 1I1AA 4OLVL 4UQCA 3K6NA 1RFDL 1U8IA 2IH8A 5EA0L 1Q1JL 4UF7C 2FX9H 1HHIA 1JGEB 1B2WL 4Z0XA 5L7XL 4Y19E 4AYFB 4OD2B 4QRPD 3DV6B 4YHLH 3ARED 5C2BH 1GGCL 4J7RA 2PYEE 3VXUE 3P4MA 2YLHA 3SDYH 1CXFA 4XXDB 4MJID 2Y24A 4ZQTA 2X44D 5ESVB 4YN3A 3FH5A 5E2VL 4QRTB 3RWHA 2CR6A 5ANME 2FBJL 5G4OA 5JMOC 2Z8VC 4UI2A 3ULUF 4HPOL 2H47C 1GXEA 1JFQL 5AYTA 2K6WA 2WSKA 1KCUL 3UYRH 3ARZA 3BD4A 4R7DB 4UNUA 2WTPA 5EU5A 2NY1B 2E76C 2R23B 3B5GA 1TU2A 1WIPA 1MW0A 5FHAH 5CD3A 2VE6B 3ERXA 1FGNL 4E9VA 5I76A 2UUDK 4FS0A 5ISZE 2E7LC 1IAIH 3GZQA 3E8VA 3TZVC 5DRNA 2K78A 5D71L 3H7BA 4LEBA 2ZD0A 4W9LC 2Y5TA 3MLWL 4N8CH 5KJRH 1AZCA 2CJ3A 5IM7B 1XIWD 2G75A 4C56E 4CW1A 2JNZA 3ZBMA 1JV5B 1M2VB 5IMKB 2BSED 4BDVB 3QAZB 1N4XL 1OWRM 4ODTL 4HKJB 2G9HA 5KBMA 2HP4A 1RUAL 3ZDWA 5I19H 1ICTA 1W0WA 1DL7L 4PJHF 5AKRA 4JVPA 1JZ5A 3TV3H 1A4BA 5DYOA 4WAFA 2LE9A 3F6IA 4JFVA 5G5DA 4WO4A 2VSMB 3DROA 5I73B 4HD5A 1CDBA 3HJEA 4ETQA 5FPIA 3HKFA 4PS8A 4ZNEA 2FD6H 4E9QA 3B7UX 1J1OH 4L4JA 1WIOA 5DJ8B 3B9VA 3T3PB 4HPOH 3BI9X 4N5ED 1DE4A 1MIEL 5IB5B 3FT4A 1TZOA 2WBJA 4V1DE 1OP5K 4HIIB 2EJ1A 3GXPA 5IVXE 2E9JA 3CN1A 2YSSB 1UFUA 4JGUA 4A7QA 1KV3A 4APQD 5E5MA 1P4IL 4FABL 4HUCA 5TQ0H 3MQIA 1IVTA 3L4VA 5I75B 5HI4C 1A7NH 4M7LL 4PW4A 1W9XA 3P3RA 1CXLA 4F37K 3FOLB 3QQNA 5E6ID 4NNPH 4XE5B 1MFCL 1UXLA 4OTXL 4OJFH 4UMSA 1VKXB 5JW5A 3BN3B 1ASPA 3FQRA 3MBED 2Z4TA 2SEBB 3VXRB 3DX2A 3RIAK 2QLVB 3OXRB 5I1JL 4WFFD 4A2DA 4TSCL 1RSFA 9CGTA 2K3HA 1DVXA 3SDXF 1X7TA 3MV9E 2IH9A 1AQKH 4HEPG 4KDTA 2DW5A 1EDQA 3MMEA 4JN2B 4BK4A 4DIXA 2PCPA 4JY4B 2D73A 3F7YA 1OPOA 4WSGA 4CMHB 1F3DH 4OKDA 2G30A 4TF4A 3KEDA 3TBVB 4JGNA 3VFSA 5B3NA 2VLME 2J44A 1PD6A 2MEJB 5LXGL 2XWDA 1MAKA 1X5IA 1M7DA 4K94L 1FYHB 2B1AH 5AYUH 2GSGA 3RPBA 3QXUA 2WXOA 2F58H 3IJSA 2FDBP 1RZJH 2Z1PA 1SY6H 4OGAD 1ACYH 4I1RA 4A67A 3VW3L 4LLMB 1UM6L 1MIML 1Q8MA 4MMZB 2Y3NA 1GCYA 3QORA 4BV1A 3SGJA 4NJ9L 3F7VB 1JPSH 3BD3A 3JV6A 3QAZC 3EYOA 4NZDA 4Y2LA 3U7WL 1AQDA 3QUZB 4GRLA 1QAWA 4FA8A 2A73A 2PETA 3L16A 2N0KA 1M9WA 2EUXA 2VC2B 4LASH 5ETUA 3RWJB 3QI9B 1J18A 5LN8A 3U4BL 3RDJA 25C8L 4TUOA 2D0GA 4PY8J 3KPQA 1NFDA 1EXUA 1YEHH 4G43A 4L1BA 1KLUA 3NCCB 1GYUA 4FFVC 4KKAD 2Z3FA 1UEMA 1UJ3B 3ABKB 4O02B 4OZFH 4L0YA 1UH3A 5FV1L 1V55B 4FZEL 3UYOD 2YS4A 5LN4A 4EQ2A 5AENA 5CU9A 5FF6B 3TBVA 3V0HA 1V54B 4U1HB 4QDGA 3RWCB 4OLEA 1A64A 4PV8A 3ZR6A 1IT9H 4GIAA 4NHUB 2BMKB 3AUVA 3Q1EA 5E1AA 1YNTF 1GHFL 5I9QC 1U3NA 5B1CA 2XSKA 4DPRA 1BQLL 3ARDC 5B7MA 2VDRB 1JK9A 5DS8A 1U3ZA 4KJYA 5SWZA 1PTZA 4M1GL 3ISWA 4RRPM 3U9PL 4WFEE 1K3IA 2G5UA 3D2UD 2Q2LA 3SPVB 3P40A 3U4EB 3TJEH 2GI0A 4MNQD 4U1NA 1CDYA 1XAUA 2R2HB 4A2HA 3LB6D 4HAGA 4HS8H 4BELD 1LM8V 4DWHA 2NY5L 1EZVX 1EO5A 1PBYA 3B56A 3RU8H 3TO4C 3B2PA 4DVBA 1KNOA 3FQUB 5GJSL 4HCGA 1T0NA 1AXSA 1B4TA 3ZRFC 2B4CC 4R0LA 5D7IE 5L0QC 5KJ4A 2YZ8A 1URIA 1Q4NX 1S6NA 4WJ5B 3HI6L 5C97A 3KD4A 2OK0L 4TTDD 1CI3M 4OF6A 1DEEB 4P2OA 1BXXA 4YHOH 2OSWA 3TA3B 4E42A 2XQYK 3T6WA 2IV9A 3LZNA 1RXLA 3VFWA 1MCWW 4FTVD 2ZKWA 5EOCJ 3GPEA 2VO8A 4IRSA 1KGWA 4JL1A 2CBMA 1WLHA 4UIMB 2H0FA 1G1CA 2HKHL 3DGGA 2UV3A 1T89C 4KRMB 4JO2L 5F7LB 3SDCB 3H3PL 4YR6A 1V7NH 4BD4A 4FQLH 3STLA 1UC6A 2WVUA 1NUDA 4GLRI 3LNDA 5T3XH 1RZ7H 4ZAKB 3L1OH 1RULL 4U1KB 1NCIA 3SPVA 3NJLA 2XXFA 4LE8A 1ZLSL 4GQ9L 4IK7A 3NSJA 3LIUA 5GGTL 1WUNT 1BEXA 2IPKA 3V6ZB 5I1JH 5EULV 3WD5L 3K8LA 3IRPX 4WI5A 5CLXA 3A21A 4AYFA 1WD9A 2CUHA 4M62H 4X7EC 2BVYA 2E8ZA 2J2ZB 2DB8A 1A22B 1G9MH 3LKOA 4RRPG 3NFSH 4LARL 3DJZA 4EMZA 4DEPC 5ESVA 4K8RC 1C12B 3S9DB 2NCMA 2XJKA 4Y1TA 2DDQL 1R47A 3SPHA 1TZHA 3D39E 1FRGL 3K72B 1Q9LB 2HN7B 3CWGA 5IVZB 3BVNA 2QKIA 5H37G 1DN2A 1ZGLB 5TGBA 3VDCA 1GVIA 4MCZA 1ZWIB 1MIEH 5CD3B 3UTZA 1OP9A 1NKGA 2ZONA 1T3FB 5I0XA 1YC7A 2CRMA 4K3DL 3SPJA 3FC8A 3H55A 4Y1AA 4HWUA 3PP3H 1DQQB 2BRRL 5HTSA 1SXBA 2HTKC 1V3KA 3QJXA 3MV9A 4U3XA 3STLB 1QSEA 4FZ8H 3HR5B 2EINB 5E2JA 4LHJB 4RGMC 1P6WA 4OM1H 1IKOP 5T1DH 1D2PA 3RDTA 3UJJH 2OMXA 3HBZA 1L7TL 5K9KA 3OSVA 3FQRB 1MVYA 3RI5K 32C2A 4OCXH 3NK4A 4B7IA 1IAIM 3EKCA 3KYNA 5HGDB 5A1AA 4HUWA 5BRZA 2WO4A 3O6LH 5MEND 4M5SA 5D1ZD 5DO2D 1E5UI 4ZOCA 3SEPA 4EKXA 3N2JA 3ZT6A 4FA7B 1U8KB 2K9UA 3EYUH 3FBKA 4EIBA 1S9VB 2G3ZA 2CRYA 4PJGA 4MQ7B 4B9PA 1NEUA 4QOKD 3H9SA 3RZCC 3IJEA 5L2KD 1RZ8B 4K5OA 4ZOAA 3I84A 4DOHB 3VXSA 3LZLA 4KNTA 4CMMB 5FGCB 5D2LB 4HFWB 4A37A 2XACC 3F12B 5IW3A 1S7RA 2JB6B 1XGQA 2HT2D 1M56B 1A6TB 2K9FB 1AXTH 1KG0A 3Q3GA 4CKVX 4NO0A 5DDHB 1GC1L 3PWPA 2IWFA 1QR1A 3BRFA 1BQHB 1WBXA 1OQXA 4LCYB 3WFCH 5C0FA 3S37L 3BCDA 2WW8A 1MUJA 1MY7A 2P8PB 4JS7A 4LPUA 3ETTA 2P8LA 4LVNC 5LCVA 1RFDH 3DMMB 3G5WA 1PFOA 4ZFGL 3EF7A 2EIBA 5AOJA 5DMIH 3FCBA 1FVEA 5D1XA 1N8ZB 3QUMA 4HUNB 4L8DB 5D7SL 2EH8L 2BP8B 1P7BA 2LQRA 4KTEL 4W9JC 5B39G 3TJHC 4M7KH 3REWB 3TESA 4WHYG 4L4VE 4OLXH 5TF0A 3EH4B 5E6RB 1RQ5A 1AR1B 3GSXA 4KO7A 2P80D 3B1TA 4NRYB 2C3XA 2E27H 2X28A 4MD5B 1JHTB 2V6HA 4OW6A 3FPYA 4Z7VA 1WZAA 5CCKH 1EZLA 1U8LB 1GAFH 2W9DL 1I75A 3HTLX 3M7FB 2FQGA 4UU9A 5B1JC 3PAUA 1U91B 5FO8B 4Q9RH 3WFDL 4Y5VB 5C0DA 1DZ0A 3CC5A 3D30A 2P24A 3KHOA 3VGEA 5IESH 4TLKA 1YSOA 1PYWB 3CSFA 3NJVA 4BA8A 3VI3B 3JV6B 4YIQB 1OW0C 2X6BA 4ABQA 1GZHC 4WJKB 2EEDA 4HBQA 1A7QL 4X42A 4YQXL 2D7TH 3T0ED 3NCEB 4CL7A 3RZCA 2YUWA 3AADB 1MEXH 1INEL 4RH4A 5F1SA 2WZPA 2DPKA 3UP1A 4LPYA 3TT1H 3WEXA 2EEFA 5T1MA 2XA8H 3VXOB 2ZAHA 3R06A 3MODH 3PXJA 1OHQA 5HYJD 1FC1A 2P3YA 1TQCB 5T1DL 3N5AA 2X3CA 1H8OA 3PY9A 1CTMA 4ELME 1GA2A 3MRJA 4K7PH 3K8KA 1S46A 5JA8B 4BHUA 2JKTM 2CR3A 4BGDA 2ICCA 5EZJA 1MQKH 5K9JL 5IGXH 2PW2B 2A1WL 2BP8A 2H3XC 3JZYA 1NMBL 1I1YA 2ZCHH 5CILH 3ARDD 4Y19A 3RDTC 1DFBH 3T77B 3L3OA 2GJJA 4YHYB 3B2XA 4ORGA 4R96A 3QBTB 1A1OB 1PG7W 2MQGA 2CKBH 3MNZA 4OZGF 1GJUA 4UIMA 3RWDB 1KSRA 2VXQH 1I8KA 2PXYD 2DYPB 3TL5A 3R18A 4HKZB 3KCWA 1MFAH 3PU7A 4G70B 5EC1A 3ZTJG 1OGAE 1OT1A 1XH0A 1J05B 5EZOL 2NSXA 5IOPA 1KTKE 2BY1A 1ND0A 2W1NA 4N2BA 1BD2B 1FFNA 4ICWA 1D5MB 2EILB 3DDGA 1RL1A 4XP5L 2C3WA 1C5CL 2BIQA 4W9EC 3E38A 1JYNA 3DVFA 2QSVA 2FJHA 1YQVH 1CGWA 5DK2B 5H37H 3L4UA 2CDEA 5G55A 5D7LA 1U95A 3FU6A 4YE4L 3UO1L 4PJAE 3FO2A 4I2XA 4X5RA 4ERSH 1QRND 3RX8A 3AXHA 2E6PA 3BAIA 4JCMA 5DSCB 1XH2A 4MD0B 4ZW8A 2PCFA 2XICA 3N1MC 5C0AB 3AB0B 2I07A 1PFCA 2J4WH 2X9WA 1XV8A 4PTTB 4Y1SA 3S2CA 1FQ9C 3ZW3A 3ZZLA 2DQUH 2X4PA 4X7DC 2EH7H 3HHMA 4WW2A 5IQ9B 5FGCE 4PTUA 1NEZG 1WT5C 4OZHA 3VXMA 1FNLA 4ORZC 3WKYA 4CBZA 3UTQA 1PZAA 3F00A 3EH3B 3BO8B 5AL8A 1KCVH 1MQ8A 3LRHA 1E5BA 1Z0MA 3WFEH 3OZ9H 1OF0A 3MGOB 4IMKC 1FZMB 4A7VA 4PH8A 1YRKA 3KAAA 1OGAB 2GT9B 4PJEE 1KLFB 3MOBH 1FFOA 3KPNA 5GRVK 2IH1B 4EDWL 5CZKA 2IG2L 2IQAA 4LL9A 4XP4L 2WNKA 3GB7B 2ZUYA 1B0WA 1XIWA 4D3CL 1HINL 1I3GH 4ESKA 4M8RA 3MN8A 3RJQB 1HHGB 3TVMC 1AOHA 1LEGA 1TQTA 5FYJH 4AOFA 2MKLC 3OHXA 5D4HA 4NQEA 3K4ZA 3WIIL 4M93C 3BYTA 4GQPH 3WV0A 3EADA 1A5FL 2HUHA 3TT3H 1BW8A 2NNAA 4L3FA 1TYJA 1U8JA 5IQLA 4AMKL 1JCVA 4FHJA 1E0OB 4U1LB 1PX3A 2OR8A 2YD2A 1K4CA 2ZSWA 1IQDA 3V2AR 1QRNB 1ZLWK 1Y6NR 4U1IB 1T1YA 3IU3A 2CUMA 2ZXDA 1PQZA 3AG3B 3BVUA 3K72A 4PB0L 4PJ8C 5HJBA 1CXHA 2FL5A 5F1NA 4U49A 5FOBA 3MV8D 5KVEE 5A2AA 3JWDH 3OR7B 4NBXB 3O8XC 1BOYA 4I0KA 5EU6A 1K4DB 3HC2A 4DN4H 2BY3A 4FFZA 3MRNB 1AQ8A 3DV6A 3O4OB 4KK5D 1AZBA 3PGDB 2XETA 3PQYA 3WUWA 3H3PH 4DUXA 5DC4B 2Y1ZA 1AIZA 3EYQC 4M00A 4WK4B 3JV5A 4YC2C 2A83B 4M61B 1LO2H 1NSNH 1E8WA 4N87A 5JDSA 3CXHJ 2IH3A 4YXLH 2G2RB 1JGUH 4LCWD 3UERA 4UQ3A 3FBQA 4QTHA 4XCNA 1BVOA 1A3LL 4YS4A 4X7TA 4S1SL 1A1MA 4TSCH 3BP5B 2K4WA 4Q6YA 1AC0A 2WGNB 4HG4K 2IAMB 2X9XA 3MNMA 2A74B 3CN2A 5EZIH 1BM3H 1J5CA 3P0GB 3FO1A 4I9XA 4GBXB 3B7SA 4J39A 3IETA 4GP4B 5FYLE 4NI3A 4KI5D 1QVOB 3I02B 4HU2A 5CIPA 3HMWH 3IN2A 2F5AL 5IROC 2HLFD 4MNHA 1D9KD 3W5MA 4WWOA 1IJ9A 2ENSA 4UYPA 1W0VB 4ZUSB 1IGCH 4E5XG 5IB1B 3TT1L 2EE6A 3UIYA 3NFSL 4I18A 1AC6A 2IPTL 5C1MB 3L3DA 2VUKA 4IRJA 3HNVL 4KI5F 4XMLH 5CS7A 1ET5A 3OHMB 1YEJL 2W60B 2W88A 4UZUA 1NDMB 4J23A 3QWNA 3ULUC 5KSBF 1PX8A 2V5TA 2LTQB 4E5XA 4YLCA 1EXGA 4JDEA 1DBML 2A3TA 4K71B 5GZOD 1A6VH 2PO6B 2WM0A 2X7LA 2D2CC 2BSRB 5F3BB 4TN9A 3ESPA 2IEPA 5I6LA 1HINH 3GMNB 2IAAC 2WINB 4I48B 4WI9A 5LCVL 3AG4B 2CQVA 3PWPB 4APQA 4DKFL 2Y7LA 2ZOKA 4G59C 3C09C 2VSDA 3AU0A 3C60A 3WJMB 2ZKHH 4U7MA 1EUTA 3MJ7B 1BQHA 1WBXB 5C0FB 1VPOH 3VG9B 1KXTB 1R6VA 3OL2A 4AQ1A 5KVDL 3QZBA 1IGTA 1XBDA 2XI9A 5CJ8A 4ZX5A 2D4DA 3L4ZA 1YMHB 2XTJB 5DRZA 3NCMA 2WLMA 2WQ8A 4FFZL 4FP8L 1X3DA 2ZUWA 3CZNA 3GMQB 3FQ2A 4KH2A 4OZFB 5CBAA 3GDBA 5CSBA 3BW9B 4KVCH 3DX0A 4UCFA 5E99L 5ERWA 1EDYA 3RHWF 3OR6B 1TF4A 3U2IA 3AVEA 1U8HA 1F1GA 1GSMA 3Q5YA 2AJXH 1XZ0B 4NC2B 3TO2B 1S7QA 1NAMA 4Y5XB 2X5PA 3H9YA 4M03A 2ADFL 4Y7OC 1OSEA 3GLZA 4Z7UA 3A24A 1P7KB 5B1AB 3I75A 1P6AB 4PJIE 2DD8H 5JIKA 1DDHA 2ED8A 3BZ4B 2B5IB 1RZJL 4XBEL 3MYJB 3CVIH 3RTQD 2BSSA 2Z91B 1S7XA 1JK8B 5ID0B 4UM8A 1SM3H 3Q01A 2R9HD 4P3CH 1E2WA 3MRLB 4Z7WA 2X2JA 2ZOKB 4MSWB 2FJFB 2ETWA 3JT2A 1SLWA 4ENED 4G5ZH 1MZYA 3NYKA 4LSPL 5ICXB 1K5WA 4PRHB 4PJ9B 3WUZA 2ITCB 2FEEL 2WZAA 5JNYB 1MVUB 1FDLH 3MBEB 4OLYH 2A1WH 5KEZA 1RZFH 2QVIA 4KY1L 1L7TH 1URZA 1YA5A 3T0VA 3RWCA 1ZVSB 3GRWH 1NGYB 3EJQA 3CFJB 2HX8A 3F58L 1HL4A 4OBSA 1CDIA 1WEJL 5I1CH 4GMSL 4NHCH 4MAYB 5DWPA 5C09E 1KN4L 3D69A 3U7YH 1QQDB 2H6PA 3LIZH 3S96B 3DUSB 4LVOC 3P3YA 3MRRB 2QHRL 4MTMA 1KCUH 4KVPA 1XF1A 2JKSA 3GUTA 2WLHA 2DWXA 1AG6A 2G60L 1QRKA 5IB4A 5K1JA 2LAAA 2Z1KA 4NQED 1I85A 2EIKB 4W1TA 2Q8AH 2MH4A 1KPUA 4NJ9H 1G6RH 4FNQA 6CGTA 5IKCB 1EFXA 1RK0A 4YX2L 4D0DA 1BD2A 1O7SA 4D94A 1E9PA 3H53A 2DWEA 1ETZA 1UB5A 1YPZA 5KYUA 4JGJA 4AUUA 3JV0A 4M6MH 4GKLA 1YEDB 5TH2A 3TIDA 4LARH 2G5BA 4LDCA 4Y1AE 5B1BB 3VB8A 4G5AA 3LPGA 2JJTA 3OHXB 4ZTOL 4FXLA 1WJ3A 4NPJA 1KB5B 1QTPA 2Z0BA 5C0RL 4QHNA 4N2LA 4XPBH 2F68X 4RQQA 2ATPB 4JFOB 3D50A 5BV7B 3Q5TA 4EIUA 1NAKH 4OGYH 5EN2B 4BKLB 3VD5A 3L5XH 5JHAA 1PKQA 5CUSH 1EZSA 5D70L 1OAXH 2FUQA 4MDIB 4N1HB 1TDQA 2VLRD 3O2VH 3QDAA 1PS3A 2EC9U 2J57A 3I2CH 5D7KE 3UBHA 4QYAA 3QEGL 1XHHA 1YAZA 1W72H 5FUZH 2VLKE 5FYJU 1ECYA 4XNAA 4DUVA 1NC4A 1DCEA 4HLZH 2N59A 5GS0L 4Z7OF 1YNKL 4OT1L 2HWZH 1BZQK 3VFVB 3VMOA 4QRPB 4FXGC 1HJCA 2OMTA 1CK0H 4OUUB 1Y6KR 1PF3A 4PD4J 1J8RA 2E7MA 4PJFE 4HW6A 1I4FB 3NIDE 4NQEB 4DQAA 4RGNE 3ULVF 5CGMA 1TOXA 2ZCZA 1MFBL 3WY1A 1D7DA 3X1GA 3AUWB 3SOBH 4P8QA 4IKNA 4G6FB 3T8XB 5I6NA 4EUPG 3AGVA 2FO4B 2NR6C 5T5FA 3ES6A 4XBGA 1JNLH 3FQXB 2VKWA 4AMKH 4QXUH 2CHDA 2XWBA 4XNXL 5J9PA 3FAWA 1U8QA 3BCFA 1PG7L 3KXFE 2FYYB 4G9DA 1S3KH 4JFDA 4H8WC 2Z7UA 5CHNA 1F0LA 2EC9T 3WXWH 4OF5A 4QO1A 3TEZA 3ZK0A 1KYUA 2WAQA 1A47A 3D4CA 3JTSB 2YAPA 3MJ8A 3H9HA 1XWVA 2DBLH 3ARGB 1YNLH 4DGVL 4Z77B 2NY3B 3QUXD 5ECGA 4BJLA 4N6RB 4JO4H 4WU7A 2UWEA 4LL1A 3MUGA 5MP6L 4AL8L 5I1EH 2AAAA 3LV3A 1CZ8H 2WWMC 3BVXA 3UZVB 2PCXA 4BWUA 2KKQA 1T0MA 4DW2L 1XF3B 2A2QT 3AITA 3BH9A 4HJGA 4QUOA 5JOPE 1DQQA 2YPKB 1H3WM 3QC6X 4KWUA 2OK0H 4AV0A 3CBJB 4N86A 1X4ZA 3QYCA 5AUMA 3OG4B 2KDYA 2VISB 1NGPL 2Q86A 1T4WA 3FU3A 3L4YA 1PY0A 4GMTL 1QOKA 3KPMA 5HGAA 3MV8A 3NCXA 5MENB 5E94B 5F3HA 2UY7B 4KPHL 5J0BA 1D5IH 1PZ5B 3RWFA 4JREC 3R8QA 4ZX3A 4MZ3A 1OB1A 4JY4A 5J8OA 4TL5A 4NJAH 1DUYB 5ALBL 3T08A 3ZE0F 3QS2A 2G2PA 4KKNA 3SKMB 1KF9B 4OLZH 2QMKA 2BSRA 3GI8H 4GEIA 2QVFB 5AG8A 4NKMB 4AYGA 3ALWA 2XPZA 3GBLA 3QNZA 3APNA 5TD4A 4WU5A 2DQJL 1T0OA 1UM6H 2VR3A 3CVHB 4XNZC 2YAQA 5DUPL 4CGTA 4M1GH 4P2QA 4HWEH 4IBQA 4M6NL 1MH5B 1S9VA 4HX1B 1SOXA 5B39B 3QULB 1LXMA 2KZWA 1QBML 3TWCL 1QD0A 2VLMD 2ZG1A 2YEZA 2Y07L 4YGAB 2ZP8A 3DI3B 3LNIA 5AVSB 3A67L 1BBJB 1MFNA 4X5QA 1ZA6B 3K5SA 3MR9B 4Y2OA 2B0SH 3A5VA 1CLYL 2QSCL 4ELDA 4TQPA 1W8NA 1LE5A 2AI0H 2EYRB 3MREA 2CLZA 1PAMA 3FSVA 4MX7B 1XF3A 4NFCA 4NHUA 5K9JH 3LKSB 2YGOA 4K15A 2DIJA 1E9QB 3FHAA 2FT8A 2MMXA 5EWIL 1J8KA 1KGIA 2XQYA 4R90L 5IMOB 2B14A 3INUL 4YDLB 4IGBD 2NSMA 4JE0A 1N6QH 4WQOA 2F7OA 2R1YB 1QUNB 2VR5A 2AITA 2FWUA 5JPMA 1AGDA 4PJCA 5CCJA 3INUH 5K5YA 3HZVA 3BHBB 5DHXB 3ULSA 4AVHA 1BSIA 1R3HB 3BX7C 3L4TA 4U0QB 3SKOB 4C57C 4PRNA 2E6JA 5T3XE 4PP1C 1E5AA 4Q0XL 3BJ91 5F96L 5GZOA 5E24E 1KDIA 2WNXA 5CEXA 5T3ZE 4LVNB 4RGNC 3FUNA 1MXGA 3VW3H 3QO0A 4X8GA 4JFSA 5GQBA 5EO1A 3SY0A 3PDDA 5DK3A 4ZS6D 1O5DT 2GJ6E 4K4KA 4NKQB 3ULAB 4UU9B 1T04A 2AV7A 5FM5M 1GY2A 4EUPB 3SKNA 2XFXB 4Z95L 1KCRH 3J7HA 4DP1X 5FGSA 2NLJB 1GOHA 4QLRA 1QSEE 4LQFL 2ITFA 4BH7A 2EH8H 4XNZB 4FXKA 1ZGLP 5IHUL 3HC4H 1XH3B 3SKJH 4MAYD 3B2VH 3M1CA 2R51A 5DJYB 4D9RE 1VFMA 4QXUL 5DWUH 5A40E 2E9IA 5I15H 3FCUB 1SYVB 1JWMB 1TMCB 3KDMB 2WCPA 3EJYC 4G8FB 1D7FA 3VFGH 4ZRGA 2O5YL 5JPMB 4MB1A 3GMLB 3DRTB 1IAMA 3MLRH 4YSTA 2GC7C 5HY9B 2XVKA 3DYMA 4H0GA 2PW2A 4M3HA 3N9GH 4ES8A 1LO4H 2ESVB 2FHCA 4FDWA 1TR7A 3KH4A 4AM0B 5I5IA 2H7WA 3EJRA 4ODVL 2W0FA 2Q8AL 2YPLE 2BVPB 1CZ8L 5I5JA 4NO2A 1IFRA 2WLYA 4YDLC 4OCSH 4L1TA 5DMJB 4TSBH 4EN3C 1WS7A 2VN5A 3LH8A 3P30L 1DBBH 3ARGC 5FCSH 4WK2B 1B0IA 4WUUB 4ZXBB 3RPIA 4WWKC 3PWUA 5D1ZI 2FX9L 1SXSA 1JYWA 5LGJA 4GAYA 4Q9CA 1QEXA 3VFRA 5K1NA 1XGRA 3TV3L 3KLHC 3EGDA 1W72B 1DVFB 2D0FA 2DS4A 4Y4KA 4NWUH 4Z5RB 4POUB 4OIIL 4MZRA 4P49A 1BMGA 2XWJB 2P24B 4MA7L 1BD2E 4YH6A 4F2MB 5SWSE 1HX0A 4DPCX 3RAJH 2NY2C 4M6OH 3DSFL 1ZHLB 1U2CA 3N50A 3G5VA 1GTNA 1G1YA 1YEIH 4FFTA 4KKLD 3IDNB 2CXKA 3SGKA 3QHZH 5I28A 3W39B 4RAVA 1BQKA 4JHAH 2H5UA 4NNYA 3NA9H 4Z7QB 3HPJA 3Q2LA 1U8QB 4TQEH 3RKDD 3T1FA 3P77A 1L4IA 4JDVA 4QRRB 1FGNH 1XCWA 3EHBB 2VAAB 4YDIH 2BRRH 4JCLA 2DEWX 3HS0B 5CEZH 4NYLA 1VEMA 3ELAT 1SYSB 1PPIA 2DD8L 4KGJA 4JRYE 4U1SA 1IGIH 5ACMA 3VFMA 2AKRA 5H4ZA 1WDAA 3S4SB 2IBZY 5F88B 3P2BA 2P45B 5IQ7H 1YG9A 2R27A 3QJRB 3MBWB 4LNRA 4YHPA 4Z0XB 1BBDL 4WEUD 3SE9L 3OKKA 3CK0H 3HFMH 3ZX1A 1SVCP 5JXAL 5LBGA 4K5NA 1G7IB 1T7ZA 4WGVB 3X1BA 2G9HB 1KJVA 2VN7A 3DOHA 4ZG1A 2YMTA 1M1XB 4WJG3 4UTAH 4PCTA 3U0TB 2H3NA 4BZ1A 3OLDA 1NMCC 1CFVH 2IPUG 2ESVD 3DROB 1M4KA 1P9MC 3I3BA 3MKKA 4XBPB 3G6JF 1UYWL 1BWWA 4QHLB 5MENA 4U6VL 4FC3E 5DJAB 4ZFFA 3QW9A 1F6LL 3B2VL 1A0QL 4LU5L 5F1IB 2JTYA 1RZJC 4C54A 1KACB 3MRQB 2E7CA 4J4PA 4ZUVA 5FS5A 5HGHA 1B4JH 3JWOL 4X4KA 4O58L 2VW6A 3E0GA 3NIDF 2FEDD 2VQ1B 2L8AA 1TQWA 1DN0B 2ICWI 4IIQA 1O0VA 4YDVA 2HSIA 3ARDA 3T3MF 3IWVA 5FAAA 2WAHA 2BINA 4P3CL 5D1XB 1K9TA 1T6WA 2YFNA 3B9AA 3ARGA 3O4LE 4HX1A 4KTDL 3T5WA 5CKAA 1X44A 3BLBA 2XCMC 4DP9X 2LOEA 4P0DA 4HDIB 5AOMA 2XFGB 1VFOA 2DI8A 1YDPB 1AE6H 2FGWL 3JWNE 5DQDH 4MWFA 1HFUA 3FO9B 2R69L 3LQZB 1FFPB 5KSAD 1F90L 1GZQB 2DOCA 3D0LB 4MQSB 4YDJB 3MYZA 4Q52A 4OCRH 4PWHA 2GUYA 4XNYH 5BRZD 4YHIA 2EE2A 1ZIAA 5C0ND 1BVLB 5F3HB 2QLYA 5ICYB 5G2NA 2AJSL 3V7MA 3V7AE 2B59A 2GT9A 2YD0A 1EVTC 2YC1B 1N19A 3RL1A 1KTLA 2P5WB 3KL3A 3QPKA 4HS3B 2R0WL 3GMRA 1YEKL 3ECWA 2H3KA 3UCQA 1LMKA 1UWYA 4M1CC 5I15L 1QUNA 1L9TA 4OZGB 1S5IL 3RIFF 4NKMA 3DUUA 4MXVF 3QCUH 5D5MA 2V2WB 1A65A 1QWHA 5GRJL 2ZAGA 4YFLI 1A6UH 4FQCL 4PN6A 4UV7H 3U0WL 4YXLL 2DLFH 3FPXA 3IK2A 1NCWH 2JJUA 4QD2E 1QWNA 1KJ3H 1DLHA 4MXQD 1MNUH 3X12A 5DHYA 3NJJA 5HDOA 1F4YH 3CFQA 1ZA6A 4MRBA 3GMNA 3POHA 2DQ6A 5DR5L 2Y07H 2DN7A 3D87B 4HIJB 3U4KA 2YGPA 3Q0HA 3PP4L 2YK1L 4FQXA 5F7NC 3MV11 5DFVD 4ZMXA 4D0CB 2QSTA 1XCQB 3U79A 1JERA 4KZ0A 5DD5H 2NUPB 2AC0A 1OM3H 4HC1L 3RL2A 1A8JH 1QFWM 1PLBA 3LVEA 3GHBH 2DWDB 4MKTA 4QPEA 5E6SB 5K9OB 1CFSB 1J86A 3QXDA 4G7QB 4WI3A 3HNTH 3FHEA 2ZXGA 5HDBF 5T3ZL 2XG4B 4WI0B 4LLMA 4W70A 4LSSH 4K8RD 3FN3A 2KL6A 1TVBA 5CMAA 3HE7D 3TN0B 3IAGC 3NEEA 3QCVH 3CFCH 1IE5A 4Y9FA 2ARJQ 3MUUA 4EZKA 3WE6B 4O2EA 2C5DC 4Z18A 5DVNA 1FLRH 3BKML 4NRXA 2XPYA 4KQ3H 4L1LA 1GOGA 3CU1A 5EO1B 3SY0B 1XF2A 4DW2H 3FB5A 5J12C 2YKLH 1OCWL 4HJJH 4LLUB 3UPCA 1T21A 3FO2B 4I2XB 4J3OD 3DX8A 3VWKC 2G3NA 1VERA 4Z7QF 1AO7B 3VXNA 4NKOA 1UJ3A 3ATDA 4OZHF 5CEYB 2GTQA 1PX4A 2YK1H 2WXIA 2XN2A 5GS1C 3FL7A 1PZUB 2BVEA 1H19A 3F85A 1FE8H 3DX9B 1D6VH 2NMSA 4ZAKC 4KOBA 1XH1A 1JIBA 4ZW7A 1QFWI 1MPAH 1H6TA 2L7EA 4PHXA 4MAYA 4ERSL 2ATKB 2AQTA 2QELA 3BFWA 1IRAY 4FF9A 4NKDB 5IVOA 1NIDA 1JWMA 3HHRB 4KZDH 4HCRH 2F53D 2FAUA 2YBRB 5BO1L 4KV5F 1WBZA 4UDTB 5C2UB 5EU5B 1TITA 4F7TA 3K2MC 4M4PA 1A3RL 4N1EA 4M43L 3ZDZF 3CIAA 3ARFC 5FWQA 3L17A 3NCJL 4RFNB 4G8FA 3ZKQD 3ZYJA 1KB5H 5HHMD 1KWGA 4XCYA 2YN3A 1KOAA 1NGYA 1OL0A 3B6SA 3LKRA 2J6EH 2LU4A 4HZ1A 5HPMB 3AG2B 3SD2A 5LWYH 3UC2A 2IGTA 3OKDA 3X3GH 1MJJB 3H0TB 4FABH 5EC2A 5CBEB 4CMHC 1HS6A 2W5PA 3DSNB 4WW2F 4BH8A 1BV8A 4UT9L 4Z8FL 3O0LA 1PEZA 3J8F7 5IHWA 2H1XA 4GJTB 1Z66A 3H9SD 4XPFH 4OZIB 4YZFE 2EC8A 3GIVA 1CIDA 5CZXD 3UYPA 1IGYB 4JRXA 2IDCA 1U93B 5AZUA 2NX5A 3KJ4C 1N0XH 3ILPA 4S1QH 2YRBA 1MN4A 4Y5XA 1GR7A 1B6UA 3ECVA 3D06A 5FO2A 3S3DB 1GW0A 5EN2A 3L1EA 5C7ZA 3DXAE 1HWWA 2JV6A 3VU1A 3ET9F 5I1DB 1VEPA 2DTMH 5C0BE 3CFEA 4ALAC 3QNFA 4WI4A 4Q56A 5LGKA 5LB1A 2BSBA 1IC0A 3NTCL 1SZNA 2QR0B 4TLTA 5C3IA 5CLWA 2ZWSA 3KE0A 4UTBH 4J3OG 3RZWA 5DD6B 4YHKL 4Z76B 1WK0A 4ISVA 4QXTA 1M7XA 4KKRA 1IBYA 1IILE 4TUUA 4DEUA 1CC3A 3KPSE 5IW6B 1FNEA 3BP7A 1FG2B 1T89A 4AM0Q 1TENA 3TIEB 1HI6A 4IIQB 4PY7A 2HKAA 4K7FA 5EZOH 3WS3A 3QIUC 1F58L 3B7TA 2TRHA 4ZTPH 2VL5A 1T5WB 3BWSA 4M6ML 5T1LA 2F53B 3HG2A 4A7SA 5D6CB 1N6VA 1BREA 4IBTA 4WWNA 2CO6A 1E6OL 3VA6A 3D6GA 5J13B 3O2WH 2WWMD 2XPGA 4C4KT 3N42B 5KVGH 1F90H 2WLLA 2CO2A 2C3HA 3RQ3A 4I2XE 4FJYA 4WSKA 4N2GA 3FZUC 1A2YB 3E2HB 3OKLB 4L2YA 4FLHA 4YHLL 3B9KA 4TYUA 4ZMTA 4OUUA 2D3NA 1M1XA 1S78C 3RFRA 1A7BA 3HG1E 2D7NA 1U3HD 1OOWA 2O5YH 1AFVH 2EIMB 2HLEB 1E4HA 4NCC1 3C2SA 4AENB 5EUKA 4YHIB 3Q43A 5F9DC 3CD4A 4YL9A 4G1EA 5ALCH 4HOMA 5KAQG 5FFOA 3SDCA 2M1KA 4JM4H 2VIRA 2X4SA 2X0WA 2DICA 3IJEB 2NTFA 4NQXA 1G7PA 4OCNC 5EDXA 3GBMH 3LN5A 4XP9L 5HGGS 4G6MH 3MROA 2A6JB 2IXQB 2DQFB 2LFEA 4JNXA 2XWBB 2CDGB 3CQQA 1Z3GH 3U1QA 1U41A 3O4OC 3BQUC 3TO4D 4EN2A 5DRNB 3F05A 2ATPA 4JFOA 3EO1B 4R7NB 4LRNH 2J2ZA 1CVRA 3QXVA 2DI7A 4S0TD 2CXGA 4NSKB 1V10A 3VWJA 3A23A 3B7RL 5FYKD 4P2OD 1WD8A 1ET8A 1E4WL 1JPEA 1Q9WB 4NM4H 1IO4C 4JEGB 3QVAA 4BK8A 1U3JA 4AEHL 1YAIA 5TQ2L 1G9NC 4P23A 5ICYA 2H1PL 2BY0A 2R2BA 3GMQA 1KB9J 4TV3A 1FNAA 2WXFA 4IKLA 1RK1B 4TULL 3DETC 3NJXA 2JI2A 4G6JH 4FLSA 5DQ9A 5IFAH 1J0KA 3ARWA 3QNYB 3DDFA 5D2LF 3U6XS 1EIBA 5CZVH 1MVFA 2AEOA 3O3AA 4GAAA 4J8QA 5E9NA 3QDME 4Z7QE 3KR3L 5F0MB 3ABZA 2OMTB 1A7PH 3G5XA 3HAEG 2CHZA 4NQDB 5DD3H 2PP7A 4KZEL 3HE6D 3TBWA 1X5GA 4MMYA 5JR1L 3HC0A 4E68A 5FB8B 1A3LH 3WFCL 1SJEA 2A4CA 2BIMA 3VFTA 3NJGA 4HXBL 5D72L 1CO1A 1F42A 2V2XA 1BXAA 1ZVSA 1CLYH 4IRSC 5F9WB 5TF1H 1R3JA 5BUGA 1FNFA 3BAEH 3GBNH 4XMPL 3QJQB 5T1MB 1OW0A 2EEBA 2CH8A 4DP7X 7FABL 3CFUA 3W0WD 4FHKA 2OCCB 5GRZA 3D0VA 5T33H 1UZ8A 3K6SB 4AKOA 5FA4A 2AEQH 5FW7A 4B97A 1G9ML 1NDTA 3MUY1 3VXTA 5EG6C 1RK0B 1RZKL 2PYEB 3GI8L 4YBLC 5EBLB 3VFUB 3HRZA 2M8XA 3RE0A 3D85D 3MDJA 1KPRB 4JY6B 1IBDA 4MQXD 4UBDC 2EO9A 2OZ4A 3L6FB 3N9GL 3L3OB 2JQAA 4XX1G 2VLRB 3JVFC 1SBSL 4OSUL 1S9YB 2BP5M 4F7TB 3BUTA 4GRLD 1T5KA 3AQXA 3LIZL 3P4NB 1AG0A 4HKXB 5IOKA 5AVWB 3HIZA 3O3DB 4IJ3C 1KWKA 2Q7YB 2WMPA 2BC4A 2IG2H 4XP4H 2NZIA 5E56A 1KPUB 4JPVL 1J05A 2W07B 3JQOB 1GGIH 2O5NA 4FKKA 4O00A 5I1HL 1CPUA 5FB8A 1U58B 3LNGA 4LLUA 1MF2L 3BVDB 4O2CA 4N28A 4PREA 3TA4D 3ML8A 4JPQA 4HCFA 2NQCA 5I74C 4R8WL 2EDLA 4OZIA 1AJ7H 1U9KA 4WO4C 2L04A 1DLFH 3ARBA 2E9WA 4GSXA 4Y4FA 5DC9B 5EORH 1KBBA 2QPUA 2EH7L 1KTDA 5DD1H 4P2AA 4QYOB 2HN7A 3DMMC 4NUGL 3CPLA 2F19L 5ILTH 2VH5H 1AO7D 5FO7A 4KTYA 5I26A 1UZ8B 3JWDL 3O45A 3RKPA 4ADJA 2J8UB 3AXLB 4KK6C 1OKEA 3IYLW 2XQBH 2RA1A 4OJDH 3T2OA 3B9EA 1G9EA 3IJHB 3PXHA 4RAHA 1H3XA 4Z7UE 5HVFB 1RUPL 4FFYL 4GQZA 4L9LC 2MRYA 5F0LB 1T6BX 1HCYA 2P5EA 5FYKU 3SY6A 2Q20A 4MYPA 3QEUB 4FQQA 4ANVA 4L4TA 3MA9L 1JJUA 3L81A 5C07D 3ZYZA 1I9IH 1JPGB 3H0TA 4ELMB 5B21A 5JTWA 1HH9B 1OGAA 3WNLA 3G6JA 4U6YB 1DQJB 1U6AL 2YO3A 1J5IA 2Q7YA 3LS5L 4JQXA 4Q9BA 1DQMH 1CT8A 1AGBB 4XN4A 4YSPA 5D7LB 2C3VB 1BXVA 2AXWA 1QLEH 1N59B 1V05A 2IWKA 4FQIH 3BZ5A 1S7WB 4AEIH 4DAGH 1AJ7L 2ZOWA 4X80H 3ALPA 1BJ1J 1Z1WA 3KLQA 3S8WA 3WXVH 4PJCB 1VPOL 3MV7A 2IQ9L 2O6FA 1EFQA 5C08E 2ICWA 1X5XA 4UQAA 3MHZA 1BF8A 1M3JA 4P46C 1K5NA 4HBCL 1H0DA 1UKTA 4R5VA 4H44C 1ZHKA 4JFUA 2B3IA 2YQ2A 4H8WL 1R5WB 3WLBB 4AVIA 2WB7A 4JW3A 1AHMA 2EDBA 2QADD 3U9UB 1IBFA 4PLNC 3IPBA 2R23A 2DDQH 4FI6A 2EUZA 1K4DA 1Z5HA 2ARJA 5DQJB 2BVTA 1SBBA 3BQUA 3OKEA 1QPKA 4Y4HC 4POZD 4R2GC 1A1NB 2OL3A 3QZMA 5E4EB 1JWSB 4YSCA 2AXHA 4WDIB 4J3WA 3RILA 2X42A 3TIEA 2APSA 2ZTBA 4EN3B 1A7OH 1YUHA 4R4ND 4NQVA 5A16B 4B95C 2K0RA 5A2KH 1EGJH 4DO4A 1NCNA 2VDQB 3UZQA 3V4UL 4A39A 1EJOL 1U8PA 1X7SA 3MBEC 3MJ8B 4A68A 4FAAB 2Y7QB 1BGXH 4EBQL 2R0ZL 3QZWB 4G2AA 2FJHB 2AK4B 1SOKA 2HLAA 4I5BA 4OZ4B 3BWAA 3ABMB 3EXLA 3FTGA 3ZHFA 3BEWA 3EJTA 2VH5L 5D5MF 5IMKA 3U9WA 1JOIA 1T22A 4F8QA 3NFPB 1CK0L 3KDMA 1D6VL 3TN0D 5IT2H 4NSKA 2VL4A 1FVDA 4E9TA 3WTYA 3SE3C 1CD8A 4PJ9D 4HOWA 4AENA 3L3DB 1KBWA 1UXWA 1UKSA 2L3BA 1RMFL 4LMQI 1LO5B 2ITEA 3OB0H 3UTSA 4EJ1C 2W60A 1MG3C 1NCTA 3BO8A 1E7UA 1AIFA 4PJXB 1F3JB 1PCSA 1WRFA 2E86A 2Q8BH 5JW4M 5EOCH 1AR2A 3I2CL 5DQ9B 3GK8H 3FT4B 2DQGH 2BNUB 3BUYA 5E23A 1RJLA 3KXFB 4KDWA 2NTFB 4TUKH 5GS1B 3BP5A 4NI6A 3D51A 2B08A 5E51A 1XIWB 4S1DD 1D5XB 1FL6B 4UQDA 4S11A 4UDUB 4P9HL 2RMNA 3DPDA 1W8OA 4LP4A 4Y4HB 4MCYB 5B39A 2D7TL 1B4LA 3W0WB 4PWFA 4ADGA 4Z7NB 1JE6A 5LKNA 4UOQA 4Y7MA 1NAML 3LOWA 3PDOA 5TQ2H 1JXGA 1EAJA 1PEWA 4ONGL 1BP3B 2R69H 4KY2A 3SJVE 5E7FA 5H8DA 3MMEB 1P5UB 4I3RH 4AIEA 2F8XC 4N0UE 3SDXB 1P4BL 1MFBH 2DQHL 3WKPA 3NABL 5I1GH 2I32A 2L0DA 4Z7NF 1X9RA 1MCHA 2ENYA 3EJYD 4X5LA 4W9ZA 2FLBT 4NAMA 3ARBD 4KK5C 3RUGA 3GXDA 3NGBB 5FKAA 2P47B 4NS0A 5KYXB 3KPSB 4HAKA 3DVGA 3KPPB 2WUBL 4KNUA 1U33A 1TQCC 4GG6A 1A6AB 5EORL 4MJ2A 5DLML 3OAUH 1BPVA 1I1AC 1G94A 4P9ML 4L4VB 3K91A 3DK2A 1YMMA 4DKAA 3ZE2F 5I66B 2OYMA 2G60H 1RURH 4FQCH 4NQDA 4ZI8A 1I8KB 3U0WH 1G0DA 3T4YB 3M7OA 4KI1A 4NPKA 2HA1A 2MHAA 5JO5B 5HVWA 5IHLB 3O3AB 4Q4IA 1YEWA 2LVEA 1QG3A 4BINA 1LJMA 3QG6B 2A77H 1SEBB 3K7UA 2MOQA 1EEZA 1GZPB 3CAFA 3QA3A 3PWPD 1NA8A 4TL4A 4POYA 1HILA 2DKMA 4FNRA 3ATAA 2CLRB 2RACA 4LRIC 4FG4A 1CF1A 1D9KC 3L7FA 3I50L 3MJ9A 3H2QA 3O3DA 3GC3A 4LEXL 3NIFF 2XBTA 3C8HA 4OLYL 1AZVA 1QA9B 4CC0A 2FX7L 3HR6A 1KC5H 2VXUL 1A4JB 4D8PA 1NLDL 1YQVL 3QEQD 4K3HA 5JYLA 2FEEI 4TRPH 3CSYB 1R5IA 3BDYH 3QXDB 4PREB 4PLKD 3RWIB 4YPJA 3Q2CA 4L9DA 5D1ZB 2BOBB 5C0AA 3WDHA 5F3FA 5T3ZD 3QORC 5GGQL 4DOHE 1XSJA 2W38A 3TOPA 3JV4A 4CKQA 2KPNA 4BH7B 4L4TE 4UYQA 5F72S 4M7JH 1MREH 2ENPA 2VDMB 4QRAA 5GGQH 4DO6A 1JWUA 4JJ5A