1OO2A

Crystal structure of transthyretin from sparus aurata
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
RCPLMVKILDAVKGTPAGSVALKVSQKTADGGWTQIATGVTDATGEIHNLITEQQFPAGVYRVEFDTKAYWTNQGSTPFHEVAEVVFDAHPEGHGHYTLALLLSPFSYTTTAVVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinctive binding and structural properties of piscine transthyretin.
pubmed doi rcsb
source organism Sparus aurata
molecule tags Transport protein
molecule keywords transthyretin
total genus 25
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1oo2A00
2WQAA 4ABUA 4QYAA 1SN2A 4TQPA 5CNHA 2GABA 1IIKA 1BZEA 4WNJA 1IJNA 4DEUA 2H6UA 3IWUA 3U2JA 1Y1DA 2G3XA 1TTCA 4TQIA 5E23A 4TL4A 5CM1A 4IIZA 1X7TA 4WNSA 1GKEA 4FI8A 3A4FA 3CFNA 4N87A 5EN3A 4PWKA 1TT6A 4TM9A 5AL8A 4ABWA 4Y9FA 3CN0A 3TCTA 3B56A 5A6IA 3CN2A 1E3FA 2H0JA 2G5UA 5AKVA 2IGLA 5CLZA 1E5AA 2QELA 4Y9BA 4TLUA 4Y9CA 2FLMA 2H0FA 4MRCA 1TTBA 4TNGA 1ETB1 4N85A 1TTAA 1ZD6A 4QXVA 3IWVA 1DVXA 4N86A 4PWJA 3ESNA 4HJTA 1IE4A 4FI6A 3IMSA 3IMTA 3KGSA 3NEOA 4PM1A 4TKWA 2ROXA 4AC2A 1KGIA 4HIQA 1G1OA 1THAA 4TLSA 4PWEA 4TQ8A 4TLTA 1SOKA 5E4AA 3W3BA 3DK2A 1ETA1 1SN5A 2QGEA 1DVSA 3D2TA 1F86A 3BSZA 3DJTA 3GLZA 3CXFA 3DO4A 3I9PA 4DETA 4PMFA 3IMVA 4YDMA 2QGDA 2H4EA 1GKOA 2QGCA 4TNEA 1ICTA 4IK6A 1BZDA 1THCA 3GS7A 5AL0A 3A4EA 4PVNA 2B16A 2G4GA 4Y9EA 1BMZA 1TSHA 5K1JA 5L4IA 5JIQA 4QRFA 3IPEA 2QPFA 3CN1A 5DWPA 3IMRA 1E4HA 3U2IA 4MRBA 3OZKA 3KGTA 3P3RA 2H1XA 2TRYA 5AYTA 4DESA 3I9AA 1DVQA 1DVUA 1BZ8A 3NG5A 5FO2A 4ACTA 2G3ZA 3Q1EA 5DEJA 1FHNA 3TFBA 3GS0A 1DVTA 1SOQA 5L4FA 5CN3A 3IMUA 1X7SA 4MASA 5AKTA 5FW6A 4YDNA 5JIMA 4I85A 1FH2A 3DJSA 4AC4A 3FCBA 4PWIA 5AKSA 1KGJA 3DJZA 3I9IA 1QABA 4I89A 1SN0A 4HJUA 4IKJA 3P3UA 1TTRA 3CN3A 2H0EA 1F41A 3GRBA 3P3SA 4I87A 5K1NA 4PVLA 4TL5A 5CLXA 5TTRA 2B77A 3A4DA 3ESPA 2B9AA 1TZ8A 1BM7A 5JIDA 3QVAA 3CBRA 1Z7JA 1RLBA 3CN4A 2ROYA 3GRGA 2B15A 4DERA 2GPZA 4PWGA 4PMEA 2NOYA 3GS4A 2F7IA 2G9KA 3DK0A 3BT0A 5CLYA 3DJRA 5HJGA 3ESOA 1DVYA 2FBRA 4HJSA 5L4MA 3DGDA 2PABA 5L4JA 4PWFA 2TRHA 3OZLA 3CFQA 5FW7A 1OO2A 4DEWA 4PVMA 4PWHA 4HISA 4L1SA 4TQHA 4IKLA 1QWHA 3SSGA 5CR1A 3NEEA 4KY2A 3CFMA 4TNFA 3KGUA 3CFTA 1U21A 3NEXA 4WO0A 4D7BA 1TLMA 4IKIA 4L1TA 1DVZA 2G4EA 4IK7A 4IKKA 5BOJA 4TLKA 3NESA 4ANKA 1TYRA 2G2PA 2G2NA 3HJ0A 2F8IA 3M1OA 4Y9GA 2QGBA 3DIDA 5E4OA 4ABVA 4Q14A 1IIIA 3P3TA 4FI7A 3IPBA 5EZPA 1TFPA 1ZCRA 3GPSA 3FC8A 4ABQA 5IHHA 3D7PA 2B14A 3IMWA 5FW8A
chains in the Genus database with same CATH superfamily
1Z5LA 3IJSA 4H8UA 1CU4H 4PY8J 4Z3TA 1QRKA 1XSJA 2MTAA 3MUJA 3EDFA 3V0WH 3VDCA 1AGBA 4GXVH 1YMHB 5J9PB 3O9WC 1GGCL 3VFNA 4Z3IA 3B9VA 4JEGB 4IOSD 1MI5A 3BDYL 2WWMC 3ZKNC 4L1LA 3ENEA 3QXVA 3EO1A 3ZKSD 1KBKA 4RIRB 4XBGA 4Q9RL 4OF8A 2XFXB 5I6MA 1CFNB 2CKBB 2F8OA 1GGIL 3JT2A 4KZDH 3V6ZA 3F5WA 5IK3A 4GBXC 3JV0A 3UZVB 5K1NA 2X4OB 5JHBA 4R84A 1OLZA 4KI5D 2AV1B 1RHFA 4MDIA 4KO5A 4S10A 1MHCB 3GMRB 4PRHA 4M3KB 2G5BA 4J4PC 5JNYA 2GITA 4AMKL 4LSQL 4QNPF 2EDRA 5IQOA 2XPYA 5GRXG 2ZYHA 3GXDA 2ODIA 7TAAA 1DQQA 4ZPTB 2FNWA 3RZCC 4Z7WE 5E9AA 1KXQA 2QVMA 3LH8A 3BWSA 4OUOA 4R7VA 1FO0A 4MAYA 4XP4L 4XN8A 3VJ6B 4AXWA 4YDKH 5EU6E 2P8LB 2Q9OA 4NDMA 1ORQA 1I9IH 1UB5A 1U3HA 2PCPB 1DDHA 3TBBA 2FT6A 2K1MA 3DX9A 4OF3A 1WT5C 2XOTA 1XH0A 3RFRA 2GEEA 1E6JL 3GMRA 4P2CG 3QR1A 3ZE0F 3MV7B 3X1BA 1NC4D 3SYOA 3HNTL 2IBZX 3E1F1 3GMPB 2X4OA 2WIMA 4JCLA 1IGCH 1MCLA 1OSZB 3T77B 5LGJB 1LE9A 2WTRB 4Q9QL 3QFDB 2JK5B 2X87A 2ITFA 5G5DB 3EJUA 3DK0A 1KBVA 4PBXA 3O3UN 3O2WL 3D09A 1PDKA 1T1ZA 5EORH 4UANA 2VUKA 4HS6A 2VE6A 3FYIB 3LZRA 3FQRB 5CHNB 2BHZA 3AMLA 3LS4H 4JLRA 4A2FA 5ABZA 4X6DE 1YPZB 4DH2A 4AGQA 1MKFA 4K9JA 3GKZA 3HC3L 5A2AA 2XTJD 3F6IA 4MSWA 4A55A 4HDIB 1OB1B 2NZ9C 4N2DA 1KENL 2F18A 3E6HB 2BIMA 4PJ8C 4XB8A 2OK0H 4FQQB 2XXFA 2WNXA 3L1OL 4U1SB 3GSVA 5D7IB 4IU2A 3HS0A 3MLYL 1KELL 4UBDD 3B5HA 2AGJL 5DRWA 1MJ8L 3V0VB 4GKNA 5JO5B 2VLRB 3VXNB 4E36A 12E8L 1BZ7B 4MB3A 4XX5A 3FO1B 4FNQA 2NY0C 4MAYC 5CS7A 4FNUA 1MREH 3G5ZB 3HI1B 2YEZB 5JOFA 3C09C 2EXWC 1E3FA 2OTWB 4G5ZL 5C0EB 3UG5A 3S5LB 4N25A 3BUDA 4YXHL 2DN7A 4L05A 3KGRA 5DFVD 5A1AA 3GSXB 4GFTB 3OTTA 4EPSA 3OZ9H 2X7LA 3HG0A 2PYEE 2F9BT 4BZ2L 3HZKB 5DD3H 2UZIH 4KK5C 4F24A 3QUYC 4KRMB 3HVNA 1BEYL 3D2TA 1WUNT 3GLZA 5IWLC 3DO4A 1IGIL 3VE0A 4KZ0A 1ZGLB 2P26A 2DDQL 2EYTB 4QHNA 3PDGA 4QTHA 2PP8A 4ZSOA 4EI5C 4Q2ZA 1OF2B 5JIQA 1VKXA 1J48A 2ZX8A 3EJYC 1KPRB 2VRQA 2BFVL 4YBQD 1XR8A 3GXMA 2X4NB 4JKWA 1J9CT 3P69A 5FUZH 4XT1C 4I3SH 1KIPB 1HXMA 2L7UA 3DGCR 4OFYA 1I7TB 3BFQG 1K8IB 1W6LA 4HGWB 4AYGA 1U8QA 3CDFA 1H6EA 3ZDXE 4ODVL 4TRPH 4J3BA 4JY6B 3GXFA 3QUMA 1CDGA 2J43A 2VDRB 1D6EA 4KUZH 2X89A 4RQQA 4AL8H 4ANXA 4Q6YA 3OLGA 4JFTA 4QHUA 1YA5A 3HG3A 1FG2B 5EUKB 1BV8A 1OM9A 2CXGA 3FQYA 4YGAB 2F53E 2NT1A 2YC1B 2A1WH 1WD8A 3NVQA 3I50L 4H1LH 2X4UB 4OZGA 4YHLL 4MZIA 3ZE1F 2F1EA 5B4MC 4QRTA 2WXJA 2OW7A 1NMBH 3QR2A 3VXSB 1J8HA 3QJFB 5CGTA 1ZVYA 1KGWA 3FQUB 5GRJH 3KPRB 3ARGA 3C60B 4G6KH 4K8RD 1RJZA 1UA6H 2EIBA 1TQBB 4G6FD 4NZRH 1A1OA 1NKGA 5FYKE 1S3KH 2EEFA 4XX1G 5DJ8B 3UJJH 2HMIC 1NDMA 2CH8A 3A67L 3HE7D 4G7VH 1M7DA 4F7PB 4UQEA 3SOBH 5J06A 1H6TA 2WWKT 1PMYA 2EC9T 4HC1L 2KLRA 4ZBJA 5LO7A 1GS8A 4HIEA 5GGRA 1BZOA 5C0JB 3EFOA 5DCCA 2DMGA 1JFHA 1T1WB 2AQTA 5KWYC 1DLFL 3UH8A 4OIIL 2DKMA 5GJSH 1I53A 1PNDA 4DEUA 4L2LA 5IB2A 1BAFL 2H6UA 1DJIA 4WK0B 3X13B 3VG9C 4PJHE 5GSVA 5CIPH 4FZ8L 3C6SA 4TYUA 3LKNA 2V9QA 3VTTA 3VFTA 2AAAA 3CBKB 2Z4QB 2R69A 3OHXC 2BOLA 4JFFD 1RI8A 5EEZA 1MFNA 1OCWL 3T65B 1QUPA 5E95B 2WLNA 1WFNA 5DZPA 4E5XA 4OCSH 1AS7A 4YXLH 2VDPH 2HKFL 4GKSB 1UUNA 3K71B 1XV8A 2YXMA 5KSAA 3UYPB 1KIRA 5KS9A 5JTWA 4AH2B 5IJKC 3DNKA 3BKJH 4OBRA 4B5EA 4HS8L 2FHFA 2P52A 2VW4A 1NDGB 4UV4H 1THCA 4G42A 4OFKA 4IIQA 3HNSL 4V1DD 1HXYB 1SNRA 3D87B 2AF2A 2LAAA 4JN2A 4S1SH 3JVFC 4MNHA 1BJ1H 4GAJL 4HHGA 4CDHA 4Z3GA 5JYMA 2J44A 2YFNA 3O6KH 2VR4A 5JHLA 1PZ2A 4M4RB 2DKSA 3S98A 1QLEB 3QDGB 2QHRL 1GGTA 2IDUA 5GQBA 3SIKA 4BFKA 1WQVT 1KJ2A 3CXDL 2ZE0A 5DRXA 3RBGA 4ZMPA 4DVBB 4AUUA 1RK0B 1SEBA 4C83B 3WXWL 4NBZB 1X7SA 5LQBH 1IAOA 4KTEL 3WIIL 2ENSA 2FJFB 3NRFA 5IGXH 1R5WA 3FRPG 3ARPA 4LQ1A 1IILE 4IKJA 4LB8A 5DJZB 4FA6A 2B1HL 3QULB 5D1XA 1G7JA 5GJSL 2JMRA 1YEJL 2BP5M 5HGAA 4AJWA 4EMZA 4HPYL 3DHPA 2CBMA 1ZWIB 3FB8B 5IUCA 4Z7WB 1XWVA 1XGTB 4AT6B 4D0DB 2GT9A 4PI0A 1WO2A 1QG3A 3AQXA 4JPWH 4WDIB 2AK1L 5HYJB 5B38G 1UEYA 5I6XC 4S1RL 1VRSA 5I30L 1GY1A 2BW5A 5TDOB 3LIZA 1I8UA 4DP6X 2BVTA 4I2XA 3SZ6A 2OQJA 5BRZD 2QZQA 3NTCL 4LLUB 4IKIA 4R2GC 2R8SH 4PJEF 1IC7H 3VQMA 3MTXA 4MVBD 5EO0B 2JKXA 1AP2A 2X2YA 3S5ZA 3LH2L 5T3ZH 3R06B 1LEKA 2H9GA 4W93A 3O3AB 3GWJA 2IF7A 1JWUA 3NN8B 3OR6A 4M5YL 3QZMA 1DN0B 1ZY9A 1H3PL 4B9KC 2BDNH 5IB5A 1FZJB 2E76C 3PJSB 1AOHA 3K5SA 3EYOB 2FAUA 3KDPB 3PV6A 4HA1A 1DL7H 1RZKH 4TL4A 4CKVX 3PREA 2NXZC 1SUHA 1IVTA 4LSSL 3FBQA 3L4VA 5GGRY 2GBVA 1LO3L 2CA3A 4NO3B 5J1AA 4I3GA 4BQ8A 4PHZA 4H26B 3IPFA 1JCVA 3SBWC 1P7BA 1ZRUA 4ONOA 4BA0A 3IU3A 1BVOA 2IH1B 1R24A 1MW2A 1S78D 2ZONA 3FN9A 4MMXB 3WTWA 3KPPB 4Z7WF 5C0BA 3LEVL 4AX3A 5BV7B 4J12A 2G9HA 2D7OA 4MB1A 5HVGB 1FFQA 4OJEH 4OSUH 5LBVA 2WXNA 1S7SB 3LY6A 4MB4A 4L9DA 4H8WC 2YPKB 4HPYH 1T1YB 1U92B 4KJWD 4LCWD 3ZR6A 4DCQA 2AXGB 3A6CL 2NXYB 4E42A 2OMTB 3O2DL 1U8HA 2P43B 2XWJB 3K5RA 3MGTB 4F15B 5KN5A 1U8LA 2R1YB 3MRMB 5CJ8A 1G9EA 2OULB 1OAQH 3WAKA 2OYKA 1IGYB 2OL3B 2DQUL 1RJLB 2RFXA 4M56A 4FQHB 4FC3E 4JDEB 3ZRFC 4AM0A 3MBEA 1IGYA 4NQQA 3Q48A 3KBFA 5C0BE 4PRPD 1IKFL 1V54B 4WTXA 5DHMC 3TBSB 2AEPH 1PLGL 4F3FB 2OXHB 5TPWH 3LEXA 4PUBH 4BFFA 4HWBL 2WSKA 3AG1B 4DCQB 4B50A 2MQ3A 4UT9L 1QBLH 5LN8A 3KHQA 1L9NA 5BXFB 4KITB 4B3VA 4L3FA 5B38B 3C60D 3OQ3B 2EIMB 3TT1H 4E41D 4D9QD 2YD5A 3ZLQC 5DQ9A 1FHGA 4NUQA 3D3VE 1ORSA 2WKGA 2CUHA 4EIUA 2HVKA 3CHQA 3MV9B 2EE9A 1CVSC 4LL4A 4J3TA 4ZAKC 5KUKA 2FK9A 4NO3A 1QWUA 1PZUB 4G6ML 1WA2X 3VGFA 1N5YH 3N43F 1D5MB 5BO1L 4YE0A 3F7YA 1GC1H 4PU2A 3S34L 2P24B 1PBYA 4ZMLA 5JXEC 4Y4FD 4AVIA 3E1ZA 1NM4A 1CXLA 4HG4J 3RYMA 2WUCH 3V8CA 4PRID 4AQZA 2CRMA 5AG8A 3E7JA 4LKCA 3QK0A 4D94A 3JUYA 5I8KL 1I7ZA 4IM8A 3FUJA 4OZIB 2YPVL 3P30L 5EO0A 2B9BA 4B5ZA 3N40F 4NKOA 4KDVA 3N42B 3QFJA 3SDYL 4NBYB 4RFOL 3U82B 1VIWA 3U9UA 1SUJA 5AL8A 4L9LB 2G0LA 3FBKA 3ZX1A 2VKWA 3GMLB 3QAZC 3VXTB 3CLEL 1U3JA 3DMMA 4NC1E 4Y9BA 1XIWC 5E2WH 5C07E 2ZXWB 1IQWL 4DN4H 4L8CA 1BWWA 5SV4A 5I5JA 4AZ8B 2GTWB 3FFCE 2EIKB 2NNFA 4BIKA 5F97E 3VRIB 4XWGH 3VD2A 4FDWA 4EDWH 5A6LA 3ARYA 2V8MA 3ESNA 1C7SA 2OS7A 2OXGA 3P02A 1J10A 1NC4B 4AYBA 1X5YA 1OCZB 4B9YA 1BECA 5IHLB 2XZQL 4JZJA 1A6WH 1CTOA 3EJPA 2CCLA 2IPUK 4PJXB 3T8VA 2Y72A 3O0LA 3WEOA 3DX4A 4DPBX 1NUNB 5L6YL 5C0IA 2YR3A 3NDZE 2F08A 4F20A 1XZ0A 2H41A 3SOBL 1XD0A 1AI1H 1DE4B 5BOZG 1E28A 4OF0A 4YEFA 2RHEA 3KGTA 5DRXB 4NJ9L 3K8LA 3VFSA 1IL1B 1Z2KA 1OAXH 4XNXH 3QEUB 4BV1A 4NKMA 1LE5A 1LDPL 2GK0A 2O6CA 4Z7NB 2F74A 5ICXB 3GZKA 4XNUL 5GZOC 2P46B 3MREA 4X4YB 1DUYA 2CNYA 2E7MA 3V8OA 5JIMA 3O6FD 4MXQC 3UTQB 1C5BH 4XNZB 1HQ4A 4NAQA 4AC4A 1S78C 4M8QA 2A83B 4Y5YB 3UPRA 3D52A 3H7BA 4ZQKA 1PKQA 3NCEB 3D39A 1XF5A 4YLCA 3MNMA 1D5RA 2WNWA 3GXTA 4AH2A 2W8CA 3WOVA 2JTYA 4JFEE 1Q9WB 4XXDB 3W2DL 4ZNEE 1KCVH 4IBLT 3BCFA 4XC3L 3K6DA 1EAQA 2CXKA 3BWUF 2EDWA 4JPKL 4YDJA 1QBMH 7PAZA 3FT4A 4D0BB 4QXTB 2Z4QA 4FG6D 3ZGIA 2UZPA 3B7UX 4CJ0A 5LLIC 5GSVB 1HL5A 2VXSH 4YSTA 3U6XS 4OJCA 4RDQF 3VRJB 3MOBH 1C16B 2BSED 1PCXA 4X4MA 1OTUD 3VTMA 3APNA 4PEEA 5E1GA 3D7PA 1SJMA 3NA9L 3ZTCC 5D7HA 4O9HH 4M6NH 3WIAA 5FYJH 1JPFB 4X7EC 1LP9B 5LVEA 3P77B 1XL6A 2VAJA 3B4NA 4KTDL 5HDQL 1NLDH 4M3JA 2GJ6D 1LQBC 4J4PD 1U8KA 2XIDA 5FHAH 1HSAA 1WA0X 4Y9CA 1NIEA 3KPRA 5K9JL 4X6CF 2N01B 3UTZB 4R7NB 1E9QA 3V5HB 1PTZA 3C08L 1RSFA 4LCWB 5HYSB 5K59F 3GUTA 1E3XA 1HTYA 3GJFA 1KNOB 4LHUA 2YC1A 1NCOA 4JFWA 5AWNH 4PTUA 1P84K 2BP3A 8PAZA 4LLAA 4ZUWB 1ES0A 1FG2A 2OI9B 1PU0A 1JXKA 5INCB 2NY4D 4NN5B 1DUZB 2UUDH 5ISZE 4J7RA 3U1PA 3IPEA 2XWDA 2FD6L 3BVNB 2Y25A 4NNPL 5DRZA 2X4SB 1FIGH 4LDOB 2XA3A 3TURA 3WFBL 3O3DB 1F5WA 2BSDA 4K55A 2E7LA 2XNAA 3E38A 3KNBB 1DYZA 4FJYA 4R26H 1IQDB 3PWNB 2NYZA 3HHSB 4WJG3 1XR8B 5I6NA 1Q0YH 2WWKO 1XIWD 4PJ9B 4QHMA 4JGUA 3CLFL 1E4KA 5CN2A 4J3XA 2AEWA 5IB1A 1XQ4A 4NXSA 1HKLL 1DL7L 1RZKL 2VLKD 4E9SA 1ZGLA 1B6DA 1YSOA 3IF1B 1AZUA 2YGPA 4HKXB 2Y7SA 2ZKWA 5FB8B 1FGVL 4GUCA 1YQ2A 5ETUA 4YIQA 4Q89A 4RMWA 4GMSH 4MCYB 3TH4T 3JQOB 5DD1L 3EG9B 4N28A 1UJTA 2WKOF 1KN2H 2GJ6B 5JDJA 3TJHC 3AM8C 4JM2B 5CLYA 5BZZA 1RU9L 1E67A 3I9GH 3MLUH 3ESOA 4WWPA 4TVSa 5GJTH 2FBRA 2B5IC 4XB3A 4F8LA 5JW4N 4Y1AB 1UM5L 5JOFB 3VFWB 3QZWG 4I0PB 4KY2A 3HBGA 5AG9A 1MY7A 2NY0D 3DOSB 4BSVA 3LKRA 3TT3L 5F7HA 4NN6B 1A4KA 2BVEA 4JG0H 4GKNB 3RWIA 2GTZB 4GINA 5HI4C 3FSAA 4ETQA 4JANA 5JO5A 3RWHB 2OI9C 4FQLL 2ADIA 5E2UH 5ITBH 5KAQF 1YEHL 5L2KD 1E5YA 1WF5A 2CUIA 2CO1A 1GZHA 1YC8A 3B7YA 4M1GL 4RGMB 5CP7B 4AEFA 3GLDA 5KBDA 2J8UB 1QFWI 4OKDA 4OCYL 2AFNA 3EZ8A 4HOWA 1QNIA 4KK9D 3LN9A 3CVHA 4KKQA 3OMZA 1RLWA 1UH2A 2QTVA 2EVGA 3PL6B 5DO8A 1TYEB 2JXMA 5D5MB 5T3XL 4X5QA 1U8PA 1NAMB 2YK1L 2QHRH 2OMUA 5DYOA 4M43H 3BUTA 1Z5YD 2P49B 3P0GB 5L2JA 3LQZB 1B4LA 5JZ7D 3LQZA 2NY5L 3V4PH 1OSZA 3W0WA 4WUUA 3VGDA 3WE6A 3RPBA 1X7QA 5HYFA 4U6YA 3VXUB 4OGQC 1RIUL 4AK1A 1DQVA 1DQIA 3PL6A 4JFEB 5HD8C 1AG0A 2QQLH 4P5MB 3FCTA 1KYFA 3GZOA 4MNGA 4OIAA 5K33A 3GNMH 4PV9A 2OYPA 5B1CA 3O9WD 5AW8B 5BRZA 1EUUA 4MCZA 3ATAA 4WLCA 3FK3A 1PF3A 4RA0C 1Z5HA 3H9HB 3W5MA 4AXWB 3EJZD 1WBXB 2PYFA 4JO2H 2WZ6A 25C8H 3SDAD 1RK1A 5DEJA 3D4GA 3IVKA 3KH4A 3Q5YA 1SYSA 1QLFB 2H6PB 3BVXA 2K6WA 5JXED 4KJWC 4D9LH 1OWRM 3NJFA 4PS3A 1KGCE 4JY5L 3QRLA 5AB9A 5I1KL 3RA7L 2X9XA 2V3DA 3LKRB 3V6FB 1EXUA 1EXUB 4UNTA 2HLEB 5TTRA 4GKLA 2VDLL 4G9FD 4OCMC 3NSJA 4BDVA 5EA0H 2D0HA 4IKNA 2ESVA 1BXXA 1J9SA 4C4KO 3TO4D 2R39A 4M61A 4O4YH 1NBYB 3HCVB 4XBGB 5ACMA 2NCMA 5FYJE 1MIMH 1YJDH 1I82A 3QC5X 1FH5L 1CURA 1C1EH 4PJFE 1GGUA 3IF1A 4G6JL 1YMHA 4TTDC 5J9PA 1DVZA 1HFUA 4R8WL 3PWUB 4MKMA 4MXWH 5C0AE 1N7MH 2VR7A 3AG3B 4IOFD 1KEML 1SJHA 3T04D 4QAWA 2ZWZA 3B2UD 3Q3GA 3WE6B 3W0WB 2NUTB 5ICZA 1XD1A 1R4XA 2YA1A 1YO4A 4F9LA 3OC5A 5I18L 4MYPA 3U0TB 1CS6A 4QGYA 2EUWA 4D0CA 5DSCB 4YMPA 4IJTA 4YVUA 4ZTEA 3M46A 3TA4D 4JR9L 5J6GA 1CD1A 4L5FE 3C5ZD 1G7PB 25C8L 4X9YA 3CVHB 1GZPB 3JYBA 2J6WA 2DYPA 1T1XA 1TZGH 4Y9FA 3BOVA 1TJGH 3R18A 3MV8D 3DI2B 1Y0LA 1A4AA 1FZMB 5E4EC 5CN1A 4XN2A 2Y7NA 3MNVA 5CP7A 3U0WH 3V5KA 4D2NA 1C12B 1J7VR 1AH1A 3HLAA 1RZ8A 3KLKA 3TF4A 5DC2A 3SCMB 3HBQA 1J0YA 3PQYD 2VDLH 4MQ7A 1S7WB 3BLKA 2YPLA 3F04A 4MMYB 5DTFA 3DC0A 3LZLA 1P5UC 4QF1B 5D2LA 2OTUA 3CSPA 1RZQA 3H3PH 5KVGH 3RY6C 1CGWA 3DOSA 3HRZA 4KY1L 1JD7A 2EDBA 3KYNA 2WLKA 4JO5A 3T3PE 4OF5A 4NENA 2JIXB 2UV3A 3N91A 3TBWA 3VFWA 3OZKA 4YBLB 3CMOH 4LSTH 3IGKA 5J1SC 3RAJL 1A7PH 3SO3B 2Q5BA 2CMRH 2ZQKA 3M1BB 2O6EA 1LJMA 5D7KE 4NC2B 1FVDB 2GJ6A 5IW6B 1NGXB 4DOHB 4KI5C 3SQBB 2BPBA 4H7VA 1S7VA 5B3JF 5HYQA 3MX0B 3AZUA 3QNXA 4QHKI 3TBVA 1JAEA 3MO1B 3ZW3A 4DZBB 3PXLA 1BW8A 2APWA 2IDSA 3G6JE 4Y16A 1Q90A 2AI0L 1NGZA 4QUOA 4LLQA 4UQ2A 2ICCA 4JRXB 4KQ3H 3M17A 4UAHA 4CSZA 1MCWM 3K2UH 3FTVA 1I8IA 1MF2H 1G1CA 1YUHA 4BFJA 4HLEA 5TFSL 4H8WL 1AIZA 5TK4A 3OR7B 5D7IF 2XSKA 3BGFB 1R3KA 3MJ7A 4AV0A 2XPGB 5IHUL 1UWGH 2YXVA 3FQWB 4R96A 2BX5A 1PZ3A 2Y3AA 4HFUH 5C0NC 5C71A 3NIFB 3FT1A 1HYSD 5E8EB 4WI4A 4DEWA 1S46A 3BKJL 1JJUA 4XX1E 5E5UB 2EUXA 3D39B 1URLA 4OLYH 1N0XL 5L2KE 3RUGE 2VL4A 3NCJH 2YUWA 3ZHDA 4GS7B 4X4YA 5LUMA 2WQWA 5F6HI 1UB6B 5CD5C 1KNOA 2DWXA 4WHCA 4L4VE 3VWKB 1T20B 3BD4A 5ADPL 2B0SH 2DKUA 5D7SL 1G6RH 4Y4KA 4DTGH 5BUPA 2H3KA 2C8NA 1CDBA 1SXCA 4EZMA 4PLNC 2G3XA 3OZ9L 4BZ2H 5CM1A 1HSAB 3RVTC 5KG9A 1E28B 3HG1E 2MQGA 2Y1AA 5KG9B 1ZTMA 2UXTA 4NQEB 2D73A 1AO7A 4YXKH 5EFIA 2ZJSH 5C0IB 4KZEH 3D25A 3ETSA 2PW2B 1T20A 2EIEA 1AMYA 2VSMB 1AXSB 4JE4B 3C8KB 4KX8A 4OQTL 5DJ2B 1FPTL 1MDAA 3DX3A 2MQCA 1ACYL 2MHAB 3O41A 4GMSL 4XMWA 3VG9B 3FF8A 1JRHL 3EDDA 4MQSB 4WU7A 3HAEA 1U3HD 3A5VA 3UEZA 3TO2A 3QG6B 3FH5A 3LXCA 1ZLDA 1TF4A 2X4PB 5D1ZC 3W82A 2DQEL 1M3IA 1CL7H 3J8F7 4IRZL 4EZLA 4BSWB 4UI2A 3SDDC 5DFVC 1ZLWK 3ZE1B 4ONFH 1XTLA 4FTVB 1WDAA 3EGDB 4L4TB 4QXTA 4WHYH 2XQYK 1PY0A 1ZJBA 3QJUB 4N90E 4PY7B 2XQYG 4DGVL 2FUTA 4KAQH 3FCUB 1TZIB 4WSGA 3LH2H 1HVXA 3V0DA 1I7ZB 1I8IB 4XTRD 3T0WA 1A21A 1KN4L 4AJ0A 5I1CH 3DI3B 3GS0A 4RWHA 2DJSA 3B8YA 3HC0A 1MJUL 1CFBA 1MN4A 1UASA 3DETC 5C6TL 4N0FB 3PDOA 4GQZA 5FFOA 4BFBD 5JORA 3DTXA 2BRRL 4FXKA 4F92B 1R3HB 2P24A 5JXEA 1ADQH 1KTBA 2LVCA 3POHA 3QORB 3MX0A 5CLWA 5AZEL 3IGUA 3L3OC 4LBEA 4GXVL 3MRIB 4MA8H 3VDBA 1S5HB 1A4CA 1JDCA 2V5MA 4U4IA 1IGCL 3QYNA 2Y4SA 3M1BA 1Q9KB 4FFWD 1MHEA 3BEWB 5ICXA 5BVPH 3QDJE 4NKMB 3QO0A 5E94B 4BQBA 5T1LA 5F9AC 3A21A 1KJ3L 1FAIL 1YC7A 3EJSA 4WTZG 5DHVH 4EE2A 4P06A 1DVYA 3GSRB 3HI5L 4EZJA 1CXHA 3GZPA 3QIUB 3O2VL 4FZ8H 3I02B 4OV5A 4MAUH 3HR5B 1NLDL 3LV3A 1VJSA 4ZPVA 4Q6IA 4OLWL 2J6EH 2F19H 3KYMB 1BF8A 3ISYA 3FCSA 4KHTH 1UXWA 1XZ0B 4G6AC 4JO2L 3FT3B 4FULA 3INUH 4ZW3A 2DTML 2XJLA 1ADQA 3HLAB 4XXCA 3K2IA 1C12A 3WY2A 5IZ7A 4GQ9H 1ZGLM 4LLYB 3IPBA 4PJHB 1MCWW 3WGVB 1FZMA 1S7RB 3RRQA 5EIIA 4AEIL 3V4LA 3F7QA 2EVFA 3F01A 4HIPA 3MLYH 3WHXA 3T2NL 4QOKD 1GZPA 1BQKA 4XNQA 1IZKA 3NJLA 3KS0J 3IETB 3MYJA 4WY7H 5IB4A 4NQUA 4IS6A 3HR6A 5DHVA 4G6FB 5TDNB 1RUKH 5LBSH 1U8HB 2VC2L 1JL8A 4L9LA 4WI7A 4L8SA 5KN5B 1JNLL 1WCBA 4PHXA 1AQ8A 4YHYB 3BAJA 3LIZH 3RZCD 3BDBA 2HKAA 3SGJA 5HHNB 2QPEB 1JMZA 2YMXL 1T80A 1FH5H 2J2ZB 4XVSL 4AQ8A 3PXJA 2ITEA 1AXTL 2ARJQ 5I17B 4HUVA 4YWGH 3MUGB 2Z7ZA 1XGUA 5I8OL 4PRNA 3EDEA 5LDSA 4DPRA 3VXSE 1N7ML 3V4VL 4G7QB 3I85A 3IFNH 3PGDA 4UT7L 4OCXL 4WHTB 2OR8A 2WMPB 3BAXA 4JK0D 4UT6H 2VYRE 1DBMH 4JM2C 4L8DB 1L6XA 3HCVA 4X8JA 3VSUA 3AGWA 2ESVD 5HGBB 2DLFL 2FBJH 2X6MA 1GC1L 4EI0A 3EXJA 1PKOA 1RZJH 3LNGA 3OXSB 4ZDHB 1UOLA 4Z5RA 2QV4A 1UADC 2HWZL 4QEGA 2BZDA 4UWQB 3OR6B 4ELMF 4GY4A 3VI3A 4K94H 4JZOB 3QHZH 5E00A 3UFIA 3WN5B 2JCCF 2VLKA 5IJDC 2CLZB 5F8RC 3HUJF 3FHAA 3A22A 4H2CA 4TOYL 5EZLB 3SB3A 1BFTA 2OZNA 1B4JL 2OP4L 4XPTH 4AL8L 1KB5L 3QT2A 2IALA 3UXFA 4OI9A 3CPLB 4P23A 4Y4HA 3ROLA 4DK6A 1HIML 1A0QH 1NOAA 5GSRA 3S9DB 2IEPA 5JQHC 3PGCB 5D1QB 2VM3A 5T5FH 2X28A 1WLHA 2PYFB 5GRVL 4NXKA 4AL8C 1F90L 1UC6A 2I32A 2O6FA 2LLLA 4M9PA 4JG5A 5HJBA 3GS4A 2PCFB 5J7CC 2J6EA 3PY9A 5HJGA 3DHMA 3HS9A 1OQOA 3CZLA 4GAAA 5E2TH 3SO5A 32C2B 5TGBA 2C9PA 1AE6L 1SEQH 3D48R 1IGJA 4W4NA 2FTAA 2KYIA 1N5AB 2R4SL 5C6PB 5A7BA 4K2UH 1FLRL 3TC9A 2OMTA 2EIZA 4ODUB 1S7XA 4WO0A 2Q8AL 4XP1H 2Y1ZA 4IK7A 2E7HA 1R3LA 2XICA 2IO5A 1QI3A 3TPUA 1AQDA 3CWGA 2HUHA 4IHOB 5D7JA 2F5AL 1RK0A 1SEBB 3NCWA 1A47A 2QSQA 3JXAA 3AC0A 1NAKH 4N1HB 2R4RL 5K1VA 4DN3L 1W8OA 1F4WL 1R24B 1MW1A 4I3SL 1FFTB 4F7EB 3LXAA 1KTKE 4KU1A 3VGGA 2C1OB 4R2GD 4ZS6C 4LIQH 4PRIE 3ZL4L 5BOPA 1EGJH 3PHQB 1I7RB 3AFLA 3UAJC 1C5BL 3MV8A 4FTVD 3KXFB 1P53A 4LT7A 3CN0A 1OP9A 2BVOA 5IMMA 4NQTA 1JTOA 3BPNB 2EDYA 2G5UA 4D7PA 3PV6B 5IMKA 1NZRA 1SJVA 3CQFA 4MJJA 5KSVA 2XYCA 2AQRA 4XPHL 4DAGH 4N86A 5HDLA 4LOVA 1T89A 1U41A 4WV1C 5EN2A 1HHJA 2DMKA 5BV7L 2B4CC 2H9GB 2FNBA 3KVDD 5I1KH 4GQQA 4JO3L 4BSVB 5BO0D 1XCXA 3ABZA 3OWRA 1GKOA 5C1MB 2QGCA 4FQXC 1J0KA 3MPCA 5TE7H 1R46A 1SLUA 3EJCA 2G4GA 4NN7C 5EEUA 3H4FA 2ED9A 2WIIA 3TZVA 1KV7A 2ICWI 4XPFH 1A1NA 3IFLL 4X8GA 3SYPA 1QEXA 1H0DA 1ZVNA 3M6DA 2OL3L 3MRRB 3U6RB 3D2UD 4ODXB 5F6IB 3ZGHA 1F4YH 2BWIA 1S5IL 1UD2A 3TJEH 1DQDH 4LRNH 3AXHA 4DW2H 1FHNA 1M6OB 1CZ8H 3HFML 1CGTA 4W9ZA 1Z9PA 5AKTA 3VWKD 2IJ0C 3FU5A 3ZYJA 4XMTA 2CLVA 1QR4A 4ADIA 4P57A 1U4EA 3TCLB 1BOYA 4XOEA 5EORL 3L2NA 1F4WH 3G6AB 3R19A 4P2OC 5DZ9A 1BM7A 3UOAB 1JZ3A 4IQHA 4Q8BA 3CN4A 5C0CA 1RURH 1A1OB 3P30H 4QCIA 4PR5A 3AT8A 1KJ2B 2OMYA 5F9JA 2X4SA 3DYOA 4NKDA 1NKRA 1YMME 3B7RL 2BERA 1JNNL 2DQDH 2WUCL 5IW1B 1Q0XH 5GS1A 3VX0A 4DP1X 1U3HC 2D2OA 2XI9A 3U9WA 4BE5A 3MRCA 4KVNH 3DO3A 3QB7C 2J20A 3JWNC 4GPVA 4PTUB 4LHUB 4BXVA 3EH5B 4JFXA 1FCGA 1CFSB 3THML 1FL6B 2PTVA 3GJFB 4LCWA 2XWXA 5HYSA 4NNXA 1IO4C 2VJ8A 1E9QB 3HNSH 4N2EA 4PN6A 1EZUA 1I1YA 4AITA 1JZ4A 4H2AA 2SODB 4JFDE 1VGEL 4FS0A 1KIPA 4X7FC 3LNDA 3G6AA 1MJUH 3QO1B 1PY4A 3FFCB 1NL0L 4FMKA 4DFHA 3ZQXA 2CRZA 2FB4L 2HTKC 3LZOA 2WXLA 3O8XC 2DW5A 4PJ9C 1JOIA 3U83A 2EYTA 2XQ0A 4QHNB 2F61A 3HI5H 2ZTBA 2EUZA 4A6YL 4FFVD 3CFKB 1Q1JL 1QRND 2EXTA 3SOTA 4APQB 2W9DH 3BEVA 4EOWH 4HJTA 3C87A 3WDHA 3SBPA 1U8OB 4E9LA 2F7PA 1U30A 5EOQL 1HSBA 4CRPA 2IQ9L 4J39A 1JZ2A 2WLJA 4CSTA 5IFHL 1BLNB 5C0JA 2ZXDA 3FU6A 2RACA 2QGDA 4PJBA 2NLJA 1I7UA 2YQGA 1GTFA 1KT2B 3DHJA 4NRZB 5A2LH 5I1EH 2YSSB 3QO1A 4YDJB 3G5VA 2WP3O 1XCQB 3HI1A 4W9CC 5GISL 5KYXB 4N20A 1KJ2L 1ZKAA 1TVBB 1X6NA 4CC4C 2BVQA 1J5HA 2DEXX 1KYOK 1NOFA 2D2CC 3OHXB 3FQUA 4XXDA 4U1SA 4ADGA 1GTNA 4YDKL 3ULVE 5ISZD 1I75A 4YHLH 3S8WA 5HGHB 1CDCA 3W2DH 1SF3A 1A14L 2QT6A 4GG8A 5CILL 1G9MC 3WSQH 1DN2A 3MODH 4A7GA 2BXZA 2GHZA 3R4RA 2K3HA 1TQBC 5GRJL 2APXA 1FV1B 5EUKA 5AALA 3VWKC 2J55A 1H3PH 1ZA3A 1AO7D 1VGEH 3FHQA 3LZPA 1D6EB 3T1WA 4Z7OB 2LABA 3QDJB 1HNYA 3QI9A 3QQ9C 4UT6A 5CCKH 3F3HA 1GGCH 1FFOB 4K3EL 4U3SB 4YQXH 4GW5B 3UC0H 3DX7A 1PZBA 5E1AA 3X11A 2I9LB 2AJSL 5IVZB 4I2XE 2BS8A 2WTRA 3MOQA 4M9OA 1RP8A 2DMCA 2EJ1A 4AG4L 3FS9A 2ZJSL 4P4KB 1I1FA 2XN2A 4JUTA 3GI9H 3VMNA 1EO8H 3EOTH 2R27A 2ICEB 3UCQA 3UERA 2H6OA 4JDTH 4O2CB 5H94B 4B9CA 5JPNB 1E2WA 3QJXA 2OJ1A 5D7IE 1UKSA 3VI4A 4IOIA 3WKMH 4AQ1C 4FTVE 5FFGA 5IHHA 1ONQA 5K9KA 4OY9A 3UX9B 4Y4HD 2AJUL 2X7LB 2XWCA 3GMLA 4UTAA 4WWKD 2YEVB 3OG4B 1MVFA 3L5XL 4AV5A 3MRNB 3G6JF 4XVTL 4YHIA 2WIIB 3TZVB 4ZPTA 1MREL 4WHDA 3GBLA 5DMIH 4L3CB 5DD6B 2X44D 5AWNL 4PGDB 3P1VA 2GITB 4GSDL 3EYVA 5J8OA 1EDYA 3IFOA 2AV1A 4MDIB 4UZSA 3TTYA 4PUBL 3O8XD 4Z7OF 4JFVA 4N8PA 3R0NA 3CPUA 3KLAA 3I75A 5JHDB 1HHJB 5JA9A 3MCG1 1PJWA 4IU2B 1KBBA 5HTSA 4PM1A 1VFBA 1DQMH 3DK2A 2JLLA 1ETA1 1E9PA 2FX9H 4PG9B 3DJTA 5CCKL 4HU8A 4YLQT 1OL0A 2EO1A 5FYLH 1S8DA 1BIHA 2BVOB 3DV6A 3HG5A 5CZXC 2WMPA 3BZFB 4CA4A 3PHQA 2HT3D 4IRJD 4OM0H 2F68X 5MI0B 4PJAB 3G08A 5DJCB 1CN4A 3E9TA 3K6FA 3NQIA 2ORBH 4TVUA 3EBHA 4XCFH 1VAHA 2EE6A 1ORSB 1UM6L 2AK4A 2ZKXA 3X2QB 3I9GL 3MLUL 1X6LA 3TYFA 3FN0H 1GW0A 5HYJE 1L5GB 2F19L 3TPUB 3UYOD 3WEAA 1KXHA 4NUGL 4RFEB 3CZFA 5JZ7C 4KRPD 1OP5K 4DUXA 5FIEA 2EIZB 4ODUA 4EVNB 5T8IA 1AYRA 4ANVA 1BAGA 3L9EA 3VXUE 4G5AA 1TPXC 5LAXB 1GSMA 2F54A 5D2NB 4Z95H 5C9JB 5I30H 1RCYA 1ZS8B 2XV6B 1NLBL 3N9GH 1S7QB 2Z8VC 3WL9A 1MRCH 3GSWB 3LD8C 1XF4A 4OZ4B 5IQ7L 4OR1A 5D5ME 3KLHD 4PJGE 4PGBB 3B7SA 1IGTB 3CFCH 5ALBL 1I9EA 1W8NA 2VB5A 4PWHA 4KDTA 1TTUA 3BE1H 3CFMA 3FCSB 2W07A 4DP8X 2DIBA 2DLHA 4UINH 3WIFA 1S7SA 4HPOL 5D5MF 4AE1A 4ZPVB 5AOZA 4JMXA 1U8MB 4ZFFA 2VLKB 4G8AC 2NY2C 3ARFA 1UWXK 2X05A 4NQDD 4PCYA 1QBBA 4NRXB 1PAMA 3VFMB 2IH1A 4M7JL 1MHEB 3BEWA 1HDMB 3HE7C 3IYLW 4JFOA 5T3XH 3V6ZB 1K4CB 5J1AB 3OKKB 4NJ9H 1OTSC 1QRNE 3WI9A 2D8KA 1QSEA 4H0IA 4KNSA 5JYLA 1J8KA 4RGND 4ZMYA 5KTEH 1BIIB 4ZAKA 3IGAB 2V8LA 3TIDA 3DMMD 3FN0L 1F8TL 3B56A 3HHRB 4FQ1L 4KKBC 2YUXA 4O2EB 4J8RA 2DQFB 3HRZC 1N19A 3KS0H 3WN5C 4U6XA 2F0CA 2VZVA 4N2GA 1MWAB 3UP1A 3F85A 3BUYA 5H2BB 1K5WA 1FDLH 1I31A 3K8MA 1GGBL 2I7SA 4LZKA 3FOLB 1TZIA 5DF0A 4OLXH 2YARA 3RB5A 5ITFB 1JK8A 4AMKH 4QHLA 3DBSA 4HU2A 2GIYA 2ATKA 3GSUA 4ZTPL 3BP5A 1UWEL 4WVRA 3UBFA 2AXWA 3IMVA 4P3CL 5T3XE 4H5SB 3D0LB 5DC4B 2R69L 2HFTA 2YD9A 4HIXL 4L8SB 3BP7B 4UU9B 1AKJB 3VSVA 3A24A 5TDNA 1RL1A 4UV7H 4GRLC 3Q9PA 4IS6B 4WDIA 5HYJA 3IKKA 4S1SL 3D6GA 2X4PA 1ZV2A 4MA7L 3MRFA 4KJQC 1I9IL 3FQTB 4JFPB 3GLEA 3FSWA 5D1XE 4AYDC 3QRFM 4Q97A 1XIWB 3COOA 3IU4L 4JFHD 4UM9A 5FOJA 1A3ZA 4MASA 1KB5A 3FZUD 4WSJA 5ISZB 4MJIA 4U1GC 3FSOA 5LQBL 2VMCA 3FT3A 3FCBA 4ANUA 2P8PA 5JPMA 3SKJL 3HE7B 4WJKB 4GI6A 3VFGL 1MG3C 1WC7B 1A9BB 3STLA 4QRRD 4DVBA 2YD8A 4Q6IB 4ZRGA 1BHGA 4EO5A 1U8CA 3RZWA 1OB0A 4MWFA 3NCXA 4EQ3A 3K0YA 3VGEA 1CGVA 1S2EA 1FGVH 2FYYB 3H6JA 3KVQA 3RIAF 2NY4B 2QTEA 5DMYA 4TSAL 3QO0B 5E94A 4MNHB 3RX7A 1R3JB 5D2NE 4GRMA 4MXWL 3C5ZB 2XZCL 5SWQA 1FJ1A 4JFUA 5IEKA 3DGDA 1S5HA 1RY7B 7PCYA 4FADA 3KJ6H 1CJYA 1TJMA 3QJHB 4BCYA 4XWOD 2WZ0A 1KCUH 2X4RB 4RAVB 3U7AA 4BM7A 3W0WE 4D7BA 5DT1H 4APQD 5GPRA 1VLXA 5E6SB 1A3LH 3WJJC 4LCYB 5B39A 2Z31B 4PJEA 2LQRA 5LDUA 4XNZC 3K71A 1F11B 1FE8L 4OFQA 1F1DA 4R96B 5ICUA 3TO4C 1OK8A 4APXA 1A5FH 3HE6D 3T65A 2CO3A 2FHCA 1COBA 3F58H 1PKQE 2WHVA 4BH7B 4LSUL 4QAMB 5D1ZA 5ABAA 3BRGC 4NM4L 3T6VA 1BZEA 1XXDC 4FTVA 1P7KB 1A7QH 3PUCA 1WTLA 1TTCA 3LX9A 4KY1H 1A8JH 2BNRE 4N2LA 1A14H 4DKTA 1IAIH 3C6SB 4F8QA 3N2JA 4PP2A 1NCUA 3TP4A 1LK2A 5FOBA 3VACA 2OZ4L 2K9FB 3C5SB 2H3NA 4YHPB 4QYOA 4U1GB 3H42H 3H54A 3FT2A 3QNXB 4TLUA 3PUUA 5AYUL 5L6YH 4MA8L 1SDAB 1GZQA 3O6KL 4M93B 4MDJA 4N0RA 3CV5A 3JWOL 4KKCC 1KPVB 5TF1H 4N5ED 1K85A 3W3BA 3FO0H 3IXAB 3N1GC 3RJDA 3TBWB 2EDKA 2ITDA 5SX5H 1U42A 4WI2A 3UAEA 3ZKQD 5JMOC 1M7DB 3FB7A 2ENQA 2ZX7A 4WI3A 3SDXB 5AUMA 3I6GA 3GM0A 1HN1A 2BMKA 1I9JH 2HX9A 4M7LH 5E5LA 4EIGB 2QADC 4DUWA 3WTXA 5J6SA 4B9GA 2Z0BA 4A7UA 3MCYA 3MUZ1 4MZ2A 4OIFA 3QJFA 4ICXA 4PP1C 1A2YB 4GP4B 2F6AA 3T0DA 4YSQA 3WLWD 4JFYA 4X6CB 1AZBA 2DM4A 3CFEB 1JUFB 2Y5TB 2DL2A 4DGIL 2ZP8A 5DZNA 3ASOB 2B39A 2I85A 3CBJB 3GC3A 2X6CA 2MFNA 3GSQB 1A65A 1NBQA 5JW4Q 3GRWL 3PWJB 2PXYB 4PREB 1X5AA 1ADWA 1TITA 4RQQB 1CFVL 1E9OA 2WINA 3FZUC 4U7SA 3QEQE 4E41B 4ZW7A 1MCDA 2HT2C 1VZGA 1I7TA 1W72B 4OTXH 4ZYKA 4X0NA 3I6SA 2WWOA 4ELMA 3KPQA 1O6VA 1P69B 4L4TE 1PCSA 4OD2A 3OKDA 1ZLEA 4YJZL 2CDFB 1RUQL 4Q2ZB 3BMVA 3O11A 1K3IA 1M3JA 5EU3A 3UIZA 3VB9A 3M17B 5C7XH 1XTMA 3P4NA 5T1MB 2DICA 4JO1L 5AD0B 2FLRT 3A4AA 4OCXH 1NICA 1VENA 3EYSL 3SGKC 2NY3B 3SDDD 5DK3A 2CPUA 4XN1A 4CDGC 1FVDA 3GPSA 3GNML 1RH8A 3GHBH 2OMWA 2WQAA 4HJIA 2NSMA 2V5RA 3WE1A 3HC4L 5I18H 2AAVA 3BCDA 1P6AB 4P3DB 4F7MA 4JGNA 2TSAA 1E4WL 4KK8C 4Y1AD 2DJ4A 2X6UA 3CFNA 1LK3H 4MJ6A 3EBGA 3V6FA 3AMKA 4LSQH 5BQ7B 2BY3A 5FGCE 1A6UH 1AS6A 2P8MA 2UWEE 4P2RD 3AY2A 4PJ5D 3EZJB 4K9EL 3U2SB 3O3EB 2L3BA 5AFAA 1HZKA 5F1SA 3RL2A 4ELDA 1N64H 1TTFA 2PXYC 5E9NA 1IQWH 5M94B 4WFFD 3IVKB 5IMLA 1RD6A 4I18C 4MMZA 4GAYA 3D85A 4AC2A 4GRWH 2P9RA 3AREA 4NNPH 3EJJX 3WFBH 3PL6D 3ZKMD 1AD9A 2WVUA 4AGNA 5L8JB 4UIMB 1DSFL 3IDGA 1G7PA 2XT1B 3TCXA 3FCTB 2AS5M 1QEWA 4TVPD 5D71L 3ECWA 2BVPB 3M7OA 4MNQB 3L4ZA 2R0LH 4YUEH 3N06B 5C2BH 3VYOA 3VG0H 1RMFH 2XRAH 3NIDB 2I07A 1GYAA 5FF6A 3WFEH 3INOA 3UZQA 3Q0HA 5LGJA 4ZUSA 3RU8L 4XNXL 3GM8A 1JGEB 2I07B 4HVBA 2HH0H 4HCRL 3T3MB 2Q3ZA 5I24A 3KHOA 4HJGB 2AJYL 2I60H 2JXMB 1ET8A 3N5AA 1E27A 1KMGA 1PFCA 4OZGE 1QHPA 5GGVH 2N7SA 1RU9H 1EZSA 1SOXA 4GUOA 4U33A 2IPKB 1DDHB 1K8DA 3L1GA 1P7HL 1EBPA 5IBUB 1NBYA 4JM2D 3F12B 4BZ1A 4IIQC 4ESKA 2RCSL 3RPIB 1KENH 4MMZB 3S4SA 2GPZA 4S1RH 4NN6C 2W65A 3GUFA 3RVXD 3VAEA 3PF2A 1T22A 1CG9B 3LOWA 1PLAA 1BEXA 3QNFA 3U79A 4L1SA 2M1KA 5CGBA 3VYPA 5BQ7A 1CE6B 1EEZB 1CICD 5EZOL 4P3CH 4NZTH 2WZPA 1RXLA 2UZXA 5CKAA 5DJ6A 1UA7A 2Y22A 4PJ8A 5GGUB 4F2EA 2PPAA 4KZCA 3B2VH 4H0GA 4PJFA 2Z7UA 2VDKH 4GG6E 5JHDD 4LEEA 4ATWA 1I4FB 1LQSR 1SLXA 1GH7A 1WBXA 3L3KB 1XGRB 1BQHB 2C9RA 2DWEA 4TQPA 2IG2L 4UT7H 4YEEA 3WEBA 2FWOA 3KEDA 1LO3H 1K8DB 1W0WB 3ARUA 1J05B 3T3MF 3ZOAA 1B9KA 3VM7A 1DSYA 4WUKH 1VGKB 4JM2F 2VITA 5T1MA 5AVRB 3MJ8A 4MNGB 5EOCL 1CMOA 1ZIBA 3RU8H 3U4BL 4GO8A 2OJZL 5KZCB 2QJDA 4V1DB 5I75C 2CD0A 5BZXA 5DD5L 1JGEA 3RJQB 3SY0B 3PE9A 4X9IA 4ZUSB 5TJWK 3EYUH 5KJRH 4ELMB 5GIRB 3C08H 9PCYA 2B2XL 1DBML 4PJIF 4O2FA 2VGLM 4FZEL 4F57H 1KGIA 3A6CH 2NNXA 2OMUB 4X7DC 4TNFA 1Y7VA 1SZNA 4GMTH 1P7QB 5DRZB 3QIBD 4W4OC 5ICYB 1UG9A 1A8ZA 5DHYB 1QPKA 1T4KA 2X1XR 2X9YA 1L0XA 5JQIB 3V5DA 2VW6A 3GK8H 1RZFL 2ZCKH 3L3GB 4XPAH 3ZDWA 4C56E 3BPOB 3CIQA 3VWJD 3O4OB 2ISDA 2YFOA 3LKOB 4TUUA 3LD8B 1AD9B 1MCOL 4X6DA 4RISH 1EGJA 3QUXD 1CBJA 2OKMA 1A1MB 3C5JA 2J8UA 1CR9H 4FFZA 4PJDA 5AW0B 1YY8B 5CEZL 5C0FB 5JOEA 2VXSL 3X1NA 4GXUM 1WZAA 4PLKD 3TFBA 3KLLA 1VB9A 3VI3E 1XCTB 1CFQA 3RWHA 2HJLB 5HDRA 1KTLB 1IBZA 4FERA 4NQEE 1AGEB 2K6ZA 2NTFA 3D51A 4KMTH 5DZLA 4YSEA 4IJ3B 4P2RA 4PJ5A 4XMPH 1GOGA 1NSNL 1XGYL 4L4TD 2IG2H 1DLHB 2RQ8A 4Y1AA 2GCYA 1SBBA 1PX3A 3HRPA 4M1CC 4EKXA 3FUHA 3V0GA 2O72A 4MDJB 1YG9A 4BRJA 3GXUB 3DUSA 3KPOB 5EIQA 2H1PH 2KH2B 3OMAB 1P84J 2GIMA 4YIQB 4YPGB 4DEPB 1DBKH 1HE7A 4I5BB 4AEHL 4MAUL 5E0QA 4HKXA 3EO0A 4IKLA 2KZKA 4GT7A 1LK2B 5FOBB 3P4NB 4NCDA 2XWEA 2R9HC 1UGKA 5KSAD 3IDNA 4BK5C 4Z76B 2NTSP 3U7WH 2DM2A 4Q9BA 5K9JH 4B9ZA 4YXLL 1OP3H 1ZCRA 3P4MB 4GUPA 3ET9F 3B3IA 2AJXH 3MU3A 1A6TB 2IWKA 3CDZB 4QTFA 4RISL 3RWEA 3ARBC 2YKLH 1CR9L 1SDDA 3MKKA 2IIJA 1ZEAH 2YAPA 4LLMA 4A04A 3OAYH 3NIFF 2ZUSA 4EUPB 3QI9D 1J8RA 2Z93B 3R4DA 1LXMA 4GRWE 1DUZA 4JL2A 2MEJB 2DMBA 3VFRB 3N50A 4JG1L 4KDWA 4UUJB 2DH3A 4XI5D 4WI9A 1Q0YL 5BNXD 1WWBX 4JFDD 1J1OL 1QSZA 2ED7A 4NZFA 5F3FA 2Q6WB 5L8LB 1VESA 3KPLB 1I85C 4FMVA 5KVGL 2F74B 1FFNA 5DEGB 3CFEA 5D1QD 3S6CA 4U2ZA 1JPTH 5I74B 3UL4A 3ZN6A 1NUFA 5BRPA 4PJXF 3S3DB 3CSGA 3D39E 3IBEA 5E9DB 1ACZA 2A6KB 1IL1A 2WXGA 4QJ4B 5I76A 2DJMA 4P5SA 4NIKB 3MLXL 2BY2A 1A9BA 1IAII 1WSST 2LTQC 3HE7A 3TJEL 3WTUA 5JW5B 5AUMB 3OKLB 3D9AL 1RZIA 3VX1A 3H9SD 4Y0GA 2X10A 2EDMA 2WVVB 5B1JA 4UM9B 4P9HH 5KYUB 4I8DA 3ILQD 3LVEA 3ZYZA 1TVDA 2VMDA 4JHWL 4NKQB 3OBAA 1AQMA 4I48A 5EOTA 5CEXB 1NC2A 4K9EH 2GSGB 2IMMA 1OE2A 3WNIA 1B2WH 4L8CB 3C5SA 1FL3B 4LEXL 3CFIC 4XVUC 4LK4A 3CSFA 4PJDF 4W9LC 2Q8BH 1WZKA 1XMWA 3M7FB 4X7TA 2E7LC 3AU1A 1IAMA 4HD9A 3T2NH 4QRUB 4UB0H 3VRLF 3Q8CA 2NX5E 3QFJB 1KCRL 5DDHB 3ULUL 2WBKA 2OCCB 4GRLA 2E27H 1OGAB 5HI3C 2PUQT 1HZHH 2DF3A 4BCXA 5LXGH 4UYPA 4KXZI 4GS7C 5I2IB 1PFOA 1AO7E 2J1WA 4M1GH 4U6XB 3UAJA 5L4JA 2VLJE 2YK1H 2OMNA 4JO4H 3CFQA 4OI8A 4KV5F 4WJ5B 5CUSL 4GBXA 1UT1A 3H9ZA 1PD1A 4N2AA 2BNQD 3UZEA 4HXAH 1NBVH 1M53A 1U36A 5D7EA 5AYUH 4LARL 4HJ1A 1HQ4B 4KXDA 3H56A 3L54A 4FX5A 3U30B 2HH0L 3QORD 3QJVB 4JPIB 3VQ2C 1HDMA 2AJYH 2XQYA 3Q2VA 1NCNA 1JNHB 1V05A 1INQB 3EOYG 2WYIA 4UT6L 5EEYA 4DPCX 2FYYA 4KNUA 1EHKB 4HALA 2QQNH 4ZJ9A 1J8HD 3BWAB 3IDJA 5IW3A 1F2XK 4PBWD 2FH8A 4M6OH 4NYLB 2FX7H 2W07B 1H8SA 1OIOA 2RCSH 1GKEA 4EQ2A 2QDWA 1G87A 1U2HA 3A23A 3MBED 4ODHL 1I85A 4HHWA 5CLZA 4B41A 1DJZA 2FO4B 1NFIA 1BYOA 1XZWA 2X1WL 4RX4A 2OP4H 5FWRA 3MBEB 2JCCE 1P4LB 3MQIA 1QSFE 4KDTC 1JV5A 1V8HA 1X5XA 3BPLC 1FORL 2RFXB 1ZS8A 4LEOB 3WHE1 2ZUQB 4R2GB 3DGGB 4GSQA 4ZUTA 4BGLA 1F86A 2C3VA 2NQDA 4HZ1A 1KLGA 1QQDA 3ZMEA 4EVNA 5M7QA 4OGAD 2R1XB 1EXHA 5EC1A 1RZPA 3L13A 5L4IA 1KUMA 4HS8H 4HZLB 2P5EE 1HH6B 2AQNA 2ATKB 3GSUB 3U2IA 1T1YA 1U92A 4AJVA 2XTLA 3GRWA 4RRPG 5E8NB 4NQED 2Y36H 2HYMA 1L7IH 3FOLA 2G9HB 4OGAC 1WHOA 1BBJB 3REVA 1G6RA 1BZ8A 1OALA 3HKZA 2WVTA 5E6IB 1L6ZA 5DJCA 2AKRA 3SGDI 5DJAA 2EE0A 1N70A 4NO5B 4H26A 1MIML 2M83A 4JO1H 4P2QB 2R29A 1FH2A 4B9PA 5AOLA 2HFGL 1YEDA 4IMLA 3F7YB 4OLUL 3DJZA 4O02H 1FAIH 1S8DB 3DV6B 4Z9KB 3RWGB 1D5MA 1TTRA 1TNNA 2VKXA 3EYOA 3LMJL 4Q7DA 5IEHA 5IB5B 1WFJA 3FFDA 5IHBA 4FHBD 2EUVA 2XC8A 2A2QT 1DN0A 1D5ZA 3S7GA 3HE6C 1Q38A 1VSCA 3NN8A 5T5FA 2K4WA 4HWZA 1IBHA 2ZUUA 1H3VA 1KCLA 2X38A 2BCMA 2GAZA 3R06A 1SGKA 1T3FB 1BBJA 4OZHE 3VXUD 1EQWA 1E42A 5E7BA 3KAAA 1CI5A 1JGDB 4AJYV 4H25A 1N10A 3TESA 2V7HA 2O61A 3BPLB 4OZFB 5L88L 4HZLA 4N0UE 2OXHA 4JO3H 5I9QC 1M1XB 2WN2A 5FKPB 7FABL 1AR1D 4V2CB 1AGDA 3WKQA 2J8UF 1HHIB 2DWTA 5E9DE 4TUKH 2MCPH 3JWNH 4WCYL 4X5PA 5ESVB 1P0SE 5HI5D 2D7TH 5FYLL 5C9JA 4YDVB 3WXVH 5HGAB 4Z3HA 3V0EA 2DL9A 2Q1EA 3AGVA 2GI7A 4X6FA 2WKOA 3FO2B 4W9EC 2ALAA 5B1JC 5JQ6H 4DW2L 4K3JL 4TM9A 2UX6A 4Z18A 2AXGA 3CGTA 4PGEA 2YEQA 1IAOB 1X9LA 4MLSA 5IVZA 3MTRA 2OA9A 1DQLH 4NYLA 2E4TA 4JFDB 3SPCA 1TTAA 3A6BL 3DBXB 3LH9A 4KK6C 4LOEA 4P8QA 3UJIH 3BAEH 2HRLA 3MRBB 4OM0L 5EC2B 5C07A 4MMXA 3RQ3A 4HLZH 3UGEA 3WO3B 2NY7L 4YSOA 4TLSA 3UBHA 1DBJL 1QLEL 2WKLA 2YD4A 2KDYA 3FAWA 1QW8A 4H8PA 5FYKH 4AQEB 1JF5A 1PSKH 3BKCH 4KKCD 1ET7A 4ZX3A 2B16A 1MFDH 1LILA 2EIJB 3DXAA 4H1LA 1WTGT 3ZO0A 1E9PB 1H3XA 2DQTL 4XH2B 3IBOA 5T3XD 5FHBL 3MN8A 5KSAB 1Q9OA 5FO8B 5GZNC 5I2IA 1Q9LB 2ZOLB 3FT0A 5DJXA 3BPNC 3KPNA 5SWZA 5GGQH 3WTVA 3H85A 5T5FL 1D5BA 2LFEA 2NCEA 1KGXA 5GS2H 4A37A 2HFFB 1AP2B 1DVFB 2AJXL 2C9SA 5AQ0A 3ARDD 2K70A 3VI4E 5DDHA 3D33A 4YAQB 2BP8B 1QABA 3BH8A 4JJ5B 5IROA 3R8QA 2NLJB 4OLYL 3TJPA 2VN4A 3BRDA 2AEPL 1BLNA 5E2TL 5FYKD 2B9AA 3SKMA 3ZL2A 1AYOA 4NZJA 4ZOBA 1HSBB 1ZVHA 1D9KB 1P2CB 1A4BA 1ONQB 5K9KB 2GSGA 5GS0D 1IFGA 1R3IH 4LPWA 3FNKA 1ERNA 5DS8B 4NLHA 4Y2DD 3DJRA 2Q86B 4JRWA 4APQA 1G6RL 5I6OA 5TF1L 5H94A 2AEQH 4O2CA 2GUOB 1PZDA 4M93C 1T6BX 4NAJA 1FPTH 3ETBJ 3D30A 4K07A 4KVCL 4DP4X 3QIBA 2E3VA 1EBAA 1R5WB 1EFXB 1FZKA 1HCVA 4I1RA 4YHNB 3F6JA 4XN4A 3HUJB 2WQUA 4H13C 3UMTA 4ANKA 5EHFA 5HHQA 2G2PA 2J88H 2X0UA 2ZOTA 3ZTNH 3STBA 2XTJB 5AB1A 4CW1B 3WKML 1B90A 3VD1A 2A6KA 3PABA 1FFOA 3MJ9A 1O75A 3SDXF 5FYLE 1CFSA 1QX1A 2P3YA 5CMAA 4W9FC 4PB0H 2WUBH 5F1KC 3GJFK 2DB8A 4HMEA 3ZYOA 2A0LD 4WV1B 2Z65C 1QP1A 2YN5A 2NRDA 3DPBB 1HXYA 2CGRL 4P2YA 3WELA 3DPBA 2H3XC 1BFSA 4M5SA 4CVZA 5EO1B 1QSFD 1NDGA 2DIAA 3AS0A 1KJVA 3G04B 5FM4A 1ZSDA 3U0WL 3WLWC 4W81A 3PABB 1UVQB 4TNGA 4XHQA 2AABH 1AAJA 1SHXA 3Q8EA 4JM4L 4BFGA 3ZUNC 3OHXA 3CC5B 4G5ZH 2QV2A 5B3JE 1A6WL 3GMMA 2L7EA 2E8YA 2VLRE 2NYYC 3QG7H 4P59H 4LGRB 2MTPA 4U7MA 5D7LE 4G83A 4ZOAA 2MOVA 3HFFA 2E6QA 3NFPA 4YGVA 4ZSOB 2R0KL 2IAND 4HKJA 1J9QA 2RBLA 2CGZA 4RH4A 3FUEA 3KYOB 1MNUH 5EO9B 4LAJH 2IH3A 5D8JH 1L6PA 1QKZL 4MA1C 5I5MA 3MNZA 5CZVH 4Z7OE 2V5TA 5I19L 5I1HL 4K9EC 3B9DA 4ERSL 2AI0H 2Q3AA 1KB3A 4OZIF 2A9AA 3FTXA 5C0EA 3ZSSA 4Y19A 3UTSB 2P48B 5HVHB 3WAJA 3B9KA 3UTPD 1A6VL 4NEHB 5CINH 4RETB 5DZAA 4YSSA 1A6PA 2I27N 4XMZA 2NY0B 3ECBB 2FVNA 1MAMH 2ZAHA 4JRXE 1RJZB 2WYZA 2R2CA 4P23C 3IDXH 4HLJA 5E2UL 2VMFA 5F1NA 3MXWL 2VR3A 1WGVA 3VXSA 1AG6A 1UWXH 5ITBL 1AHWC 4UQIM 2Z1PA 3B2PA 3ATFA 4H20L 4Y1TA 5JLZB 4HKZA 4UIKH 1B4TA 4M8UA 4D9QE 2IC2A 4XCYA 1ZLSH 3ZE2F 2ADYA 4ZO9A 1FF5A 3ULVH 2P7TA 1NM9A 4LPTA 3MZTA 3NAAL 4AQEA 4Z77B 4OFDA 2VE6B 5CHNA 2ZAIA 2DQJL 2Y3NA 2VQUA 2DWYA 3EJTA 5EBLA 1N18A 4HS3A 2HT4C 3H3BC 3JWOH 5C07B 1J87A 1NL0H 4C47A 4UTAL 1MH5A 4M6NL 3MA7A 4XCCL 3U1SL 2VDML 3HBPA 4R4FL 2QZ5A 3SE9H 4QTIH 5A2KH 3E2HC 4BH8A 1ACCA 1AQDB 3H42L 3PWVB 3O2WH 3II3A 4CGUB 1R3LB 2A74C 2VMEA 3HBZA 5LNGA 2FIRT 4JBSA 4YHMH 4X4XA 3EBIA 3M8OL 1I9JL 4PRDA 2HWZH 4QKXB 1MFBL 4U0RB 3DOHA 3G5XB 1QOKA 4O9HL 3EJZC 4LIQL 5FUCC 5DJDB 3RWCA 5I1HH 4TN9A 5CZKA 3ZJAA 5TDPB 2NY6D 2EDHA 4H8HA 5G2NA 4N0UB 4ZMXA 3UTTB 5KW9L 2V5YA 2RJMA 4IRJC 4JY4A 4XNYL 4QGTA 2QHLA 1T0PB 3PNRB 1QNZH 1FG9C 3CFUA 1TETH 2NUPA 2PNDA 4U1NA 3MRRA 3IDMB 3U6RA 3WJLA 3PJLA 1THAA 4ZW5A 1PZSA 3JVGC 1YECL 4PJCF 1L9RA 1SJEA 3J2PA 4I18A 3SDYH 4KI1A 2BP8A 1AHWA 2YEZA 3FKUS 3PWPE 4CN6A 2YOCA 4R4BA 2F7RA 2EDQA 3UTSE 3WCYA 1HJBC 4HWBA 5AW7B 5FPIA 1L9TA 4QRFA 5I1AA 3BWZA 3QNZB 3ZL1A 2JFCA 3BVUA 1E40A 1MELA 3FYEB 3KPNB 4RZKA 3R1GH 4NP4L 5SWZB 1OT4A 4OQTA 2H1XA 5FO8A 3QC6X 5EN2B 5AAMA 3UZVA 1DVQA 4QIRA 2W65B 4BINA 4GO9A 5FO2A 1HT6A 1TVHB 1NIDA 1NBZB 1PNCA 4PLJD 4B9FA 5I1GH 1MI5D 5JHAA 1R0AL 1SOQA 3MLSH 4GYBA 5CN3A 1V55B 4EUPH 4NQVA 4E41E 4CVXA 1YPZA 4XCCH 1TYJA 4JKMA 3CVIL 4PWIA 3RURA 3I9IA 4DGYL 2DLTA 3TVMA 3EAKA 3FQRA 3OGCB 4ANWA 2VDMB 4PRNB 1R1CA 1ZHKA 3MV7E 3N85L 3GFUA 3NK4A 4ONGH 4FMFA 1FUNA 1Q72L 3C12A 4OV6F 1B0RB 2CIIA 5E8NA 5D7JB 3ZDZE 4FA7B 2XX1A 1JGIA 2ID5A 2PXYD 1R17A 4D3CL 1CDYA 1OSPL 4AGOA 3UZQB 1ZDSA 4FZEH 4OW6A 3T77A 4F57L 2NMSA 3KLSA 4JFED 3T71A 4GMTL 3FO2A 4XPHH 4DAGL 1II4E 5KZCD 1EGJL 5IB3B 2JB6A 1EHLH 4ZUTB 3DGGA 3T0VA 3U25A 4EEEA 3WFDH 3JZYA 4LCIH 5ADOL 4NFBA 1QFOA 1U95A 1XMEB 2X42A 3LAFA 1OAZL 3RIAK 1YLBB 3GSOB 4X9BA 3BP4A 4XC3H 2BZCA 3VJ6A 1MHHA 1A5FL 1J0ZA 2D3NA 4IHBA 3W9DB 4OT1L 1KWGA 2HT4D 2CA4A 2YO3A 3MFFA 4L8BA 4ZSOE 5FW8A 5IMLB 3K6OA 5F0JB 4IDJL 1DQKA 2X2UA 4GLRH 2IAMA 2EQDA 3H1ZA 4YR6A 4KQ4L 4ZMOA 4G8GE 5F7EL 3OF6A 1FNFA 4HCRA 1T3FA 1PG7W 5IY5B 4L4JA 4OI7A 1S3KL 4PLKC 2VQ1A 4XAWL 1JNHA 5ACZB 4WWOA 1HXKA 4Z5RB 3GXIA 2HG5B 2ZOWA 4U1MA 3MCLH 4KJPD 4M8RA 3MRIA 2QBWA 2XFXA 4XZUB 4QNPE 4I7ZC 3LKSB 5I66B 1CD9B 1ACXA 2HRPH 5KOVC 3KCWA 3N85H 5JPNC 1L0QA 1ZLUH 3QRGH 3WNOA 1CBVH 3L1EA 2ZXAA 4IBYA 4PBVC 4NO5A 3S8GB 4N0FA 5LN4A 6CGTA 2GIXA 3IMRA 2CBQA 5BS0B 5E6IA 4NKIL 3JTTA 4FA8A 4J8QA 2J1ZA 5IBTL 2BP0B 2EC8A 4ZUUA 4Y2OA 1ZLVK 5BS0D 4OD2B 4NPYA 2J2ZA 4ONHB 4NHUA 2NDFA 4ACTA 3KPQB 3EGDA 1DCLA 2E7CA 4L4TA 4PTTB 4XPTL 3FAXA 1T7VA 4PRBB 3LXUX 5HDOA 5FUCE 1GAFH 4AUYA 2W0FB 3IJ8A 1KY7A 4MS8D 5E0FA 2PLTA 2C7UB 4GJTB 3WJJA 2E9WA 3MVSA 4O02B 4PVLA 1MXGA 1TZ8A 5CP3H 1JV5B 2WPGA 4LEOA 3KD4A 3TO2B 1P4LA 3CH1A 4ZD3L 1P5UB 4G7RB 3T8XB 4WKXA 4UDUA 3WXVL 5K69A 3CZEA 1EK3A 1HI6A 2RB8A 3RUGB 4JQIL 4XN5A 3ARDB 3QJTB 1BQ5A 5I74C 4Z8FL 3EDKA 5FYKU 4MMXC 4NQEA 4O4YL 2PWFA 1H5BC 2PTUA 3G5YA 1OW0C 4HJJL 3TBTB 4LVHC 5I19H 1S9YA 2DQ6A 1WV7T 4IBZA 4S1DD 3PAVA 1NANH 1A9EB 3LVTA 1T5WA 2C4FU 5JPMC 2PW1A 4E0RB 5LG1A 4G6JH 1BZ9B 5CXPA 1QKZH 3CFDA 1HOEA 2CZNA 3RHWF 5FGSA 4LSPL 2PR4H 1Q9KA 5IMOA 4WU5B 1O9ZA 1FRGH 3UJTH 4FFZL 3VQLA 4P48A 1UM5H 5D2NC 4Q52A 4ENZA 1BJ1J 4QYOB 2Z1KA 3HN3A 1C5DB 1Y6KR 4JRFA 4M48H 2FWSA 1T21A 2D0FA 3VB8A 3TNNB 3P4MA 12E8H 2R69H 4HIXH 3QH3A 4FQ2H 2BWDA 4P5RA 2NY3D 2XN9E 3OR7A 1YVLA 3RVWD 1NEZA 2VH5L 3FUFA 3NAAH 1XF1A 2LU4A 4NJAH 4PWEA 1ECYA 3IDNB 3J7HA 4LNRA 5GHWH 5FO7A 5L0QB 4KKNA 3V95A 5HHOE 2JJSA 2ZCZA 5D1QE 2MRYA 5I73C 3GIZH 4Y5XA 1FL3A 3NACL 4GRWB 4YPGA 4F1SA 1ZE3H 5T3ZE 3CAFA 5CU5A 1IEBA 4BXSV 5F70A 1WFOA 1OARH 1VEOA 4HEPG 5IEKB 2H1PL 3OG6B 1JFQH 3P2BA 1CYXA 4FTDA 3UAJD 1NSNH 2F54E 2K4AA 2BHFA 1AXSA 3B5TA 4ZS6D 1HHGA 4X98B 4LO9A 2Y7QB 5A2CA 1BLIA 4JRYA 2EINB 3VGAC 5DEZA 1E4XL 3I3EA 3KYNB 4TSAH 2VWEE 3HRZB 3KL5A 2VXVL 1CLCA 1GGIH 4QY8B 3L17A 3VFOB 4HOZA 4QF1A 5D2LB 1AR1B 3EBAA 5DTFB 1QWNA 2UWEA 3FL7A 3KWWB 4AQ8C 4HIIB 5D6CA 5J89A 3CSTA 3EYQD 2X6VA 4BUQA 4YPJA 3SKOA 5LGYA 1KFAH 3L1FA 2WTOA 3VWKA 3V5KB 1XIWA 4GFXA 4HV8A 1DO5A 5HD8D 1P5UA 3WUZA 1A25A 3IMBA 4XVJH 2Q6WA 4X6DB 4G9FE 5IQ7H 4JGJA 4KOCA 4HXBH 2DYPB 2OZ4A 2AQ1A 3MMEB 4CMHB 4K3DL 3V79C 3V5DB 5GS0C 3ARBA 4PG2A 4IDLA 3NTCH 1X44A 3NEXA 5D6DC 5CGYD 2XIIA 1MWOA 3U0PB 4B9IA 1A6TA 2AJZA 3QQXA 1ZA6A 2F8IA 3TA3B 3ZE2B 1KB9K 2IAAC 1C5CL 5JUEH 2D31A 1JK8B 2DLIA 4ONHA 1BD2D 5CFAA 3B6SA 5AVSB 2B14A 4MDRA 3EGSA 3U46A 3NZSA 3BUYB 2WLMA 4TVPL 5IKCA 1KLUA 4BWWA 2W94A 3D9AH 4F9LC 2PTTB 3MR9A 1IT9L 3MACL 4DP9X 1WZMA 3EO0B 4N6QA 1G7IB 5DRNA 1JVLA 3BDYH 4F9PA 4OLZH 1TT6A 2BY1A 4KXCA 4UQ3A 4OLUH 1NPNA 1DLFH 2NZ9D 2HRHA 3MLXH 3P3YA 4ISVA 4WI6A 1QSEB 3DUSB 2DI8A 4M61B 4LKXA 4R5TA 5IW6A 1N3NB 5CSZB 1A3RL 5ANMB 1K4CA 4ERSH 4S0TD 2DIJA 3MUY1 4G6MH 3U7YH 3X14A 4PJFB 4TKWA 5CEYB 2E9GA 2GUYA 3H9SE 4UOJA 3VFMA 5DJ6B 1CL7I 2P80D 2QGEA 2IANA 5F72S 4P2RB 4PJ5B 3RY4A 3GPEA 3HNVH 1SXSA 1WFIA 3OSKA 4OVUA 3GZQA 4TNEA 3A0OA 1JI2A 4TF4A 3NCYS 3FRPB 2AITA 4JQIA 4YR6B 2OK0L 1ECZA 2X6BA 1BAWA 1JZJA 2BNUB 1SYSB 1PZ5B 4GEJA 1IUZA 3RI5F 1FI8C 3U6XA 3S4SB 1OAUH 2HX8A 2IPTL 1VF5C 2GI0A 2H47C 3F12A 4OCRL 4DESA 4F37F 4CVWA 4QT5A 2FYVA 3BFWA 3S36X 3QZPA 5LJYH 1DVTA 1LO0H 3ELAT 2Q0ZX 3BD5A 1P1VA 3V6BR 4PV9B 4A1RA 1JWMA 1XB6A 4AENB 4JKKA 1JZHA 4Y7OC 2A6IB 5T1KA 3WFCL 4HJUA 3EFDH 4DOHE 2JB6B 4ACPA 2CQVA 3ZDYE 3FB6B 5DVLA 4A39A 3VM5A 3RAJH 1SOSA 3I6LE 4ZMWA 3D05A 4WW2A 3VWJB 5CIPB 3PPEA 2FX8L 2KQNA 1L5GA 3N6YA 4YHML 4HIJA 2VLLB 4V1DA 2BSRB 1MJJA 2BVPA 4HK3N 2AK4B 4AM0Q 2PYEA 3ILEA 3D08A 3MJ8B 4BRVA 3TVMB 5KTEL 3PNWA 1I8LC 2ZUXA 1Z0NA 3LIUA 4CU7A 1QI5A 3BQUC 3L7EA 4RGNB 4EN2A 4DP0X 43C9B 1TKWA 5FC9A 1NCAL 1CGSH 4NBXB 2GVYA 2J72A 2CUAA 5JIPA 4YDZA 1CDHA 3ZZSA 4GAGL 3KLAB 3IJHB 5E2VL 2P8MB 2WNGA 3BIBX 2PMZA 3NOIA 2EO7A 1GZHC 3O2DA 2A1WL 3SQRA 5I1AB 3WJLC 3L3HB 3O6FA 5E9DD 1FORH 1ZT1B 3QZLA 5ERWA 1DVFC 4B0MM 5A6IA 4L37B 1N26A 4H0LC 3S2CA 5F7WC 2WLIA 5DMKB 4P49A 1O6TA 2E86A 2OL3H 2WQRA 4Y5VA 3ALXA 5C0AB 3QCVL 2W38A 2NNAA 1GSKA 4PWJA 4L3EA 3H9HA 4L5FH 5MP6H 2WXIA 3MLVH 1MVUB 5I1IH 1VADA 2W9EH 3QAQA 4F37K 1I3VA 3UADA 3PWPA 3I9PA 2Y07H 4WEUD 3I6KA 4LHUG 4PJAF 3MOBL 1ZK9A 2IGFH 1C8QA 3W38A 4JFEA 4X0KB 4NQXB 5DJDA 3RWCB 4H8VA 5IVXA 2ICEA 5KJ4A 3GMNB 2AV7A 4RA3A 2DBJA 4JHAL 3EYFB 3F65A 4QLRA 2LLNA 1AQKH 3WEXA 4JDZB 2F8VA 3TVMC 2WSDA 1PJ9A 1XL4A 3FSZA 1JF6A 2AEOA 2DYRB 3KNBA 2K7PA 3MRJB 4HGMA 1XF3B 4LIQE 4A2MA 2VT0A 1ZDQA 4DNLA 2DZEA 3NGBB 4MD0B 2Z35B 5AOIA 3KWVA 1KLFA 4NAMA 5DGQA 3K80A 4P2OD 4Z77A 3DTUB 4I0CC 3FU8A 2H0EA 4QR7A 1UATA 3S96A 3S37H 4XCYB 4PRPE 2WVSA 2VDRH 1FQ9C 4RAUA 4PG2C 4Y19D 1NMBL 4HWNA 4MA3B 1U6AH 5J0BA 3PLYA 4OJFH 3UAAA 2JJTA 5BRZE 1YUKB 2ADIB 5I1LB 1QBML 4G8IA 4ICWA 4E9TA 4K2UL 5B3NA 4N0YL 4NO2A 5L8KB 3WKPA 4FFVC 1QBLL 4XODA 1OAKL 5DQDH 1A64A 2IDQA 4LAQL 3DV4B 3ELQA 3GEFA 3QNYB 4PS4H 3D3VD 2VXUL 5CJOL 2NX5A 3RUGF 1XH2A 4J3OH 2ZF9A 3D2UB 1LM8V 4TLKA 5HYJD 1NAKL 5KYWA 4FFYA 5E4OA 3S36H 4Q14A 1UD3A 4MBRA 1S7TA 2CJUL 4TNVK 1UFGA 2D9CA 3O4LB 1RUAH 1P1ZB 2CO6B 3QP3A 3OF6D 3SGEI 1AQKL 5BQDA 3TN0C 4AMWA 3LZQA 1DSWA 5HYIA 1E4WH 3QS3A 5EU3B 1UM4H 3CZNA 3O11B 2ED8A 4LVOB 1CLOH 1SM3H 4E2OA 3DX1A 1QHQA 3KLQA 1QLEH 1ZHNB 3GHEH 1H15A 4HH9A 1S4IA 5FYKL 2O93L 1PSKL 4QOKE 2BS9A 4FYTA 3RTQB 4HPHA 2ZCKL 2MWCA 3U4EA 5GS0L 3L08A 2YRLA 1DVXA 5EV7A 1KFAL 1F11A 2XNAB 3IT8D 1YZZA 4Z7QF 3QZWB 4EN3D 1KCRH 3EFFA 4H8QA 4G8GB 4UAOB 1W91A 3OVUB 3L1OH 4M7KL 2H32H 1JPST 3SDCA 2K45A 2F8XC 2WQSA 1ZSDB 3QJHA 5ACLA 4G3YL 2UYLA 4HH9B 4PW3A 2VLMD 3PWJA 4Z7AA 3UTQA 3JSSA 4KK6D 1HCYA 2Y1VA 3C75A 4YHKL 5C0BD 2R2BB 3VXSD 4LAQH 5GS1B 5TE6L 2E4FA 1V5JA 4R26L 4X6CA 3LN5B 3K72A 3WFEL 1USQA 1T2XA 4P2AA 1H5BB 2XBTA 3IFPB 3MNDA 4OFIA 3UTZA 2UWEF 2BO0A 4PR5B 5SWZE 1GCYA 1U8KB 4GP8B 2X1OA 3I6GB 1QATA 4PYHA 3HAEH 3KPRD 1AMXA 4KI5F 1LGVA 3QUYA 3KYKL 2CJ3A 3TCLA 1MHPH 1JPFA 2FJUB 5LXVA 4LVNC 1T7XA 3HJEA 4FJZA 1KFGA 2CLVB 1OW0A 4M6OL 1J0IA 1XGPB 1WPCA 3NFSH 3NIFE 3IRPX 5EIVA 3HG1A 1HU8A 5D2LF 1E2ZA 1QYGL 3VD3A 4DERA 3F84A 5IBLD 1MPAL 4NZ8A 1CLOL 2COQA 1IV8A 2GSIB 4FXKC 1CT8A 2DYSB 5DEFA 5HDBE 3VXQA 4KVNL 1P2CA 1XH1A 2CGRH 3NH7L 3VRJA 4BUHA 3W37A 1GJIA 4NWTH 1NUGA 1OAQL 2VDNH 2A7BA 3BKYL 1I1CA 3RA7H 2JJWA 1IU1A 2VDKB 1D7CA 2OV0A 2OR7A 2EAEA 3G6DL 2FATH 4FRWA 2VWEC 4UAOC 1QHOA 2H2SC 2R59A 3RKDC 1HIMH 3BGFC 4OUUA 1GYWA 5D4IA 3FH8A 2JIXD 1R19A 3ULAB 4MD0A 1UH4A 2AP2A 4ZOEA 1XVSA 1OAUL 1Q9LA 4MD4B 2BSSB 2HVJB 2XXMB 3OMIB 3ES6A 4QYAA 4YVNA 3AVEA 4FQCL 2ZG2A 2BCKA 4BSJA 3V0FA 1BX2A 2C1PA 3HS8A 2V6HA 3WV0A 2X4RA 4RAVA 1H19A 1X7TA 1DZ0A 4OGZA 1X5KA 3Q2NA 4GW4B 2MCAA 2R51A 3EJRA 3KXFA 5JQ6L 5IVXB 3MGOA 4JCMA 2AJ3B 1UJ3C 5AW6B 3MREB 3QPQC 3C5ZA 1KIQB 4IU3B 1KEMH 2FLMA 4XOAA 4ADJA 4NRXA 1ZD6A 2OMXA 3W81A 1KCBA 3QXDA 3ZDXB 1PS3A 2L7JA 3VFSB 4J2XA 2OMBA 2FRGP 4NERA 4GH7B 1DVSA 1SQ2N 2MJWA 2XQBL 3NFSL 4HWUA 3DURA 3QPXL 4RSYA 3OC8A 4I9XA 2KLSA 2RH0A 5KYNA 5EUOE 2WV3A 3SGJC 3O2DH 4N1CA 1S7XB 2ARWA 3WS6C 4PJCE 1TEYA 2HKFH 4WEEA 2MH4A 1H9DA 3O6FB 4OCWH 4I88A 4DGIH 3KR3L 2DQTH 3WL9B 1EAPB 4K23H 1DHKA 3DROA 4S1QH 2XY1A 1OPOA 1JV2A 1ANUA 1HAWA 3MV9D 4MX7B 3MRFB 4X42A 2YBRA 3S88L 2OYLA 3QDMA 4JM0A 3VXTA 1V10A 2JB5H 1FNGA 2CU9A 2NY2D 4EJ1C 2XWJA 3UACA 4V11A 1NEZG 3U9UB 1MEXL 1M7UA 3MLVL 5DVKA 4H25B 2G0KA 3IFLH 4CN4A 1OE3A 1IBBA 1L9PA 2IDTA 4FE9A 4QRSA 4HX1A 5CUSH 1G1KA 2B4CL 4RSVA 5AVVB 4XGZA 4Y1SA 2XZQH 2AJSH 5CSGA 5SX4I 4JZOA 3WN5A 4HWZB 4XTRC 1FZOB 2NOYA 3KH3A 4XE0A 1UJ3B 5KS9E 3GTVA 3IU3B 4KMQA 2CK0L 1RPUA 4K3EH 2MSPA 4KRLB 5LKNA 5AAWC 1J5IA 4UQ9A 1EJFA