1OO2A

Crystal structure of transthyretin from sparus aurata
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
RCPLMVKILDAVKGTPAGSVALKVSQKTADGGWTQIATGVTDATGEIHNLITEQQFPAGVYRVEFDTKAYWTNQGSTPFHEVAEVVFDAHPEGHGHYTLALLLSPFSYTTTAVVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords transthyretin
publication title Distinctive binding and structural properties of piscine transthyretin.
pubmed doi rcsb
source organism Sparus aurata
total genus 25
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1oo2A00
1BMZA 2ROYA 3I9PA 3Q1EA 4ACTA 4AC2A 2G9KA 3CBRA 1FH2A 1DVUA 1SOQA 1TTCA 2TRHA 3ESPA 1DVQA 2PABA 4AC4A 3DJZA 2G2NA 1KGIA 3ESNA 3A4FA 1ETA1 2TRYA 5AYTA 3BT0A 3IMVA 5L4JA 4ABQA 5AL0A 5TTRA 5E23A 3DO4A 1TSHA 1QABA 3CXFA 2B14A 5EN3A 4I85A 5CR1A 1SN5A 2WQAA 2H0FA 3P3SA 4Y9EA 5CM1A 4HISA 4TQPA 5AKTA 3M1OA 4QYAA 3IWVA 4N87A 1SN0A 2G3ZA 2G4EA 4Y9FA 4DEUA 5L4MA 2FBRA 3P3UA 1Y1DA 3DIDA 3IMSA 3ESOA 1RLBA 4PVMA 3TCTA 1E3FA 4PMEA 4PWFA 4TL5A 3NEXA 5CLXA 2F8IA 5IHHA 3QVAA 4TKWA 1KGJA 3DGDA 3IPBA 3D2TA 3CFTA 4FI6A 4PVLA 1X7SA 5AKSA 3SSGA 1ZCRA 1U21A 4PWIA 1DVZA 2IGLA 3IMTA 4TLSA 4PWEA 1TTAA 3CFQA 3IMRA 3NG5A 3OZKA 4PVNA 5HJGA 2QGBA 4DERA 2QGDA 3GS0A 4IIZA 4PWJA 2B16A 1SOKA 4HJSA 3FCBA 3IPEA 3KGUA 3CN0A 4Q14A 1Z7JA 4ABUA 3B56A 4FI7A 4IK6A 4IKJA 5L4IA 3D7PA 1DVSA 3P3TA 3DK2A 2F7IA 4YDNA 3DJRA 3GRBA 3IWUA 2G5UA 4TLKA 3A4EA 4Y9BA 2QGCA 3A4DA 1IIIA 1F41A 2GABA 3CFMA 4PWGA 4PWKA 5E4OA 5JIDA 1GKEA 1BM7A 1DVYA 3FC8A 3KGSA 3NEEA 5EZPA 3CN4A 1FHNA 3CN3A 3U2IA 3U2JA 3GPSA 1IIKA 1THCA 4TLUA 1ICTA 3IMUA 4ABVA 4TQHA 4TLTA 3CN1A 4HJUA 2NOYA 5FO2A 1TZ8A 2B9AA 2QGEA 3GS7A 3I9IA 5E4AA 3GRGA 1OO2A 4N85A 4ANKA 4QXVA 2H6UA 5CN3A 1E5AA 1BZDA 4FI8A 5CNHA 5AL8A 1IJNA 2G2PA 5L4FA 1DVTA 4Y9GA 1BZ8A 3I9AA 4QRFA 4DETA 5FW7A 2ROXA 2B77A 3W3BA 4TNEA 1DVXA 4TL4A 4D7BA 5A6IA 3NESA 4HIQA 4PMFA 4TM9A 4DESA 1G1OA 1GKOA 4Y9CA 3DJTA 3IMWA 1X7TA 3CN2A 4IKLA 4KY2A 4IK7A 4N86A 5CLZA 3DJSA 3TFBA 4TNFA 4DEWA 1ETB1 4L1TA 4TQIA 4MRBA 4IKKA 4WO0A 2G3XA 4ABWA 2B15A 1E4HA 4TQ8A 2FLMA 5JIQA 4WNSA 3KGTA 1SN2A 1TLMA 3CFNA 3OZLA 4HJTA 4MRCA 4YDMA 5BOJA 5JIMA 1BZEA 1TYRA 3GLZA 1THAA 2H4EA 5DEJA 2H1XA 5K1NA 1QWHA 2QPFA 4I89A 3BSZA 2H0JA 3P3RA 1F86A 5K1JA 5CLYA 1TTRA 4TNGA 1TFPA 1IE4A 4PM1A 2GPZA 3NEOA 4I87A 3DK0A 3HJ0A 2G4GA 5FW8A 4IKIA 2QELA 4L1SA 4WNJA 5FW6A 3GS4A 5DWPA 1ZD6A 1TT6A 2H0EA 4PWHA 1TTBA 5AKVA 4MASA
chains in the Genus database with same CATH superfamily
2GK2A 4LLYB 3RDTD 4XI5C 3LSOA 1OP5H 4IDJH 5EZLB 4XNUL 2HT3C 5ICYA 3GO1H 3P0VH 2W95A 1JVLA 1P1VA 2BDNL 2L04A 2YPLB 2GC7C 2HPTA 4DOHB 5KVEL 3PAYA 4LPWA 3WDIA 1FBIH 1CG9B 2O6DA 4D7PA 3LB6D 3WTVA 2G3ZA 3BPLC 3BWUF 2Q8AH 4D2NA 3WHXB 2LTQC 3DIDA 3WKYA 1FFPA 1LMIA 4YS4A 2AQ2A 2W91A 4GMTH 4KRMB 1UTDA 1I9JL 1TSRA 5I1GL 3FQXB 3T8XB 4X5XB 3OBAA 4TSCH 3EG9A 1FGNL 1WS8A 1VFAB 5F9OH 2Y7LA 3WCYA 2HTKD 1JYXA 2VDRL 1Z2KA 5LBGA 3ZT6A 2OULB 1ILUA 3NG5A 3H42L 2AGJH 1XGPB 2NMSA 1UYWH 2P80A 3EH5B 5ETUB 2GTQA 5F21B 4OKDA 4HEMA 2ORBL 1YMMA 5ILTL 4XNYH 1FI8C 3JYCA 2Q86B 1M9WA 1GXEA 5CSGA 5DLML 1QRNE 1YUHB 1XCTA 3S5LG 4GMSH 1IT9H 3MBWA 1SRDA 1MAKA 1A7QH 1HCYA 2BSEA 3CXDH 1OSPL 4RQQB 5I8EA 5EC2A 5AW7B 3QDGE 3ARFA 3WTXA 3GTTA 3ZVVA 2YUVA 1G6RA 2LFGA 3CVCA 4YHLL 3EJUA 1F90L 1D9KB 1RLWA 4MDJB 2LU3A 2VRAA 4X9GA 3PP4L 4FABL 2QQLH 5CBEA 5ES4B 3MV9E 2WKLA 3WY1A 9PCYA 2DIJA 1WBYB 1RSFA 3MNVB 4TNEA 3S35H 4AK1A 4EMZA 2E7LA 1GYAA 3HN3A 3P0YH 2YAQA 3EUUA 4HFWA 1MLCA 4O9HH 3ASNB 3HAEG 2ATAA 5EO0A 4PJAA 2PP9A 3HE6B 3WXVH 1KBPA 1AQKH 2JLPA 1YECL 1FVEB 4OFKA 2BHUA 2XN9B 1FZOA 2NY3B 3O9WD 4J3OH 4OKVA 4PJGA 4QXUL 4JKLA 3DVGB 5ITBL 2XWRA 1UZ8A 4B96A 2CD0A 4GFTB 4DZ8B 4WWNA 1DBMH 3HPLB 4X4ZA 3QIWA 1U30A 1YJDC 1OM9A 3AM8A 3IYLW 4K2UH 4CSZA 2CNYA 4WI0A 2K4WA 4H88H 3DOSA 4EN2A 2WWMC 4NZDA 5T1DL 4ODBD 5EH1A 4DKAA 4ZMPA 4YIQB 3FRPG 1OGAB 1MXDA 2EIZB 5LWYH 2ZOLA 4RRPM 2I26N 1NEZG 5IQ9A 3LXUX 1KG0A 3L1OH 3K3QA 5E1AA 3R7RA 4ORZC 3IMVA 1FHGA 5CCHE 3LZQA 2FD6H 1UB6B 3IDYB 1JNHB 2BERA 1AP2B 1IKFL 2PCPA 4IOSA 3BISA 1R5IA 4X80L 2H6PA 1N12A 4HUXA 2FAUA 4H0LC 2WXPA 4HIIB 1I9RL 3OKYA 4OGYL 4Y4HC 3ZDXE 4KROC 2BFVH 1T0OA 3RFRA 4UT6L 2VLKD 1CIUA 2XPZA 2E7LC 2ICWI 2QVKA 2Z1KA 2ZIDA 5TE7L 3BD3A 3PGFL 2DM2A 1S3KH 4P59L 2E0PA 3LQZA 5CEYB 5I0VA 5KYYB 1KN2L 4NP9A 2FSEA 5IG7A 4HIEB 1K5WA 4PFEA 4MNQE 5HJBA 3CBJB 4FQPA 4OTXL 4OLEA 1A1NA 4A7UA 3FF7A 1RZFL 5F1NA 3OPUA 1Q90A 4Z3GA 2VH5L 2D7TH 3SQOL 3QEHB 2E7MA 3VXTB 2Z7ZA 1M2VB 3L3KB 4KKLC 4PUBL 2VXUL 3RWJA 4KNQA 1NLDH 4ORGB 1DBJL 4IKJA 1DQDH 5TQ0L 5L2KB 1SJXA 1XBRA 3KR3L 1U3NA 3AQZA 4J8RA 1TU2B 4KGLA 2B9BA 1OK8A 2Q1EA 1BEYL 4QHLA 3X11A 5L2JB 1QQDB 2FYVA 2NY6D 1ICTA 1LE9A 4KRPC 4ANVA 3L4YA 3HZKA 3MKKA 2A9DA 4LB8A 2ADGB 5KJRL 4X6BA 5IBTH 2IFGA 2AITA 3KPMB 3BZFA 4OAWB 4HIJA 3SYAA 5AL8A 1IJNA 1E43A 2FGWH 4M61A 3QEQD 3RI5F 4WK2B 4LARH 4UAOB 1Y0LB 3ET9F 1V05A 1U36A 3HG4A 2R4SL 3O2DH 3Q9QA 4K94L 3BJLA 4CC0A 4TL4A 3FO1B 4XNMB 3VD1A 4IJ3B 2HRLA 1GKOA 5C0AB 4FD0A 1IAKA 4X0KB 3LPGA 3DUUA 4XX1G 1EVTC 5FHAH 1DBKL 3W82A 2VRKA 4BFIA 3SKUD 5F7HA 4CADA 2X4TB 5BVPL 4KVCL 5ACMA 3CH1B 4JFWA 2AJZA 2FGZA 3E7JA 5F9AC 1AHMA 3ILQC 2MSPA 3KGTA 4TUKH 1BXAA 1RPKA 3WO3B 4HEME 1THAA 4NM4L 1NLBH 1E50A 1XMEB 5K1JA 4KBPA 3V0VB 5KBNC 1QRKA 2DMGA 3IJHB 1E3ZA 1I7TA 2YD2A 1JPFB 3PP3K 2JI3A 3D85A 3MNWB 1WCQA 4NT6B 2ZP8A 3UZEA 2AJYH 3E0GA 3H6AA 3SYQA 3GZKA 3WHE1 4IRZL 3T0DA 1BBDL 2DH3A 1R3JB 4AEIH 5CEZE 2NYYD 3ESNA 1YSOA 3SOTA 3QNXB 2D7MA 3F85A 3LEYH 1LO2L 3HRZB 1NCIA 5EN3A 1MFNA 3ZDYE 3V0HA 4HUCA 5HYIA 3MRRB 5EC1B 4KQ3H 5B3SB 3BRFA 1UACL 3F5WB 3IWVA 3QH3A 4MQ7A 4PJAE 3GMPA 3MXVH 1O5PA 3PWLB 4PJGE 3V7MA 3HI5H 4Y7OC 3BQVA 4IRJA 1ZLWH 4F58L 2YGNA 3LH8A 3GSRA 1WS7A 3FJTA 3FKUS 2Q0ZX 4ALAH 4D0DB 4HU8A 5FDYA 3EO1A 4F92B 1T2XA 5ID1B 4GRMA 4KKZA 5IQMA 1J9CT 3RVWC 1JVOA 3EYSH 3ATBA 3U0TA 4BE5A 1RZGA 2Y06H 4FN0A 1IQWL 3V4UL 2GBVA 4LDLB 1SJHB 1UXWB 4BH7B 3DX6B 3VDAA 8PAZA 1U58B 4KHTL 5IBUG 3RWHB 1CYGA 3UG4A 1Q1PA 3IDIB 5DURB 3UZEC 1NGZA 4MCYA 1HL8A 1T6BX 2JKSA 3V52L 3IXTA 1GHFL 4MSWB 4A7TA 1M2OA 4ZO7A 1J5HA 2Q76A 1ZLUH 4PJ8D 1MCFA 1E7VA 3ECVA 2IJ0C 4ZMNA 2APSA 3X1EA 1DQKA 1H3GA 3Q48A 5CS7A 3P0GB 5A2AA 5I1AB 3WIIH 1IQDA 3H9ZA 4NN6B 4QXTB 4YXHL 4LFHG 1KDIA 3OKKA 3VD5A 1S4IA 3VH8G 5FW7A 4BSWB 4OQTA 2B77A 4WU7A 4AJ0A 5HHQB 3VFSA 1INDL 4HUKB 4JHAH 1N10A 4OSUL 5D6CB 5IOKA 1S9XA 1CL7L 2MOVA 3VDBA 4IRJC 1PCXA 2X28A 4ONGH 2R7EB 4YK4C 4HVBA 1NIDA 5ADPH 2DM7A 5BO1L 3NCCB 2VR6A 2BJML 2CALA 5FO7A 1TCRB 3DX2A 3MA7A 1HN1A 2VDMH 3WIFA 5DS2A 3WTTA 1TNMA 3VU1A 1RPQA 4QXGL 5C3IA 1M9SA 4MD5A 2Y7MA 1H5BB 3S9DB 4JDEB 1Q0YL 3S8GB 4RWYH 4Q56A 2DTSA 4N8VG 3QZWA 5FOBA 1CI5A 5HVWA 2ZCHH 3OLIA 5DD1H 5JUEL 3RFZB 2X4OB 1R3IL 4IHBA 5D5MB 2X1QA 4FG6D 3NIFE 2EH8L 2MPAH 3QJZA 3O3AA 1RUAH 3NH7H 5E7FA 1W72L 1DJGA 3SPVB 5E5MB 4GSUA 5DZOA 4OB5H 2IWEA 1EFQA 5F44A 3HAEA 4FQCH 1TEFA 4EI6A 3W38A 1Q8MA 3VXSD 3NDYE 4FHBD 1EAOA 1X44A 2R0LH 2CGZA 1IEHA 3ALWA 2FHCA 1TZOA 3QUXB 3QWOB 4OW6A 4U1LB 4F7PA 5EBWA 3CFDA 1AI1H 1J9SA 5HGAB 2YPKB 1VCAA 5K9JH 1PIFA 1IGIL 1RK1A 3B9AA 1UA7A 4R90L 2CDEA 4KKBD 2YO3A 2NZ9C 5D7KE 3MCYA 4ZMOA 4KHXH 5C0FA 1FG2B 3D18A 2ED8A 4OF5A 3SE9L 4H5SA 5TE4H 4JHUA 5F7KC 1P5UB 3OGOE 1E2WA 2F5AH 3BYTA 5KAQG 2H26B 3DNKA 5B8CA 5CBAA 5DA4A 3LPPA 1F18A 4PJIE 1OAKH 5J4MA 2Y25A 3TZVD 4YZWA 5CO1A 1IM3A 1ORQB 2EDOA 2H3NA 5AAPA 1U8LB 2GABA 1KLUB 3BMVA 3KXFB 4QJ3B 2AEQH 1MJ7H 4F7KA 1HEJC 4KMQA 5EUKA 5BZWA 4DP6X 1THCA 2DYPA 1S8DB 1L5GA 4XAWL 3WKNA 2A74B 4G7VL 4RLDA 2IMNA 1WH0A 4ODUB 5D1XB 1E28A 2WO2B 3JWOC 1QAWA 4HCFA 1RHHA 1TJXA 3UTSB 5HVHB 3TNMB 1N6QH 1GL4B 2WQXA 2YAHA 3U7YH 1JYWA 1AFVH 2N1KA 4RA0C 2CLRB 2DIEA 2PW1B 1GGBL 4NQVA 4ZFOA 1YAIA 3A67L 4H8QA 5I1KL 5C09A 5D7JB 1HEHC 2Z31D 5F3BB 1EXHA 5MEND 1FVDA 1RUQL 3BLPX 3V10A 4X6EB 4AQZA 3VXRB 3G9AB 3GLEA 5EF0A 1OT2A 4IU3A 4EZJA 4URKA 1VGEH 2K70A 3WNIA 1HQRA 3BUBA 2J6EH 4KKCC 4Z77A 2V3DA 4PRIA 4NJAL 4K7FB 5GZOD 1OCOB 1R0AH 2ZF9A 4NOFA 3VG9B 3X2QB 5C0NC 4KGJA 4R7XA 1R17A 1G5GA 4QUOA 2XBZA 2V17H 3D39A 2Y7SA 3NSDA 2R0ZH 1QSZA 3BCDA 1MQKL 1I1AA 2EQDA 3FUKA 2EDRA 4JKMA 1AVAA 1IC4H 4J3WA 2X4NA 4GOSA 4PJIF 5T1JA 5F0PB 1AOZA 1GAFH 3LRGA 4IBUA 2DQUL 1IKOP 3CZLA 2R2BB 1INQA 1EMTL 2LVEA 4HZ1A 4LCUA 1FLRH 2L3BA 3VQ1C 4UF7C 3RU8L 1FIEA 4GSQA 5CR1A 1NJ9B 1Y6KR 4L9LB 3H3PL 3O11A 4FFVC 2R59A 1YNLL 3D0VA 1DJXA 3P3UA 1A6UH 5EPMB 2HG5B 4HFUH 3RWEA 3LAFA 1J8HB 3NA9L 2D3LA 1D5XA 2EH7L 3I9GL 4URTB 1GTNA 1BF5A 3FT3B 5CLTA 5DFVC 1SDYA 1NGWB 4AITA 1TJHL 1CTNA 3PL6D 5EFIB 4AKPA 5BRZA 5LVEA 4KJPD 2C9VA 3RWGB 5CIPA 1ZT7B 3CVIL 1I3VA 4HKJA 4BELD 2AK4B 4JQIL 4IIQC 4LLDA 4TNWK 5FDWA 3FH5A 3DX7A 4WFED 5IQ7H 4F15C 4NAMA 1F5WA 3HR6A 3FQ4A 4LCYB 1J1PH 5D7HA 1I1AC 1PJ9A 2J71A 3BVUA 4N2GA 3KLDA 2ID5A 2ZJSH 3LQAC 4UWQB 3PFQA 4FA7B 3QC5X 2X89A 1M71A 3VSVA 5CKAA 3FO2B 1K4CA 3WGVB 4R5XA 3VVWA 2AJ3B 1Q0XH 3POCA 3WJMB 5D2LE 1PZAA 1TEGA 4UTAL 2XETA 2PO6A 4KDWA 5KSBF 1MWAH 3UTPE 3U4EB 5DK0A 3D69A 2FWSA 3MU3A 3JZ7A 4BA0A 3LZOA 2Z93A 3PQYD 3C60A 3P2BA 4A7VA 3TIEB 4QGYA 4N6RB 5GZNC 5DJ2B 2PWFA 5IQNA 2X3BA 1FFNB 2DW5A 3APFA 3BD4A 4IK7A 4KJYB 3KWTA 4L1TA 3OKNA 3CZSA 4Z7AA 1WFMA 2UXFA 3WEBA 1TPXC 4G6FD 4DKFH 3NOIA 4UNVA 1F3RB 2OMBA 3ARDD 3SE4A 3OR6B 2DL2A 2CG9X 3BVNA 4EKJA 3MR9B 3O8XA 5E0QA 5AG9A 2X1PA 4J3VA 2ZKMX 4PHZA 4RGMC 5C0CB 1TZHA 3WYRA 3UC0H 2BNRB 1OSYA 1W8NA 1A3LL 4Z7UB 2NW2B 2FH8A 2WSDA 4NO0D 5EA0H 4DNLA 5KN5A 2O6PA 2WZAA 5I71B 1QOKA 2AERT 3VH8A 3KJ6H 3S88H 3T3PB 1DVUA 2TRHA 2XXMB 2E7HA 1KB5A 4AIOA 3B7UX 4RSYA 4FNUA 1J86A 4BQ8A 1BFTA 4FLSA 3CX5K 1UWFA 5DI8B 5EF3A 4TV3A 1IGJB 4H7VA 1FFRA 4E9TA 5FX3A 1NCWL 4NQCD 2NY0B 2NY5C 4N2MA 5D2LF 2P47B 4NPYA 5HPMB 5C09E 4PJDB 2ZWZA 3FRUA 4P2YA 4W68A 4HQQL 5AOKA 5ITFA 5JDSA 4ODWA 3C60C 5HYFA 1UURA 3BE1L 2Y69B 1HZHL 2BIOA 4HAGA 4N5ED 1J0YA 1U8PB 4PRIE 2FWLB 3U9PH 3W56A 2DD8H 5F6HJ 2FVNA 3GBML 4Z5RB 3DIFB 4R4FH 1NFDA 3MBEA 3OM3B 3V4VH 2VW4A 4XC1L 2XN1A 1JXGA 4MAYD 5I1DA 3LNHA 1BWWA 1YQ2A 4ZW8A 3D39E 3SE4C 2C9AA 1AO7A 3DTXA 5BW7C 3QUZB 5I17B 3QUYA 3E9TA 2I07A 1VPOH 3F7YB 3O8XC 5K39B 3S37H 3SYPA 3ISYA 1YC8A 1CBVH 2HJLB 4AJWA 5CHNB 1ZEAH 1MFBL 4KJQC 4NYLB 3H9YA 5HYJA 4YDKL 3GHPA 3VXUA 3IDNA 3B7TA 3OC8A 3UTOA 4XX1E 3T2NH 3D05A 5J1AA 2VAAA 5I66B 2C9RA 1FPTH 1NBCA 1YEEH 2ICES 4ANKA 4BFBD 1HHKB 3AUWB 3QNZB 1QTSA 4YVNA 5TK2A 1HZKA 5BMFL 3FUFA 2WLZA 1KTRL 3N1QC 1OHZA 4Y9GA 4A39A 4N20A 4FXKB 3DA0A 3ZSSA 1C16A 1XF2A 2R1YA 4PJFA 4QJ4B 3CDGA 2BSRB 2V0AA 4P9HL 2RD0A 3DBSA 1N18A 2XWTB 1MVFA 3HKZA 4FQXB 4FYTA 4XRCB 2EDNA 4N86A 1J05B 5BRZE 2V2WA 4POZD 4XVJL 4B3EA 5ACZA 3BVDB 2NTFA 1F11B 3MBEC 4WNQB 4F8OA 1MEXH 1ZRUA 4HMEA 3C8KA 1F6AB 5HYSB 1FYTD 3AB0B 4QT5B 4L8SB 4R9HA 1AKJA 4WWPA 3QIUA 3C6EA 3QDJD 1Q38A 4IBTA 3Q8FA 5IMMB 1OGPA 2OBGA 3QQ4A 3UAFA 4GXUN 2Y1VA 4ZFFB 3GMQB 3AXLA 2VDNL 3BUQA 1BAGA 3A6BH 3VTTA 3D9AH 4L1SA 4DVBB 1TZIB 2VUYA 3AAZB 4C4UA 4LEBA 5I9QC 5IHLB 3VD2A 5DD0L 5AW2B 1F2XK 1S2EA 3X13A 3S2AA 3VNZA 4DPCX 3EHBD 4XVTL 3PJLA 3INUH 3TURA 4J3BA 4C59B 1X7QB 1MF2H 4R26L 4LLVA 4CN1A 1KY7A 3DX3A 4OIIH 3CDZB 1SHWA 2CH8A 3NAAL 1M53A 3O3EA 4QOKB 5MI0B 3PHOA 4LHUA 3W0WD 2J88H 4AW7A 5AOZA 3TWCL 1Z9PA 4NQSB 1T3FB 3NEXA 1U8CB 1MPAH 1C5CH 2VR7A 3N42B 4OLUL 4Y88A 5FF6B 4UT7H 3V79C 5SWQA 4MBOA 2AJXH 3VXOB 1AXSB 4P07A 3ROOA 1ZJBA 1TYJA 3BN3B 3HFML 3X12B 2FTAA 3AU1A 2X40A 3GJFH 4Z7QE 2GTZA 4UV4H 1NEPA 1UD8A 4FNSA 5A3IC 2D7QA 4B5EA 2H7WA 1P7QA 2YQGA 3I3EA 4FFYH 3C09B 5EO1B 1S7WB 3ARGD 4NKQB 3QJXA 1F41A 2MCG1 3TF4A 3VE0A 2JKTM 1W8EA 5DRXB 3AXIA 4EI5B 4K0OA 4DHLA 3BQUB 1F6LL 2AKRA 1YYLL 1KCWA 1HNFA 3BN9C 1JS4A 3ZTCC 4YSAA 2NNXA 2CLVB 3NPZB 4WO4A 4RVBA 1D2OA 1NGYB 1RIVL 5INCB 3GIVA 3MRDA 4F33A 4HCGA 1WTLA 4XMPH 3ATDA 1UXSB 2BOBA 1E9OA 2P4AB 1E30A 1F02I 1FCCA 3S97C 4D9QD 4I13B 1BZOA 2FBJH 2HVJA 4NUGL 1NFDE 4RAUA 3LKRB 3HOGA 1X7TA 3WI9A 2E9JA 1I7RA 2GAZB 1PNDA 4LGRB 1AO7E 1OB1A 3LXCA 4DP8X 4FFZA 2JB5H 3BDYL 3GKWH 3JWDC 5B39G 1OD9A 1MFVA 5CP7B 1SGKA 4P2RE 4QRRB 3FHQA 4HYTB 1T1YA 1KB3A 1ZHLB 2H1XA 4JFHE 5FAAA 2PPEA 1A6WL 1IGTB 3QNYA 1UD6A 1PD0A 5CLYA 4BSVA 5H4ZA 5HYJE 3O6KH 4OM0H 4E9RA 5AOIA 3VXUE 2GPZA 2NQ3A 4J3XA 3SKOA 3BIAX 4JO1H 1F4WL 1LO4H 1ZT1B 2XIIA 3ABGA 4X99A 1HSAB 4ZQKA 3SYCA 1A14H 1BPLB 3BH9A 1JPGB 4NNPL 4PJHB 5HGBB 4ACTA 3TESA 3D4ZA 1MRCH 4AC4A 1KEMH 4GXVH 4R3SB 5I5RA 3BUIA 5DJ6A 2WVSA 4NOBA 4OT1H 4WO4C 3C75A 4G70B 4PJFE 1WHOA 5KSUA 2LOEA 2KT6A 4P4KC 1LK2A 1XGUA 1J5IA 1DQLL 2BINA 4GW4A 2H9GA 1FNEA 1T2JA 1H0DA 5CLXA 2JELH 4U6XB 4IBYA 5DJYA 4JM2A 3G6JB 2ADIA 4XNAA 1NFDF 2K3HA 3VFPB 1BPVA 3LEXB 3HHRB 5ICUA 3X3GL 2ZWLT 1BZ7B 3EIFA 3MRPB 1BQLL 1JPSH 1AQ8A 2QGDA 5CGMA 5BQ7B 4H1LB 3RX7A 3U9UB 3QQNA 2BIPA 3AG3B 2WN2A 2OSLA 3HZVB 5PCYA 5AB0A 1HILB 3VB8A 1D2PA 1HHJA 2VJ8A 5GJSH 5KYXA 2AP2A 4YDVB 1CB4A 5EU4A 1BVKA 3T65B 2WUCL 3CD4A 5JLZB 2LLGA 1J0JA 1HHHB 4GUPA 3MFFB 1QBML 2AXFB 3VGAB 5EZIH 4JFFA 1D3CA 3T6QC 3MUY1 1F4XL 2CMRH 1IARB 5HJDA 3ULVF 1A6AB 2R69H 4U3SA 4AX3A 4U1NB 5AALA 4G9FB 3ML8A 4LEOA 25C8H 3O6LL 4J28A 3N9GH 4XC3H 2H2PC 3MCLL 2IPTL 2L8AA 2ZUQC 5CMAB 3K80A 2FX7H 3AWEA 2HX9A 2E9IA 3KH3A 4MMZB 2P8MA 1N0LB 4FRWA 1SQMA 4MXQD 1UB5B 1JHKL 4XWGL 3RZCB 3ULSA 1YYML 1B4JH 5KAQF 1GC1C 4A6YA 3I2CL 4XPBH 5K93A 2GCYA 5F1SA 3EYFB 1XTMA 3B7RL 1KJ2B 3M8OH 3GK8L 3ARBB 1ROWA 1IGFL 2BVOA 4YNYB 2F53A 1KN4H 5I1LB 4Y1SA 4PRHA 3OHMB 3V4LA 4XN5A 3V95A 4A63A 1IGML 1DQIA 3CUPB 3IT8D 5FKPB 4EVNB 2ZOWA 4RGNB 3E6HB 4UM9A 1N67A 2B08A 1LTXA 2PP8A 5DUPH 4ZX5A 2NY7L 4IKIA 2WB7A 1NC2D 3QEGH 3KLLA 2EECA 1OVZA 2B4CH 2A99A 3BWAB 5JW4Q 2F74B 1MZYA 2IBGA 3L2LA 2Q9OA 4IEFA 4J6IA 1KZYA 1UQSB 4LL9A 3RA7H 1SFDA 5K59E 4I3RL 4FQHB 1CFTB 1EJ6A 1C1EL 2Y24A 4MYPA 4NPJA 4CL7A 1WCBB 3W37A 3F12A 4TUJB 1IGYA 5CJXA 3QJTB 5CF3A 1A7OL 5C9JB 2ALWA 3GHEL 4QHNA 5JZ7C 4KUCD 5LAXB 3B2DC 5DS1A 4R5VA 2HFFB 2ADJA 4HHAB 2IWKA 4PD4K 4CAGA 2YXFA 1CGWA 3LIZL 5F1IB 1KACB 4FZEL 1FO0L 3M17A 2MNWA 2PW2B 3U4KA 1KJMB 3H9SA 3QFJB 5LBSL 1ZCRA 4RZCB 1MRFH 2UZYB 4FEIA 4ISVB 5ALBL 4AGOA 1T5KA 3QI9B 4DFHA 1I75A 4GKZB 1WBZA 3QO1B 4OZFB 5EU6A 3OF6A 3AFLA 1BHGA 3IJ9A 3K4AA 1QMUA 1XMWA 4CMHC 2Z35B 1FSKC 4QXWA 1UOVA 1OM3H 1DBAH 1JZ7A 5JYMA 3L3OB 1AGCB 4UV7H 5DHYB 4HXBH 1DVFD 1WZMA 4S10A 4XCYA 2DQFB 1LEKB 2CWRA 3M45A 4FADA 1MWOA 1RSYA 1KJVB 3QYCA 1BAWA 3DPBA 1ZSDB 2XWJA 1HXMA 3QQ9C 4F8LA 4L5FH 1OTTD 4S0SD 2EIBA 2E76C 1U3HD 1ZDQA 3CLFH 3L5IA 5KVDL 1HC1A 4XXDA 5C08B 5D2NA 4A38A 3WIHH 1PX8A 3G04B 4JFXB 1G9NC 2WD0A 4LEXH 4XP1L 3KCPB 1WZLA 1YHPA 5CJXC 3T0ED 5K59F 1KELL 2BWQA 2NLJA 2R9HD 3GF8A 5KVFE 5JXED 3A47A 1B4TA 3KPOA 3WY2A 1BG1A 1Y7VA 5FPIA 2E46A 3MJ9H 3KS0H 4XZ4A 5AAMA 2EVGA 2VM3A 2I60L 1MIMH 2QDVA 5KSVB 3RVUC 2X4PA 4AQ8C 2VZUA 2C7UB 1JDDA 1NEUA 1ZV2A 2IGFH 1X5FA 3MA9H 2DWXA 4IOIA 5B1BB 1WZ1H 1JJUA 4JPQA 4V1DE 2MOGA 3MYJA 4HC1L 3PXLA 5GS1A 5K1NA 4Z78A 4PRPA 5JW5A 4MJ6B 12E8L 4DGIH 1ZT4A 2FATH 1KIUB 4O02B 4M7LL 3M07A 3REVA 4JFFE 4U4BA 2I69A 1BOGA 3ASWA 4M48L 1LO5A 3UTZB 5L9DL 4XPHH 1A3ZA 4ANXA 2V2XB 2VDKB 1H19A 1T0NB 3L54A 1NCGA 3IM1A 5I73B 2YA1A 5KUKA 1UFGA 5IVZA 2C9PA 2CGYA 5LN4A 5IM7B 5D2NC 1J5OH 1LE5A 2NX5A 4HJGB 1YEJL 4NUJB 4OZIB 3ARZA 4YR6A 3FXIC 5HDRA 4N8CH 4E5XB 1QSFB 4F57H 4GI6A 5F3FA 5AAMC 2IPKA 2C8NA 4OFYD 4CBZA 5JORB 1Q9KB 3Q2CA 2DQEL 1TITA 1NCOA 2FLBT 2Y6SD 4HWUA 5AVTB 2F53E 2MOQA 5GRUL 4BWWA 5FA4B 2J8HA 1EANA 4PRHE 4FL4B 2AAAA 4BFOA 1QPXA 3PREA 3V9CA 1U8MB 1TTAA 5F96H 3ZHNA 1LILA 4FFWD 2VC2L 1UKSA 4N1HB 4QCIA 4UNUA 5E1GA 5AZEH 1AG6A 3A6OA 1REIA 1NIBA 2O5ZL 5DMIH 4AYMC 3GMLB 1RK7A 4QWWC 5J1TC 2R1WA 4JZNB 5F7EL 3LZLA 5DJZA 1GIGH 3HHSA 1G0YR 1QLRB 4XI5D 4IBSA 3CC5A 4UUJB 5B22A 1B9KA 3MREA 2V4LA 2TSAA 4H40A 1YEDA 2HT3D 4RIRB 5EC2B 3UTQB 3LKQA 2Y2YA 3GSQB 1JRHI 4ABVA 2X3CA 5C0BA 3MV8B 4PS4H 1UA6L 2C3GA 2WMPA 3I6KB 2LU5A 3VGGA 3D07A 2H2SC 4NGHL 3WMPA 5ALCL 4R7VA 1ZANL 3W5NA 1BZ8A 3WO4C 4HGKC 4G72B 4J6RH 4X6DA 1HVXA 4HWZA 2XTJC 3EGDA 4ZTEA 1BECA 4JPIB 3H9SE 1ZOXA 4JHWH 1CLOH 3I02A 3QDMD 2VMJA 4CMMB 1Z3GH 4F37K 2XICA 3ECWA 4L4JA 3FFDA 4GO9A 4KO9A 3VMPA 1SHXA 4ZOCA 5EU6E 1ETB1 1RZKL 2BWDA 4U3CA 4TXVB 3TA3B 1WWCA 1A1OA 4BD4A 1TVHB 2XZAH 2WCPA 1U2CA 3SEPA 4JCWA 3AABA 5DJ0A 4CNIA 1OAJA 4XO5A 3EYOA 3JV5A 3EYUL 3IXAB 2OTWA 4HWNA 4YL4A 4ELKA 5A2KH 2QFPA 1UJ3B 5DEJA 1F58L 3RAJL 3VX1A 3JV6A 4JL1A 5AW1B 5GGSA 1UOWA 3GGWB 4AYFB 4F9LA 2B5IC 3PWVB 5ICZB 5JW4R 4I1RA 2XPYA 4XVOA 3DXAD 1PZ5B 5GGUB 3SO3C 1E6OL 2BOLA 1WA1X 3HBPA 2GQHA 4FZ8L 5F7MC 5I8KH 1BDYA 2YRBA 4Z8FL 5C0EB 2GEQA 5LN8A 3QA3B 2KLTA 3K2UH 4UT9A 4IYKA 2X0VA 3TJHC 1AZVA 1E9PA 4MA7L 2J21A 5D2NE 1OHQA 4OLZH 5C0JA 2ALAA 2JIXD 2BOCB 1BAFH 4EBQH 3CZFB 2FBOJ 3C87A 4WCYH 4EEEA 3O0RH 2V9UA 3I6GA 2RCSL 3UBXB 3CZUB 4WKZB 2RA1A 3FQXA 4O02H 2EE2A 1UH2A 4X5XA 4XMLH 4NXKA 1RERA 5D1QA 4YHMH 5DRNB 1HE8A 1J87A 4JY6B 4JFZH 4P46A 2HPOA 4J3UA 4QRAA 2DQDH 3UROR 1TQVA 1H3VA 2AXGA 4BINA 2PYED 2B8OT 3GYRA 5AUMA 4KNUA 4FQJL 5AVXB 4LVNC 3ZLQC 3UYRL 2XWBB 1F3DJ 1IGCH 3CDYA 4PRPE 1NMBH 1P0SE 4FNRA 2QLVB 1J48A 4XMKH 3C5SB 2WWMD 3PPEA 2D9CA 4A66A 1QR4A 3G5ZB 2ZP9A 4F9LC 4KY1L 1QFUH 3HG1B 3T6WA 1I9IH 3CC1A 4HOXA 3WL9B 3WFEH 3NTCH 2BSED 3TV3L 4RQQA 2JQZA 4ENEC 2WXMA 1FLTX 5EU7C 1DDHB 5JPMB 2CHDA 4P2QA 4KI5E 4MYWB 4AJVA 3OKDB 3QWRD 4OCWH 2QEJA 2VLJB 4MDJA 5FM4A 4EO5A 1SBBA 4QRSB 4NQDA 4RBPH 2NX5E 2JI2A 1MG2C 1NTDA 4P3CL 4G80B 4Y4HD 3WNKA 4KROD 1UCBH 3MRFB 4JDTH 4NUPA 2I5YL 2XTJE 1NWOA 3NIDB 3ZKNC 1WAEA 5T3ZH 1OCRB 2N0KA 3HE6A 5IQLA 5KVFL 4HJJH 1FVEA 4HKBA 2Q3ZA 2XN9A 4P2OA 4W9JC 5IBLC 5SWZB 4P46C 1QO3B 1L7IL 1WFIA 3DVGA 2B2XH 2Y3NA 3DX0A 5HY9B 3UJTL 2EJ1A 4PRNB 3F04A 4EZLA 3CV5A 3L1EA 1BIIB 2YA0A 2GY7B 2VDPL 3GSOB 4WEUD 4KKLD 1K72A 1RU9L 2EYTB 1T66C 3SGKA 4MA3A 1C7TA 4MD4A 1ITBB 3NCJL 1WE5A 5DUMH 4GG6B 1B90A 3U7WH 2EIZA 3IBEA 3B2UD 4PJBB 2OL3A 1NAMB 3DSNA 5AAWA 2ENJA 3RIKA 3N0PB 4KRPD 4I87A 1R9FA 3GSWB 3MRGB 3VFWB 3WBDA 3OJ2C 3BDXA 5C0BE 4A1RA 4I9XA 2QQKH 2M8XA 2MTPA 1CVSC 3HE7D 2MCMA 8FABB 1UB6A 2OMXB 1AP2A 1D9KC 2CSPA 3M88A 4XWOD 5DUBB 3T4YB 2BSTB 5FA3B 4NZUH 1ZIBA 2BNUA 4HIIA 2W81C 4X6DE 2BCMA 2X42A 4M7KH 5KYYA 3D2UB 4HIEA 3HE6C 3RLSA 3EOBB 4ZSOB 1SFHA 2NY3C 3GMMA 4F5CA 5AWNH 2WBJB 1VSCA 3D25B 1HKLH 1FUNA 2YD8A 2XWXA 3IU4H 1JI2A 2B7DT 4F93B 5TDOB 1VAHA 1HYRC 2ZUSA 1KGJA 3QCUH 1M2VA 1O9VA 3L3KA 4OFQA 5C0RL 3UPRB 1XO8A 5KBPA 4ORGA 3U2SB 2DQTL 3Q1SL 4X83A 3MQIA 5C2UB 3LCYA 2Z6FA 1EXGA 3VCLB 2QL1A 3VWJB 2GUOB 1A21A 3KPRD 4JRYB 4UDUB 5AAWC 3AGVA 4DOHE 1JNNH 4QIRA 5D8JL 3B7SA 3GXUB 4KK8C 2HT4C 4ALAC 5H37A 3P40A 4HJ0C 4YSCA 3VUAA 2J8UF 2WLIA 3TO2A 5IV2B 3IDYC 3KLQA 4TLUA 4ELMF 1G5AA 1RQ5A 3L4TA 1RIHL 4DT2A 4Z3IA 5E8PB 2DN7A 2X09A 3ZE1B 3OHXA 2YUZA 1LK3H 4FP8H 3FO1A 4FI8A 3S3BB 3K74B 1A1MB 3BAEH 1BQSA 2NY4B 4X0KA 2JKRM 4BQ9A 1XAKA 4J8QA 2DWSA 1UUSA 2MKWA 3EBAA 1S7TA 1NSNL 4XGZB 2UZPA 3N2JA 3U30B 4PJ9A 4N25A 3VFUB 2Y7QB 2ITCB 5HHOD 4HW6A 3R4DA 1VKXB 3V0VA 3S3CB 3IJHA 4BA8A 1JPFA 4NFBA 4DVRL 4LCIL 3AXHA 6FABL 2F19L 1U8QB 3MNWA 4NT6A 3WY3A 1N59A 5IFJB 1UWEL 1IAII 2P8LB 4P2QE 3KLAA 2CUIA 3BVTA 3P4OB 5DD6B 1CQKA 1R3JA 1WWAX 3ELAT 5LNGA 4GG8B 2E8ZA 3EJZC 4M93B 1ODUA 4H8HA 5B4MC 5I28A 1W0VB 1ID2A 1CCZA 4B5ZA 3HRZA 1INEL 3H4FA 4P5TB 1G9MH 2QVIA 2WXHA 4RMWA 4UTCA 3MRRA 5EC1A 4M3JA 5IFHL 1CBJA 2BPBA 4UAOC 4ATTA 3F5WA 2VIRB 2WZPA 2BIQA 1Z6JT 1D7FA 4HV8B 3VXMB 2WKOA 3PWLA 3SB3A 1XR8B 2XN9E 1N3NA 4IJ3C 3ABZA 3ULUL 4K3JH 2H0FA 2YXMA 1A64A 1X3DA 1HCVA 1RD6A 2VWEC 4TNVK 2WIIA 2A6IA 3T6VA 5C7XL 2V7HA 5DR5H 2XQYG 4P0DA 2EUXA 1Y18B 3L1FA 2FX8L 3J07A 1JTPA 1SJHA 3A22A 1NINA 1UXWA 5T3XL 4BH7A 5SWSD 1JWMB 3MSPA 3QB7C 4TULH 3DX6A 3TYFA 2O26U 2VMFA 3FTUA 5F7YC 4XP6L 1MW1A 2D73A 3RWHA 4PJXF 3BIKA 5JHBA 2AABL 3ZQ9A 5L8KB 2CR3A 4XO3A 3HNVH 3JV0A 2P48B 5DVLA 3S5YA 4MSWA 4IK6A 1JPTL 1KTBA 3FU9A 2Z4TA 5FKAB 2BH0A 4Y2LA 1QYGH 3TEXA 5JIDA 3TJEL 5JMRA 1ZGLM 3HRZC 1AC6A 2OR7A 3PABA 4ZMVA 2K45A 4KXZH 2R29A 2W92A 4BSWA 3MLXH 1FAKT 2QGEA 4NXSA 5T33L 5J1SC 5TGBB 4G5ZL 5F7DA 2XLLA 2IBBA 1PTZA 3S96A 3MRJB 3L9RB 4FFTA 3EBIA 4AYDC 5LJYH 4F5CE 1T7YA 5AYQA 4AMKH 3TO4B 2CA3A 3FFCB 4KZEL 1L9RA 5BQDA 3H3KA 1TCRA 2NZ9D 3BX7C 4NP4L 4B7IA 4PREB 5FYLH 5GS0L 5GXBB 2GIMA 3CZJA 5GHWH 4OCRH 3Q3GA 1KLGB 1QHOA 3BZ5A 1ZA6A 1EAQA 1W0YT 1H5BA 3SO5A 2CJTA 4JDEA 5E1QA 3MX0B 1L6ZA 1IAOA 2D7NA 3F01A 6TAAA 1NBVH 4KAQL 3RFZA 1IVTA 5D70H 5BV7L 1T5WB 2X4OA 2ED7A 1ZMYA 4XNBA 5D7SH 5D5MA 4QD2E 1G4RA 2I24N 1U2HA 4NQEB 1HJCA 1OP5K 1RK0B 2P52A 1SOSA 1J0HA 4JFPB 5FW6A 4Q9RL 1UM6L 1UT2A 2BVYA 2H0EA 2V5MA 4NN6C 4DEPB 4GY4A 3SGDI 1WPCA 5AKVA 1T7XA 3A6CL 5LGHH 3IK2A 4XP5L 5AOJA 4AUYA 5HD8D 4ZAKA 3QUXA 2VWEE 2AI0L 3SZKC 1H8OA 2VJXA 3QISA 3QZPA 1P69B 1HXYA 5CR8A 2DQHH 2YN3A 1TUPA 3RWDB 1BCIA 3TN0D 3VSUA 3FUNA 1N7MH 1SM3L 2R2CA 4C83B 1FH5H 1MELA 3N41B 2ITEA 4KKCD 1FG2A 2UXVA 1JK9B 2GC4C 2I9LA 4Z3HA 3WLWD 3QG7H 2H26A 1ZY9A 5C0ND 1IM9B 5IJKC 4PW9A 3NJJA 4HH9B 1H5BC 4Y4FA 5EZJA 5FM8A 2WUBH 5KYWA 1SEQH 3HVNA 4MB3A 3CJJA 5KWYC 3T04D 4MHHI 4QKXB 5HYSG 4GIAA 1QSEB 3T0AA 2A1WL 2L7EA 4Z0BL 1MCIA 3RFZC 1NZRA 4XH2B 2O5XH 2DI9A 3CWGA 1F45A 4UT9L 1JBJA 3KL0A 4FLOA 3QHFH 4JO4L 3IBOA 3NZSA 3R06B 4L4TB 1X5IA 3VFVB 1QI3A 4ODUA 2OLDA 2UY6A 2VMEA 5LNEA 5L8JB 3K7UA 2FZ3A 3KPNB 5BO1H 5IW6B 3UTSA 3HG2A 3TNMA 1T7ZA 2I32A 4PRAA 1BREA 4ZW7A 4LCWD 1P4LB 1Q72H 4ZAKC 5TD4A 2CLRA 2ZNWA 2DB8A 3QUXC 3Q5YA 1J5CA 2DQGH 2BLFA 5DD5H 4G1MA 5D7JA 1F3DH 4JVUA 5LQBH 5F3BA 2AXJA 4X6EA 2OX5B 4YE4L 4HS3B 1U8KB 1U8NB 3QZOA 1GH7A 2J5LB 2F58H 4PV1C 1BQHG 4P48A 3TBCA 4HT1H 3VYPA 1KTCA 1CGYA 1MY7A 2VDRB 4LIQH 1VEOA 2EE0A 1I1CA 4K7FA 2FSDA 4R2GB 1P5UC 3N40F 2OXGB 3LS4L 4Z95H 2QQNH 4EN3A 2JJUA 4LESA 3DRTA 4WGKA 4B27A 4H25A 5D4JA 1JWUA 2TSBA 2NPLX 4L8BB 1I1AD 1XH2A 2IH3B 4KWUA 1QLEH 4NO2B 1ADQA 1E67A 4DIXA 5BUGA 1Q1JL 2IAMB 3C6LB 3EJRA 1O5DT 2XC8A 4PB9H 3WFDL 4YHZH 5HDOA 2E5EA 1RURH 2R2BA 5D4HA 4XBEH 7FABL 2A74C 3DV6B 2COQA 2JNZA 3PHSA 5ANMB 3A23A 3I3DA 2CKNA 4NKMA 4QF1B 4H0IA 4XNZB 1ZLVH 5IIEA 1UEYA 3CVHA 3CSYB 1J8SA 1KJ3H 1NJ9A 3I50H 4L9LA 4AL8L 2WQ8A 3FHEA 5I18L 4APQD 5HVHC 2YIHA 1PEWA 3K6DA 3OPZH 5EPMA 5F71A 3D4YA 5EF1A 2HG5A 5DHXB 4LOUC 4LVHC 3MODH 1NCDL 1J8HA 5D7JC 5GZND 2F7RA 5JOPE 4OD3H 5AB2A 4ADGA 1OPGL 1P9MC 3FT3A 1BD2B 5IROC 1NGWA 1S78C 4NS0A 1KNOB 1NFKA 3F2LA 5BOZG 5CSZB 4IGBB 4GBXD 1J1OL 3L8QA 4JLRA 1ZT7A 3OKLB 5BRZD 1NAKL 3RWGA 2AMUA 1B4LA 3MZGB 1TNNA 3QXVA 2AK4A 4K7PL 3VG9C 4X4YB 1UA3A 4NNYA 4FI6A 3IJSB 4HSQA 5I8CB 3X17A 3F58H 3M86A 5T1LB 2CCWA 1DLHB 2OL3L 4N0UA 2YD1A 3QZBA 4LCYA 4NENB 1CGVA 5D5ME 3LN4B 2J4WH 2B16A 3BP6B 4FERA 1AXTL 4LGSB 4OCSL 3KD4A 3BUTA 2G3MA 1G7PB 2AJ3A 3LYRA 2CA4A 4IRSA 3CCHA 3WJMA 3L9BA 4U49A 3X3FL 3SDDA 2JTDA 4X5LA 2OMWB 1QLFB 4PI2A 1JPST 4L9LC 4DF9A 3KH4A 2J7LA 3U4EA 3U6XS 3IDUA 4KQ4L 2EEAA 3ZY7A 2WYIA 2H6UA 1IKNA 4WI6A 4F2MB 5C6TH 5G5DB 5DJ2A 4HCRH 1FFNA 2Y1ZA 3G5XA 4AIXA 3T5WA 4KJYA 3EGSB 3EADA 1ECYA 3JXAA 4NO3A 1BF8A 3RZWA 4I3GA 4R7LA 1RIUL 1R5WB 5E9DB 5KVEH 3OR6A 1T20A 4U1JB 1JZ8A 1BSIA 3L4UA 4WO0A 4EIUA 3FOMB 1P7KA 2E6PA 3EYQC 1CLZL 4OGAD 3MXWL 5C0CA 5EUOA 1PIGA 2HKFL 5CZRA 2BNRA 5E5RB 2NW2A 4RGOH 4GQQA 5LKNA 1WV7T 3DGCR 3MLSH 4H1LG 3SDXF 1CZ8L 4DGUA 3K0WA 3B34A 4LFHD 5IT2L 1VEPA 1LHZA 4XN9A 1B0RB 3ZSTA 4JN2B 5IHUL 1SXSA 4N9GB 1M4KA 3WLBA 3UTSE 5GRVL 3MCG1 4I0CC 4AYGA 4QLWA 4GP8B 2QADB 2Z64C 1FV1B 4PJDA 4LVOB 1BIHA 5CFHA 4HWEH 5ILTH 3B3IB 3MTXA 1KC5H 2P42B 2ZYSA 2MPVA 3QIBA 5DLMH 4FQLL 2ZXDA 3HA0A 3LN5A 3LRKA 1U8PA 3KYKH 1UZGA 4L1DA 1JCKA 1T22A 3NFSH 4KMLB 5I82A 4F8TA 2G3NA 5E6ID 5EOTB 5FYKU 5C07A 5SV3A 4Q9CA 1G7IB 1T1WB 5DRZA 2WM0A 2DLTA 5EWIH 5E08H 1GSKA 1F90H 3QUZA 5B21A 5B7EA 3U79A 3E6FA 1CGUA 2FX9H 3F7YA 2BHYA 5A7EA 3S36L 4C57C 4P2RD 2HJLA 5CHNA 3IPFA 9CGTA 1CR9H 2XZCH 4JFHD 4NYLA 3QXUA 2JKNA 4KZDH 3Q2NA 5HYJD 3FCBA 1QKZH 3NK4A 4J3TA 4EXPX 1YECH 5I71C 3SCMD 3VYOA 4DGYH 2V8MA 1CT8A 3CSPA 2MJWA 3PCYA 1ZLUK 5ITBH 1OAZH 1HHKA 3QNZA 3ULVD 2DMHA 2DIAA 3TVMD 3CN3A 2NQDA 2I7OA 1J18A 3CX2A 4G5AA 2UZIH 5HDBB 4G8FB 2NY0C 1BM3H 3RPBA 3ZXAC 1UH4A 2WNKA 3M46A 3SDAB 1J8HE 1ZPUA 2XQBH 1ZTXE 2ZF8A 3UBHA 3SKMB 2QZ5A 3LKSA 1WJ3A 3WFCL 1MN4A 1ND0A 3Q01A 5ESAB 2XWTA 3VI4B 5FEBA 1J05A 1BFOA 3CXHJ 2AK4E 1F11A 1FYHB 2EIKB 4WNQA 1OAYL 1NM4A 4U31A 1F6AA 4N3UA 5GGSY 5HYSA 4PW4A 2MCPH 4B7LA 3FUIA 4Q9QH 3EF7A 3QUZC 2E8YA 4WUKH 1GYVA 2EO7A 3HG0A 1I9RH 5A3ID 2YAFA 3Q6FB 1NGQL 3D1MC 5AFAA 4UTBL 1HI6B 4QO1B 3GMQA 1F1DA 3B9KD 4WUUB 4JY5L 4N0YL 4OZFG 4D9RE 4WEBH 1VGKB 4LEEA 2Q7NA 5E6UB 4DVBA 3BP7A 1KN2H 1QRNB 1TZIA 3D0LB 5CXPA 4WI5A 4U33A 3QDHA 5T1KD 2R29L 5A2JH 5FIEA 4Q8BA 3Q06A 1EDYA 4JE0A 4ODVH 3LJ3A 1IZKA 5DYOB 1RMFL 4A37A 1A5FL 4TSAL 4M43L 1G7HB 2Y72A 3E1F1 4KPHH 2FEEI 2PPDA 4BFKA 3CQPA 5DVKA 3VFGH 4FXKC 2VXUH 1JGDB 1GR7A 1QZ1A 3OX8B 1DBJH 4QOKA 2IMMA 4XODA 4ZUVB 3V0IA 3C5ZB 5ECJE 2X7LB 4BFGA 3KR3H 5DF0A 3RIAF 4NQSA 2ADFL 2O72A 5MHSD 3RJQB 1OE2A 1BEYH 4LSTL 1WD9A 4FQ1L 4OLWH 5FF6A 1EPFA 4C4BA 4NQTA 4CVXB 3E8UL 5HHVL 3VXOA 1AXSA 1A6ZB 1JFHA 3MLRL 1KGUA 2NXYB 1XGTB 1NC4B 2RH0A 3AB0C 4S1DC 3X12A 3VA6A 2XA8L 4L8SC 6PAZA 4K5OA 4GKSB 5C0CE 1OQXA 5EUOE 4YEEA 4YZFF 1I1RA 1SYVB 2BNRE 1SMOA 3SSGA 3DX4A 3UDWA 5BUAA 3H2QA 5ISZD 2N3JA 4TLSA 5DDHB 2PWEA 3F7KA 1HWGB 3MC0A 1P7QD 3FU6A 3K1KC 1OCCB 5EO1A 1S7WA 4Z3JA 3WXWH 1ZXQA 2KPWA 4HK0B 1DZ0A 4ZO9A 5DWUL 5E4IA 1KFGA 4EI5A 3BQUA 3LQMA 4GEIA 4PJDE 1KCRH 2CLVA 1W72B 4NFDA 1NGYA 1ZSHA 4NM4H 1FZMB 3IFLH 3R4RA 5INCA 2LTQB 4G8EA 3FU3A 4XNDA 2MHAB 4K8RH 3S3DB 4P4KD 1UXSA 5MI0C 3ZDXB 3ZHKA 3P2TA 4S1QH 3EKCA 1FL3B 4NPKA 4CVZB 1DSWA 4FNLL 4F24A 4GKLA 2VYRE 5C07E 1DVTA 5I6MA 1K8IB 4XOAA 4I9WE 1JHLL 3CHRA 1SY6H 3KYOB 1BBDH 2FR4B 3FU5A 3KMDA 4MNQB 3ARXA 4MWFB 4ERSH 4H26B 4E5XG 5FGBC 3MMEB 1JUFB 5CP7A 4QRRA 1LO2H 4J1UB 1M7XA 1UGKA 2HSIA 3GMNB 1ZHLA 4RAVA 2D0GA 1UOLA 1IGTA 4GYBA 3UDWC 4AGNA 3K4ZA 1X5YA 1PQZA 1A66A 3G5YB 4KX9A 3ZOAA 3C09C 5BOJA 4KK6C 4AKOA 3GSVB 1GJWA 4Z7UF 3ZR6A 2HFGL 3V4PH 4R7NB 3LSOB 4F58H 4Q6YA 4ONFH 1NH6A 3L5XH 4PJHA 3T3PF 4EI5C 5HGBA 2AV7B 5ICYB 1UM5H 1MFDL 2CJSA 3BQUC 5I19H 3X1NA 2IGTA 4TVPD 3MLYL 3CSTA 2P26A 3V4UH 1WFTA 3QRGL 5KSAB 4PJDF 1OAUL 3FAXA 5DMYA 5E4EB 5FYKD 1DBBH 2WXJA 3OAUL 3OMAB 3UJIH 3QZMA 3O45A 4XVSL 3APNA 4L37B 1CPUA 1JF5A 3FW6A 1ESOA 2VDLH 3LKNB 2R51A 3G08B 5ADOL 1GZQA 1KB9K 3BWSA 4BWTA 4I48B 4WJKB 2G4EA 3G6JA 2VZOA 2DYRB 2XY1A 1T03L 3ZPDA 3LEXA 1OLLA 3ESOA 5LB1A 4TQEL 5DHVH 1YNKL 3FPXA 2DMBA 3MRPA 5T5FL 1CTOA 1IJ9A 3VAEA 5BQ7A 1YMMB 4H1LA 1XIWB 4NI6A 2O93L 4F7MA 3BH8A 4M9PA 2OK0H 4V1DD 4S2SB 5I6XB 5JXAH 5DEZA 1R4XA 3H8NA 4XMUA 1CL7H 4DK5A 5CCGE 4YDVA 3U9WA 2B20A 3T65A 4Y2DB 1L7TL 2WW8A 1CDYA 4Z7OE 4YOKA 2CO4A 1CE6B 1HHHA 4L23A 2OJ1A 3ARFB 3IDXL 3MFFA 2AXFA 3CVHL 4XPTL 3SDCB 3TIDA 4A55A 3T8MA 2FEJA 3BYYA 1T7WA 3RTLA 4KX8A 3VFMB 3DVNA 3RGVB 4Y16B 1A6AA 3FU8A 4QOKE 3RDTB 3VFNB 1BM7A 1MCLA 5K1VA 5LXGH 4QXGH 5AVVB 4G9FA 3ZDYB 1FC1A 2K78A 3CN1A 1AZCA 3HR5A 4E9LA 2ZNXA 1MLCB 2WXKA 1L0XA 5HBBA 4MMZA 4EPSA 4PJAB 5JZ7D 1N0LA 2BIHA 5CNHA 4F27A 1RZ7L 5CU9A 1CO1A 4PJGB 3UBXG 5I6KA 2MQGA 4N2BA 3GMOB 1COBA 4PGJA 4OV5B 3K6SA 3EYFA 2BSCA 3ARUA 4R4ND 5JIKA 4B6ZA 1KJ2A 1W72H 3FQWA 2AEIT 3QIWB 4NWTL 1YEIL 4YNYA 5I1LA 3LKOB 1WZAA 3HBGA 3ZX1A 2QSQA 2RJMA 4HJ1A 4HDIA 2FHFA 2XUWA 3CUPA 4EVNA 1OIOA 2GSIA 3RVVC 1AY1H 3E6HA 2K3TA 5FYJD 4JG9A 5H94A 1LWRA 3V0GA 4MX7B 5A2BA 5IQ9B 3CH8A 2R56H 1IGIH 1M3IA 1KG0B 2F0CA 5E1AB 3PWNB 2GG1A 3VGAC 2AJSH 3QQ9D 5FWRA 3UADA 4Y2OB 4W9GC 3SE9H 5LUMA 1UQSA 2H6PB 2QELA 3QR0A 4HMCA 1OWRM 3RP1A 4OV6F 3IFNL 1CFTA 1DFXA 1H3UA 1X4XA 2RAMA 1R47A 1JZ2A 5C9JA 1OT1A 2KDGA 3TX4A 3EJPA 4MMZC 5KTEL 5IG7B 4LKCB 3HPJB 3NK3A 1VZGA 2BZ7A 3AQYA 3S48A 1HESA 1O7VA 1K6QH 1XH3B 4FE9A 2F2HA 2YA2A 2ZSWB 3RZCC 5F1IA 3N42F 5E8NB 2E6QA 1E4KA 2PW2A 3RVUD 4QRRE 2BW5A 3QFJA 4RZCA 4G7QB 3QPXH 4LSQL 1PF3A 1BEXA 3QG6B 4ISVA 4OLYL 1DSFH 3GIZL 1GYCA 4XAWH 3EJYD 4HUWA 4QTIL 3LXBA 4XTRD 3QO1A 3ARBC 4OZFA 1U33A 3EBGA 4ANWA 3O9WB 2KQNA 4XCNB 5M7QA 3Q7JA 5TPWL 2Z35A 3EGXB 5SX4I 4PPTA 2UWEB 4J8RB 4UCFA 3L3OA 1KPVA 4QHLB 4RGNC 3ZR5A 5DHYA 5I1JH 5I1KH 2QDWA 3A67H 4PJHE 3C5JA 3ZO9A 3MNMA 2DQFA 3L16A 2D03L 2HH0L 1KJVA 2DQJL 3HZKB 1ZSDA 1Z7JA 1RUQH 2LAAA 4FULA 3FT2B 1WF5A 2EC9T 1YJDH 2EDFA 1JRHL 4LDEB 1G9HA 3NIFB 4ZUTA 5CGYD 1DLFH 1MFMA 4M61B 2ESVA 4N8UA 2DAVA 1E7UA 1D7CA 2A2QT 3MN8A 1UATA 3OLGA 5C08A 3G04A 2OR9H 35C8H 1OB0A 1LQSR 3KCPA 3ALXA 2DJUA 2XV0A 1IL1A 3ZUCA 5CJ8A 1IAKB 2J1ZA 1FE8L 1IC7H 2EC8A 2VDQL 4HETA 4DAGH 5AVWB 3G6JE 4XXCA 4ZOBA 1IC1A 2Z0BA 3K81A 3RL2A 4HPHA 1EO8L 2X4SB 5KSVA 3O4LD 2VLKB 1G6RH 4RISL 5IVXA 2DLEA 5CEZH 1IMHC 1G9EA 4PRBB 5IFAH 3LKPB 3RNKA 4JGJA 1BYNA 1DR9A 3QI9C 4WTZA 2OI9B 4BV1A 2AQTA 3CFIC 3GBNL 1UM4L 4TNFA 5J06A 2XN0A 4MJ6A 1VENA 4ODHH 1AH1A 1V7ML 4RRPG 4JFED 4P49A 1KIUA 3I6LE 3L3OC 4TRPL 4PB0H 4YSRA 4IQHA 5E8EB 1FFTB 4LU5H 2JJVA 3AITA 3WS6C 1E6JH 4N2IA 3UTZA 2H0JA 2DI8A 3QJUB 3SJVA 4PJHF 4WHCA 4KO7A 5BCAA 1T0NA 4PGDB 4E36A 1U8HB 3COOA 1OF0A 4G9FE 3IN2A 3QJOA 4XNXH 2W9LA 5FW8A 3IAGC 2NY6B 4YSTA 3FMGL 4G2AA 4WFHE 5IM7A 1NUNB 2H2SD 3P11H 3SE6A 5DQDH 4F8PA 4MQ7B 1D7BA 3GMPB 2FQEA 2O5NA 2RTTA 4NUJA 4OZIA 3ZW3A 2NXZB 1PZCA 4E5XA 4X8GA 1XSKA 1QSFA 2XTJD 3QEQB 1AE6H 3GSRB 4XXCC 2IFFL 3RYMA 1GOGA 5CZXD 1AJ7L 2VR8A 4AVHA 1Q9KA 4J3SA 2OTPA 5DJDA 2HVBA 4M1GL 1RLBA 2DBJA 1T5XB 4MLIA 5GGQL 1U8MA 4H8WC 1RCYA 5I1CL 5HHMB 4ZT1A 1BBJB 3MUGB 5CINH 5EV7A 4HOZA 2R2EA 5CP3A 3GJFK 5EBLB 3GMLA 4BZ1H 4JZNA 3APCA 2CR6A 1YEGL 2K7PA 3CSGA 3LNFA 1QLRA 1FL6B 2YAMA 4APXA 1KFAH 4UUJA 1N6UA 2Q76B 2VDNB 4J3OD 1OAXH 2VLRD 4RIRA 3RDJA 3UTQA 1F00I 4Y5VA 3GSQA 2WINA 3U0WL 1OAQL 4F7EB 4G8GA 4MS8C 3E8VA 3B2XA 2H1LM 3DETC 3I6KA 5I73C 3M7OA 3QARA 4KH9A 3OKKB 2WLLB 1OL0A 3RX5A 1CDUA 3PXJA 4FLQA 1MI5D 4WU7B 1Z5LB 4EDWL 5K9QI 3VFSB 3LEVH 3IJEB 2WBXA 3TEZA 4L4VD 3BSZL 2NR6A 4OM1H 2GSGA 5JW4N 1H6TA 4JPIA 3QFJE 3QXTA 4CMMA 1ZLEA 2OMUB 2P44B 4FQQB 2R27A 3FCSB 3MA7B 3GUTA 3DX8A 4KKRA 4AV0A 4KKAC 4J2QA 1D5MB 3K91A 4NNXA 4DO4A 1YNTB 4FL4C 3BO8B 5GRYA 4UZGA 4HXAH 1OSEA 2GVYA 3ATAA 2D8KA 4QTHA 1T83A 5FO9B 3BW9B 3OSKA 1B2WL 2OCFD 3IXAA 4LSVH 1D6VL 4YDIH 4HF5H 1UJ3A 3GHBH 1WAAF 4LSUH 3QZWB 4Z9KB 4AYFA 5FOBB 3GGWA 3JUZA 3PWVA 3RTQA 1GCYA 1PZ5A 1S7QB 3L3GB 2MTAA 1TF4A 3ZE2B 2Z4QB 1XH1A 4PV9A 4XMXA 1PG7H 5HVGB 4EQ3A 3O3AB 1RZIA 3UIYA 2VLME 3BFQG 2YPLD 2ZOKB 3RQ3A 3I3BA 5C08E 5E99H 1MUJB 2WTOA 2WXGA 4YXKL 3HJ0A 2J20A 2BOCA 3R0NA 4J12A 1T0MA 4EI6B 3MV01 1A3RL 4PJ8B 4KZ0A 2X4UA 5I74B 3N1MC 1Y07A 1K5NB 1PAZA 4WKZA 4AYSA 1V5JA 4PGCB 4TPRL 4MTMA 1IO4C 5DRNA 4K4KA 5EBWB 5DVPA 1K9TA 4OIBA 2N01B 5IVXE 2IDCA 5ICXB 1QBLH 4JY6A 4LPCA 1OV8A 2HRPH 3L4WA 5ABZA 2WP3T 1PZSA 2HB0A 1TZGH 5AVRB 4RETB 1XCWA 1XT5A 4DGVH 3VXQA 2BWIA 4GI8A 1EDQA 4Q0XH 2N59A 2P46B 3TBTB 3BVWA 3G6DL 3I74A 2XWBA 3TA3C 5B8CB 3C5SA 1T66D 5MEQB 4W1TA 5BMFH 4ZX3A 3DI3B 1UJ3C 3GUFA 1IM3B 3G5ZA 4PWIA 2EXSA 2H3NB 4Y19A 3HG1A 2WQSA 3KWXA 4AZUA 1S7RA 5AVUB 3SJVE 3WL9A 5GJTL 3H3BC 4TOYL 5KBLA 4A04A 4KOCA 3B9DA 3JT2A 5BZWB 2DYPB 1DDHA 2WXNA 5JPMA 1JFQL 3AY4A 3L1GA 5L7XL 2ZXQA 5AYUH 1L5GB 3OKDA 2AZAA 2VLJA 1D9KD 3DPDA 4QRSA 4XVJH 5D7IF 3Q6GH 1GPOH 1LJMA 4XP9H 2E9BA 4G80A 4UBDD 4OZIE 1MJUH 1IEAB 2VXSL 1SJEB 2HXAA 4YX2H 1QSFE 4UQIM 5IB4B 4NQVB 2XKNB 2E75C 4UMSA 1EXUB 4EQ2A 1U8IB 1N2RA 2D3VA 1OGSA 2R0WH 2NY3D 3CVDA 4K9EC 1FVDB 1SYSB 5FLUA 3MRQA 3VXSB 5BVJA 3DX1A 5FUCC 5HY9A 4G6JL 3P4LA 4PTUA 3ZDZF 2WXOA 1QPPA 2DM4A 2P5WD 1F1AA 3T2LA 4Z77B 4JGNA 2PR9A 3GSOA 5TQ2L 4GQ9L 4OQTH 2FJGB 4CC1A 2QT6A 4YHKL 3QP3A 3L5HA 4GG6A 5D96B 1OGAD 5DEGB 3OQ3B 3NAAH 4EDXB 1NAMA 1IAIL 4AG4H 2OV0A 4JO3H 2X44D 2PP7A 2F7PA 3GSWA 3MRGA 3TWCH 4KK8D 1JGUH 4WDIB 4Q9BA 4G8GE 2FRGP 5IW3A 3VFWA 2H4EA 1ID5I 1V3LA 2X5PA 5JPMC 1MIEL 4L1LA 3TZVB 3MOBH 5T1MA 3CSFA 8FABA 3P3RA 2OMXA 3IDJA 3Q8CA 5HI4C 3MGAA 4OLUH 5DUBA 5JO5A 2W65A 1UEMA 2BSTA 2WTRB 4PM1A 1JZ5A 3OAZH 5TH2B 1IU1A 4TVPL 1JZJA 4GAAA 1R6VA 3SKJH 3HC3L 4W6XB 1DANT 3TPUB 3VFTB 4AGPA 3EJSA 3D2UA 2D9QB 4HBCH 4OZIF 2WJ7A 3DJZA 4M3HA 5EBGA 2Y36L 3EOBA 4ZSOA 3RWEB 5FYKL 3LH2L 2HN7B 3MV7B 1E4WH 3D25A 3FULA 4BQCA 4UINH 1NCAH 4N8PA 5TDOA 3NZHL 1TPXB 1G0XA 4CC4A 4GXUM 3HAEH 3JWOH 3MI6A 1MG3C 5CIPB 2P24B 1GGIL 2Z31B 4S1RH 2CIKA 3NJIA 1R34A 4K7PX 1U6AH 5FDWB 4YHYB 1AQDB 3SE8L 3VFOA 3DRQA 5L2KD 3PV7A 3VCLA 1HZLA 4DUXA 1FNHA 4NQXB 3VWJA 2K8MA 2GUOA 2FNWA 2ZXEB 2PXYD 1KIQA 1DVZA 1V3MA 4WHYH 4OCXL 4UDUA 4I18B 3THML 1C9SA 3ATFA 3DYMA 5GRJL 3FBKA 2WTPA 3AQDA 4ZTPL 1M71B 3EJZD 4NUGH 2BSSB 4CN4A 4L8CB 1PYWB 3IPEA 4ABUA 4GJTB 5PAZA 4D3CH 1FL5B 2WJ5A 4JVWA 3VACA 2PO6B 3BDYH 1VA9A 5B38B 5L0QB 5DK0B 4M6ML 3D69B 4V2BA 1A0QH 4NM8H 5CWSB 3SQBB 4LPVA 2BIIA 3RIFK 4NN5B 2YLHA 5C0AD 3LV3A 1KTDB 2A38A 1D5IL 3CMGA 4OZGA 3IJ8A 4YBQC 2JXMB 2GJZB 1HH6B 5IESH 3FQ2A 2FL5B 2WBJC 4XGZA 1XF5A 3ETTA 3NN8B 2G2PA 2PWHA 4I77H 3OKNB 4DZBB 5INDB 3GDCA 2V5RA 3VFUA 2Y7QA 1YEHH 2EILB 2ITCA 2X70B 4CC4C 4NNPH 1E8ZA 3NFNA 4MZIA 4RDQG 1FO0B 1DQMH 4AQEA 1VKXA 1DQQB 1NGPL 1CLYH 1DSYA 4Y9CA 4Y19E 3HG1E 2P5EB 4UZUA 1JXJA 2WWKT 2PPCA 2YAPA 1U8QA 1JN6B 3OB0H 3PL6B 3VWJC 4IBVA 2XG4A 1TZHB 4Y4KD 1IRAY 1KGCD 4M6NL 4TQ8A 4WFFD 3K71B 1U91A 3P4OA 1Y1UA 4YDMA 2VLJE 1G94A 1AHWA 3KJ4B 4GG8A 2GYSA 3DROA 4WI2A 1E65A 1M7IB 1W0VA 32C2A 2F6AA 3QCTH 5E94A 4P5TA 5FYJL 4X98A 2VXTL 3TTYA 3GI9H 1C5BH 3NIDE 4UNTA 5F7NC 3TWYA 2G4GA 2VIRA 3X3GH 4LF3A 3VXMA 2QJDA 1A7NL 4NPYB 1XR8A 4O5LH 4PG9B 3FRUB 3EFFB 3H55A 3W3BA 1EAPB 2NY4C 3EO0B 3LQAH 1YPZB 5JDSB 5M95B 4QRUB 3BJ91 1OP3K 2JQMA 4EXKA 5A6LA 2ZD0A 3BT0A 4LP4A 3R1GL 3CSBA 2VR9A 1QABA 2BC4A 3U30C 4PJCF 2WUCH 2BS71 4BRJA 1HNGA 3FONA 4ZMQA 1Y18A 2KYIA 4NHCH 5EDXA 1USQA 1QFHA 2V2TA 4OI9A 4QYOB 1JERA 1F4XH 4GG6E 1MNUL 1EHNA 1A9BA 1HAUA 1RP8A 3QUYB 4FYRA 5F70A 2BVEA 4R4BA 4AQOA 2CE6A 1J5DA 1OCWH 3WFHB 1A7PH 2ZCKH 3MCLH 3ARDB 5DURD 1ECZA 1PS3A 3PDOB 1BGXL 3V5KA 4HS8L 5F6HI 5EEYA 1KTJA 4LSSH 5FKAA 4LKXA 1A2YA 5ABAA 4M93C 4PW3A 1AR2A 3LVTA 5L88H 4XWGH 1MVUA 4DPRA 2VL4A 3WD5L 1CF8L 1PDKB 4MD0B 4P5TC 2CBTA 3VTAA 3KW8A 4M7JL 1SXNA 2K6WA 2WVVB 3ZKXC 3RL1B 4BZ2L 3DJRA 3UJIL 2F5BL 4MXWL 4AWJC 4JM4L 2DQ6A 3FC8A 3NJVA 5D6DA 3ASOB 3MRJA 4BSJA 4ZSOE 1U8JB 1C16B 4OJCA 3EAKA 2B1HH 3CQFA 2A9CA 3QW9A 1AS8A 2VXQL 4NLAA 3FFCA 4PJFB 2Z3FA 2DF3A 5FCUH 3UTTA 2FT6A 1UVQB 2D7PA 2IH1A 3NSCA 4G3YL 5DHMC 2YPVA 3L6FB 2NY7H 1U93B 2IQ9L 2XBDA 2H6OA 5ACZB 2PUQT 2BP8A 1FZJB 4H20H 2AC0A 1KLGA 4ANUA 1KYAA 5F7BA 4IDJL 2NY5H 1AKJB 2EDTA 3RUGA 1KMGA 3QIUB 3GO1L 3P0VL 3TEYA 1PG7X 3MX0A 1A65A 4I3RH 1FBIL 1GJIA 4GG6F 2BRRH 4CU7A 2VC2B 4PJBF 1T5WA 3AXLB 4J7RA 1A7OH 4ABWA 1WRFA 2Q8AL 2E56A 4ZS6D 2C1OB 3NCEB 3IB4A 1FDLH 3VD7A 5CJOH 3F7VA 4NQEA 4GMTL 4JK0D 3ZMNA 4UOJA 2QKIA 4FS0A 1UWXH 1JZ3A 4JFPA 3VFRA 1VJSA 1BZ9B 4TSCL 3ML9A 3UCQA 2YN5A 3ZE1E 4YEFA 3HMWL 4L3EA 2AGJL 2VQUA 1UYWL 4OZGE 2YKLH 5B1KA 3IGLA 2VT0A 2Y7NA 3PJSA 4LHUB 3TO4C 1UGNA 1WEJL 3RWDA 5ELIA 3O6FD 4M4PA 2WLHA 4C83A 4HX1B 4JO2H 1KB5H 4Q7DA 4GMSL 1WUZA 3NABH 1IT9L 3O3BB 1A7QL 2IDTA 2LGNA 4WAFA 4Q4EA 4QYAA 5D7LA 2H41A 3CXDL 4K23H 1RJCA 1IM9A 2DY2A 4HH9A 2GTZB 3D87B 3B5GA 4JRXB 5FK9B 4J27A 1QSEA 2HTLC 4Z7VF 2QQLL 4WZ9A 3MCKB 4U0RB 2YAOA 3KXFD 4JKNA 4XMZA 3VE0B 4NDMB 2Q7YB 3P0YL 1OTSC 4JPKH 2AZUA 3QDJB 4O9HL 4YGVB 1HINH 3R06A 4M7ZB 2FIKB 2PTUA 3WXVL 5BRPA 3VFVA 2AKRB 1AQKL 3OJDA 4DEPC 2WHVA 1WFUA 2JKWA 2Q8BL 4P2CG 5D1XD 3VXME 1SVCP 3NBNA 1WIUA 2J1YA 5D1ZD 4WO4B 5CKGA 4A7SA 3ZE1F 1P4LA 2QVFB 4RBPK 1PZDA 1H3PH 1DBML 4LQFL 1JV5B 2O30A 1NQBA 5BNXD 4K2UL 5DMGD 1SF3A 5BO0D 2BOBB 4TTDC 1E9OB 1EUUA 1WSST 2P3YA 4HHGA 4LOUD 4YLQT 4BH8A 4KITB 2ICWB 4H88L 5IROD 1AMYA 1ZV5A 3OZ9H 4HS3A 1U8KA 3UIZA 3VXRD 4M7LH 5KVGE 3QULA 2WAQA 1I7RB 3L95B 2HP4A 5LWYL 3NIGF 3CHPA 4M48H 1P2CB 2HLFC 4DTGH 2EEBA 3KWUA 3IGFA 2OXGA 2HFTA 4IW4C 4JW3A 7PAZA 4WVRA 3VJ6B 3EJTA 2GFBB 3L1OL 4HZLA 3WUWG 1T1ZA 3FF8A 2FD6L 1Q9LB 4L8BA 4K5LA 5EU5B 4LSPH 2C4FT 4XAKD 2IH3A 4I0PD 4NO2A 2E7BA 2DWEB 2CO3A 3CU7A 3Q0HA 2OR8A 3L5JA 5GIRA 1P7HL 3AU0A 1S3KL 3T1FB 5JQ6H 4X99B 4YHOH 4UNIA 2P28B 4QF1A 2DQEH 3CSYA 4XBGB 2WAHA 2WNXA 3KPQA 4PU2A 3FFCE 2D7TL 5KSUB 2VC2H 1AGFB 1IAIM 3UTTE 2VUKA 2COVD 1LK2B 3FO9A 1XGUB 1AS6A 1NLDL 1LO3H 2ZYHA 2O5ZH 4GW4B 4U6YB 4AVIA 3ESMA 4LK4A 1BD2A 3KPSD 1FNEB 2VKXA 3AS2A 1ETA1 4HJEA 2H8PA 2J5LC 2EP6A 1KNOA 4Z7NB 2VR5A 5DJYB 4JM2B 4ODSH 2ADIB 5CSZA 3RUGE 3UP6A 5I16A 3OKLA 4R2GC 5J7CC 2SEBB 2FECI 4TQPA 1I9EA 1NDTA 5IBTL 1GW0A 1S9WB 2VDPB 2XACC 2YD7A 1DLHA 3ARQA 3FSZA 3PG2A 5T1LA 4PGBB 4NENA 3BT2H 1E4XH 3JVGA 3LN4A 3DUSB 1IAMA 3QGVA 4WF7A 2N7BA 3BP6A 2A83B 3DGDA 4LARL 4NQEE 4WGVB 2IG2H 4KO6A 4PLKC 2IAMC 3C6LC 4Q6KA 1LD9B 1G7PA 3V9EA 5H2BB 2DS4A 2Y3AA 3STLB 5IMOB 2UUDH 5FHAL 1XAUA 3JWDH 4L3EE 4ZUWA 4XNZC 5DU7A 3QZLA 4BGLA 2CCVA 2CO1A 3WJLC 3BGMB 3H7LA 1QLFA 5IHZA 2XHNA 1RZKH 1LO0H 3DK2A 3OAWA 4TUKL 4KRNA 5FM5O 4QHKI 1KBWA 5D4QA 4Z6AT 2HKAA 4IHOB 1NLBL 1T4WA 2NUTB 4UT6A 2YEVB 4XMWA 3RAJH 5E2UH 4NZRH 3ERXA 1JMZA 4FZ8H 3WOVA 2X88A 5CAYB 2MNUA 1T04B 2AJYL 4NCC2 5CN1A 4AIEA 1R5WA 5E9DA 4IGBC 3BCFA 4JHVA 4U1JA 4LHJB 4AEIL 4MA7H 5FFGA 1QSEE 3FOMA 3ZZLA 4M1DH 4TSBL 2F53B 2YUXA 1ZE3C 3O2VH 3LEYL 3BZEB 2GKIA 3U48A 3SN6N 2D7OA 4JPVH 1EX0A 1J1XH 1G1YA 3JVGC 1BA9A 3UERA 2BNRD 2RCSH 4MB1A 3WNOA 3T3MB 4KQ3L 2PLTA 1X5AA 2HRHA 3MXVL 4UDTB 4ZFQA 4XOCA 3SPHA 3N85H 4ZMTA 5G4NA 3HI5L 1NUFA 4HUNB 3QRBA 1FRGH 4FFZH 4JPSA 4N9GA 5DVMA 2LAGB 2X6MA 4A68A 1WT5A 4EIGB 4LXFA 2EXYD 2FEEL 2ETWA 3NRFA 1FV1A 2NY0D 3FB6A 2Z8SA 3RVTC 1JGEB 3CQQA 3FUHA 4QY8B 3B3IA 3EYSL 4HWBA 4JO5A 4PP1D 3OJMB 3QUMH 2Y06L 4LHQB 2L7UA 4QHNB 3PYCA 1FNSH 4LVEA 4W70A 3T1WA 2F7QA 4YLCA 2ADJB 3REWA 3VSTA 4JG1L 3FU7B 3HNSH 3N41F 3WAKA 4KX7A 3LRHA 4JANB 1G7IA 1T1WA 3Q9PA 2YAEA 2J1WA 4LAQL 5I0XA 1UOKA 2AQNA 3V5DB 3WY4A 5FS5A 1WBZB 3QEUA 4C47A 1GZPB 5FFOA 3U4AA 3WIIL 3ARED 4X9IA 1URIA 2I5YH 5GGVY 2R15A 4F91B 3SOBH 2VOTA 2BP0A 3D2TA 4BYHA 5KVFH 1GC1H 4JHAL 4XCYB 4DKEH 2GJPA 4IRZA 3TT1H 1GSMA 4PJ5B 2K7QA 4ONGL 1X6NA 2XZQH 4QAWA 2Y4SA 3KGUA 3IJ7A 4JKKA 3FOLA 1WT5C 1IZJA 2QADC 2YSSB 3AQXA 4EF3A 1TIUA 3FTVA 2YC1A 3MRMB 4G8FA 4P57B 4OJYA 2HLAA 3MROB 4OJAA 5F7WC 3SDAA 2IC2A 4LVOC 2VDML 4BCZA 4WEMB 1BD2E 1CFBA 2PTTB 3SKMA 2BVQA 5F9DC 4YDLB 4K94C 2LU4A 4MMXB 2ATKB 3MRKB 3KPOB 5ESAA 5KOVC 2XWZA 3VI4A 2HA1A 4B9IA 4RWYL 5FGRA 4FQXD 1Y6MR 4OZHA 1HH9A 4JMNA 2EUVA 2EZ0C 1BQKA 4JKPH 3DO7B 2O61B 2ZCHL 5DD1L 3PWJA 4OF0A 1N5AB 4W6WB 1TJIL 3GXPA 4QRFA 4ZYKB 3BPCA 4LASH 2J72A 2MPAL 2Z91B 5AW9B 3NH7L 2FYYB 1QWNA 2UXTA 5GS1B 3PUUA 1HI6A 4OB5L 4Z78B 4PRPB 4QO1A 4WUUA 4FQCL 3WMQA 3CN2A 1BG9A 1HWWA 1VGKA 1E9QA 1ZT4B 4OJFL 4DETA 3REVB 1LDSA 2F54D 4A6YH 2UY7B 1NCHA 3P73B 4EOWH 1CIDA 1JCVA 1LO5B 2ZCLH 2APTA 1P1ZA 5DYOA 4M5YH 2HT2C 5E6ZA 1OCZB 3LZFL 4QI3A 2ZKHH 5LGJB 3MRIB 1DL7H 4TNGA 3MV11 2OMVA 1L6PA 1JGDA 2N56A 3OX8A 4GS7B 4KHXL 5CN2A 5E9AA 1LE5B 5E5UB 3SDAC 5TE4L 1P6FA 2KZKA 2NX5B 1TTGA 3C5ZA 4YHIA 2F5AL 3RWIB 2X7LA 3HC4H 3ISWA 1A8ZA 2ZPKH 2CXKA 1JZ4A 3TNNA 3ILPB 2YPVL 1YQVH 3P3YA 4A2GA 5KANI 4RDQF 3L2NA 1OAKL 2CGRH 3X14B 5E9DE 3KYNB 2ZUWA 3MGTB 4PCTA 4G7YL 4R6UA 3PAZA 5I2IB 4POUB 4NZTH 3NRPA 4CVXA 3T0EB 4Y89A 5KZCD 1A6ZA 1MJ7L 2AEQL 3KM2A 4AGLA 1XGTA 4OJDH 1RP9A 1I8MB 4WHDA 4GKSA 2XWEA 4G8IB 4MB5A 1G9NH 1SYVA 1N8ZB 1XXFC 1OW0A 4OLXH 1XFPA 3KBHE 4FYSA 4KXZI 2ZKWA 1OPOA 2FJUB 4KK6D 1NCNA 1BXVA 1GW6A 3HBZA 4IU2A 5DJZB 2J5WA 1N6QL 3U7YL 1FNGB 1SUJA 2O1AA 1AFVL 3CC5B 2XVKA 5BV7B 3WNNA 1QFPA 2P43B 4EI5D 1OOAA 2E7DA 3BQUD 3LKQB 5I30H 3IN0A 3VB9A 2EKJA 4YSPA 4U7MA 2QPEB 3L9YA 2PN5A 1QX1A 2BS9A 5FUOL 2JSFA 1I3RB 2WMPB 1FZMA 5LGYA 3ZKMC 3NVQA 2RFXB 1HWHB 2J6EL 5C3LD 1QTYT 1UZ6E 5J13B 3IE9A 4YFLF 3C5ZC 4JY4B 4DVRH 1R0AL 1X5HA 5CILL 1FL3A 1V27A 2F19H 4QRTB 5EZPA 4CVZA 4HWZB 3D3VB 3L3IA 4ZMZA 3IMUA 1K8IA 4TQHA 2V17L 5CUSL 4DO6A 4FX5A 5CCJA 1B3JA 3I02B 2R0ZL 1A7BA 3KYOA 4U6TA 5EOCJ 4H26A 5CGBA 1V7NH 2H45A 2JCWA 2NXYC 3IF1B 3IKCB 3MMEA 1JGIA 1PCSA 4J1UA 2OS7A 4TUOA 5GRXG 3D0AA 3GMNA 4Z3FA 2HAZA 5L6YH 1IFHL 1AXIB 3VI3F 2ZWSA 1U3ZA 4KFZC 1LP9F 5DJ0B 3W81A 1WTGT 1OW0C 3H9HB 4NRYA 2ARJB 2B1AH 3G5YA 5A2IH 3UJJH 2EIJB 2E6JA 3US0A 2W1NA 2E27H 4N4YB 1PFOA 3S5ZA 2EDHA 4R7NA 1I7UA 4DW2H 4WK4B 1KYDA 3D48R 1OEZW 4Q52A 2VUOA 2AV7A 3FQRA 2E86A 4HFUL 5E8OB 3E80A 5HDBE 5ESQA 1E9PB 5C7XH 1Y6NR 4I89A 5C0JB 3SGEH 4C8XA 5D7EA 2XCMC 1OE3A 5GISL 3RWFB 2FX8H 5KSAA 3T0WA 1ITCA 1IE4A 3FHAA 5CGTA 2X12A 3O2WH 4Y2NA 1GOHA 3I6GB 4ZW5A 4YO0A 5BS0B 3BD5A 3ILDA 3VI4E 2LE9A 1QEWB 4FHKA 4OZHE 4X8CA 1ET8A 4L37A 5D1QB 3LKNA 3G08A 5IQ7L 4P46B 1XGZA 2GITB 1J1PL 4I48A 4HK3N 3F7LA 3CLEH 3CZGA 2AXGB 2ZJSL 3EOYG 3DO4A 3ARSA 5AUMB 3C2SA 4AV5A 1FZKB 1CK0H 5DFAA 4HG4K 5D55A 2J6WA 4WUUE 3WFZA 3N1FC 4Y9FA 1Z0MA 1JDAA 1SN0A 2YBRA 5HI3C 1XIWA 1Q0XL 2QV2A 5CZVH 2VO8A 1X5ZA 5IB2A 3OL2A 1N70A 4S2SA 5T33H 3T0XA 3B6SB 4G5ZH 3RVVD 5KW9H 4FF9A 1DE4A 1P7BA 1MRDH 4LBAA 1MWAL 4Y2DA 2OMNA 3QZWG 3IS1X 1CE6A 4KNSA 3SDCA 4FXGA 4P2QB 4FXTA 2W9DL 3VFMA 3GS0A 3RGVA 4Y16A 1KWGA 4PBVC 1T89A 2CHXA 3RDTA 4NQDB 3VFNA 3FT4A 3ETBJ 4WSKA 5HDBF 3NACH 5KSAC 4XPGL 2CM5A 4DKFL 3ZN6A 5E4EC 4HOMA 2QGCA 4PWGA 3RVXC