1OO2A

Crystal structure of transthyretin from sparus aurata
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
b'RCPLMVKILDAVKGTPAGSVALKVSQKTADGGWTQIATGVTDATGEIHNLITEQQFPAGVYRVEFDTKAYWTNQGSTPFHEVAEVVFDAHPEGHGHYTLALLLSPFSYTTTAVVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transthyretin
publication title Distinctive binding and structural properties of piscine transthyretin.
pubmed doi rcsb
source organism Sparus aurata
molecule tags Transport protein
total genus 25
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1oo2A00
4DESA 2H0JA 4AC2A 1TZ8A 3CN2A 1IE4A 1DVZA 3ESPA 1TT6A 5L4JA 1TTCA 3OZKA 4WNSA 1F86A 3CFTA 3DJSA 3GS0A 4PMFA 4Y9CA 1ZD6A 3NEEA 4TL5A 3I9AA 4QYAA 3CXFA 4MRCA 4PWKA 2IGLA 1SOKA 4L1SA 2B14A 3A4FA 4TNFA 2B16A 2G2NA 1BZEA 3IPBA 4PWEA 5AL0A 2FBRA 3NEOA 3IMSA 2H4EA 4HJSA 3DJRA 3GS7A 1THCA 2F7IA 2G4GA 3DGDA 3QVAA 1IIKA 2ROXA 4IK7A 2G3XA 3U2JA 3FCBA 4DEWA 5BOJA 1QABA 3DJTA 1FHNA 3KGSA 3IWUA 5CLXA 4ABUA 4IKJA 4TLUA 5AKTA 1Z7JA 1KGJA 5CM1A 3CBRA 4TQIA 5EZPA 4TQ8A 3TFBA 4N86A 2TRHA 3I9IA 2H1XA 5FW6A 3ESNA 3A4DA 3BT0A 5CR1A 1TTRA 3P3RA 2QGEA 4HJUA 5FO2A 4L1TA 5JIMA 5K1NA 1DVSA 4FI6A 4N85A 4HIQA 4TKWA 3TCTA 3IMWA 2G4EA 4TQHA 2QPFA 1BZ8A 4IKIA 1TLMA 5E23A 4I89A 5K1JA 1TTAA 5FW7A 1TSHA 4ACTA 2NOYA 3OZLA 3DK0A 3DK2A 4ANKA 5IHHA 4TQPA 3CFMA 4TL4A 1DVUA 1QWHA 4ABVA 3U2IA 4HISA 1DVTA 4QXVA 5AL8A 4IK6A 5TTRA 3M1OA 1ZCRA 5AKSA 4D7BA 4PWGA 4WO0A 4PVMA 5E4OA 2G5UA 3B56A 4KY2A 1GKOA 1X7SA 1THAA 3CN4A 4TNGA 1SN5A 1SOQA 2TRYA 4ABQA 4DEUA 4MASA 4TLTA 1Y1DA 3FC8A 4TM9A 5DEJA 1ETB1 2B77A 5EN3A 3GLZA 4HJTA 1DVQA 2H0FA 4FI8A 4I87A 3IMTA 2GPZA 2QGCA 4IKLA 1RLBA 4Q14A 3P3SA 1ETA1 3IMRA 1BMZA 3GPSA 2PABA 1KGIA 1IIIA 3CN1A 4YDNA 2H6UA 4PWFA 4PVNA 2B15A 1E4HA 1SN0A 4ABWA 4IKKA 4DETA 3IWVA 2ROYA 1ICTA 4Y9GA 2QELA 4PWHA 5JIDA 4YDMA 4QRFA 2G3ZA 1BM7A 2FLMA 1E5AA 1DVYA 3DIDA 3SSGA 4N87A 5CLZA 2B9AA 5JIQA 1TYRA 5L4MA 3CFNA 3GS4A 2QGDA 5CN3A 3HJ0A 1X7TA 3GRBA 4PWIA 2F8IA 3DJZA 4IIZA 3D2TA 1SN2A 1BZDA 5DWPA 3DO4A 4Y9FA 3A4EA 3KGUA 3D7PA 3P3UA 2GABA 4I85A 4PMEA 4PWJA 4PM1A 1IJNA 1DVXA 4Y9BA 1OO2A 5AKVA 4WNJA 3NEXA 1F41A 1FH2A 1GKEA 1G1OA 3IMVA 4TLKA 3W3BA 2G2PA 5HJGA 5CLYA 3Q1EA 5A6IA 1TFPA 4DERA 3NESA 4TLSA 3IPEA 2WQAA 5L4IA 5L4FA 5FW8A 2G9KA 3P3TA 3CN0A 4Y9EA 2H0EA 1E3FA 3KGTA 1TTBA 4PVLA 5CNHA 5E4AA 4AC4A 3CN3A 3CFQA 3ESOA 3BSZA 3IMUA 2QGBA 4FI7A 3NG5A 4TNEA 1U21A 5AYTA 4MRBA 3I9PA 3GRGA
chains in the Genus database with same CATH superfamily
2WVUA 1OM3L 1U8NA 3HRZB 3NT0A 4OLUH 5H8DA 2VXTL 4GS7C 3HHMA 1YZZA 4Q2ZA 2V9QA 1N6QH 1A1OB 1U8LB 3JWOH 4PMFA 2VQ1A 4YWGL 3CLWA 4FYQA 3E6HA 1ET8A 2YGQA 3A67L 4XPAH 5AVSB 2E4FA 3MKKA 5I2IA 1HHKB 4YHYC 3I3BA 4XVJL 3VD9A 2FO4B 5D7IB 2FJHB 3O0RL 2KT6A 4I0KA 2A6DA 2D31A 1IIKA 2ROXA 2WLLB 2Y5EA 3S34H 1FHNA 3WFHB 1MJ7H 4Y4HA 5E8PB 1IGFL 4IRJB 3R4RA 7TAAA 1RL1A 4WK2B 2ZUQB 5DJ2A 2ZXDA 4Y2DD 2TRHA 5EEZA 4ONFH 3ZIYA 1H6EA 5T3XD 3PCYA 2ZCKH 2HFTA 4L29B 3TZVC 4Q9RH 3TLRA 3GMLB 4ZXBC 5D1XC 4ZD3H 4I89A 5GGVH 2J8OA 5G4MA 3C12A 4NX0A 4BGLA 2DRUA 4PJ7F 3DURA 3IS0X 1VGKB 4A2HA 1QWHA 2WLHA 5DJ8B 3AUWB 4IRSC 5K9QG 4HUXA 3HB3B 3OR7A 3K8MA 5MEPB 1AQHA 3D0AA 4X99B 2CO3A 4MNQD 2BVPB 4G5AA 1X7QB 3TURA 1MAKA 1Y1DA 3L17A 4FQHB 4NKMB 3UYRH 1KT2A 3NCWA 4FI8A 4Y4KC 5FF6B 1MCNA 3O2WH 4WFHD 5I8KH 1AGDA 5FUZH 4AYFA 1U8OA 5AOIA 3VNYA 2WSDA 1F11A 5J9PB 4NOBA 5DD3H 5FDWB 4GAAA 5DWUL 4KKBD 1LGVA 2ROYA 4IOSD 4KROC 4PWHA 5KJ7E 1QRND 2CDGA 1JPST 1PLBA 4Y5XB 4L4VE 2X89D 3LRKA 3QWNA 4ZPTA 5A2CA 2JKNA 5D7HA 3V4PA 3FQ4A 2B59B 1ZLWH 4PJBA 2AMGA 4JCLA 4M5YL 4IRZA 3C87A 3NH7L 1XBDA 2WLIB 3Q8EA 1IQDA 2B5IB 3IFPA 2YD1A 2COVD 4X4XB 4YBHA 4L4TE 4OQ1A 3HPJA 1BX2A 2WUBL 3VGBA 3WS3B 3X14A 2A99A 2H9GA 1P4BL 3H3PH 4IJ3C 4N20A 1IU1A 3WJLC 1AE6L 2Y4SA 4FL4C 4AL8L 2M1KA 1NZRA 2X70B 5L4IA 2F9BT 2Z8RA 3N41B 2O5ZL 3SGDI 4PVLA 5I0WA 3DHPA 1HC1A 5M7QA 1WAAE 3BUIA 3NPSC 4GBXC 2A74A 5K9KB 4JZJB 4TTDD 2JCCF 1KN2H 2FT7A 4N4YB 2CRYA 2OTUB 3CLFH 4PS7A 1Q8MA 5FA3B 3W0WB 2GJ6D 5DI8A 3EJYD 1F2QA 3N1QC 3NA4A 1KEML 2ZXAA 4M29A 3O3EB 2UX6A 3DOIA 2N0MA 3SKJH 5BV7L 1NCNA 2KI6A 4YS4A 3AG1B 1W8NA 3SE8H 2F53B 2HWZL 3OKDA 5AYUL 3IBOA 2WSKA 3Q06A 1A22B 4FQIH 4FTVB 4N5EC 3TT1H 3WUWG 1VFBA 2JCWA 2BM3A 1G6RH 1AO7E 3Q8FA 4F37F 3GHEL 3CDGA 4HLZH 2FL5B 1VA9A 3U4BL 1KCKA 4N90E 2CGRL 4HJUA 5EIVA 1B0RB 4PJ8D 3LXBA 2EH7L 2ITEA 5LWYH 3TWCL 3D2UD 4RGNC 3LYRA 3OGOE 4G7YL 2P7TA 3ZRSA 1FYTD 1MLBA 2KUTA 2LU5A 2VDPB 2Y24A 2EXYD 3SDYL 4I9XA 4P8QA 1CWVA 3LKOB 3MOAL 3ZTJH 3FQRB 4UQBA 5DHVH 4XAKE 1ACCA 2CR3A 4HKBB 3E6FA 4X8JB 1LHZA 3ARVA 5HHXL 4XCCL 1BQRA 3M46A 1BW8A 3BP4A 4NGHL 1H15A 4HJ1A 3SDAD 3ARSA 3D4GA 4GMTL 5ICUA 2VDQL 4UF7C 2J8UB 4HAKA 3FUNA 5GJTL 4E41B 4EI5D 1C9SA 3ULVC 1I9RL 4KX9A 3P2TA 1CLOL 4LHUG 3ABKB 1MFEH 3GMQA 3D39B 5INDB 4FA7B 4LBEA 4XXDB 3QJVB 3HW7A 4XP5L 5FYJE 5E8NB 3SPIA 3QGVA 2HRLA 4ODUB 4IMLB 5EZIL 5HYSB 2VM9A 1UYWL 5C7XH 1WT5C 1SYSA 4WNQA 1U30A 5DQDH 3FUDA 1CG9B 5TPWH 2Y5TA 4QO1B 2DQTH 4P5TA 3QUGA 3SBPA 2DLGA 1TZGH 2J2ZA 3H8NA 5LXGL 3DO3A 4JFDE 2V9TA 5DXWA 4CVWA 4AKQA 1DDHB 3CMGA 3TPKA 1NDGB 3FYIB 3HJEA 4AWJC 3KYAA 3GXPA 4BCXA 4MCYB 3NZSA 2AAAA 1MW2A 3C5XA 1C1EH 4R96B 3Q44A 1KLFA 3O9WB 1ZLSH 3R8BB 3RBGA 4ZYKA 5I74B 1WZAA 1XX9C 2PYEB 3BHBB 2NY7L 1GIGL 4MD0B 4NQVB 4Y7OC 1NBCA 4CSSA 3FUFA 1ETZB 3QUKA 4AW7A 4A67A 1JXFA 2VDKH 1WD8A 1PEZA 1QKZL 4TMPA 5CKGA 3KPQB 4J3BA 4Q6IC 2XV6B 1RUQL 2E7CA 1QR4A 3S4SA 2FQFA 1AXSA 1X9QA 3OKLB 4JM4H 4XPHL 4NAJA 3RNQB 1J05B 2FYYB 4ZX4A 2PW1B 1OEZW 1I7ZB 1HHGB 5KBPA 1DJSA 1DJGA 4ABUA 3HE7A 3NJIA 4UIKL 2NSMA 2VISB 4DZ8B 2VR8A 4IJTA 5CGBA 5J11C 3T65A 4OF0A 2LLNA 4OZGF 3BQUD 2F58L 5F89A 4D0BA 5I18L 2YLKA 2ZX6A 5HVFB 3S3PA 1XL4A 4I2XA 2E6QA 2X3AA 5ID1B 2OMWA 3PXJA 3HRPA 1R3HB 2O5XL 4LEOA 3H42L 2ESVD 5EZOL 1ITBB 3QUZB 5EF1A 4E42A 2H41A 1XGPA 5GJSL 1S9YB 5FYKH 4LL1A 4AIXA 2VLJE 3TBCA 4QHPA 4NO0B 5CZVL 4ODVH 2ZWLT 3I6SA 4HIXL 1WFOA 2WWOA 4WCYL 4F15C 4LEXL 2ZXBA 5SX4I 5KN5B 1YEIH 5HDOA 4JJOA 1R5VB 2AJVH 3F85A 2X4SA 4ZSOE 3RA7L 4KTYA 1RUPH 1U4EA 4NRXB 4DETA 3HUJF 1Q0YH 1YEFH 4WIQA 1L4IA 2X7LA 4HUKB 4URKA 2WV3A 3QIUC 1FL6B 1A9EA 3H9SA 5C70A 5TDNB 2VLJD 4Z5RA 5IVXA 4IBWA 1LK2B 5CGYC 4OI9A 4JDEA 4HAFA 3BISA 3UH8A 1ZT7B 4O02H 3WY3A 3N50A 2QTEA 1ID5I 4W9LC 1XB3A 2KERA 2GFBB 3ZGHA 2SEBA 2BP8B 1BJMA 4MSWA 4ETQA 3RX9A 2BINA 2EYRB 3FN9A 1OTSC 1VADB 4I48A 3UIYA 3N04A 3DIFB 4A2MA 3BOVA 1ZLDA 3L81A 2P8PB 2G2PA 4WU7A 1CT8A 1RZIA 1CXLA 1YPZE 3UJIL 3P11H 3V6ZA 1TIUA 2WQAA 5B21A 2OXGA 2KS0A 4I77L 1DO5A 3CSBA 2AXFA 4H13C 2ZZUT 1YUHB 4GRWB 5GGRA 4JDZA 4MRBA 4P4RA 5SWZA 3AM8C 2LW3A 3L3DA 3MNVA 3HLKA 5FKAA 4AC2A 3GSQB 1KEGH 3V0EA 3T8MA 3P73A 4PJDE 5E9NA 2GT9A 3SDCD 2ZX8A 3KL0A 3V0HA 3R7QA 5C0BE 3B9KB 1CICB 3SYAA 5DZNA 4ZS7H 2XVGA 2DF3A 4B53A 1XCQB 5GRJH 1XIWA 1KN4H 2A9AA 1FZMA 4N8PA 5EU4B 1JF5A 1B4JH 1FAKT 3NCXA 5AYQA 5HGAA 2CM6A 2VDML 4WUKL 4EBQL 4JRXB 1BVKB 3UG5A 2RCSL 4JRYB 1LP9E 1HQ4B 3VSVA 3MV7E 4MX7A 4XBPA 1DFBL 1UFUA 1JGDA 2H26B 5IKCA 1SBBA 2ADFH 3C09C 3LQAL 1E8YA 1WWBX 1J12A 2C3WA 3NJFA 2QGEA 1OAKL 2IMMA 1KTJA 3EJZC 2EEXA 2BS9A 2EUZA 1FP5A 4ODTH 4Y8DC 1E5BA 3FSAA 4BFEA 5SWSD 3T0XA 2DOCA 3CFMA 4BQ9A 1BBJA 1JGEB 5I1DA 3KPMA 2YKLH 3CFBA 3UPAA 1T21A 4Y16D 1C5DB 2HN7A 3LKRA 4AQOA 3CSGA 3NABL 3MRMA 5GS3A 5MERB 1HSAB 2CRZA 1UACL 4H5SA 4QCIB 3EOBB 4AVHA 3HAEA 4TM9A 3MLWH 2E59A 3LNFA 3SKMB 3ZRCC 2I32A 2XVLA 3GIVA 4PRPA 4GG6A 4CW1A 2WQWA 4AH2A 1CFBA 4GEJA 4GUQA 3ARGD 3DX9A 3LEVH 4YSDA 4ELMB 3LN5B 5HJ3A 4PWFA 1V3KA 4KVCH 1XH2A 1JI2A 3L45A 4YR6B 5EUKA 2R9HC 3KYKL 4ZFZB 2A1WL 4KNTA 3X3GH 1RZPA 4ZUVA 3VX0A 1N5YL 5J57B 5AAMA 4NKQB 5D2NE 2VDQB 2P24B 4BSJA 3UG3A 4EIGB 4KFMA 1LDSA 2J8HA 3NJVA 3U0PB 1J88A 2LE9A 3QCVH 3VWJA 2K70A 4AENB 1F4XH 4H8WL 3BLKA 3MYJB 4XN8A 2VMFA 4KTDH 1ZSDA 3QK0A 3LZRA 3KLQA 3JT2A 1TFPA 4M6NH 4MVBC 1FZKA 2WVTA 4EXPX 3S96A 3VXSD 3RFZB 3WNMA 2VKXA 4FFVC 2O6FA 1GHFH 2A7BA 4UT9H 5KVGE 2XJKA 3RAJL 1EVUA 5KANG 3UTSB 3BWUC 4FI7A 1OAUL 3PQYE 4IBTA 1T1WA 4QRUB 1OSYA 1TQUA 5T1LB 1LEIA 3DX8A 5B38G 3QI9B 2F54E 4AY0A 3IJSA 3DV4B 4GW5A 5JHLL 1G1YA 4MJIE 4O9HH 1HZHH 3BWAA 5F8RC 3FTGB 4K55A 3TV3H 1PVHA 2MNWA 4U1LB 4KJPC 4ALAH 1IM3D 3P4NA 4NI3A 5AVVB 4E5XB 5K9OB 1W72B 1JMZA 3QS2A 4WTZA 3RWDB 3ISWA 4I5BB 2EZ0C 2BJMH 3PHQB 3NACH 1OCWL 3MLYH 2NR6C 4DGYH 3JV4B 5C2UB 1LM8V 4L3EE 1ZVSA 3GKZA 3FCGA 3V0GA 3E3QE 2W9DL 3FOMA 4YUEL 1H3VA 1QYGL 4JM2A 3VM7A 3JUYA 5CLXA 5EF2A 4HDIA 5TE7L 1PZ2A 4G8AC 3X12A 3ZBMA 2EYTB 2GIYA 3QWOA 5DLMH 3ZO9A 3HC0A 2C9XA 1J18A 1HCVA 1AGBA 4B7LA 4M02A 3P0YL 3WXWL 3HRZA 1NINA 4IEFA 2DMCA 2YJLA 3TZVD 3VGGA 4XMKH 5IQ7H 2EEDA 5ISZB 2B4CC 4ZXBD 1A1OA 2H47C 1U8LA 2IAMC 3BZ5A 5D1XD 4P59H 3BXNA 2LOEA 4GRLB 4JPQA 4FQLH 1HHKA 1LEGB 1RJYB 4IRSD 3A21A 1BQHG 4TQEL 2FO4A 4YEEA 2VLME 5D7IA 5I1GH 5D9SB 2X0WA 2WLLA 5SX5H 5DMIH 3VVWA 1AGCA 2Y7OA 3WFHA 5E8PA 3B2DC 2B77A 3N55A 4IRJA 3GLZA 3LKPA 4JMXA 3ZJAA 4Y4KD 1NANH 2MCPH 3ZIMA 3WSQL 2FWOB 1KCRH 1A6TB 1DP0A 1RIHL 4HBCL 4ONGH 1KCVL 4L29A 4NC1E 2PP7A 4OFQA 3GMLA 4Y4FB 1HEZB 3L9RB 4KROD 4ZOCA 5DQJB 5LBSH 3VI4B 1SEQL 3O41B 1VGKA 2C1PA 3CFKB 4WWPA 5EIQA 1QZNA 3PAZA 1M4KA 4L3CB 3ZKXC 4RETB 5ESQA 2V2XB 5MEPA 3ROOB 2BVPA 2DB8A 1X7QA 4JKKA 2HJLB 2WCSA 1WLHA 4PS3A 5IQLA 4Q9BA 3BFOA 3RZCC 4QRTB 4WGWB 1S4IA 1IJ9A 5GRWA 3WN5C 4NKMA 2KZKA 1XGZA 3D9AL 4O58H 5FF6A 4ODBD 1WS8A 3F7YB 4FQ2L 5I0YA 1VB9A 5D1QC 4ZO6A 2VR6A 1X6LA 4NFDA 5FDWA 5J9PA 2DQDH 4D8PB 4A37A 3JYBA 3AG3B 2XWRA 5CS7A 1WITA 1QW9A 4Y5XA 1D5BB 2IAAC 1SQ2N 1GPOH 2CNZA 3NP4A 3GUFA 1T5XB 5F9OH 2WZPA 2B59A 3IMBA 3FRPA 2LGNA 4OM0H 1W9XA 2WLIA 1T6VN 2HT3C 1LO0H 4F1SA 1N59B 4L1SA 4M7LH 3GM0A 1NGZB 2PN5A 1BBDL 3WS3A 1J1XL 4KNSA 1UWGL 4R7XA 4HJSA 4IIQB 1TVDA 4GG8A 3BUYB 1OALA 1GYAA 3MJ6A 2X70A 5GRXG 1CGSL 4X9IA 5C6PB 2AEPL 3PGDB 1V55B 3CBRA 2FATH 1A3ZA 5B1CA 4MA7H 2Z31C 6FABL 5JOFB 4WTXA 3L7EB 3G9AB 5K9KA 4JZJA 1SLWA 2VDMB 1S7SA 2M2DA 3CZFB 5LBSA 4HIQA 5I23A 4PJGE 4XN5A 2OTUA 5D70L 2W80C 1TLMA 5FA3A 3W0WA 3S8GB 2QV2A 5AUMB 2MOGA 2EC9U 4RGND 4JRLA 2Y2WA 4DKFH 3JUZA 1PAMA 2CHZA 5JDJA 2QLVB 3NFSL 5T33L 5HVHB 4MFHA 5IWLC 4FFZA 4ZW3A 2F53A 5FHAH 1ZCRA 5F9WC 2FAUA 4NQXB 1J0HA 1TNNA 5H37G 3DARA 4FTVA 2CKNA 5ALBH 2ZP8A 3WKNA 4M1DL 3BC9A 3O6KL 5L9DL 4MXWH 3FU9A 2WB1A 4XN1A 2OI9B 4GLRI 5D1ZI 1ITCA 2FL5A 4FJZA 2V8MA 3MACL 2CBTA 2QQKH 5C2BH 1B0RA 4LRIA 4OCWL 1MXDA 3AU0A 4WWID 3ULVD 5I0XA 2B1OA 4GQQA 4N28A 3SQRA 3HHSB 3UEZA 5D2LE 1RZJL 5DJ6B 4PB9H 4EIUA 1CL7H 4MD5B 1GC1H 3F6LA 4HWEL 4KOCA 4AE1A 1MJ8L 4IIZA 3LKOA 2FNWA 2Q7NA 1I8MB 3FQRA 3FF8A 1OM3H 3S88L 4UQ3B 3S9DB 2VXTH 2J25A 4NUQA 1P6WA 2YUZA 1LWHA 1FH2A 1XGUB 2D3LA 4XO4A 1CDYA 3GKWL 2AK1L 3JV6B 4YWGH 5TH2B 2PPFA 1IBZA 3A67H 4E41A 1AIFB 2J8UA 1QFWL 4YX2L 4MD4A 4B3VA 4R4BB 4UM8B 4XVJH 3BZFB 5D4IA 3UBHA 2YPKB 3O0RH 2N1TE 1M6OB 1S7WA 2I26N 3D39A 5INDA 3RTQB 2X9YA 4XXDA 3QPXL 1IGFH 1ADQL 1MFAL 5E8NA 3ZN6A 2OYPA 2ZYSA 1T7ZA 3NIGB 4ODUA 5DVNA 5K39B 5I16B 3I02B 5HYSA 3I85A 1MFMA 1DBAL 1W8EA 4N26A 2O6EA 2H2PC 4RMQA 1CG9A 1F3RB 4QO1A 3FH7A 1MAML 3L2NA 4E68A 1NH6A 4M5TA 3IMSA 3X1GA 5BRPA 2HCZX 1U2HA 2X88A 1DDHA 4X5WB 1NDGA 4LSRL 5C9KA 2XFXB 3GI9L 3TM6A 2DLFL 2RALA 2VMEA 2VO5A 4TQIA 3ARFB 4R96A 1YCSA 1Q4NX 4WV1C 4F7TB 2VMDA 4HG4J 3O9WA 2QHRL 3TO4C 4ONOA 2PYEA 2VCOA 3BHBA 4MD0A 4NQVA 3GXIA 1GSKA 4WKZB 5AVRB 2EICA 1ETZA 3ULSB 1AJ7L 1AHWC 3A4AA 4GSDL 4J3OH 4U2YA 3TGXA 3KPQA 2VMCA 2WXHA 1NCIA 5DWUH 3QQ9C 1PL3A 4NZTL 5IHWA 2FECL 3OKLA 2BIMA 4L4VB 1J05A 3RNQA 5LKNA 5E4IA 4M48L 3RY6A 2V7NB 1U8HB 2ICWI 2HTKC 2PW1A 1I7ZA 1HHGA 4P57B 3TIEA 1Q94B 2ATAA 4HKXB 4M5YH 3IMTA 4LDCA 2VL5A 2NX5E 2VISA 4DZ8A 5FXCH 3WL9B 1QPKA 4L4TB 5MEND 2WUBH 2P5PA 4UAOB 2NUPB 4X9FA 1P4BH 2HKAA 1YAIA 2R15A 5EDSA 2DH3A 1AE6H 1NMBL 3QIUD 4BFJA 1R3HA 2O5ZH 2FR4B 3OHXA 4U3CA 5CGYD 3W5MA 3IFLL 1XEDA 1S9YA 4XB7A 4PWIA 1KELL 1F3JB 2D3NA 2PTVA 3FU7B 1HSBB 2E86A 3BZDA 3KPSD 4YE4L 3DI3B 4NO0A 3WV0A 1E0OB 2G2RB 3O6ML 4PBDA 1DL7L 3KYMA 1KEMH 3FU0A 5KN5A 3Q6FB 1YRKA 1R5VA 2VM4A 3WCYA 4B9PA 3GXMA 3ZK0A 5BV7H 4IS6B 3MLZL 4NRXA 2HWZH 2ZXGA 5AYUH 5AALA 3D2UB 3IU3B 3SKUD 1G87A 2RR3A 1CXEA 1FL6A 4PUBL 4QD2E 5CBAB 5TDNA 5M94B 3LSOA 3KDPB 1LK2A 4PJIE 4Y1AE 1P5VA 3PWUA 1WD9A 1HJCA 3CMOL 1ZT7A 2P46B 4IGBC 5L4JA 3U4BH 2CK0L 4QRAA 3BAIA 4L1DA 4OZHF 1OZTG 4HEME 4PGDB 2CGRH 2CZNA 2GFBA 1NICA 3AMLA 4WFFD 2BP8A 3FF7A 1WFJA 4AYMC 2EH7H 2EYRA 5DEGB 3UZEC 1VADA 3TWCH 4FNUA 3DIFA 4A7GA 1KG0B 4G7YH 2MCG1 2P8PA 3W82A 3F01A 4JQXA 3ECVA 1T2QL 4OT1L 5EORL 3SDAB 4B5EA 5AAWC 4EI5B 3FT0A 3SDYH 2WM0A 4H0IA 3CQQA 4JKWA 5F96L 3GJEA 1NGXB 2CBOA 3MOAH 1WSST 4JW3A 1YUHA 5E1HB 1YMHB 3KNBB 4PD4J 5DJXA 4J1UB 4BKSC 3N44B 2J7LA 3VNZA 2D3JA 1AG6A 4XCCH 5HHXH 5C0RL 3MRPB 4NGHH 4WHTB 2WGXA 4QWWC 4GMTH 5E0QA 2VDQH 3B9KA 3NIDB 5GJTH 3BUTA 1I9RH 5B4MC 5T5FA 2C3VB 1CLOH 3RJDA 5E2WL 4OLEA 5EU4A 1V7ML 4OAWB 2EH8L 3WOVA 3C08L 4FMVA 3H4HA 1U36A 2CM5A 4JRXA 5DCCA 4XP5H 4CU6A 4ZMYA 4JRYA 1HQ4A 2GK0B 1NPJA 2H0FA 1T2JA 4ORGB 5EZIH 3S4SG 2A9DA 1UADC 1UYWH 4OKDA 1CLVA 1IIIA 4M7ZC 5KYUB 5L2JA 1ZTMA 4Q58C 4U1JB 1FH5L 2X41A 4KXZH 3V4VA 1SLVA 5LXGH 4QT5B 2IANE 3CIAA 1JV5B 3FO9B 1S8DB 2LU3A 1OT1A 3LNDA 4JFDB 4MMZB 1LTXA 1EDHA 1X3DA 1IV8A 1EUUA 1XR9B 2WZAA 3SSGA 2LLLA 3JVFC 3O6FB 4HJIA 1JGEA 3ZPDA 1C5DA 5J12C 2P80D 1JNNL 1ZHKB 5ABAA 2YUVA 4EIZC 5KSBE 2MIZA 5BZZA 3RGVB 4D7PA 3D18B 1FAIL 1HSAA 3QR0A 3ECQA 4LT7A 3TN0A 3UFIA 4BFNA 4JNXA 1EXHA 3F83A 3FPXA 4QCIA 3EOBA 4U6TA 2WLYA 2NY7H 1B0WA 1J8HA 1GIGH 3P9LB 3FRUB 2ZT9C 4R0LB 5DHMC 4IQHA 2FWSA 1QKZH 2XPZA 4PJ9C 4CSTA 1CD0A 2UZXA 2AQ1A 3UC2A 4YXLL 3ML8A 4FQPA 4ELMA 3U6XS 3LN5A 1ZE3C 4MVBD 1HHHB 3L9EA 3BQUB 1RUQH 5BVPL 1QFWM 4A2GA 1PLGL 2EADA 4YR6A 2W1NA 3ESVF 1HNGA 4GKZA 1GYCA 4XPHH 4ZFZA 3K2MC 4C8XA 4YO0B 2DJMA 4JRFA 5J8OA 5AVUB 4AYSA 4WI2A 3H55A 2P24A 2Z7UA 5I73B 1N2RB 4FNPA 4UIKH 4PJXE 5TFSL 3WFCL 1DBBL 4K8RC 3UYOD 2GEQA 3MLVL 4UNVA 4AENA 3N3EA 2Y3AA 3MYJA 4P4KD 1UKQA 2F58H 3F5WB 4KJPD 3UTPE 5I18H 1ZHLA 4NN7C 3P0GB 4QRSB 1NWPA 2C9UA 4TNFA 3PABB 1EK3A 5AL0A 4IOIA 1TTUA 2EZ0D 4FP8L 4R84A 4WEMB 4GUOA 1TJXA 2DI8A 2O5XH 2R0WL 2NR6D 4NFBA 1UZ8B 3H42H 4O5LL 4F33B 5EZOH 2NW2B 2OBGA 4ZMZA 5GJSH 4NRYB 4D9LL 4YHPA 2DWEB 3SPVB 1RPQA 3QXUA 5FOBB 3UTSA 4MAUL 3TP4A 2FX7L 2Q3XA 2VLJB 4KH2A 4G6KL 1Q9KB 4PRIE 3VCLB 5CZVH 43CAB 5AB1A 5GZOD 4QRUA 3S5LB 2JJWA 4G6JL 5T1LA 4WCYH 4HIXH 4L8SC 3T2OA 1KIUB 4LEXH 4F8TA 3GSUB 3DV4A 2J6EA 4NDMB 5IVXF 5EBWB 3C2AL 4OFPA 1S9WA 5C0AD 4UQDA 3RA7H 1MCOL 3FTGA 4ANKA 4DGUA 4U1LA 4ZSOB 2IAMD 5K9OA 4XMTA 1W72A 2R2EB 3CHXA 4ANXA 3RWDA 1N6UA 4H1LH 4JGMA 3K71B 2FQEA 3IDUA 3GMNB 3JV4A 2XG5A 1L9MA 1KBPA 3S97C 3STBA 4IHBA 4ZOBA 4UU9B 2GUOB 3JSSA 5HY9A 2OPCA 1A1MB 1R47A 2EYTA 4A6YB 2NSQA 2ODIA 1OK0A 5C0FB 4P0DA 1ZHBB 3ZQWA 5CEYB 1NCOA 1TOXA 1OP9A 3GEFA 1ACZA 2CUMA 1OHZA 5ISZA 2Q3ZA 5E1IA 1PZUB 1YPZB 4QOKE 3SGJA 4I77H 2CPCA 3FSVA 1RZGB 2IPUK 1KXVC 2IDTA 3L9BA 2NY5C 1LEGA 1RJYA 4EZJA 5FFLA 1MRDL 4XO8A 2OV0A 2XIBA 4AVKA 1BQLL 5F0LB 1L0QA 1PJ9A 5ANME 1I8LC 3E7JA 1T4KB 2V5RA 3MJ7B 5AOKA 4PJDB 2QLYA 4LLQB 3VXOB 5E70A 3ENEA 4BINA 2PWDA 1N64L 2BSDA 3CUPB 4OFYA 5C0BB 4GNKB 2FWOA 1A6TA 5I5RA 3JVGA 3HAEG 3RL1B 2XWTB 3BVUA 4NQQA 2WXRA 4ZTPL 1J8RA 3PJSB 1IAKB 4M8VA 2HA1A 3F62A 1ODUA 3CN3A 2WBJB 4PS8A 4Y4FA 1HEZA 3RWHB 1EEYB 2VDMH 3L9RA 5GGQL 1GJIA 5DQJA 3TBYB 5AKTA 4EBQH 1F90L 2QKIC 3VI4A 5GRZA 3O41A 3CFKA 2IPKB 1SMDA 2QVFB 1G9HA 5IQMA 1DFBH 5IF0B 2X6AA 4GINA 1XXFC 3DPDA 3LQAH 4L3CA 3D85A 3QE5A 1YEDB 5FGCB 1IX2A 3LRHA 3PDGA 4H8UA 1OAKH 3J07A 2HJLA 2D0FA 3EDDA 3APCA 2IOMA 3ULVL 1AHKA 2HT3D 2JJTC 1G7QB 1FL5B 4JJ5B 3SGEI 4LLVB 5HDBF 1BZ9B 1Y6MR 4X6CA 4X7TB 3F7YA 4ZODA 3ARGB 1CF8L 2C8NA 3L3GB 4JPIB 3UTTE 2V7HB 1IZJA 2R59A 3MX0B 5E7BA 4GG6F 2QSQA 1VACB 3NABH 3TCLB 4A7UA 2KDYA 1UACH 1JNLL 3WFDL 5FW6A 4MKTA 1XTLA 2YMXL 2Z31D 3G6JF 1D5BA 2D0GA 3UAFA 1OWWA 4AGQA 2NZIA 1I3VA 1VIWA 5IVNA 2BSTB 3WHXB 1U0QA 2P44B 2NYYD 5CIPA 3MMEB 3ABMB 5D6CB 1N59A 3L4WA 3PHAA 4ZMPA 1NGZA 1P4IL 3KYKH 1J5CA 2A1WH 2PLTA 1NUGA 1N5YH 1OVZA 4IIQA 3OX8B 7PAZA 2IOIA 3LZLA 5LAPA 3BUYA 5ANHA 1MFNA 1CIDA 1R3KB 3KDMB 3AQDA 3AMKA 1ZLEA 3WS6A 2GEEA 4RX4A 4LCWD 4ELDA 1P4UA 3PGDA 2WNGA 5E8OB 2QBWA 1ZVYA 4D2NA 1QSFD 4H8WH 4MNHB 3L7EA 4G83A 5BVJB 1RSYA 1YNKL 3CZFA 1B4TA 1P7BA 1SXCA 1T04B 1DSYA 4GS7B 3MV01 3B9AA 5AUMA 2YAEA 3CH8A 1LWRA 4E9QA 1HQRB 3RQ3A 3A22A 4LHQB 4Y5VC 3BQVA 1OAUH 2G5RA 2PR4L 4NQXA 4I18C 3PQYB 3WY2A 3DX7B 1FSKC 1YNTF 1WDAA 5JHLH 2DPKA 1TENA 4MJIB 4KMTL 5A6IA 1UGKA 2DEYX 3SPCA 2HXAA 3I6GB 4X9YA 2NXYC 3IU4L 1D5RA 1OCWH 1N8OE 2H6PB 4ZXBB 3HHSA 5D1XB 2OW7A 1IVLA 2PUQT 4BUHA 1IBGH 2W9DH 4YUEH 5DD5L 1QYGH 3RWJB 1ADWA 3Q2CA 1YAZA 5DJ6A 5TE7H 4ODSL 3QORA 4MD5A 5IJBC 3VFTB 3UO8B 4ZX5A 3FQXB 1ML0A 1GCFA 4RAVB 4W4OA 5I0VA 1I8MA 2Z35B 2BSEA 3P0YH 4QKXB 2DM2A 3WXWH 5DC4B 5C07D 1EZUA 5DS8B 2H2PD 1K5WA 2R1XB 3ZL2A 4TOYL 1MZZA 1JWSB 3V55A 3JV5A 5TH2A 3JV6A 3R06B 1C5CL 1HN1A 3U2JA 3QA3B 3U30C 5FKPA 2C4XA 4UOW1 1EZVY 1NCJA 4R4BA 5HI5C 3BZFA 4TQEH 1J9TA 3TFBA 2X0VA 2YPKA 3VAEA 1JD9A 4MWFB 4NN5C 1M6OA 5IESL 3C8DA 2WXIA 3DMMA 3RTQA 5CGTA 3WEMA 2YD3A 2XI9A 4XHJC 1WTLA 2X1XR 4ZS6C 3UPCA 5AW9B 3UGEA 5K39A 4PGCB 3WSQH 4HKJB 1RIHH 3H1ZA 4G1EB 4HBCH 4JFFD 2DKSA 1KCVH 5EHFA 2Q9OA 2PWHA 3VTAA 2FLBT 2MRYA 2ADGB 4JMNA 4OLVL 1CPUA 3FRPG 3QQ9D 1EGJA 5E4OA 1YEGL 2G5UA 1SEQH 2OM5A 4YK4B 4X5WA 2FH6A 2HTKD 1BG9A 2VABB 2XFXA 3IETB 3VYNA 1ORSB 1B2YA 3ARFA 3GPSA 4F7TA 2AJ3A 2XQ0A 5KVFE 3G5YB 4UINL 5IBTL 3OQRA 3D9AH 2VDLB 4ONHA 1QTYT 2B3IA 2WBKA 3MNMA 1IFHL 2CLVB 3MODL 4FQ2H 2XQYK 4WKZA 4BH7B 5D6DC 3FTUA 1FGNL 4JFXA 1DEEB 1HXYA 4G8EB 3DV6B 5DHXB 3ZSSA 2AEWA 2BIOA 2V2TB 4Z7QF 3HJ0A 3EBGA 3U1PA 3MREB 2IALB 1BVNP 1SVBA 4L4VA 2NY1C 2O1AA 2Z93B 2V7NA 1U8HA 2WBXA 3QHFL 2MQCA 1RKRA 2WMPB 4PV9A 1Q94A 4HKXA 4CKVX 2OSXA 4KDTC 3T2NL 2YSTA 2X3CA 3BI9X 3OLDA 5CLYA 4CNIA 3WL9A 3N41F 5F7NC 5I5MA 3D30A 2FBJL 4L4TA 5LNGA 1BBDH 2DJSA 1J1XH 2NUPA 3H2QA 3F12B 4UOQA 1UWGH 5GQBA 4Z0XB 1CGSH 2JQAA 3F7VB 2FR4A 3BAXA 3G5VB 2AEPH 1XH0A 3AS2A 3PWVB 5C09D 4IGBD 1WAAA 3VG9C 6FABH 4IBYA 3FU7A 3NJLA 4NCC2 2BSSB 4MRCA 2E8YA 3BMWA 4PFEA 2ITFA 5D70H 4PJGB 3HS0C 2G2RA 3RJOA 3VRLF 2DLIA 3FFCE 1UXMA 3Q6FA 3NFSH 1A4CA 2JI1A 3ZE1F 5T33H 2X0UA 4IS6A 4V33A 1EJ6A 3AY4A 1EFXD 4YHOL 1ZXKA 3H2WA 4W9ZA 4X7EC 2JKIS 4WK4B 4M1DH 2VT0A 3O6KH 2PR9A 5L9DH 4GO8A 2OLDA 1N3NB 3AITA 1K5NB 4OVVA 1AO7A 1YYLL 1JF1B 3FB6A 3FQNB 4PJ7E 3BN3B 4AMKL 5C0CD 2C9SA 2OSYA 3WGUB 3MACH 3GK8L 2AEIT 2G60L 3DOHA 3CFIC 4FG2A 4QWWD 3GC3A 4OCWH 1WRFA 4KKAC 5GGTA 1IGCL 5B4MD 3I6KA 3CHPA 2AQSA 4V2CB 2IH8A 1TPXC 3C60A 5AVTB 1KY7A 3SDAA 3TBVB 5BJTA 5HYSG 1RZJH 5D2LB 4F7MB 1YMME 4EI5A 4AE0A 5A3IC 4HWEH 4W68A 4DP2X 1MJ8H 4K5MA 1NGXA 4NYLB 3HR6A 4F8PA 3LHAA 1JERA 4ZMLA 3L3OC 1EXGA 1VRSA 2FK9A 3KNBA 1K8DA 1VFAB 4J1UA 2DQ6A 3RPBA 3ARXA 1NKRA 3CPLB 5CSGA 1LO5B 4BIKA 2W38A 1V3LA 2AK1H 3GKWH 3MRPA 1E4XL 3R0MA 4WHTA 1EEUA 3WNJA 4HWBA 1E43A 3OKOB 4YX2H 1FGVL 1NAKL 1QFWH 4ZAKA 2ZUWA 3UTQB 3OKKB 4UQEA 4OJDH 3QJRB 5BO1L 2C3VA 4KAQL 3GRBA 5BRZE 1D5MB 1OQOA 4FQXC 4HYTB 3QPXH 1UWFA 5EBMB 1ADQH 1MSPA 1Z5YD 1ZXQA 1MFAH 2QV4A 1BOGA 2NCMA 1DVXA 4HJGB 1F41A 1GS8A 1CFMA 2OR9L 1CVRA 4ORGA 4P5RA 4NWUL 3MGAA 4QXGL 3ZE2F 4I1PA 2QQLL 1DBAH 4MAZA 4PJ9D 2CLRB 5KYUA 3V5DB 5J11B 4U1JA 1MAMH 2WY3B 3L13A 5F71A 2W88A 4QT5A 1BFTA 3FO9A 5LXVA 1JV5A 3AJ7A 4FERA 2Q87A 2JCCE 2Y07L 1YUKB 4NC0B 4JFDA 3LY6A 4MMZA 2GK2A 1XR9A 2YPVL 3OAZK 2P42B 4XE5B 4LSRH 3O6FA 3U25A 3SBWA 3GI9H 1LVEA 2DLFH 1DFXA 4NWTL 3DSNB 4UI2A 2CUIA 4ZMQA 3RGVA 3V6OC 2QHRH 3D18A 2OX5B 4K8RD 3LPPA 3S0PA 1EIBA 1G94A 3MO1B 3A4FA 3P9LA 3NSFA 4R0LA 1TXKA 2V5SA 1AJ7H 4GSDH 1U91B 4U05A 5IHUL 1E8XA 1FLRL 5F6IC 1AI1L 1X5AA 1P5UB 1QABA 3ZZSA 5MENB 1CFQB 3KGSA 2ZOKB 1HHHA 3EO9L 3BQUA 4QR7A 3UBXB 1KSRA 4NCC1 4NZTH 4Z7OB 1Z0MA 5GZNA 3QIUB 1HOEA 4YO0A 4YOKA 4MLSA 3Q2NA 4Z8FL 4N85A 1H6UA 3B8YA 1DR9A 4N2FA 2NX5B 1KBBA 3FONB 1LJMA 3F5WA 3SN6N 2YZ8A 4ZI8A 4QRSA 1E9PB 1ADQA 2A0LC 2H2SD 3PABA 4BZYA 5F7BA 1NMBH 3U83A 3DSFL 1GVIA 1XZ0B 5TD4A 3T1WA 3LAFA 4F33A 4TLTA 3IFLH 2NW2A 5IJVB 4P9ML 4YSTA 4BK5C 1KELH 4BSVA 3SPVA 4W9DC 4WI6A 3LRLA 5L8LB 3U6XA 2VLJA 3GBDA 4TNWK 1Q9KA 2JTYA 4NRZB 4YE4H 43CAA 1DQKA 1IGTB 4DEPB 3S5LA 1UENA 1KIUA 3O6MH 3NCFB 3QHTC 5I0DA 1DL7H 3GSUA 4G3YL 5EO1B 3VI3E 4NDMA 5EBWA 2P8MB 1XDTT 3A24A 3HI1B 2BS71 3SD2A 3CCHB 4AMWA 3BGAA 4ZSOA 4U2ZA 3MLZH 3TTYA 2R2EA 3MUJA 4IMKC 1JZ5A 4XNUL 1MQKH 1J9RA 3U9WA 3VG0L 1VHPA 2JV6A 2NNXA 4PUBH 3K71A 4D3CL 4K73A 2D7OA 3DKHA 5CMAB 4M6ML 3HZKB 1NFDB 3N1FC 2VSKB 3QQXA 4PJIB 5DR5L 4ZMWA 4AGLA 4LLUA 3O4LD 1U8MB 4X50A 4OIAA 4UDUA 4H8PA 1A1MA 1JGLL 1LQBC 2ERJC 3LNGA 4A6YA 5KVDE 3I3DA 5C0FA 5G5DB 1UD4A 3BH8B 4NNXB 1ZHBA 1X5FA 1BXUA 5CEYA 3BW9B 4BZ1A 4LEBA 3RY4A 4NPKA 5CCKL 4YH6A 1T2QH 3IRZA 1BSIA 1AAJA 1ZWIA 3IFOB 4OT1H 4F9LA 3LTVA 1R3JB 1YPZA 2ZQKA 1FG2B 4FHKA 1D5ZB 5A2JH 1RZGA 4Y4HC 3ZMRA 3P3YA 5I6PA 1BQSA 2ZCZA 2NY2B 4O2FA 4LHUD 4GO6B 2KDGA 5C08D 1M1SA 5KTEL 3FQUB 4R5XA 1T4KA 3L3KB 3MJ7A 5C0RH 4PJDA 3FUKA 5HI4C 4LLQA 1NCDL 3VXOA 1B0GB 3LV3B 4ISVA 2RFXB 3DIVA 5C0BA 1GZQB 4EUPB 5F3BB 3FCBA 1A4AA 4I0PB 2Q7YA 1A9BB 1FIGL 1JS4A 1KCSL 1YYML 2XWTA 3RL1A 5E2WH 2LQRA 1FO0B 1ZANL 1IAKA 2CO2A 1V7MH 3J7HA 3PJSA 4KKZA 2EH8H 2WBJA 4K71C 1HL8A 3C08H 1B2WL 3RWHA 1EEYA 4YLQT 4OZGE 3U36B 1QHOA 3CFUA 1F4AA 1UXWA 4HU8A 2PWEA 4OZ4B 1H8OA 2IPKA 4Y19E 5FWQA 1LP9A 5IF0A 3VFWB 3MV7A 2ZAIA 1BZ8A 2F08A 4H0LC 1TEGA 3DX0A 3RDJA 4HSCX 1YEDA 4TUUA 4MQ7B 4NQDD 2UXVA 4OW6A 4YSUA 1B9ZA 1FH5H 3RKPA 4JJ5A 4ZUUB 1G7QA 1FL5A 3RDTA 3UP1A 2IANB 1BZ9A 1C5BL 1E8WA 2GUYA 1Q9OB 4X7TA 3BVTA 2ZXQA 3AWGA 3L3GA 4PR5B 1LO2L 4EKXA 1T7VA 2FEJA 2COQA 2V7HA 1TVHB 3IDYB 4TF4A 2IDCA 3EJPA 1JNNH 2B7DT 5DUBB 4HPHA 2BSRA 4UNIA 3TCLA 1FAIH 3FU5A 4UB0L 2XFGB 3HUJE 5KBMA 2GHZA 2HKHL 4HULB 4NHUB 4WTWA 1MWAA 1FFOB 3ALXA 1Z32X 3QAZB 1KMGA 1D7BA 3V9CA 3FPYA 3IDMA 5AVQB 2BSTA 3WHXA 4YXLH 2MSPA 3KVQA 5AG8A 3VRIB 4N2DA 3MMEA 2HTLC 4P4KB 3WFEL 5BVPH 1J9QA 5TF1L 3FT4B 4UILL 5D6CA 4F9PA 1PLGH 4AM0A 2V37A 2Y1AA 4XVSH 4W9KC 1VCAA 3A6CL 4P2RE 3EW3B 2DYPA 3CZEA 3OX8A 5EN2B 4H0GA 1WTGT 1R3KA 4Z7NB 5D2NA 1CGWA 2C3GA 3HG5A 1KYOJ 4WEUD 1FC1A 3U0TB 5TFSH 3WFCH 4HUNB 1DBBH 3MLVH 3WTSA 4UUJB 4MNHA 3L5WB 3VX1A 1EA9C 2FH8A 3ZY7A 3MRBA 1QSEE 2NXYD 3QUML 1T04A 1HH9B 4FP8H 2H5UA 2R0WH 4DP0X 2XZZA 4O5LH 5C0NC 2EIJB 4N2GA 4XAWL 2IAMB 4JFSA 5E6IB 1HQRA 5ACZA 1ZHNB 5I6OA 4D9LH 1JTPA 2XN1A 4ODWB 4MAUH 2FX7H 1DN2A 1HEJC 1SYVB 3CFTA 1X5YA 4G6KH 1IGIH 1FORL 1NANI 3PQYA 4PRIB 4F2MB 1WZMA 4G6JH 3PHSA 5FGSA 2P5WD 3WTXA 4M03A 2F54A 1D6EB 1QSED 1MCCA 2YBRB 3IPBA 3NVQA 3OAYK 3IVKB 4MJIA 3C2AH 1MCOH 2UY7B 1H6TA 3MRRB 3I6GA 3DTXB 4EO5A 5CJBA 5ECJE 1Q9LA 3V5HB 2J5LC 1KOAA 1MCBA 4U1IB 1LLAA 3RG1C 5HI5D 2H6PA 4BFRA 3FMGL 4IM8A 4L3EA 4Z7UB 3RWJA 4X6DF 3WU1A 4J6IA 4XHJD 1MDTA 3GLDA 4M3KB 1XL6A 3HMXL 3FQXA 3WY4A 4RAVA 4ZS6D 2GITB 4RA0C 3VACA 5E2UL 2Z35A 4YBLB 3BPOC 1DQDL 4HISA 3OD3A 3BDYL 5DS8A 3QDGD 3TU6A 3FO1B 2R1XA 4BFIB 3HNSL 1QP1A 1WCBB 3C5ZB 1JWSA 3W1ZA 1A2YA 3IDXL 5C9JB 3KHOA 3R06A 4QOKB 4AVIA 2HRHA 3QA3A 1ES0B 1XAKA 2GI7A 1MRDH 1M6UA 4WF7A 3GINA 1BQLH 4MWFA 2IQAA 3O3AA 4ILDA 2XBDA 1E2VA 2F68X 3QAQA 4NQSB 5ANMB 4KDVA 4HK3N 4HVBA 1Z9MA 5GXBB 2VXQA 2VZVA 1ZJBA 3KYOB 4HIHB 4P5TC 3ZXAC 4KVPA 3SQOL 4ZQTA 2VN7A 1N64H 4BHUI 3VQMA 4PGCA 5LJYH 2R1WB 4HKJA 4L05A 2XOTA 4G1EA 2JTDA 4HMDA 3ZHDA 4ZTPH 1TF4A 1MWOA 5MEQB 2ADGA 4HH8A 5GGQH 3V9EA 3IS1X 1F90H 1HL4A 3ULUF 1EEZA 2RTTA 3D7PA 4AXWB 4RMVA 2NY1D 4HCRA 4X6CF 3X1NA 1J8SA 4HALA 1I8AA 2VABA 4JFPB 3IETA 1FI8C 1ORSA 3NK4A 4ZPVB 3BIKA 1Y1UA 3NRFA 1ZKAA 2Z31B 2IMNA 3ULVH 1Z9PA 4MDIB 4N1EA 3IGAB 3CQPA 1WAEA 3V9FA 3ZSTA 4MCMA 1TTBA 4BH7A 2CLVA 1DE4B 1CF8H 3UTTB 2Z6FA 1DEEA 4DESA 2WW8A 4R5VA 4G8EA 2Z4QA 4FADA 3GZOA 4B6ZA 3HE7C 4RESB 3MREA 3IJ9A 1E67A 2CRIA 1JNLH 1N26A 2HH0L 3WFDH 5IJKA 3DGGB 5E5RB 2IALA 2YMXH 1BQUA 4YHLL 2RAMA 2QT6A 1PG7W 2Z93A 4F58L 5JIKA 4DUWA 1M56B 4LCWB 5JQ6L 2WMPA 1IVTA 3WIFB 1H0DB 5DHYA 1CGTA 4DF9A 2ADIA 1U3HA 1KYDA 1LD9B 5F7MC 3GLEA 2CG9X 1P4IH 1CL7I 1DZ0A 1KGJA 3L3JA 2FGZA 3H7BB 4X5RA 2IBGA 1SHWA 5EEYA 4Z0XA 1ETJA 4AQZA 2XV0A 4PRHE 2UZYB 4OVUA 2IFFL 3O6LL 3OZ9L 2PTTB 5EBLB 3KL5A 3PWVA 1LE5B 4U3XA 5IB4B 3WTWA 1E4WL 2BSSA 2V8LA 3LD8C 4W70A 1YNKH 1FE8H 1BCIA 1IEHA 3SCMD 1V54B 3BWZA 4KKAD 4LGSB 4PJGA 4WW2F 4XO3A 1AZZC 4HETA 1Y18B 5E1QA 1MCDA 4IHOB 3WFBL 4QHNA 1M3JA 3SKNB 4ABQA 5L88L 4ZMTA 3LZQA 4QRBA 5A6MA 3F58L 3VH8B 4Z1PA 3NYKA 2ATKB 2DIBA 1B88A 1WEJL 5A3ID 3WAJA 2PR4H 3PGFL 2QGCA 4ETYA 6TAAA 3UERA 2GBVA 3N06B 4A63A 2NY4C 3MZGB 1N3NA 4MCNA 1K5NA 4FXKB 1JF1A 3FQNA 1L3WA 4KMTH 1A5FL 4OLWL 3QH3A 1T1ZB 5AW2B 5I1EL 1TCRB 1SY6L 5IROA 3IU4H 3WNPA 1H3UA 2VR3A 1JSYA 1G7IB 2AERT 2VXVL 4M1CC 3QDJD 1OT4A 5DD5H 3TBVA 1DZBA 1QBLL 4FQXD 5D2LA 3DPBB 4F7MA 4ODSH 4QLRA 4TVPE 5LCVL 5I6KA 3HC3L 1MFDL 3QJZA 2XNAB 2X2HA 3TH4T 4HG4K 5BUAA 3C75A 4RNRB 2IWKA 2VH5L 1VFAA 4WV1B 4GIPD 4TSCL 5IHBA 1J1OL 1HIML 4Y9EA 5JYMA 3CPLA 4KXDA 2ALAA 1XIWC 4MJ6B 1L6XA 3ESOA 3GGWA 3C6SB 5D4JA 5EO9B 5FAAA 1C5CH 1P1VA 4LGPB 4R4NC 3A3YB 3OKOA 5IBLC 1XF3B 3DXAE 3IJHB 3OJDB 4WENB 3UTQA 4BRJA 3OKKA 1I1AB 2DEWX 1RU9L 3HFML 4TTGA 1MW1A 3QUMB 1N8ZB 5IESH 3MJ9L 1EAOA 5DFAA 5ERWB 3K5SA 4WUUD 3QUHA 4E9LA 4M61B 1OT2A 5EBMA 3QEQD 3RUGB 3ZDXF 1J1PL 1PKOA 1MELA 4HJGA 5KS9E 3B2MA 4JVUA 1HILA 1JZJA 5AVWB 3CVIL 4DUVA 3RZWA 4O51B 2CLRA 3V5DA 1XGRB 3P69A 4YFLI 3IWUA 3S3JA 1MJUL 2NTSP 2CCVA 2NY5L 3J8F7 4OLVH 5FS5A 1YLBB 4HOMA 1YEGH 2BXYA 2W5PA 1EO8L 2QL1A 1UA7A 4NQCD 2GYSA 4F2FA 1Y7VA 4CGUB 3LIUA 2X2JA 1FFQA 4KK5C 4ZO7A 2VLLA 4DVBB 4OD2B 4ACTA 5FUCC 1T0PB 2ZOWA 3AB0C 4UINH 5IBTH 1G9NL 4TL4A 2P5ED 2ENYA 4YHKL 4DPRA 3MO1A 4NAQA 2O4EA 3MODH 1IFHH 2YRBA 2VKWA 3EDEA 1FGNH 1RJLB 1U91A 3L7FA 3MUZ1 4KY2A 2CQVA 1WQVT 2Z7YA 3FZUC 5AAMC 1P5UA 4JFVA 4PP1C 2GCYB 1CFQA 2ZOKA 4JHZA 4MS8C 3T8XA 3TXAA 3WHE0 1KDJA 3JV0A 1BD2D 1OAYL 3QHFH 3VWJC 2OJEB 5H2BB 4QXTB 1IFRA 4Z3HA 1ZPUA 3WGVB 5KZCB 1JZ8A 4JUTA 1JYXA 5F44A 5LGKA 4JG9A 5C09B 3T2NH 4IGBB 3II3A 5JNYB 4JCWA 4LSPL 3K72B 2NX5A 1KGUA 4OZFB 3HZVB 1FVEA 2FBJH 4OQTA 1RI8A 3FONA 5E03A 1P9MA 1WAAF 4G9FE 1E9PA 4FJ6A 4F5CE 4UTCA 4XCFL 5SV3A 2VRQA 1SN2A 3SGKA 2NYZA 1U8QA 2YMOA 4MB1A 2F1BA 5CP7B 3QXDB 5FM5O 1MCRA 5AWNL 2YQGA 3AROA 4GUPB 3QJXA 5FB8B 5AD0B 3QZMA 4OV6F 1IM9B 1KIRB 4PY7A 3VFRB 4EUPH 4Z7WF 4Z95L 4AK2A 1SVZA 4NRZA 2GTQA 4LP4A 1CXKA 3BPNB 5JORA 3FFCB 5EO1A 2YD4A 4BFBD 3GRGA 3CCHA 4YHOH 5D5MF 4JM2C 1T7WA 2IPUG 5AW6B 4OIFA 1GH7A 3NDYE 2EDYA 2WBWB 4Y4HD 5B1BB 3W2DL 3GS0A 4APXB 3NEEA 3LOWA 1OGPA 1OAQL 5CMAA 2DQIL 3HZKA 3B2UD 1YYLH 3CDFA 4PJIA 4JGNA 4Y1AA 3OGCB 3WDIA 3EO0B 4ESKA 2QVMA 3HRZC 4KXZI 1U8MA 4FOMA 2ID5A 4AMKH 4PJ7B 2XU9A 3NCJL 1JG9A 3GK8H 2EQDA 2G60H 5HI4D 5JA8B 4HEMA 3ZX1A 3L48A 5G5DA 4NNXA 2VSMB 1IGCH 2EABA 3BH8A 5IUSA 3MRQB 4JG1L 2NY3B 5FGRA 3SYPA 2V5MA 4TQ8A 1O9WA 3VGEA 4JKMA 3IFOA 1A6VL 1R3JA 4AKPA 1FG2A 1YMMB 4Y8AA 2EE9A 5DJAB 4JFEE 1TTGA 5LN4A 4IRJC 3G5WA 1ZK9A 2Q10A 2ZUQC 4S1SL 4K9JA 4F7EB 3NJKA 4UV7L 3L3KA 5HGGS 3VFSB 3MCKB 1E4XH 4DKDC 1MG2C 1NOFA 1BOYA 2AVFA 1MW0A 1B0GA 1FGVH 1NAKH 1SDYA 1X7SA 2RFXA 3LV3A 2WP3T 1GZQA 4K5PA 4PREB 2A6IA 4EUPA 3OXSB 1AOZA 4I0PA 5BO1H 4OD3L 1A9BA 1I1RA 1KBWA 4KAQH 3HB3C 3Q3GB 1FO0A 2AVGA 5D8JL 5BRZB 2J43A 4ES9A 3PHOB 4R6UA 3KLSA 1OLZA 4OZ4A 1N4XL 3U46B 4K9EC 5IFAL 4ACPA 3VFWA 4NWUH 4QXGH 2QQLH 4MQ7A 5KVMC 3VSUA 2FLMA 3IJEB 2JB5L 2HTLD 2WZ5A 3EUDA 4ZUUA 3SBQA 3JZYA 2IANA 2Y07H 4I4WB 2DLEA 2JCCB 2K8QA 1Q9OA 4KNUA 1X5GA 3T1FA 4EI0A 2YPVH 3WLBB 4L1HA 4Y5XC 3S98A 4PR5A 3M7OA 3MI6A 1IKFL 2CALA 2BHYA 3CXDL 3AZUA 1TVHA 2ZYRA 4LCIL 3VGAC 4NWTH 5DUBA 1ZPLA 3EOAB 3ISRA 2ZWSA 1HDMB 1Q72L 5KSBA 1NL0L 3I50L 4RSVA 4KJWD 2B5IC 4NZUL 4NHUA 2XXFA 1X6NA 2VOTA 3VXPB 3QRFM 1FFOA 2I27N 2VLRE 6PAZA 3F3HA 5IHUH 2OYKA 1FLRH 1T1YB 3MXVL 1NAML 2CH8A 1AI1H 3BVNB 4LCCB 3VRIA 3NAAL 5C0ND 2EP6A 3EO9H 4P4KA 2EECA 1UKTA 3S5LG 3FT4A 2YUWA 3ESPA 1R5WB 3CBKB 3GFUA 4PJ5E 2KC0A 5EIIB 3DJSA 5EN2A 2YJQA 2BSCA 4JZJC 1SOKA 4GXVH 5AZEL 1QACA 3U0TA 4PJXA 4DUXA 3MA7B 4OV5A 1GJWA 3QDME 3L5WA 1SXSA 5GZOA 3QFJE 4M7KL 4R7VA 3QNXB 4Q89A 1WWAX 1XH3B 4U0RB 1HH9A 6PCYA 3DSFH 3FFDB 4N86A 1R17A 2P45B 4G6FD 1NM4A 5E6IA 5JIMA 4P9MH 1PYWA 3FBKA 4MDJA 3TNMB 4ODWA 3O45B 4XB3A 1SYVA 3DK0A 3GBEA 2R2HB 4C56D 5HYFA 4PRIA 1Z5LB 4FZ8L 2YPVA 4LRIC 1I7RB 4PB0L 2P49B 4G3YH 2AXGB 2Y7NA 1CGYA 3LIZA 2YBRA 5GRVL 2YGNA 3EYSL 3IVKA 1G7HB 5EEUA 5J13B 4OGQC 1SOQA 5E5MB 5A43C 1EHAA 3DTXA 1D6VL 4XNUH 3KCPB 2D3VA 1G1KA 4QAMB 2EE2A 3V5HA 3VG0H 4U1IA 1Q90A 1NA8A 1NIAA 2X87A 5GRUL 4BH8B 2FCBA 4TNVK 2HPTA 1IB5A 2IC2A 4M6MH 5DR5H 2AABL 1QPPA 3N9GL 1E4HA 2FYVA 2MQGA 2R29H 5FGBA 2VO8A 1YPZF 1JGLH 4P5TD 3WMSA 2Q20A 1ZEAL 2GITA 1FPTL 5C08B 4F7KA 1TYRA 5TK4A 5I6NA 3GS4A 5CCKH 4E9VA 5IMOB 5DC2A 4KI5C 3WI9A 1OZUA 1P7HL 4BFIA 1QNZL 2Y22A 1WCBA 3C5ZA 2DH2A 5C9JA 3COOA 4QOKA 1HE7A 2W60B 3GTTA 3QWRA 4WHYH 4BWWA 4XVUC 1ES0A 2OP4L 5IW1B 4N2CA 4AJ0A 1G4MA 1S7VB 1Y6NR 2YPLE 1OD9A 1I85A 2FDBP 1EPFA 4LPWA 1XHHA 4NQSA 5ANMA 4EI6B 4H2CA 5KTEH 3T2LA 3L95B 5CNHA 3KYOA 1NCDH 4HIHA 4ZBJA 1CC3A 4AOFA 2XQYG 3GJFB 4NQDB 5JPMB 5HYIA 2FJGA 3SO3C 1LP9F 2R1WA 1FIGH 1KCSH 4FKEA 3VA6A 3CVHL 1ZANH 2ATPB 5MEQA 1B2WH 4QJ4B 3HE7D 5HSFA 5IW6B 3FQYA 1BFVL 4OZGB 2ADYA 4RAUB 3RTLA 3KM1A 3EDJA 3O9WC 4PWKA 5FYLD 1RZKL 5I74C 4CJ1A 2GQHA 4JFPA 4ZPVA 1I9IL 4DP6X 4MA1C 3T6XA 4G1MB 1I4FB 4FULA 4MDIA 3IGAA 5I6LA 1IBYA 4WFED 5D1QE 1C5BH 1M2VA 3CFCL 4YVNA 3IJYB 4ZUWB 1DE4A 2VRKA 1IT9L 1E42A 1UM4L 1LO2H 1JJUA 3PPSA 3UTTA 2AQNA 4UTBA 1G7MB 4B95C 5FR3A 2QPFA 1HJBC 4KJQC 3AS3A 4PV8B 4UB0H 2VB5A 4Y5VB 4B5ZA 3UZQB 3DGGA 5K5YA 1DJYA 2HKHH 3HUJB 1J7VR 2GIMA 2Q1EA 2BP5M 2GTZA 1SBSL 3EFFA 2ZCHL 4CU8A 3MRDB 3WIFA 1H0DA 1VGEL 5JPNB 1NOLA 2ZSWB 3T2PA 3WFEH 3H9SD 1SVCP 1GAFL 5TF1H 1LD9A 2VN4A 3G04B 4UILH 4A2LA 1A14L 3OHXC 3LZFL 4XNYL 5EN3A 2CE6A 4M6OL 4QHMA 3A6CH 3H7BA 2ZP0T 1IC4L 1RLBA 4P2RB 2YD0A 2E5EA 4KVNL 4JHBA 2YK1L 4ANWA 1RUML 4WO4B 5AG9A 2UZYA 2BX5A 2NY4D 2YWYA 5EBLA 4JREB 2PTTA 3R4DA 5J3HC 3CHOA 1LE5A 1SDDA 1E28B 4BBWA 5IB4A 1M3IA 1U8JA 1W6LA 2G3ZA 2UX7A 4N2OA 4HSAC 3BVWA 3QUMH 5IY5B 1QSEB 3C6LB 3OMZA 5DYOB 3GXDA 4UYQA 5K33A 4HX1B 1PTZA 4IHOA 4XAWH 1KWKA 5FLVA 4LDOB 1I8UA 4M1CD 4M9OA 3SKNA 3IGKA 4I85A 3B1TA 5EC2B 4J3OC 5SWZD 3VH8A 3QJSB 1ZT1B 1FYHB 1N9PA 3UAAA 3JWNE 4R83A 1ZSHA 5D72L 1FORH 1I3GL 4K7PY 4LBAA 1BIHA 2CPUA 2G5BB 2VSDA 2A4ZA 3QWQB 5FYKD 3POCA 4FXKA 3ZHLA 4FE9A 4PHXA 4P2QE 4B9IA 1T1ZA 3IMUA 1TCRA 3NSYA 4QLWA 1SJEB 4JQXC 3TBTB 4BELD 4R4ND 1GTNA 4MMXB 5GIRA 5IBLD 1OY3B 2DQJL 1KWGA 2VDOL 5B22A 1EX0A 3FMGH 4K94L 4WI4A 2DAVA 3NPZB 3ZMEA 1PW3A 1NAMB 2JKTM 3DPBA 5BZWB 3W9DA 4AL8C 1QEWB 3NCCB 3HMXH 5EOQL 1IGJB 2XLLA 1WA1X 4MAYB 4NM8L 2XNAA 1JF6A 2P8LB 5E2UH 4ZFFB 4MHHI 4RNRA 3B9KC 3WIIL 1DQDH 4LVEA 3BDYH 1T3FA 3HNSH 2J6WA 3ZT7A 5DFWH 4MJ6A 1HK6A 3G6JE 3C6SA 3IDXH 4APQD 2ZXWB 3B2PA 4OM1L 1INEL 4G8IB 1XF3A 3IJHA 3OJDA 1I1AA 4GY4A 1UWXH 2JELL 4OZFH 2XSKA 4F93B 1S7XB 2IIJA 4KK5D 3FTYA 1N18A 4QHLB 4PRPD 3GJFK 3FULA 1MFUA 5ERWA 1WF5A 3KS0J 4BQBA 1TEFA 5HHME 4M61A 3RUGA 5E8EA 3WLWC 4LF3A 3SQOH 2XX0A 4JUSA 4X7DC 4NSKB 2O30A 4J3UA 4R90L 1AKJA 4XNAA 3CN4A 3HBPA 2HT2C 4O51A 1BXAA 2NZ9C 2YBGA 4Z3IA 1XGRA 5C0EB 3HI6L 5JYLA 4JZNB 2MOQA 1RERA 2GPZA 3D34A 4MS8D 4WTQA 1DBKL 3K80A 4X5PA 4QTIL 3TN0C 1RCYA 1YY8B 2FSEB 2HT4C 3D51A 3VWJD 4CJ0A 1DLFL 2X40A 3P40A 1BLIA 1IAIL 3Q8AA 4NNYB 3ZVVA 5I9QB 1HL5A 1CF1A 4DVBA 1CCZA 1GY1A 3VG9B 1S9KC 4KZEL 1JHTB 2K0RA 4HOWA 1TJMA 1MLCB 3SYOA 4UWQB 4JVWA 3UC0L 4G6ML 2FX8L 2YEVB 3E38A 1MCWM 1RJLA 2WAQA 3HMXA 1A47A 3A4EA 4U1HB 2F2HA 2YAFA 2RHEA 3VYOA 2GCYA 2G75B 4JO8A 5AKVA 2H1PL 5EPMB 1C16B 2HH0H 3Q01A 2ZCLL 1G7PA 4YHLH 1GGCL 1P69B 2OJEA 5H2BA 4QXTA 5E00B 1TR7A 4F58H 5AB0A 2QHLA 5JQ6H 1AQKL 1D7FA 1NGWB 1N5AB 2DIEA 4GP4B 4XP1L 5CWSA 4LQ1A 1OP3H 3CAFA 2QGBA 5JNYA 3QSKB 1XCXA 3K72A 3OVUB 3HZVA 3M07A 1AS8A 2H0JA 3TPUB 5A16B 2GTWA 4XC3H 3SCMB 2O72A 3V4PL 5B38B 3IF1B 3CHSA 1KTCA 2WB7A 3KR3L 1QLFA 4IRZL 1GY2A 5JHDE 3X13A 2JQMA 5CP7A 5HPMB 3VQ1C 4FABL 2IFFH 3O6LH 3OZ9H 4GUPA 5FB8A 3WTYA 4U7SA 5AD0A 3IGLA 4G71B 2J1YA 1IM9A 3K8KA 1KIRA 1J0KA 4TNWF 1E4WH 2ICES 4EQ2A 5E6ZA 2V5YA 3PJNA 3FK3A 1ZE3H 1UM5L 3ATFA 4LHJB 4JGUA 1JXGA 3KH4A 4EVNB 3HBQA 4MZIA 2J57A 3GXFA 1GGUA 3FFCA 3LKNA 4DNLA 2OCCB 3S37X 3WFBH 4HMCA 4F8NA 2X5PA 3CH1B 3PRZA 5L88H 1BVOA 1XD0A 2CIKB 1Z9LA 3F58H 4OIIL 1WEJH 4LMQI 5DJ0B 3PGFH 3MNZB 2DW5A 3T0VA 4IRJD 1U8CB 3CZSA 3QDJB 4APXA 4K23L 3P4OB 2W07B 4CU7A 5DFTA 3M86A 3OGCA 3EO0A 4LPCA 3R18A 1A5FH 1SLXA 4OLWH 3QEGL 5I1EH 4PJ7A 3VFOB 5KSAB 1SY6H 4XCYA 4W4NA 4HSQA 4KX7A 4YSCA 3KVPA 3NFNA 3SGJC 3MRQA 1UCTA 2ICEB 2VXVH 5AW7B 3HG4A 3HB3D 3RRQA 5IB1B 4H7VA 1KY6A 5B39A 4HFWB 3W5NA 1QBLH 2HLFC 1NBQA 3ZQ9A 4DQAA 3RHWK 4QI3A 4LIQL 1YMMA 5MHSD 2L7UA 5LCVH 1IAMA 3V0AC 3U7AA 3MC0A 5DJAA 3HC3H 1BZ7B 1MFDH 4NI6A 5EEVA 3KWXA 2V3FA 1U3YA 1WG3A 2VH5H 1IFGA 3CDZB 2ITDA 4N0CD 4TSCH 4FLSA 4Z7QE 4FLRA 2PP8A 2RQ8A 1J1OH 1HIMH 2B9AA 3KWWB 3RB5A 3JVGC 4HK0B 1H8SA 2MQ0A 1J9SA 4N0RA 2BZ7A 3VFSA 4E9SA 2F74B 2FECI 3VTMA 1S3KL 4Y4FC 5CD3A 3EH2A 3MLTB 3T77B 3T9WA 3GMPA 4PREA 1WA0X 3DXAB 3WNOA 4YDZA 2JKJA 3D69B 3OXSA 2GABA 4PWJA 1RU9H 4CDHA 3LZPA 5FUOL 1U2YA 3Q3GA 3NSXA 3T4YB 3AUVA 3MJ9H 4M5SA 5BRZA 2WZPD 1JAEA 3UROR 3PHOA 1J1PH 1U2CA 3ULUC 3VFGL 1UJTA 2JXMB 5EO0A 3U46A 3OF6A 1UB5B 2W9LA 3F7PC 1UD5A 5EA0L 5KS9B 3MGTA 2K9UA 4ENEC 2VM3A 4ADGA 3CVIH 1RXLA 2CHWA 2NQDA 4KKCC 3IJEA 1E27B 1RY7B 1MJUH 2NNRA 2NY5H 2LU4A 1EO8H 2NUTB 4PJCF 4ADIA 2JCCA 1T22A 4ATTA 4DK6A 1AY1L 1JZGA 2PPDA 2DDQL 3VRLE 1EHXA 5CEZE 4PAZA 2VDOB 2EEBA 3EOAA 5CFAA 1KYUA 2YIHA 3EYVB 5MP6L 1HDMA 2F7IA 2H3NA 1G9NH 2K6WA 3W0WD 1TQBC 3GHBL 1MRFL 3CIQA 3VXPA 4HD9A 3DECA 5F70A 5LCVA 4XH2B 3EBAA 2EACA 2F53D 3FBQA 4IIQC 4LCCA 1JNHB 3BVNA 5GS2D 3H56A 4E9YA 2CO1A 4JHUA 4XI5C 4FTVD 4ODHL 3WS6C 2ZF8A 2YWZA 2ZXEB 5C6WH 3FUMA 4W93A 1R5WA 1VEPA 3ZTCC 4B9YA 3IAGC 1OAYH 5EIIA 4X8CA 1BGXL 2AI0L 3SO5A 1S9XB 2V5TA 1QRKA 4LSUL 2BW5A 5HYJE 1CUOA 3QEUA 5KEZA 2ZNXA 4PJHE 3VMNA 3BUDA 3KYNB 1U8NB 4HC1A 3QJQB 3LX9A 3C2SA 4LSPH 1CDIA 2GW5A 3AQYA 2DL9A 3ZLQC 3MA7A 2OL3L 5HGHB 4NM4H 1SRDA 4WI9A 3MJ9A 3LQAC 3MCYA 5JIPA 4AJYV 3E6HB 3QNXA 3AXLB 2D7QA 4XCFH 1A4BA 3AW5A 5FYLL 5AWNH 3QJFB 2A6DB 1IGML 3K2UL 2YQ2A 1ICTA 43C9A 3ELQA 3TNMA 2P28B 3RGHA 1ZOXA 1JZDC 3O45A 4Z95H 4NENA 4UM9B 2VYRE 1QVOB 4XBEL 2BFVL 4IBUA 1KFGA 1I7RA 1OPGL 1Z9NA 1GGYA 2AXGA 1KLUA 3ARDB 3G6DL 3K8LA 1EO7A 3L2MA 4FFWC 3VI3A 3WMQA 1G7HA 3UTOA 2CSPA 1Q1PA 4TUJA 4EKJA 5E5MA 5EOCJ 5I8CA 3D39D 3PYCA 4HUUB 3KCPA 2LV4A 3ZE2E 3UTZB 4XVUD 2BNUA 3QORC 3ARPA 3W2DH 2Y36L 4BDVB 5EU7E 1RK0B 4BH8A 1OAQH 2OMNA 4W4OC 3KXFE 2BNRE 2DQIH 4YHZL 2W9EH 4EUPG 1ZAGA 1DHKA 3BO8B 2GKIA 3NCJH 1DUZB 4XX5A 2GC7C 4JG1H 4X98A 4AQ1B 1U3NA 2ZOUA 1HE8A 3MDJA 5IMOA 4PJ6A 3QFDA 1PZDA 1X5KA 4FXTA 1H3XA 4YZFE 2AFNA 1A6VH 2JKXA 1RAMA 2CDGB 3M88A 2W60A 3DMMC 4Y1TA 3D48R 5LBGA 3RTQC 5EF0A 3O9WD 4JFEB 2EVHA 5IW1A 2EDWA 4XWOD 5M95B 3V4PB 1S7VA 4S1SH 4WEBL 3V6BR 3O3DB 2E8ZA 2QTVA 3VU2A 3IXTB 3E2HC 2WK2A 2HRPL 4UV7H 3L95A 4HLEA 1O0VA 3QZPA 2DL2A 3QDHA 5IQ9B 3GJFA 2H1XA 5JPMA 5EEXA 3A4DA 4HHWA 2QDWA 3DOSB 4NT6B 4OD3H 5LNDA 4XOAA 5JW4R 1KGCE 2HZHA 1EDYA 2YUXA 5D8JH 5CGMA 4KKBC 1T0NB 5CILL 4K15A 5IW6A 3ARFC 1NC4B 4KJQD 4OZGA 4RISL 3BPLB 4RAUA 1N4XH 3WKML 2A74B 1OW0A 5IFAH 3DDFA 4Y19A 2MNUA 5EUOE 3BEVB 5DD0L 1GZPB 4N9GB 1TQWA 1W15A 4L23A 3CX5J 1XD1A 2JB5H 4G1MA 2EKJA 1I4FA 3BYTA 5JQIB 2WQUA 1R24B 4YLBA 5GPRA 4YFLF 5KSBF 3IJYA 4ZUWA 3OKDB 2R0ZL 1JMXA 1G0DA 2QVTA 3KPRE 4OBSA 1IKFH 3CXDH 1HZKA 2B15A 5HD8C 4LCIH 2VXSL 1VFBB 3PLYA 1JHLL 2FX9L 4NO0D 1CYXA 1L5GB 3BVDB 1Q72H 1SPDA 1NL0H 4PV8A 4CC4A 5J3HD 3CDGB 3I50H 4W9IC 3UZQA 4NZUH 3HUJA 4BE6A 2I9LB 4UQCA 3EZ8A 2B2XL 2HYMA 2VLRB 1L6PA 4UAOC 2UV3A 4HEPA 3MRDA 3MXVH 1NAMH 1U8PB 1RPUA 3NAAH 4C4KO 2ZSWA 4NC2B 5F7EL 4CN1A 4WAFA 1OCRB 3G04A 1JZIA 4OZHB 4PJXF 1K72A 3I3EA 3D8MA 1UGNA 1T83A 3DRTB 4PJ5B 3W3BA 3VMPA 4BUQA 4YJZL 3QIBD 4P2RA 3ALPA 4W9CC 3W81A 3KG5A 1AQDB 4G6FB 1WA2X 4WO4A 4G7QB 5FIEA 3UPRB 3SY0B 1CFTB 4FKKA 3UXFA 3E6FB 1U58B 2K7QA 5GHWL 2ZD0A 1VFOA 4EZLA 1CXHA 4C56B 4TN9A 4U6VL 2FVNA 3BP4B 3QFJB 3BPOB 3D08A 3AY4C 1QSEA 1DVZA 3C6LA 4ZUTB 4WW1A 1ZMYA 2XN2A 4HX1A 4CN6A 4OSUH 2A5UA 3DHJA 5EC2A 4PJFF 1BA9A 1ZT1A 4J6RL 2J1KA 4UMSA 4NP4L 3U7YL 3HOGA 2G5BA 4FZ8H 4GKSB 1UD6A 2XWXA 4PB0H 3DVFA 3B9KD 1YEKL 3HC4H 4H26B 3EYSH 1MAJA 2NSXA 3E8UL 3CC1A 4JG5A 4P5TB 2J2ZB 3ABZA 1TQCC 2PCFB 3TBTA 3C60C 1D6VH 3SDAC 3WE6A 5BUGA 1J5OL 4MMXA 4NBZB 1NFKA 3QZLA 2J88H 4EI5C 5D93B 1JHKL 4JRXD 3ECBA 5GRUH 3MV8E 4JRYD 2NOYA 2WJ5A 2AABH 4GAJL 4XMWA 5AOJA 1NM9A 1OGTA 1NC2A 2AK4E 3N9GH 1KLFB 3VFMA 5BZWA 3VFPA 3WLWD 4IK6A 2NLJA 1IGJA 3AS1A 4O4YL 3PV7A 1ZEAH 4MAYA 3B7YA 4HPOL 3LH2L 2P8LA 3SIKA 3BN9C 4ZFFA 1XF2B 1FPTH 2BDNL 2HT2D 3IJ7A 4ZAKC 1FFTB 2NZ9D 3Q8CA 5DVKA 1A6WL 1V10A 1QNZH 4BGDA 4HW6A 2IQ9L 5ICYB 2E7HA 2JI2A 1AXSB 2OL3B 4XP9L 1C08B 4G8IA 1YEHL 4PVNA 3TN0D 2OP4H 2EDXA 3SQBB 5FFOA 2HT4D 3ULAB 3BJ91 1J8HD 1S7XA 4PRNB 1P1ZA 2YPLB 4QHLA 3PF2A 3TF4A 4D9RE 1CLZL 3II1A 4XNQB 2Q8AL 4BE5A 3T65B 3H2PA 4YGVA 4WFGD 3QISA 4ES8A 2HFGL 2X10A 4RFNB 3EOYG 4NSKA 4KXBA 5F89B 3ZDWA 3OPZL 1PZAA 2Z1KA 3ASNB 4I1NB 4I2XB 5D71L 4MMZC 25C8L 5L2KE 3CVHH 3K4DA 4NB7A 3O6FC 5C0EA 3SBWC 1QQDB 1MVYA 4GQRA 4JZNA 4P3CL 1AD0B 3B7RL 5HGDA 4BUGA 3BZEB 1NFAA 4M3HA 4E42B 1BFVH 1OPOA 2OMZB 4MBRA 3RGVC 5B8CB 5ITBL 4X9BA 1RZKH 2FSEA 1M9WA 2WO2B 1KULA 3MOBL 1IRAY 3KEHA 5DLLA 2E7LA 4NNYA 4R0LC 3GSOB 1I9IH 1L9NA 5TK2A 1ZDSA 5AFAA 1BWMA 4KFZC 2WGNB 4H44C 3T3PE 2X2UA 3KWUA 5A7EA 1W8OA 5L2KD 1MLCA 2X4SB 4CDGC 3ARBD 1V3JA 3BQUC 3CFCH 4QYOA 1H5BB 4NQEE 4RDQG 5CSZB 2CGZA 4PW9A 1IT9H 5GZNC 4D9QE 4X8XA 1UM4H 5AW4B 1A25A 1H8LA 4U1HA 3UTSD 3X3FL 2AV1B 4EIBA 4K9EL 4CUCA 5IVXB 4L0YA 3QB7C 2V9UA 5EPMA 4ZK8A 1C16A 5T1LD 2JE8A 4PPTA 5I73C 3LEXB 2WTRA 1THCA 2G4GA 2HG5B 3K81A 1CGXA 5E00A 4ETQB 1OE3A 1SBSH 4FNQA 4MSWB 3VH8G 1NGWA 4ZMNA 1N5AA 4NQED 5F3FA 1VGEH 2K7PA 2FQGA 2GHWB 4X6DE 1GAFH 3T0EE 1A14H 1RZIB 2BY1A 3TPUA 3LZFH 4XNYH 5J6SA 2BSBA 4J8RA 4M6OH 3SCMA 3K46A 5E23A 3LZOA 1IC4H 3TL5A 5B38A 1PAZA 3IF1A 4KVNH 3ARTA 3QARA 2YK1H 4R5TA 5IHHA 1RUMH 4X9HA 5HPMA 4EAEA 4JFOB 3UBXI 4PRHA 5DJCA 1DQVA 2Q6WB 3O2VL 5K1VA 5FKAB 2CO4A 3S48A 3N2JA 3QP3A 2O93L 1TFHA 2YEZB 1X5IA 5F72S 5ISZD 1YHPA 1FNGB 2ARJB 4ODXB 4AV5A 3LJ3A 4LOEA 2BNQE 1FC2D 2Y06L 1P84K 3T4AB 3W57A 3CSYB 3FU6A 2R1YB 3CH1A 3J2PA 1X9UA 2CIKA 3FYEB 2HLFD 3BP6B 2XVKA 2GY7B 5JTWA 4H8QA 3N1MC 4NXSA 4QY8B 1MNNA 5DJ0A 4CVZB 2EDOA 1ET5A 1I3GH 5D72H 3V0FA 4Z77B 5DMGC 1U8CA 1KB5H 3BYYA 1TDQA 4G6AC 2W07A 1BWWA 4OFYD 4J3VA 2YA2A 3VFVB 4Q4EA 3WFZA 3FJTA 4FFZL 3ILDA 4P2QB 5DT1H 1UVQB 3VFOA 1RZFL 2FD6L 2GI0A 5KSAA 2QZ5A 4ZOEA 2VC2L 4F9LC 4Y4FD 4C58B 1PJWA 3AXHA 5CEZL 3ZDZF 2DQJH 2VDOH 4J3SA 3LN4B 2ICEA 4K94H 4P9HC 1F58L 2APVA 3CFBB 5HBBA 5IB1A 4YVUA 3LKRB 4HAGA 4APQB 4HFWA 4ZNCD 3D85D 2CWRA 2Z8WC 4IW4C 5HDBB 4JHWL 1OCZB 3ESUF 5HI3D 3UOAB 4B9KC 5EOQH 3TC9A 4XO9A 3ULUD 3HAEB 1BZ7A 4NM8H 4B96A 2WWNA 4KRMB 4ENED 4X7CC 4CW1B 1U8IB 3WIIH 4A55A 1EZVX 3AB0B 3KLAA 4U0QB 2WXFA 3KWWA 4KKCD 3DX9B 3ZDYF 3AC0A 2VDPL 4HK0A 5I5IA 1XR8B 5JIHA 3TYGL 4XR8C 4AEEA 2XZCL 2F74A 3FAWA 3G6JB 4WNSA 2WBJC 5DHEA 3MLTA 3T77A 1INEH 5EUKB 3DXAA 1HWHB 1INQB 3D69A 4YFDB 4YSOA 2JELH 2A83A 2R69A 1IEAB 3M17B 5BCAA 3NEOA 2UZPA 5H37H 5CJ8A 1ZY9A 3DGDA 9PCYA 2XPYA 5HHMB 1ZT4B 1EANA 3B2VL 1XEUA 2RD0A 2JXMA 8FABA 1ODAA 1UB5A 3RDTC 5KS9A 1KPRB 2HX9A 5T1MB 4R90H 2VUKA 3IRCA 3BT0A 3IKCB 2R0KH 4IU2A 1T0MB 3WD5H 1CD1B 1L0XA 5BZDB 4Q6KA 1E27A 3QUYB 3HI6H 3RY5A 1CB4A 3EJRA 3SEPA 1JXKA 4GAGL 2A4EA 4XI5D 1K4CA 5TDOB 4E9WA 1DBKH 4RX4D 5CAYB 1TSHA 2NUTA 1BYOA 2A9NL 4QTIH 4LVHB 5IJDC 1YEEL 2YD9A 1MHEB 3LRGA 1DLFH 1H3GA 4RWHA 5HDRA 2DD8L 4FCAA 1T1WB 1YJDL 1IAIH 1HFUA 1RD6A 2ZX9A 1CE1L 1E2ZA 3CQFA 1CD8A 1LEIB 1U92B 1JUFB 3BKYL 2JI3A 4KZEH 1QR1B 5A2FA 3UJJL 1RQ5A 1CFVL 2DQMA 1M2OA 3UC0H 3P4NB 4G6MH 4XE0A 3BSZL 4O2CB 3EJTA 3E1ZA 3F05A 4F9PC 1AXTL 2FX8H 2VZ1A 3A6BL 1YNTB 3FU8A 3WUZA 2CGYA 4JFYB 3UX9B 1B0IA 1Z66A 2J56A 2H1PH 2UUDH 4P48A 5D2NC 2ED8A 3AG4B 1F1DA 4AW4A 2ZCLH 2EYSB 1QTSA 3FW6A 4LLYB 1GGCH 2DYSB 3EFOB 1E5AA 4M6AA 1AQKH 2VWEE 1AGBB 2QGDA 3KYNA 4XP1H 3PP4L 4RMSA 2QVKA 2WLNA 4IEFB 4FFWD 5A2KH 3H54A 4LQFL 5I28A 5HGHA 5EU6E 5H37A 3DNKA 3V0VB 3V4PH 4PM1A 3BXNB 3MUUA 4F20A 3AXLA 1GKEA 3OR6B 2X6VA 4F5CA 32C2A 1WFMA 3KR3H 3BP5A 4IRZH 3IN2A 3QORD 5FA4B 4CVXA 5JHDB 4FABH 3QJFA 2BSED 2D4FA 2VN6A 2H0EA 1AGCB 3ZHFA 5JUEL 1E4XI 1OM9A 3UCQA 3LKPB 5B39G 4UM9A 1UM5H 1QVOA 2APSA 2EO7A 5DJZB 3BLBA 3DBXB 3ARDA 4JR9L 3G5ZB 3LKSB 3ZDXE 3LPWA 4GQ9L 4Z18A 4OIIH 1JZ4A 3K6SA 3E3QC 2ORBL 4HUUA 2C1PB 3DMMD 3RTQD 4TNVF 3UTZA 2NXZB 2FB4L 3JQOB 4BDVA 1UZ6F 1T5WB 1HYSC 1CXFA 4K23H 1RK0A 2B20A 4DN4L 5MERA 3FUIA 5ESQB 2IPTL 4KO6A 4ERSL 1HNYA 3BO8A 3OB0K 3QEGH 3WHE1 4MHHG 5CEXB 3TVMB 4TVUA 5MI0B 1X4YA 2MOVA 1DUZA 2Y6SD