1ZA3B

The crystal structure of the ysd1 fab bound to dr5
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
230
structure length
224
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFSIYSYSIHWVRQAPGKGLEWVASISPYSGYTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRYSSYYSYYYSSSSYSYAMDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab-YSd1 light chain
publication title Molecular recognition by a binary code.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/signaling protein
total genus 35
structure length 224
sequence length 230
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1za3B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1za3B01
3IETA 2OSLA 3JVGA 1F4WH 3ZMRA 4X99A 5F21B 1ZLWH 2GTZA 1KLGA 5FUZH 3BAEH 1HXMA 3LHPL 4U1HA 2XWJB 4TYUA 2X4OA 4H25A 5IFJA 3BX7C 3V79C 1EEYB 5GRUL 1M7XA 4IM8A 4IIQC 3F7YB 4K3EL 1DBKL 5EC1B 5ADPL 2IANB 4JFXB 2HMID 3BKCH 3MRGB 1IT9H 5HHQA 5FGCB 2O5ZH 3OBAA 2YOCA 3WL9A 3HUJA 4D3CL 2GAZA 2R0WL 5F7WC 4W4OA 1G6RL 2XXMB 1JTTA 2FGWL 4JKLA 4CGTA 3P9MB 5ISZB 1HQ4A 5B4MD 3BD3A 3EYOB 1S5HA 3IFLL 1L4IA 1XF4B 3RWFA 4U1IB 1J1OL 3LKRA 1WCBB 3D3VA 3MREB 3QH3A 1OP3K 1HEZA 1WIPA 5BW7A 2HP4A 1FDLH 1OM3L 4F3FA 1S7VA 4P3CL 5FHBH 1TMCB 3B6SA 5IB1B 4WV1B 5I2IB 4NO0B 3R06B 2FYYB 4OCNC 4TOYL 1XGQB 4F57H 3A67H 2FHBA 4ELKA 4H0HB 3FOLA 3MNZB 4HKBA 3HPLA 2MCPH 1T0MA 5D1QD 3EOTL 1F58L 4I3GA 4LSRH 1ACYL 1RIUH 3T0EB 1BVKA 3GBNL 2H2SD 4M4RA 1JWUA 4GS7C 1EFQA 2XT1B 2APVA 1HWGB 2YHGA 3K4ZA 1Z0MA 4L1DA 2J8UA 5BV7H 5J11C 1C5CL 2IAMD 1YPZA 1OGAB 1RZKC 1MCFA 4Y0GA 5L88H 2X4TB 3SO5A 3SCMD 1TJIH 4PJFB 1ZT4B 5JW5B 2OL3A 2VQTA 4MDJB 1EMTL 3QPQC 1A6ZA 2XY1A 1KN2H 4YBQC 4N8PA 2RHEA 3U6RA 3NH7H 3MRMB 3R0NA 1IZKA 2DYPB 5LGHH 4RDQF 4Y1AA 3HE7B 2IFGA 1MRCL 3VGFA 1R3HB 1N59A 3MLYL 5C0JB 1IC5H 3RL2A 4UTBL 3SGDH 3W9EB 1OSZB 2I07A 2NX5B 3RIFF 4GAYB 5B8CB 2R0KL 3QWOB 5DT1H 4U31A 1DQLH 1F6AB 3GMPB 1RUMH 4YDKH 1XCTB 3HNTL 4HKXA 2ZJSL 2X40A 3OKLB 5FCSH 5T3XD 2DD8L 2HAZA 3CCHB 1FGNH 1GGYA 2HA1A 3CFIC 4GKNA 5J13C 4XCCH 4PV8A 4PP2A 1I9RL 1EGJL 4LCYB 4ZFZB 3FQXA 4QRRE 4GW1A 3LQZA 5BVPL 3JV6A 3O2DA 5E5RB 4M8VA 5IHZB 4TNWF 3QA3A 3VWKC 4U49A 4PJDA 3P4NA 4GW5B 2I26N 3ARDD 1AC0A 3NCFB 5E2UL 5EU6B 5FDWB 4NC1C 3TIDB 3U0TA 5J9PB 4DW2H 4PPTA 4POYA 1N5YH 3SGEI 2PXYB 2RCSL 4TVSa 3GBMH 3FO0H 3MR9B 4OZGE 1I1AA 3ARPA 3S88H 5CZVL 3FO2A 3IDYB 1GCFA 3LKNA 1DEEA 1GGUA 4QWWC 3D2UB 1FC2D 4K8RD 4PTUA 4JO4L 3S9DB 5F44A 5C09D 5C0CD 2F8OA 3Q0HA 3NZHH 3MYJA 2VISB 2L0DA 2IALB 4ONOA 3QNXA 4XZUA 3BE1H 5EA0L 3V4UH 3C5ZB 4ERSH 4AL8L 3VMNA 2F58H 1FO0A 1ODAA 4Z7UF 1SEQH 1FFPA 5GS1B 5EORL 5D1QA 5I1JH 2PO6B 4MD0B 3FAXA 2A6JA 3NABL 5BS0D 5JO5A 4XNMB 3G5ZB 3P11L 1DBJL 5FK9A 1A1OA 5J3HD 1T4KB 1KEGL 5M94B 3U36A 2NMSA 2IAMA 1BGXL 1P6AB 1LD9A 4X98A 1KC5H 3DETC 3O41A 2IMNA 4XXDB 1R5IB 1WTGT 3VCLA 1A7NL 3G6JF 4JGJA 3SCMA 1C1EL 4QXUH 4D0CB 2C4FT 2Z8WC 4E42A 2D0FA 1K4DA 1JL8A 3GGWB 2CIKB 2SEBA 3BHBA 4ZS6C 3FB7A 1KTDB 4H26A 1K8DA 1BM3H 1T7ZA 12E8L 5LVEA 2AS5M 5I15H 4CN6A 3QDJE 3VXMB 5L8LB 3GSWA 3QIBB 5JXAL 5IQ9A 1JV5B 4XVTH 4AEHH 2G60L 1IEBB 2EIEA 5D72H 4OGYL 5I76B 1MCJA 4ODUA 2D4FA 2YMXH 4KDTC 3NA4A 3QAZB 4XCYB 4OD1L 5T5NF 5C0FA 1AR1C 2YPKA 2F53D 2ZUTA 4G9DA 4HK0A 1RUKH 3BPLC 4HWBH 5FO7A 4X9FA 4H1LB 1A9BB 5JW4R 1CDJA 4KWUA 2D3VA 4X5WA 5A2LH 2CR6A 1IGYB 3BH9B 4MA8L 3Q5YA 4NM8H 3WIFB 4HBCH 4H8WL 1FN4A 4ZODA 2Z9TA 5IMMA 4WWKD 1XFPA 1RUPL 2CK0H 5JMOC 4Z5RB 1A02N 4JFEE 4I0PD 5D1XD 2NY7H 2X4NA 3WNKA 2BRRH 1YQVL 3ARDA 4ZFFA 5HYIA 2AQ3A 2QL1A 1RZJL 2ZKHL 3EOYG 4NN5B 5MI0B 4OCRL 4GLRI 4JFHE 4DZBB 1AIFA 1I4FA 3UTOA 2ZUSA 4PGCA 3RDTB 4TULH 1CLZL 2MSPA 2APTA 3LEYL 4FMFA 4B7LA 4FXGB 1VFUA 1LP9F 4U1JB 3SDDD 3V9FA 4K7FA 1RIHL 4OV5B 4ODWB 3ELAT 5TE4H 5IBLC 4HAGA 3ALPA 2OTUA 3S4SG 4HH9B 4YDVA 5C09A 2EDNA 1S78D 5IWLC 4QRUB 5DEGA 5LXGH 5C0CA 1IM3A 4FG6D 3VFVA 4Q2ZA 2DMBA 1W0WB 3DUSB 4OBSA 4X0KB 4F9PA 2DWDA 1YEKH 1AO7D 1MIMH 2CLRB 3REVB 4JZOA 1OAUL 4KUCF 4RGOL 4JFDD 4MNQE 1NDMA 5DHYA 1OCWL 2R56L 1M71B 2E9JA 2W0LA 4HGWA 5CIPH 3K7UA 5DMGC 1QSEB 3MZGB 1ZTXL 3KR3H 4M6OL 4OLZH 5CD5D 3FFCE 4ZAKC 3N50A 2V17H 4OLEA 5IHLB 5C9JA 1ETZA 3MRIB 3F58L 1KLUB 3TA3B 3TO4C 3ULUD 3MLVH 3DBXA 1JHTA 5D6DC 3EYQD 4U6TA 4PJAE 2KDGA 4G6JL 1BVZA 3PQYB 5C6TH 4MJ5B 1JGUH 1IGTB 1YC8A 1MCHA 5D9SA 4JRYB 1QNZH 2EKSB 3UP1A 4FNLH 1TVBB 4ZFGH 2BCKB 1T03H 4J6RL 2FLRT 5FXCH 4WU7B 4KV5E 1NGPH 4ZUUA 1VACA 1CDHA 1S7RA 1MI5D 3B2UC 5B3NA 5FB8A 2H2PD 4NNXB 1NAMH 1WBZB 4AEFA 2DQEL 1NLBH 4PJIF 3PL6D 1J0IA 4M02A 2L4OA 1R3KB 1VESA 5DUBA 1YN7A 3CUPB 5E2TL 5HYEA 5L6YH 1F3JB 4S0SD 5DJ8A 2E7LA 2EE2A 5JUEH 3HS0B 4NKOB 3N1FC 1TNNA 3LRSB 1OGTA 1L0XA 4TUJB 1EERB 1NGZA 1ZS8B 4HCRH 1JI2A 3HMXL 3MRFA 1I85A 2A83B 1MCBA 3OKKA 1CLYL 4P2QB 5E6ID 4IDLA 4OLUH 4DGIL 5EU3A 5EZIL 5IV2A 4XP9L 2UY7A 2YSSA 4FABL 2VDKH 1T21A 4D9LL 4PG9B 3H9HB 3WNLA 2XA3A 3V8CA 5JHLH 1KG0A 4WWKA 3EDKA 3U4BH 1D6VL 4I0PA 5D1XA 4JM4H 5D2LE 1SVCP 1PYWA 3DIFB 3SJVE 4ZUTB 2OI9B 4BSVB 5DJAB 5SX5K 3MRCB 1BX2A 3CVHH 3PGFH 4G8FB 1FVCB 4WFHE 2HLAA 4XPGH 4ZQKA 2GJ6E 4PJ5D 5IW3A 4W4NA 2XZAL 1LE5A 5IHUH 5MEND 3SDDA 3HZYB 1KBGL 4RAHA 1ED3A 3HPJA 3ILPA 3FT4B 4HS8L 2JB6B 1G7LA 3SDCD 3CNKA 2EXYC 3V0AC 2FSEA 4RIRA 3RIAK 3VXQB 4KVCL 4QXGH 3NCJH 4L8SC 3L5HA 3RU8L 4HIHB 4EXPX 2QQKL 4V1DB 5BZWA 1XZ0A 2P8MB 1LO2L 1AO7A 5I8EB 1YEIH 5F1IA 5KN5A 2NY6C 3C6LB 1KB9K 4R0LC 4JFDA 1A9EB 2AQ1A 3E2HC 4TVPL 5IB5B 2Z91B 4QGTA 1AQDB 3B2VH 1H3GA 4NGHL 1QBMH 2DTMH 1NKRA 5CEZH 1JPFB 3EW3B 3MLRH 1IKNC 1FL6B 4J4PA 1UM5H 2GITA 4PGDA 1I1YA 4JM2D 4JFYA 5HI4C 3L1OH 4OZIF 4U1MA 2AEPH 1ROWA 35C8H 3SO3C 3WD5H 4OZGF 3WLWD 5HHXL 3CFJA 5FUZL 4HZAA 4KKCC 1N6QL 1MHPH 5DO2C 3BP4B 5HVGB 5MHSD 5B39A 3QUZC 4NKMB 3VXUD 4PRNB 1QYGH 4YHLH 4DFIA 3BKCL 5IM7A 4R9HA 1IT9L 1MI5A 2O5ZL 1V7NH 4JFZL 1MCIA 3R8QA 1NC2B 4FQ1L 2FEEI 4KRNA 4HPOH 1NGQH 4Z7VF 2X1WL 4GG6E 2AJUL 3DSFH 3BUYB 5CD3B 3QEUB 5JW3H 3GSNB 3D85D 5H37H 2A77L 2X70B 1P5VA 3SKJH 5C0DB 5BOPA 4M5YL 3FQWB 5EUKB 3GEWB 1AY1L 1FDLL 5F89B 1T89A 2JJSA 2J6EH 2NXZC 1IQDB 3EO1B 4YBLC 3WO4C 4F57L 3A67L 5IMKB 2VDOH 5DR5H 1LEKA 3OHXB 3SGKC 4X4XB 1QFWM 4CAGA 2MCPL 3VGBA 5FOBA 5DQ9B 2BOBB 3U46A 5IQ7H 4I3SH 4IJ3B 3QCVL 4LSRL 1RIUL 2A0LD 3DECA 4CMMB 3D69B 2EXWD 2G5BA 1RJLA 1RI8A 4S1DC 1FNGB 4F37K 5J0BA 4A2LA 5BV7L 1EIBA 4PY8I 5ETUA 2FDBP 4MXVE 1T1YA 5I16A 4PB9L 5CS7A 3DRTA 3H7LA 4JKKA 2R2BA 2HFEA 1IAIH 2P5WD 4FS0A 1TJIL 4PJ5A 3VXPA 3B9KC 4CBPA 5MENA 5A2JH 4J8RB 5IBTL 3JWOL 4NO5B 4D8PB 3CD4A 4NQEB 3SDCA 2X42A 1I8LA 4HBQA 2FL5A 1YNLL 5CLWA 5B38B 1DE4A 3MJ6A 1EO8H 3SDAC 4Z8FH 1IAKA 1IC5L 2WBWB 4XI5D 1MRFL 3CFEA 5CEXB 1T2JA 2FECI 5EC2A 2MQ3A 3ARGC 1R6VA 1KJ2A 1P2CB 4Q6IA 4QRRB 5DHXB 1ADQL 1F8TL 2WUBL 1VGEH 2NW2B 4OZFH 4OCSH 1D7FA 5DT1L 2DQUL 5GIRA 2F15A 1S7TA 1DQLL 1YEGH 1RUML 3BPOC 4YDKL 2ZZUT 1AFVL 4K3HA 3UTTE 1QZ1A 1ZHNB 1IVLA 1J1PL 1UEMA 2LV4A 3F7VA 2G5RA 3I6GA 1FGNL 1NBYB 2LFGA 4O2EB 4LSUH 5J1AA 4JM2A 1R3IH 3MCKA 2V5YA 5D93C 1KCVH 2IBZX 1WITA 3WFDL 3VGAC 2ARJA 2HTLC 3QEQD 1ZVSB 2HJLB 4HKZA 4FQIL 4YC2C 1KJMA 3FRUA 3U48A 3WKML 1SBSH 5IFHL 4NZJA 3BZEA 1KENH 4R96B 3UZVB 1A2YB 3RA7H 1NEZG 2BVTA 2UZXB 1G6VK 1AD9B 2R9HD 3VXUA 2FX7L 4M6NL 5KOVC 3I6KA 5D7IE 1T1XA 3A6OA 5DQDL 2Y23A 3UAJC 4YDIL 3C5JA 1N5YL 4NYLA 4Y5YA 5CAYB 2DICA 1N4XL 1EFXD 1FGVH 4YNYA 5EU7C 4JCMA 4HWZB 3TGXA 4GXUN 3S88L 1FG2A 2DWEB 4NQTA 1IQWL 1QA9A 3LS5H 3IDXL 4UV7H 3NMEA 5KSUB 1WFUA 3D85A 5GQBA 1JTOA 1LILA 4JHBA 2DQTH 3SKMB 3O81A 4NCC1 4JO2L 3BGFB 1YJDH 2VB5A 3P4LA 2RFXB 4U6XA 2PCPB 4BUHA 5L2KD 2NYYC 3BE1L 5HGGS 4TUKH 3V4UL 3RZWA 2Q87A 3OKNA 3B8YA 2R1WA 1E6OH 3DROA 1SEQL 5D70H 5IKCB 3ZT7A 3IU3B 4LHQB 4HHAB 2DN7A 1J87A 3M45A 4R2GD 5D1QC 4OIBA 1ZEAH 4G8IB 5TFSL 3MRNA 5DJ0A 1OP9A 3UTZB 2HFFA 1ZGLA 3SE4A 3TBSA 5CBAA 3FQRB 1P7QD 1TVHB 2G75A 2FJHA 4E0RA 4YIQB 5EZJA 1G6RA 4QTHB 1A3QA 1MCQA 4G7VH 2P5WA 4LLMA 5F7LB 2CQVA 1XGUB 4C59B 5IVXA 1I3GH 3KPSD 4GT7A 3WBDA 3SKNA 1IL1B 1J10A 5K9JL 4FXKB 4ZXBB 2NR6D 3MOBH 3PABA 3EOBB 2DQFA 5C3TA 4NNPH 3RGVC 1KT2B 4KHXL 1A5FL 4BH7B 4TTDD 4FRWA 4GAFB 5I15L 3L6FA 1H0DB 3M8OL 4NRYA 3WE6B 4NM4H 4NPYB 1JGVL 3MRKA 5D8JH 3CX5J 5D72L 1HH6B 4QNPE 5DD5H 3CU1A 1RZIB 1Y6NR 1LK2B 1S7SB 1PY9A 4CN1A 2XPGB 3ARFC 3T2PA 4ZMAT 4EI6B 2P5ED 1OAYH 1NCNA 2K7QA 1WZ1L 4XP4H 4I48A 5E8EA 2OJEA 4QHLA 1I7RB 4X5LA 1UJ3B 2BVPA 3MROB 2IG2L 3AB0C 4PJXF 3HZMA 4Y4HB 3U1SH 4BFBD 3FQUB 4Z0XA 3P30H 1A7QH 4FTVB 1FNFA 4PS4L 2ITCB 1UG9A 4I77H 2Y07H 4DUWA 1A4JA 2NY7L 1INQB 1UGNA 2VXQH 4Q9QH 3OJVC 4N90E 2CMRL 1NBZB 2QJDA 4UIKH 2MHAB 5ICYA 5K33A 1EFXA 2XYCA 4TPRH 5GZOC 1JP5A 3NIGE 1I8IA 3ARWA 1ZT7B 15C8H 3CU7A 1EX0A 3O11B 4I1NB 3KLSA 1TETH 2R1YA 1U58B 3RWHB 3FQNB 2H32B 1PZ5B 4PD4J 4IMLB 1MCPH 2EDJA 3MTRA 1X5FA 1Q9LA 4E5XA 1B4JH 5LXGL 1LDSA 1N64L 5CMAB 4UT9H 3CFCL 3MRQB 1CDBA 5F96H 3H8NA 2DMKA 5D7KE 4BELD 4PJAB 1MIML 3DX7A 2Y7QA 4JKPH 4K7PX 4LLQA 3WYRA 1RU9L 3FRPG 1Q9KB 5L0QB 3ULVE 3QO1B 3H2WA 4WUUD 1X5YA 4X4ZA 4BM7A 4MNGE 4FQXD 2BSSB 3MFFB 4OGAC 2GUOB 1EGJA 2BNRD 5IFAH 1A0QH 1AHWA 3RWIA 3TBTA 5F93C 2UWEE 1JZ4A 1T1WA 3HI5H 5IESL 3BKJH 2YPLD 3FAWA 3DGCR 5EO1B 3E6FA 2R0LH 1CIUA 3OG4B 3D0VB 1X7QB 3BVNB 1MJ7H 3KYMB 1CL7I 4JZNA 4WHYG 3P9LB 5HHOE 1P7QA 1QFUH 3QULB 3U9UA 1CICB 1OQOA 2R23B 1U3YA 2AK4D 5E95B 5BO1H 4PRHE 4U05A 4C83A 3STZB 2X4SB 4XMPL 2JCCF 3KPSA 3VFPA 4ZFGL 1T03L 4U1LB 1VFBA 2P7TA 3OKMB 4N0CC 4X6DF 1QRNE 5DK2A 1VFAA 1KFAH 5E4EB 1HOCA 2JF1A 5SWQA 1OLZA 5EBWA 2FCBA 4MJ6A 1X5JA 3RZCD 1WAAF 5LAXA 4OF8A 2EDQA 1GL4B 1EBPA 1T7XA 4BUGA 1CLOL 3TH3T 3MJ7A 1U8PB 3D0LA 4IMKC 3VRLF 5CJQH 2PTTB 5TQ2L 4JY4B 4Y5XA 3FB6B 3KLHD 1A6AA 4CL7A 2IFFL 3H9SD 4PR5B 4D0BA 3RJDA 3MNVA 3QJFA 1NBQA 3EFFB 5JUEL 2P5EA 1ZGLP 1DN0A 5D2LB 2VN7A 3SJVB 5GISH 4HH8A 3MLUH 4YZFE 1LEGA 5A2IH 3VWJB 2P4AB 1I85C 3G5XA 1W2KT 1XEDA 3RUGF 1FPTH 3TZVA 4OLUL 4FFWC 1F00I 1WV7T 4IBLT 4WEBH 3TV3H 2GT9A 4X7TA 5CWSA 1J88A 3VG9B 1R5WA 2XNAB 4X6FA 2GJ6B 2ZUYA 1FIEA 1XF5A 5ESVB 4DWHA 5DJYA 1F11B 2NY5H 3NCCB 1A7OH 5K9QI 1WWBX 4JM4L 4FQCL 4PJ8D 5GGUA 4PJGE 4QEGA 4KKLD 4RAUB 5IMLB 4KVNH 4LVEA 1HKFA 2F54D 4P0DA 1LGVA 1WFOA 2MMXA 2NW3B 3RTQD 3RY5A 1T0NA 4Y8AA 2Q86A 4Y2DB 4IHOB 3MYZA 3VFWB 1HHHB 2BJMH 4Z77B 3VXSB 3UTPE 3L3KB 1OTTD 1AJ7H 5EDXA 2CKNA 4UDUB 2X4PA 4QXGL 4KKAD 3ULSB 1U8HA 4FG6C 4XCNB 4XAKD 3X3FH 5GPRA 4ALAH 6CGTA 4CMHB 3BGAA 3HNVL 4XPBL 1YEIL 1MRDH 1MCOL 5F9DC 1JMZA 4N0RA 5IK3A 4WUUA 2GK2A 4FQXA 2X9XA 1CCZA 2DQCH 4EI5A 2BNRA 4XWOD 2ZUVA 4G7YL 3OR6A 1QBML 4MJID 3U4EA 2YPLA 2EZ0C 2X05A 3MLRL 5HBBA 3MLPA 4NNYA 2AKRB 1M7IB 4E41E 1IKFL 4WY7L 5DHVA 1UM5L 1JRHL 1SEBB 5GSRB 3L1OL 3OAYK 2AEPL 5LGKA 4GG6B 4QCIB 1LK3L 4R7DA 3WD5L 4JVUA 9CGTA 4OCXH 1UVQA 2K3TA 1RULH 2J2ZA 3QEGH 4HG4J 3OKDB 5JMRA 4WW2B 3U82B 4QY8B 3WFEL 3MUGA 1QACA 5L7XH 3BJ91 3GM0A 3FB5B 4EDXB 1YYLH 3S5LG 4P4RB 1SVZA 3EJJX 2F8XC 2Y6SC 1RZFH 3RZCA 1A6WH 3SEPA 3W9DA 4AEIH 3BKYH 3PL6C 5MEQB 5HD8D 4MQXD 2E8ZA 3DSFL 1YMME 3X14A 4DCQA 5GSVA 1J0JA 4HT1H 1MJJB 2NXYC 2VLME 4P46C 5JW3L 4LAJH 4TVPD 1P4LB 3GSNL 2O5XL 3SDXE 3ZDZF 3T08A 1CZ8H 3EAKA 3SKOA 1UWEH 3PXJA 4MWFB 5HYFA 1FCGA 3NN8B 3PP3K 4Y4FB 5D7LE 4MSWB 2VDRH 3TVMB 5HYSB 5JW4M 1RIVH 2J6EL 5E6IC 4MD5A 3GJFA 4EQ2A 3DX8A 4JDTH 1C08B 3OGCB 4PLNC 2X2YA 3VH8G 3OJDA 4OUOA 3JV4B 1G9MH 4OZHF 4JZJC 4PJ8A 1BJ1H 1QBBA 1CL7H 3VFOB 4CU7A 1VPOH 3EJYC 1H3VA 2IAND 1FZMA 4N5ED 2H3NA 3HB3D 2MPAL 2F54A 4UMGA 3C2SA 1VADA 3RTQA 3DGGA 3RBSA 3RKPA 4M1CD 3RY6A 3BP6B 4P23C 1T7YA 3IJYB 4LCCA 4HFUH 3MOAL 2O61A 4QNPF 2H8PB 3OKOA 3T2QA 5ISZD 1A7PL 1CU4L 1KELL 4MLSA 5AAWA 4Q9RL 2VL5A 4Z7QF 4I5BB 3UTTB 1XGYH 3IDIA 5C86A 5LWYH 4DAGH 2BDNH 5DK0A 5IB2A 1XGPB 2L7UA 1JNJA 3HMXA 4K9EC 4CNIB 1EO8L 4PGEA 2J88L 1WCQA 5CHNA 4WFFE 1BOGB 4AT6B 2HLFC 3MBXH 3PGCA 3S37X 1B88A 2B5IC 4AENA 4QOKE 5KSBF 4OCSL 3IFPA 3QDGE 1JNNH 2WBKA 3WEXB 1HNFA 4MJIA 3ROLA 5CZKA 1U3ZA 1A1MB 5K59E 2ZUQC 5JZ7C 3T0ED 1KJVA 5D7IB 1L6ZA 1AD0B 2GCYA 4GKSB 2UZYB 1K3ZA 4R90H 2EDBA 1YYMH 1OARL 1OGAD 2VLLB 3HE6B 5E9DB 1MJ8H 3T3PF 2R1XB 4DVBB 3WLWC 3NA9H 5DVMA 4YWGH 1XR8B 1Q8MA 4B41A 1SBSL 4G6KH 3RA7L 4JQIH 2XA8L 4XPHH 4YE4L 1WJ3A 3CH8A 4GKOA 3QUMH 1UQSA 4PRIE 4ZD3L 4DKEH 5IJVA 2XWTB 1FGVL 4JDZA 1IC1A 5IOPB 3MA7A 3CVIH 5SX4H 4KH2A 4E9LA 1QLRB 3HE7D 2XQYK 2ATKA 2WM0A 4HJ0C 4LDEB 2P45B 2P49B 1QVOA 3OXSA 1U8OA 2NX5D 3LS5L 4HLJA 4M03A 1T22A 4LKXA 4UV7L 3TT1L 1HHJB 5CILH 4DTGH 1JYNA 4YFLI 4JPVL 5JLZA 1G9NC 5T1MB 4N9GB 3B5TA 3L9RA 1MEXH 2ZOLB 5D7JB 3T65A 3TBVA 5GGRB 4Y5VB 2Z31B 2VDQH 4LARH 1RZGA 2R4RH 2B4CH 4MA3A 4DEPB 5EOCL 4KI5F 1DL7L 1NMAH 1G7PB 1BBJB 1JPTL 3HG1E 2WZPD 1WT5C 4UBDC 2XWJA 5F3BB 3DTXB 4IDJH 3WN5B 1CF8H 1EEYA 5C2BH 3BRGC 1P53A 3F7YA 2EXWC 4FQQA 2IANA 4JFXA 3CLFH 4MAYB 2GHWB 5I1CL 4PP1C 2PXYD 2Y06H 3BMWA 3LN5B 3DUHA 1HYRC 4FQ2L 1I3GL 3P9MA 1BP3B 5IR1B 1QG3A 5D5MF 4QKXB 1WGOA 2DM2A 2HKHH 5K93A 4N8VG 4I2XB 3EYOA 3D2UD 4R97C 4HUVB 1E27A 4NFDA 25C8L 4NNPL 5J4MA 5EPMB 4Y16A 1T2XA 1BVLB 1DBAL 1A64A 2CLZB 1WCBA 2NTFB 5KVFH 4YZFF 1FCCA 4RDQG 2XQBL 4PY7B 4NM4L 5IB1A 4WV1A 5D7SH 5I2IA 3C5ZD 2FYYA 3IAPA 3O0RL 3R06A 1XGQA 4ODTH 2ITDB 4GQ9H 3MNZA 3NFSH 4KXZI 1U6AH 1WBXA 2FH8A 1J8KA 2UVFA 2PO6D 2YC1A 3DPBA 4G8EB 2MFNA 2VSDA 1OAYL 2ZPKH 3T0EA 2FO4B 2P1YA 3EOAB 1MOEA 2XG4A 4WO4B 3EO0B 4MA7L 4XP4L 4KMTH 1D5XB 1QO3B 4CN4A 1PG7X 3FOMA 2YD1A 1D5IL 5DEFB 5EOQL 1AQKL 1QR4A 1OGAA 3P0VL 3U1SL 4PGBB 4QTIL 3TCLB 2X4TA 1PKQE 2OK0H 4PJFA 5I19L 1ZT4A 5JW5A 1A7QL 1RK0A 2NY1C 4J1UA 4M6ML 3INUL 4LMQI 3JZ7A 4K94L 4Q9QL 3MRBA 4GO6B 4Z7OE 1F45A 2C3VA 3JWDC 5JPNB 3O3BB 4M7ZC 3QUXB 2HRLA 4IRSC 4TPRL 1QFWL 3HE7A 3VXMD 4EBQH 1R3HA 2NY2B 3DWTA 3QIBD 4MNGB 5C0JA 1YEJL 3W9EA 1OSZA 4GRLB 1E4KA 1TETL 3O9WB 1ZV5A 1ADQA 5B8CA 3MJ8A 2UWEB 3UROR 3VXOB 5D4QA 1RFDH 4GKZB 4M7LL 1MCPL 3K8LA 5I8KL 3W2DL 3GMPA 1XCTA 2Z35B 3OKLA 4HS6B 3WXVH 5HHOB 3QSKB 4EKXA 5ESQB 1J1XH 4NQCB 4L3CB 1RUAH 3FTGB 3MSPA 3S35X 4WW1A 3CXDH 3MUZ1 4PRHB 4HXAH 3MLXH 5FOJA 4G6AD 3P40A 1EO7A 2R4SH 4LCYA 3CX5K 1D3CA 1QPPA 2D7TH 5FCUH 2VLKE 1U8KB 2R0ZH 3BKJL 4CDGC 1NCTA 3WDHA 2DL9A 1QRNB 2WIIB 3HN3A 5H2BB 2ADGB 4WVRA 4RCAA 4GW5A 1YJDC 3Q1SL 4YXKL 5FDWA 3TIDA 5AG9A 5J9PA 1UB5A 3W81A 2MJWA 2FX8H 4HUWB 2PXYA 2EKJA 3Q6GL 5HGAB 3P0YL 5C0IB 3MR9A 4LGSB 4G3YH 3RDTD 1IEAA 4JJHA 3TEUA 3UTQB 1UM4H 2YPVH 3SGJC 3SDXF 1F4XH 1HCFX 1UXWB 1DUZA 4N0FB 5KJRH 1VGKA 1A8JH 2VE6B 4M7LT 5CKGA 4M7KH 2ZOKB 3UPCA 3C60C 4NC0B 4F2MB 5GRJH 4P4KB 2NZ9D 1WVZA 5KANI 5KVDH 2IALA 5C0NC 4AZ8A 5FKAB 1U8IA 3C5ZA 2YD2A 2XOTA 1EHLH 3PP4H 3VFUA 1I9IH 5GJTH 5GS1A 4XP5L 5GS2D 4PUBH 1QSED 1KGCD 3O4LB 4RSVA 2PO6A 3WUWB 3VGGA 5GISL 4PJGB 4TQEH 4S1SL 4PD4K 3IAQA 3DOSA 1MUJB 4V2BA 1EEUA 4XNMA 3G5ZA 1RAMA 2EDHA 5CSGA 1MCWW 4WEBL 3TV3L 4LSSL 3OSKA 5FFLA 4JO3H 2EE9A 4AK1A 3CDGB 1R5IA 2IH3B 4PRPE 5I1AA 1VKXB 1X3DA 1CI5A 1HXMB 4U1HB 4KJQC 4JRYD 2IGFH 5HHME 2YR3A 5AYUH 4JRXE 4D0CA 1CXEA 2FB4H 4H25B 5HVFB 2EH8L 3BIKB 3L5JA 1PSKL 3GGWA 3GSVB 5BZDA 3NFPB 3QDMD 2CDGB 1CWVA 2CIKA 2GAZB 1KTDA 3RX5A 4ELME 4N0UE 3ZKSD 3UPRB 3VXMA 2YD9A 5CZXD 5GRWA 1IBGH 1I7UB 5FYKE 4DQOL 3QIBA 1JV5A 1EHAA 3F8UB 4AEEA 1IEBA 4HWNA 4LHUG 5I76A 2WBJA 5C3LD 2BJML 1DP0A 5HVWA 3KJ4C 1QFPA 2NY3B 1MFEL 3D3VB 1CS6A 1HEZB 4E41B 1YN6A 4ALAL 4GOSA 3T8XB 2V6HA 5DLML 4H1LA 1A9BA 1Z3GL 3UZEA 4P2QD 2B2XH 3LB6C 4U2ZA 4XT1C 1IGYA 4L3EE 1P6FA 3BH9A 1PEZA 3FL7A 3WIFA 5J06A 4HKBB 4LSVL 2BY0A 3C6SB 1GRWA 2WK2A 4Z5RA 4A6YH 3ILQD 3OMZA 5F7MC 3MLZH 4Y89A 1OTUC 2QR0B 5J89A 1RZJC 3FT3B 3V5DB 5EH1A 5FO9B 4DZBA 4GUPB 2R8SH 4O2CB 3RDTA 4YHZH 3IFNH 4FXGA 3JTTB 3UTSE 3NTCH 4U1JA 1ONQB 1UZ6E 3QIUA 5L7XL 4OV5A 4ODWA 1YYLL 5C7XH 2FEDC 4HH9A 2AJXL 5KG9B 1S9VB 4QRUA 4UI2A 2ED9A 2BMKA 4AEIL 3DUSA 1W0WA 1BOYA 3IS1X 3O6LH 2CLRA 3REVA 4APQC 3C6LD 5F9WC 2NCMA 5FUOH 3EGSB 1BPVA 1HIMH 1WC7B 3CFKB 1WBYB 4QHMB 1CZ8L 2W1NA 5DJ6B 1M71A 4XRCB 1QSEA 5T33L 3PUCA 4XPFL 3HAEB 4JLRB 3UPAA 3MRIA 4RGNC 5F9JA 1KLUA 5GZND 3I3EA 2J12B 3KPMB 5E08H 2ILLA 4MJ5A 1IGTA 4OM1H 4F7TB 3GIZH 2Z92A 1S7UB 1RZ7L 4EUPB 4JRYA 4PYGA 5E5UB 2WLZA 1TVBA 1ZK9A 4TSBL 1DUYB 3C8DA 3QEHA 1MCDA 4OQTL 3GMLB 1FSKC 4YHMH 4OD3L 2WNGA 1RY7B 3QWRA 1VPOL 4WU7A 4R6UA 3QDMA 1BQSA 1BZ9A 4NNXA 4QXTA 1WBZA 3PWJB 1NC2D 2G2RB 4PJEE 2CJUH 1Y6MR 4UAOC 1I1AB 1TJGH 5L8JB 1KCSH 2VLJE 4UILH 2Q8BL 3BGMB 3QDGB 1I8KB 4JEGB 4K55A 5E8DH 5C8JB 1UWGL 3CUPA 1JUFB 1DQJB 1IC7H 3F12A 4ORGB 5D96B 2NY5C 4M6AA 1F3JA 4HG4K 2GW5A 3T3ME 5TPWH 4OLVH 2AJZB 3HS0A 4NP4H 4NKOA 5HJ3B 4BFGA 2BFVH 2HVJA 4TUJA 1AGDA 4OM0L 1H9VA 2E9IA 3MV01 2I60L 4P2QA 3E3QE 2X1XR 5FKPB 1TFHA 4RFOH 3ZTNH 4NC2B 4Y4KC 2ICWB 3AAZB 4PG9A 4JVPA 4XWOC 4D0DB 3H9HA 1MFBL 3DHMA 5HHNB 3QCUH 1ZLUK 1WFTA 4MVBD 3CZFB 4WDIA 1OD9A 3NZ8B 3HZVB 4LFHG 4PRIB 4Z0BH 5JXEC 2J4WH 1JCKA 4EN3C 4C57C 2IJ0C 3ZL4L 3MLSH 3DIFA 5BOZG 4F15B 4ZUTA 4BSVA 3TFKD 4NC1E 4WRLA 5DJAA 4BYHA 1YYML 5T5FL 2IAMB 2Z0BA 1CD8A 3MRCA 4FHBD 4FP8L 3O2VL 1YY9C 1MJ8L 3BUTA 3KYKL 5C71A 4G8FA 3SCMB 1FVCA 1QSVA 1LP9A 1A14H 1GIGH 2R69H 4JG1L 3V6OA 4UB0L 3P0GB 5ADOL 1D9KB 3FT4A 3RAJH 1ES0A 4DKEL 2EDEA 3MXWL 5C0GB 3H3PH 3AS3A 1TLKA 1H8NA 1K8DB 1JZ6A 4K23H 5HY9A 4C56E 3CVIL 2YD7A 3GSWB 2P8MA 5EUOF 4Y2OA 5I8EA 2FH6A 5FYLH 3C6LA 3GKWL 1WLHA 1C7TA 4KQ3H 4QRRD 1OWRM 1L9NA 1A9EA 2HTKD 3KGRA 5CILL 3HG1B 5IB5A 1CGSL 5I9QC 3B9VA 3OGOE 3ORJA 1AQDA 1GJIA 3QJHB 1DZBA 1MEXL 1YECH 4G9DB 4AMKH 4HK0B 1NUDA 4F8TA 2GSGB 2Y5TA 3RVTC 1U42A 1FL6A 3MRHB 3LIZL 1TZGH 1TXKA 1N2RB 4GJTB 2LE9A 5EZOL 5T1LB 5GGSB 4OLXH 4IDJL 5FYJH 1CF8L 3JSSA 1DFBL 1LO0H 4NKMA 4PRNA 1DTUA 3JV0A 4N5EC 2QV2A 3HB3C 4PGZA 3GI9L 3VGHA 5CJBA 4DKFH 4ZUSA 2GTWA 4PJIA 1NC2A 5F1SA 1AIFB 2RB8A 4KRPD 3DV4B 2ESVE 3QDHA 4B5EA 4NZUL 1R24A 5HYJE 3NVQA 4HXBH 1NCDH 4RFNB 3BUYA 5CD3A 3QEUA 3GSNA 3OPZL 1X5AA 4LP5A 1G9MC 1GAFH 4PG2A 2BSED 3BO8B 5C09B 3FQWA 5EUKA 5DEGB 5KVFL 4WCYL 3VFVB 2DWDB 4JZOB 1GGIH 2DKSA 2J6EA 1IQDA 3EO1A 4RQQA 4KK6C 1FFNB 4JDVB 3T77B 2EYSB 2IMMA 3QXDA 4FQJH 5DRZB 3OHXA 4O9HL 3L3DB 4X4XA 3NFSL 1HHIB 1JYXA 1AP2B 1RHFA 2ZPKL 2NY0C 1GH7A 1MCEA 3LPGA 5DSCB 4CMMA 2OXHA 3D69A 4KMTL 4Z76A 1JHTB 2OJZH 3WDIA 3ARRA 4ELMF 2MTPA 3TNNB 2FZ3B 4MA1B 5I1LB 1KIRB 5E2WH 2OYPA 3FONB 3FB8B 3U0WH 1UZ8B 2C3WA 4LVNB 1QLEL 4XC3H 3BQUA 2RQ8A 4AJ0A 4J8RA 1TPXB 1IZJA 1WIOA 4KY1H 4NO5A 4ZXBD 4YHIB 4D8PA 2VYRE 1D5ZA 5F6IB 5TDPB 5MERB 1DQDH 3PHQB 4RMSA 4AH2B 3P9WB 2M8XA 5B38A 1L7TH 2HN7A 1ZHBA 5LCVH 3GJFK 3WMSA 5CEXA 5LG1A 4DGYH 5AG8A 4QRRA 2ED7A 3CSPA 4OZFA 2NW2A 1OAXH 5BXFB 5DJ8B 4R4FL 5I1GL 2HRPH 3HMWL 4JFED 4HQQH 1FNSH 4ZG1A 1RMFH 1NMCB 5E8PB 3WXVL 1B0GB 1NGZB 2YA2A 1ZHNA 5HVHB 4M1DL 4P5TD 5IT2H 1NBYA 4F33A 1ZSDA 5HI3C 2WUCH 4JFHD 2NY4B 2WIMA 1XIWC 4HXAL 4S1RL 3MLXL 1GGTA 4OZGA 4LPXA 1ZVSA 2HJLA 4Y4HD 4HC1H 1K4CB 2R4SL 2M26A 1C5BH 5I18H 1MF2H 2CRIA 1F2QA 3OZ9L 4WWKB 3UYRL 2D7TL 2R0ZL 1MPAH 4FTVD 2EICA 4LQ1A 3LY6A 4ZTPH 4L3AA 4R96A 4KJWC 1PYWB 1FLTX 4OI7A 1AD9A 3B5GA 3X3GH 2E6JA 5DZLA 4FQLL 3LZFL 1HKLH 1V3JA 3GMMB 2B4CC 2X44D 4G3YL 3BYYA 4HWZA 2AV7A 4MNQD 3WS6C 2DWEA 1LE5B 4K7PH 3SDDB 1HI6B 1ED3B 3FN9A 3MBEB 5KSUA 1MIEH 3SN6N 5KJRL 1HDMB 5DGQA 4GRWH 1YNKL 1JHKH 4Z95L 2XZCH 3B43A 1X9QA 2DLHA 2PYFB 3KXFE 2RFXA 4XPAL 4JHWH 1ZKAA 5KVDL 1ZGLM 4O4YH 1C12A 1EHLL 1JFQL 1Y18A 3PP4L 4PRPB 4M5ZH 3MJ9L 1OAZH 5HHMB 4LVOB 1FRGL 2VZOA 4JRXB 3EYUH 4HF5H 3S3PA 5ALBH 4HHAA 4KK9C 3U9PH 2APFA 5L9DH 1E28B 3EBAA 5KSAB 4G8IA 4GBXA 3GHEH 3I85A 2Z93B 3EFDL 5TGBB 5LBSL 4LAQH 3UTZA 5ITBL 4PGDB 3FQRA 1TVHA 4JFYB 4YX2H 3QDJA 3HZKB 3AY4A 5ABDE 1F3RB 1CICD 3BKML 4JO3L 4QTHA 5EULV 3CFJB 5DI8B 3DXAE 3ARBB 1XGUA 1PY4A 2QKIA 1G9EA 3LDBC 4IRZL 1VFMA 3VI4F 1IE5A 1IL1A 4LPUA 4FXKA 1A21A 1P1ZB 4POZD 3AROA 1MFAL 4O00A 2VXTH 5DURB 1Q38A 3ZE2F 4Z9KB 3G08A 1QSFA 1P5UA 4LLAA 2W9DH 4BH7A 4EDWH 4ZO9A 1TCRB 3CMOH 1YEHH 5I1HL 5AD0B 3WE6A 4NPYA 5FA3B 1N0XH 1H3UA 3X11B 1OOAA 1SYSB 1IJ9A 1IGML 4I9WE 1HH6A 1FBIH 1RZIA 2ZUUA 1LK2A 1S7SA 1RURH 4Q7DA 2H26B 1NBVL 3MV7E 3WLBA 2GQHA 4JFEA 4XNUH 4IIQB 2VXUH 1IGCL 3E6HA 3SJVD 5IEHB 1NCBL 1FLRH 4P5TA 3L95B 3VWJD 4UNTA 1Q0XL 5D2NC 3ALWA 1TTUA 4ONFL 5GS0L 1I7RA 1MNUH 3QFJE 4C54A 1UJ3A 5DMJB 1HXYB 3M17A 1W8OA 4F7CA 1CFVH 2IBZY 1I9JL 3R0MA 1VSCA 2GJ6D 4MHHI 2BHZA 4MS8D 4Y4HA 1EAPB 3UTSB 1NCAH 3FQUA 5EBGA 3QZWG 3U46B 1P84J 1T2QH 1DLFH 3PWPE 4R4NC 2OQJB 2ITCA 3GNMH 3EYSH 1IILE 4OTXH 1INQA 4LPVA 2DQGL 1NBZA 3O4OC 3IFOB 2MHAA 4NN5C 5ETUB 2OR8A 2J8HA 5DRWA 2I24N 3TP4A 2R8SL 4RMQA 1P69B 1E4XL 4KI5C 4WI7A 3Q5TA 4MNQA 3IFNL 4Y2DD 1ZT7A 2HT2C 4OI8A 3O11A 1DBBH 1U58A 3SBWC 5K9OB 2YKLH 3RWHA 1GC1C 3FQNA 4WFEE 3TJEL 2F19H 3FFDA 3FFCA 2D7PA 4NJ9H 3T0VA 3RIAF 3QHFH 2EECA 3QNYA 4GS7B 4RZCA 5CMAA 2WQRA 3MRQA 3WNOA 4P49A 5J11B 2AV1B 3PHOB 1DE4B 1BQHB 4PJAA 1FIGH 5EC2B 3WNMA 4RMTA 3QO1A 4Q6IB 2ZNWA 2BSSA 3MFFA 1FH5H 1PVHA 3ZO0A 3CPLB 3S6CA 4Q0XH 3D0VA 2BK8A 3BVNA 3KYMA 3I6GB 4HK3N 5SWZE 3TA3C 32C2B 2B20A 2APBA 5E08L 3MCKB 4PJEB 3QBTB 3QULA 4OLYL 1J8HE 2YK1H 1CICA 43C9B 2R23A 5EOCJ 3GMQB 5JORB 3ARSA 4HPYL 2VLJB 3ZE0E 3FRUB 1EZVX 5KAQF 3HI6L 1B6DA 3BZEB 4JJ5B 5J57B 3CC5A 4U1LA 3OTTA 1KOAA 3VXUB 4RGMC 1F5WA 3ARUA 1UWXK 1DANT 4NYLB 4PB0H 5E2VH 2VR4A 4YNYB 4F9LC 2CJUL 4CADB 3LRGA 1PKOA 3BDYH 4Z7NF 3FZUC 1U8PA 1KCSL 5DD0H 4YPJA 5T3ZH 4UILL 1HZHL 1I8MB 4ZFOB 4JY4A 4L5FL 3QXAB 3FB6A 2X1OA 3AGVA 5I73C 1F3DJ 2CKBH 4S0TD 4PR5A 3AS2A 3VWKB 1NPUA 3HCVB 4NP4L 2OR9L 2BFVL 5D2LA 1GHFL 4AG4L 4KZDH 4U6VH 3SJVA 4Y4FD 3TVMD 4U6XB 5FYJU 4R3SB 3UC0H 3VWJA 1U8LB 4OD2B 2ZG1A 3GO1H 4JQVA 4YO0B 3KPNA 4U3XA 5I71C 4EEEA 1F6LL 4X7FC 1FVDB 4LASL 2R1WB 4OT1H 3DROB 3ZTNL 2VKWA 2XNAA 3T4AA 2GJ6A 4NHCH 2CPCA 3QCUL 5ESVA 1T5WB 3J8F7 1F11A 1S9WA 4KZEH 4Z0BL 2J4WL 2VOTA 3ILQC 5DJ0B 2HT4C 3B8SA 3I9GH 2HFFB 1E6JH 1ZGLB 5SX5H 4OCWL 5IMLA 5DJ2A 4NZTL 2G75B 4NZRL 2QSCL 3VD9A 1CTOA 4QXWA 4PRDB 3AU1A 2FIKA 1G6RB 2BNQE 3QRGH 5EU7E 2VDMH 2VN4A 2CDEB 4Y2DA 4IHOA 4OCMC 5DD1H 4XNYH 3ZHKA 3VFWA 1HHHA 1S5IL 1L0YA 4B7IA 3CGTA 3ECBB 3V0VB 3RAJL 4JY5L 3BWUC 3S37H 3MPCA 1NANH 4DN4H 4Z77A 4NUJB 1R0AL 2AJ3B 4OF0A 3L3KA 5FM8A 5JIHA 2PKDA 5EIQA 2GY7B 3UTTD 4UDUA 4L29B 3UMTA 2DTSA 3BISA 3ULSA 5KW9H 4XCNA 1HINL 3L6FB 4L4VE 4NRYB 4PJBF 2QLVB 3QUKB 4W68A 3TPKA 1DCLA 3C6LC 1Q0YL 3WFHB 4AQ1B 4K7PY 3O8XC 2KBGA 3L3JB 4YDLC 1GXEA 2MKLC 4UUJA 1D5BB 3RVWD 3ES6B 3UJIH 1ZWIB 4MJ4A 5CLTA 4JHAH 4PJ7E 4AMKL 4O58H 1FL3B 2XKSA 4I48B 2AKRA 6FABL 1M7IA 5E8EB 5C07E 3FO1B 3HFMH 1SEBA 5GSRA 4EJ1C 2AJSL 2ESVB 3HE6D 5E9DD 2ZCKH 3VFGL 4GG6A 1TZGL 4QCIA 5HYJB 4JFOA 3AREC 1UFUA 5DVNA 2JCCA 4M1GL 4UTAH 1NFDF 2XI9A 1RJCA 3DNKA 4BQBA 1KLFA 4OLXL 4WW2A 1A4JB 4QY8A 4X6DA 4DKDC 3DO7B 1CLCA 1I1RA 3CXHJ 3FB5A 4KQ4L 4BH8B 4EDXA 3QO0B 4N1HB 3BPLB 3O3UN 1GGCH 4DKFL 2FD6H 3VA6A 1EFXB 4LCIH 5F7EH 4JFQB 5GRVL 4ENED 4M8QB 2DAVA 4NOBA 1HILB 4HXBL 1NCDL 2EYRB 2AGJH 4DN3L 1P4LA 1E4WL 5GGVH 1GAFL 1NUFA 1AKJB 4NWTL 1Q9LB 1I7TB 4MWFA 2LVCA 3MCG1 3NN8A 2X4UA 3TBYB 1MFDH 3H42H 3QQ4A 4MSWA 4Y4FA 5EZLB 5D7JD 3TVMA 3VE0B 4PJCE 3W0WE 5HYSA 3K4DA 1UA6L 2IQ9H 4URTB 3S36L 2Z31D 4OCYH 1A7RL 1NGYB 4UT6H 1W72B 2EYTB 5D6CA 4FQJL 1UXSB 3CK0H 4R26H 3RWIB 2D7QA 1P4IL 3OGCA 1T1WB 5IROA 3ZYJA 1NEZB 1XCQB 2A74B 3O6FA 4X6CE 4U6HA 3RKDC 3MRRB 1CE6A 1J0ZA 3JV4A 4OQTA 2PR4H 3HNSL 3VFOA 2HKFH 1L7IL 3U7AA 4PJHE 1B2WL 5BMFL 2AJYL 1DQQA 3H7BA 4MAYD 4PIRF 2I25N 4X7SH 2DBLH 3BP6A 3MGOB 3EYVB 4LL9A 5IBUB 2YD8A 3WDJA 4M7JL 1ZAGA 2H8PA 2H45A 1M05B 3HC3H 1VFBB 4M9PA 4LSQH 3TLRA 5IMOB 3PV6A 3GIVA 3TH2T 5DK2B 4HWEH 5IW6B 1QBAA 4I5BA 3UTTA 3TO4B 4IS6B 5EBWB 5E8NB 1T83A 2JIXA 1QBLH 5LAXB 3WKNA 1XGPA 3NGBB 4CNIA 4Y19E 1L7TL 1BOGA 4ODVH 3C2AH 1ZA6A 4X8JB 4AT6A 1PG7H 3MGTB 1E4XI 4GSDL 2M1KA 2NNAB 1A6AB 1WISA 4RA3A 1QR1B 4H88H 4XBGB 1BFVH 1OW0A 3MNVB 4P2YA 4HQQL 1FNSL 5E99L 1A1MA 4N90D 1K8IB 1UB6A 5BS0E 5D7IA 5I1EH 4WO4D 1AD0A 1LHZA 4AIZB 5IT2L 3Q48A 3TZVB 3HUJF 4QRQA 1RVFH 3EHBC 4MQSB 3W5NA 4J3XA 2GT9B 3L7EB 4PYHA 2VLLA 3HE6A 2VZ3A 2YEZB 2R1XA 4DVBA 4XVJL 1C5BL 3SE9H 5I18L 2IH1A 4FZEL 1MHEB 1XR8A 2M2DA 1X44A 4N9OB 4XBPB 4NUGH 1KB5H 1IGFH 1KCUH 1JIBA 3X3GL 2GY5A 1FP5A 1CT8B 2JJTC 3G5YB 3WIIL 5AZEH 2AABH 2XWTA 5D7KD 4MCYB 5SWSE 3QUXD 4FFYL 4JGMA 1HKLL 4XXCC 5IOPA 1LDPL 2AXHA 1QLRA 3ULVD 1JF1A 3NAAH 4OSUH 1KXQE 2NY2D 1A6TB 3G6DH 3GMOA 2K7PA 1KN4H 4YHPB 2FX9H 3RFZC 4GRLD 1JPSL 4I18C 5DMIH 2DM4A 3O9WD 3S35H 3PXHA 3EKCA 3TBWB 1HHJA 2PTUA 5T1MA 4N9GA 3I50H 1M6OB 3ZDYF 1CTNA 2F53E 4OKVB 1JHKL 2ID5A 3BGFC 2XZCL 2ZOLA 3Q6FA 5D7JA 5HHOD 2E27H 4JHWL 4Y5VA 5GGRA 1TQBC 1OSPH 2DKMA 1J18A 4NQCD 2J8UF 2Z31A 1YPZF 4PLKD 4XP1H 5IK3B 4X7EC 4OF6A 4HV8B 4PRHD 4YGVA 4HJJL 4EI5B 3MXVL 2YS4A 5IJKC 3U4EB 1HHKB 3R1GH 3HHRB 4PLJC 4UNUA 1QRND 3DTXA 3KPLB 4NNYB 4KHTL 3RWJB 5DHVB 1G7IB 2ZSVB 1BMGA 4MAYA 5A43C 2A9NL 2NY6B 5FYKL 3K81A 4CU8A 4QRPE 1G0XA 3RVXD 5HYQB 4DK3A 2ICWI 5IR1A 1G0DA 3ZKQD 3LPFA 4BZ2L 4ZXBC 3MV7B 1BJ1J 1JPST 2VXTL 2E5EA 2X9WA 5EPMA 1Z6JT 4YPGB 2AI0L 1BVLA 2CLZA 4BK4A 5CUSL 3L3GB 1S7WA 5JNYB 4P4KD 2C3HA 4LDOB 2DQHH 3QFJB 4IRJC 4PY7A 3CDFA 4XVSH 5ANME 5I1KH 3SO3B 4YHNA 4FOMA 3BFOA 2UZIH 1QEWB 2ITDA 1RURL 2VQ1A 3BSZL 3SKOB 4XGZB 4XNUL 3O4LD 4HJGA 3QUZB 2VXUL 4POUB 4X7DC 1C7SA 2VDLL 4MYWB 3VG0L 5JDSB 4NQXB 2FO4A 1INEH 2WLYA 4WO4A 4AY0A 4KK8D 3BWAB 3TYGH 1QO3A 5BJTA 1HQRA 1MNUL 3GJFB 1CK0H 5DEFA 3WJJC 5D1ZC 1CFVL 5TDNB 4PGBA 4RBPH 4Z7UE 4Q74A 1NCAL 4NO2B 3RNKB 1DLFL 3BZ4A 4GW4B 2MKWA 1GZPB 2EH7L 3OJDB 1WFNA 3UTPD 1B0WA 2H6PB 4PJ8B 5E7FA 3LEVH 4FFZH 4EOWH 3BPCB 3FHAA 4QYOA 4NDMB 3V7MA 2H3NB 4TNVF 1NCCH 3QUXA 4ZO7A 2NXZB 1JE6A 1UKQA 3UBXB 4YBLB 5C08E 3WO4B 3G6JE 2FNBA 4MNGA 2O61B 1SHMA 5T1DL 4GRLA 4MGXA 3ZHLA 4KRLB 1CDCA 2UWEA 1H5BC 3B9DA 3VXOA 2F19L 4GKZA 1DN2A 1PQZB 2J3SA 3DVIA 1S8DB 1WEJH 1NMBH 4LNRB 3QHFL 2NY3D 3D3VD 5DVKA 5SWZB 4E41D 2Z35A 4HS6A 5IB2B 5HHOA 3OJMB 4PGEB 5ESQA 2X5PA 5GS0D 4L3CA 1RZKL 4LCUB 1ZANH 1R5VB 3SOBH 4PRHA 4X80H 4V2CB 1G1YA 3RWCB 3B9KB 1XH3B 2OL3H 1RD6A 2N7BA 5GGVY 3WFCH 4WHTA 4MJIB 5DWUH 5A3ID 1U8KA 2QHLA 3Q5OA 5CINH 5E7BA 2X7LA 2F8VA 1QRNA 2WIIA 8CGTA 2ADGA 1B0RB 3NFNB 3DVNB 4KTEH 3BZFB 2FATH 4MX7B 5INCA 2JJUA 4FMKA 2VC2H 4NO3B 5D71L 4YQXH 2N56A 1FAIH 3SDAB 4WTZA 1MREL 2YK1L 5GGQH 1MHHA 4HUWA 1EUUA 5KVGH 5ACMA 2X1QA 5HGAA 5C0IA 2VLMD 4PRBA 3UX9B 2OR7A 2ORBH 5BVJB 4NIKB 3JV5A 3QPXH 2B0SH 4POZC 1K3IA 1UXWA 4LOUC 3CSYB 1P84K 3VFNB 4N0FA 2CH8A 5FGBC 4G9FE 5IJVB 1C8PA 4K3DL 2VE6A 4KMQA 4JDZB 1Q1JH 3GDBA 4PJCF 4P4KA 3BDYL 5D93B 5FECA 4NSKB 3TJHD 3VGAB 3KDMB 5DD0L 3P73B 3OXSB 4YC2B 1F90L 4ZFOL 1U8OB 4K2UH 1T22B 3SDYH 3MJ9A 2EIZB 3O2DH 43CAB 3ARYA 2CKBL 3V6OE 4MQ7A 3BI9X 3S34H 1QKZL 2EDDA 3WUWA 1J7VR 1P4BH 4U6VL 4PJGA 2GFBB 2ZUWA 5HGHB 1F4YH 1MUJA 3UC0L 4PJHF 4ZTOH 5HDQH 1TTGA 2OTPA 3GO1L 4H20L 1RZGB 5KANG 5JIIA 2Q3ZA 3GK8H 4MA3B 4OT1L 4HUKB 2EDXA 2AK1H 5GGTH 3CDGA 4MS8C 2IH3A 1VKXA 5AYQA 5BCAA 1SMAA 4KZEL 3S5LB 3QIWC 5CEZE 1GOHA 3BIKA 2JJVA 1P9MC 4FQQB 3N85L 2DIBA 4FFVC 2HYMA 3GSVA 3NFPA 4OJFH 3GSQA 2CDGA 3PV7A 4L4VB 4U0QB 1JWSB 1FYHB 3RI5F 3UPRA 4WFFD 5B38G 2VDML 1I1AD 1I7UA 1A6VL 1FO0H 4XNYL 4YUEL 4QOKD 5KS9F 5DVLA 3QDGD 3V7AE 1E27B 2IQAB 3RVUC 2DM7A 4ETYA 4PJ7B 4Y16B 2BNUB 3DMMD 1RUQL 4EZMA 3VFRB 3KS0J 2YUWA 4KGJA 4E41A 2E9WA 5C07B 1YEDA 4M00A 3T8XA 1OVZA 4PJIE 4WI8A 4P2RE 4LGRB 4YEFA 1LO4H 4HKJA 4U1NB 4PRAA 4ZPTB 4U7KA 3VH8B 3FT2B 1LO5A 1WBXB 1YY8B 2OP4H 4BZ1H 1ZHLB 3UJIL 3C6SA 2YC1B 4MMZC 4MQTB 3C08H 4PRID 3RGVB 4MXQC 5GXBB 4XAWL 4J3WA 1YUHB 2XKNB 3FOMB 2DQIH 2QR0A 3CFBA 3ARTA 3OAYH 5BV7B 5F9OH 3FT3A 1T66D 3V5DA 2ZCKL 4ZDHB 5FO9A 3V6BR 4GUPA 1YMMA 3ALXA 4O2CA 4UTAL 1S3KH 1MVUA 2BSTA 1RK0B 1WTLA 3JTTA 2AXJA 3ZLQC 4J1UB 3SDXA 4YHKH 4LBEB 3U7YH 1ONQA 3ARFB 3MRBB 3DRQB 4G6ML 1D9KD 1Q72H 5FHAH 2C3VB 3K46A 1UCTA 4OLWH 4XWGH 5T3XH 5D7LA 1GGCL 5KG9A 2D03L 1S9VA 5IB4B 4LCIL 5F7EL 1QTYT 1AE6L 1PGRB 3CMGA 5KBNC 5EFIA 3ABZA 3OF6D 1MH5B 3AB0B 2YD5A 1Q9WB 2Y1VA 3EGSA 5DD6A 2AGJL 2B1HH 3RPIB 3SPVB 1WC7A 3CFKA 3LS4H 3MJ8B 1WBYA 3HG1D 4QHMA 3IJSB 4X6CB 5DJ6A 2CRMA 3EYFB 1DBML 2O5YL 4XRCA 3MJGX 2OS7A 3PP3H 5EO0B 3GMRA 4HIXH 3HAEA 2VRAA 4JLRA 2C3GA 4PJHB 4Y4FC 3TVMC 3O2WL 4PREA 4NQUA 2LABA 3KPMA 2XIDA 4LPTA 4G6FB 4OCYL 4WW1B 3QEQE 5F1KC 1W72L 3WSQH 3MX0A 4KJPD 3CK0L 4M48H 2J5LB 4F7TA 1M1SA 2GIYA 1S7UA 3KJ6L 3T0DA 4EUPA 4YFEA 1U3JA 3FMGL 5T1LD 4K8RH 1U91B 5FV1L 4XB8A 1DUYA 4WI3A 2PR4L 5DD3H 3GMLA 1SM3H 2AW2A 2HKFL 4HWUA 3NIDE 1F42A 5JR1H 4PBWD 1T7WA 4PV9A 1UB5B 4JN1L 4CRPA 4OZIE 3PWJA 2G2RA 2HWZL 4Y19B 2R2EB 5I30H 1IEAB 3QUYC 3IU4H 4TN9A 4ODSL 1J05A 4QOKA 2XTJC 3BGMA 3QDGA 1I8KA 4NBZB 1NUGA 5FGRA 3O6MH 5C8JA 3AM8C 1JUFA 1DQJA 4ORGA 4HS3B 1CFQB 3PE9A 1DUZB 1VGKB 4L9LA 1KACB 2W07A 3DMMA 2AJZA 1AGCB 5HJ3A 4XBEL 4PJ9A 3ULUF 3RX7A 3JTSB 3CXHK 1Z9OA 5L2KE 3UYOD 5CCKL 3WXWH 4J7RA 2YZ1A 4LGPB 4Z7VE 1ZHKB 2GSIB 5FKPA 1U8IB 1XAUA 3I02B 3QQ9D 3C09C 3VFUB 2PNDA 3A6CH 2XZQL 1IARB 2ICWA 3AAZA 4XCEB 2PETA 4L8DB 2ATPB 4D0DA 1IAOB 2BC4B 5HHNA 2KL6A 2ICEA 3CZFA 5A16A 3NZ8A 3HZVA 4PRIA 2FWOB 5I1EL 2CK2A 5SWSB 4NFCA 3BT2L 1U8NB 4YHOH 5I1AB 1S7XB 4KKBC 3U0PB 5DFWH 4HIJB 1XF1A 3GI8L 4NUGL 5CGYC 2APXA 2CGRH 1KB5L 3UJTL 1D9KA 1U3HC 4B50A 1R3LA 1PX3A 1KJ3L 5BZDB 5C0GA 2C1OA 1FHGA 5AZEL 5M95B 1FYTE 3L3OB 4NN6B 4LEOB 3KPQB 3VU2A 3OF6A 3NAAL 3G9VA 2XWBB 3WHXB 5DMIL 5IHBA 2WBJB 4YBHA 3S35L 5F88A 3HG1A 3LQAH 4CVWA 2WANA 1UENA 3I50L 4L4TE 1JHLL 3QJHA 1BAFL 1YN6B 3GRWH 1GOGA 1QSFE 4Y7MA 1NDGB 2E27L 2GSGA 2VJXA 1JGLH 4P59H 3BEWB 5JPMB 4XP1L 2NY4D 1OAKH 3RGHA 4QRPB 1TTFA 2VH5L 3MRHA 4U6YB 1BEYH 1UH4A 3CIQA 4G80B 1N2RA 3R1GL 3EO9H 5T1LA 5GGSA 2PUQT 1F4AA 2PYEE 1YEEH 4GRMB 3WN5C 3V5HB 1FNEB 1W8NA 5ENWA 1FAKT 5DZOA 5I1IL 3THMH 1L9MA 1DVFA 3DV4A 3RVVD 2WP3O 1OTSC 4FZ8L 5DFVC 1K2DB 5AWNH 3UO1H 1OWWA 3F7PC 3QIUB 1CQYA 3K8KA 5HI5D 2BVUA 1WWAX 3MBED 2CIIB 3AS1A 2KZWA 2QQNH 1V8HA 5J6HB 4LRIA 4WEMB 5F1OB 3EZJB 4A2MA 3BO8A 5EU5B 5I75C 2BOCA 3ULUH 1MCWM 2Q7YB 2BMKB 2DQHL 4MCZB 4X9IA 4NJAH 5IVZA 1JZ8A 4JM2F 2Q7NA 3NPZB 4IOFD 4KAQH 3VDCA 1U2CA 1FFNA 4Z7UB 4JDVA 3T77A 4JQXC 1PKQA 4PRPD 4QHUB 2EYSA 1IGJB 4KPHL 5HHMD 5DRZA 3L3DA 2AXGB 4JRXD 5CIPB 1IAIM 3UJJH 4F80A 4WTXA 5TF0A 1TJHH 4FXLA 2W0KA 1HHIA 3IDJB 1AI1L 1AP2A 5DC9B 3LH2L 5KSAD 2XG5A 1INEL 5F9JB 5DSCA 1UCBH 1LMKA 3TYGL 5DJZB 3MO1A 4J4PD 1CFNB 5TDOB 3F62A 2AJVH 1MLBB 2Z8SA 2ZG2A 4HFWB 3TNNA 2FZ3A 5C08B 3B9AA 2AK4E 5FYKD 3G6JB 5A1AA 1KIRA 2ICWJ 2JB5H 1U41A 5I1LA 2Z92B 2NXYB 3FONA 3FB8A 3IAGC 1UZ8A 2QQLH 3ARBD 3CSBA 3D9AH 4Z7WE 4OB5H 3QEHB 4K3JH 3LEVL 2I5YL 4FFZL 2X89A 4YHIA 1H3PH 5DURD 1TENA 2V5MA 3QDMB 5TDPA 5MERA 2BVQB 5ID1B 1BZ9B 1NAMB 2NZIA 1NCCL 3EDDA 3PHQA 4QXTB 2PW2B 3V0WH 3U83A 4GMSL 3SGEH 3H9ZA 4AH2A 4M62H 1N7MH 4UT7H 1EH9A 4JPIB 3ULVC 3O6KH 1FQ9C 1X4XA 5E5MA 4LLVA 3BJLA 1J5OH 3O9WC 3VXTB 3F12B 5KVEH 2YBRA 3H9SE 4WFGE 1D5MA 2VLKA 4GAJL 5BXFA 3MRPA 4P9HC 1WEJL 5C6WH 4JZJB 1NMBL 5DFTA 2HVJB 4RGNE 5E8PA 1AGDB 1B0GA 7FABH 2X4QB 5F72S 3FQTB 5GHWH 1CDYA 1RJZB 4UOW1 1EJ6A 4P23B 5HGDB 3WJLC 4XMKL 1PLGH 1ZA3B 2YUVA 4X80L 1T7VA 2XN9E 3E8UL 2OL3L 4GQPH 1K4CA 5IVXF 1FNLA 3UTSD 2W60A 1G7JB 2HH0H 4WDIB 5CINL 2F5BL 3MLTB 4U3HA 4G9FB 1A3RL 5TF1H 2VC2L 4OIIH 4WUKH 4YQXL 1UYWH 4CVUA 4HGMA 1FAIL 5CGMA 3KNBB 4K9EH 2WWMC 3CVHB 5I8OL 2IPTH 2KKQA 5GGQL 4PJXE 5JA8B 1OY3B 3GMMA 4LHUB 2B5IB 1LP9B 1QQDB 4XC1L 3GMNB 5EO9B 1CGTA 1HI6A 3AS0A 3QPXL 3MBEA 5DUPH 1ES0B 4U0RB 2ZUQB 2L7JA 1HDMA 5HY9B 5F7DB 3TT3H 1CG9A 5IGXH 2PYFA 3L5XL 4F58L 4UV4L 3T2NH 1PD6A 3BRDA 4PRPA 5EN2B 5ICZA 3U7WH 4JRXA 5TH2A 1JGEB 1ITCA 2QBWA 2F9BT 4YBQD 1E28A 4ZUVB 2IPUK 5KSAA 4X9BA 4LPCA 1F4YL 2RJMA 3LMJL 2Y5TB 4ZOAA 2Z93A 5TGBA 3NIDF 4O5LH 4ELMA 4N0UA 1FFQA 3HZKA 1TZHB 1F4WL 3JVGC 1XMWA 3RQ3A 1IM9A 5TQ0H 5GGTL 5DJDB 3GSXB 2VLJD 5DI8A 1CDGA 3ARBA 3BAEL 2BHYA 4LCWE 1U95B 2VQUA 4I13B 1G9NH 3QXUA 2DIAA 2Q8AH 5BQ7A 2I27N 1HSAA 1P1ZA 3S4SA 4KROC 3QG7H 4OJFL 1IGIH 5E6ZA 3CDCA 3AXLA 3D1MC 1CFTA 4ZUSB 5AEAA 2GTWB 4PJIB 3KPOB 4I0KA 4N1EA 4XX1G 1TCRA 1A6UH 1O7VA 4GLRH 4P2RB 4W4OC 4MB5A 3V6FB 4YXHH 5FUCC 1MCKA 4L3EA 1R24B 4ACPA 5AD0A 1I3RB 4HGKC 5FA3A 3X11A 1U0QA 1SYSA 4PTTB 3VDBA 4BK5A 2JCCE 4OUUB 2KUTA 3LHPH 4X6DE 2H26A 1PDKA 3VWKD 2A1WH 3I6LE 5GRUH 2NY3C 4IIQA 1PG7W 4K3EH 5ADPH 2HT3C 5IEHA 1WAAE 1I75A 3D18A 1EVUA 3T09A 5BW7C 3PDOB 3L95A 5FHBL 1PJ9A 4D3CH 2R0WH 4RQQB 3VRLE 3VFSB 2R2CA 1HXYA 3TNMB 3QXDB 3WNPA 1G7MB 4LLUA 3Q3GB 1LWRA 2B8OT 1EAPA 3UTSA 4QWWD 3TO2B 2W92A 1BZ7B 3C08L 3WV0A 3IFLH 2OQJA 4Q9CA 1QLFA 4UDTA 3SHSA 2IPUG 4MNHB 4JREC 1H8OA 3ZKMC 1J1OH 3A6BH 5TE7H 4Z76B 4ZNCD 4WHCA 2UUDH 1JVKA 2DQIL 4ONHB 3RUGE 1HYSC 5F9OL 3NPSC 3IFOA 5H94B 5JW4Q 2QADC 3IDNB 1OM3H 4P3CH 5DJCA 5GRYA 1I1CA 5L88L 3LD8C 1CE1H 1A1NB 4ZPVB 3BQUB 4MHHG 5KAQG 3HC0B 4C58B 4YHKL 5K9OA 1KN2L 1CVRA 3EOTH 1D5ZB 1V3LA 5JTWA 1CGVA 3GBNH 4OLWL 3NH7L 4P99A 5LGHL 3AVEA 5EBLB 1WZKA 2Z8RA 2AV1A 3PHOA 4CJ0A 1BQHA 4HDIB 4NQDE 1C5CH 3BN9C 4R8WH 3TJHC 2HN7B 1FZOB 1ZHBB 3QISA 3RY4A 2VDNH 4XP6H 3LS4L 4OZFB 2P48B 2NY1B 1EMTH 1I3UA 1G0YR 2YN5A 3CPLA 4P3DB 4HIXL 3BH8A 4UOW0 3JWDH 4LVHB 2P24B 5L2JA 3OXRB 1O7SA 4YH6A 2BSRB 2UYLB 4F33B 1ZSDB 4IRSB 32C2A 5E03A 4OZIB 3U79A 4PJEA 1MRCH 4XCCL 3WSQL 2ESVD 4OZGB 43C9A 3MLYH 3L7FB 4UTBH 5HYJD 3GMQA 5JORA 2VLJA 1Y6KR 5KVMC 2R0KH 1CXLA 4ZSOA 4JJ5A 1I1FB 1AR1D 4DZ8B 4JG0H 5JR1L 1BFOB 2HMIC 4D9RE 4DW2L 2DD8H 4BKLB 4KRPB 5HPOA 4Z7VB 4Y8DC 4CADA 3GBML 5I30L 3FO0L 3IJHB 2EDWA 3IU4L 2AV7B 1I1AC 3MLWH 3GUTB 5BRZE 1I8MA 1EGJH 4ZFOA 2LAGB 3QXAA 1W0VA 5B4MC 1FVEB 1U8JB 3QDAA 2CKBA 4OAWB 5HPMB 3VWKA 4DKAA 1AKJD 3HCVA 5E2UH 3NZHL 3VI3F 1DDHB 3DVGB 1OT2A 1DQTA 1HN1A 4R3SA 1U8LA 4OD2A 2RCSH 4YO0A 1C12B 3UBXI 4ERSL 1Y18B 1BQLH 1FVDA 2F58L 3A6CL 1EAJA 3NOIA 5CZVH 3ZDZE 1ZLUH 4Z7WF 1KUMA 5I1JL 2NPLX 3GBLA 1T5WA 2DDQH 5IBLD 4QRSB 1FFOA 1ERNA 1CGUA 4GBXB 2HVKA 1T1ZB 1C16B 2H2SC 4I4WB 3C60B 1FYTB 1J9CT 5F7KC 5EU6E 4C56A 2XKUA 3QDJB 2IAMC 5F3HA 4XNQB 1KC5L 4JPWH 4PRDA 4YHOL 2VXSH 5EA0H 3SCMC 2QKIB 2CDEA 4QXUL 2EE6A 4XB7A 4KKNA 1YC7A 3V0VA 3ECBA 4OZHE 1RK1A 4L4TB 4ZAKD 4HUUB 4NUJA 2AJ3A 1MWAH 3NABH 3G08B 5MEPB 1QSFB 3TO4D 4L29A 1BM3L 4NKQB 2JJWA 3BW9B 1XF3A 3P11H 1DBJH 3QUKA 4XVTL 4AEHL 1OP5H 3OJ2C 1G7QB 3WFHA 4DOHE 1A7NH 2YMXL 2E8YA 3VMOA 2MOVA 3L3JA 5F7YC 1C1EH 2EO9A 2JTDA 4Z6AT 3QB7C 2PYEB 3WLBB 1D5BA 4JFEB 2W38A 4Z7QE 3ES6A 2DMCA 3U30B 1ZWIA 3E6HB 4ZOBA 3GRWL 1FL3A 1RUKL 4HWBL 4P5TB 3B2UD 3C5SB 4L8CB 4ODHH 4WWID 3FO1A 2ZNXA 3TZVD 1OAKL 3M17B 4NM8L 4F7CB 2ESVA 4HBCL 5JXAH 5HYJA 5KSBE 2G60H 3VJ6B 4HW6A 2NTSP 4KDTA 3EO9L 2CK0L 1EZVY 4J3OC 1YEEL 1EEZB 2BRRL 3SQOH 3DO7A 4BH8A 3WUZA 3ARDC 3QO0A 3U2SB 2P43B 3PWUB 2FRGP 4KTYA 3W11D 5DRWB 5ALCH 4JFQA 3T3PE 4M8QA 4RWHA 4YR6B 5DS8B 3S96B 4TULL 3TN0B 4MNQB 4H8WH 1HILA 3WIHH 2EYRA 2ED8A 4WENB 1NGXB 2VABB 2ERJC 3FFDB 4K8RC 5TE4L 3FFCB 4OFIA 1AKJA 3DYMA 1I7TA 1KCLA 3QNYB 4RZCB 4ORZC 3TBYA 3B83A 3VE0A 5EZLA 4ETQA 1RZJH 2ZKHH 4F9PC 1YEKL 5D2NE 1P7KA 4NQSB 4OCRH 3W39B 4KAQL 4N68A 1NGYA 1W72A 4J23A 2EYTA 3QQ9C 1HH9A 1F02I 3MFGB 1CLZH 3DXAD 4EI5D 1UXSA 4OGZA 3UJJL 5FM4A 3SE3A 3KR3L 1RIHH 4OLZL 1NEZA 1XCQA 2A74A 2A9MH 2V17L 3MRRA 1WK0A 2EXYD 1RZ8B 3MLVL 5IWLA 2XICA 3OV6A 1U9KA 1HK6A 5C6TL 5J3HC 3RHWK 1JGUL 4HIEA 4APQB 1SQ2N 1OAUH 2NY6D 5F9WB 2RR3A 4F8QA 4KI5E 4RGOH 4I9WD 3MGOA 3EYVA 2QQLL 4EVNA 2DL2A 1ORQB 1QNZL 3D9AL 4FNLL 4ISVB 2X9YA 4LVNC 4HSQA 1EXUB 2R56H 4OB5L 3QXVA 1M05A 3CC5B 2ARWA 5IMOA 1ZTXH 4M6OH 3MV7D 4ZAKA 5IW6A 3HC4H 1NGPL 5F6IC 4MD4B 2DQJH 1BWMA 3TO4A 3V0WL 4IS6A 5E8NA 1NAML 3TIEB 4KUZH 2B1AH 1NLBL 4U1GC 5D6DA 3VA2C 1N7ML 5HI4D 3H0TB 3QFJD 2Y5EA 4NRZB 4HUMB 2H1PH 2XN9B 3IF1B 3WHE1 4QHKJ 5JIPA 4X8JA 3S8WA 4ZUWB 5D5ME 3MGTA 4P2OB 2NNAA 1WIUA 1QR1A 4XBGA 5DO2D 5L6YL 3PWPD 5IUSA 5E8OA 2E7LC 1EDQA 4NHUB 5IF0A 1FSKB 2V9RA 3QUZD 5HSFA 2VAAB 2E7CA 3EDJA 1JNHB 3DV6A 3PDDA 1K8IA 5B3JF 2GJJA 7FABL 4HCRL 3VD4A 5HVHC 4AIZA 2XRAH 1NC4A 3KPNB 3AUVA 3KVQA 3PQYE 4PJXB 3ISWA 4G43B 3L7EA 3G04A 5J6GA 2VDKL 3SGDI 2YEZA 3T4AB 1U93B 2XTLA 5JHLL 1MHEA 4WWKC 3U4BL 3LQAC 4XBPA 2HH0L 1S9WB 4GXVH 1QUNA 4WFED 4WJ5B 1JK8B 1KB5A 4I0PC 3IRPX 5D1XC 1CGWA 1PBYA 5TF1L 3IVKB 4LLDB 4OIIL 4WUKL 5DJ2B 1CT8A 3G5YA 4N0YH 3KXFA 4K9EL 3HMXH 3CVHL 4MCYA 3AU1B 2ADJA 3GSOB 2FIKB 2NXZD 1ZOXA 3PGFL 4P5MA 3T1WA 1N5AB 5DQJB 5EZIH 4XPGL 3RVVC 5C0BE 1A6TA 4XP9H 1V7MH 4YHPA 5IHUL 4D9LH 4TSCH 3QNZB 3SDDC 1VENA 2EEDA 3NACH 1Y0LB 5DUPL 3TBWA 3ZSSA 1LNUB 1ZE3C 1QSZA 4EN3B 2XACC 1M6OA 1J11A 4OKVA 5DK3A 1S78C 3NCJL 5I8CB 3HAEG 5SWZD 3TT3L 1BHGA 5IGXL 4OFDA 4BSWB 3T2NL 4WI9A 5INDB 2IBBA 4HV8A 3QZWB 3DXAA 3LKSB 4LCWB 3WNNA 3B9KD 1EK3A 3U7WL 2WINB 4UUJB 4PJFF 3KHOA 1S9XB 3B2VL 3SY0B 1KBGH 4EUPG 3HR6A 5IP4A 2DTML 1HHKA 1FORH 5CEZL 5CD5C 4MXWH 4XTRD 1KPUB 3KPLA 2KH2B 2W0PA 3ULUC 3RWJA 4KVCH 1Q9OB 4L8SA 2VO5A 4J4PC 2VMFA 3EYQC 3RU8H 1G7IA 2ZSVA 3SDAD 5I1DA 3TPUB 2D31B 35C8L 1LO2H 3IGAA 5CP3A 4JY6B 4MLIA 5TQ0L 4JFOB 5AZ2H 4R0LA 5ICXB 2JCCB 4IEFB 2ZSWB 4U1SB 4X5XB 5I66B 1YMHB 1EPFA 1H3WM 3ZT5A 2DJSA 2O93L 5HYQA 1MHPL 4TVPH 1BJ8A 2BVOB 1G9NL 3ESUF 4X6DB 3G6AA 4NGHH 2VZUA 3MV7A 2A38A 1NFIA 1QYGL 4YHLL 4GG8A 3ZTJG 3MOQA 4YPGA 1V7NL 2C26A 2H2PC 1IKNA 3L3GA 1A6UL 3FRPA 4HPOL 4V1DE 5C0AE 5JNYA 1NGQL 4M61B 3QFJA 1KPVB 2HTLD 3OAZK 1E4JA 1Z0NA 1GOFA 2QEJA 2VIRB 5HHPB 1OD7A 3NCYS 5HHXH 2AQ2A 1QEWA 1AGFB 5DUMH 1N6QH 4LMQE 3PWPA 4XGZA 3SKJL 3OB0K 2A1WL 2X6MA 3QUZA 1YDPB 1BBDH 2X4UB 5JDSA 3TYFA 3QQ4B 4LSDA 4NQXA 3UAJD 2V5SA 3KPRE 3RUGB 1U8MB 3FJTA 3MRDA 1T89C 2JJSC 3BWAA 4JFZH 2WAHA 1F13A 4FQ1H 4G42A 2BNQD 3LRHA 2NLJB 5D6CB 5GRVK 2VDOL 4P9MH 5DR5L 1MAMH 4EXKA 4Q97A 5TDNA 2AJUH 3OG6B 4NO2A 5IQ7L 5FIEA 3O6FB 2D2OA 2H9GA 4I3SL 3RNKA 4U6HB 4GW4A 5E24E 1GZPA 1CE6B 2A77H 3DO3A 3MV8E 2H6PA 4D94A 4F7MB 3A6BL 4M5YH 5TE7L 3BPCA 3T4YB 5FGSA 4LP4A 4NDMA 4EIGB 1DQQB 3H7BB 4L4VD 1AY1H 2X4RB 2Q6WB 4NQDB 2NYYD 3UBXA 1IAIL 1CE1L 3TC9A 3T0WA 1T3FB 3SGKA 5DMYA 4ZOCA 2FJFB 2YRZA 3MGAA 1I7ZB 3PV6B 3GIVB 2D7OA 2C4FU 1FL5B 3QCVH 2NY0B 1PQZA 5I74B 1S8DA 3SDCC 4Y16D 1I8LC 2FJGB 4LNRA 4MDIB 2JIXB 4JPKH 5EU4B 5SWZA 2WWKO 5C07D 3WHE0 4Z8FL 4R8WL 2MQCA 1J8HA 4PB9H 1OHQA 1ZA6B 2VDNL 4LCUA 4XP6L 1R5VA 2EEAA 4Q6IC 4I0CC 3STLB 4N1CA 1VGEL 3RWCA 3B9KA 1XH3A 5E70A 5CFHA 5KTEH 1HCVA 4ZO8A 1YEGL 5IBTH 5J12C 3JWOH 1F2XK 1UB6B 1X5HA 3FHQA 3RGVD 3JWDL 1B0RA 3NFNA 3DVNA 3BZFA 4MX7A 3B5HA 2VUYA 2WQ8A 4NO3A 4LSUL 4QRQB 1YNLH 4OV6F 1R3IL 4JM2C 1KCVL 5H35B 3SDAA 5F7UA 4AM0B 1ND0B 2FLBT 3T1FB 3C8HA 3K0WA 1MRFH 2Y25A 3ARGA 2IH1B 5BRZB 2Y36H 4RNRB 4F7EB 4JKMA 1ADQH 1F8TH 2WUBH 1KENL 4NN7C 5BVJA 2DQUH 1MCSA 4U7SA 3ARFD 2Q76B 3QUMB 1CXKA 1KSRA 3ME0A 4JG0L 2ENYA 3CSYA 1VEOA 1AFVH 5F70A 4NQEE 1UWXH 5AAMA 4HUXB 3VFNA 4M93C 1J1PH 4S10A 3N1QC 3W0WD 2C4XA 1MCCA 2AERT 4Y5YC 1FZKA 3EZ8A 1JF1B 4NSKA 1XIWB 3E3QC 3MLWL 3GMOB 3KDMA 3WFDH 5A2KH 3P73A 1AXSB 4FQIH 5E00B 5F8RC 2EIZA 3WKMH 5IFHH 43CAA 2VITB 2CRZA 2DQTL 2GI7A 3GFUA 4PLOB 1YJDL 1GPOH 4J2XA 2FX7H 4M6NH 2GFBA 5HGHA 3Q6FB 4HLZG 3F6IA 4FQHB 5DQDH 3ZKXC 4YDIH 4WNQB 1EEQA 1N4XH 4TUKL 4G6FD 1KCRH 5GZOD 2BNQA 5FYLE 1BQLL 4YGVB 3WCYA 1E6OL 5D70L 4QGYA 5GGTA 2F74A 3G5VA 1HHGB 4TUOB 2EDRA 1IQWH 3IDXH 2DDQL 1NH6A 4M9OA 4OZHB 3T04D 1ZEAL 4L4JA 3S5LA 2A0LC 1MFCH 2C9AA 4OFYD 4UU9B 4JO2H 1JZ7A 4JR9H 1AR2A 3SE4C 4HMDA 3VXRE 4L4VA 1JWSA 3BN3B 2ZCHH 4JPWL 1OLLA 4Y19D 2VXSL 5IB3B 4G7VL 4UNVA 2OTWB 1JPGB 3CFDB 3QFDB 4DOHB 3GKZA 4OGAD 5IW1A 5IIEA 3MOBL 5FYJE 1LO3H 1BF2A 3FCTB 2IQAA 4JN2B 1MWAL 1ZLSH 1X4YA 4PJ7A 5TFSH 2BNUA 4S2SB 2BRQA 3VFRA 1S7WB 5E1AA 2FEEL 5C07A 5J7CC 3ZE1F 2XQYG 3PGDB 5D8JL 4XI5C 2C1PB 3WO3B 2VUOA 4YHNB 4LEXH 5KSBB 5DD5L 4KU1A 2YA0A 4U1NA 2VQ1B 4I3RH 3ZSTA 3LDBB 4YEEA 4HMEA 1ZT1A 4ZPTA 5FO8B 3VH8A 2A6IA 5LGJB 4YFLF 3FT2A 1YY8A 4QHNB 3QG6B 4HJGB 5K9JH 1ZHLA 1LEIB 4N0CD 5E1HB 3UXFA 1WUNT 3RGVA 3TF7C 4KMLB 4W70A 4KHXH 1A5FH 3KWWB 1YUHA 4ODHL 2XKNA 5BJTB 1HQRB 5SWSD 3M8OH 5CEYB 3MA9H 1JGVH 4ZDHA 5F6HI 3H6JA 1TCMA 3P30L 3BZ4B 1T04A 2LU7A 4I77L 2Y07L 1MFNA 3LQMA 4LBEA 3ARFA 2CO6B 3MMEB 2VXQL 3DRQA 3SQOL 2YXMA 4QYOB 2R9HC 1Q94A 4CVZA 4ODXA 4UIKL 2LTQB 5CBEB 3W0WA 1G7HA 1WZ1H 2EDLA 4PJCA 5IB4A 4H1LH 2VLRE 5D2NB 5ALCL 1JRHI 3FO9B 3RWDB 4FFWD 4HUNB 2IADA 3FN3A 2IG2H 4HZLB 1MH5A 1Q9WA 15C8L 3WIHL 3SPVA 3RPIA 2WBJD 5EG6C 2LU4A 4IOIB 3IJSA 4X6CA 3EYFA 4PS4H 2OMBA 1B4JL 2VNCA 5EO0A 4UT9L 2CMRH 5F96L 1A3LH 3O4OB 2GJZA 4PJHA 1J0KA 1JMXA 4JKPL 5EUOE 2ZUXA 1CXFA 2FECL 3L5IA 4J12A 4QRPD 2V2XB 3I75B 4LSPH 5IFAL 1A0QL 1AHWC 5I0DA 4WHTB 1YQ2A 3HI5L 3SE3C 2CSPA 4R2GC 2A9ML 4FTVE 1GC1H 4X7CC 1U91A 1ZVYA 2X7LB 2RGSA 2R0LL 4ZNEE 3LN9A 5B39G 1MJ7L 2DOCA 4OFYA 5INCB 1N64H 3CFCH 3OAUH 4YJZL 5CGTA 5E56A 1QFUL 1MHHB 1RU9H 4Y19A 5BO1L 2R2EA 1X6NA 3OB8A 4PRBB 5D5MB 5KS9A 1V3MA 2JELH 4B0MM 2VXVH 1GGBH 4QRTB 3QIUD 3MRJB 1AGBB 2NR6C 5GS2H 5IESH 5LQBH 3S7GA 2EZ0D 4HS3A 1CFQA 1KFAL 3HC4L 3DI3B 2DQJL 4XHQA 1T6VN 5BS0A 1AGCA 4KUZL 2B1AL 4TTDC 1BF8A 3JTSA 2E7MA 5FECB 2MCG1 3NGBC 4KK5D 5J8OA 1ZHKA 5EWIH 2H1PL 4RMVA 5CJQL 1MY5A 3REWA 2QQQA 2GSIA 1IAII 3I02A 4Y5XC 2PW1A 4XMPH 3RWGB 4XCEA 4MQ7B 4L8DA 2ATPA 1IAOA 2BC4A 2EEBA 1TQCB 4RGMB 3D5OF 4MMXC 1KYOJ 3MLUL 2FWOA 4GRWE 2XRAL 2Y6SD 4CDHA 3PWVB 3W5MA 3F5WB 1CD1B 5SWSA 1FPTL 3TZVC 1CLOH 4UQ2B 4IMKA 5I6XC 3P77B 5C08D 1U8NA 2AXFB 5C0BB 5TQ2H 5EBMB 2NXYD 4P46D