1ZA3B

The crystal structure of the ysd1 fab bound to dr5
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
230
structure length
224
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFSIYSYSIHWVRQAPGKGLEWVASISPYSGYTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRYSSYYSYYYSSSSYSYAMDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab-YSd1 light chain
publication title Molecular recognition by a binary code.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/signaling protein
total genus 35
structure length 224
sequence length 230
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1za3B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1za3B01
2IANE 4LSQL 4BK4A 1S9WA 1YECL 3MJ7B 2AK1H 4TTGA 5ISZD 1UVQA 3CFKA 4NO0B 3HI1A 3N85L 5FV2A 4U1KA 1Q72H 2NCMA 3SJVA 2A73A 1K3IA 4POYA 2P42B 3UBXI 3GEWB 4ZAKA 5E8DH 5JHDD 5FYLL 5IOPA 1PFCA 3D0VB 2GFBB 3N9GL 2NZIA 4X9GA 1HIMH 3HPLA 3QJFB 1YPZE 3LQZA 5FA4A 1HXMB 3SGEI 3AB0B 3ZZ1A 4X9FA 3ZYIA 2GJ6E 4G9DA 1SEBA 3OAYH 4APQA 3HRZB 1G9NC 2VXQL 1Q9LB 2AQ2A 4OGZA 3TBSB 3VXQA 5D7KD 4UUJB 1XFPA 1DBKH 4N9GA 3SDCB 4NQCB 1P1ZB 4U3XA 5C0AB 1FZOA 2J8UF 4ZO7A 5ACMA 5T1LA 5I73C 4ZFFA 5E5UB 1OGTB 1MCWW 4GQPH 4KAQL 4M43H 3SJVE 1M7IA 3ILQD 1OF2B 2DKMA 3ZKND 5F7DB 2G5BA 2DLGA 5D5MA 4DKFL 3RJQB 4IRJB 2R1WA 4FMFA 5C3TA 2GI7A 5GRZA 5IB3B 3GUTB 4MDJA 1V3JA 2DQJH 1B0GA 1KBGL 1VDGA 2BSTB 3L9RA 1WTGT 1AO7B 1WC7A 2MMXA 3MRDA 3L95A 5TQ2L 4FOMA 2ZSVA 3ZKXB 3L3DB 2F5AL 3QUZD 2YPLB 3BWAA 5GJSL 3B6SB 3VFMA 4ZOAA 4QRTA 5IVXB 1YQ2A 3EO9H 2R69L 1YYLH 1GJIA 4F7PA 3S35H 2BSED 4NNPH 4EDWH 5SX5H 4CU7A 2GITB 4OZ4A 1I8KA 1ZA3A 2O5ZH 4QWWD 3ZL4H 2X70A 3IJHB 2A77L 4JFFB 4W4OA 4Q6YA 5EDXA 2FX9H 3O6FD 4PRPD 1YUHB 4JJ5B 5DURD 3WO3B 3O2WL 2X4RA 5EZJA 3DUUB 1DZBA 3QUXB 1SJEB 1EHAA 4OZFB 3U6RB 4OLUH 4QXUH 4C56B 1U8JA 5DC0A 1GC1L 3IJYB 5B8CB 2EE6A 4JE4B 4PG9B 3BQUC 4RWYH 1IKNA 1F8TL 1I1AB 3GMQA 3O9WC 1I7RA 2EDFA 4KRPC 1AGDA 2R1XB 3T2OA 2BFVL 5GRUL 2D9CA 3OGCA 2O5XL 2B39A 1P53A 5TH2B 1J86A 5IQ7H 4OCXH 4S1SL 3T0BA 1O7SA 2AEQH 4JKPL 1FVCB 1SJVA 1UG9A 2H8PA 4Q9QH 1BZ7A 4HG4J 2MNUA 4DZBB 4OTXL 2CGRH 2YHGA 1IJ9A 4HLZG 1HILB 3MNVB 3BSZH 5IT2H 1EH9A 5HGAB 4GXUM 4PJAA 1MJJA 1F4YL 1ROWA 1FFOA 1S9VB 1KCUL 3WKMH 3ZTNL 1DFBL 4OD3L 5MERA 4P46A 5FFLA 5DSCA 2VH5L 3CGTA 1X5IA 4DZ8A 4ELMF 4UILL 2AV1A 3UYPA 5E4IA 3KYNB 4M7LL 4HK3N 5E5MB 4XWGH 4O2CA 1IAKB 1R6VA 2XXMB 4MJIB 1TCRB 4FZEL 3IT8D 3VXUA 4X7SH 2FEEL 5J6HB 3U83A 2NW2B 4NN5C 3VGFA 1ND0A 4G8GB 5CBAB 4HUXB 2VIRB 5D7IB 4BA8A 3GMPB 4HF5L 3MZGB 5T1KA 1JCKA 3RNQA 3Q5TA 5C0AD 4P23B 4MXQD 5J56B 1AE6L 3B2UD 2X41A 1HINL 4JFQA 1QOKA 4IRSB 1S7XB 2YRPA 1Q9OA 2YRZA 1FL3B 4OIIL 5JDSB 4YBHA 3C60D 3F7VB 1NCCH 4J12A 3GO1H 1DUZA 4PREA 3E6HB 2E7LA 4YDKL 4R0LC 2QR0B 3CVIL 5E8EA 2JB6B 4PJ8D 1L9NA 3V8CA 1D5MA 1EVTC 4AENB 1XCQB 3MRNB 3V0AC 3OKLA 3HC3H 1WFTA 4WDIA 3VWKB 3VXUE 2VTFA 1AKJB 4C59B 2YPLD 4PJ5E 2DQDH 1LE9A 3S3SA 1IBGH 1QSFA 3GSWA 1SBSL 3VD5A 4XCYB 2EIZA 3QCUL 3WDJA 5JW4Q 5J11C 4YHOH 3GGWB 2VXUH 1U36A 2NYYC 3EFFB 1KT2A 4XP1L 3AS1A 4WY7L 2FGWL 4Y5VC 1B90A 3MRPB 4ODWB 2AABH 3IDIB 3QUXD 1N8ZB 4RMRA 5DWUL 4WW2B 4LLWA 4UU9B 3VFSB 4PGDA 3LS5H 3QDMB 4IMLB 1C5CL 5F89A 2EIBA 5DJ8B 1R0AH 1KJ2H 5F6HJ 3F6LA 5HHQA 4CW1A 4KK6D 4C4KO 3MUHL 4MAYC 2EYTA 3IXAB 2Y36L 3B9AA 2EIDA 3BKML 3WFBH 5H94A 5DLMH 1N64L 4AIOA 1ADQA 3EO0A 2A0LC 4PJ9D 3AMLA 1G0YR 1UXSA 4GAYB 1QSFE 4GG8B 3M1BB 4ODXB 3P4MA 3WFDH 2EKJA 1FN4A 1KCVL 3OF6D 3T77B 1LILA 1U8LA 3JUYA 3MA7B 4U1LB 3ZSSA 1SYVA 2HG5B 3W11C 1ZWIA 2FSEB 1T20B 3SY0A 4HWEL 1MH5B 4KQ3H 3KNBB 1DQDL 4KQ4H 4I18B 1KLGB 4HKZA 4DWHA 5JOPD 1A21A 1T0PB 4F9LC 4NO3A 5I1DA 4Z7WF 2XPGA 2A9NL 3QJHB 1UWXK 1SEQH 4ZFOB 4G8GD 2W59A 3MGAA 4XRCB 3HI5H 3S36H 4EN3D 2AGJH 3EYSL 5MEOA 1IL1A 4YBQD 4JHWL 4KFZC 1FV1B 1CICC 4JZJB 4Z7OF 1T7VA 4WHCA 1NCNA 4YGVB 4NKMA 1DBAL 4HG4K 4TVPL 5I16B 3E8UH 1QFWM 4MB3A 5A2IH 4POZD 3DROA 3UPRB 3CVHL 4Z0BH 1DQQB 1MPAH 5I18L 4OD2B 3HRPA 1I8LA 3L3IB 2AXFA 4NOBA 1RU9H 1BVZA 4DCQA 1FLRH 5KVEH 1YEJH 1YNTB 4P2RB 1D5ZA 1CF8H 2N56A 5I76A 4WJ5A 1M6OA 1D5BA 3L6FB 3MOAL 1PY4A 3ZTJH 4LKXB 2A6KA 4V2BA 1KPVA 4U6XB 4X5WA 1F02I 4HIJB 5A16B 3WN5A 5HGHB 5D7LB 1P4BH 4JKKA 5IROA 5JORB 1S7WA 4LMQI 3GRWA 4HK3J 2GKIA 1CFQB 3VXTB 5EB9A 1NQBA 4WFFD 1WK0A 3VGEA 3CH1A 4JM2B 1P84J 1RHHB 2V9RA 3NFPA 1A7OH 1KIQA 3Q6FB 4N8PA 3GSQA 2NY1D 4D9LH 3O6FA 3LB6C 4PRPA 1U8MA 2YWZA 2AJSH 5LQBH 1BD2D 1JHKH 1KSRA 2X4SB 3C5ZD 3X3FH 4QO1A 3FFCB 1NMBH 4ZUUB 2PO6B 5D72H 3PWLA 2NY2D 2R0ZL 4L3EB 4KZEH 4LNVA 4YQXH 4IRZL 1OAYH 2YK1H 3G5VA 4ORZC 2MOVA 1QBMH 5IMKB 3KYOA 1EUTA 3PWVA 4RMSA 12E8H 4P57A 3LD8B 1G9ML 3O6ML 4PPTA 4M5YL 5KANI 3BIBX 4HJ0C 2DBLH 5ALCL 3T65B 4FQ1L 2YC1A 4U1MB 2J8OA 1RFDH 3RKDD 5L0QB 1X4ZA 1F42A 3RX7A 4LCCA 3GNML 5EOCJ 5T3ZE 2YA1A 4G42A 2ZUWA 1EMTL 1IM3A 2NXYB 1YJDL 5EZOH 4IM8A 4CMMA 3D85B 4M3KB 3G6DL 2P46B 2VLME 2IH3B 3VXPB 2OJZL 1HXYA 5D70H 4CN4A 2NY5L 2OK0L 3STZB 3TZVA 4JCMA 1IC1A 3RVWD 3IXTB 5A3ID 2APXA 5TFSH 1KLUB 2HVJA 3MLRH 3NIFE 5IB2A 1S3KH 1D3CA 2AAVA 2YD2A 4I9WE 5I1CH 3OXSB 3AXLA 3V4UL 3W9DA 1MIML 1OM3L 2ZG3A 4HS6B 4HC1H 4K94L 5TDNB 3OBAA 1FE8L 1DQJB 1WBYB 2CD0A 1V3LA 2W07A 1BBJB 1JNNH 3PWPD 2B1HL 1IT9H 3VH8G 1RIUL 3WS6A 1Q0YL 4LHUG 4PJ8A 3VRLF 4Y4KB 1Q1JH 3OV6A 4KKBD 1NCAH 5IVXF 3TA3A 2HN7B 4EKXA 1TIUA 3FQNA 2VLKD 4K3EH 1MI5D 3PV6A 3BN3B 1EVUA 1UZ6E 3G08A 3JV5A 1K6QL 3LQAH 1CDBA 5C0CD 5IUSA 1RUAH 2NY3B 2V7NB 4FTVD 1JF1B 1V7MH 4HH9B 1C5DB 5LXGL 2B2XH 3WV0A 3P30L 1UZ8A 4U1HB 5D7SL 5SV4A 4QHNA 4OCLC 1YEFL 5F7MC 1WBZA 1X5ZA 5DHVA 1TPXC 1J1XH 2Y1VA 5DK3A 1HZHH 2FJFB 5FO8A 5CUSL 5ERWB 1LP9B 4YUEH 4UOW1 2WQ8A 2JIXD 1HH9B 3V6FB 2GY7B 4XP5H 3QYCA 1DLHA 5AD0A 1U3HC 5BJTA 1CLZL 3DO7B 2V2XA 1K5NB 4GW1B 4ZXBC 5JNYB 3W0WB 2Z31A 4MCZA 2VN4A 5CD3B 1E6OL 1YEEH 2MKLC 5T3XL 3QQ4A 4QXTB 3RVXC 5HD8D 5MHSE 5TF1H 1R5VB 3BXNB 1IGML 4PJ9A 1YMHB 1L0QA 4M6NH 2VC2L 4NZTL 4W6YB 2XZQL 1GCFA 4XMLH 4W68A 3OF6A 1B3JA 2QKIA 3AS3A 5E5RB 1BFSA 2E9IA 3U4AA 3O3DB 5HBBA 4UV4L 2CUHA 3D85D 3IU4L 1XIWB 4WW1A 3KPMB 3V95A 4R6UA 4YPGA 3VG9C 5C70A 1NDGA 5D7IF 1LE5A 2L0DA 3RL2A 4PRDB 1KIUA 5KW9H 4HFWA 2YMXL 1KOAA 3NACH 4WU7A 3H9SB 2JCCB 1G7MA 1CE1L 3WXWL 2C4FT 2VDOL 4LLUA 3MRHA 2LU3A 2H1PL 5I1IL 1MVUB 3DMMC 4ACPA 2KQNA 3OAZH 1RIHH 4EN3A 4P5TD 4ODTH 2EYRB 2UV3A 5GSRB 2D7TH 5ADOH 3MRRB 2G9HA 4X80L 5IEKB 5CWSB 2AKRA 5HPMA 1S5IH 5DA0B 5SX4H 1NFIB 4JLRB 4IBLT 3ARTA 2E6QA 3SQOL 2E3VA 5FIEA 2ZG2A 3RGVB 1NUGA 1RULL 2F54D 3NGBB 4M5ZH 4ODUA 3FN0L 1RUPL 4H8WL 1XGRA 1A47A 1I9RH 2A74A 4MX7A 3TEUA 2HKHL 5IV2B 5DQDH 3LN9A 4AJ0A 3G6JB 5C71A 4I8DA 1P69B 3PABA 3C8KA 5F70A 1VACB 4X7DC 3S6CA 1XGTB 3W2DH 1N26A 4EVNB 4OZHB 1RI8A 4JM4H 4WW2F 3HNSH 1KB5A 1U8KB 1I9JL 3MR9B 2BC4B 1FNSH 5F7EL 5I2IA 1J1OL 3LIZH 1QD0A 1UM4L 3EJZD 5C09E 3VD4A 5H35A 1TJIH 4Y7MA 2FL5B 1BQHB 1I3RB 1PQZA 2EXYD 4P2YA 1NC2B 5F1KC 3RIAK 5JW3H 4XI5D 1H3WM 1CFTB 4F7CB 2VLLA 4FXGA 3DYOA 1KELH 4FQXB 3MACL 5CJOH 1BD2A 2OL3H 4I0PB 3O3AB 3BN9D 2NTFA 4U33A 4ZDHB 3UX9B 4YZFF 1U3YA 1BX2B 3DX6B 3C5ZA 1ES0A 4YEEA 4K07A 3TPUB 1H3UA 4O00A 1NLDL 3EYQC 3ULVD 3SDAD 4QT5A 1YNLL 1ZHKB 2H3NB 1YEDB 4P2QB 3S34L 3RVTC 2ZJSL 4Q9CA 3V5KA 2KH2B 3O4LE 4DN4H 5E6YA 5GRXG 2DWDA 3BEWB 2BCKB 4URTB 2LTQC 1JNHA 4LAQH 2EEAA 3OTTA 1CN4A 3ILPB 4LSPL 4MQ7A 3RY6A 3VFPA 2HFGL 2KBGA 3LN5A 4ELKA 1IFHL 3EJYC 4BFIB 4QRSA 4PTTA 1FJ1A 4ZNEA 2NY4C 1JUFB 3K81A 1OP5K 2FLBT 2V5MA 5ENWB 2OI9C 1DEDA 2AXGB 3LRSA 2PR4L 4O9HL 4YEFA 3TO4C 2HJFB 4DFIA 4NJAL 1TTUA 1QLRA 5DXWA 1TFHA 2D4FA 3FAXA 2ICWI 2JJUA 3EJJX 2ZPKH 1BFOA 5AYUH 3A0OA 4OFPA 2XQBL 3IU3B 2DYPA 2IBGA 3O11A 1SJXA 1AGBB 4Y2DA 1KFAH 2ZUTA 5LJYH 3T4AA 4KRMB 3REWA 3PWNB 4A6YL 1JGVH 3VXNA 3HE7A 2J5LB 1QRKA 2NY0D 3AAZA 3FRPG 3DX8A 1J7VR 1AFVL 4OKDA 4R7DB 1MFCH 4ZNEE 2YZ1A 4K3JH 4UDUB 1NANH 1GGUA 2HMIC 4XNUL 1AD0A 4KROB 3PWPA 4R8WH 3D3VD 2I27N 5IF0B 2O5YL 4XVSH 1HH6B 3BEVB 1IAIH 4WI4A 2PYEB 3BGFB 2K3TA 3BJ91 3MRMA 1WZ1L 4HKJA 3KLAB 2QSTA 3KXFB 2Z35A 3SKJL 4P4KB 5E1HB 2EDHA 4JFED 1MI5A 3FONB 3ES6A 1CXFA 4KI5D 4M7KL 4XVUD 1Z9OA 4M61A 5E03A 4DUWA 1FNGB 5C0CA 1OARH 1JE6A 2FX8H 4NM4L 5EBWB 2BOBB 2D3VA 3FRPA 3EDKA 1EZVX 2ZOLB 3A6CH 2FYYA 2GK0B 1VADB 4PLJC 4QRQB 1FL5B 2ZNWA 4R4FH 2AEWA 5DMGC 3AREC 5E7BA 5IP4A 3QEQB 1T21B 4JQVA 3OG4B 5HI5D 5IJVA 4X6CA 5C0EA 2ILLA 3PWPE 4GKOA 4Z7NE 4NNXB 3GMMA 2WV3A 2Y7QB 1A6WL 4XB8A 4H0IA 5KZCB 1FHGA 2OMBA 4XXDB 2R0KH 4KY1H 3FQXB 2VERN 3LN4B 3OAUL 5C6WH 5IR1A 3H9HA 4BQ8A 2LU7A 1BZ9B 3OKMA 4NQEB 5IBTL 3O3UN 2Z92A 3V52H 3QUYD 3MOBH 5C0CE 1NGYA 5FYKU 4Z95L 1EDQA 4W70A 1N0LA 2QHRH 2IAMB 2ZUVA 5BOZG 4OCYL 4QF1B 4L3AA 1NCUA 1XMWA 1G7HB 4ORGB 3RU8L 2D31B 4KTEL 5EPMB 1KPUA 3U0PB 3WJJC 5HI3D 4ZFOL 3VI3E 3ARGD 3C8DA 2DLEA 3IKCB 5C7XH 1MFBL 4J3SA 1A0QL 4HUNB 4X6CE 2X6MA 5DQ9B 4U7MA 3T1FA 4NSKA 1OQXA 5KVFL 4CVXB 4NWUL 2VDQH 3MXVH 2YD7A 3MCKA 4U1SA 1IGCL 3UTQA 1DDHB 4JVWA 1NAMB 3EHBD 1PZUB 2UYLA 4ENEC 4DAGL 5JIIA 5DVMA 2VUYA 3S5LG 2KZ1B 3BAEH 1CGWA 3OX8A 3I3EA 1YQVH 5DTFB 4RFEA 5CJXC 1P7QB 2CKBA 2VWEE 5C1MB 4P5TA 2DMKA 5FB8B 1A6ZA 4GSDL 3REVB 5CZVL 1F4XH 2VZSA 3U2SB 1MCPL 2V5YA 2I07A 3RVVC 1G0DA 5ICYB 2IQ9H 1PDKA 3FT2B 4YHLH 2YUVA 4M7ZB 5FOJA 3STLB 5I73B 5F7LB 5GGRB 1OAXL 1OAUH 2PTVA 4RMQA 3V5DB 2RJMA 5KSAD 3M07A 4PS4L 3OR7A 2F54A 5D1XB 1RUQL 1ULVA 4Q2ZB 3KXFD 4P4KD 1I9IL 3KPSD 2YBRA 5HHOE 4X6EB 3LV3B 5C0RL 1ED3B 1RJLA 3ARDC 1J12A 4XPTH 4C4KT 4OLWH 3C9NA 3CFDB 1AR1C 1L6ZA 2J12B 4XP6L 3B2VL 1VFBA 5IHLB 4U05A 4Q9BA 1UFUA 1LP9F 5GS0H 2LV4A 2NY6B 3QQ3A 2J88L 2R56H 4R9HA 1L7TH 4PYGA 3AM8C 4NPYB 3IFPA 3DXAE 4CN6A 1OCWH 2UWEB 4XBEL 1A6TA 1G7LA 4RRPG 2P8LA 4M93B 2P7TA 5F7FA 1K85A 1I7UA 4FNLH 4KC3B 3LPFA 5TGBA 1QNZH 4X6DF 2X4NB 1GXEA 5BQ7B 1X5FA 3OWEA 1EJ6A 4HAFA 4NHUA 4NQED 1I85A 1B9ZA 4MS8D 3OZ9L 1T3FA 3BQUB 4NUGL 1I3GL 4PYHA 4KRPB 4UTBL 4JFYA 3QPXL 4JN1L 4NQSA 2ZCHH 5DZNA 2Q8AH 3KLSA 1CVSC 1EPFA 1A5FL 1ONQA 4M8QA 32C2B 5DT1H 3RWIB 1U3JA 2BNUB 4GOSA 4Z8FL 5EUOA 1CQYA 3U30B 2I60H 1MJ8L 1NUFA 4KUZH 3RX5A 1VFAA 5DJDB 5FYLE 3LKSB 5C0BD 1FVDA 3ARZA 2BMKB 5TDPA 1ORQB 2G75B 5FECA 1GGBL 1IZJA 1QQDB 3A67L 3PIQB 5H37G 1AHWB 2OXGA 3WD5H 3LCYA 1P7QD 5ID0B 3GMLB 1NGPH 5JXAH 2BXZA 2VISA 1Z9SA 2WIIB 4Y16A 3ULVE 4NN5B 4YHKL 1CU4H 1IGFH 3QFJA 3Q6GL 4UNVA 4N5EC 1ADQH 3EYUL 5DDHA 4BELD 4BSVA 2ARJQ 4K2UH 3IDXL 5JUEL 5HGGS 5HHMB 3UJTH 1NH6A 1LEKA 5D2LB 4DFHA 5J9PB 1RIVH 5IBUG 1FZKA 5IFJA 4ZFGH 3QWQB 2CR3A 1G7IA 4JO4L 1Q9WA 4Q74A 5DMKB 4PRID 5JPNA 5AAWA 4RFNC 4N8VB 2X09A 5CHNA 3G6JF 5BZDB 5K9KA 1J10A 3PGCB 4PJFE 5HDBF 3FRUA 4AMKH 1A7PH 4JY4A 3D3VA 2E6JA 4YIQA 5D9SA 1AI1H 4KI5F 3U4EB 1RK1A 3QA3B 4OZHF 3UZQA 4GBXC 4P2OC 5D1ZA 1EO7A 3HE6B 1F3DH 3CSGA 3KGRA 1MRDH 3A6BH 1CFBA 3I6LD 1FL6B 4G80B 3TV3L 2Q7YB 1NGWA 4M1CC 1UJTA 1LD9A 3THMH 1UADC 4Q0XH 4JGJA 4YXHL 4EQ2A 1J8HB 3QFJE 1OB1B 3O45A 1FLTX 4LLQB 3MLVH 2YRLA 2C3WA 1FO0B 5JR1L 1T1YA 2DN7A 1CDUA 3Q5OA 2A1WH 2IWGA 2R9HC 5DRWB 2MHAB 1JGUH 3MRJA 2IPKA 1AJ7L 4QRRB 1F58L 2DD8H 4ZO8A 1S7UA 3ZE0F 3FQRA 3TCLB 4OI8A 4TNVK 1F3JA 2E27H 3BZDA 1NLBH 1PYWB 1S8DA 3GI8H 1N3NA 5TF0A 5KVGL 2ZWLT 4IIQC 4RQQA 1EEZA 3EGSA 3E3QE 4QXGL 2MQCA 3BQUD 4PJ7F 3BWUC 3O9WD 1E4XH 4MAYB 4F57L 4F7TB 4IHOB 1EERB 1G7PA 1H5BC 4H1LB 2Q86A 4Q6IB 1NCWH 1ZA6B 1LO0H 3CU1A 1AGCA 5BRZB 3WIFA 2JE8A 4PJ7A 1DBBH 3QULA 5B4MD 4HT1H 4FFZL 4U6VL 2MCG1 1V8HA 6FABL 3GRWH 2WAHA 3LKPB 3K8KA 2YPKA 1W8NA 3OAYK 1O0VA 2C3VA 3OPZH 4KJYA 4P48A 4WCYL 4MJ5B 3ARGA 2R23B 1WT5C 5DRNA 3GSVA 3H7LA 3BKYH 5GGUA 3RAJL 5LCVH 2MQ3A 4O58L 3EUUA 3J8F7 3EOBB 1A9BA 2I5YH 5ANME 2DBJA 3BJLA 5E08L 5T3ZH 1BREA 2JJSC 4ZOEA 2DJ4A 3OKKB 4XCEB 5I66A 1DBML 1F4WL 4I2XA 1KG0B 4KUCF 3FB7A 5IB1B 1M05B 3G5XA 4P4RB 2EH7L 3FB8A 2L7UA 3D18A 3DVFA 4LCYB 5HYJB 2X05A 4OLYH 1T66D 2AJXL 5HYSA 2IADA 1J8KA 4MJ6B 4GO6B 4U0QB 3DETD 4KVNH 1XF1A 4H88L 3WHXA 2ED7A 4NYLB 3TN0A 3STBA 3TO2B 1B2WH 4RAUB 5I0ZA 3CMOL 4KK8D 1P5UA 4O02L 4BH8A 2QQLL 2RBLA 3VXSA 3GI9L 5IM7B 4PGZA 2D7QA 3ZT6A 15C8L 1LEIA 2E9JA 3QI9C 1JWSB 3BD4A 3HZMA 2CJUH 2OR8A 5IK3B 4F7EA 4TTDC 3BUYA 2V5RA 1YN6B 3DX7A 3L3HB 5SX5K 1A7NL 2PCPB 4D8PA 2RHEA 4HXAL 3SGKC 4UB0L 5I9QC 4I2XE 1CDGA 1RVFL 4U2YA 5B39B 3HFML 2Z93B 1J1PH 4K7FB 1FORL 4ZUTB 4GT7A 4L9LC 1XF4B 4LEOB 5GGTL 1E4XI 1A3QA 3RWEA 4L8SC 2F5BH 4IS6B 4YHPB 2EDBA 2JJWA 1DQLL 4WVRA 4EUPG 4QRRD 2NYYD 4MA7L 1JHTA 2ATKB 3VXSE 1NUNB 4OJFH 4X8JA 3AUVA 1QA9A 1JPGA 4L8CA 1CD1A 1JZ7A 2CPCA 3QEGH 4UT6H 5FGSA 1RJYB 4JFXA 4JO2H 2GAZB 2GIYA 3MJ8B 5DUMH 1GIGH 5I30H 4PJIB 4KVCL 2Q20A 1BEYL 1KN4H 1XCTA 5BXFB 1GSMA 4R2GC 1LO4L 5EBMA 3QHZL 4NCC1 4NKDA 4KJPC 2LVEA 1XZ0A 3UO1L 1MRFH 4NZDA 2FHCA 2A0LD 5INCB 5ICZA 3MREB 4U2ZA 4YC2B 2P43B 4GMSH 1QEWA 4CVZB 1WCBB 1C08B 4XAWL 4OIAA 3G5ZB 5EU6B 3U7WH 2FX7L 1W72A 3EOTL 3X12A 1XGYH 4TRPH 1U6AH 4NN6B 1HWGB 1FNHA 1NCDH 2Z91B 1N4XL 1DUYB 2VDLH 1YC8A 5FA3A 3W11D 2DLFL 1HNFA 4FQIH 3DV4A 4ONHB 2E8YA 3DRTB 4L4VB 5DHVH 5JOFA 4QHMB 3WIHL 3SQBA 1U93A 5C0BA 1VA9A 4XC1L 4WUKH 3C09C 5DJXA 2VAAB 1I8MA 3MLWH 1VPOH 5C08E 2J1KA 2FZ3B 5CLWA 2J8HA 4TUJA 1QBBA 1F6AB 5CGMA 2ZCKL 1MJ7H 4MD5A 4KTYA 4PRHA 1I8IB 2EDJA 4KPHH 5TDOB 35C8L 3QEUA 1CICD 2X1OA 3QO1B 1H15A 4Z76A 4KKCC 4NP4L 1R5WA 1U9KA 2YKLL 5T5NF 1QBLL 3WL9A 5HI4C 1T7ZA 3OSKA 3P11L 4M6MH 3PUCA 3UEZA 3FB6A 4JJHA 1QO3A 3LEYH 5F96L 2HLAB 2NW3A 1NBYA 1XGQA 4UQ3B 1UC6A 2J6EA 3PG2A 3FO1A 5HHNB 5BZWA 3SGDH 4PRIA 3RZCA 4WTZA 2WIMA 3VXRB 3B9KC 3K8MA 4QOKE 4LLVB 4M1DL 4XXCC 3DV6A 4K71C 5HYEA 5INDB 5EO9A 5I1GH 4X5XA 3HPJA 4ZQKB 2HT3C 1FNAA 3CPLB 3GZKA 1HI6B 2ZKHL 3VFGH 1P4IL 3O0RH 2YN3A 5E6ID 4V1DB 5CP7A 3M8OL 2H2SC 3GBML 4PRHE 5DD5L 1ORSA 3MBEC 3GKZA 3OR6B 4XMKH 5DD0L 3Q48A 1YEGH 2HAZA 2QEJA 4HV8A 5IVZB 1IQWL 3IGAB 3WFEH 1N59B 4U1JB 4ONFL 1DLFH 4I3SL 4XVTL 3TPKA 3BT2H 3KG5A 2DQCH 2N4IA 1WFOA 1RZGA 1SYSA 4WO4A 1FGVH 2FATH 3FOLA 4G9FD 4K3DH 3O81A 1EXUA 3LB6D 1CL7H 4PJXF 4JB9L 1JNLL 4JN2A 4XNYL 1TPXB 1INDH 2AK4E 3HI6L 4K3HA 3BDYL 1A6AB 3K1DA 1G84A 1R24A 4PR5B 5DFVC 5HDLA 1F45A 3PGDA 3LZFH 4S2SA 3F7RA 5BMFL 2A6JA 2C7UA 1W0VA 4J6RL 3RWJB 2FDBP 3BIKB 1YEIL 3DVGA 1A2YB 3FOMA 5JHLH 1DVFC 4TUKL 2UZIL 3ZO0A 1V3KA 3BE1H 4LCIL 1Q9KB 1QTYT 4JFOB 4JZNB 4MLSA 5GGQH 1MWAL 5DJYA 3UPAA 4PTUA 4HWZB 3CZFA 5EO0A 1CGXA 1GOGA 5T5FL 4FFYH 4C57C 4HJ0D 4QYOB 5EA0L 5F1IB 3QCTL 3WJLA 2HJLB 2Z9TA 3MLUH 3UTSB 1NCBL 1KB5H 1NAML 4MWFB 5CEZD 4FFWC 3T8XA 2FJHA 4JPIA 4PJBB 3DYMA 2PXYA 5E2TL 5LWYH 4JPVH 1RJZA 2ED9A 4YBLC 1F6LL 4LCWB 5C0NC 2X9WA 3QNXB 4Z7WE 3C5SB 3UBXB 4LLYA 1KEGL 1G9NL 1AQDA 3VG9B 2H2PD 3I6KB 3S96B 3GJFB 3KPQB 2W9DL 3X3GL 3HNTL 5D2LF 3FB5B 1JZ2A 2V9TA 2CMRH 2VZOA 4N0UB 2GCYA 4N0YL 5FO7A 4BZ2L 1I1RA 2W0FA 4I1NB 2OTUB 5FUCE 3NBNA 2PF6A 5E70A 3C6LA 4L9DA 2FBOJ 5E8OA 1AY1H 5EBGA 2D7PA 1HNGA 2P5EA 3IDGB 2BRRH 1INQA 2IJ0C 3HZYB 5I17A 3VA2C 1JPTH 1CZ8H 2R4SL 3QDGE 5I1AA 4NQXB 3KJ4C 1BJMA 1DE4A 1AXIB 4OCRL 1KYOJ 3KPTA 2FCBA 5IW3A 4PLNC 1BM3L 5AG9A 1TDQA 4R97C 2VUOA 2F53E 4PJEA 4NO0A 2FEDD 1ZS8B 2KDGA 3U9UA 5E9DB 3OJMB 3RIAF 3O3BB 3X13B 1MHPL 3GMRA 4H26B 2AJVL 4F8TA 3D2UB 4XMPL 5FOBB 1UH3A 1GGCL 3T04D 4HZLB 4BQ9A 3QJFA 2NNAB 2P5EE 5IFHL 2X4OB 4Y5VA 1IAOB 3DYPA 4BK5A 5F9DC 3HRZA 3MRFB 4EI5B 1D5XB 4ZOBA 3K1KC 2G2RB 1E0OB 1LK3H 4W4OC 4UUJA 3U0WL 1A22B 4OF3A 1U3HD 4HUUB 5HHPB 3ARVA 3IF1B 4ZXBD 1ZT7B 5CSBA 4N68A 4JRYD 5T3XE 3CLEL 4GG6B 2ADGB 1OGTA 4MD4A 1B0RA 5E4EC 3RVXD 1SMAA 3VXOA 2A38A 3WUWA 1IKNC 3BMVA 3DVNB 4N0CC 1I4FB 4PUBH 1MFDH 2LABA 1OTTD 3C6SB 4JG0L 4OZFG 5EWIH 2BOCA 1BVLB 4OI9A 1OW0A 4DUXA 4CNIB 3BRGC 2BSTA 4YHYB 2JKXA 2LTQB 1ZHLA 1FFNB 4KMLB 1K2DB 1K8DA 4LVNC 2JB5H 2Q6WA 4NN7B 3U46B 2RFXA 3B6SA 3B5TA 1YDPB 1FRGH 1ZLVH 4HS3B 3BZEB 1QHPA 4P46C 3OQ3B 5DGRA 2OI9B 4F9LA 3BDXA 4JFFA 5EIVA 3DMMD 2C26A 2X9XA 1CYGA 5DVOA 1HQ4A 4JHZA 5JIPA 4JO1L 3Q3GB 4RGOL 5C07D 3GSRB 1MF2H 4OZFA 3BP6B 3EZ8A 2QLVB 4WWKB 4WGVB 2PW2A 4YJZL 1CGTA 4JFZL 1U8OB 5B8CA 4WFHE 1XR8A 4ERSH 3D48R 1D5IH 3L3KB 3MRLB 1BJ8A 4TQEL 4UAOC 3NA9H 1A6VL 3HC0A 1AO7E 3LS4L 3SHSA 4ALAL 1U2HA 5GS0C 5ID1B 1X7QB 3LMJL 1S7SB 1XR9B 2MPAH 4OGYL 1KLFA 4YDVA 3UDWA 3NFSL 4DEPC 4PJDF 1YA5A 1DQMH 3RVUC 1DEEB 3GFUA 2RIKA 2YXMA 3VRLE 3RWDA 3G5YA 3I75B 5C2BH 4DZBA 1FO0L 2GUOB 4HUVB 1XF2A 4JFFE 2E7LC 3TNMA 3VWJC 4BKLB 2HFEA 3VE0B 4U1NB 2DWEB 5E6IA 3MO1B 5E95B 5FKPB 3IDJB 1R3KA 1C1EH 1H3TA 1TENA 2XA8L 1BLNB 5F6IC 2CKBH 1A1NB 2DI9A 2DLTA 1WCQA 1RZFH 4J3OC 4UIKH 3VGAC 2UVEA 2EH8H 2NW2A 3D0LB 4PJIF 5IHBA 1CWVA 3U82B 4Z78A 2VIRA 4OGAD 3GMPA 4P49A 3AREB 3H7BA 2C1PB 3UC0L 4MMZC 3OJVC 1IARB 4ZS7H 4BUHA 5GRJH 2K9UA 3QO0A 4P59H 3HMWH 3INUH 4CGTA 3DTXA 1PD6A 4DKEL 2AP2A 2OLDA 3KPNB 3Q1SH 3HR5A 3EAKA 4ODVH 4XPAH 4U7KA 1JK8A 2AEIT 3SE8L 5EC2B 1ZHBB 1S9YA 5D93C 4JY6B 3SPVB 3GBLA 5IBLC 4FABH 5FUOL 4UNTA 4LSQH 1I3VA 4MJIE 5D96B 1KIRA 3OKNA 3VWKA 4Z6AT 1A7BA 3OAZK 4OZIB 3IS1X 1AKJA 2V5SA 5I1EL 5CMAB 1NGXA 2FHFA 3TBVB 3CFBA 1GYAA 1UEYA 5HYQB 3EJYD 1UXWB 2I24N 1T1ZA 4ZPVA 1OAZL 2NY4D 5FCUH 1T0MA 4DK3A 5AAMA 1HOCB 5DR5H 4XCYA 5LBSH 1XH3B 1A1MB 1WV7T 5FYLH 4ISVA 3JUZA 1G6RA 1U3ZA 5BS0B 2V17H 1BAFL 1VSCA 4LFHG 3TO4D 3EFFA 3IDMA 4GAFB 5SWQB 3P0VL 3MJ6A 4RFOH 3F5WB 3MRPA 5DJAA 4OQTL 3ALXA 1N8ZA 1HN1A 4V2CB 1A3LH 4Y4FB 5J12B 4PJCB 3BOVA 4UU9A 3VFSA 5ESQA 4GRWB 3KLHC 2VQUA 4DGIL 3JV4B 4IMLA 5TE7L 4PP2B 3FO2B 3ULVH 1ZLWH 4O2FB 4H0HB 3NMEA 3H3PL 3PQYB 4MSWA 2JJTA 3VJ6B 4M62H 1KEMH 4Y5YB 3K7UA 5JPMB 3HMXL 1A3RL 2E7BA 5CEZE 1C8PA 2ADIA 3PDDA 5E0QA 4OCMC 2HMID 4NUJB 5E2WH 3M1BA 4ZTPL 5F21B 4EQ3A 2BJML 1IKFH 3D39D 3ECBA 1I8LC 3O8XC 3WNLA 5E8NB 3MA7A 4X6FB 4NRZB 2WWKO 3FJTA 2HG5A 2X4QB 1KJ2B 4MB5A 4HUWB 2FSEA 3CC5A 3I50H 3BPNB 5D7JA 1T2QL 3PP4L 3QH3B 3UTZA 5GJSH 1I7TA 1X3DA 4YDJB 3ZHDA 4NO2B 1QFWL 1F3RB 5I8EA 2ATPA 3WN5C 4KV5F 3UYRL 2BNRD 5IROC 4DN3L 3QJHA 5J8OA 4Q9RL 1L4IA 2A77H 5DMGD 3ARED 3GHBL 3GSUB 3BVNB 1Z0MA 3N1GC 3OKEB 1FV1A 4YZFE 1AXSA 1CLYH 2IMNA 4JZJA 4QWWC 1ZTXH 1IQDA 4NM8H 1W0WA 4YGVA 3TYGH 3QQNA 4HPYL 4FHBD 4XCCL 4PV8B 5EG6C 2IBZY 3O6FC 5JMRA 3UTTD 1BQLL 4XCFL 1DQQA 4JRYA 4TOYL 3QG7L 4NRXB 5DMIL 3L3IA 5CJQH 1MNUL 3N1QC 4S0SD 2X5PA 4CADA 4K7PY 2AJUH 4QNPF 4YK4B 3H42H 2BVTA 1LO3L 3D9AL 4YXKL 5C6TL 4JFDD 3K8LA 1UA6H 3DI3B 3MBXH 2VLRB 3SKOA 5SWSB 4LKXA 5KS9A 2EYSB 3U36B 3T4YB 4U6XA 4OF7A 2J3SA 4JY5H 2FHBA 1F4YH 2WUBH 5F9WC 4JREC 1OAQL 2VQ1B 1DFBH 1U8HB 4OD3H 4MXVF 3QRFM 5JO5A 3D69B 2VH5H 4JPKH 2AEPL 4S1QL 4QHKJ 1II4E 4Y4HC 2D0FA 5B3NA 2CUMA 3PHOA 4LCCC 3WSQL 3IAPA 1T04A 4LSUH 4JM2A 3G9VA 4JRYE 1RHHA 3MLZH 4YE4L 1NBQA 3PNWB 5C2UB 1DANT 5F8RC 4XVJL 3U0TB 2DQHH 3BESR 4LCUB 5FHBH 4OLVH 2B5IB 4UINL 2VXVH 1K4DB 2VL5B 1T0NB 3PQYD 5D1QD 4QRPD 3TZVC 4AQ1B 3RVVD 2J4WH 1CGYA 1GGYA 3RUGB 3FFCA 5L2KA 3E0GA 1MVFA 3DSNA 1XF5B 4YWGL 1DSFL 3GIZL 5ICXB 1L6XA 1RMFL 4KDWA 2DDQH 3QB7C 1MIEH 4Z5RA 4MXQC 5FDYA 4LSRL 1OVZA 5DHYB 5IESL 2D4DA 4RFNB 4P9HH 5HY9A 4NBXB 5FK9B 1V5JA 4CU6A 2ADFL 1KJ3H 3CVIH 1TZHB 1HDMB 1YMMB 3DRQA 3E2HC 4FQ2H 1G9EA 3SGJA 5KJRH 1Z3GL 1U58B 3V4PH 1N6QH 4R4NC 1LQSR 4E5XB 4GBXB 4P2OB 1BFVL 4OCSH 1CLCA 3ARDD 1MFAL 4D0BB 3WS6C 3RY5A 1RHFA 1TZGH 2X40A 4O5LL 4TNVF 1AR1D 3TA3C 2CKNA 3R4DA 3T3PF 4XPHL 3RDTB 4PRBB 4EXPX 2EIEA 1KULA 3FFCE 5L2KE 1EUUA 2X4PB 2VKWA 3VXPA 4M48H 1DQTA 1IGYB 3EOAA 1UB6B 2B1AH 3VG0L 4HKXB 1QKZL 4GG6F 43C9A 1XF3B 3TT3H 4MA8L 4X0KA 5GHWL 2X7LB 4D0CB 3TIEA 4GW4A 3FHAA 4GXVL 4N1HB 1MLCA 4NKIL 4P3CL 1MREH 3QWRA 3LVEA 3QNYB 4NQUA 3P77A 3MV8D 1FNFA 2FIKA 3BW9A 4X4YA 2OSLB 5TDNA 3O2DA 1MFNA 2NY7H 3CSYB 2Y5TB 3BKMH 5T1DH 4FP8H 4OKVB 5AZ2L 2Z31C 1N2RB 4XZUA 1QYGH 2PW1A 4NQVB 5C0JB 4XNZC 2EEBA 4MQXD 5F88A 4TSAH 1F3DJ 5GIRA 5C6PB 3L5XH 3BH8B 5ILTL 4L3CB 5K93A 1FDLL 4PJ9C 3S4SA 1QRNB 1U8QB 3MTRA 1CXHA 3VGHA 2X89D 5CIPA 2V9QA 2BVQB 5DVNA 5BV7H 4YHZH 5C3LD 5KSBB 3F7QA 2OTWB 1QFHA 6CGTA 3DX9A 5FO9A 3L5HA 5E2VL 4XX1G 1NFDB 1VGKA 1G0XA 3BD5A 2VDRH 4UOW0 4KHXH 4DGVL 1QACA 3EYSH 1MHCA 4OB5L 3FO0H 2JTDA 2Y6SC 4FQLH 3OB0H 1HHJB 3RI5K 3WFCL 4JHWH 1KTLA 3JV6B 2VLJD 1JRHH 4M00A 3BP5B 1DCLA 4NOFA 4NJ9H 25C8L 2OP4L 1HH9A 2BNQB 4GW5B 4Y1AD 4EN3C 5GGSB 4O51B 1CFSA 1XGUB 5JTWA 4F58L 5IB4A 3HG1B 3P9LA 1W72H 2Y5EA 1MHEB 3TVMB 3MZTA 4WU5B 3C5JB 4QXTA 1NAKH 5CZKA 1NEUA 3QI9B 3BXNA 5ADPL 1YMHA 2R15A 1YMMD 1MCRA 5DJCB 2P8MB 7FABH 3N1MC 1FNLA 1N0XL 2Z4QB 3JWOH 5C0DB 1A8JH 3TH2T 3D39A 4EBQL 5ITFB 1UB5A 1JV5B 4H20L 3TBYA 4GBXD 4WUUA 4EOWL 5I8CA 1LO2L 3IAQA 4XB7A 3MLXL 4M1CD 5IHZB 3MLTB 4U1IA 4P5KB 1BMGA 3CH8A 3KPMA 4L9LB 1NPUA 2AK1L 1NBZA 4KKAD 4PRDA 2F74B 3EO1B 1NC4B 4L8SB 3GB7B 1HHIB 2JCCA 1Q72L 1HE7A 4DOHB 3IFOB 4OT1H 2PNDA 5IMMA 2LVCA 3TBWB 4TSBH 5T1MA 3NCJH 2J6EH 5GSRA 1FIGH 5EN2A 4YGAB 4GLRH 2KL6A 4ZTOH 2VB5A 4GMTH 3C2SA 3KPRB 5CWSA 2FNBA 1U8PA 5F7WC 5AWNH 1SY6A 4WUUE 2NY1C 1HHKA 4DTGH 1P9MA 4R2GB 2VZVA 5ELIA 4OZIF 2EKSB 2W9EH 5BOPA 4XHJD 1DBKL 3SDXB 1LEGA 1BQHG 3C5ZC 2XWJA 1YC7A 4L5FH 3MUGB 5JXEA 4PRNB 2ZUUA 1F13A 3H9SE 4KDVA 2JCCE 3TIDB 3HZKB 3S3JA 4LU5H 3KPPB 4JFDA 2C3HA 4YHIA 4N1EA 1J5OH 5DI8A 4RA3A 1QLFA 3ROLA 3MRBB 4RGNB 2FWOB 4HAGA 3T0EB 2MJWA 2FH6A 3PXHA 1XGTA 1NKRA 4WNQA 5E00A 3RY6C 2DQJL 5EU4B 4JVUA 3MFGB 4EVNA 3R06B 5DEFA 2XN9D 1U8KA 2IFFH 3D6GA 3DURB 4AYFA 1P7KB 2BC4A 5C0FB 5F6HI 2XRAH 3DSFH 5EBLB 2P5WA 2BSSB 3NZ8A 1NC2A 2AW2A 4I5BB 3EO9L 1YYLL 3CD4A 2ICWB 3ETBF 3S35L 3H9ZA 4NNPL 1CFTA 5DS8B 4F7CA 3UZVB 4M4RA 4J4PD 2O5ZL 5I15H 3ZL4L 1J05B 3O3AA 4HWBA 1FFQA 2ED8A 3QUKB 2FX9L 5D1QA 4QRPA 1BX2A 4LLMB 1KXVC 2DM7A 4JFDE 3RVWC 4C58B 5A3IC 4OD1H 2ZNXA 1TQCC 4Y2DC 2RQ8A 5HHXH 4PIRF 4OLUL 3ARBC 1T5XA 4QXUL 2QQNH 1DTUA 3MSPA 2Q3ZA 5J1AB 1W8OA 1YEDA 4PBWD 4P2QA 3HE7C 3UYOD 4OZHE 4XPGH 3V6OA 3B9KB 1P2CB 2FD6H 3CDGA 4RWYL 3IFNH 4LNRB 4QRUA 3I02B 4GLRI 2P5WE 5C0IB 5IQ7L 1GPOH 4OCXL 4CJ1A 4KZDH 2YD4A 2AEQL 3GSOB 3QEHB 3L1OH 1NJ9B 2Q1EA 4PJGB 1QFPA 3MBEB 1MAJA 1JUFA 4KKBC 2ESVB 3FT4B 4GUPB 4QCIA 3VGGA 5IT2L 4OCWL 4QRPE 2AXGA 3WKML 2GT9A 3V0VB 1SJHA 4XNMB 1R5IB 2AQ3A 2HJFA 3H2WA 4Z7VA 5EOCH 1YEFH 4C83B 4XWGL 3ZKQD 4NZUH 4P2QE 3QFDA 2IANB 1JTTA 3MV7B 2GSGB 4MNQD 4WV1A 1F90H 4NQDD 4JQVC 1PLGH 3PWNA 3DBXB 2Z8WC 1D9KA 3IJSB 4G5ZH 4R2GD 5MEPA 3MV8A 2C1OB 3FT3B 1E6OH 3MV9B 4YNYB 5T3XH 1DVFB 3ZKMC 4LVOC 2XZCL 2G60H 2FH8A 4X7FC 5EZIH 5E24E 3V6ZA 2DAVA 2X1PA 1HEZB 1B88A 4L4TD 1YPZB 4AG4H 2MTPA 3IVKA 1NCCL 3FCTA 4JZOB 3BRDA 3GO1L 2R8SH 2GJ6B 2VWEC 1X5AA 1KNOB 4Z7VE 3ZMRA 5GJTH 3LKQB 4HX1A 3HCVA 4UT7H 5TPWL 3S35X 4ZD3H 5DHXB 5DJZA 5IEHA 1B6DA 1S9WB 2X89A 4CN1A 1VKXB 1UVQB 3CFKB 2BOBA 3HI1B 5K59F 1FG9C 1OGAB 3VGBA 4U1KB 3QPQD 3SJVB 3MV8E 2A73B 1TQBC 1BJ1H 3VFOA 5I1HH 1FZMB 4F37K 1IBGL 3RUGF 4LIQE 1CXKA 5I1IH 3QIUD 1A1OB 4ZAKB 2BVOA 2O26U 5IOPB 4YHOL 2VXUL 4KKCD 3B43A 2VLJA 5IVOA 4Z7QF 4XXDA 3LQZB 5FA4B 4MVBD 2AABL 2PYEE 2Z8SA 4PGCA 4Y2OA 4OCNC 5DUPH 5D2NB 2VE6A 4P5TC 4G9DB 3RL1A 3AVEA 3VXMD 4APQB 2D2OA 4LASH 3LS5L 4LRIA 1XGPB 4JCLA 3VXQB 3SQOH 1UCBH 2C3GA 2CDFB 4G8IB 4RAVA 2ORBH 3B9KD 4EXKA 1Y0LA 1R0AL 1KJ2L 4N9GB 4G6MH 1FZOB 5FKAA 5T1LB 2IAMA 3WFBL 5DLML 3KS0H 3JXAA 2CLVA 1M7IB 5K9JH 4JG1H 5B3JE 4R97B 5GS3A 3U0PA 2HKFH 1JMZA 3EYVA 3IKCA 4S0TD 2J8UB 5KN5A 5D5MB 3WFDL 2VDPH 5DQ9A 4Y89A 3MGOA 4XC3H 5SWZB 5I8KH 3EDEA 4CVXA 4RMVA 4MDJB 5GQBA 1B0GB 5T5NG 5ABDE 1FC2D 5HJ3A 4OZFH 1DDHA 2PTUA 1CE6A 1WC7B 3CK0L 1IZKA 3MRDB 3CFCH 2DI8A 2ZSVB 4MA1C 4BH7B 3BWAB 3VFMB 1J0KA 2VQTA 5MENB 4ZYKA 4JFHD 3ZE1F 4F7PB 1V3MA 1H3PH 4OZ4B 5DFVD 4DVRH 1SEQL 1S9XA 1ZA3B 2X70B 3EJZC 3HI5L 2OJEB 3F6IA 3S36L 4X99A 3U2SA 2AGJL 2EXYC 3DI2B 4IIQA 5CZXC 3FT2A 3STLA 3HC4L 2DIBA 1WSST 5L6YH 4XNQA 3T0DA 3BN9C 3V5DA 1NLDH 4G7YH 4H25A 1U8JB 1H5BA 1RURH 1I85C 3E8UL 5E4EB 1ZT4A 1AIFA 1UQSA 4Z0BL 4ONGH 1KCSH 1GRWA 3ALPA 4Q2ZA 3GMQB 1I7RB 5KSBF 3ULVC 5C8JB 1AGDB 2F9BT 4FFWD 3F7PC 1NFDF 1T4KA 2YPVH 5KVEL 1YEJL 3BPLC 3V0WH 1CF8L 2H8PB 1N5AA 1BZ7B 4LVNB 5MP6H 4OGXL 3BHBA 2ZUQC 1EFXB 3HA0A 2WLYA 5KTEH 3BO8B 4PJAB 1MJJB 1OLLA 2XN9A 5F7YC 1FFOB 5MERB 1RY7B 4P46B 1PW3A 5DSCB 4GKZB 5I71C 3MGTA 1ZV5A 4FQHB 2UWEA 2N7BA 3OKDB 4JR9H 4O2CB 2WWKT 3MUZ1 4J4PA 4KRNA 2E7MA 3CNKA 3VXUB 1A7OL 1CFVH 4Y16C 3DUSB 4YFLI 4D9LL 1ND0B 4WEUD 3QIBC 2AJSL 2BY1A 5LQBL 1ITBB 1JHKL 1CVRA 4UAOB 3VFTA 5E7FA 5T1KB 4TVSa 1OP3H 3RNQB 1EJOL 3X3FL 5CEZH 5HYFA 2HLFC 4DEPB 4HH8A 1NMBL 4JFQB 5D72L 4X4XA 1CG9A 2Q8BL 3QDJD 4KZEL 4W4NA 1FSKC 3SGKA 3HUJA 2BNUA 1OAYL 2YK1L 4Y5XB 1DUZB 3KYAA 2R39A 4NKOB 1GH7A 1X44A 4PREB 1C5BH 2UWEE 3X11A 12E8L 2Y06L 5DJDA 5E8EB 2DBLL 3FN3A 4XBPA 5D1ZC 3UJIH 1D5MB 3E3QC 4ZUSA 1JZ8A 3OKLB 4N8VG 4WDIB 1RFDL 2QQQA 3S36X 2OM5A 3EDDA 4NIKB 2IFGA 2VJXA 1AHWA 4DGYL 5EZOL 3VGAB 2P44B 3NOIA 3GMLA 3GSWB 1SBBA 4M7LT 5GISH 2EIZB 4QHUA 3PDGA 3SDDD 4M8VA 5JW4M 5D70L 5IKCA 3I3BA 3NN8A 2BY3A 4ODBD 4JDTH 5TFSL 3MLRL 3WE6A 5DMKA 3Q0HA 1S3KL 4PGDB 5TQ0H 4LEXH 5I1CL 1LMKA 5F89B 3X17A 5HHQB 1CR9H 4CW1B 3H8NA 4HC1L 5HDOA 1MEXH 3QAZC 5CJBA 5BO1L 4PY8I 3QA3A 4L4TA 3U1SH 3HE6A 1T03H 3LKOA 1JNNL 1FL6A 3EO0B 4PJHF 3S37X 1UXSB 1IT9L 1C7SA 1YNKH 5FGRA 4G8EB 4P5MB 3P4MB 1J8HA 3OL2A 1OB1A 5EC1A 1Q1JL 1MCDA 1NCAL 1FN4B 2F19H 2Y07H 3ZDZE 3BPOB 4H1LG 2RB8A 1U8LB 4NKQB 5HHME 4K3EL 5HI3C 5D2LE 5ISZB 2FR4B 3ARGC 4P9HC 4JO3H 1IGCH 4Q58C 4EI6A 2NXZD 2LU4A 3LQAL 3CDYA 5IMLB 3SY0B 1RUAL 1NMCC 2ICCA 5IQ9A 2B2XL 2D9QB 2DRUA 2VR9A 3QIUA 4HKZB 2JLLA 4NO3B 3VFUA 5KVDH 5B22A 5I1DB 4IDJH 4LPTA 2SEBA 4I13B 3ZDXE 2W9LA 2WW8A 4XP4L 3CSBA 4PJ5D 3ZYJA 4E41D 1J1XL 4L4TE 3HLAA 1HZHL 5MEOB 5GS0D 2X1QA 3LRHA 3HAEA 4QTHA 2W60A 3RKPA 1OSZA 3VXMA 1HHGB 3TN0C 2E6PA 4YUEL 2EDLA 1J8HE 3WEXA 4XP5L 4Q6IA 1A6PA 3RVUD 4FQQB 3DROB 1WIOA 1YEEL 2O61A 3PWUB 3LEXB 3JTTA 3VWJD 1JGLH 2ITCA 2AXFB 5TF1L 1PJ9A 1V7NL 4CJ0A 1KF9B 5L8LB 1QSED 2WBJD 3O6LH 1YYMH 1T1XA 3MRGA 2R23A 4J3TA 4DCQB 4XMLL 2I26N 3EOBA 1D5ZB 4RNRA 2DQIH 2LQRA 4WJ5B 1M6OB 1D5BB 1FNEB 2A6KB 3B2VH 1KPVB 2COQA 4X5WB 5M95B 5ALBH 3WN5B 1QSFD 3OKOB 4I48B 2YN5A 4XH2B 4F2MB 5I1JH 1M05A 1RZ8B 1S7WB 3QZWA 2DKUA 5HYJA 4D2NA 5F9AC 5CINH 3NACL 5B39G 4MJ6A 1OWWA 3MFFA 5MI0C 3B83A 3TO2A 1IM9D 3BP7B 4LDOB 2VR4A 3NFPB 9CGTA 5L8KB 5BV7C 1RIHL 3GSQB 3O6FB 1YPZF 4PRPB 1U8MB 4G6FD 2D7TL 5ADOL 2XTLA 1JWSA 3GJEA 2XIDA 5IK3A 4PB0H 1Z9MA 1ZLVK 1PEWA 1YN6A 4KK5D 5IBLD 1S5IL 3LKRA 3KR3H 3MROA 3ULUL 3PWLB 1T7YA 1B4RA 5CEXA 3MUJA 5DD3H 4YAQB 3G5VB 1TETH 4K7FA 5HYJE 4ZUTA 2XQYG 4M5ZL 3PWVB 2OZ4L 4P57B 3T08A 4HWNA 4JHAH 3BGMA 4JFHE 5F9WB 3TJEH 1AH1A 4R7NA 4BFBD 4IS6A 5DMJB 1I9RL 2CLZB 2YC1B 2ZUYA 7CGTA 3QHFH 4LSSH 3U4BH 3SKMA 2UUDH 3JWOC 3JWNC 4QEGA 4LCCB 3LAFA 4G42B 3W2DL 5ESVA 4JM4L 4CMMB 3HNSL 2XNAA 3O2DH 4ZUWA 4LBEA 3KLHD 2GAZA 1FNSL 5KOVC 2DB8A 3CFIC 3LIZL 3KPLB 5FYKE 3MJ8A 2VDMH 4YO0B 3BZFB 1TJIL 1HXYB 5JW3L 3P4LA 1WAAA 4AT6B 1MLBB 1OTSD 4G6AD 2HVJB 3QIWD 5IB2B 5CJOL 1JYNA 5INCA 2VOTA 5EOTA 3U9PH 1RJCA 5D5MF 1E4JA 1C08A 3AXLB 3TBTA 3W9DB 1UM5H 5CIPH 4D9QE 1B6UA 3O8XD 4M6OH 4M9PA 3RZCC 3QDJA 4Z7UA 2XZAL 3E2HB 3OG6B 4F15C 2VMFA 3AU1A 2Z91A 3C60B 1K8IA 2YSSA 3F7YA 1Q94B 1X5LA 4ONHA 1F4AA 4DN4L 2EDOA 4PLKD 3WFZA 1FFPB 4QHMA 3VMOA 1VHPA 4PJ8B 3TJHC 4LAQL 2D7NA 3FQNB 1ZVHA 2VAAA 5JR1H 4PJIE 1WAAE 5LG1A 3RNKB 4OFIA 4AM0A 3G08B 1QLEH 1L0XA 4HCRL 2A83A 5BVJA 1F58H 3KWWA 4R26H 2BHZA 4WFGE 1UZ8B 3QG6A 3SDDA 5J57B 2OXHA 4WO4C 4QHNB 3QDJE 1CBVH 1WBZB 4Z7UE 5T3ZD 1IVLA 2ZPKL 5DHVB 5AYUL 4XPFH 1SQ2N 3EKCA 2HLAA 5DF0A 5DD1H 1AP2A 3F12B 1KFAL 2VLMD 1K9TA 3VXRA 4QKXB 1DLHB 1JGVL 5AD0B 1EHNA 5INDA 3HNVH 2Z31B 2R29H 4MCZB 1LDPH 1KTDB 1U42A 3MOQA 3CPLA 1MFCL 4XNZB 3QQ4B 4K3JL 5I1KH 3CXDH 5L9DH 4PJAF 2I9TB 2XWTA 4MZ2A 2HJKA 4R8WL 4PJ9B 1QFUH 4I9WD 3FN9A 5FUCC 4XVSL 4WCYH 3WJLC 1ZLWK 5F8QC 5B4MC 3IS0X 1LK2A 3LDBB 3RI5F 1IAIL 4YX2L 3IGAA 4AEHH 5DJ6B 1DJSA 4U1JA 4Y4HD 5E08H 3U7AA 1HWHB 2V2TB 2PXYC 1BP3B 1I75A 3LH2L 4L29A 1VEPA 3PJSA 3L7EA 1SY6H 2BVUA 3DLQR 3P4OB 3MXWL 4B50A 3MA9H 5EUKB 2FX8L 3P4NA 1NDGB 5C9JA 3VXRE 1MJUH 4W6WB 3RL2B 1JBJA 4HFWB 3C2AH 4WU7B 5EZLB 4U0RC 5GS1B 3RGHA 3A6CL 4GRLA 1YN7A 3TZVD 4LLUB 3MRHB 3UBXG 4KHTH 4R4FL 2X4TA 4PJ5A 4E41A 1T66C 5F1NA 4V1DE 4EN3B 1FAIH 2O93L 3DETC 4AEIH 4U6YB 1SVCP 4JFOA 4JZNA 4HPOH 2G9HB 3C6LC 2HFFA 3P0YH 1OSPH 2R0KL 3CMGA 4KK8C 2ZUXA 2EE9A 2AKRB 3QXAA 1MCOL 2OBGA 4XNXH 1E27A 1OP9A 4QYOA 1DL7H 2IPUK 3V52L 2EE3A 1WEJH 3UTSA 4LKCA 2DQTH 4R4ND 3MOBL 3VWJA 3HFMH 4PJBA 1QSEA 2WBJA 4A6YB 2QHRL 2DTMH 2IALB 3TA3D 5DJ0A 4ODUB 3AROA 3NZHH 3QNXA 4MD0A 3TNNA 4X4ZA 3DHJA 3PXJA 4OZGA 3BMWA 2A74B 4MX7B 2J2ZA 5C7XL 3GJFA 3KPQA 4E41E 5MHSD 4HWBH 3DNKA 1WISA 4UIMA 2QL1A 1UT9A 3C8KB 2DQEH 2R2BA 3FB5A 3QRGL 2VDQL 3MXVL 1NEZB 5FM5O 4N0UA 2IG2L 3PGFH 3S9DB 2B0SH 2VXTH 2P24A 4FXLA 3WFHA 2VZUA 5H35B 5L7XH 1IM9A 3UTSE 1YQVL 3PWJA 4MGXA 1CDCA 5E94B 5EO1A 1JZ4A 3GMNB 2NY1B 2VLLB 4FXGB 4OF0A 4PJBE 1QSEE 3SDCC 3OXRB 3GMOB 1BD2B 1F4XL 2NTFB 4WI5A 3W9EA 2Z31D 1CDYA 2IQ9L 3C5ZB 5CGYD 1WGOA 4XAWH 4OZGE 5EULV 1JFQH 4YHLL 5DFWH 2R2EA 5GS2D 5JZ7C 2NY2B 1CLOH 1OAUL 1LDSA 5AYQA 3O4OB 4QT5B 1MCHA 4IRJC 5E9DA 1L9MA 4FN0A 4DW2H 4EDXA 5AEAA 5CD5D 3O3BA 4N0UE 5EFIA 3V5KB 1KJVA 1OW0C 5DJ2A 4RISH 4AL8H 1RUKH 3UCRA 2DJSA 1JNHB 3VFPB 4MQ7B 1EK3A 4UV7H 5E2UH 3CFEA 3UTPD 3ZKXC 4XPTL 3L3JA 4OLWL 4QRSB 4PTTB 1FJ1B 5FGBA 5DD6B 1FBIH 2Y6SD 5C0GA 3ZE2E 4EI5A 5GS0L 3QUMA 2R56L 1URLA 2FGZA 1L7TL 4LIQH 4WEBH 2AJZB 5JIHA 3FO9A 3LRSB 3JVGA 43CAA 2IH1B 5K9QI 1OCWL 3GKWH 1QBLH 1QLRB 4BSWA 5FYJE 2BK8A 3P11H 5DA4A 5E9DE 3MRQB 1ZK9A 2P49B 2ZZUT 3E1F1 3QIWA 2DYPB 1QNZL 1F5WA 1TQCB 3MNZB 5B8CC 1CK0H 1OY3B 5C09D 3REWB 5F7UA 1CDHA 5LVEA 2IF7A 2XOTA 3HE7B 3AAZB 1WIPA 3C6SA 3UDWC 3DX8B 3O8XA 2V2WA 3ISWA 4J8RA 4CNIA 1F2QA 2GTWA 1MAMH 5F9OH 1OTUC 4LF3A 2Q76A 1AD0B 4OSUH 3GBMH 3PWPB 4HMCA 2ZCHL 2KKQA 2M1KA 2Q8AL 3HTLX 3U46A 5DT1L 1YDPA 5E6IC 4LL9A 3QQ9C 4HS3A 3MRMB 4HKJB 5M94B 2I60L 1UKTA 4KUZL 3MRIA 2VLKB 1MI5B 3ES6B 4GG6E 2JJVA 4MJ2A 4M61B 5C0CB 4K3GA 1UH4A 3O4LD 2BY0A 4FTVB 1TVBB 4XNYH 3ZHLA 1EHLH 4X4MA 3LRGA 3V79C 1EAPB 2ZOKA 4WWKA 1NBVH 2FYYB 3WD5L 3SOBH 2YD8A 1XT5A 2LFGA 4I0KA 5IFAH 1DN2A 1NGPL 2HWZH 3DVIA 5JXAL 4LGSB 1CU4L 2NMSA 4YDLC 1IGFL 5ID1A 1X7QA 5IJVB 5C0EB 1ADQL 4K2UL 3GMMB 3S88H 5ESAA 3UJTL 5ETUA 3NIFF 4IJ3B 1RIVL 2JIXB 5CILH 4ZFGL 3H9HB 2ZSWA 3P73B 5FDWA 2H6PA 4HUVA 2GUOA 4WI3A 3H0TA 4XP9H 3IKKA 2Z92B 1NCBH 4BZYA 3VE0A 4U1NA 2DWEA 5F9JA 2E9WA 4F37F 3OB0K 4AMKL 1NGYB 1A7PL 5FKPA 1AI1L 1RZ7H 4JKMA 4X7EC 3VWKC 2A6IA 1IGJB 4X4ME 1MRDL 3A6BL 4D0DA 4Y4HA 1KPUB 3THML 3X14A 2BHYA 4Q0XL 3MLYH 3KYMA 5K33A 3GM8A 1TQBB 4I4WA 1BF8A 3MJ9A 1UZ6F 2H2PC 5CBEA 3MCKB 4U1SB 4UBDC 2A1WL 5LAXA 3UTQB 5JDJA 1JGUL 1M7DA 2UYLB 4KKLC 1UKQA 2DD8L 2NZ9D 3KPNA 2DYPD 4RFEB 2YUXA 2E27L 4NFBA 1F11A 1UM6H 4Y2DD 1NLBL 3GI8L 4P5TB 3ARBD 4RSVA 1S5HA 1A6ZB 2HT2C 2JJTC 3HE7D 1EO5A 3BFOA 2I07B 5K9OA 1PX4A 2DIJA 4NNYA 5DEGB 1E4XL 1HKLH 1FYTA 3DOSA 2YEZA 4OUUA 3W5NA 3WLBA 1JVKA 1WBXB 4IDLA 3JBG7 3AY4A 1NCWL 1B0WA 1LO0L 5CMAA 3TBVA 3OR7B 5HYQA 1DBBL 4HFUL 2F54B 3MCG1 4HT1L 1MHPH 1KCRH 3CCHB 3GRWL 2FEDC 2VXSH 5IW6A 1XH3A 2YBRB 4XCNB 3OPZL 4MLIA 5BS0A 5BVPH 1BJ1J 4WI8A 3ARFD 5D7JC 5SWQA 3BKYL 3AGVA 5LCVL 3F5WA 5LGHH 3V5HA 3C9NB 2I5YL 5T3ZL 4Y4FA 5JW5B 4PJCA 4MB4A 3QQ3B 4LLDA 3SKNB 5FCSH 1A9EA 1WWWX 3ESVF 3HHRB 4XAKD 1FYTE 1GZQA 2DQFA 3Q2CA 3VH8A 4OZIE 4HJGA 1BGXH 4JZJC 1A6TB 1G7LB 4Y5YA 2IGFH 2P8LB 4LGRB 2F15A 2P7TB 4LHUA 1NDMA 4KVNL 4FQCH 2Q87A 2NQCA 3ZKMD 4GQ9L 5TGBB 1B2WL 3LPWA 4P3DA 4PG2A 4NHUB 3ARRA 1MCNA 3KS0J 3VRIB 4HIXH 5BS0E 2PUQT 3MCLH 1HSBB 1T3FB 1T6VN 2HYMA 1LNUA 1KXTB 3U48A 2CJUL 4X6DB 3SDAB 1AGEB 4JFYB 4PJCE 4NQSB 1OTTC 1T5WB 4GRWE 3RTQA 1ONQB 1P84K 1SMOA 1X5GA 4M8QB 4YDJA 4NO5B 5EIQA 4X83A 1NGZA 5EUOB 4PY7B 3LHPH 4NDMA 4LVEA 1J1PL 2ZUQB 1FAKT 5GGSY 3S97C 3UJJH 2DKSA 1FZJA 1WIUA 2MWCA 5KANG 4UTAL 1VFAB 2CIKA 1UWEL 2F5BL 2GSIB 5I71B 3BVNA 1VB9A 4L8DA 2FECI 1E4WH 3OKEA 5JOEA 4JO1H 4RGOH 5HHOD 4JM2C 5A2KH 4OJFL 2IC2A 2VABA 1ZGLA 3Q5YA 4KH2A 1L0YA 3D1MC 4E42A 3QEGL 3SCMD 4UT6L 3QNZA 2VISB 3ZLQC 1M71A 3FAWA 4TQEH 4JO2L 4KJQC 5A43C 3P2TA 3QFJB 4OGYH 5DDHB 5DUML 2KQMA 1GIGL 3MLPA 4QLRA 4LARH 1ZVYA 5DVLA 5I30L 5IW1A 1KN4L 3DXAD 1AGFA 1G1CA 5C09A 1FZKB 1EGJA 5IFJB 4FQJH 1G7IB 2CK0H 1MRFL 2NY0B 1Q9WB 2VLRA 3IDNA 4Q97A 4OV5B 3UTPE 3C8HA 1MCWM 1FSKB 4GMSL 3T4YA 1U2CA 3WS3A 1RZKH 3LD8C 5CHNB 2YA2A 5K9KB 3U7WL 1U8HA 3SGJC 5FXCH 4JY4B 3D3VB 4YIQB 5D9SB 4ZUVA 3B4NA 4MA3A 1XGYL 4TRPL 1U6AL 1NCDL 1LWRA 3BH9A 4J2XA 1RV6X 4LPVA 2VDLL 1KJMA 2V6HA 4FQIL 1NGWB 3RRQA 3QCVH 4G43B 4PGJA 1LD9B 4JFEB 2NX5A 3U0TA 3V7AG 1P6FA 3O45B 4PY8J 3HAEH 3O4LA 4F3FA 4WUKL 2CIIB 4ODHH 1T1YB 3MLWL 4L1DA 4MHHI 1VPOL 1IAMA 4H1LH 3UC0H 4HQQH 1UACH 5IB5A 1JHLH 3BZ4A 2VLRE 5CZXD 3QWOB 4QXWA 3GBNH 3L5WB 4KPHL 5FYLD 1HHHA 4OGAC 3EYFA 4HWUA 2Z8VC 4LRNH 1C7TA 5E99H 1TNMA 1F00I 4PD4J 4RQQB 1EEZB 4M6ML 1U41A 3ULSB 4DVBA 3TM6A 3LEYL 1TZHA 1HDMA 4DJMA 1IEAA 3EDFA 1OPGH 3BKJH 2YS4A 5I19H 1G7PB 2NX5E 4E5XA 2Q86B 2FB4H 3QUYB 4PRAA 4D0BA 1ZVSA 1AGCB 4K8RH 3CX5J 5I1GL 2OX5A 3WIFB 3FQTB 4PJ7B 3QULB 5K59E 1CI5A 2PYFA 5ITBH 1DR9A 2AJYH 3RDTA 3VFGL 3O0RL 4NWTL 4LSTH 3RUGE 4CMHB 2C3VB 3PHSA 1QUNA 2I9LA 4KJYB 5SX4I 1BAFH 3ARGB 4XMKL 5E8PA 4AH2B 1BBDH 2NY3C 5JQ6H 1YEGL 5DRNB 2V7HA 3GSVB 3BGAA 5GSVA 3WFEL 4HKXA 4E0RA 1A9BB 1DLFL 3N1FC 1NMCB 5DQJA 5GZOD 4YLQT 2XTJE 3BT2L 3CFJA 2X7LA 4D0CA 2DQCL 1IEBA 2W92A 3GIVA 1JGDA 4I2XB 2DQUL 2FATL 1K4CB 5EIIA 5CAYB 3FB7B 2W0LA 3G5XB 4Y16D 3NIGE 1JWMA 3V7AE 3FB8B 1CL7L 5FYKH 4U6HB 3QFJD 3QIBD 4RX4D 5F7NC 4GKSA 3CJJA 5HYSB 2IADB 4ETQB 3CSYA 5GGVH 3WHXB 5F3BA 3LZFL 3ARBA 4N8CH 1LVEA 4JRXA 2HLFD 2H32A 1EEQA 3MODL 4TYUA 4OLXL 4ZTPH 5JHLL 4NQVA 1JPSH 3VXSB 3NH7H 4JDVB 5DGQA 5AZEH 2A6DA 3BE1L 1LEIB 1U91A 1KC5H 1NGQH 5D8JH 4F7EB 3BUYB 2W65B 3DX7B 1QRNA 1P7HL 1U8QA 1U95A 4FFYL 5KSAB 3TYFA 5I75B 5D1ZD 3WBDA 1T7WA 4G6JH 2R0WH 2BVQA 5CKGA 1KB5L 1GVIA 2OTWA 4LPWA 1ZLUH 1ZHNA 3KPSB 4YPJA 1EIBA 2HTKD 1YEHL 3FQWA 2WZPD 5LWYL 3NIDE 3ARFA 4JPVL 5GPRA 1RAMA 3NCFB 4HHAA 3RWEB 3MQIA 1H9VA 2YZ8A 4JRXE 1JF6A 4X6CF 1N5YH 2DLHA 3ARPA 4X8JB 1SHMA 3SE4A 4N90E 1XGUA 1QA9B 1JPGB 2BXYA 4L8CB 1CD1B 4UQ2A 2CMRL 2WM0A 2NTSP 2X4UA 5BV7B 4YR6B 5C86A 1QRNE 2VYRE 2CDGA 1D6EB 3QDHA 2Y4SA 4KXZH 5JIKA 1AXTH 1AY1L 2P8MA 5C0DA 1P9MC 3VMNA 1XCTB 2BRRL 4YXKH 2QSCH 5EBMB 4ZSOB 1KACB 4JFPA 3RWFA 1OAKH 1XZ0B 1ETZA 1JPTL 1CZ8L 3GSNA 5FHAH 5ICZB 3NGBC 1J0JA 3L5JA 2ADJA 2DIAA 5JXEC 5IHZA 1QEWB 4GAJH 3MLTA 4P5KA 5TJWK 3ROOA 2W91A 3VI4E 1AQKH 2YD5A 5EU3A 1W72B 4C55A 5KSVA 3X12B 2BNQE 2CRYA 3EO1A 1MWAB 3PL6D 4XAKE 1UWGL 5HVGB 1HYSD 1CD8A 5FA3B 4WRLA 1OP3K 3DV4B 5F44A 5JOFB 1U93B 4N5UA 5C0BB 3NVQA 1PAMA 1NANI 4PD4K 1G7JA 3FMGH 5HHOA 2PTTB 4KJWC 3JZ7A 5J6GA 2EDKA 1IAII 4MD5B 2CRZA 2AJ3A 4FQXC 3SCMA 4L8BB 4HBCL 1J88A 3TN0D 3QEUB 1LK3L 4XGZA 4Z76B 1RMFH 2EKSA 3CX5K 5D1QC 3SDXA 1OWRM 4JPWL 1NSNH 1MQKH 3VXSD 5IESH 1YZZA 1Q0XH 4F33A 2BSRA 2M8XA 2OQJA 3WNMA 3DXAA 5DUBB 3FB6B 4IOSD 1INEL 2P45B 3HZKA 4R96A 1QO3B 1S7QA 2NW3B 3WYRA 1ZXQA 1NBYB 1XGQB 5E56A 2EXWD 5BZWB 1Z3GH 1JWUB 4PRIB 3MMEB 3V6OC 5IJKC 5HGBA 4IMKA 2CH8A 3DV6B 3MLSH 1MFDL 3BP4A 3I9GH 5EO9B 3S5LA 5EWIL 5L2JA 3HPJB 3T2NH 5EU4A 4PP1C 4QY8A 4KXZI 5CP7B 3DURA 1ORSB 4FQPA 5CS7A 1IGTA 2JB5L 1IGIH 3FTGA 5EBLA 5J0BA 4BSJA 3RWGB 4J1UA 4HV8B 4R90H 4UOJA 3SDXE 1FRGL 3BPCA 2WINA 4LSVH 1Y6KR 3W82A 4HLZH 1JPFB 5FUZH 1RZGB 1SYSB 1N7MH 1REIA 5BW7A 3FOLB 4UZGA 1EXUB 2HVKA 4DQOL 4P2CG 4RA0C 1JI1A 4YXLH 1MF2L 4RGNE 1YY8B 5DRZB 4WV1C 3T0EE 1IC7H 1R24B 4G8FA 3ULVF 4U3CA 3PGDB 2C5DC 5C08D 2DICA 1D9KC 3NA4A 2A6JB 5DYOB 2C7UB 1W0VB 2J5LC 3RWHA 4ERSL 3RFZC 3ULUE 4OF8A 3LKNA 1P2CA 3NA9L 1I1CA 4PJXB 2DL2A 4LNRA 3FOMB 3JTSB 1GZPA 1EEYA 1TVHA 5JW4N 2MPAL 3O9WB 5EUOF 5D6DA 4DKAA 2XV6B 5DJYB 1DQML 3GJFH 2DM3A 4G3YL 3CZFB 3FFDB 5EO0B 3CIQA 1NJ9A 4MQXC 5C2BL 4PJGA 3BGFC 1MHHA 4RRPA 4E9LA 3T8XB 3V0VA 1HSAB 4QOKD 4CDGC 1X5KA 3CUPA 3NPSC 3WLWD 1C1EL 2PXYB 3UZEA 2B4CH 1RJZB 4PJFA 2QADD 2CDEA 5IIEA 1TJHH 1PZ5A 4C83A 2CKBL 3VW3H 5ACZA 4TUOB 1RZFL 1AQDB 5KBNC 4UIKL 4S1DD 1DBJH 5F72S 2EH8L 4PRHD 4U0RB 5FGCE 3SDYH 4QTIH 4O2EA 4HCRA 3VFWA 3TT1L 4ODSH 3QIBA 4RX4A 2GCYB 2EO1A 2W0KA 1HK6A 4ZS7L 5GRJL 4YNYA 4P59L 5FYJH 3LEVH 3QDAA 4PJGE 2YD3A 2APTA 4Y19D 3HMWL 3INUL 4MXWH 1ZSDA 4NT6A 3L3OA 3VFVB 3BRFA 2HRLA 5E8OB 1HEZA 4QHKI 4LRIC 3Q1SL 2P5EB 3RZCD 1INQB 4ODVL 4XPAL 1DP0A 2OCFD 4JZOA 4H20H 2AK4D 4M02A 5I1AB 4Z18A 4LP5A 3LKQA 4OLZH 4FABL 1DE4B 3MRKA 2FO4A 2IAMC 4R0LB 5F7KC 3MV7E 4UDTA 2BP3A 5IHUH 3TJHD 1TXKA 2DQGH 1VKXA 3QUMH 4PJEB 5IGXL 1WUNT 2P8PA 3LSOA 1KUMA 1OGAA 1BOGA 2ITDB 2XWBB 4J3XA 3U9UB 1CIDA 5FCUL 1A6UH 5CCKH 3GMRB 1FZMA 3MV9E 5DR5L 1A1OA 4M1GH 3EOYG 5LBSL 4KKAC 1Y18B 3S8WA 1O7VA 3UTOA 2FO1A 2V17L 5J11B 4WO4D 4ZFZA 4KI1A 3RPKA 4RFOL 4F7MA 1ACZA 4Y5VB 1KXQE 1A3LL 5E1AA 2CRIA 1KN2H 5D2NA 1MCKA 4Z77A 3K2UH 3VU2A 5ANMA 3GSXA 4HIEB 1XGPA 1R3HA 3TWCH 3ULVL 2C4FU 4HIHA 2CDFA 4G8IA 3ESUF 3SE3A 4JGUA 5D6CA 3EFDH 4L4JA 4M62L 1KEML 2UUDK 3R0NA 4IOFD 4M7ZC 1MCSA 1OGAE 4MD4B 1B0RB 4CU8A 3P40A 4XHJC 2JELH 1ZLSH 3VXOB 5E2WL 4K7PL 3WUWB 1IKFL 5D1XC 2J8UA 3CZJA 2RGSA 4OF6A 4KMQA 3O3EA 1WZLA 1CGUA 2EC9T 5SWZA 4HS8H 2BOCB 3NAAH 4GKNA 4ZO6A 3HZVA 2GQHA 2PXYD 2NPLX 3QDGD 5D2NE 3PL6A 4OUOA 2R4RH 1ZHLB 3I50L 4G7VH 1K8DB 2BDNH 2F58H 2Q6WB 4BH7A 2RFXB 4O4YH 1A7QH 2NY6C 5MENA 3OB8A 4TSCH 3JWDH 2XY1A 5MEQA 2F53D 3VRJA 3KHOA 4XHQA 4NRYA 2OJEA 1M1SA 3I6GA 2YWYA 3OJDB 4M93C 4OM1H 1RZJH 1HQ4B 3MYZA 1VERA 1CLYL 4J4PC 2J8UE 1ZTXL 2GTZA 5D5ME 3NFNA 1CICB 4NM8L 3TYGL 3C6LD 5CLTA 1X5JA 2PW2B 5SWZE 5I74C 2N7AA 2P5ED 4P9MH 1XR8B 3VFRA 1PKQB 3HC0B 1NMAH 5CJQL 4PBVC 1WWBX 5C8JA 3P9MA 4YDVB 4X7TA 1Z0NA 4WHTB 4QHLA 2AJUL 1J18A 2A2QT 2GJZA 3RBGA 3H42L 5T33H 5MENE 2QV2A 3RWDB 3G5YB 3QXTA 1NKOA 1UA6L 4NO0D 2Z8RA 3OMZA 3MBXL 5T3XD 3MJ9H 4CUCA 3U30C 1XF2B 1EFXA 4PJDB 3BO8A 3TNMB 2HFEB 2WUCH 4JY5L 4OCWH 5E6IB 5H2BB 2WUBL 5JLZA 4X6BA 4LSDA 4HGWA 4WFEE 3D5OF 5D71H 3ZDYF 4GKZA 4JPKL 1R3KB 2GYSA 4FQHA 4BQBA 3RPIA 3IETB 1NUDA 3MYJA 5TE4L 4YH6A 4NCC2 3OKDA 2IBZX 1S7TA 4LSUL 1AHWC 3ARUA 3UPCA 3MLZL 1RUMH 2FBJH 4ELMA 3K80A 5EORH 2DQHL 3DUSA 4Y8DC 5J13C 4CVUA 1E6JH 4ZPTB 5IMOA 4Z78B 4G9FB 5FHBL 4OLVL 4K7PX 3TESA 2VXVL 4YHMH 3H7BB 3SDCD 4NQCD 1W0YT 4YDLB 5DK2B 3QO0B 1HQRA 2J4WL 2XZCH 5C08A 4XBGA 1FG2A 2VSCA 3DTXB 3T3MF 3V4VH 3KHQA 2CUIA 4PJAE 2DDQL 2OR9H 1MIEL 5JZ7D 2R2HA 3HR5B 4A2MA 1MCIA 1AC0A 1JK8B 4Y5XA 1S9YB 4IRJD 4NKOA 5CSZB 1RK0A 4P9HL 4EUPA 5F3HB 2I25N 1AD9A 4OAWA 1UEMA 1WZMA 1BIIA 1KJ3L 1R3IH 4WFHD 5TPWH 4FQ2L 5I6XC 4NHCH 3HE6C 3CVHA 5KJRL 2HH0H 2JK5B 1AO7D 3B3IA 3V4PL 1KIRB 5DRXB 1N6QL 3OKNB 2BY2A 4A2LA 4I77L 4K9EH 4GRWH 4OCSL 4ELME 4I0CC 1NGXB 1TZGL 3CFBB 2AI0H 1T1ZB 4ZPVB 3IFLH 4N9OB 4QOKA 4UT9H 1T0MB 3L7FB 1X4XA 2QQKH 1UYWL 4XPBH 1RZKC 4ISVB 4JFFD 1G6RB 4KTDH 4JVPA 3QPQC 4M48L 2D03H 3IDMB 3IDYC 2XT1B 2B1AL 5CEYB 4GXUN 2ZUSA 5DJAB 3QIUC 3TT3L 2HTLD 2MSPA 4TVPE 1EO8H 2H9GA 4C56D 5ESQB 5GS2H 2FRGP 1MREL 4MVBC 4Y19A 3PDOA 1I1AD 1ZEAH 5F93C 1H0DA 4MSWB 2ZP0T 4LP4A 4UI2A 2FIRT 2NY7L 2XKNA 1CTNA 2ADIB 4Q6IC 1UCTA 5T1DL 2AK4A 4FP8L 2IQAA 1OTUD 2NR6C 3KDMA 1QYGL 2RCSH 4G8EA 3KYKH 4P5MA 1TTGA 3ECBB 4TSAL 3L5XL 1KGCD 5A1AA 5AUMA 1IC5H 3QQ9D 1F4HA 1SM3H 5ISZA 2FR4A 4Z0XA 1C16A 4WHYG 1S7VA 1Z5LB 2X1WL 1MCCA 4NZJA 3CK0H 3DWTA 3WHE0 3CC5B 5IMLA 5D7JB 1QR4A 5BV7L 3UTZB 4YHZL 1WICA 2ZCLL 1TITA 1I7TB 2A9ML 4MJID 4NZRH 5I8EB 5JHDA 4TPRH 2ATPB 4Y19E 4LQFH 3K4ZA 4K8RC 2VDRL 3KPOA 4KHXL 1U92A 1A4JA 5HTSA 4ZG1A 1U8NB 2ENYA 5FF6B 1EGJH 1E28A 3FO0L 2AXHA 1MOEA 4FQLL 4PV9B 4KMTH 4P23D 1HHGA 1JRHL 1N6VA 4Z7WA 1AXSB 3HC4H 1IAIM 1KTRL 4M7JH 4NJ9L 1IQDB 1W0WB 4IRSD 4NGHH 1I1YA 4FQQA 3O2VH 1U3HB 2IPTL 2NLJA 5ISZE 4ZXBB 4PB9H 1W72L 4HUMB 1FH5L 4JRYB 3ZT5A 3PWUA 1NAKL 3LEXA 5KG9B 3W39A 3WXVL 3UAJC 1CFNB 4CADB 7FABL 3JWOL 5LGJA 1JPST 3ZHKA 4YDIH 5JHDE 1FPTH 3VWKD 4MDIB 1AKJD 1W2KT 4PGEB 3SKOB 1RZIA 4OGXH 5A40E 1FNEA 5TE6H 5KS9B 1UJ3A 3F58L 3FQUA 1FVEA 4OQ1A 3OKOA 4I48A 3QDGA 4XH2A 4F2MA 1PG7H 3NABH 1T22B 4BFGA 1RZ8A 5HGDA 5JO5B 4HBQA 3SGDI 3S37H 3QUZA 2R1YA 5D7KE 3VGDA 4UBDD 2FJGB 1ZOXA 1CGSH 3PHOB 4KKLD 5CSGA 2F53A 1T04B 4OT1L 3BP7A 2GEEA 4Z7OE 5I8OL 1I7ZA 4TSBL 3DMMB 1I1FA 3NCJL 3QDMD 2J6EL 1FIGL 2VDKL 2ICES 1KPRA 4ZTOL 2R0LH 4GMTL 2HT2D 5C07B 1EJOH 2IEPA 5AWNL 1PG7W 4GRMB 1JYWA 1C12B 5L2KB 1JYXA 3WNOA 4DTGL 2Q8BH 2UVFA 2W9EL 4PJEF 4YC2C 4MAUH 3T2PA 4YAQA 4Z5RB 4L5FL 4LFHD 1JN6A 1CL7I 4ZOCA 5HY9B 2Y06H 3MJ7A 4LU5L 3DRQB 3VFNB 4NN6C 1A7RH 4DUVA 1J5OL 2CLZA 5GRVK 4FZ8H 4GAGH 4HK0B 4TNWK 5D7JD 1CQKA 4KDTA 4PRPE 1YEKL 1LO5B 5L88H 4DGYH 1QSZA 3PE9A 3D0VA 4U31A 2GFBA 2IFFL 3NTCH 3GHEH 3E6FB 1K3ZA 1QG3A 1PVHA 2XRAL 3KPLA 1HXMA 3DSFL 4K23L 4YO0A 1RPQA 3BZFA 2H32H 5EOQL 3EOAB 1A14L 3I84A 4AT6A 1MLBA 1Q9LA 5J3HD 43C9B 4U1GC 1T1WB 3SDDC 3TBSA 5I15L 4X0KB 1VESA 2ARJB 3TIEB 5DK0B 1T2XA 3SDCA 2QJDA 4NQCA 1P1ZA 4GW4B 1NL0H 5C0AA 4HIIB 1MLCB 1TJGH 3G04B 3SE9L 4OD1L 3P77B 2FIKB 3BW9B 4X4YB 5HHXL 5BO1H 4HMDA 4WENB 1OF2A 3EW3B 3K4AA 2QQNL 5F7DA 3C60A 4XPGL 4IRJA 2FD6L 1VEMA 1Q94A 4P2RD 4XZUB 3IFNL 2PW1B 5GZNC 5F88B 5IB3A 1FFPA 3GUTA 3ZYOA 5GIRB 3VD3A 4CL7A 4JQIH 1JMXA 1AO7A 4I3RH 2BHUA 1GPOL 4S1RH 2BZDA 2PKDA 3B5GA 5D7LD 3S4SB 4KZDL 3MV01 4RZCB 1KTKE 3RNKA 1MFEH 3L1OL 5HHVH 3L3DA 4K55A 2YPLA 5EU5B 5CIPB 2NY4B 5IVXA