4XVJL

Structure of the hepatitis c virus envelope glycoprotein e2 antigenic 2 region 412-423 bound to the broadly neutralizing antibody hc33.1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
GGGSQSVVTQPPSVSAAPGQKVTISCSGGSFNIGNNYVSWYQQLPGTAPKLLIYDNDNRPSGIPDRFSGSKSGTSATLDITGLQTGDEADYYCGTWDSSLNVVVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV E2 antigen
publication title Structural basis for penetration of the glycan shield of hepatitis C virus e2 glycoprotein by a broadly neutralizing human antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xvjL00
1IQDB 1R5WB 5B38G 1DBMH 3OAUL 4L4TA 2P8LB 4OBRA 1WT5A 4A6YB 2BRRH 5C0ND 1LEGA 3JTTB 2Q6WA 1L0QA 2A6JA 1QG3A 1TENA 4AY0A 2P5WE 1OW0C 4U1NA 4WIQA 4G8FA 3BP6A 4I3RL 4NKDB 5I1LA 4TSCH 5CSGA 2WQRA 4YBHA 1P4LA 4E41D 1KOAA 3DMMC 4M02A 4QNPF 3HNSL 2YA2A 1FH5H 5CILH 4XP6H 1A6TA 3BEVB 1EAPA 4KI5D 4QT5A 3MYZA 2I26N 1ZVSA 5EOTA 5JW4R 2NY1C 3VWJC 3RX5A 2FBJL 3TWCL 1KIQB 5JZ7D 1U6AH 4YHML 2Z8RA 4I48A 5TF0A 4F7PB 4Z7UB 4NM4H 1QRNE 4ZSOB 1TJIH 4LRNH 4WUUA 3W2DL 1Z5LB 4XNXH 4XNYH 3ZL4H 1JE6A 4PJAA 3PWUB 4B50A 4H1LG 2ILLA 2ZPKL 3DX8B 4JQVC 5KSVB 3O3BB 2F53A 4OQTL 4CVXB 4ZFZB 4D8PB 2XXMB 4XVJH 4OF6A 1F4WH 3FQNB 1UQSB 1I8IB 3VWKA 4YH6A 4YO0B 2JCCF 1OAXL 3RWIA 1KB9J 5TGBA 4PJBE 1Q0XL 3E2HB 3I2CH 2HG5B 3U30C 1ZSDA 3HE6C 1CXLA 4H88L 4FABL 2FX9H 1UADC 1PG7X 4I3GA 1MSPA 1V7NL 4BSWA 1GGCL 4DKFL 5EORH 1MWAL 3WL9B 1OGAA 1ZHKB 1YY9C 2VLRB 2VZ1A 3HAEA 5A16A 4LF3A 4NCC1 4PP2A 1CL7L 4GRMB 4UTBL 1NGPH 1UH4A 3GMPA 3B9KB 3NACH 4FQQA 4AIZA 1T1ZA 2C7UA 4TPRH 3EYFA 3WNLA 4CJ0A 4R97B 5DT1L 3LCYA 3FB6B 3GHBH 2UZYB 5HGAB 4HXAL 5F6HI 1TZIB 3C5ZD 1FZJB 5T1DL 4Z76B 5EUOB 1SVCP 2X70A 5I1DA 1I1FB 2NXYC 5FGSA 5IGXL 1GGIL 3I50H 4N0FB 4PJ7A 2CLRB 5FXCH 2FWOA 2NY0B 1AE6L 3BVNB 4NYLA 2AEPL 5HDQL 4ELMB 4HJGA 1MCNA 1Q0YL 5DD5L 3LN4A 4EQ3A 4Y19A 1XF5A 1INQB 4JFDB 1ADQL 3LQAH 4LHUA 1EJOH 3AB0B 4EN3D 1FGVH 3OV6A 1UVQA 4HPOL 2ICCA 3NABL 2G5BB 3HLAB 3DUHA 5F6HJ 2D0GA 3DYPA 3QDGD 4Q9RH 5HYJD 2BCKA 4U1SA 4KRPD 4N8PA 1XF1A 1X5KA 4OFIA 3W39B 1AKJA 2IBZY 5FAAA 4HGKC 4PY8I 3MV7B 1LO3L 4IMKA 2D31B 1C16B 1XCQA 4Z78B 1F11A 2HTKD 2LE9A 4PBWD 4PJEF 3GHEL 1XR9B 3QNYA 2IH3B 2R0KH 3MNZA 1AO7A 2CUIA 2L7UA 3IJYA 3V0VA 2XWJA 1XIWC 3WSQH 3FKUS 3RIFF 4M6OL 4GH7B 4I0CC 1AY1H 4DOHB 2BOCA 5I1GL 4YX2L 5JHLH 4Y5XC 2XV6B 4J7RA 1LGVA 3MRGB 3UYPA 3RL2B 4ZUVA 4FQ1L 3FMGH 4B7IA 1HQRB 1OTSD 4NZTL 4PY8J 2V2WB 1Q94B 4P57A 3QRGL 1QSEA 4XH2A 3F7QA 4UQ2B 5CJXC 5C0CD 3SGJC 1RK1A 2MQCA 1U2CA 4AM0A 1N5AB 4AIXA 1OARH 1B2WH 1REIA 4YXLL 3T1FB 5C2BL 1MELA 1PBYA 3FO1A 1J1OH 1EPFA 5SX4I 4LQ1A 4X99A 3HMWH 5IB3B 1N64L 2P42B 4WHYH 4KKLD 4OLEA 3GUTB 4M1GH 1TVBA 5TF1L 3FN0L 4M93C 1VFAB 5JTWA 3ULVD 2R8SL 3THML 3QHTC 3T2QA 5LWYL 1MNUH 4HC1A 2H32B 1G0DA 3L3DB 3FCTA 4X6CE 3WCYA 1OAQH 4K9EC 1MY5A 5LKNA 2Y6SC 4YDLB 2YPKB 4UU9B 5IESH 4MWFA 3O81A 1IGFH 3VXME 5GHWH 1T66C 2CKBH 4FQLH 3QJHA 1KIPA 3GMLB 1R0AL 4K3DH 5ADOH 5JA8B 3MRDA 4ISVB 1I85A 4BKLB 4YJZL 1QLEL 1AR2A 1TZHB 3N1FC 3TN0B 3WUWA 2OK0H 1MRFH 4LVNB 2MKWA 1AGFA 4MA1C 4XAWL 2IPUK 4EUPA 2A6IB 4AIOA 4R4BA 1PVHA 3QO1A 5IEHB 4XVSL 1S9XB 2B1HH 2FYYA 3VXQA 2XN9E 3KPNB 3DROB 3ALPA 4PD4J 4KJYB 4QOKA 3W0WD 5C71A 3A0OA 2XQYG 1KEGH 3U82B 3L7EA 2YD2A 2VABA 1HEZA 2DS4A 4MJ6B 3QUXC 2XYCA 1ZHBB 3KYOB 4XTRC 1QR4A 3MOAH 1FPTL 2YSSB 4LSPH 4Z7VE 3TPUA 4HUUA 2LV4A 5CJOL 4KGJA 4L29B 5DS8A 1G7LA 2UZIH 4Z7OE 1NANH 4DN3L 25C8H 1J10A 5FUZH 4L9LC 2EO9A 2CK0L 4I77L 4JDVB 5DQJA 3O41A 4P46B 1HH9B 3S6CA 1K85A 1U8PA 1NMCB 4ZNEE 4JDZA 4E42A 2CDEA 3PG2A 4IHOB 1X4ZA 1UJ3A 1J86A 4UNVA 1TTUA 4YHKH 4PR5B 5GS0H 3EZJB 1TZGH 4GRWE 4DCQB 2DRUA 3NIGF 3P4OB 4MQ7B 3VFPA 5AG9A 2E7BA 3IDJB 1OOAA 1SBSL 2ZG3A 3VI3E 2E7HA 3JV6A 3MCLH 1FDLH 5GGUA 2UWEB 3M45A 3U7AA 4BZ2L 4U6YB 3T0EC 2AEQL 4YDVB 3VXNB 2HLFD 4K7FA 1NEUA 5ACLA 3LHPL 5DJCA 3FHAA 1WFOA 1IC5L 1JK8A 3L3KB 3LQZA 1FIGL 4NO2A 1JTTA 3HAEG 4I8DA 3P4MB 5D7IB 1G9MC 1LDSA 4TUKL 3NA9H 2DLFL 4APQD 2BSSA 4I18B 3GIVA 3SDDA 5C0GA 2DI7A 3IFPB 3EJZC 3ME0A 1IM9D 3O6KH 3Q3GB 3WS6A 5AZ2H 4W68A 4ELKA 2EXYD 3PGDA 4HWZA 1QSFB 4JM4L 1IMHC 1S78D 4PJGB 2VH5L 1P5VA 4HDIA 2P5WA 5HPMB 3QO0B 2Y72A 4OF7A 4ZNCD 4N0CC 3VI4E 4NBXB 2NNAB 4HXBL 1ZANL 5IHLB 3H2WA 1S7RA 2DLEA 5GRVK 3GMNB 5T33L 5IVZA 4DKEH 1G7JA 2HT3D 2HRPH 3QXDA 2Z31A 4R96B 3MLPA 2EIZA 3NCJH 2ZNWA 1HQ4A 4PRBA 3RL1B 3H9HB 3UPCA 2IADB 4I0PC 4N1EA 4JZOA 2NQCA 1YNTA 1DLFH 2PYEB 1BAFH 4CN1A 5TQ0H 1I4FB 4OLYH 1QFOA 4LHUG 5GIRB 1SJHB 4DTGH 1KG0B 3MBXH 3STZB 5IEKB 4HUVB 5F9AC 2ZSWB 3U9PL 4KUZL 5D5MF 4LGSB 2VLKE 4N90E 1T3FB 1AQKL 5C0DA 5AAMA 3UJTL 4ZAKC 2XFXA 2QL1A 1I3UA 4FZ8L 4JRXB 4ZFOB 3Q2CA 4Q7DA 3TT1H 4U1IB 1T20A 5F89A 1NMBL 5D7KD 3WFEL 5J6HB 3LEYH 1F97A 2OZ4L 4XNMB 1D5XB 1SHMA 2VQ1A 4IRZL 1I1AB 3IJSA 3MREA 1ES0A 5DGQA 2X89A 1RUQH 5BZWA 5I1KH 4IOIA 4PJBA 1D5BA 4ZFGL 1W72A 4P2QB 1WWAX 3TNNA 1CE6B 4P59L 5GZOC 3SCMA 3BKMH 1RI8A 3C8KA 4KVCL 5SWZE 2ICWI 4KK5C 3RTQD 4UOW1 4OLWL 1WFTA 1P1ZA 1M7DA 1UKSA 3G5YB 4LGPB 1Y18A 1BQHA 4LLQA 4XP1L 2UYLB 3KS0H 5C6PB 5L2JA 4JKLA 2AXHA 1OWRM 4U1HA 3BN3B 4CN6A 3NVQA 2WBJA 1L7IH 2ZUQB 5GS2D 2I9TB 5T3ZL 1KCSH 4U6HA 4LSSL 4LSUL 1NBYA 4ZQKA 1X5XA 4RDQG 5IROA 2WBKA 3R4DA 3PP4L 2W0PA 4ZG1A 5KAQG 5EOQL 1J18A 4HWBL 5DR5L 3F5WB 3X11B 4DN4H 1VGEH 4J1UB 3CFEB 4Z0BL 4QRUB 2ICWJ 3O0RH 3VFGL 5HVFB 4GXVL 4P2OB 4PJFB 4FQXD 2X09A 2Z93B 4NBYB 2B7DT 4WO4D 4XPTL 1DEDA 1FYTE 3Q1SL 3T0EE 1G84A 4CUCA 2IEPA 3GJFB 1DQJB 4EDWH 4LLUB 2YKLH 4XBPA 2EH8H 1AIFB 3BXNB 2FNBA 5D2NC 4QHLB 2D3VA 1CGSH 4YZFE 1HIML 1C5CL 4LVOB 3G5VA 2MHAB 4M3JA 4NC2B 1U93A 1E6OH 1K6QH 4MD4B 2M8XA 4KRLB 3IFOA 3WUWG 1MAKA 4YLQT 3UROR 3LN5A 1ROWA 3K4AA 1G7QA 5I75C 5CD5D 2DQUH 1FG2A 1TLKA 4OD2A 1OW0A 4ZTPL 2FCBA 1BOGB 3L5IA 2R0ZL 4XNQB 1MHPL 5CBEB 3KJ4B 2XG5A 2EC8A 1U3HC 4XI5C 4EI5A 3VGFA 4B41A 5TQ2L 4PJAF 4XHJC 2KQMA 2ADFH 3CK0H 3QIUC 4YGVB 4YXHH 43C9A 3V2AR 2G75B 4OAWB 4O2FB 2AJVH 4RMUA 2DQFB 3HMXL 3VWJA 1RULH 4GW1B 1FNGA 3QI9C 1DQTA 2NY4D 3N06B 4ZUSA 4PJCF 4GW5B 3P0GB 4LCWE 4LNVA 1RIVL 4HUMB 1YC7A 3V0WL 4HBCL 2E6JA 3OMZA 4BH7B 5E56A 1E4XI 1JYWA 5L8JB 4JFFA 4LPCA 4NNXB 2DDQH 2YUXA 4RBPH 1HI6A 3OR6A 4UUJA 3GBML 1T83C 2QLVB 4QTHA 4PJ8A 3VXSE 4JQVA 1W2KT 3RKDC 5C0NC 1RZ8B 5KZCD 2BK8A 5I6XB 4PLNC 1QRKA 5FDWA 4OIIH 2VLJD 4X83A 4O2CB 3DUSA 4ZFFB 3HE6A 1NKOA 4BQ8A 5FYJE 1ZS8A 2HJKB 3BGFB 3E8UH 4LKCA 4HK0B 4X6CA 2ZZUT 3OB8A 4ZYKA 4OM1L 3CU1A 4NQED 4IMLB 4NRZB 5C0IB 2MCG1 2AAVA 3VXMA 1OPGL 3G08B 2X4UA 4PJ7F 4OCXH 2R4SL 1MIML 3BPOB 4U3CA 2X4TB 5D9SA 4RFOL 3EOTH 3BEWB 1EO5A 5C0AB 4IJ3C 5GS1C 15C8L 3TC9A 1IBGL 2FBOJ 4XC3H 5F3BB 3PWNA 3OKNB 5ICZA 2DBJA 4OJFH 2J6EL 2Y7QA 2XN9A 4U4BA 2X9XA 5C08D 1A6UH 5E8NA 3KYKH 1CD0A 3MTRA 1RIUH 5BOZG 3WJJC 3U9UA 2GT9A 1EFXB 5JPNA 2VJXA 5D2NE 3TYGL 1WBZA 4OKVB 3LKOA 3BZ4A 5FYLH 3W81A 4Z7VA 3S5LA 2ATPB 4TSCL 1PJ9A 1OP9A 1RZ7L 3UDWC 3WUZA 1I3RB 3ZE2F 3GO1L 2WV3A 4BFIB 3TBSA 4MXVE 5IJKC 5J8OA 1I9IL 2XG4A 4Y2DD 1F4XL 2JB5L 4NO3A 4XP6L 5CBAB 3MRLB 3G6JA 1FNHA 3TJEH 4ZNEA 4ZUUA 1CBVL 5J12B 4NKQB 4F57L 3NAAH 3IDXH 1X5AA 3SKMA 3QEHB 5FUOL 2XY2A 2G2RB 1E0OB 1OSZB 2DKSA 1N4XL 3MLTA 5GZND 1YMMA 2X10A 3C60D 1CIUA 3W5NA 3FB7B 3T65A 3RGVD 5DHYA 1WSST 3UYRL 1F6AA 4Y7MA 5JXAH 4U33A 1KACB 1ZEAH 1RZJL 4J23A 1XIWA 5KG9B 1Q9OA 2R2CA 5IVXE 1CZ8H 5ID0A 4EI6B 2FH8A 1RJZB 5L9DL 4Y5XA 4MAUH 2HLAB 1B3JA 4JQXC 3HG1D 4X8JA 5C0JB 2EDBA 3UTTE 3OR7B 1UXWA 5KJRH 2F19H 2GUOA 1CDJA 5E2WH 4MS8C 4Y4FA 4PJ5E 4R0LB 1OP5K 1OAKL 4YHYB 5CJXA 3V6ZA 5DDHB 3QIWB 3NFSH 3PWJB 1OQXA 1FNSH 3GM8A 5IW1A 1MI5D 3GM0A 5LGHH 4BYHA 2CDFB 4O58L 1J0ZA 2DM2A 2GW5A 2XZZA 2CMRH 2CSPA 3QCTH 5J3HD 2CUHA 3WJLC 3O6FA 1NFDB 1IGML 2EDXA 4IIQB 1Z0MA 1NGZB 4KRPC 2P7TA 2GEEA 4XXDB 5HHVL 1MRDH 1FE8L 3BW9A 4WW2C 4LLVB 4GQPH 1RUPL 3R06B 3S37X 1JHTA 3GIZH 4DVRL 4W81A 4E41E 1NCCH 4RSVA 3ZTJH 3BH8A 5D7LE 3U0PA 1HYSD 4K94L 2NMSA 3KR3L 4MQSB 3V5KB 1JGVL 4L4VB 1KC5L 5T5NG 4JPWH 4RFEA 4TSBH 4UDUA 3X12B 3QPXH 2VLKA 2X4PB 5E2TL 5EZIH 2DKUA 1FFPA 1OL0A 3FFCB 3ILPA 1B0RB 4LLDA 2R2BB 4PGCB 3NFNB 5FM4A 1EJOL 4X7FC 1OTSC 2VISA 1S5HA 5EUKA 5DK0A 3VH8B 3TVMB 4PJHB 3V6FA 1K4DA 2AXGA 1WC7A 5CZXD 1N5YH 3BIKB 3TPKA 3SOBH 3PQYB 1E4XL 3IFLH 2J5LB 1ZLVH 3QUXA 4XT1C 2CLZA 5C09D 2WIIA 2YPVH 3KYAA 3IDIB 4XRCA 1U8LA 2IWGA 4KKBD 5E03A 2BDNL 5SWZA 3EAKA 2B0SH 4WEBH 2AJSL 5FCUL 3HPJA 3HZKA 1F42A 1Y6NR 3TYFB 3ULVC 1MCOH 2ITDA 4ONFH 1AHWA 1CTNA 1FNEB 2DMKA 2C3VB 5DUBB 5C07B 4H0GA 4MB3A 4WFHD 1T1XB 3DVIA 1UCBH 3A6BH 3NH7L 3IDYC 4KTEH 1P9MC 3S36H 1P7QB 2F54D 1CG9B 2JELH 4HIHB 3CFDA 4LNRB 4EIZC 3S37H 3BRFA 3UC0L 4MJ5B 3PDOB 5L88H 5DJDA 1F2QA 2DAVA 4JFZL 1FYTA 2I60L 1RZFH 4XVTL 5DJ6A 4LLWA 4G8EB 5DMJB 1XGRB 3WE6A 3QDHA 1J1OL 4Y16A 1QBLH 1W0WA 4XCYA 4P99A 3L3OB 3HC3L 4F7MB 4X6BA 3HNTH 4TVSa 3QHZH 2J12B 4QRTA 1JTPA 3MR9A 5D1XD 4PY7A 1A4JB 4X0KA 5BV7L 1X3DA 4KJPD 3O8XB 3MFFA 4JKPH 5F6IC 5F7NC 4NFCA 1J1XL 1HHKB 2IPUG 1L6ZA 1CFSA 3GJFK 2BMKB 1DDHA 1DQMH 4LL9A 1LVEA 5F1NA 1JPGB 1PLGH 5C0FB 1FFQA 1JPSL 3ARGD 5SWSD 2Z4QB 3L6FA 3QDGE 4YXKH 1PZ5B 5BRZB 3B83A 1AGDA 1F3DJ 4X6EA 1B0GA 2X4NB 3QAZB 4M1DH 1TTGA 3KS0J 4N0YL 4U3HA 4YHZH 1MCHA 3ARFB 2DQGH 3I6LD 1CICB 1X7QB 3V4PL 5ADPL 4WU5A 3VFMA 3UPRA 2R23B 3QNZA 2BY0A 3D39A 4PJBF 3RWCA 3LSOA 1MHCA 2XZAH 2MPAL 5GJTH 2PYFB 3H7LA 1LK3L 2G9HB 4GJTB 1YEFL 5I66A 2NLJA 4GFTB 2H2PD 3VU2A 2DB8A 1AD0B 3OKYA 4M03A 5A3ID 3PL6B 4XGZA 5LQBL 2J8UE 1A7OH 4P4RA 3ZT6A 2ADGA 3GSNL 1TIUA 3PDDA 4HJ0C 3VXSA 2BRQA 4MNQD 4P4KD 1ZKAA 3DURA 1IZKA 4PLJC 5C0CE 2DQDH 2DI9A 3H42L 3LS5L 3MLXL 4DZ8B 1ZGLM 3WEXA 2APFA 2R1XA 3VFTB 1F4YH 1NEZB 2NX5D 4NKIL 2A74B 1EGJH 1AP2B 3K4ZA 4XP5H 4BK5A 4HW6A 1FDLL 2WLZA 4KQ3H 3SO3B 3KPSB 4FQPA 3ULVE 4JZJB 5C92A 1XGQA 4G8GB 1VFMA 1FO0B 3MRQA 3PHOA 3L95B 1DVFB 5KVFL 1P69B 3D6GA 5GRXG 2OL3L 1SJXA 2YPLB 1YEHH 4MSWB 5DJXB 4QYOA 2VTFA 1JN6A 4Z77B 1R24A 3FOLA 1U9KA 3QRFM 3O6KL 5GGRA 4HUWA 3EDKA 4YAQB 1S7WA 2XTJD 2JLLA 5T5NF 1A3QA 4FTVD 4M7KL 2VE6A 1KF9B 3L5HA 4MZ2A 5HGBA 1LP9B 1I1YA 1KJMB 1FO0H 4LU5H 4M43H 3PIQA 1U58B 4HH9A 4HWNA 3M8OL 2DJUA 5J1SC 7CGTA 4N5ED 3WFBH 8CGTA 1R3LB 3OG4B 4NQSA 3KJ6L 4L8SB 1AFVL 3B43A 4ZUTB 3LKSA 2NYYD 5AWNH 4OZFH 1YECH 3JWDC 1BGXL 4JRYE 3RTQC 1DLFL 1BAFL 1KIRB 5EOCJ 1X5IA 3SN6N 4PB0H 4PB9H 4UQ3A 4RMWA 1S8DB 3T4YB 3C08L 2VXTL 3WXWH 4JO1H 4PRID 5DVMA 3VMNA 1LO4L 5I8OL 2ADJB 2W9DL 1DN0A 4Y4KB 3BO8A 4G3YL 1ZT7B 3GRWH 1Y0LA 1MCJA 2K7QA 5GRWA 1J5OH 1EHAA 4LCIH 5F7EL 4NO0A 3QXAB 3ARDC 4IDLA 3BRDA 5GS0D 3V7AG 1I3VA 3KHOA 1N3NB 1L9MA 1YPZE 3OF6D 5C6TH 1HHGB 3B6SB 5IMMB 3QI9A 3AC0A 4HUXB 1NGWB 4WO4C 3ARYA 3W9EB 1ETZA 4RNRB 5I1KL 3OJVC 3UTTA 1KB5A 2Z9TA 4PJ9D 3V4VH 3JV4B 1XR8B 3MROA 3ARRA 4Y4HD 4X6CF 3BKML 3VDCA 1A9EB 4PJ5A 5F7DA 2EZ0D 1CR9H 2BZDA 1FN4B 5IP4A 2RGSA 4LOUC 1OAZL 2YXMA 3JUZA 4J3VA 3VRLE 4XPHL 1T89C 4XCEA 1A47A 4UMGA 4YWGL 1OB1B 4GAYB 1T83A 4O02H 2A6DA 4G9FD 4HKBB 3SGEI 3MRFB 3B5HA 4I13B 1I8LC 1S7QB 1RMFL 3MRRB 1KB9K 2ZCLH 4XWGL 3BWAA 4D9LL 1GGYA 2UUDK 4U1JA 4LCCC 5TH2A 1AI1L 3O11A 5CD5C 5EU4B 5C7XH 5I1IL 2IFGA 5B39B 2ICWB 5IMLA 3ZTNL 3RI5F 3IETA 4X9IA 5EO1A 4N8VA 5D6CB 4E41A 1F3JA 4M6NL 2ORBL 5FM8A 2Q8AH 3MLVH 1ERNA 4MD5A 3CVHB 4NRYA 4NN7C 4NKOA 4KK8D 1TJGL 1YMHB 4GBXD 4C83A 5SWQB 4H20L 5GGSA 3G04B 4W70A 1JBJA 3GGWA 3WDHA 4EDWL 3IXAB 4G5ZH 4Z7VF 3KNBA 1UJTA 3GI9H 5GS1A 5DURD 4D3CH 1T1WA 4X6DA 4Z7OF 5FEBA 1F6FB 4XPAH 3IS1X 4ERSH 2Y36H 2NY4C 3L1OL 3ARED 4BFEA 3GDBA 1DP0A 4XCCH 2OR7A 5D71H 1WGOA 3G6JF 1JF1B 3V0AC 3CVHH 4LBEB 2Q76A 3BGMB 3ULUH 4GMTH 2RHEA 2C4FT 1CFVH 2NY5L 2IH1B 2IAMD 3QQ3B 2NY6B 3K4DA 4FOMA 4OCNC 4ZO8A 3UDWA 3VI3F 2V2TA 1IEAA 1YA5A 5D1QB 2FJGB 3JWOH 1NGQL 5IJKA 3L3HA 5I71B 1CWVA 2R0WL 1CGXA 2CUMA 3AAZA 4KMQA 1EEYB 2VDQH 5FHBL 5D2LB 1NFIB 2CD0A 5CMAA 1PKQE 2DM4A 4YK4C 1ORSB 3WFCL 3CFJA 1XGUA 5D7JD 1DUZA 4U1MA 2H45A 1TETL 4K8RH 1CDBA 3GMQA 4M9PA 2X41A 2L7JA 3VCLB 4MLIA 1B90A 3RKPA 4MNHA 3WFDH 1K3ZA 4WWKB 4Y5YC 2KBGA 4PS4H 4N9GA 3QQ9C 5E2JA 3VI4F 1UA6L 2DDQL 2XZQL 3REVB 4MAYB 3O6LL 4NQXA 1GGBH 5J6GB 4LSRH 2N7BA 3C5ZA 3KLAA 2FECI 4U7KA 3UTQA 1U3ZA 4IDJH 4G7VL 3B8SA 4JQXA 5EOCL 3EYOB 1JGEA 3X3FH 1H15B 3V79C 3K1KC 2MOVA 1CT8B 5HHQB 4U1LB 2R69H 1WUNT 4KKCD 1FL5B 3AS2A 3MLYH 3IVKA 1EX0A 1TPXB 1JPTL 2QEJA 2VAJA 3G5ZA 4J12A 2VITB 3GSXB 3RY4A 4EN3A 5HDOA 4B7LA 4R4ND 4JFEB 2V17H 3EYSL 4NN6C 3WJLA 2V5TA 3QDGA 1A6WH 5HYJA 1G9NC 3IJHA 2BERA 1C12A 5FYKU 1I7TB 3IGAB 3KXFB 5J9PB 2RCSL 4WW2A 5I19L 1Q8MA 3P77B 3PV6B 1QFUH 4HAGA 5LGJB 3KYKL 4XZUB 4X5XB 1TVHA 3RGVC 1DZBA 2SEBA 1B0WA 1UZ8B 1LNUA 2VIRB 4TN9A 3MGAA 3SE9H 3OAZH 3RHWF 1MAJA 4YNYB 1JUFB 5C0EB 4QRRB 5HVHC 1U95B 5I1CL 4F7CB 1MWAA 1XF2A 5A2LH 3V5HA 1RV6X 3U7WL 3QUYB 1CLYL 3MV11 4X6FB 4XNZC 2J8UA 1JHKH 4UB0H 1MVUB 1YEKL 1ACYL 5JW3H 5EBLA 4PRAA 1KT2B 3QEQB 1RJLA 4WU7A 1T7XA 5LVEA 3ZKXC 3TJEL 5C0CA 1PY4A 2ZOKB 5IK3A 3UAJC 5BV7B 4JB9H 1U2HA 1P4BL 3RZCB 1JNNL 1MEXL 4YE4L 3NZ8A 2GSGA 1LO2L 5FYJU 2IQ9L 1A6AA 2VLJE 3NA4A 4GMSH 3IKKA 3GJEB 1JNLL 5ILTH 3ES6B 4BZ1L 3MV9D 2APWA 4OGAD 5DJAA 4ODSH 4NZUH 1ZEAL 4YHPB 4PRNB 1A3RH 4M5YH 4YZFF 5JNYB 4N0UB 5EU7C 3IXTB 4G43A 4NQEE 2QSCL 3SE4C 1WISA 2XRAL 4PGEB 3LKQB 4X7EC 4ZXBB 1VFUA 3TV3H 4LHQB 4EOWH 1OTTD 1OTUC 4M7JH 1P9MA 4JAMB 1HYSC 1HOCB 1QLFA 2GY5A 3BH9A 4GG6B 5KJRL 5CD3A 3VXOB 5MP6H 5CEZL 4LSVH 3QWOA 4OT1H 3D0LA 3DVNA 3KHQA 4X80H 1EHLH 4N8VG 5B3JF 3AUVA 1CD1A 1RU9H 4ZO9A 3HFML 1CGYA 1QSVA 4ZTOH 1ZTXH 3GSNB 4FQ2H 3W0WA 2XWBB 3NIDE 3OAYH 5CZXC 2DI8A 3R8BB 5HD8C 2DTMH 5AYUH 4MQXD 1FQ9C 3UTZB 4RGNB 4C55A 3HRZB 4XX1G 4ZUWA 4OV5B 3W82A 5HVWA 1AGCB 5E8PA 4KKBC 2ITCB 4JN1H 3SE8L 1KULA 1ND0B 4CRPA 5DQ9B 4M8VA 5FOBB 1UKTA 1CTOA 5DUPH 1URLA 3SGDI 3VE0A 3WV0A 4PUBH 3LPWA 4K3EH 4MHHI 1KN4H 2NY3B 4TVPL 1ONQB 3TCXA 3TM6A 1KN2L 4XBEH 3O4OB 3VGBA 3HR5A 4JPIA 1X5ZA 4AMKL 1LO0H 1OP3H 4HJJH 3P0VL 2FATL 4OCMC 1EDQA 5I1JL 3RWJA 1YPZA 3ECBA 3RNQB 4OM0H 1DE4B 3WHXA 4J4PD 2O61B 3RUGE 1QVOA 5IQ9A 5MEQA 1A14H 3FTGB 1T7ZA 1IC7L 2EIDA 3SGKC 5DEFA 1A5FL 2XA3A 4DUVA 1GVIA 2A1WL 3C2AL 2BOBA 4F58L 1F13A 5F8QC 5ABDE 1B88A 2D7OA 2OMNA 4MDIA 3HG1E 1S7VB 2WK2A 3BQUB 4APQA 5HYQA 2FECL 3OTTA 3HNVL 2VAAB 2B0SL 3BKJL 2KKQA 4DFHA 5JUEH 1L7TH 1IM9A 1INDH 2XI9A 1MCOL 4NUGH 3OJDB 4NHUB 5GQBA 4HLJA 2V9QA 5D1XC 3RRQA 1G6RA 5DRXA 4RA0C 2VDPL 5D6DC 1BJ1J 1MI5E 3LQAC 3VG9B 3ZKNC 3MOBH 4OZHB 4KTEL 5HVGB 5L2KB 3GSRB 4JG1L 3D3VD 5IKCB 3ARGC 2JELL 3H3PH 1MAML 2VXUH 4HKZA 3I3BA 2NZ9D 5ITFA 5L88L 5KN5B 2YD1A 4Z95L 3PABA 4C57C 5CJBA 4F33B 1KJ3H 2H9GB 4OCSL 5EU7E 1QBLL 5BS0B 4LASH 4R90L 4MXVF 4RX4D 1QQDB 1KLGA 1E4KC 3G6DH 1D7FA 2CDGA 3R0MA 5BVJA 3HC4H 5CGYC 5I76A 1CQYA 1NUGA 4UV4H 2H2PC 3DVGB 3D0VB 4TVPD 5DUMH 3ROLB 5KSAD 5ICXA 4I2XB 2H3NA 2HFFB 2H8PA 4I5BA 1U92A 4R4FL 1ZT4A 1DBJL 4M6AA 3SDXE 3FT4B 2DBLH 3ET9F 3UPAA 1QA9A 2HKHH 3NFPA 5ELIA 3AFLA 4JGMA 4RGOH 3UZQA 5I15L 2Y5TA 4PREB 1MCEA 3MJGX 2VDMH 5F7YC 3F8UB 1FZMB 2QR0B 4LEXH 5H35B 5GISH 2J88H 3IKCA 2CJUH 5C09E 3OGOE 1ZLUK 2M26A 5KSBE 2DQGL 4EQ2A 3HN3A 3HCVA 3RTQA 3RWGA 3UP1A 3LEVH 3EYUH 5IF0B 3LV3B 3KPPB 3BIAX 5IMKA 1A1OB 2EDEA 5D1ZD 1HHIB 3K8KA 3LS4H 5C3LD 4CVZA 1MFAH 2HWZH 4XPFL 3CD4A 1UT9A 4L9DA 4F37K 4Z7NE 5T1MA 2R39A 1JF6A 1D9KB 1BBJA 1I9RH 4JHWH 4TNVK 3LKNB 1GHFL 4M3KB 2W9EH 1YYLL 2GSIB 5KVMC 2J8OA 2Q86A 1U8OA 4DEPC 2XTJC 3OB0H 4FQXA 4YR6B 5ISZD 4WO4A 4D9RE 4JHBA 4NNYB 4N1CA 3VXUD 2H1PH 2OJZL 3LRGA 2BJML 3ILQD 2CO7B 4YDLC 3C6LB 3WIIH 2HT2D 3MXVH 4OUUA 4N5EC 1RUMH 2QSVA 3LOWA 5DK2B 1MFEH 3O9WB 2A6KB 2NYYC 3STLB 2P1YA 3IT8D 5ALCH 1CLOL 2VXSL 3RU8H 2EE2A 3OXRA 3TO4B 4MCYA 2VNCA 4LCCA 2XWTB 3OKLA 2HAZA 2FIKB 1NPUA 1HDMA 1SMOA 4P23D 5A2KH 1BEYH 3SKNB 1TQBB 4NJ9H 3D85B 3VFNB 1H3PL 2BSRB 2JCCB 5SWSE 2FSEB 3LN9A 5EUOE 3VFUA 5F7KC 2DL2A 5ICYA 5IT2H 2WUCH 4WCYH 3I6LE 1KFAL 5DMGC 4X4ME 4M1CD 2ESVD 4YDJB 4G6MH 5GS0C 4ELME 5L6YH 1UWEL 4LRIA 3GB7B 3E6FB 3TBVA 5E08L 3CDFA 2CIIB 1LE5A 5IIEA 3REWA 1GH7A 1AGEB 3FO0L 1H8SA 5FA4B 4P46C 5E2UL 4PJ9C 5IW6A 1ACZA 3WYRA 1G0YR 4Y4HC 3QXWA 3MLRL 5BRZD 3O4LB 5FHAH 4GLRH 2EZ0C 4FRWA 3CLEH 3QHFH 3NPZB 5E70A 1AJ7L 3VFOA 1FBIL 1YEEH 5DMYA 3CX5J 3MV7E 2HVKA 4F3FB 2JF1A 4JO1L 1A0QH 4HWBA 2D9CA 1F90H 4LIQL 1F8TL 5H94B 4JO2H 3R1GH 2AK4B 3MLZL 4DGVH 5BJTA 4L3CA 3RX7A 1YEDA 2CGRH 5E4EB 2VLJA 3IDNA 3TJHD 3V6OC 3DO7A 1K5NB 1BHGA 3S35X 2NX5E 2IALA 3W9DA 1WZLA 2YRZA 2ID5A 3J7HA 5IHUH 5DMIH 3H9SD 2X4QB 4NQEA 4F7TB 5ACZA 2GJ6B 2GJZA 5EBGA 3NN8B 2IPKB 1GZQB 3HI5L 3QFJB 4JZNB 3U2SA 5MEOB 1MRCL 1D5MB 2AJYL 1CXHA 5IW3A 1IKFH 2X4OA 4Y5YA 4PTTB 4PGDB 4OLVL 2C26A 1X4YA 5DRNA 2AJZB 1VKXA 1GC1H 3AREC 3L3JA 4PJEB 4OGYH 1UB6B 4KTYA 4P9HL 4XNUL 5F1SA 3BT2H 5C08A 1X6LA 2XTJE 4L5FH 1HSBB 5HI3D 4FTVE 1CI5A 1KJ2H 4X5WB 1T1YB 1KNOA 1A7NH 1RZGA 4OLUH 5DRWA 5F7UA 3O3DB 1ED3A 4WW2F 3QG6A 1KTKE 3QH3A 3SPVB 1GSMA 4HIIB 1EO8H 3MJ8A 3QEGL 4RISL 2GFBA 5CJ8A 4Q74A 2XQBH 4TUOB 2JK5B 1Z9SA 3QP3A 4GUPA 4RZCB 4RFNB 1QHPA 1JZ4A 12E8L 5IVNA 4Y2DA 4OF3A 1X4XA 3QBTB 2YS4A 1IGJB 4H25A 4K07A 2KH2B 1FLTX 1A2YB 1KEML 1H3VA 5HXMA 4MX7B 5D7JC 1YC8A 3OKEA 1O7SA 2VSDA 1PAMA 2J8UF 1BBDH 2X4RB 3EO9L 1IGYA 5MERB 5B38B 4PRIE 4E0RA 3DHJA 3DX9A 4ERSL 5A43C 2Y36L 1FSKB 4QCIA 4Y5VB 5HHOD 3S35H 5D71L 3VXRB 4IRJB 3DGGA 1I1AC 3C60A 5DJ2A 2YMXH 1Q9KA 1KYOJ 5IG7B 4ORGB 3RGVA 4NM8L 5HGHB 3RUGA 1CFVL 5JW5A 1BJ8A 5F71A 3SJVB 4LSTH 4OCYL 3LH2L 1JPST 3S3SA 3Q5YA 5BXFB 3QWQB 3KYMA 3EYVB 4LSDA 4C4KO 3HG1A 1E28B 1NC4D 3ULVF 3CNKA 1JNHA 5HYFA 3ARSA 1W8NA 5GGVL 2ZUQC 3DV4A 3HE7D 1ZAGA 2ZP0T 4E9LA 1KTRL 1NCAL 3LIZL 1S7TA 1LDPL 4KUCD 3BPCA 5LAXA 3RBGA 5I74B 1MI5A 5B22A 3T09A 4R4NC 2WZPD 2DD8H 4ZPTB 3DYOA 3TO2A 3P73B 3MUZ1 2GITB 5HHNB 4P2OC 1MOEA 2B1AL 2P5ED 5B8CB 4H1LB 3V6OE 4HIEB 4XC1H 2VZVA 3FZUC 1A7RL 1NMAL 4KRNA 1BZ7B 2AQ1A 5F3HA 1NCWH 3PJSB 2R9HD 5JO5B 4LVOC 3MBED 1U8NA 1FV1B 2P45B 2DWDA 1CDCA 5CUSH 1T2JA 1U8HB 1WWWX 5IFAH 1CXIA 2F8VA 4X4XA 3GMOB 4PV9A 4QHUA 5KSUA 3FT3B 4K7PX 3FQWA 5LBSH 2BVTA 4IRSB 4O00A 2ED9A 2DQEL 5TDNA 4S11A 4YUEL 1A3LL 1I7UA 2C1OB 4Z5RA 4PPTA 3SDXA 5JR1H 3A6OA 3KJ4C 1M4KA 2Z0BA 5CHNA 4X7TA 3MRPA 4LLYB 2ZSVA 1NCUA 4NZRH 5E5RB 1QSZA 3RDTB 2DLIA 3KPMB 4ALAH 4NQDD 1S9YB 5GRJL 1A6WL 1Q9WB 1A7PH 1JZ2A 1KCRL 1QR1B 3ULUD 4HS6A 1MCSA 3T3PE 3FQUA 1P5UA 3RZWA 5C09A 5T3XL 3T77B 5KSBA 2HJFB 5FO8B 5JDSB 3QCVH 2AABL 4XP4L 3NCMA 1YPZF 1J87A 3CSYB 3CCHA 3C5SB 2A77H 3QDJB 1PYWB 2RIKA 3FFDB 3SDAD 4U0QB 5F1IA 1NJ9A 5GXBB 4OGAC 3FQTB 1FGNH 4P5KB 3SE9L 1A7QL 2W0FB 3QQNA 4PJXE 4HUKB 5K9QI 3VRIA 5HGDA 3GEWB 1G7MA 3TIDA 3VRLF 5GJSH 5E5MB 3B2UC 4GKNB 1LK2A 5EBWA 2ADIA 1CU4H 4HS8H 4KK9D 1I8MA 5DSCB 4UB0L 2BXZA 2F54A 3MRHA 4Q6IC 1WEJL 1OAUH 1BVKA 3RPIB 2J1KA 2EYRB 1WBYB 5CIPH 2YC1A 1UWGH 1NUDA 1OSPH 2WSKA 3WKML 2EIBA 3BGFC 5TE6L 2CK2A 2GK2A 4WFGE 4MDJA 4K7PH 4L3ED 3OL2A 5E4IA 1UEYA 4HEME 5TDPA 1WZ1H 4KV5E 3GI8H 1NAMB 4R2GB 5HDBE 4OD3H 4MQXC 2LTQB 4JM2B 2DQTL 2J2ZA 1EXUB 1R3HA 5F44A 4C56B 1HZHL 3KLHD 3BPOC 3RBSA 1EK3A 3EYQC 1IEBB 5ESVA 1RHFA 4WWKD 5F88B 2R2HA 4CMHC 1NEZG 4HFWA 5D1XA 3MRKA 5I73C 1DLHA 1IVLA 3FB8A 1H0DA 5HBBA 5CP7A 4EOWL 5D6DA 3UCRA 2Y4SA 3C09C 2BY3A 3ARGA 5SWSA 2F8OA 5EU5A 6CGTA 1NAMH 5IHZA 5E8EA 3TNMB 4H26A 3EO0B 1X5YA 3WIHH 4M7LH 1RHHA 1SYSA 2XNAB 4L8BB 2FGWH 4X4MA 4X4YA 3SDYH 1RU9L 3AS0A 4M5ZH 1T04B 1BPVA 1HXMB 5C6WH 5JHDB 4J3UA 2WP3O 3CLFL 4UIMB 3EKCA 4UILH 4FQ2L 1KPVA 4W6XB 1IQWH 2FB4H 4J4PC 4TNWF 1FFNB 1RZKL 4PLKD 3VD4A 5CEYA 1MREH 5SX5H 1T21A 4GSDH 4WHTB 3VG0L 5J12C 4JHZA 3CH8A 3JZ7A 2F74A 3RY5A 2WUBH 4JN1L 4L4TB 1JRHH 1K2DA 1LEGB 3CXDL 3UO1L 4S1RH 8FABA 2Q6WB 5HHPA 4JVUA 1G6VK 2A6JB 1W72L 3I9GH 4LAQH 3IAQA 4HEPG 4MNQA 4P4KA 1MJ7H 2WANA 5E6ID 4U1NB 4G8FB 5DFTA 3BP6B 5I1LB 5F7FA 4TRPL 1NDMA 1P4LB 3MRJA 5CP3A 1R3KA 3GBNH 4JEGB 5IFHH 2NX5A 2QTEA 2PTTA 1A6TB 1X5HA 2G60H 4JPKH 1EAPB 4QT5B 1L9NA 2MSPA 2AKRA 1IGTA 4FQCL 1ZVSB 2RB8A 3MV9E 5EOTB 1VB9A 2IFFH 5I1EH 1RUKH 4PRDA 1GXEA 1FVCA 3MODH 2UV3A 5D96B 4PV8A 1DSFL 1VERA 4YHYC 4KAQH 4I48B 3P11H 1WFNA 2HT4D 4RMSA 1MIEH 4WUUB 2PW1A 2CKBA 4YHOL 4PJAB 5CJQH 1JI1A 2VDKH 4ZS6C 2EDDA 1C1EH 4NUJA 4K3JH 4LCUA 5KSAC 4ZMAT 3BPNB 4FTVA 3H0TA 2F53B 1VFAA 3CH1A 3EOAA 3P30H 5EA0H 2X7LA 2IG2H 3RY6A 3VWKB 4G6FD 2EH7H 1MJJA 35C8L 3B2VL 3RWIB 5CLWA 3CGTA 1FORH 1ZGLA 5TGBB 1MF2L 1QRND 1KCVH 4PJIE 1ZSDB 3PHQA 3CFKA 4POZD 1EZVX 2FX7H 4U1GC 4AEEA 5IQ7H 4KTDH 2LABA 4BSWB 3OKOA 1OGAB 3CFCH 5KANI 4E5XA 3T4AA 5B39G 1B6DA 3HAEB 1DBAL 5FYLE 5A16B 5E7FA 5IBTL 4LF3B 5INCA 4OLZH 4PP2B 2D03H 1Q72L 3FO9A 4UV7H 1I9JH 1TITA 1TJHH 5LXGH 5D1ZC 1QO3A 4PRIA 3GMPB 4FQQB 2A2QT 5BVPL 4AIZB 2EDYA 4RWYH 4WGVB 4OB5H 1T1ZB 3TVMC 2C7UB 3WO4C 1VEPA 4YHIA 3EYFB 4MGXA 2EC9T 1JI2A 4OLXH 4JR9L 4FXGA 4NWUL 2EDTA 2Q7YA 3R0NA 1BREA 2GYSA 2J5LC 5E94A 4AEHH 4HKJA 3HAEH 2QKIA 2DBLL 2BVOA 2X70B 5EZOH 5I1DB 1QKZH 4G7YL 3CFIC 2Q3ZA 3OF6A 4QEGA 2QQKL 4PJ7B 2FWOB 2NY7H 1N7MH 2IPTL 2E9WA 2NXZD 3MXWL 2Y25A 4NYLB 3SQOH 4HJGB 5ITBH 3NPSB 4PJ9A 2C3WA 3DXAD 3LN4B 4Y19B 1XF5B 4Y4HA 3ILQC 5DWUH 1DQDL 4LHUB 4OF5A 1QYGL 2FL5A 3EYUL 2VDRH 1UVQB 5E1AA 2APXA 2X9YA 1KENL 4X8XA 5KBNC 5L7XL 4G9FA 2MMXA 2BCKB 4U1SB 1G7HA 4OFKA 3IDMA 1XMWA 1AKJB 1A6VL 3NCBB 4NP4H 4WNQA 4ZO6A 4JPVL 3FONA 1XCQB 4P23C 1F11B 4GAGL 1YZZA 1I9RL 3QNYB 1IGCL 3HTLX 3MNZB 1AO7B 3D3VE 5J0BA 2NY2B 2LU4A 3U7YH 4OFPA 3PGFL 3IJYB 2HFEA 3NIDF 3CVIH 3V0VB 2XWJB 3MLWH 4BQ9A 5IVOA 1IEHA 4GBXA 4I0KA 2BOCB 2O5YH 2VZUA 4M1CC 1VADA 2I5YL 4ZUVB 2ZCHH 1FL3A 4XMPH 3O8XC 1UM6L 1JGLH 3DMMD 3AREA 3QUZB 4P57B 2D7PA 4NKMA 1QSEB 4XH2B 2AJXL 1RK1B 2AV7A 4AM0B 3F7VA 2DQHL 3ARWA 2VRAA 2YR3A 4M7ZB 3FO1B 3RFZC 5DC0A 2NY1D 3QXTA 2IAMA 4H0IA 4X99B 2YBRA 1CICC 4PG2C 2EDQA 2FHCA 3S34H 3LPFA 3GSOA 2R0LL 5GIRA 5DQDL 1TVBB 2QQNH 2YD5A 3QXVA 4K23L 2VXVH 3WMSA 1YY8A 3EJJX 3TJHC 3RUGF 3FCTB 5JOPE 4O51A 3HC0A 2Q8BL 4N5UA 4L4VE 4MWFB 1UACH 4PJXA 2OTWA 3C87A 3QJHB 1KIPB 5D7JA 3IU4L 1RUAL 3MRDB 3L3IA 2HJLA 5CGTA 3WUWB 3CUPA 4JQIH 1AGFB 4PJHE 1CF8L 4HC1H 4EUPB 3JVGA 5CCKL 4R4BB 3QO1B 2FYYB 3VXQB 5ANMA 3F6IA 5DMKA 1RK0A 4AQ1B 3FN9A 3T04D 4QOKB 5HY9A 3Q5OA 1HKLH 3UJIH 4Y8AA 1BMGA 3DX7A 1KV3A 3L7EB 3OZ9L 4MA8H 2VABB 5HI3C 5ISZE 5DVOA 1LQSR 3MA9L 3MACL 1T2QL 5F93C 4JO2L 3BMWA 4HCRH 2HN7A 4HUUB 4JVWA 3TPUB 4ONGH 4JZJC 5CZKA 4WRLA 4F8QA 2PTUA 2IQAA 3ULSA 5DS8B 1G7LB 4FNLL 3DBXA 1XGYL 1A22B 2QQLL 5KVEL 1DVFC 4PRPD 5C07E 5DQJB 2G5RA 3FAXA 3O41B 3ZKQD 1KGCD 1U8PB 1HCVA 4HZAA 4JDZB 3OSKA 1UXSA 5CSBA 4E42B 2DMBA 2CDEB 3P9MA 1K8IA 1UJ3B 1IKFL 3EFFA 3P40A 4AEFA 4GQ9H 3L5WA 4K9EL 1N2RA 3VFPB 5HHMD 3SDXF 3JV6B 2QSQA 5GGUB 4S1SL 5H37G 1U3JA 1B4JL 3RVUD 3MRNA 1LO5A 3W5MA 4AT6A 3SKJL 3KPOA 4K7FB 3WDIA 4YHNA 5DJCB 2YXFA 1JK8B 3LQZB 4L8SC 4NO2B 5EZLA 2J8HA 4OLUL 3PV7A 1T5XA 2ESVE 5F96L 4JCLA 5EG6C 4F2MA 5KSBF 3TO4D 2BSSB 2D7QA 4MNGE 5AD0A 3GIVB 3SDDB 5C0GB 1MFDL 4S2SA 5FUCC 4S1QH 3DSFH 4QHNA 5DJZA 4ELKB 2XQBL 3PGDB 2P8PA 4YPJA 4HWZB 1NC2D 2R29H 4Y0GA 2AEIT 3HE7C 4HDIB 3QCUL 4LCYA 5BRZE 2P5WB 4YDKL 4U6XA 4Z7NF 2VC2H 3N85H 3UZEA 1S7RB 1H3WM 3EGSA 4ONHA 5J56B 3UX9B 5I1HL 5IVZB 2X44D 4OKDA 1G7JB 2BX5A 3QXDB 1LHZA 2Z31B 1GZPA 4F37F 2PW2A 2EIZB 3HS0A 4LDLB 2YD6A 1HQ4B 4LGRB 4PRBB 4G6JL 4P9MH 4ETQA 2VKWA 3ARBD 5ID1A 2AJUL 1KCUH 1YNTB 3P9LA 4JO3L 3U4BH 1XT5A 1A8JH 4JFQA 4ZS7H 2FLBT 1U8IA 4KHTL 5BMFL 3E3QC 3MV9A 3MJ9H 5HI4D 1A4KA 2ARJQ 4JJ5A 1NDGA 4CMMB 3MBEC 3H9SE 4G8IA 2IGFH 2LAAA 4DGYH 3CZJA 1A6ZA 2RFXA 4G6KL 1QD0A 4X5LA 5C0DB 3Q6FA 2NTSP 4DQOH 4Q6IA 2XFXB 1AD9A 43CAA 1RZ8A 4HX1A 2ZNXA 5IR1A 1X6NA 1WCBA 1GAFL 1T20B 4ODWA 1DUYA 1DBBL 2IAND 1G9ML 2K1MA 4HMCA 3MOQA 4ODHH 4I4WA 2VQ1B 5EWIH 1T66D 3IJSB 4LSQL 3MREB 1ES0B 5BZWB 1QFWI 4IOIB 4WW1A 4PJBB 1T03L 1D5BB 4PJIA 5EUOF 1W72B 2PETA 3TNNB 1D5IH 3SCMB 3KPSE 5TFSL 3S96A 3C8KB 1FLRL 1DQQA 3ULUC 1SVZA 5FO7A 5BO1L 3DWTA 1BWMA 2VLLA 1P1ZB 1M7DB 4OCWL 2EO1A 2Z8VC 4ELMF 2I9LA 1Y18B 1BQHB 4LLQB 5EU6D 2YPLE 5L2JB 2I07A 4U1HB 1RVFH 2J7LA 2WBJB 1RJYA 2YEZA 3EO1A 3JWOC 3EDJA 3ZYOA 4U6HB 3SDAC 3RX8A 1TVDA 3L5XL 1NBYB 3C6SA 1DR9A 4YIQA 2DYPD 1ZT1A 5BQ7A 1PY9A 2F9BT 3D69A 1JHLH 4KMTL 1JMXA 5HJ3A 3QNXA 4K8RC 5KVDH 4XBGA 4KK9C 1NLDH 1NH6A 4NGHH 5HHOE 4K7PY 1IAKA 4ALAL 3ZYZA 1N0XL 5E8DL 3JBG7 4XBPB 2V5SA 4J4PA 5I71C 1CLZH 1GOFA 5K59E 1EHXA 4HKXA 1BFOA 3KPRB 3G5VB 1WWBX 1IT9L 4HFUH 1U93B 2V7HA 3SDCD 4RIRA 3QCVL 3IFOB 4Q0XL 5FUCE 5HHXH 5F7HA 5DYOA 4OZ4A 3B9DA 3LN5B 2B4CH 3T0ED 1C5DA 1G7QB 3M07A 4IOFD 4G9DA 1MJ8H 3VD5A 3BD4A 4WWKC 1FG2B 5FYJL 5EB9A 4ODTH 4OD2B 5HI5C 3X17A 4OSUL 3FRUA 1NGXA 3AS1A 1ORQA 4EI5B 2O5ZH 3DI2B 2F58H 1KTLA 3EJZD 4IM8A 1NCDL 2H26A 1ZVHA 3D3VA 3GKWL 4O5LL 5HPOA 4ZOAA 1JWUA 1CFQA 3ARTA 1S5IL 2P5EE 43C9B 4NWTH 2JJSC 4ZD3L 5F97E 2GI7A 4GAFB 2OP4H 3VWJB 2F5AL 4N0CD 1FNGB 3X3GH 4H8WH 3TIEA 2WM0A 1H8NA 1BP3B 1TPXC 4ZUSB 4FFYH 3GMMA 4GT7A 2YWZA 1T4KA 4R26H 1WZ1L 1SBBA 4RX4A 4PLKC 5IHBA 4KZDH 3PWLA 4I0PD 5I2IA 5C8JA 4JFFB 1MPAH 1OM3L 1HI6B 2H6PA 3OR6B 4UUJB 1SQ2N 5KSAA 4QTHB 3NCEB 4PJ8B 1T22A 1T0MA 4LARL 1E4JA 1YNLH 3EW3B 5J1AA 3CDYA 1HINH 2GK0A 4JG0H 3SKUD 5FDWB 4XHQA 2QHRH 3T2PA 5ALBL 4LCWD 4JKMA 1LD9A 3DUSB 5E6IC 4NQDE 3HE6B 5DD3L 4KJWD 5K9JH 4FZEL 1ZS8B 3ULUE 2OLDA 5C1MB 4ZAKD 4LKCB 3MLUH 4X6CB 4ZYKB 2MFNA 3M1BA 2JIXD 1N6QH 3SKOA 2FGWL 5E2VH 2X4PA 3VXMB 4M5ZL 3HR6A 2X4UB 4O4YH 3QUYC 2P24A 5D9SB 3LZFL 2VXQH 4Q9QL 1IQWL 5D1ZA 2J3SA 4HHAA 4WI4A 4TOYL 4Y8DC 2OI9C 1ZA3A 5F9JA 3BYTA 5GZOD 4PJHA 3PWNB 4P3CL 4UAOC 5ICZB 4FQJL 3BE1H 4KK5D 4KPHH 4D0BA 2Y7QB 2XN9B 1BQLH 2XPGA 4M62H 1P2CA 3X13A 5E8NB 1I3GL 1JF5A 1FAIH 2D7TH 5KS9E 1OT1A 2NXYB 2E9JA 4LAQL 1DQLH 3U9UB 2GT9B 5MEND 5DC9B 5ISZA 5DJYA 5JPNB 5SV3A 1WBZB 3LKOB 3BZ4B 4Z7VB 1RIHL 3S5LB 4PRHD 3VXUA 4R8WL 3LEXA 3TBSB 2ZJSL 1O0VA 1MCRA 4WGWB 2XA8L 5JIKA 3CX5K 4NO3B 2OR9H 1JIBA 4POZC 5ESAA 1BF8A 4LK4A 4XB7A 1QFWL 3G6JB 3N50A 3QEUB 3P4NA 4ZUUB 3T1WA 3OWEA 5JXEC 5DA0B 1T2XA 3SKMB 1BFVL 1RUKL 3UJJL 2I27N 3WIFA 4JO4L 2AEWA 4MCZA 1UYWL 3CMOH 3MLTB 4P23A 5EIVA 1YMMB 4JFYA 1MIEL 1Y6MR 3L3GA 3T65B 4EXPX 5DHYB 3VFWA 5MEPA 3RAJL 5D5MA 1WJ3A 1F6AB 4K3JL 4LDEB 1XIWB 4YQXH 1Q9OB 4RGNC 5ID0B 4M9OA 1YUHA 3T3PF 1CFNA 2HMID 4Y5XB 3TZVD 2ESVA 4Z7QE 2IG2L 5AYQA 5D72H 4X8JB 2M1KA 1QFWM 4HIJA 4MNGA 1U3HD 5JLZA 1IAIH 1JFQL 1UXWB 5D70L 2GUOB 3B3IA 3IAGC 2NXZC 4L3AA 4X7SL 3HI6L 4KTDL 4Y4FB 4DAGH 3QIUD 3VD9A 3BDYH 4TSAH 3V6ZB 5DHXB 4PJXF 5EO9A 2VZOA 4AEIH 2C3HA 2DQCL 5BRZA 1IRAY 3NCFB 5IW1B 2HFGL 1EZVY 1I9JL 3FJTA 3O6FB 1EHNA 2W91A 1Q1JH 4RWYL 4KK6C 2VDOH 2EDJA 2P7TB 4BA8A 4Z7WE 2R23A 3QFDA 2AJ3A 3BW9B 1X5JA 3CDCA 4K2UH 4OLXL 4UTAL 4NC0B 4MZ3A 1JHTB 2YUVA 1NGYA 4JY5L 5TE7L 2R2EA 2EYSA 4MJID 4OZGE 5GRUH 1GCFA 1NCBL 4LPYA 3G6AA 1DBKL 4J8RA 3BH8B 3BP7A 1QPPA 4XPBL 3H9SA 3RKDD 1EGJA 3U0PB 4KV5F 3WS3A 4WEMB 1AC6A 3NMEA 5GGTL 2ED7A 3QUML 4RFEB 2HRLA 4UDUB 3V52H 1W0VA 3P4LA 2VLKB 3VXTA 3VW3H 1C08A 3SQOL 1I8KA 4BUGA 2EC9U 1FFPB 3BZDA 1KYOK 3ILPB 3O2VL 4LLDB 4OCRH 2AK1L 2ZG2A 2V2XA 3BZEA 2VISB 1S5HB 1RZIA 5EUKB 5DK0B 2R56L 5E99L 3MX0A 3V6FB 3VG9C 1K4DB 2AXGB 1WC7B 3BKYL 3NCCB 3WBDA 4A6YH 5D7LD 3V95A 1AP2A 3WFHA 3GMRA 1BFSA 4WUKH 3QUXB 2CLZB 2WIIB 4A2LA 5EZJA 4XRCB 1U8LB 5SWZB 3B9AA 2X05A 1FRGH 3UBXI 6FABH 4CW1A 4WY7L 3WHE0 3NZHH 4KVNH 3HPJB 3HZKB 2K3TA 1GOHA 4NT6A 3WD5L 3VFRA 5I1AA 3HRPA 4R7NA 1JL8A 2ITDB 4UT6H 1AHWB 2X9WA 4KJQD 4QXTA 2DQIH 4HS3A 5KOVC 3WN5A 4OZFA 3UYOD 4C58B 1KJVA 3F7RA 2XIDA 1P6AB 1TCRA 2VWEC 3P0YH 2BXYA 3PNWA 3TH3T 2BVQB 5JQ6H 3CFDB 1G1YA 4JFXA 2EKSA 1U41A 1YEGL 1WVZA 2B2XH 5HHOA 3VD3A 4PJCA 4WTXA 5DJDB 4OUOA 3MUGA 1FYTB 1ZLSH 1UGNA 4XCFL 3U0TA 3ARXA 3O45A 3GRWA 5DJ6B 4LLWB 5JDJA 1VA9A 3B9VA 2VYRE 1J0HA 3WE6B 2CKNA 3J8F7 4Y16B 2XZCH 2X1PA 4XPGH 1W0WB 4XCYB 4KY1H 5C0RL 1KELL 3MLSH 1GGUA 3A67H 3GZKA 4X6BB 3D87B 3VA6A 2QQNL 1MLCA 1HHJA 4FS0A 4WV1A 5D8JH 1MCBA 1NC4A 1F58H 1NUFA 1UM4L 1UH3A 4QRTB 5TPWH 3DXAE 3MR9B 4PY7B 5I18H 3HE7A 3RIAK 4ODVH 1TDQA 4X0KB 5JMOC 1V7MH 3A6CH 3MFFB 5GGQH 1U91A 1GIGH 9CGTA 1CFSB 4YHLH 4GW4A 1DDHB 5C2UB 1MFBH 4HWEL 3VRJA 3AGVA 3NTCL 3D2UD 1D9KC 5F1NB 5K9OA 3FQXA 1CDIA 5K93A 5IUSA 5CKAA 3QG7H 4GAJH 3ULVL 1AGDB 3AXLA 3K2UH 4X6EB 1B0GB 3RA7L 4LQFH 2Y07H 3EFDL 4MS8D 5F8RC 4CDGC 4L8CA 1OLLA 3CX2A 2P5EA 4WU5B 4KXZH 3VFMB 4QRSA 1BZ9A 3QSKB 3UPRB 4FXKA 3QNZB 4KROD 3D39B 3JV0A 3RWCB 3RVUC 4PJIF 3MBEA 3LSOB 1MHCB 5FYKH 5F9WC 2PCPA 1P84J 1NQBA 1PEZA 4XP9H 4G80A 5I66B 2NLJB 3QXUA 1PX3A 4ONGL 2D7NA 4QXGL 3U36A 3GSQA 2HVJA 4XGZB 3TO4C 2ZCKL 2F15A 2O5XH 3IFNH 4P4RB 5ACMA 1SM3L 2ADGB 1UC6A 2YK1L 3AY4C 3VXSB 1NL0H 1PG7H 2WIMA 4WTZG 5TE4H 3T0XA 2KDGA 3MRBA 3LMJH 3DURB 3W11D 4BH8A 4OZHE 5L2KE 2JE8A 4HF5L 4P0DA 2H2SC 1E4WL 2VSCA 4D2NA 1EMTL 3BDXA 3GSVA 4NQDA 3WEXB 2R1XB 3EJYC 4EBQL 5FM5O 1HNGA 1CD9B 2KZWA 4NFDA 1IGIH 1Z0NA 1O5DT 3OHXA 5F9OH 3ARBC 1CXKA 2DJSA 4YDIH 5FKPA 2VDNH 2EECA 4U6VH 1XGQB 1G7IA 3QUZD 4I3SH 4WFFD 3MRQB 3SDAA 3PHOB 5HI4C 4GKSA 1QFPA 1QNZH 5I0DA 4X7DC 1J0JA 2PO6D 2BNQD 4I2XE 4QYOB 4Z18A 5FA3A 1JN6B 3K81A 1R24B 3K7UA 3FOLB 3FAWA 1FAKT 1YNKL 4KU1A 2MCPH 1IL1A 5GGRB 5T1LD 4JY6A 4HUWB 5AG8A 2DTSA 1S7WB 1NSNH 1R3IL 4P5TD 5KS9A 2VE6B 3ARPA 5HGBB 3V4UL 4N0RA 1J12A 2NR6D 1I1YB 1FL6A 2FJGA 2VDLH 4D0DA 5E4EC 4WEUD 3PIQB 2W1NA 4HWUA 4HH9B 5GSVA 3DVFA 1JZ7A 3DTXA 1VEOA 3BYYA 4L1DA 5ERWA 2R4RL 4OZIE 1GC1C 4L3EA 4NQSB 3JTSA 4M48H 3LKSB 1P7KA 3BKCH 5C3TA 1PQZA 3BHBA 1G6RL 1AXTL 1KPRA 3RI5K 2H32H 2AV1A 2N4IA 4U3XA 4UQ3B 4WWKA 4KWUA 5ECJE 4ZOCA 4PRPE 3T0VA 1T7VA 4G42A 5AZEL 1KGCE 3VXPA 1DN0B 3BO8B 1SYVA 4UT9L 1QBML 1Y0LB 3CU7A 2R1YA 4MHHG 1PSKL 2OTPA 5DD0L 5TDOA 5E5UB 4HV8A 4JRYD 4NO0B 3TBYA 2ZUYA 1YEJH 5HHME 3LKRA 5CZVL 3QI9B 2XKSA 3MV8D 4JANA 1ETZB 3TLRA 3UTTB 4BSVA 1OCWH 2DICA 1KB5B 3AROA 3QISA 5CINH 3MROB 4RFNC 5BW7A 3NIFE 4OGXH 4PJ5B 5F7DB 4DW2H 3K3QA 2P43B 2Y5EA 3OKMA 4XCEB 4WTWA 3SDCC 1YJDH 3WXVH 1MCPH 2A6DB 1H5BC 1HWGB 3K1DA 2HH0L 4U0RB 3MRMA 1BQUA 1FHGA 2YZ1A 1WTLA 4MA7H 1FSKC 3BWAB 4IOFC 4U1JB 4HPYL 4Y5VC 5TH2B 3O11B 3ZHKA 4AG4L 4DGIH 3FT2A 3TFKC 4IRJC 2WMPA 4PJHF 1KB5H 3JWDL 4M4RA 5E6IA 1F4AA 4O2EA 4Z7WA 4Z0XA 5JPMA 2GAZA 5IMLB 3GNMH 2AI0H 4FQIL 2Z91B 3IETB 5EO1B 4ZPVA 2E9IA 4N8VB 4E41B 1F3JB 4OZGA 3S7GA 4MD5B 1JUFA 4NHCH 4HJ0D 4NRYB 3SQBA 4F80A 4NKOB 4Z8FL 1CE1L 4C83B 4LEOA 4N8CL 1JGUL 5GGSB 3GGWB 3F58L 1RD6A 4PLJD 2NTFA 4CGTA 3KNBB 1DFBH 3Q6GL 3WNPA 1T6VN 1WBXA 5GS1B 5IB4A 1WITA 4XWOC 1K4CA 1T1WB 4X6DB 2FHBA 4KHXH 2P8MA 4NQCD 4D9QD 5DD1H 5EBMA 3FB5A 2AGJH 4NCC2 3VGGA 4GRLD 2J4WL 4P2RD 1QEWA 5J57B 4M6MH 2E7MA 2Q76B 3GSUA 1HH6A 3RPKA 5CLTA 4FFZL 5IV2A 4D0CB 2XKNA 2IANE 2ICEA 3IB4A 5IB1A 1LEKA 2V2TB 1IEAB 4NDMA 1FG9C 2V5RA 4NPYA 5FO9A 1NBVH 3L3HB 1QRNA 3BUYA 4TYUA 5IBUG 1S7XA 4KJWC 4V1DD 3TEUA 4QTIH 3CC5A 3AAZB 1INEH 2JJVA 1IC4H 2YA1A 5CMAB 3UEZA 4JKWA 1XGUB 2YD7A 3KPLA 1DUZB 4U1MB 4IRSC 2AP2A 1XF3A 5EU6E 3GMQB 3RP1A 1JYNA 1J0KA 4Y1AD 1FFOA 2BNRD 4UINL 4FFYL 5JORA 4DVBA 1M05A 4MNHB 4R26L 3RHWK 3AU1A 4QF1A 1BD2D 1BX2A 2KL6A 1OVZA 2EYTA 4U1KA 4O9HH 4JDTH 4N9GB 3ZSSA 1MPAL 2FD6H 5B3NA 5D7SH 4NQXB 3C5ZB 3KLAB 2CLVA 3UTQB 1J8HD 1YN6A 4XMLL 4JG0L 4YFLI 3OAUH 4MD0A 1JGEB 1MJUL 5A2FA 5DEGA 5DVNA 2GTZA 3IVKB 4HQQL 2Y23A 5DFVD 4F9PC 3DXAA 1RPQA 4AH2A 3G5ZB 3ARDD 3S3JA 3QIBD 4I3RH 1J88A 4EN3B 3UTSD 2A83A 1JTOA 4UT7L 3HNSH 3QDGB 4LP5A 5CEXA 5HYJB 1SEQL 1BFTA 3IJHB 1OAYL 2E9BA 4KRPB 1C12B 4XMKH 1D6VL 5E9DD 3RQ3A 1U8MA 4WW2B 4ODUA 3PGCA 4UNTA 2FDBP 3H6JA 4QHMA 4PJDE 4LOUD 3GKZA 1BQLL 2FBJH 3TWCH 3BUTA 3E6HA 3ROOA 1OGTA 4QXUL 4AL8L 2SEBB 1LNUB 1UEMA 4EUPG 3O2WL 2LTQC 4JM2C 3GJFH 3W2DH 1A02N 5C86A 4OI9A 2HMIC 3QDMD 1MWAB 3TZVC 1XF2B 3V5HB 2Y9RT 4ZDHA 2ZPKH 3DV6B 1CFTA 2J8UB 4J6RL 4RMRA 5KW9L 4OQTH 4KQ4L 3OPZL 5EBLB 4PRAB 3DMMA 3MYJA 5FECA 2C3XA 1RJLB 1OAXH 4WU7B 2PXYB 5C0CB 1Q0XH 2XT1B 1VPOL 5IK3B 4H88H 5EPMA 2F8XC 4FABH 1FNFA 1NCNA 4DKFH 1V7NH 1GGCH 1CGVA 1MWAH 1RJCA 1IFHL 3NZ8B 2GSGB 3INUL 3U0WL 4J3XA 1A6AB 1CL7H 1YEIL 4TTDC 1Z3GH 4UTBH 4QY8A 4FN0A 4PGZA 5DJAB 5E95B 1G9NL 2CR3A 5F70A 5K59F 3H7BA 2HKFL 4G43B 2RAMA 5DT1H 4XB8A 1XGPA 3QUKA 2FX8L 4HXAH 4U05A 1QLFB 3BH9B 4JREC 5T1DH 5FB8A 5CD3B 1SJEA 5IGXH 1GGIH 3QWOB 5IB2A 4OTXL 4POYA 3D0LB 3DVNB 1AE6H 1CD1B 4KUCF 2AEPH 5HDQH 2Y1VA 4KDWA 4J3OC 5DD5H 5DGRA 2QQQA 3W0WB 5FOJA 3BAEL 4RCAA 3O2DH 1ADQH 4OZIA 5MI0B 5E8OA 4FP8L 1FVEA 1MHEA 5T1KD 4FQHA 2PR4L 5MENE 4HPOH 5B4MC 4Q97A 1J05A 3N1PC 4ZUWB 3S88L 2KZ1B 3CJJA 5E8PB 4PRHE 3LDBC 3IDUA 3QQ9D 4NNPH 1WIOA 1G7PA 2GQHA 5E6ZA 2A38A 4S1DC 2BSTA 5GRUL 1DBML 5D96C 1LO3H 3VE0B 5F6IB 4PRPA 4PTUA 2BRRL 3GHEH 1LWRA 2EEDA 4KJQC 1QBAA 5FKAA 3T2NH 3HR5B 4JPIB 1MHHA 3BPNC 4M6OH 4F15C 1JMZA 2XOTA 5DEZA 5I1GH 4Q2ZA 4YX2H 4YBQD 3ETBF 3RNKA 3RWJB 1YPZB 3ECBB 3VWKC 4FQ1H 2FR4A 1FH5L 2PKDA 5CILL 3WHXB 4K3HA 5E24E 4OI7A 1QVOB 5IQ9B 5MEQB 4NZTH 3TCLA 3NGBC 2FEDC 4X98A 2ZOLA 4RMTA 3T8XA 3ULUF 3QRGH 4OFYD 1QLRA 4WUKL 4MYWB 5DEFB 4C56E 5I8CA 1ZMYA 2KQNA 3H9YA 2BOBB 4CADA 1FRGL 4POUB 4YXLH 4MDIB 3TO4A 4APQB 5C2BH 5HYQB 1U6AL 3N1MC 3S4SA 3NZHL 4NM4L 3AY4A 1IM9B 4RGMB 2BNUA 1TJIL 4LRNL 3KDMA 1NC2A 4XNYL 4XNXL 4UT6L 3ZL4L 2WINA 5I8EB 2ENSA 5DTFA 3NBNA 3LRSA 5TF1H 3FN0H 3TA3D 2R8SH 1R3JA 1G6RB 3THMH 5LWYH 5DRXB 1TNMA 1BQHG 3GSWB 1NANI 3BX7C 3BGAA 1JZ6A 4XVJL 2QJDA 1F4WL 4NJAH 1BLNA 5I30H 4HKZB 1U8KA 3HB3D 5KS9F 3I2CL 5ITFB 4HZLA 2OR8A 3JV5A 1F3RB 3ARBA 4MJ2A 3PABB 2FX9L 1QLEH 5IJVA 5EORL 1N6VA 2LFGA 1F4HA 3SGJA 3BD3A 4U2YA 1KSRA 4KMLB 4MJIE 4XAWH 3RWEA 2HYMA 2ZUUA 3UAJD 1IAOA 4KROC 1AR1D 3C5JA 4XVSH 2UUDH 2RR3A 1Z2KA 1KLGB 3KYNA 3BJLA 2CDGB 1NGPL 2EDFA 2W65A 3MA7A 5BVJB 2YUZA 5I76B 3NACL 3SE3C 4BQCA 5ENWA 5ICXB 4CAGA 2H3NB 4I5BB 2H8PB 4KI1A 4TPRL 3PWPD 1U92B 4GS7C 1Z9OA 1ZT4B 3GHBL 1MFCH 5C0BD 5CJOH 4IMKC 4NSKA 1QA9B 2IANA 3NFPB 4WJ5A 1CFBA 2Y5TB 3W11C 1OTUD 4DN3H 2CIKA 3ZSTA 2OS7A 2CK0H 4I77H 3I50L 3K8MA 3IKCB 1ZWIA 4P3DA 2HA1A 3F12A 1KJ2A 1JPFA 3HZVA 3HCVB 3MUY1 3RTQB 1NLBH 3RWGB 4EJ1C 4LFHG 4Z7QF 5IMKB 1AXIB 3LQAL 1FGVL 2DIAA 5EU6A 1PFCA 1IC1A 1EEUA 3MRIA 1SBSH 5CSZA 4CVZB 5GSRA 3QUZC 5HD8D 4Q9RL 2DKMA 4HH8A 4BZ2H 3QWRD 2DYPA 5M7QA 5T1MB 2AEQH 3OXSA 5K9QG 1WIUA 2PO6C 2V7NA 1BBJB 3LHPH 1IC5H 2V9TA 3MO1A 1LE9A 1FIGH 2FIRT 3P2TA 1Z6JT 4M7ZC 4S10A 1PG7L 1EEZA 2Q86B 1D6EA 4TUKH 2R0KL 3B9EA 4IS6A 3RVVD 4L9LA 4FQXB 4P5TC 4RAVA 4WO4B 2N56A 3NCYS 5GGRY 3F7YA 4Z7WF 2NR6C 2M2DA 3WSQL 1AY1L 4WI2A 5JIIA 5JHLL 2VH5H 3N9GH 5J11C 3OGCA 4OZGF 3U4AA 4OUUB 1A1MA 3FMGL 1ZANH 3SDCA 3D9AH 5T33H 1H5BA 1I85C 1MCFA 5B38A 1SJVA 3OXRB 3MRCA 4MCYB 3TF7C 5GRYA 4D9RD 3T0EA 4LCCB 4NQTA 1OARL 1B2WL 4UI2A 3OKLB 1IKNC 1HDMB 1BOYA 5EC1A 3QT2A 3HMWL 2VLRD 4NQVA 4PJDA 3R8QA 1IE5A 5EN2A 3VFUB 4YC2C 4M1GL 5ICYB 3VFVA 1MNUL 3U9PH 3F65A 4KUZH 3HPLA 3B9KD 3VGDA 4A2MA 1XGTA 1WWCA 4C54A 1AQKH 1OAQL 1K8DA 3UJTH 1G1CA 3TBVB 5IESL 1LE5B 1IGFL 4FZ8H 5CFHA 1I7RA 5IIEB 5GHWL 3ZKND 3REWB 2CKBL 4FQLL 5EULV 2NY4B 3DPBA 1NMBH 3CDGA 4K3DL 5ADOL 3WFEH 5IW6B 2OZ4H 4M61A 3BI9X 2OK0L 4LVHB 2UY6A 4L4JA 4IRZH 2EEBA 5DI8A 1MRFL 4I0PA 4HIXH 3S5LG 3VFOB 3KPQB 3VJ6A 4ZFGH 4P48A 2NY0D 2GCYA 4P59H 2B1HL 5HTSA 4KVCH 1NAKH 4OLWH 1S9WA 2P47B 3O3EA 4H5SA 5SX4H 4JFDD 5KZCB 1AQDA 1KEGL 1ZOXA 5BJTB 4L3CB 4LCWA 1YEDB 2VLJB 3IDNB 5CGYD 3DO7B 3MOAL 4P49A 4LSPL 4MXWH 4JFHD 5T3ZH 1MH5A 4LSSH 4ZAKA 2IALB 4LSUH 3W9DB 5HYSA 3S4SG 2UZIL 2JIXA 25C8L 2DM7A 4NQEB 5ACZB 1FC1A 3PP4H 5FUZL 3MV7D 4KFZC 2GJZB 5EOQH 4HWBH 1DEEA 5DR5H 3RVTC 3U2SB 4Z0BH 4WFFE 5CJ5A 4GXVH 3DIFA 2X4OB 4Y5YB 4XPTH 3O3AA 3BZFA 2IF7A 3Q1SH 3CSGA 4MA3A 5GGSY 3ISWA 1VACA 3VFSA 5LGKA 3FOMA 4YHKL 2BNQE 2VUYA 5GS0L 1F45A 5DRNB 1VKXB 1TZGL 2VN7A 3L3JB 3ZO0A 1VENA 1KXQE 3RIAF 1YJDL 1QR1A 1QPXA 1HIMH 1C5CH 3JSSA 1E27A 4GRLC 5C08B 3MCLL 3H9ZA 3QA3A 4LAJH 1WZKA 1CL7I 5AAWA 2E7CA 5A40E 1KNOB 1RZGB 5DRWB 1L4IA 3HZMA 1T80A 5MENA 1H9VA 3CSPA 1ED3B 3QH3B 3QG6B 5CIPA 2MQ3A 2RQ8A 4RMQA 3I02A 4PRHA 4GG8A 3MJ8B 4F9PA 3NA9L 2GFBB 4ZTPH 2IBBA 5K33A 3P9WB 4HSQA 2LU3A 2R0ZH 4GUPB 3EUUA 5AZ2L 3ZDZE 4Y2DB 1KBGH 1R6VA 5C9JA 5TQ2H 4H25B 5IMOA 5H2BA 5HYIA 5J4MA 4CL7A 1K3IA 3OKEB 3LAFA 1MCDA 1K9TA 5D2NA 1IGYB 5ESQA 4E0RB 3DX9B 1XZ0A 4S0TD 4DKEL 4QCIB 2HRPL 4HGWA 5M95B 3HMXH 1F2XK 4QRQA 3NCJL 3V5DA 3DGGB 2VL5A 3CIQA 4OZHF 3C60B 5DJ2B 1YDPA 1Q9KB 1ZLWK 2FJFA 2VZTA 4M6ML 4OD1H 3RGVB 3ARVA 4IEFB 3V0WH 1RIVH 1ZHLA 3RUGB 5JW5B 1J8KA 4HBCH 2YOCA 3SCMC 3TN0D 2F5BH 1JZ8A 5TQ0L 4OLYL 5DRZA 3OBAA 5HVHB 2WWKO 4DTGL 4LKXA 3TZVA 3KYMB 3MBXL 3MV8E 3GBMH 3PXHA 2FJHA 4XNZB 3HG1B 1LILA 1U3HA 1JNHB 3HUJE 4GXUN 2WBJC 3DV4B 5EU3A 2BVPA 5FV1L 1INEL 5DFVC 3ZKXB 3QIUA 3QPQC 5AUMA 1S7TB 5DMGD 3BPCB 4HK3N 2AQ2A 4LLAA 5LAXB 3TT1L 2L0DA 3QIBC 1W8OA 5IVXA 3DRQA 3ESUF 1MI5B 3LEYL 3BP5A 3ZDYE 1BECA 4OM1H 3TO2B 3I6KA 4AZ8A 5L0QB 1RUQL 2B4CC 2ZKHH 5I16A 1OPGH 4FHBD 4P46D 3MMEA 5E6YA 2R4SH 1MIMH 2YD8A 2ZG1A 1BIIA 1AGBA 2VR5A 5F3HB 3DOSA 15C8H 1IBGH 4XVUD 2V6HA 1T5WA 3LY6A 4ZFOL 1U8NB 4MJIA 4OZIF 2DIJA 5AEAA 5K9KA 2DWDB 4YBLC 1FZKA 2J6EH 5EFIA 1L7IL 2FGZA 4X4XB 3QJFA 4PV9B 4QHUB 3VDAA 5KSUB 1KCSL 2OSLB 3FQWB 2Q3AA 3RWFA 4WI7A 2I24N 5TDNB 2CH8A 2OJEA 3D48R 1I7UB 3H8NA 3TYGH 4H8WC 4NQCE 4D9QE 4Z5RB 3SDXB 4DN4L 1VGEL 4EI5C 1RZ7H 5CHNB 4X7TB 3C2SA 3O0RL 3MRPB 4P2RE 2ZSVB 3GO1H 1CDHA 1I9IH 5D7LA 1G0XA 1F4XH 2JB5H 4HS6B 4BZYA 2YKLL 3FQUB 4JRWA 2EH8L 4XMKL 7FABH 4MMZC 5C09B 1QSFD 1S9VA 1CBVH 1CGSL 5KSBB 4F57H 4EDXA 2XICA 3CCHB 3ABZA 1E6OL 5FUOH 1K6QL 3ZKMC 1N4XH 4V1DE 1KXTB 5F1IB 5BZDA 1NJ9B 3MGTA 3KAAA 3D25B 3VRIB 3Q5TA 3NIFF 5F1KC 5HGDB 3WJJA 1EAJA 2DQUL 1G7MB 1FNAA 3UYRH 3TIDB 1RAMA 4PLOB 4GRWF 2PYED 1RZJH 1LK2B 4OIAA 5EBWB 2ADIB 4TNWK 4Y1AE 3V8OA 2BNRE 4PJ8C 3CPLA 1BVLA 4YPGA 1I8MB 2F54B 3MRHB 5L9DH 1ZLUH 3HI1A 5DLMH 1V3KA 1BVKB 2YN5A 1BD2E 3I3DA 4PP1C 2ADFL 3CK0L 2YC1B 2W60A 4YXHL 1P84K 3D18A 4DZBA 5HYSG 2P44B 1GOGA 1WF5A 2AJVL 1OAKH 2OX5A 4MDJB 3STBA 1RULL 1J8HE 4JRXD 5TDPB 4LHJB 1UWXH 3FQRA 1EIBA 1R3HB 4O58H 5DO2C 1Z3GL 2BHUA 5ETUA 4D94A 1GYAA 1I1AD 5GGTA 1EUUA 5ESVB 3QUMA 2R2HB 1IGMH 2Q7NA 3CZFA 4HFWB 5D1XB 5DJ0A 4P2QD 3MRKB 4Y88A 5HHVH 5I9QB 1DLHB 3FB8B 1H0DB 1FE8H 2JJTC 5CP7B 1FIEA 1RUPH 3TP4A 4WFGD 5L8KB 3VGHA 4DVRH 3D2UA 3UTSE 4BK4A 1MCCA 3ARGB 5SWSB 5EU5B 5IHZB 5E8EB 4OIIL 4H26B 5HGGS 1RHHB 5E9DE 4K94H 1T0NA 3KR3H 1JGVH 1CDGA 1KC5H 1Q9LA 1SYSB 3DRTA 3E8UL 3PF2A 3N1QC 2JB6A 4X4YB 5E2TH 4YBQC 3KPRE 2OMBA 4M8QA 1ZA6A 1KPVB 4RA3A 4BQ6A 1MLBA 3O2DL 1BZQK 3T3ME 4OCXL 5CEYB 3EOTL 1T21B 4P2OD 4NC1C 2V5YA 3BIBX 3SE3A 1XF4A 2CRIA 3QDME 1PDKA 4XC3L 2F74B 3U4EA 4YFDB 4NNPL 3FZUD 1E4XH 4OJFL 1L0YA 3BPLB 1HYRC 1K2DB 1A21A 8FABB 4RQQA 2W0KA 2BDNH 5HHPB 4NIKB 1A6UL 1LEIA 2VLMD 4MNQB 4P4KB 4BSJA 1RIUL 2AJSH 4NZDA 5FCUH 4AENA 3TA3C 3MCKA 4FMKA 5I17A 5JA9A 4B0MM 3T2NL 4UBDD 1NDMB 5CAYB 4JY4A 4TUJA 3MRJB 5FYLL 1R3KB 2NX5B 2PTTB 4J3WA 1EH9A 2VL4A 2BC4A 4DK6A 3HB3C 2R1WA 1EUTA 3NH7H 1OD7A 2AKRB 1IGTB 4JN2A 1SY6H 3ZLQC 1KPUA 2CXKA 2Q1EA 1SEBA 4PRDB 2IBGA 3QUZA 3SO5A 4Y4FC 3UC0H 1FVCB 3TBTA 3NAAL 5J13C 2PXYD 3IDXL 4PV8B 4JFFE 2FO1A 4JFZH 5CWSA 3ZKSD 2I60H 2Z8WC 3WO3B 1AR1C 4XVTH 2PO6A 2BNQA 5CP3H 3MZGB 2C1PA 2PW1B 1S3KH 5FK9A 4PGJA 2CKBB 2BHYA 4PBVC 5T1LA 2FZ3B 4JLRA 1ZHNA 4NUJB 3O6FC 4LCUB 4DEPB 2XTJB 3HC3H 2Z35A 2YUWA 4FTVB 3H0TB 4P5TA 4PFEA 5JXAL 4YEEA 2DWEA 3CH1B 3EOAB 2X7LB 1CZ8L 3TGXA 4WDIA 1MJJB 4PJDF 1ZGLB 4MAUL 4XAKD 5BV7H 3FHQA 3B2UD 1UG9A 4NJAL 3PHQB 3CFKB 4R3SA 1J1XH 5I30L 1XCTA 2F19L 3OKOB 1OF2A 5E2WL 1JPSH 4E5XB 3T4AB 1J9CT 4HCRA 5INCB 3IDGA 3NFSL 4N0YH 4P5MA 2QV2A 3I75A 5EC2A 4QRPB 3FO9B 3E1F1 1FNSL 1IKNA 5LGHL 3V4PH 1QO3B 5ADPH 4PRIB 3CFBA 2CMRL 3QCTL 1JCKA 4JKKA 4YHIB 4WWID 5H37H 3T2OA 4FXGB 2ICES 2MPAH 3EYQD 1LK3H 1MRDL 2Q7YB 4GKZA 1YEFH 4JRYA 5E94B 4HKJB 5FYLD 5C0AD 2QKIB 1JWSA 1MFCL 2BVOB 3GIZL 2ZUWA 1NCCL 2A0LD 5LQBH 3RVVC 2X1WL 4HLZG 5F72S 3MV8A 3GSNH 2OTUA 1CD8A 3V6BR 3HUJA 4PJ9B 1U8JA 1CDYA 3G6JE 4JPWL 4NC1E 4TSBL 1S7UA 3QPXL 1AHWC 4Y4HB 1FC2D 1RURH 3H42H 5EZIL 3LS5H 1NLBL 2FL5B 1ZXQA 2OL3B 1EFXD 3MLXH 5DJ8A 2QADB 3DETC 1OT2A 5E1AB 1MCWW 4NKIH 3ALXA 1WTGT 4G9FB 4ONOA 1YMME 1N5YL 1G7HB 3I6GA 3IDMB 3E2HC 4NRXA 3SOBL 4WNQB 5F7LB 3MJ7A 3FONB 3IFLL 3Q48A 2Z92A 2YPVL 5FFLA 3UTOA 1O7VA 1XH3A 5KVFH 4Y16C 2OL3H 1ZE3C 1M71A 4ZOEA 2B20A 2HFEB 1NFKA 4WEBL 2Q20A 3BP4A 2QSTA 4GBXB 1R5IA 4NO5A 3B9KC 4Z6AT 2HTLC 4ONFL 1VADB 4NN5B 4M7KH 1F6LL 1JWMA 1ZV5A 4R97C 1PG7W 3N9GL 3TH2T 5DURB 3L9RA 1EV2E 1DTUA 3MJ9A 3UMTA 1FL3B 1UCBL 3KG5A 3A6BL 3UBXA 4JFPA 2AXFA 3AREB 4NQCA 3S36L 4NKMB 3M8OH 1U8QA 3D9AL 1ODAA 3S37L 1N59A 2XACC 3VD7A 2AV7B 4GRLA 4P2RA 3T0BA 3F7VB 3OG6B 3PWPE 3QZWA 3KJ6H 1AFVH 1RZFL 3TBWA 2NY0C 2IAMB 5C0BE 2YBRB 1BGXH 2JTDA 3X14A 3GSOB 3QIWD 1IAMA 1QZ1A 3IU3B 3AB0C 4EVNA 3C08H 2NW3A 2VXTH 3EOBA 4CMMA 1YY8B 1LO4H 3HNTL 5I8OH 2W9DH 1RQ5A 4O51B 3HC0B 4ZS6D 4V1DA 4G3YH 3QHZL 4JM2F 3SEPA 3O3UN 4LPUA 4PJXB 2OTWB 2OQJA 1ZGLP 5D7JB 4JKPL 5F7EH 1DQML 1OQOA 5JMRA 3L3IB 2HJLB 2BNRA 4Y1AA 1KUMA 3CUPB 1PLGL 5INDA 4F7EA 1FJ1A 3G5XA 4YXKL 3OKKA 1BD2A 1TXKA 4BJLA 1MCIA 5JOPD 4HIXL 4M1DL 1I1RA 3ZT5A 2KPNA 5ANMB 1MCLA 4YHZL 3MNWA 5IM7A 4L4VD 5DMKB 1RK0B 2FO4A 2NW2A 5IVXF 3DX6A 5HY9B 3OX8A 3ESVF 1PKQA 2B5IB 1NAKL 3DX7B 1HHHA 3FFCD 2YD4A 1OAZH 3V7AE 4CU7A 2YRLA 1J8HA 3BN9C