4MS8C

42f3 tcr pcpb9/h-2ld complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
199
structure length
196
Chain Sequence
SVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQMLLKYYSGDPVVQGVNGFEAEFSKSDSSFHLRKASVHWSDSAVYFCAVSAKGTGSKLSFGKGAKLTVSPNIQNPDPAVYQLRDSKSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNSIIPEDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 42F3 alpha
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus
total genus 33
structure length 196
sequence length 199
ec nomenclature
pdb deposition date 2013-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ms8C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ms8C01
5GS3A 4FQ2L 5F6HI 1N59B 3M17B 2IH3B 5LCVH 4JKPL 4HS6A 3QIBA 2EDJA 1N6QL 1PG7X 2ZCHH 1YQVL 4RGNC 3WIHL 2Q87A 2X40A 2AK1L 4HHAA 4KVNH 4XAWL 3TBVB 3BKJL 5D9SA 3UJJH 4NFBA 3NH7H 4NC1E 5J4MA 2E8ZA 3D0LB 4U4BA 1U8LA 1INDL 3HMWL 3H3BC 1JVKA 4FQ2H 5JPMA 4XCCH 2V9RA 5F7DA 5IB5B 5IHUL 4KKBC 5GRXG 2YPLB 1HILA 3DLQR 4AIZB 3C08L 3FONA 4HD9A 2B4CH 2M26A 4IRZL 1KIPA 2PYFB 1FFRA 4GRWF 2AK1H 2ZG1A 2Y7QA 3BIBX 3S8WA 4YIQB 4KQ3L 3X17A 1CDJA 2GUOA 1MCQA 1SBSL 2ZUVA 2ADJB 4JPIA 3S3PA 2YPVH 5FKPA 1ZGLM 1T83C 4HX1B 4U1HA 3HPJB 2HLFC 3HMWH 3V0WH 4IRJD 5DVNA 4MHHG 4HIJA 3ZTNL 32C2B 3JUZA 3GMPA 4L8DA 4ZFGH 5KN5B 5IHUH 3VFPA 3OAZH 3V4PL 1S78C 3MGOB 4N8CL 4LF3B 3GHBH 4HKJA 2Q8AH 1T0MB 1VEOA 1MAKA 4HS3A 4ZPVB 5JOPD 5GZOC 3MOBH 3QXDA 4QYOA 1FCGA 1RAMA 1LILA 7CGTA 3IF1A 4P2QE 5C3LD 4U2ZA 4KQ3H 1F11A 4PJ9C 2NY0C 3G6JE 3KNBB 1FG2A 1MAML 1R3IL 1KG0B 5TDOA 1W72H 4P4KD 4JG1L 4D8PA 3P4MB 4LSSL 3U0WH 1NLDL 3O3EA 3JSSA 5ACMA 3ZTNH 4X6FB 1T20A 4MAUH 1UWEL 2XG4A 3JWDL 3V4PH 4DQOH 4N8CH 1X5FA 4YXKH 2XQYK 3QQ9C 5L7XL 1UFUA 2ILLA 4F57H 4HMEA 1EK3A 4OSUH 1QBML 3QRFM 1CK0H 3KAAA 4LCIH 4RMTA 4DVRL 1FJ1B 1R3IH 3UMTA 1KCSL 4K9EL 3RFZC 3NIDE 3QFDA 5KAQF 3T3ME 1IGJB 2WBWB 2JJTC 2XWBB 4NRZA 4YHNA 5DHYB 3JWDH 3LHPH 1DBKH 2G75B 1JHLL 1EO7A 4XCFH 2PCPB 3LS5H 4P5MA 3MACH 4WY7H 2HKFL 2NR6C 5DURD 5HHOD 4LLUA 4WNQA 4NO2B 4YO0B 3S96A 4XMLL 4DVRH 4MJ6A 4C83B 4WV1B 4JZNB 3MLUL 3MYZA 2HJFA 3LKOB 4ODXA 5IWLC 1KXTB 5J12B 3OKKB 3QEQA 5GS0L 4FQJH 4EI5A 3FQWB 4R7DB 1I3GL 3QUXD 5EO1A 4RGOL 3TCLA 3WL9A 5IBLD 4JDVB 2Z8WC 1A2YB 1O5DT 4R4BB 3J7HA 4TUJB 2C3VA 2HKFH 5JOPE 4ZS6C 3I50H 5CP7A 4DN3L 5C0IA 5TDPB 1NLBL 2WP3T 3RGVC 1NKRA 2ZCKL 4BUGA 4XMLH 3Q5TA 3KYNA 3C2SA 4JCLA 2GFBB 2OTWB 2EIBA 3MLUH 4Q6IB 4BZYA 4Y4HC 1I9RH 3VXUA 5JOFA 3DIFA 5GS2H 1BJ1J 1F4YH 1ZHBA 1XH3A 3MJ6A 4X6CE 5GS0H 4HKBB 4YR6A 4M5ZH 3HCVA 5EUOF 3GI8L 4G6KH 1IKFH 2ENYA 3QIBD 2VITA 2AXFA 1ZA3B 2VISA 4QXGL 3QDGA 1HQRA 4K7PY 1ZVYA 4Y4FB 2RQ8A 1LP9E 5FKAB 3RDTC 1E27A 3V5KA 4NKOB 2PN5A 4PGDB 5HDOA 1CL7L 3B9KB 3DUSA 4RMVA 3U36A 4LP5A 1MNUH 3FFCB 3QUKA 1BVLA 3F7VA 5F9OH 5T5FL 1AGFA 4GH7B 5AAWA 5ESQB 4XPBL 4WDIB 1N26A 5E99L 4I77H 3LY6A 5EOQH 4LHUD 5AZEL 3MLZL 4HV8B 4OI8A 1HXYA 3D3VE 1TETH 3GJFB 1V05A 4N0UB 5HHOE 2A77H 2AI0L 4Y16A 4JO4L 3T0EB 1KB9J 3S35X 3LEXA 3BP4A 1L4IA 3FO2B 2X9XA 1YY9D 2X44D 4MA7H 5E99H 3GKWL 2MPAL 3SKUD 1QR1B 1ETZB 2DTSA 3V8CA 2VDPL 4APQA 5DA4A 3WKMH 4KXZH 2HWZH 5HGAA 5MERB 1OTTC 2QQNH 3TBYB 2F54A 1K5NB 1A9BA 1MCOL 4NT6A 5BVPH 4JO4H 3S36X 3GMLA 2EIZA 3GI9L 3L3GA 2P5WB 3VXRD 2F74A 4WUUA 3I6GB 2XPGA 2OXHA 1T1ZB 5H35A 1I9JH 5DD6A 1RUAL 4GUPA 1MJJA 2FLBT 1FZMA 3MJGX 1MF2H 2X89D 3ULVH 2YD3A 1A3RH 1IGCH 4HIEA 4QCIB 5KSBB 3WHE1 4ELMA 5B3JF 3CC5A 2VDKH 1XF4A 3DBXB 4UT6H 3WNLA 1BJ8A 2E6PA 1SJHA 1EA9C 3GI9H 2PO6A 4K7FB 4NOBA 1P6FA 3OX8A 4WHCA 4FXGB 5EBLA 2NW2A 3O9WD 1GZPB 1ES0A 2VC2H 3QUML 2AJUH 1CFBA 3UO1H 2NY0B 5E94B 3ZKMD 4LCUB 4EVNB 1S7RA 5HYEA 2YEZB 3E6HB 3JTTA 1FAIL 3HB3D 3IAGC 5EBMA 5D1ZD 3LEVH 3KDMA 4KK8D 4PP1D 1XR9B 3T77B 3DX8A 1RUPL 5TE7H 3GSVB 1NC4B 1CL7I 1I1RA 5EC1A 5FCUL 4XP5L 1EH9A 3WEXA 1KOAA 4GKNA 5DEFB 1I8MB 2B5IC 2XWJB 2KPNA 4U6XB 3KLHC 1L9MA 1HCVA 1KB5B 3QUMH 5DTFA 4NZRH 1CS6A 4F7TA 3SQOH 5FDWB 5IMMB 2YN5A 1QVOA 3KPNA 4RX4A 1DQDL 4YDLB 3A6CL 2X4QA 1QLFA 4RFEB 1WFTA 5K93A 3PHOB 2A1WL 1RUPH 4XP1H 4AQOA 2FIRT 3DMMD 4NZTL 1INEH 1G7PA 3MROA 3UXFA 1A14L 3VXRE 2HJLB 1L0YA 1OAZL 1XGTB 1PAMA 4ZS7H 4JGJA 2DM3A 3SOBL 1T7WA 5K9JL 1XIWA 3A6CH 4LEXH 5HGGS 4YK4C 4GRLC 3HNVL 3P77B 3GMMB 4HCRL 4LLAA 2A1WH 1IAIH 5ADOL 1PKQE 3HG1B 4JM2D 1ZA6B 4H8WC 3U30C 4EDWL 1A4KA 2DM7A 3BESR 2EYRB 2ZUXA 5FB8B 4PGCA 3QEGL 1Z5LB 3UTSA 2ZNWA 3CDGA 5JR1L 3IAQA 4G8GA 1FL3A 3QJHB 2DQGH 1KC5H 1U2CA 3SOBH 3PJSB 4Q0XL 3AAZB 1JGEB 5EIQA 4Y4HB 5GIRB 5IQ9A 4KDWA 4LRIA 4RWYL 3S97C 1BD2B 1OL0A 3UC0H 2WBJA 2VXVL 3UTOA 1CVRA 3ORJA 3KPMB 4EDWH 3QEQE 3DURA 5EC2B 1ZVSB 4HJ0D 3QEGH 3NPSB 1NBYA 1TTUA 5KG9B 5DFWH 5HHXH 1J12A 1DQJB 3KLAB 2PXYA 2HH0L 4MXQC 3LN4A 4Q0XH 2GSGB 1YNKL 2HA1A 1UACH 3VI4F 4RWYH 4NKQB 5I1LA 4GG6B 4EEEA 1WIPA 3N9GH 1JGUL 1L7IH 2VAAA 2XKSA 2HVJA 3HAEA 4XT1C 3EYSH 1UCBL 4JO1L 4UIKL 3L7EB 3RVXC 1UZ8A 1IM9D 2ZG2A 3VDBA 1KNOB 1U6AH 1RY7B 3G04A 3L1OH 3S5LA 3SKOA 5B4MC 5EN2B 4F80A 4QRRA 1QPXA 4RMQA 3CNKA 4TSAL 3NFSL 8FABA 5DUBB 1KUMA 2DLGA 4P57A 3K1DA 4HWNA 3REVB 4G8EB 3BO8B 3IFNH 2R56H 3I85A 3Q3GB 4JFPA 2A74B 3MRHA 3VE0A 4FNLH 3WHE0 1JGUH 1I9IH 2VUOA 2Z8SA 5J9PA 1ZANL 2D7OA 4XVUC 3IDMB 1EO8L 2BNRA 5CP3A 1I8IB 5HJ3B 2VL5A 1M6OB 3EDFA 1W0VA 1M7XA 4C57C 3W0WB 5JHDB 1L6XA 4MCZA 4UBDC 4DZBB 3BWAB 4J3WA 4Q9RL 5ILTL 3IJSA 2NCMA 1AC0A 1T0NA 3RWFB 2PR4H 5E8OB 3KXFB 1D5ZB 2NMSA 4ZSOE 4NQVA 4ETQB 5CJOH 3WFZA 5TE6L 5AZ2H 1DTUA 1K6QL 1EO8H 2BMKA 2W1NA 4OUUA 1QRNB 3RWCB 1FL5B 1I1YB 1YECL 4HC1H 4P49A 4G5ZL 1WAAF 4LASL 1RIVL 2VH5L 4XZUA 4FMFA 5JUEL 2F54E 2MQCA 1S5IL 4L1DA 4Z8FL 3HI1A 5I19H 2C26A 1U8QA 4NOFA 3MV9A 2PF6A 1YYML 3ULVF 3RWHA 1HXMB 1MCWW 4R96A 1F3RB 4P5KA 5EOCL 1U8KB 3MJ9A 3AU1A 3QNZB 4WUUE 1YMHB 1YECH 5JLZB 5J57B 3HS0B 3CFDA 5HGBA 4OZGE 4X99A 1N4XL 4G5ZH 4S0SD 3MV8A 4LASH 1RIVH 2VH5H 5IT2L 1D6EB 3WUZA 1AXTL 3EYOB 3C5SB 1BZQK 4J6RH 3UZEA 4J4PC 2EO9A 5HI3D 4OLZL 3VFRA 1Q8MA 43CAB 3PDOA 4ZUUA 5CSBA 1GZQA 1LO2L 1LO5B 1Z0MA 1CFVL 1YYMH 4KRPC 1JYXA 3W39A 5C0JB 3UTSD 4F15B 2ESVB 2R1YA 4IDLA 3FT4A 3EO1A 5C9KA 4PLJD 1LK3H 2GCYB 1N4XH 5IG7A 4UIMB 3LPGA 2A6IA 3TPKA 4ZQKB 1R3JB 5J1SC 1UWGL 3PV6B 4MB3A 3ARYA 3C2AH 1IQWH 1DLHA 4KY1L 1WSST 2BFVH 4X98B 1LO2H 3LKPB 1CFVH 4PLKC 1ONQB 1U8IB 4EQ3A 1INQA 5KSBF 4G42A 5HHPB 3ZDZE 2EDKA 3K8KA 1NMCC 3FOLB 4JZOB 2WWKT 4YK4B 4GRLB 1KLFA 4TTDD 2B0SH 5A16A 5ALCL 3DTXB 4FG6D 2CDFA 4X5LA 1XGPB 1OF2A 3U30B 4X8JB 1PEZA 1Q9WA 2EIDA 4KC3B 4OD2B 3S35H 5LAXB 2DQEL 3MRQA 4ZNCD 3X3GH 3KPSB 1KTDB 3VJ6A 4GW5B 4FFZL 2AJYL 4YBQD 3F6IA 1A7PH 3WFDL 1J86A 1V5JA 3BT2H 3BZFA 3V6FA 2VDRH 3T8XA 3ZTJG 4FFVD 4YHOL 4MA1B 3N06B 1RZFL 5J6HA 4PUBH 3QEUB 1DN0A 3QDJD 5DJAA 1LQSR 3NGBC 2QJDA 2W9LA 2RFXB 1NC2B 3I6LE 1QSZA 3ARTA 3BKYL 1C7TA 1UENA 1DN2A 1GOHA 1QNZL 1QSEB 3BP6B 1N64L 2YOCA 4NNYA 2BNRD 4JFEA 4TRPH 5FK9B 2OJEB 5C09D 5E9DA 2OP4H 3AXLA 5T1LD 3UTSE 5D7LB 3GDBA 1UVQB 3QAZB 1D6VH 4NZJA 2PTUA 3RIFF 4XPHH 1T3FA 2YA2A 1EDQA 5INCB 3MLWH 2WINA 3F7YB 5CJQL 1I8KA 1UB5B 1MWAB 3N50A 1NCCL 4PG9A 3V52H 3HZKB 2DQJL 1QFWL 3BQUD 4XHJD 1UWXK 4O2EB 4MJIB 4MXVF 2XNAA 5FGCE 4QRUB 4H8WH 1QNZH 2QQKL 1HCFX 5HDBE 3VGHA 3SO3B 1HYSD 3RY4A 2GHWB 5HI5C 4L1HA 4M8VA 2DTMH 2EC8A 1SYSB 4PJCB 3BJLA 4HGWB 3DXAB 1A02N 4BFIA 5FA3B 2H9GB 4JO2L 1GXEA 1QZ1A 3KJ6L 4RFOL 3A0OA 3JV6A 2DQJH 3HA0A 1NDMB 1QHPA 1T7XA 1QFWH 1JGDA 2YUXA 4TVSa 5C86A 3MV9D 2MJWA 4CMHC 3G6AA 3U6RB 3O45B 4U1LB 1TMCB 3LQAL 4ZG1A 5EUOA 43C9B 2IANA 5EORL 1BX2B 4MCYB 4J3TA 3KS0J 1LO3L 2FB4H 4HH9A 5F7YC 4J3UA 4L4VA 5A2FA 4IRSD 5B8CB 4ZTOL 1KTKE 12E8L 4CW1A 5FF6A 2OI9C 4RMWA 4MA8H 2X1XR 4PBVC 5EO0A 2NY4D 1FDLL 2ZOKA 4AZ8A 3L3JB 3QWRA 3QDJE 3SDAA 3QXTA 4L29A 5IVXB 4F3FB 3Q6FB 3AREC 1JHKH 3D25A 2O5YL 4M00A 4AK1A 4M62H 4MAYC 5F6IC 4F7PB 3UTTB 1FQ9C 1AR1C 3K2UL 2BNRE 3B5GA 5C09E 1LO3H 1WV7T 3MBEA 3MX0A 2B1HH 3DVGB 1ACYL 4NSKB 3D18A 2VR5A 4ZTOH 1I7TA 2GJZA 2GKIA 1TVBA 5CGYC 2WLYA 5IMLB 1C8PA 3WN5A 1NCTA 1GPOH 5L9DH 5GZNC 4M9OA 3PGDB 2IAMD 1EEZB 1VACA 3LRSA 1JWUB 1YEKL 2W9DL 3MFFA 1MLBB 3QUYA 4M6OL 2FECL 2FNBA 1JNLH 5C08A 2O5YH 2FO1A 4O02L 2ARJQ 3VG0H 5E5RB 5E2VH 1LK2B 4JPKH 5I1EL 1XF1A 3EO9L 1DDHB 3MNVB 2HTKD 1ACYH 3NN8B 4NFCA 5E24E 3T3PE 2ZPKL 4ODTL 2CMRL 2R15A 1PBYA 1QR4A 2O5XH 4BSWA 3OKNA 3SKNA 1ZT4B 1NL0L 3MA9L 4KRPB 4M6OH 2OL3L 1GCFA 2F5BH 3QIUD 4O02H 3MV9E 4YGAB 3IDUA 1MQ8A 4OQTL 2ICWB 4GBXB 1AKJB 3GMOA 3RVTD 1A6TA 1IC5L 4LIQL 3IYLW 5EWIH 1G7IB 3SDXB 1LD9B 1MI5A 1G84A 2LVEA 1WC7B 4OB5L 1N8ZA 5HSFA 2ZPKH 1RUQH 1B9ZA 2CMRH 3L5XL 5DQ9A 5MEQA 3BEWB 1WTGT 2X1QA 1NL0H 3IGAB 3VH8B 1BBJB 3TO4A 5DK0B 4ZYKA 2OCFD 1HNGA 3DVNB 1JWSA 5IVOA 4OQTH 3O6FC 4NUJA 5FUCE 2CGRL 1TJGL 2DMKA 4X6BA 3KHQA 1ZLUH 5KZCD 4HT1H 4NRXA 3K81A 1YN7B 5H37H 4GRWE 5DD0L 5IFJA 4HEPG 2FH8A 2D0HA 1NEUA 3M17A 4NQSB 2IH3A 3VXNA 3L5XH 5FYJL 2VWEE 4P23D 2MMXA 3B8YA 1FVDB 2XZCH 1TZIB 5HD8C 2VDLH 1UXSB 4L8SA 2VXSH 3FQNA 3HUJF 4LVNC 3TBVA 2Z31B 3PE9A 5HPOA 1R3KA 3QXVA 4HBCL 3IDIA 4AM0B 1W72A 2EE9A 2F5AH 2A9NL 1TJGH 2CGRH 1G9NH 1T6VN 2VLRB 1BAFL 2VDNH 1U8JB 1MCPH 5E08H 5C0ND 2E7HA 5GHWH 2YRZA 3CH1B 1ACZA 4JFQB 4I3GA 2ZNXA 4YAQB 5IB5A 1AI1L 4UILL 2YPLA 5CGMA 3B3IB 4AIZA 2CJUL 4XMPL 3WUWB 1QG3A 1LEGA 3ILQC 5EPMA 2DBLL 1TJIH 3R8BB 2EYTB 5EULV 5IM7A 3TESA 1NGYA 2R0LL 1KJ2B 1R5VB 2QQQA 3IDYC 1I85C 2B2XH 4LHUG 2DI9A 2AJ3A 4M7LL 3UBXB 3QDMB 3RZWA 2QTEA 5C0BA 1C16B 2AQ1A 1UB6A 4POZC 2JE8A 1GC1C 32C2A 4OLUH 3QI9B 1P4BL 1F6AB 5BVJA 3V79C 1CWVA 4LF3A 4P2RD 3GNML 3DX7A 1T0MA 3CFBB 4PJ7E 2PTTB 4ZPVA 3AGVA 1HDMB 1RZKC 4PTUB 1BLNB 4P3WA 5GGVL 3VWKB 4G8IA 1NCNA 2CRZA 3FQRB 4PJGF 3VI3E 1KG0A 4HK3J 2YC1B 3GMQA 3UYPA 3P4MA 1YZZA 1OPGL 5GS1A 4MVBD 3P73A 5T33L 5CCKL 1CFSB 5DRZB 2ARJB 3MCLH 5EZIH 1YC8A 3WDHA 1FJ1A 1S9XB 3PNWB 3WFBH 1KJ2H 1HZHH 3AS2A 1U41A 1IKNA 1TTFA 2H45A 1E4KA 4MNQB 2XWBA 1J88A 2O61B 5J7CC 2NYYD 3AREB 4TN9A 3QULB 2G75A 1CDBA 3BH9B 2PCPA 5T33H 2A6DB 1ZXQA 3QNYB 5EUOE 4ONHB 4PJBB 4Y89A 3WXVL 2Y06H 1A6AB 4NO2A 3QHFH 3C60D 1DQLH 4WV1A 4WW1B 4JZNA 5A3IC 1YMMB 5DFTA 4P5TC 3CSYA 4XI5C 3GSNL 3FQWA 2VMFA 4R7DA 4DW2H 2YUVA 4DKEH 1X5ZA 1L0QA 4LLVB 1A2YA 4R4BA 4P2RE 1KLUA 4H20L 1FGVL 4DTGL 4PJCF 4HSQA 3OJ2C 2FHCA 1X5KA 2V2XB 3DARA 4N0CC 5HYQA 1MFCH 2DQUL 5TDPA 1H5BA 4HPOH 2J2ZA 1B90A 3GBLA 4QXWA 3AY4C 4Z9KB 3CXHK 1KENH 2R0KH 2IFFH 3NPZB 1BFVL 4HKBA 1AC6A 1VKXB 4U1NB 3TNNB 4ODUB 2YA0A 2QL1A 4KMQA 2V2WB 3U7AA 1ADQL 5C08E 5F93C 4H20H 1FFOB 1Q0XL 3SDCC 5HYJB 3FN0L 1FN4B 2Z8RA 4Y4FA 2DQUH 2JB5L 2BY2A 2WIMA 5DUPL 1F90L 1E6OL 2AK4D 1DLFH 5IVXF 5ESAB 5A2LH 4WU5B 5IQ7L 3B9KA 3KPPB 1FLRH 1WAAA 5E6IC 4OT1L 4JQIL 1ZLWH 3CJJA 4AENB 3PWPA 2VERN 3G5ZB 3S37X 5ESQA 4WDIA 1G0YR 5I75B 5T3ZD 4PJXB 4HV8A 4JFDD 4OLYH 1Q38A 3MLYL 3F7QA 1RFDL 4WHTA 4YPGB 2YHGA 4MD0A 2FGWL 1JZ8A 1T5XB 5GGQL 3MLVH 2BY0A 2W60B 1X5IA 5DUPH 1DBAL 4GXVH 4EN3C 1E6OH 1MI5E 1WFUA 1C5DB 3T0EA 4K71C 4ODBD 4CNIB 2VLJD 4JFOA 2LQRA 4K3DL 4MQSB 1HINL 4JQIH 4M93C 4QHMB 3VMOA 5EBWB 3GFUA 1MH5B 3U7WL 2VZOA 4PRHD 2EDFA 5FM8A 1AE6L 4AL8H 1QR1A 4C58B 1ETZA 3P4OA 3DWTA 4YZFF 1RFDH 5EU6A 1EHXA 5HHNB 5D71L 2FGWH 3B2UC 5MERA 3TBYA 4XC1L 5GGQH 1K5NA 2EDRA 3T0VA 3X11B 5F71A 2R0WL 1AGBA 4LNVA 4BM7A 3VFMB 1KN4L 4CJ1A 3EYFB 4NHCH 4WENB 2VR4A 4KH2A 1HINH 1R3HB 4Z77A 1ROWA 1U8OB 3U7WH 3QUMA 4LAJH 4NN7B 4UDTB 4G3YL 5SX4I 1AE6H 3R0NA 3IDYB 1T1ZA 1QQDA 4QNPF 1PSKL 3MJ7B 2GQHA 2Q3ZA 1T83A 1JTTA 5D71H 5KSBA 3L6FA 4RMUA 4Y5XC 3DBXA 3LZFL 1BPVA 1F6LL 1KN4H 4RDQG 5FGSA 1QTYT 4K7FA 4M3JA 1P7QB 4TVPL 5MENB 2YPLE 4Z76B 4G3YH 4BKLA 2YZ1A 3CXHJ 1VFOA 1A0QL 2NLJB 3UPAA 5E94A 5T3ZE 1SEQL 4JGUA 4QRSA 4EVNA 1D9KB 5DSCB 5E2TH 4LVOB 1XR9A 2ERJB 1U3ZA 6FABH 1NC4A 4JRYB 4XNZC 5IW1B 1GC1L 2ZKHH 5LGHL 4QXTA 4KUCD 1EHNA 3O3BB 4JY6B 5DEFA 5I73C 3OXRB 5AYUL 5CBEA 1I8MA 4U6XA 4X4YA 1DFBL 4M61B 2I9LA 3VA6A 3WS3B 1J5OH 5KSUB 5IMMA 1SEQH 2B39A 4PRBB 4XMKH 4RA3A 4KKLD 1K85A 4Y8DC 5KTEL 3O8XC 2FWOA 2JJTA 3W5MA 3PHOA 1VADA 5IESL 2OR7A 4XX1E 5D7JD 4BQBA 4NJAL 3S3SA 3EFDH 1GC1H 5LGHH 4FTVA 1OTSC 4JKKA 4PRAB 1IZKA 2UY7A 2XACC 5I8KL 5KVFH 4KK5D 1ZS8A 1RURH 1UYWL 5DJ0B 3F7RA 1MFBL 4JEGB 1KPRB 1RZKH 5SX5K 1D5MB 3GK8H 1E4WH 4AG4H 2G5BB 3GIZH 2H1PL 4AEFA 4YHYC 1FO0L 1EFQA 4Z7VF 2FGZA 5IWLA 1L7TL 5K9QI 3BPNB 1K9TA 2H41A 2WV3A 3GMMA 3CU7A 4P2OC 1NFDF 1SMAA 2IQAB 3HG1A 5I76A 1ZA6A 3FFCD 5FB8A 3VI4E 5JIKA 4LDOB 2YXMA 5CEYA 3BRFA 3WNMA 3RVWD 1U8HB 1BQLH 4I3SH 2GTWA 5I16A 3RGVA 2ADFL 1P69B 5FM5M 2R8SH 3PJSA 1FBIH 4BZ1L 3AAZA 4HUWB 2A6KA 4LKXB 4Y4HA 5GIRA 3LKNA 1TQCC 2P5EB 4G7VH 4XPGH 5ISZD 3T0ED 1F4WL 1QHOA 1RUML 3UZQA 1GGUA 4QF1B 3BEVB 3AS3A 3KPMA 5FUZL 3DO3A 3SCMC 4M5YH 5JW5B 1X7QB 1QYGL 1R0AL 3FCTB 1CDYA 5T1MA 5ACZA 4U1KB 5CEZH 5FO8B 5KG9A 4RGMC 3KLAA 1AGDB 1RJLB 5EFIB 3RDTA 4BZ1H 2E3VA 2Y23A 4LHQB 5DLML 5J3HD 5I66A 4P3DB 4YHPB 5EB9A 5F7KC 3BP7B 1F4WH 1N5AA 3PL6D 3QFJB 4MDIB 4LARH 4I2XA 4JM4H 4X80H 5D5MB 2P5WD 3HAEG 1QYGH 1LDPH 4HC1A 5C0GB 4JO3H 4IMLB 4F37K 2DLTA 3SPVB 1VPOH 1QLRB 2DYPD 4A2MA 4N1EA 3O4LB 2XWTB 2AV1B 5DUBA 3LSOA 3MR9B 4G8EA 3BO8A 5D2LB 2P7TB 5KANI 4BH7B 5I6XC 5I2IA 3MRBB 2F53B 1WAAE 2P8MB 1G9MC 3IDMA 4HMDA 5TGBB 3MREB 2ENSA 3FFCE 4YUEH 1AXIB 4X7CC 1M6OA 1UXWB 4U1MA 4ZPTA 3C6LC 2E9IA 4GQ9L 1BM3H 3NCJL 1HE7A 2CLRB 4YFLF 3W0WA 2F8XC 2DICA 3HLAB 1T89C 4LCWA 2O5ZH 3ULVE 2NY6C 5EG6C 3U48A 2YD5A 4G9FD 1JRHL 4H1LG 3HE6D 4BUHA 3RWFA 3WKNA 4N0UE 5KW9H 2HFFA 3GMNB 4NQTA 5E8OA 4MS8D 4F2MB 1NC4D 2DDQL 3T0EE 1PW3A 4HUMB 1CVSC 2P24B 2MWCA 1A7NL 2I07A 3QQ9D 4FQXD 3V6OE 4J3OC 1QRNA 4NZUL 5HYSB 1VA9A 3O2WH 2VQUA 2APWA 3RWEB 2CDGB 4X5WB 2H32B 1FNEB 1RHHA 2LABA 5B3NA 4GMSL 4NC1C 4AIXA 1JRHH 4QWWC 5E8NB 4X7SL 5C92A 2IBGA 2XA8L 3SKMB 4I9WD 1OAKH 5KJRL 2J12B 4IJ3B 5B38A 2DL9A 1HXMA 4Y7MA 1U8KA 2IQ9H 4PJ8C 3QPQD 2P5WE 3ZDXF 5I1GL 3QNZA 3HUJA 5JW4N 2PNDA 1MFNA 2C1PB 2KZWA 2YD9A 4U6HB 4IOIA 2J8UB 1Z3GH 1NEZB 4HWUA 3VFOB 4W68A 5KSBE 3TIEB 3RVVD 5DMKA 2XA8H 4ZOCA 3HG1D 3MRPB 1FCCA 1K2DB 3FT3A 4XCEB 4TTGA 5CWSA 3WFHA 5C0JA 2F8OA 5JTWA 4CMMB 5BCAA 1XGYL 5HHVH 1UM5L 1JFQL 3CVIH 4JFFA 2DL2A 5I1GH 4OCRH 3H9HB 5EU7E 5KSAC 1IM3B 2GCYA 5E0QA 5F96H 3V4UL 1A9EA 2CXKA 5JXEC 3L5WB 5FYKH 4OFYD 4ZQKA 1YNLL 1R3JA 5HPMB 2QHLA 1BD2D 1T7VA 3MNZB 2LVCA 4S1DD 1FYTB 5I18H 4X98A 3BRDA 3O3DA 3IVKB 3D39A 3LH2H 4L3AA 3T0XA 4LSQL 3N1FC 4JQVC 1ZGLA 1UM5H 1JFQH 3S37H 1TCRB 1F8TH 1T04B 4YHYB 3BE1H 1PQZB 5T1DL 1OAYL 4D0CB 4JZOA 1I1AD 4GRLA 4P2OB 4PJGA 2FCBA 2BC4B 3DTXA 3E3QC 4OLWH 1XGPA 2IMNA 1MCKA 3KPOB 4X8JA 1FZOA 4QRPB 3BPLB 4OD2A 3TWCL 5JXAH 4JVPA 4I9WE 4KJQD 1B3JA 1GVIA 2QEJA 5T3XL 5D1QC 3NZ8B 3ET9F 1W8OA 5D7IF 5T1KB 4GW5A 4O2CB 2EE6A 3PP4L 1XF5B 1RULL 4NBYB 4OFKA 3MRRB 1EVTC 1TQCB 4S0TD 1G6RB 5ITFB 1AIFB 3QEUA 4JG0L 3RTQC 4F7EA 3A67L 1HWGB 4NO0A 3CVHH 2RFXA 1NC2A 2XI9A 2FJHA 1FSKC 1MHCB 1YDPA 4NM4H 3HG1E 3LEYL 1GGIL 2B1AL 2XFXA 2YD7A 4IRJC 3BP6A 1U92B 2R2BB 5FFLA 5FK9A 1CDHA 4RGMB 4WVRA 4BSJA 4J3SA 3CDFA 4MJ2A 5D7LA 3EOBA 4Z6AT 4N9GA 3W0WD 3TIDA 1RULH 1DR9A 5JHDD 2CQVA 3OXSB 3TPUA 5C0CD 3ALWA 1X5JA 3SBWC 1GGCL 3G5VB 1A3LH 1F00I 4JG0H 5I1JL 3D0VB 3A67H 5SWSA 4LQFL 3KXFD 4NZDA 4LSRL 1FH5L 3HRZB 3HZKA 1BD2E 5ALBL 5C2BH 3RI5K 4P4KC 4QRUA 3BGAA 4M48L 3LEYH 1CDUA 3MRMA 1UCTA 1XZ0B 1QRND 5ELIA 1TLKA 3MOAL 4NQED 3ZHDA 4PJCA 5K33A 4HGWA 4PJDB 5DUML 3CZFB 2EC9U 4Z95L 1M7IA 3EO0B 1GGCH 5FA3A 2H9GA 1G7QA 3PWJB 4YHIB 5I1JH 1YC7A 3HFML 5I6XB 5DK2B 1G6RH 4NGHL 1NCWL 1WQVT 4GG6E 5BRZB 1MJUH 2HVKB 3U6RA 1IVLA 4U1LA 4Y19B 4DN4H 1J87A 4OD3L 3B6SB 3C6LB 2F58L 3STZA 1BX2A 1RJCA 4MCYA 4MZ3A 5L2KD 3AM8C 4GRMA 4ZODA 2NY6B 1I1CA 5HVHB 4G8FB 4QHLB 1Z0NA 5CHNB 3W9DB 2HKHH 3RNKB 3SKJL 3LB6D 3MXVH 5ICZA 2C4FU 3L3JA 3KYOA 5IVXA 4NGHH 3HKFA 3Q6FA 1U93A 5E2JA 2H3NB 1YYLL 1F4XH 1RU9L 3HE7B 3T65B 3MO1A 4F7PA 1MFEL 5J06A 4OZFB 1S7TB 2ESVD 5EU3B 4EI6A 3QUXC 4GAJH 3IFLH 4MLIA 1EUUA 5FUOH 3DVGA 3VDAA 2D7MA 3W0WE 4NSKA 4U1JA 5JHDE 2AW2A 2AJVL 2CK0H 2WP3O 3STLB 3U2SB 3VRLE 1EEUA 3MGAA 1AHWC 5D5MF 2GT9B 5F1NB 3QG6B 2W65B 5I9QC 1JWUA 5I1DA 3KXFE 4OQTA 3P9LA 1RU9H 1ZT1B 3NA4A 5SWQB 4PJ8B 1P9MC 2NW3B 1LK2A 1G9MH 5ERWB 3REWB 2QADB 5EZJA 1Q9KB 1GGTA 1U8NA 1QRNE 4YE4L 3MNVA 3QIBC 1WF5A 3H0TB 1REIA 2VDQL 3NN8A 4JFZH 4KJPD 3BPOB 3C9NA 2VABA 4GRLD 2K1MA 1ZOXA 2GJ6B 4KHXL 4J4PA 4TSCL 5J11C 1XGRB 5LGJB 3RZCD 4E41B 5DJDB 4OGYL 4XNUH 3V0VA 1JF1B 4HDIA 3TF7C 4HIIB 2VSDA 2BZDA 3KPSD 3HZYB 5KSAB 4YDKH 3FFDB 5KS9B 1R3LB 5GPRA 1O0VA 1KPUB 1E4XL 3TVMD 1LD9A 5F1IB 5IEKB 2DN7A 3DROB 1FHGA 5DMIH 2HYMA 4PG2C 3NZHL 3MRKB 2VDQH 2Q8BH 4HFWA 4N0RA 4ZUWA 3L5IA 2X4RA 3GKZA 3FB5B 4Z0BL 4Z0XA 3QPXH 3IGAA 4N8VB 1QSED 4E0RB 4Y4KD 3DVNA 3DSFH 5IVZB 1KCVH 2R9HD 4Y1AD 4QGYA 5BS0A 4FQIL 5D7LD 1NH6A 2ESVE 5FCSH 1YY9C 4PRIA 3O0RL 1OWRM 1A6ZA 3NFPB 5T5NG 4JHAL 3NZHH 3VA2C 3JTSB 1VFUA 4NQSA 3H7BA 1T1YB 1KEML 4OTXL 4R0LC 5FV2A 3ZTJH 4MJID 1UXSA 5D1QB 3MNWB 1AY1L 2DQHL 1UQSA 4I3RH 2OR9L 3VDCA 1UKSA 4OCYL 1BF8A 2K7PA 3OKOA 4QGTA 2J8UF 3BW9B 1ZLVK 1JN6B 3STBA 3DXAD 1CE1H 3NTCH 5BZWB 4JHAH 3RTQB 2I9TB 4HGMA 4KFZC 2C1OA 2BRRL 4QEGA 1BIIB 3TH4T 2JELL 1IRAY 1FSKB 3EYQD 3RQ3A 4M7KL 5CS7A 1CBVL 1OSPH 3WUWA 4IRJB 3H3PH 2EYTA 1JWMB 1NBZA 4NWUL 4LPTA 1CXEA 1NUFA 1DVFB 2DQHH 3UP1A 3QSKB 4YEFA 2BSRB 1N3NA 1KJ2A 1R5VA 3NA9L 3TT3L 1F2QA 5F44A 1FIGL 1P7HL 4M02A 1IGFL 2YRLA 2EDDA 2WIIB 3QDMA 1O7SA 1C16A 3O9WC 3CDYA 1G7LB 4WJ5A 5CD3A 1G1YA 1H3VA 2P49B 5CUSL 5B22A 3ZKMC 4Z7VA 4IM8A 5F1SA 4QT5A 4U05A 4P4KB 1BF2A 3R0MA 3CD4A 1CBVH 3KGRA 3HB3C 1NFDA 3LMJL 1JGLH 5D1ZC 1BOGB 5DT1L 4KK8C 4PP1C 4WO4C 1NKOA 2YZ8A 1HDMA 2WLZA 1UA6L 1BVKA 4KUZH 4PTUA 4X4XA 1BLNA 1QSEE 3UTTD 5L8KB 2V7HB 3NA9H 3GSWB 4OFIA 5CD5D 1HKFA 4K23H 1AR2A 1U91B 4OAWB 4LFHG 25C8H 4MD5B 4TUKL 5CINH 5D7LE 5F9AC 1E4XI 4NP4L 1FV1A 3MLRH 3ULUD 3RWDA 1NJ9B 4RA0C 4PJ5B 4XX1G 2X2YA 4S11A 5I30H 5GRZA 5CJXC 5HHQA 4LPYA 3LMJH 4N5ED 1FNGB 5DHVB 5TDNB 3IJYB 3WIFA 2UVFA 4MJIE 1CFSA 5DT1H 5DRZA 2ARJA 1RZJC 3DMMC 1FRGH 5I1HL 1ZHNB 3IXTB 1P1ZB 3T2NL 4GAYA 1TXKA 1XCQB 3ARDD 2JIXD 2I25N 3E8UL 4PJCE 2QHRL 4M3KB 5HGHB 3DXAE 4E5XB 4G80A 2O61A 4LP4A 3AREA 3QG7H 3QULA 3KWWB 4MAYA 4KRPD 5GSRB 2X05A 5A43C 5FEBA 3OJMB 2A0LC 1Z2KA 3VFGH 4JM2C 4GBXD 3O2DL 1AKJD 2XZQL 4OD1L 1A6AA 3WNKA 1MHPL 1AQKL 1PJ9A 5DYOA 4F58H 1YMMA 5BZDB 5L0QC 3T09A 2BNUB 5IW6A 3ARZA 3IB4A 1CLCA 4JLRB 3EJYD 1TVDA 2VQTA 2BXZA 1QA9A 4PLKD 5IVXE 4TOYL 3ECBB 1NAML 4URTB 1B6DA 2J6EL 5DHVH 2K3TA 3UTTE 3D1MC 1JF6A 2F8VA 3ARSA 4HJ0C 1AQKH 2HRPL 4TNWK 1T2XA 3RWIB 5KOVC 4XWGL 3F12B 1U3HC 3A6OA 4JVWA 1XEDA 3P4NB 3DX9B 3ULUE 2EDLA 2YMXL 2JJVA 1XCTB 2WSKA 2IBBA 5GGRB 2I5YL 2Q86A 3OAYH 3VRJB 2Z31D 1FFOA 3ARGB 2DWDB 1JGVL 1FN4A 4XHQA 2VLRD 1MQKL 3HI6L 1DE4A 2HRPH 2GAZB 4K8RC 3UTPD 4KK9D 2PW2B 5HGDA 4Q74A 1PYWB 1UH3A 1K8IA 1ZKAA 2KH2B 4WU5A 3VXQB 4YZFE 4N0FB 4PJAB 2D4FA 4M43H 2YMXH 1I3VA 5D6CB 1OM3H 4L3EA 2WQ8A 1Z9LA 2NY2B 2FEEL 1CGSH 4LOUD 4UT9L 5DJCB 4MXWL 2Y07H 3ROOA 2AQ3A 3O6FA 4PJFB 5F3HA 4PJXA 3IFPB 3EYVA 1QACA 1KV3A 2R2HB 4TQEH 1MQKH 3PUCA 3I6KA 2W60A 2AQ2A 3SDXE 1C5DA 2IG2H 2DJSA 3GJEA 5ITBL 3QHZH 4M6NL 4CNIA 3PXHA 1IL1B 4HIXH 1A1OA 1H9VA 4KZDL 5I1KH 3QI9D 3DETD 1MH5A 3MGTA 4Z7WB 5HBBA 2VE6A 2RB8A 4XVTL 4Z7UB 5BJTB 4GOSA 3WLBA 1BMGA 2IADA 4NJ9L 4FZ8L 3VWKD 5BO1H 4HUXA 5C0AB 4G6FB 5LXGL 1KJ3L 1EAPB 2FX7H 3ZLQC 3X11A 3TBTB 4MNGB 5SWZB 4DWHA 1GSMA 3RUGB 3VFWB 4M6NH 3BHBA 4PYHA 3EYFA 1MCEA 3FQTB 4KZDH 3VU2A 1EMTH 1CCZA 3GB7A 4JREC 2AXHA 5I15L 4UDTA 4YHLH 5KS9F 2Q7YB 4AJ0A 3BP5A 3GZKA 5DMJB 2VLRE 4FRWA 2BSED 1H8OA 1TTGA 3K4ZA 3QCVL 4P9MH 1K8DB 3FO0H 3UTPE 4MNQD 5GRUH 3W11D 5JORA 3ROLA 3ARED 5IF0B 4IOFD 4W4OC 1P7QA 4MMXC 5FYLD 4WO4B 5EZLA 5MENA 1N5YL 1ND0B 5FO7B 4PJHB 4NRYA 2EH8H 5HI3C 2VSCA 2NLJA 5D7IA 2AVGA 5JIPA 5DEGB 1IC1A 2H8PB 5FIEA 4GKSA 3GSUA 3UJIH 5B39B 3NIDF 4UI2A 3DX6B 3QDME 3D2UD 3BUYA 1UJTA 5EA0L 3OHXB 4Q9CA 2Y9RT 3LVEA 4PLJC 4M8QB 2A2QT 4XP6H 5IW1A 1J0ZA 1P84K 4MX7A 3O3BA 4JZJC 2A9MH 4JY6A 4I18B 2F19L 2FEEI 4M61A 1NDGB 3GSRA 4DUWA 2Z4QA 5C8JB 1MEXH 3GIVB 4X7TB 5KSUA 5CMAB 2ZCLL 4PRBA 4CVZA 1P4IL 2VXTH 3FTGB 4KK6D 2YN3A 3O6MH 3S88L 5TPWL 3V6ZB 3PABB 1Q9LB 5SV4A 3GMRA 3P0YL 1J9CT 4PRAA 5M94B 4FG6C 2AGJL 2F19H 4JM2B 3F5WB 1OTUD 1KPRA 1HEZB 5HYJD 1QLEL 4WWKD 1VEMA 1D5MA 1KN2L 2X5PA 2J88H 3E1F1 5CSZB 3V0AC 1AD0B 2ZUTA 1AD9A 2OYPA 2BX5A 4P5TA 3R4DA 4LSPL 2FATL 4YBQC 4NC2B 4X6CF 2J4WL 3S88H 2VZUA 5TPWH 2E7LC 4FFVC 4TNVK 4MNQE 4ONGH 2DM4A 2C9AA 4DGVL 2FX9L 4QOKB 5FYLE 2AGJH 2FD6H 4FN0A 4KPHH 3OBAA 4BH8B 4KMTH 1RVFH 4F7CA 4ALAL 5SX4H 1RZJH 3TJEH 4O4YL 4KZEL 1U3HB 2R2EA 3AY4A 4LKXA 4PJBE 2PETA 1OD7A 4Q6YA 2C5DC 4OJFL 5E8EA 4IIQC 4Y2DC 3H8NA 2HFTA 1YMME 3U0TA 4D0BB 2J4WH 3QO0B 3TO2B 5EU4A 3PWLA 1V3JA 4MA3B 3O6LL 3LV3B 2VLLA 2CR6A 3ESUF 1X7QA 1T0PB 1MCHA 3SJVB 4QHKJ 3SDCA 4U1KA 5FO8A 2VAJA 3BQUC 4XHJC 4F7MA 3H9SA 1W0WB 3U0PB 5LQBL 4ALAH 1AGDA 5EFIA 1S8DB 1WEJH 3EFFB 1HYSC 4OJFH 4WFHE 5E6IA 2A6JB 4ZNEA 4JPVH 4ODVH 2AV7A 3QFJA 4XBPA 3JV4B 2V6HA 4BFBD 4OLVL 3HZMB 3UAJD 2APBA 3O6LH 5D5MA 3WFEL 4K7PL 3TM6A 2DKUA 2VQ1B 3FHQA 4IMLA 2QV2A 4UV4L 3SPVA 1ZMYA 2HRLA 2IPUG 2RJMA 1QLRA 4I5BB 3O4LA 1S5HB 5HYJE 2CDEB 2R1WA 1P84J 2GJJA 2AV1A 2XWTA 4EN3A 3MR9A 1HH9A 2VKWA 4BH7A 4NO5B 1U3YA 3VG9C 4IRSC 3MRBA 4WUKL 3RL2B 3W5NA 1VFAA 4YHKL 3B2VL 5TGBA 3MREA 2NNAA 1TVHB 1EXUB 5MEND 2NY4C 5HY9A 3WFEH 2DLHA 3DOSA 4JJ5B 1UXWA 3RY5A 2EICA 1EEYA 3OGOE 3UX9B 4EBQH 1S7XB 4UV4H 2X70B 3HLAA 4PJXE 3KPQB 4OCWH 1QSFA 5D93C 2Z92B 1FZJB 2GK0B 2IALB 5FUCC 1D9KD 3OB0H 3ZDXE 2I24N 3BDBA 3QCTH 3GMNA 4XGZB 4K8RH 5JW4M 4F2MA 5IBUB 4WI5A 4JRYD 4W6YB 4PV8B 5D2NB 2P24A 4YDJB 4L9LC 4YHKH 4YWGH 3OZ9L 2VWEC 3V5DB 5KVGH 5I74C 3PQYD 3OKDB 4MD4A 4LDEB 2IAMC 3MRFA 1CG9B 1HIMH 4X5WA 4XNXL 2ZJSL 1LO0L 3DVFA 1KIUA 4PJAF 1MRCL 4YHML 1FNEA 4Y5XA 2APVA 1A7QL 3SGJC 1KTRL 4ETYA 1DBJL 4Q97A 5A2KH 4YH6A 2HT4D 2HTKC 2CR3A 4R90L 5DFVD 3BVNB 5BOZG 1M71B 5EO9B 3RIAF 4MYWB 5CEZD 4X4ZA 3GBMH 3WNOA 1PG7W 1I7ZB 5IR1A 2CIIB 4FP8L 4FZEL 4PRNA 4LMQE 5DRXA 3FRUB 4FFWD 4QHKI 2IH1B 4JN1H 3WIIH 3QIUC 1AFVH 5A3ID 4U6HA 1F97A 1AP2A 2J8UA 3VMPA 5DXWA 3C8KB 1BP3B 1A7QH 5ID0B 3MCKA 3VFOA 2VN4A 4XI5D 2P47B 3TIEA 4Z7WF 4UNUA 3KHOA 3RVTC 2C7UB 2DQDL 2BRQA 4WFFD 1YEDA 4YDVB 1K2DA 4FQLH 4PGZA 1MJ8H 3HI5L 3OKLA 1RV6X 2D03L 4CMMA 4XPTL 4JCMA 5MENE 2ADGB 3H9HA 1WCQA 1IM3A 4UQ2B 3CVHA 3O8XA 3L5WA 5HYIA 1IBGH 5D70L 2NXYC 3G6DH 3UTQB 2P5ED 5HPMA 3CZJA 3K8MA 4YGVA 2DQDH 3O4OC 1BZ7B 3MNZA 4JRYE 5LWYL 3K1KC 3IVKA 3HI5H 2VLKB 1RZIB 3U9UB 4DGIL 1I4FB 2D03H 3AUVA 1F02I 4P23C 1JNHB 1T04A 2E7CA 5IV2A 4XH2B 4W70A 1A4JA 2MHAA 1RI8A 4P2OA 5IB1A 5FYJU 4JKLA 4ZO8A 4QRPA 5IUSA 1C08B 1DANU 3BJ91 3WXWL 4OF5A 5C0NC 2BNQB 4PJHF 5J6GB 1NGPH 4PPTA 3WO4C 3I9GL 2YA1A 1UZ6F 4O58L 5CEZE 1EJOL 3RPIB 3MA7B 3FHAA 3QHTC 5ID1B 1NCAL 1QFPA 1H3PL 3EOTH 4BYHA 4KGJA 3MRRA 3RU8L 4NKIL 3K4DA 1X5GA 1PVHA 2W91A 4OM0H 1G6RA 4Y2DB 5ITFA 2FYYB 4DAGH 3H2WA 1AIFA 2XXCB 5F1OB 4EIZC 1XGQB 3EUUA 5F7EH 4H1LB 1MHCA 3SCMA 2BHUA 1PY9A 4NN5C 2F53D 4RNRB 4WFFE 1J8KA 4XAKD 3BIKB 1G7HA 2VTFA 4D3CL 5LGKA 2GSIA 3EDJA 5C07D 4QHNB 2E6QA 4OKDA 3BQUB 3QB7C 3ARFD 1NCAH 2D3VA 3ARQA 5TQ2L 4K94L 3RU8H 4JFXB 3QDHA 1DUYB 1U36A 4N90D 5JQ6L 1A6VL 1BFOA 3D0VA 4O5LL 1QFUL 3C6SB 5IMKB 5IEHB 3ZT6A 2SEBA 1UJ3C 1FORH 1U8MB 1DBMH 4JM2F 1CLZH 5GISL 3RHWF 4HUUA 1YEHL 4OM1L 2GTZA 1IC7L 1Q72L 1A1MB 1JI2A 5EU5A 4D3CH 3VD9A 4N9OB 4U2YA 1XZ0A 5IIEA 4MVBC 3MLSL 1IFHH 3HC0A 4RBPK 3ZE1E 4PJDA 1JPFB 4HBQA 3Q1SL 3HNTL 3BSZL 4NM8L 3EO0A 5JQ6H 3U1SL 3T0WA 1A6VH 3CCHB 1F58H 3BISA 3VG9B 4PLNC 3DRQB 5C71A 4O5LH 1HH6A 4OCSH 4IRSB 3WS6C 2DLIA 2E6JA 4ZNEE 5DGRA 3QH3B 3QFJE 2HVKA 3VFTA 4Y19A 4H1LH 4HS8H 1IC7H 1IAOB 1Q72H 1G7JB 1H3UA 3B6SA 3C6LA 4NNPH 1NBQA 4LSUH 5D5ME 2EO1A 2NYYC 2ATKA 4QRQB 1T89A 4Y5VC 3UROR 1CICB 3RBGA 2E27H 3MLSH 4JR9L 1S7QB 3T08A 5D93B 4G8FA 5AWNH 4QHLA 5CHNA 1HI6A 3Q1SH 5E7BA 3W9DA 3O4LE 3FB6B 3ARWA 1C5BL 1UM4L 3NVQA 4P2CG 3L3DB 4WHYH 3MJ9L 4X7FC 5D2LE 3C60C 1OAQL 5ICYA 1WZ1L 4UV7L 4LLWB 2F53E 4DFHA 4XAKE 4UOW1 2R29L 2H6PB 2IAMB 3WLWD 5EU3A 5D6DC 3V9FA 3SY0B 4WI2A 3LPFA 1F6FB 5DK3A 1JZ3A 4PYGA 4OZGF 4JR9H 1R5WA 2YK1L 4Y8AA 4G6JL 1SY6L 1WWWX 4PTTB 1PX4A 5D1XB 2KZ1B 3RY6C 3STLA 4N90E 5JQHC 2A83A 4PJIB 4WW2C 4M1CC 2GT9A 5F1NA 3QG6A 3CXDH 4QTHA 4MJ4A 4RDQF 2FX8H 1OAQH 1D5IH 3MRNB 1FYTD 3LD8C 5D72L 2D7TH 2VYRE 1BREA 2X7LB 5SWQA 4PJ8A 3G08B 3MRJA 5ERWA 4L5FL 4FQ1L 1IAIM 3D85A 4GT7A 4UTAH 3THML 1XT5A 1F3JA 1OLZA 5H37G 1BFTA 4G6MH 1EX0A 1CD1B 2V2TB 3G9VA 1SY6H 1TITA 3V8OA 5DQDH 1IGYA 2GJ6A 3LOWA 4CN1A 5LGJA 1HWHB 2QQLH 4QRPD 3BDYH 5JO5A 2FLRT 1JF1A 3MOQA 1OARH 2EH7L 4HIIA 5KVMC 2R69L 5DDHB 1Y18A 5DJ2B 5T1KD 4FQ1H 2KDGA 5TQ0L 5KSAA 5KS9A 2R4SH 1DSFL 3ZDZF 3W2DL 1KPUA 1TNNA 3BDXA 5GRVL 1ITBB 3TZVB 4KHTH 4P2QA 5JXEA 1QO3A 1N7MH 1BEYH 3AB0C 2NXYB 3C5JB 4D0DB 4KTEL 1QKZL 2V5MA 2J8UE 3O4OB 2R2CA 3BH8B 3FB5A 1KIQA 4RMRA 4ZUSA 4UTBH 3BYYA 5FHAH 4N8VA 2HFEB 3ZYIA 2EH7H 4E0RA 2R69H 1SVZA 3PGCB 3VH8G 5FECB 3I2CL 4P23B 1ORSB 2J5LB 4LDLB 4KQ4H 5DD1H 1DSFH 1J7VR 1YUHB 3FB8A 4PY7B 3W2DH 4H26B 4LLQA 3S9DB 3NFPA 3ARRA 1YNTA 4NQCB 3JTSA 3D87B 3BKCH 4KTEH 3IDXH 2NX5B 1JUFB 3UPRB 5D1QA 1ORQA 4IEFB 1FYTE 1WJ3A 4LAQH 4ZAKB 1RMFH 3DUUB 4TULH 5BV7L 1NCDH 3IJHB 3KLSA 1JN6A 3SE3C 2YD6A 3SGDH 5KVDL 4N1CA 5BZWA 3RTQA 1G7MA 5FGBC 3MBXH 4NN5B 4CN6A 1PGRB 5E5MB 1C5CH 4IRJA 3BUTA 2UZXB 4QRPE 5BRZD 1JWMA 4X5XB 5DVOA 3WUWG 4Y2OA 2RIKA 2BSRA 3C6LD 1CLOL 4X8XA 3GHEH 3IU4H 1MCRA 4WEMB 4QTIH 4ZFOL 1HHIB 3OAZK 4O51B 3UBXG 3SBWA 4L8BB 1X6NA 2XA3A 1UM6L 1BWWA 5KVDH 2BOCB 1M4KA 1RUKL 3T2QA 4UAOC 1RPQA 1RHFA 1UJ3B 4AIOA 3M8OL 2CLZB 5DS8B 1A6WH 2BY1A 4P4KA 3W9EA 2XN9B 3L95B 3OR6B 4X6CA 1WFOA 2LFGA 1BOGA 3HE7D 5C6WH 1MVUB 3NACL 1HSAA 5J12C 3FRPA 3K80A 5LJYH 3GSWA 4OIIL 5E00B 1GRWA 1U91A 3VXOA 2PYEB 4V2CB 2CKBB 4UOW0 1CLYH 4LU5L 1T22B 1T1XB 5SV3A 4HZLB 1NJ9A 5HDQL 4LGRB 1DEEB 3CUPB 4KKLC 1JPGA 1P7KB 4Q6IC 5DHVA 4EOWL 1KIRA 3MV11 1P2CA 3AM8A 1UEYA 2CIKA 1N0XL 2QADD 5D7JC 1T4KB 4ZO6A 1I75A 4MLSA 2HTLD 3LKSA 1ZHNA 2HT3D 3IXTA 3P40A 5HYFA 4KK5C 3U7YL 4RRPA 4Z5RB 2BVTA 2P8LA 4PJDE 1S9WB 5HHOA 4E5XA 2GJ6D 4PR5A 3SE8L 1T03L 1JBJA 3C60B 3OJVC 3PGFL 4A6YL 5GGRY 3BXNA 4E41D 1V7ML 3KWWA 2FSEA 1HHJB 1IJ9A 3V6BR 1WFNA 4D9QE 5BRZE 1KXQE 5LCVL 1WZLA 3QUXA 4XPAH 4ORGA 4Y19E 5KSAD 4JDZB 4KVNL 2BVYA 4OI9A 1WLHA 3ES6B 3T3PF 3TA3B 3RVWC 5K9KA 3UJJL 4OBRA 2BNUA 3NH7L 4WW2B 1AHWA 5H94B 4K07A 1CFNB 1T03H 5IHZB 1Y6KR 1RIUL 3PGFH 4PD4K 3LD8B 4A6YH 1XFPA 2VR9A 4U1IA 5MHSD 1P9MA 1J8HD 2XTJD 3ECBA 4XCCL 1MIMH 3OKEB 3T0EC 1NQBA 1AO7B 1WUNT 2Z91A 2B4CL 2RGSA 3RJDA 3D69A 3V6OC 2IPKB 1LNUA 1JTOA 1M05B 3RWIA 3H42H 3F12A 1QPPA 2DQCH 3DV6B 3L5HA 3P4NA 4C56B 2YPVL 2P48B 4XCYB 1XCTA 2OX5A 1OCWH 5I8CA 1RIUH 4CRPA 4OBSA 2AK4B 3V0WL 1FZKB 4FXKB 4XTRD 3G5XB 5D1QD 5J3HC 4LGSB 2UVEA 4PY8J 4ZFGL 1JPTH 3PL6C 3U4EA 1OB1B 5H8DA 3BI9X 5GGVY 1D7FA 2E9BA 3WJJC 3GHBL 4NBXB 2Q8AL 1U42A 3AB0B 3KPLB 4PG2A 5DZLA 3MOBL 2GAZA 4S2SB 4LHUA 4JFDB 1TQBC 4YPJA 3RWJB 5DWUL 3RTQD 1PYWA 4K3JH 4PJAA 3X13B 5DRWB 5D6CA 4RIRB 2GJ6E 1W72L 3LRGA 4X6DB 3U0WL 4E41E 4W6WB 1XF3B 4UB0H 1JYVA 2VLJB 5CJBA 1BGXH 4MAUL 2KL6A 1DVFD 4P4RA 1CE6B 5F9WB 4DQOL 4PRHB 4RAVA 4YXKL 2R2HA 3ZHLA 5KS9E 1V3KA 4PRPB 4F57L 1KCLA 4BSVB 5EU7C 4OSUL 1A64A 2R23B 1IGTA 1CK0L 5DWUH 1JNNL 1RZ8A 2L7UA 4LCIL 4HF5H 4ORZC 1IL1A 2W92A 4R0LA 3QQ4B 1MJ7H 4Z7WA 3B4NA 4XXDB 4GLRH 4R26L 2Q3AA 3HE6C 3RX5A 1ZE3C 5MHSE 4X0KA 1VENA 4MS8C 4D9LH 5BJTA 3CPLB 1FE8H 4X4MA 4YHZH 3LHPL 1DBKL 1QFWM 3VXRA 2DQIH 3WD5H 5IK3B 4XCFL 1JZ2A 4XP4H 3LS5L 4FQXC 1EAPA 1SHMA 3MACL 4WY7L 4NN6C 5CIPB 2KQMA 3IU3A 4G9DB 5AUMB 5SWZA 1DUZA 1R5IA 1JNNH 5LBSH 1QBLH 5IBTL 3U82B 1MHHA 3P9MA 3E3QE 2JCCB 2X89A 3QIWB 5T3ZH 4PJ5D 4TPRH 5H2BB 4YBLC 4YDLC 5CFHA 1JZ7A 5A1AA 1PKQA 2BVOA 4PJ7F 4R26H 4J8RB 4FQJL 4H88H 5GQBA 3DO7B 3U4BH 3T2OA 3U46A 4PD4J 5I0ZA 3VI3F 3O9WA 5L88H 5E56A 4EXPX 3C5ZD 3FQUB 3V7AE 1CFQB 3JZ7A 3QPQC 4UAOB 4Q2ZA 2CRIA 5EZOL 1YN6B 3I50L 3FOMB 4LLMB 5GRJL 3GM0A 5IBTH 1CYGA 5IB4A 5D1ZA 3U9PH 1I9RL 4WO4A 5JMOC 4NPYB 1F4YL 1BZ9B 4PJHA 5F3BA 1S9KC 1MVFA 3RVVC 1QOKA 5CAYB 2FJFB 4M5ZL 3IKCA 4G6KL 4ODSH 1X6LA 1IGIH 4QRTA 1IKFL 4XCNB 4MGXA 2CLVA 2DIJA 3IFOB 3NAAH 1IQDB 4PY8I 1BBDH 3DX6A 2OTUB 2Z35B 2VN7A 3OHXA 5EZOH 1MIEH 5GRJH 4J3VA 1KGCD 5CJXA 1V3MA 4C4KO 3G9AB 4GKZB 4I18A 3MRCB 4XBGB 1MNUL 3C8HA 3DMMA 5D7JB 5I8EA 4S1DC 4JANA 5F9OL 1E6JL 4U1GB 5CMAA 4I77L 3LS4H 5EOQL 3FTGA 2J1KA 3BGMB 3HN3A 2IGFL 3NPSC 1TETL 3VGBA 3D9AH 4XNQB 3V6ZA 3PABA 5IB3B 4XVJL 1Q9LA 2ITDB 4YQXL 2A77L 4PJ5E 1I1AC 5FYJD 1NAKH 1P5VA 5E2UH 3N85H 1KTLB 2GI7A 4JM2A 4LKCA 2AJSH 5TE4H 3ARGD 1HEZA 2E7BA 3GM8A 1MLCB 4KJQC 1E6JH 4MA7L 1ITCA 4UINH 3BZ4B 5GGTH 1AD0A 3CFCH 5FAAA 1J0JA 2JJUA 4HS6B 1QEWB 4NHUA 2IGFH 4KROB 3TYFA 3WKML 2HWZL 4MNHB 2APXA 2QQNL 4R6UA 5IW3A 4HHAB 4XVJH 4YQXH 4ZSOA 2NY2D 3T04D 5BVPL 1NUDA 1I1FB 5D9SB 5DQJA 5ISZB 4RAUA 1IE5A 4QOKA 5IKCA 4JB9H 4JN2A 2D9QB 3E6FB 4BH8A 1LGVA 1U8LB 2WM0A 4M1GH 3WFCH 1T5WA 3RIFK 3BAEH 1OY3B 1U3HA 1UGNA 5JPMB 1ZLVH 5CJ8A 5F7DB 4NWTH 3SEPA 5C0EB 1I9JL 2EKJA 4V2BA 3FONB 1A7OH 1QSVA 1MF2L 3ULVL 1A3RL 1IGCL 4MA3A 3EIFA 5F7WC 1KGCE 2VDKL 1NGWA 1HOCB 4JPIB 4UT6L 3SJVA 4HJJH 3PL6B 9CGTA 4UQ3A 3MV7B 4U1HB 1S7SB 1W0WA 5MEPA 1IM9A 1S8DA 3VXMD 4H25B 4HIJB 5C0AD 1OQXA 3EFFA 1TQBB 4G6FD 4OZ4A 3GMPB 2VC2L 4DEPC 2AJUL 4OZGA 3UO1L 4HGKC 5SWZD 3EYUH 2W07A 2DYPB 3JV4A 4HKJB 2UZYB 5JPNB 4JAMA 3V7MA 4DFIA 5F1KC 4QYOB 3RL1B 2AJZB 2PW1B 3GJFH 3LEVL 4P3CH 3ZKSD 5TE7L 5FYJE 1F11B 4HKZA 3X3FL 2XG5A 1FG2B 4ZUTB 5TDOB 1RZGA 3BGFB 4I5BA 4D8PB 3BRGC 4WI3A 1S5HA 4X6EB 4WW2F 3O3EB 2V9TA 5T5NF 1HQ4A 1T20B 3AROA 4NZRL 4HKXA 1EHLH 4CDHA 4NO5A 3SQOL 3ZE0F 1VHPA 1FC1A 4BJLA 4PJAE 1BQHB 4G9FB 3HE6B 4HFUL 1OGAB 3LCYA 1TVHA 4WO4D 1R24B 4FQPA 1CGUA 1M7DA 1MHEA 3LB6C 4XP1L 5DMGD 4JJ5A 2BOBB 2ZOLA 3X3FH 1ZLSL 3VXPA 2X70A 3L3KA 3SDDD 4OLEA 4P9HC 1INEL 3BFOA 3QFDB 4PJFE 1GYAA 4FQXB 4NN6B 1FZJA 2X1WL 3LRHA 2IALA 4KTYA 4ZFFA 4F15C 3UDWC 4NRZB 4LCCC 4ZS7L 1AJ7H 1DJSA 3EJZD 2UYLB 4BQCA 4YBLB 4KXZI 4PV8A 4LEXL 4R3SA 4K55A 4YDJA 4IDJH 4X7DC 4HFUH 1Q9OB 3N1QC 4YDIH 1IAIL 4WTZA 2P8PA 4Z7WE 4WNQB 3S96B 4PGJA 5IJVB 1ZLSH 4HWBL 1CG9A 2MQ3A 2YPKB 1X4YA 3IDGA 5HYSG 1WITA 4X4ME 1H0DA 1PG7L 3FB7A 5C0AE 2LAAA 3T2PA 2EDXA 1KPVB 2DQGL 1KC5L 1FNLA 3TCLB 4X6DF 4MNGE 4I4WA 5SWZE 1KB5L 3BVNA 4W4OA 3RUGE 1Q1JL 4KJPC 3PWUA 4HW6A 3GO1H 3WO3B 1CIDA 2CRMA 2NY5C 3UC0L 4U1SA 2A0LD 2CIIA 3RZCC 5BXFB 4OF3A 4HWBH 3FRUA 2IH1A 2UWEB 3VXUB 5JOFB 3DIFB 3FJTA 1FL6B 1XH3B 4JRWA 1PG7H 2EKSB 2Y5EA 2AABH 4YR6B 5ID0A 5HHXL 1XF2A 5IJKC 4PB0H 3IXAA 3TVMC 1NEZG 1U58B 4JZJA 1KB5H 3ZE2E 1UACL 4NQXA 1PZ5A 1Q1JH 4MA1C 4ZDHB 4H0GA 4JRXD 2OJZH 3QDGB 1HQRB 4WI7A 3OJDA 3VRIA 4QOKD 3N9GL 1XR8A 1L7IL 5FOBB 2CO7B 4H0HB 4PJHE 2DLFH 1BFSA 1E27B 3V5KB 3EYSL 4H5SB 1NFIB 2DAVA 1KCRH 1WZMA 3I3DA 2XZAH 2Z93A 4UQ2A 5CZXD 2EZ0D 1UZ6E 2APTA 3DUSB 4Y4KC 1U3HD 1U6AL 3L1OL 3U36B 4K3HA 2R9HC 3UTQA 1BVLB 1NANH 1NGZA 4WCYH 5FM5O 3QAZC 4KAQH 4U33A 1BZ7A 1I1AB 3PWVA 5ESVB 3IFNL 1SYVB 4LPVA 2R56L 3T4AA 4LSVH 4U0QB 1HXYB 3F58H 2WNGA 4S10A 1I4FA 5HHMB 3SJVD 4FNLL 1I9IL 3DNKA 2HT2D 1NSNL 2XZZA 4Y16B 1JCKA 1XAUA 2V7NB 5LG1A 1UADC 1M1SA 2N1KA 1B88A 4K8RD 4XH2A 1WCBA 3BP4B 4NKMB 3J8F7 1JHTB 1MCNA 3SO3C 2RR3A 5E8PA 2E7LA 1UKTA 4BA8A 2BNQA 5CLTA 2XTLA 5BQ7B 3QDJA 4KUCF 2PR4L 4APQB 4E42B 1CR9H 1IEAB 1NBVL 5CJOL 5HGAB 3RPIA 1FVEB 3EYQC 5ID1A 5AZ2L 5A40E 1NSNH 1VDGA 4OFPA 5J1AA 1A9BB 4MQ7B 4NT6B 4QKXB 5C09A 1U95B 2EIZB 3CLEH 4IIQA 4Y2DA 2FYYA 5FGRA 5T1LA 4OIBA 1VGEH 2J3SA 4HC1L 2DWEB 1YY8B 3VW3H 3JUYA 1OT1A 2DD8H 1PKOA 2Z8VC 4ELKA 4H1LA 1H3XA 5C0CB 5C7XH 4UU9A 2JB6A 5B8CC 2QSCH 5H35B 3EOAB 3LIZL 4A2LA 2AEQL 4F9LC 3BIKA 5DD6B 2NTFA 1UC6A 1MJJB 5I19L 2D7PA 4QHNA 3BPCB 3BQUA 4TVPD 1NBVH 4Q9QL 5HDLA 4QOKE 4ELMB 3GUTB 2L4OA 1DQMH 4DEPB 3DVIA 2IMMA 1EUTA 1Y6MR 1DUYA 1SJHB 2PO6B 1C12A 3N0PB 4L9DA 4NQEB 5CD5C 3OX8B 1CDGA 2P44B 1LVEA 2FL5B 3HC3L 2NW2B 1U8MA 4IHOA 1FFNA 2YD1A 3LIZH 1CFTB 2YWZA 3ULUC 1ZHLA 2AEQH 2VZVA 3MUY1 4J6RL 1A1MA 4OV6F 1NGXA 3LKRB 3QRGH 1S7RB 4MWFA 3SJVE 4Q9QH 1HSBA 5EOCJ 1EV2E 3NCEB 5IB2B 4N5EC 3KDMB 4M03A 1J18A 2BCKA 5L2KB 2L0DA 4ISVB 2KKQA 1SMOA 4R97B 1OSZA 4M7JL 1LK3L 3KLDA 3WEXB 4GKNB 4IRSA 3HC3H 4WGWB 2EDBA 3QH3A 4BK5A 4BFGA 3ARDC 3CMOH 4M1DH 1S7UB 3IDJB 3NIFE 3O3UN 3NCYS 4F7TB 2Y6SD 5CEXB 3C2AL 1X5AA 3S34H 1IQWL 2BFVL 4LCYA 1SY6A 2X4QB 5CJ5A 3NABL 1S7QA 1QLFB 1G9NC 4LVEA 4LCCB 2R0ZH 2P45B 3FB6A 3VFUB 4GW1B 4YNYB 3VFNA 4GBXC 4M7JH 1HHKA 4BQ6A 1G7PB 2VDMH 4L9LA 5D4QA 2MCPH 3FO9B 1ZK9A 4M9PA 2B0SL 3ARPA 5J13C 2IAMA 1MFDL 3S35L 4CADB 4D94A 3EJYC 1XIWB 4OZFG 2Q6WB 1IAMA 3NABH 3X3GL 4P9HL 5EDXA 4UDUA 4PTTA 3SGJA 1A7PL 1IT9L 2H2PD 3BT2L 2VDRL 3C87A 1S3KH 4YX2L 1MCCA 5FHBL 1YEIH 1VERA 1KBGH 4PUBL 4G8GB 5D2NE 1FL3B 3T1FA 5MEOA 3G08A 1CQYA 2VLKD 3M1BA 3RZCB 4CL7A 4KJYA 1CXHA 2AEPH 1MFDH 1F2XK 3Q6GH 3S36L 2G2RA 1Z9SA 4NUGH 3QIUA 3DPBA 4HK0A 5J0BA 4TRPL 2V2TA 4P9HH 2WBJB 4AQ1B 2OP4L 1QRKA 2Z31C 3HC4H 1IT9H 1D6VL 3TVMB 1CN4A 3LDBB 3DURB 1I8LC 4XPHL 3HMXH 1BQSA 1QFOA 3MLWL 3BN9D 3BIAX 4M6AA 4YX2H 2X1OA 5FHBH 4GSDL 2BNQD 3PIQB 1NBYB 4KK9C 1DQTA 3DV4A 5DJ2A 3V52L 1JZ6A 2LE9A 4PJ7A 3S36H 2OQJB 4H8WL 5DZNA 4LOUC 4Y4KB 4RISL 3DYOA 1MFAH 5CBAB 1I3RB 4Y1AB 3C5JA 4G6AD 4RFNB 4Y2DD 2DOCA 3WV0A 2DTML 3H9ZA 5JZ7D 3BH8A 3N1PC 4BK4A 3TCXA 1ZLUK 3FO1A 3RP1A 1DQQB 4GSDH 1FGNL 1X3DA 2OZ4H 4QXUL 2HFEA 3OAUL 3S5LB 1OQOA 5DJYB 3PGCA 5FECA 1T1WB 4P23A 1RJZB 4N8VG 4QRRB 3BN3B 3MUGA 2X10A 4NDMA 1G0XA 4HXBL 2NY5H 4Z78B 1UH2A 3QI9C 4PS4L 3DETC 3TC9A 4PY7A 1WWBX 4H26A 4RISH 5K9OA 4DGYH 1MCLA 4NQUA 5CZVL 4JFPB 1MCBA 4NQCA 1WVZA 5J9PB 4HAFA 2FB4L 4BELD 3VWKC 3UPRA 1W0VB 2X4OA 4MA8L 1LEIA 3RJQB 1FGNH 4QXUH 2Q20A 3OAUH 3TFKC 3ZYOA 4ZFOA 4ZFZA 4LSTH 4MCZB 2UWEF 2IPTH 2VLKE 3DUUA 4HXBH 1JHKL 1IC4L 5E1AA 3HR5A 3O6KH 4PS4H 2HJKA 2J7LA 4M62L 2P46B 1MWAL 3IJHA 3KVQA 3V7AG 15C8H 3MCG1 4RQQA 4NQVB 5CZVH 4CN4A 4L8CB 2Z9TA 1PY4A 2B1HL 3HZVA 3BKMH 2VXQH 4GW4B 2XICA 5JDSB 3GBNL 4OUUB 5EBGA 5KBNC 2BNQE 1GPOL 2XY2A 4O9HH 5L9DL 2DIAA 2MOVA 5JNYA 3W11C 2M8XA 2RHEA 3SGKC 4P2RA 1JNLL 1HHIA 1IC4H 3B43A 4IOFC 1AXSA 1CICD 3VG0L 2YRPA 1MWAH 4XZUB 5E2VL 4O51A 4JPKL 4L8BA 3TGXA 3HI1B 1U8QB 4M6MH 2BOCA 2Q76A 1UJ3A 3CK0H 5DS8A 5FO9B 1MELA 2FIKA 1KF9B 2MQ0A 2OK0H 2XN9A 3GBNH 3L95A 5EUKB 4GG6F 4HWZB 1CGWA 2EYSB 5IFAL 2O5XL 5HGBB 3PG2A 4TSBL 4X99B 3TBSA 3MV8B 5E00A 3FRPG 2F5BL 2PYEA 3N1MC 3PHSA 8CGTA 3CFJB 1EERB 4JY4B 4MDJB 1RIHH 1T22A 3VFRB 4A6YA 4ZUUB 2P43B 4KTDH 5D1XD 4HZLA 5EWIL 3WS6A 3V4VH 2X42A 2FZ3A 1TZGL 3W39B 3CUPA 4TUOA 3ARDB 2JIXB 1MCWM 1RUQL 4KK6C 1P7KA 3D6GA 3DYPA 2WUCL 3PXJA 4Y88A 1C1EH 1MUJB 5IFAH 4XBEL 2VJXA 4Y5VA 3ULUL 1WBYB 4TSBH 2ZZUT 1T4KA 2DB8A 3CSPA 4UT7L 1QFWI 5E95B 2WUBL 1JJUA 2OXGA 4Z5RA 1ZT7A 3TNMB 5C0FB 4N1HB 3RWGA 4RRPG 1OTUC 3VRLF 3FQXB 4WWKC 4HT1L 2G9HA 3O41A 3C60A 2FR4A 1TZGH 5KVEH 4EJ1C 2NY7H 1IAKB 3TN0B 5J13B 5EOTB 2WUCH 5D6DA 3DYMA 4XBEH 3ULUH 1S7WA 4LHJB 5T3XD 3GSQA 2XZCL 3MRIA 4S1QH 5E6ZA 5KOMC 2VDLL 2RAMA 2VXSL 4UT7H 4JDZA 5GGSB 5A16B 1QFHA 3TZVD 2CDFB 2WUBH 3AMLA 5I75C 3ZKXB 3RY6A 3TA3A 2NXYD 4RCAA 2F5AL 5C9JA 4WW2A 1G9NL 4P46B 5H94A 1OP5K 4CVWA 3MRQB 4KDTC 2VDNL 1MCPL 5E08L 1AGCA 5GHWL 4CGTA 2RBLA 4L4TD 1PDKA 3TBWA 1BQUA 1N59A 3V6FB 3T8XB 1AO7A 2V5RA 1TJIL 4UNTA 5J6HB 1EIBA 1BECA 1DN0B 1M05A 2MFNA 2EDEA 4IMKC 3NIGE 2DI7A 1J11A 3D5OF 3DV6A 2B2XL 4NQCD 4KKCD 3D0LA 4C55A 2NX5D 4NNYB 4PJIE 1GAFH 4JFEB 2AK4A 4K3EH 2BP3A 1FZKA 5E9DB 2AEIT 1J1OL 3G5XA 3AXLB 1NMAH 1TENA 4OLUL 4NQDD 3Q48A 5AYQA 2KUTA 1T3FB 4ZAKD 3S6CA 1MPAH 2WINB 1FYHB 2WK2A 1ZLWK 3UAJC 3NCCB 1LHZA 3HPLB 2PYFA 4NN7C 2FECI 1D3CA 4S1RL 4S2SA 5MP6H 4JFDA 4YIQA 2W0PA 5D7SH 4XNYH 2ADJA 3X13A 5DRWA 2DLEA 1GH7A 4RIRA 4RZCB 4HX1A 3HPJA 4HUNB 4X6DA 1J1OH 1CTNA 4DK6A 2VLJA 1NCBH 4K9EC 5KN5A 4OCXL 3MGOA 5D96B 4PRHA 2Y72A 4BFIB 3NCBB 5T3XE 2ZSWB 1T21B 4XXCC 3S3JA 4S1RH 3UYRH 3MCLL 5EZIL 2VO5A 4BSVA 2R23A 2FO4B 3JV6B 2AERT 1JGDB 1J1PH 3G6AB 3WFBL 3KNBA 3QQ4A 1KJ2L 4R7NB 1GIGH 5JHLL 2IANB 1HZHL 4XXDA 2XN9D 1D9KC 1X5HA 3DECA 3KJ4B 1TPXC 4LVOC 4HH9B 4X6FA 2ERJC 4L4VB 3CPLA 3CX2A 4Z7QE 4OCXH 5FF6B 2ORBH 4HPYH 3RAJH 5F7NC 3SE3A 2PYED 2ZOKB 4D9RD 5ENWB 5C2UB 3SDAB 2NY3B 4G9DA 5FGBA 2C3HA 3D25B 4XRCB 2Y06L 1SEBB 3QHFL 4NQCE 1DQLL 4KKAC 2NZIA 5I71B 3PV7A 5JHLH 5I1AB 2NX5E 1IGJA 4P59L 4J8RA 3MBEB 3LKQB 4I0PD 4N68A 4OF7A 4DW2L 2HT4C 5DHYA 5DFVC 2GJZB 4DKEL 4PFEA 1TVBB 1B0RB 2IJ0C 3ZKQD 3VGAB 3FQUA 1CFQA 5FV1L 3O2VH 1VACB 2N7AA 1MFCL 3FOMA 4LLMA 4FFWC 4YO0A 4HPOL 4C83A 2BK8A 4FA8A 2XY1A 3D2UB 4KI5D 1MRDH 3LKOA 1KENL 1SM3L 3BPNC 1BZ9A 2R0KL 3OKKA 4P59H 2IFFL 1EGJH 5GGTA 5JMRA 3IFOA 4KKNA 1IQDA 4JDVA 4TUJA 3PDGA 5FYLL 1B2WH 2EC9T 2OTUA 4XP9H 3TA3D 4U3HA 5B39G 1CDCA 4M1CD 2NXZD 3LQMA 1U8PB 1T7ZA 4CKVX 1J05B 3QA3B 1OAXH 2GFBA 1DLFL 1QBAA 2OTWA 4Q6IA 2W38A 4Q7DA 3GMOB 1RD6A 1FLRL 2ADIB 4YC2B 1SM3H 1A6TB 2XN9E 4XBGA 5AG8A 5D7JA 2FEDD 1AO7D 1CQKA 3PP3H 3EBAA 1ZA3A 2PYEE 3BGMA 5FYLH 4OLYL 3SE4C 4WWKB 3FKUS 4C56D 2C4FT 4XNQA 3B83A 3TO4B 3MLVL 4ZYKB 4IOSD 4AMKH 1FFPB 2ITDA 5FKAA 4GXVL 2YD2A 5E2WL 4NKOA 2NZ9D 2X6MA 4NUJB 3ULSB 7FABH 1H3WM 4PGDA 1LEKB 4X6BB 3MXWH 5CGTA 1SVCP 4NFDA 3FFCA 3X14B 3UJTH 1MLCA 3BZ4A 4AL8L 3VXNB 5CILL 5DC4B 1QEWA 3P0VL 3GJFA 1WT5C 3ULUF 5DD5H 4MNHA 4L8SB 3FQNB 4FOMA 2YXFA 4N0UA 2PKDA 1R3KB 5E2WH 3EHBD 3ZYJA 1I1FA 5ISZA 3IDIB 5TJWK 1W72B 3P4LA 5F21B 4KI5E 5IGXL 4NHCL 3AS0A 3E6FA 3V6OA 3FO2A 3F8UB 4PRPD 5CILH 5C0EA 4JKPH 3IS0X 3ARFC 3P0VH 5DI8B 1LEGB 1N6QH 5EPMB 2YD8A 1YQVH 4EKXA 2A38A 3QUZB 3WIHH 5IM7B 4XAWH 3CMGA 3BKJH 4ZTPL 1NGYB 2W9EL 1HOCA 2Q7NA 1S7VB 3VXTB 3PL6A 2AJ3B 3ZE0E 3MV7A 5IGXH 5C0BB 3WJJA 3UTZB 1UB6B 1S7SA 1INDH 3WBDA 1AO7E 2P5WA 3I6GA 4H25A 3QZWB 3SDXF 5BVJB 3VWJD 2DYPA 3C08H 5JPNA 3DX7B 2V17L 5K9QG 1EFXD 3QIWD 4IRZH 1N6VA 4C56E 4QCIA 3RL1A 2AJZA 2PW1A 4ZTPH 5E2TL 2W9EH 1ED3B 4OF6A 3S4SB 4G8IB 2AK4E 1SBSH 4GS7B 6FABL 4JJHA 1KACB 2ZKHL 4FQHB 4ZUTA 1A6PA 3GMQB 4AYFA 4FXGA 4IJ3C 1PZUB 4X6EA 1GZPA 5GGUB 2EE3A 3IDNB 3I3EA 4FABL 5F70A 1J5OL 2YBRB 1P5UA 5GS1B 4LCUA 1TZHB 1F5WA 4JFDE 3P73B 4XMKL 1CXKA 3P3YA 2V17H 2YEZA 1KB9K 3E6HA 1BQHA 4G9FA 3HE6A 1Q94B 1OGAA 1TPXB 1R24A 3T77A 4HWBA 3GSVA 2BOBA 4X6DE 5F89B 4D2NA 4ZO9A 4WI9A 4YFLI 1MAMH 3EFDL 1MSPA 2VLJE 4WI6A 4S1SL 3EJJX 4JG1H 2VXUL 4FQXA 4LSSH 5KVFL 2XWJA 4PBXA 1NLDH 1RURL 3PQYB 4PRHE 3WDIA 5J1TC 1UWEH 3KYAA 1KB5A 3WLWC 4FABH 1RZKL 1RK0B 4PRPE 1WISA 4OKVB 3GK8L 1E4WL 4AG4L 5ICXB 2UYLA 5FDWA 3G5YB 3GIZL 5IBUG 5L7XH 3D3VD 1FNFA 1I9EA 2MKLC 4RFEA 1Q9OA 1QBMH 1VB9A 1H15B 1WWAX 1VESA 1LO4L 5IJVA 4DKFL 4WTZG 1KCSH 4NCDA 4K9EH 4S1SH 1UEMA 2YPKA 4HEME 1QBBA 2VXUH 3CSYB 3ARBD 1BQLL 2BVQB 4I3SL 2HJLA 4HLJA 1XGTA 4MHHI 1KPVA 2R8SL 1FBIL 1VCAA 2BHZA 5KANG 1JHLH 1KLUB 4R2GB 2JCCE 4XPGL 4G7VL 3P77A 5HYQB 4OZHB 1H5BB 5BXFA 1LO4H 4DKFH 2GEEA 3BPLC 4M5YL 2EYRA 2UWEA 1KFAL 1Z5LA 1FL6A 2GK2A 4U7SA 2EKSA 5CEZL 1I3GH 3QJHA 3L7FB 3F6LA 2X9WA 4KROD 4RGOH 1U58A 1JGEA 1TNMA 4ZDHA 4OFYA 3LN9A 1BD2A 4MZ2A 3KPRB 4DN3H 1NLBH 2J8HA 4LARL 5FOBA 2ZCKH 4H5SA 4JM4L 1NFIA 1T66D 4X80L 5EC2A 2P42B 1J1XL 1ZVSA 1LDPL 1V7NL 1KFAH 1A22B 4H0IA 3R06B 4JO3L 3BZEB 4PB9L 2VLMD 1VPOL 3GI8H 1DQJA 1BJ1H 3CSGA 3PWPB 4PJEB 2GSGA 2ID5A 1I1AA 1U9KA 4LMQI 5F9DC 5ESVA 2HLAB 4LL9A 1SYVA 4EUPB 4QXGH 4GXUN 4WHTB 5CKGA 4MD0B 4OUOA 4GG6A 3MV7D 3DI2B 2NQCA 3L3HB 4U0RB 2V7NA 4W4NA 4YUEL 1J1XH 3L7EA 2O26U 1CL7H 1V7NH 4PJBF 1KNOA 4XNMB 4JFOB 4NKMA 1BM3L 1JHTA 4U6TA 4PB9H 2NY1C 5EN2A 4RGNB 2O5ZL 5T5FH 1GJIA 4XPBH 3REVA 5BQ7A 5KW9L 3Q3GA 5AZEH 3MLZH 3P4OB 5EU6B 4E42A 2AXJA 2A74A 1IEAA 1KULA 1FVEA 2AI0H 4MQ7A 3F62A 1AGBB 1I8IA 5C07B 3QXAB 5HJ3A 1U95A 3O2WL 4OGXL 3ARFB 2WMPA 4Z77B 4FHBD 3UPCA 2DWEA 1YY8A 3RVUD 5JHDA 3QUMB 5C0CA 3NFNB 5HVHC 4DZBA 3BWAA 3AFLA 3GKWH 1QQDB 3EOAA 2MPAH 4HLZH 1OGAD 3KXFA 1D5ZA 2VDPH 2ZSVB 1OAKL 4ETQA 1CGYA 1D5BB 3BPCA 5ISZE 4EUPH 3L6FB 1WTLA 5IOPB 3WE6B 3GUTA 4LQ1A 1MCOH 4Y5YC 3HE7C 2IQ9L 4GG8B 3RWCA 1FL5A 1I1YA 4OGXH 4WHYG 4NQEA 2FL5A 2VLME 3F65A 1XMWA 1Z3GL 4BKLB 2W0FB 1CFTA 4JHZA 4PJ9B 1MCDA 1RUAH 4B53A 3LKRA 1Z9OA 4QRSB 2JJSC 4BFEA 1NUGA 5IB2A 3BX7C 3MV7E 4PJXF 5HI4D 1CD0A 3BD4A 5L2KA 4ISVA 3QEQD 2OLDA 5HHVL 4EI5D 3CVIL 2GYSA 3MV01 2QADC 4OCRL 4QXTB 1YMHA 2LV4A 5JLZA 3HS0A 2HTLC 1KT2B 2HT3C 5F96L 2XT1B 5CBEB 1A1NB 4X4YB 1J0KA 4OF0A 1S9VB 5FYKL 4KV5E 3T1WA 2I9LB 1D6EA 3EYOA 1S7UA 2XRAL 1CXLA 3BPOC 3C5SA 3IDJA 5CEXA 43CAA 5I18L 2YKLL 1LO5A 1FAIH 4NNXB 3IRPX 2FWOB 3LH2L 3OGCB 1VADB 3VXUD 1PEWA 3HMXA 3PHQB 2XYCA 2ESVA 3UDWA 1S9YB 4LCCA 3VFUA 3S37L 1SBBA 4GW1A 4YNYA 5FCUH 1F8TL 4FTVB 1MOEA 4XP5H 5E70A 5IROC 3BE1L 1ZS8B 3EGSB 3FO9A 4UIMA 5ETUB 4OLWL 1G9EA 2E9JA 1P4LB 2XRAH 3QDGD 4G9FE 2H32H 5DJXB 3VD3A 3PV6A 1R6VA 1OGAE 2I27N 1DQDH 1ZHKB 4CADA 5JXAL 1CXFA 2YKLH 2Q6WA 1OLLA 3LKPA 2XTJC 1XGUB 5I76B 1TJHL 5DO2D 1ONQA 1U8IA 4NZTH 4OZIB 5HHPA 1A5FL 2OZ4A 5DVMA 2OSLB 3UCRA 5CEYB 3FOLA 1A14H 4KJWD 2GTWB 5I16B 1OAZH 2EXWD 3RGVB 3ILPB 1JRHI 3CVHL 2OMBA 3RZCA 5HHMD 2C3GA 2A6KB 3FAWA 4NM4L 4ACPA 5LAXA 2EEAA 5K9JH 5DZOA 3LKNB 1FVCB 4Y16D 4XTRC 3HNVH 5F8QC 3KPSA 4HCRH 1KTDA 5ADOH 1TJHH 5IJKA