4MS8C

42f3 tcr pcpb9/h-2ld complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
199
structure length
196
Chain Sequence
SVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQMLLKYYSGDPVVQGVNGFEAEFSKSDSSFHLRKASVHWSDSAVYFCAVSAKGTGSKLSFGKGAKLTVSPNIQNPDPAVYQLRDSKSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNSIIPEDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords 42F3 alpha
total genus 33
structure length 196
sequence length 199
ec nomenclature
pdb deposition date 2013-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ms8C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ms8C01
2BVQB 4OZFA 4R2GC 1FL6A 5T3XD 3QEHB 5F88B 4NGHL 2QQLH 1VA9A 2D0HA 3TH4T 3NPSB 5DMJB 1N6QL 5IW1B 5MERB 3PE9A 4HHAA 3R1GH 4Z95H 4OF7A 3HE6A 4O58L 1ZV5A 3FO0H 2ID5A 4PJAA 5I1IH 3IU3A 1FVDB 5JIKA 2XKNA 2WLZA 2D0GA 4RMQA 1NEUA 2LE9A 1XMWA 4C4KT 2FL5B 4K3EL 1OSZA 3FFCD 3FRPG 3E6FA 5I71B 5HYJE 3CVHA 4NO3A 5I1KH 3HPJA 3T0XA 5MEOA 5C0FA 2IJ0C 4M43H 5A40E 2X1XR 3HE7B 5D8JH 3L3IA 5KTEL 3ZMRA 4JZOB 5EO9B 5FYJH 1IEBB 2BVTA 3FQUA 3GO1H 1LEKA 1QD0A 5JOFA 2IH1A 1AJ7H 5JMRA 3GBNL 1T2XA 2P5WE 1YEHH 2O5ZH 4LARL 1S7XB 4HFUH 4ZXBA 2JJTC 5CMAA 1T7XA 2X7LA 4YDVA 1S7SB 3G5ZB 4YEFA 4ZSOB 2Z8VC 4JHWH 4X80L 4FZEL 1KN4H 4G9FD 2AXGB 4KJPD 3ZE1E 3Q3GA 1ACZA 1HKLL 1RJLA 2BVPA 3DV6B 5DA4A 2DJ4A 4P9HC 1F11B 1OP9A 3T4AB 3KJ4C 1FRGL 1BFVH 3HZYA 3MQIA 5T5FL 2QQNH 4TUKH 1CG9B 5T1KB 5AEAA 2EH7L 1ADQA 2FSEB 2XN9B 4WFFE 3QYCA 3QFDB 1Q9WB 3OX8B 4G7VH 4YHKL 3HAEH 4LQ1A 2ATPA 5JHDD 4RRPG 4MS8C 3BX7C 3FMGL 4I3GA 4FG6C 3QCVH 4WFHD 1K4CA 3KJ6H 5BZDA 4RQQA 1LO5A 1R3IL 2OR9H 3DGCR 2Q76B 3B9KD 3EKCA 1LE5A 2I9TA 2J1KA 3RBGA 3LY6A 4XMPH 5JIHA 2G75A 3LAFA 3Q48A 2PR4H 3EJYC 3PDOB 1WWCA 4HS6B 4HV8A 3LHPH 3C08H 2OL3A 2DWEB 4FXKA 3RKDC 3ULUH 3TNNB 4D0CB 4QF1A 4QOKA 1KIUA 3T4YA 1A6ZB 2XKUA 1PKOA 1RK1B 3NABH 3RZCD 4TOYL 1G6RA 3W39B 3LH2H 4MNQD 4HUXB 5J0BA 2DIAA 2IMNA 3QHTC 2OJZL 1F4HA 2VLRD 3SDAB 2XWTB 5D7IB 1MF2L 3MXVH 5MENE 4KJWC 5LGHH 4M9PA 1IFHH 1QPPA 3HKFA 4JFFA 4UTBH 2EECA 3O45A 1CYGA 3UYOD 5IHZA 4PJ5B 3V0VA 2FZ3B 2J88L 4HGKC 1CLCA 3UBXG 1E4WL 3PHSA 2VXUL 5CP7A 2NY6D 4QRRA 4KC3B 1TQBC 4K9EC 5FUCE 2IQ9H 4JANB 4WJ5A 1I1YA 1MCWW 1I85A 1HHJA 3CFDB 4PR5B 3VG0L 3UCRA 5EIIA 1Q9KA 4R0LC 5HI4D 4OGXL 4YLQT 3UTZA 4X9IA 1NJ9A 2EC8A 3RWFB 3DVFA 3MYJB 5JW4Q 5I0ZA 1HSAA 3NCEB 1OM3H 5K59F 5INDA 4FQJL 2CK2A 5IEHB 2EXWC 2YD1A 1T0NA 3U4EB 3QUZA 4PRBA 3OZ9H 3BOVA 3DUUB 3P30H 5D72H 1FVEB 2N4IA 5ELIA 1OAYH 1S7TB 1S3KL 1YPZE 1U3YA 5HJ3B 2JK5B 4LHUD 1RUPL 4IRZH 3MV9A 5BRZA 4GRLD 4Z5RA 2OTWB 1SY6A 5BJTA 1QLFA 1JZ3A 1HYSC 3DX6B 1CFQA 2DLGA 2IAMB 1KV3A 3KYMA 5D2NA 4JO2L 1AO7B 1QYGL 3QIUD 3MLUL 4LSVH 1HHHA 2Y1VA 3QUMA 4H88L 4OD2B 4XPBH 4U05A 3BAEL 2DIBA 1HDMA 5I6XB 3Q1SL 4S10A 2EO1A 1VGEL 2VXTL 4X6EB 4YDIH 3MRJA 1OAXL 2F19H 1OM3L 5EU7C 4XBGB 4U6HB 1YEJH 3O4OC 4O02H 2ZP0T 1M6OB 4J3WA 3UBXA 1OOAA 3SE3A 4OZIB 2CRZA 3JUZA 4QXGH 3U7YH 3REWA 4GUPB 1QRKA 5ACZA 1N5YL 2HMIC 1LEIA 2P1YA 3VD4A 3MBEB 2DQCH 4HEME 4LLWA 5BW7A 2X4SB 3F7PC 1RUPH 4P9HL 5H94B 4U0RB 3PL6D 2ICWA 5C6WH 1PSKH 4L8BA 4EI5A 5DLML 3QDGA 2P24B 1IJ9A 3F5WB 5E2JA 1J1PL 5HHME 1JRHL 5C6TH 2DDQH 3C09B 3QCUL 4OLWL 3RNKA 5A16A 3AS0A 1RV6X 3LKPA 2NXYB 4F15B 5I74C 5IIEB 3QQ9D 3Q1SH 4HUWB 3QXVA 2PYFA 3WV0A 4OD3L 1FBIL 1RI8A 2YUVA 4PPTA 4XCCL 4ETQA 3LS5L 1JNJA 2EYSB 3BT2H 2OP4H 3IS1X 5I73C 3LSOA 5DD5H 1KSRA 5I1GL 4HWBH 4HC1H 4RA3A 3W0WE 2C4FT 2EDQA 5DUPH 3U46A 5ITFA 5MEOB 5D5MA 4R96A 5BS0A 2YPLD 3C8KA 1KN2H 5E24E 3HE7A 4JFDE 4UT7H 1YMME 3PL6B 4U1SB 4ELMB 4ZFZB 4R2GB 3Q6GL 1IC4L 1LEKB 3E1F1 3DMMA 3FQUB 2VDNL 1U36A 5D1ZC 1ZXQA 2AQ1A 5AAMA 4M03A 4FABL 4APQC 3HMWL 3LN9A 1T83A 5GGSB 5I66A 4WY7H 4Y19B 4UINH 2A6JB 2SEBA 2HLFD 5FA3A 3VGHA 3VXRA 4PJGA 4D8PB 2PW2A 3OKKA 3AREA 3TM6A 1JGDA 4KJYB 1MJ8L 1XT5A 2QSTA 1YY9C 2OZ4H 3GSNL 3QDMD 3NFSL 4X4YB 5E6ID 4F33A 4F7EA 1U3HA 1CFTB 4QOKD 3TIDA 2BFVH 1H8OA 4M5YH 4MA8H 4Y0GA 1CVRA 4R9HA 1CD0A 5DD1L 5KS9B 1HKLH 4RFEA 2NYYC 3KVQA 4HPOH 1G9NH 4NQCB 1G7JA 3JV4B 5C7XL 2ZUQB 5LGJA 3UJJL 1SYSB 4PJFE 4U1JA 5SWSA 5IQ9B 3BDXA 5EH1A 4HS6A 1PLGL 4KRPB 4GBXC 1KOAA 1RIVH 1RZGB 4NP4H 3B2UD 4TN9A 5DD6A 2I60H 1FV1B 5DFVC 2P48B 2PTTB 3A0OA 4BSVA 4MQ7B 4JFZL 4ISVA 4YDKH 1DBMH 5B38B 2F53A 3O6FA 3W9DA 5A2KH 2F8OA 4IOFC 5KVMC 1LO3H 2CRIA 2GJ6B 3HUJB 1WBYA 5LQBH 3ZT7A 2ITDA 3V4UL 1WSST 2N7AA 1D9KA 5E2TH 5T1DH 2EYRA 4I13B 1XGRB 5D6DC 3ZT5A 3PWPE 4TOYH 1T22B 1E6JH 2BNUB 3LH2L 4K07A 3UMTA 3HS0B 3WNMA 3OQ3B 3MCG1 3X12A 3TYFB 1F6FB 1XGTA 3KLSA 3QPXL 3PV6A 1AIFB 4N8VA 3RVXC 5I8EA 1IM3B 5HI5D 2CO7B 3WLBA 1WUNT 3LPFA 1U8IB 3JWDL 3PGCA 1ZVYA 2EKSA 1KJVB 4NNPH 3CD4A 1Q0XL 4TUOB 4XNUH 5JR1H 5HTSA 4G6KL 1MQ8A 1CR9L 4JR9L 5CILH 3STLA 3SEPA 3CSBA 3HI5L 3IJSB 1LILA 4J1UA 4NO5B 5CP3H 1G1YA 4R4FL 1Z6JT 4TTDC 4C59B 1QOKA 5GS1C 3DO7A 3Q5YA 3OKNA 4WUUD 3VXTA 3TT1L 4KUCD 4OI7A 1N7ML 2P5WA 5E0QA 2EE9A 4WO4D 4IDJL 1KT2B 1FVEA 2OR7A 2P42B 4DVBB 4M1DH 4OGYH 2JK5A 3HLAB 4KK5D 3TF7C 4EBQH 3TJEL 4G5ZL 3UTOA 3GBMH 4U6VH 5HHOA 1F90H 2DF3A 4YQXH 2FJHA 4QHUB 5I9QB 4JRXA 3CXDH 1HHHB 3QUMB 4OD2A 5DK2B 3MC0A 3LN5B 4NNPL 3LS4L 3O3DB 3LKQB 3GJEB 4NUGL 1S7UA 5F7HA 4B5EA 3F65A 4PLKD 1JWUA 1JI1A 2G60L 3SKOA 1YEKL 1PG7H 2AI0L 2BVOA 3EYOA 4HIEB 2AS5M 1M6OA 3TIEA 2DKMA 4JG0L 1SBSL 3UTPE 5A2FA 5AWNL 3TT1H 1VFAB 4EIGB 1DJSA 4NSKB 2BC4A 3WNOA 2Q7NA 5JNYA 5EU4B 3U9UA 3TC9A 5CEYA 5EO0B 3M17A 5EU3B 1J8HD 3EO0A 3TT3L 1Q1JH 4WEMB 5E8NA 4BFIA 3BJLA 3NVQA 4UQ2B 1JFQL 3VMPA 3T3MF 1A2YA 4AM0B 4HH9A 1A7OL 1G7QA 4QCIA 4P2OC 1U8KA 3NGBB 5J13B 2QV2A 4LP5A 2OMNA 1FP5A 4FQXD 4F7PA 4PGEB 2VXSL 1WCBB 3GI8L 4X99B 4KHTL 4PGJA 3EYVB 4GJTB 4Y4FD 4HJGA 1OTSD 3CDGB 1JNNH 4GQ9H 1UH3A 1H3TA 4M61B 5FF6B 5J06A 5ITFB 3U46B 4AMKL 3VW3H 3PWJB 3QCUH 4OLWH 4Q2ZB 1MHPH 1JGEA 4XWOD 1W72A 1IQWL 3ILPA 5C0AD 3VWKD 2X4PB 1ZANH 1OGAE 5DJYA 5DRZB 5DFTA 3S8WA 4DTGL 4LNVA 3V6OA 3GIZH 1QFWH 2CDFB 5FO7B 5K9QI 4M6ML 1J0KA 2DMBA 4X4XB 5KSAC 2BZDA 5DUPL 1YNLH 1O5DT 5GRWA 1FAIL 4FQXB 3VXRB 3BZEA 3MLTA 4LLDB 4LSRL 4D3CL 4HXBL 3V2AR 4BELD 5F9OH 4MAYC 5FDYA 2WM0A 2JF1A 2HJKB 3QR2A 4QYOB 4WU5B 3IDMB 3ZTNH 2XWBA 4G6FB 3H3PL 4L9LA 2IH3B 4X5WB 4P5KA 3ARUA 3RKPA 2DQEL 3EO1B 3DYOA 4OCXH 4UINL 3GB7A 3DLQR 5C08E 1IGCL 3B9VA 4GG6B 5AZ2L 1BHGA 3EFFA 5EWIH 4GAYB 2NXYD 4ZUUA 3EW3B 3FT4A 4MVBC 3CU1A 5TE4H 4M93C 1N5AA 3IKKA 3GSNH 3HAEG 3N85H 1HXMA 2VC2L 4OM0L 2EH8L 5I1DB 1LK2A 1XCTB 5C92A 3V5KA 1QFPA 5GSVB 3WE6A 4AG4H 4O2FA 4NRYB 5D7LE 1FNSH 5LBSH 2Y07H 1UYWH 2DQFB 3GHBH 4IHOA 4OSUL 3WNKA 1OTTC 4O51B 3IFOA 1T03H 3LQAL 3VGDA 5C0JA 2H2SC 3WFDH 1EGJL 3ZE2F 5CEXA 3ARGB 3VXPA 4OF0A 1I1AD 3NIGE 3B6SB 1AXTH 2I07A 4EUPH 4N1HB 4ZFFA 4Z7UB 2GEEA 4WO4B 3FT2A 7FABH 12E8H 3G6JB 3O9WA 3M8OL 4PD4K 1QNZH 5L9DL 1EPFA 5IMKB 4NQVB 3GMLB 3HI6L 1T1YA 4U1LA 1J0IA 2BNUA 1FO0A 32C2A 3MRQA 1MWAB 4R3SB 3RY6C 3SY0A 3QB7C 4TSAH 1CL7H 1HXYA 3X12B 5ANMA 3QIUA 4JCLA 1FIGL 2V17L 4LCWE 5FUOH 3MV7A 1EAPB 4JFDA 4LCYA 3RGVA 1K4DB 5BV7L 3O9WC 3ZKQD 4LSUH 5JORA 4KDTA 5FYJL 5HDQH 3O9WD 1HH9B 2NY6C 2AKRA 4PV9B 3H3BC 1KB5B 1YQ2A 2CQVA 3HZMB 1ADQH 3U1SH 4KAQH 3L7FB 4R4NC 4MJIA 3GMPA 4K7PX 2FHCA 2FIKA 1ZHLB 2R69L 1JWSA 3RU8H 3DO7B 4GAJL 3OXSA 4P4RB 2PYEE 4TVPD 4NWUH 1VPOL 3EOAB 1RZKH 5KSUB 1WEJH 1U2HA 3SDXE 2W0FB 4G8GE 3TPKA 2R8SH 4S1SH 1ZT7B 2AEIT 4MMZC 1QVOB 1FIGH 3C5JA 4HF5L 4PJXB 5AAWA 4Y5XB 3NFNA 2JJSA 3P11H 1BJMA 4X4ZA 3QO1A 2FJHB 3MRIA 4Q6IB 2A6IB 4QHUA 3RAJH 3SQOL 5TPWL 5DSCB 1X4ZA 1EO8H 4G7VL 4Y5VA 4YHKH 4FXGB 1W0WB 5F21B 1QBLH 4IDJH 1FNHA 5DJXA 5HYSA 5CKGA 3DOSA 2I9LB 4XCYB 1ZLUK 3NZHH 2HFGL 4V1DE 4R7NB 3B4NA 2BVOB 4P49A 4NHCL 2NTFB 3IU4L 4JFFE 3VWJB 2KQMA 4QRPA 3GUTB 2BXZA 2NNAB 4MWFB 4WTZG 1A4JA 3QZWB 2YA1A 4PP1C 4H25A 3KPSE 3K8KA 3C5SB 1ES0A 1WBZB 2Z9TA 1RZKL 1OB1A 5HHVL 5MEPB 1J9CT 1G7PA 3BGFC 3LN4A 2R9HC 2YMXH 4IRSD 2VLJB 4JM2D 5CP3A 3R8BB 4OCWH 2G60H 3E2HC 4PJ9B 3BSZL 1AHWA 1OW0C 3T0EE 3V6OC 1SBSH 3MRLB 1KTDB 2NY1C 2IPKB 4DJMA 3E8UH 3UXFA 1GZQB 4JFOA 5T33L 1MFBH 3TT3H 3LRSA 3O2WH 3VH8G 1FFOA 2V9QA 3HN3A 5GS1A 5DEFA 2ICES 1KNOB 2UY6A 2HVKA 4CVWA 1QSVA 1BQUA 4N0YH 5CBAA 4WFEE 4I18A 3O3EB 5F3HB 4AEFA 2YN5A 4DKDC 4H20H 2B4CH 3P0VH 2C3HA 5DRZA 4TRPH 2YMXL 3TYGL 15C8L 1FLRL 1GXEA 3ZE1F 3W2DH 4AYFA 1ERNA 4P23B 4PRID 2R0WL 1PVHA 4PRDA 3I50L 2WBJA 1X6NA 5D7SH 5C3TA 1JNLH 2B39A 4OF6A 4XMKH 4NO2A 4UMGA 1V3LA 4DEPB 1MCOH 1ZANL 2P43B 1IQDB 2Y7QB 4MJ2A 4WI4A 1ITCA 1TZGL 4FFVD 1RZKC 1U8JA 2WSKA 5ID1A 3CUPA 5F9WB 1XGUA 5T3ZD 4XHJD 3RY6A 4MJ5A 2YD9A 5D6CA 3T1FB 3RZWA 4UNVA 1ZHNA 3MFFA 3QIBD 2GTZA 5KW9L 4OZIE 3HTLX 3LEYH 4U1IA 1PKQB 3O6FC 5ESQB 4XNMA 5ACLA 1SJEA 5TE6H 2NLJB 3W5NA 2O5XH 2OLDA 4OFVA 3U0TB 4H5SA 4GW1B 3VFOA 3ARFB 1QFUH 5HVGB 3F8UB 5DI8B 1XCTA 4J3UA 2VZ3A 1L7TH 1UXSB 2R4SH 5KBNC 3FQXB 3GNML 3MJGX 2EE2A 4O9HH 2NYYD 4LKXA 2DM4A 1FNEB 1OAQL 5GGSY 5DQJB 2VMFA 4H26B 4ZUVA 3BN9C 2CKBL 1BWWA 1I1AB 4UBDC 1BZ9B 1U91A 3OF6D 3BN9D 1TTGA 3ARGA 3VXPB 3QWRA 1D6EB 4OLVH 3EJJX 3K2UH 4BA8A 5IW1A 1RZ7H 2XG4A 5IW6B 1U6AL 4PJBF 2VDOH 3BH9A 2A9ML 3EDJA 4Q9QL 3RI5K 1JUFA 3G6JA 4KV5E 3O9WB 4KI5D 4GW5B 5IVOA 3FHAA 1G7MA 4XMLL 1RFDH 2XKNB 4OD3H 2H2PD 3V95A 1FO0B 3MRQB 1F4XH 3O4LB 1MWAA 1P4LA 3JV0A 3QZWG 4R3SA 3SY0B 2OR8A 1RZJC 3MLWH 2JCCA 3HCVB 2MWCA 1JNHB 4G80A 4V1DD 4R7DA 5DZNA 1YJDC 4PJBA 3ZE2E 1DN0A 3UZVB 1HQRA 1IEBA 3MRNA 1Q8MA 2CRMA 3NH7H 3O2VH 1H3WM 3CSGA 3O81A 1MHHB 1XZ0A 4G43A 3PJSB 5ITBL 1S7VA 3SPVB 3L3KB 3QXAA 1SY6L 1T7YA 2AXFB 1BQHA 3MFGB 4JM2F 2R2EA 4NJ9H 2XTJD 3VGFA 1RK0B 1ZHLA 2X4OA 3RWGA 2GUOA 3S3JA 5IB1A 5DMGC 1IGTB 3FO2B 2QQQA 4NRXA 5BVJA 2PYED 3T8XB 3KPLA 3CC5B 1RY7B 5ISZA 5TF0A 4UNUA 5FYJU 3ME0A 3C60A 4ENEC 1JPGB 4G6JH 5DZLA 3QNXA 4JFED 1JK8B 4Q6IA 4I2XB 4JQVC 2R69H 3UZQA 1BVLA 3O6KH 3O8XD 4L29B 5CD5C 2Q3AA 5FYKL 1YJDL 1NC4B 3BPLC 1M1SA 3DX8B 5BXFB 3V0WH 2NCMA 2I9LA 2VLJE 2HKFH 1JN6A 1BIHA 3V79C 1QRND 2LABA 4MQSB 2NW2A 4NZTH 4PG9A 3V8OA 4JPIB 3M1BA 1N5YH 3BP7B 1KPVA 2DS4A 1JJUA 4YJZL 5MEPA 2Y4SA 3EDEA 5D7JB 4DZBB 5K9JL 4ZNEA 3QUKB 4WI3A 2K3TA 3VXRD 3OV6A 3V52H 1J8HB 3EYQD 4HUXA 1GC1C 1ZTXH 2ENYA 3CVIL 3CPLB 1SJXA 1QBMH 1FPTL 2LVCA 1LD9A 4OCSL 4C83A 1P69B 1KCVL 2CPCA 1ZSDA 3EJZC 3MV8B 3GRWL 3WEXB 4A2MA 4XX1E 1AO7E 1QFWM 4P0DA 2C26A 3R0MA 1U8LA 4D9RD 1E4XI 3O2DL 3QA3A 4OD1H 4UT6L 1K9TA 3LS5H 2VLLB 1YPZF 2UZIH 2YUXA 4PRHE 4MXWH 3VD9A 1UENA 1AGEA 1NFDB 4IRJA 4HC1L 4RAVA 4F58H 4P2OD 3PWPA 4MB5A 4ODHH 4IEFB 1YEHL 5H37H 2A9NL 2BSSA 2NMSA 5D96C 3GSOB 4B50A 1KN2L 4JDVA 1DVFA 4OQTA 1KCLA 4RGND 2HTKD 4QRQA 5DUMH 1UB5A 2HT4D 1U3ZA 4JCMA 1NCUA 3JWDH 3MRRA 4Z7OE 1YNTA 4EDXA 4HLZH 3S98A 5I2IB 2FGWL 4PTUB 4KUZH 1X4YA 4MCZA 2VSDA 4MDJA 4Z7UE 5INDB 4NM8H 4PGCB 4PTTB 1MAML 2W65B 2BY1A 1X5AA 4ODSH 3PHQB 3GMQB 4NT6A 4RGOH 1NCWH 4OCNC 4I0KA 5A2IH 5GZND 2X9WA 4MJ4A 5L8KB 4UV7L 4U6XA 2OX5A 2XZZA 3IDNB 2HTLC 5CZXC 1A6VL 2BVEA 1OGTA 2VZSA 3T1FA 1MCSA 4GKSB 4YQXL 5HHXL 4DCQA 2EICA 6FABL 5FUZL 2X70B 4HQQH 4G8FB 4HGWA 1FN4B 4HPOL 4X6DB 1T04A 1Y6MR 3NCBB 1KEGL 4JY5H 1YEEH 1KCUL 4APQB 2FGWH 3QDHA 4A2LA 3TVMC 3T1WA 3AC0A 1OP3H 2EDWA 1PLGH 3BP5B 3ARDA 1MF2H 3DX9B 4JG0H 1BLNA 2LAGB 3LEYL 4Y2DB 4L8DA 4LSSL 3VXRE 2W92A 1JVKA 5LWYH 4KRMB 1FDLL 2O5XL 3WYRA 4KTEL 3HA0A 4JAMB 3QEQA 2J88H 3VCLA 5M95B 3U79A 3GSWB 1EHXA 4GSDL 1CE6A 1WC7A 1BBJA 4PJEE 1U58B 4KV5F 3W11D 4PGBB 3FN9A 1Y0LA 1OAQH 2JB6B 4QXUH 4RBPH 2IF7A 2QLVB 1KEGH 2DQGH 1RURL 2AERT 1NCCL 2VDPH 3SQBA 1NGXB 8CGTA 1R3HA 4KHTH 2ADGB 1BOGB 4U1KA 3SBWC 2XXMB 1LP9B 2NY5C 1QUNA 3BIKA 5F1IB 5JZ7D 3ET9F 2JIXA 2ZSVB 5I1HH 1D5XA 1OVZA 4Q9QH 5EC2B 4Z7QE 5L8LB 2XIDA 2XQBL 2WNGA 2DLIA 3FQNB 3QFJD 1HQRB 1RSFA 3GSNB 1RZ8A 3IFNL 3DMMB 5FO9A 2DQIL 2YBRA 2GK0B 4PJBE 1XZ0B 1OAYL 4LF3A 5H2BB 4HFWB 2P44B 3TJHD 5FGSA 3WN5A 1ONQB 1ZHBA 4TVSa 1P4IH 1P6FA 2QADC 1MREL 2XQYG 1IGYA 5J3HD 3BW9B 1UKTA 1GGTA 5GJTH 2A6JA 3QI9D 1UZ6E 3RWGB 5D1XD 1V5JA 1HOCB 4NQXB 2FX8L 1A7QH 2PW2B 4MCYB 1A7PH 2EDOA 1HINH 5DJ8B 5DC4B 4DAGL 3NH7L 4LNRA 3WS3B 1A9EB 1FNFA 3B5HA 3E3QE 3OR6A 5D7KD 5FCUL 3PABA 4HS8L 1XCQA 1DQJA 4WGWB 4F33B 1YEJL 4O02L 2EXWD 1EDQA 1T7WA 2PTVA 2DQEH 4OCXL 2DQHL 3B5TA 3ZL4L 1QBAA 3GGWA 4Y4HA 4V1DA 4XP9L 5CEZH 3SGDH 3T2NH 2Z31B 4LAQH 4ZOCA 5F7DA 2YN3A 5CGMA 5MENA 4OFKA 3U4AA 1NKRA 3ARXA 3RDTB 1DBAH 3TP4A 3LPWA 2VKWA 4MD4A 1MVFA 3L5IA 1NCBL 2DM7A 4HBCL 4LBEA 1W0VB 4RGMC 2CD0A 4H1LG 1VEPA 4E41B 2E27H 3G6DH 4X5XB 3TBYB 2OK0L 1UKQA 4OV5A 4P23D 4HLZG 4ERSL 3CXHK 1CDUA 4MQ7A 1I9IL 4OLYH 1FBIH 1BVKB 4PRHB 3HR5A 4QHLA 2HKFL 1DBKL 1X5FA 4LEOA 1AHWC 1OW0A 2BHYA 3CDFA 5IT2H 5E8OB 4C83B 2ARJA 1XGPB 5H37G 1FZJB 5CSBA 3FOMA 4U2YA 2ITDB 4G8EB 3HNTH 3TBTA 5IBLC 2UWEB 3BWUC 1TJIH 2VERN 3WUWA 1XGRA 2X7LB 1EERB 4L4VA 5LJYH 4LCCB 5E2VH 4XHQA 3V52L 3V5HB 3BMWA 4MDIB 1KJ3H 4RAVB 3MV7E 3VXMB 2EYTB 2BVPB 1B0GA 3KPRD 3MLYH 5I75C 5DVNA 5GZOC 1QSFA 5GS0D 1ZLUH 3BJ91 3NIFF 1ZK9A 3I3BA 1IM3A 4U7SA 5DRNA 5I8CA 1Q9WA 3OX8A 5HYEA 4QHNA 4TULH 1FYTB 3O3BA 5ENWB 3SHSA 5IT2L 5TFSH 4Z76A 3QDME 4J1UB 1X44A 3IKCB 2R1XA 3CFJB 2XA8H 4N0UB 4WTXA 2IBBA 3L9RB 3R8QA 4ZNCD 4W68A 1VCAA 1LO5B 1F02I 1S7RB 5F72S 4WDIA 3V5DA 5D1QC 1S5HB 2B1AH 2ADIA 3L3HA 3EYFB 2NY1B 2VUOA 4UQ3A 4XNZC 1F3JA 4JPWL 3RL2A 4WV1B 5FGCE 1N2RB 5E8EA 1IC5H 3CIQA 3GI9L 3JV6A 4JEGB 2IGFH 2ADJA 4PJ8D 4M62L 4M00A 4G42A 4LLVA 5D1XB 3SQOH 5T1LD 5EORH 2GJZB 2DI8A 5AZEL 5DJAB 5D1QA 3HE6C 4CW1B 4LVOB 4NHUB 4Z78A 4L8SA 3VFSB 4L5FH 3A6BH 4RAHA 3ARTA 4HIJA 2N1KA 2EDJA 3LIZH 4NZRH 5HSFA 2YPLE 4APQA 2DWDA 3J7HA 2F74A 2IAMD 4HX1A 3NZHL 1JWUB 2WQ8A 3TVMD 5C08A 3JBG7 1NC2A 1FC1A 4DGIH 5CJQH 3TIEB 2GW5A 5KVFL 4PJ5A 4XXDA 4M48H 5EA0L 3V0VB 4QRRD 2FO4B 5EOTB 2IADA 3MUJA 1HHGA 1I4FA 1VFAA 5FYKU 3O2DA 3HI1B 1I85C 2DI9A 5FM8A 1E28B 1V3JA 3U2SB 5JNYB 1AQKL 1XF3B 4WJ5B 5SX5K 5EO0A 5EU3A 3X11A 1GGUA 3CFKB 3FAXA 3RL1B 3JWNC 5JXAL 2NY7L 2OYPA 3SDDD 5I19L 5B21A 4Y5YB 2QSCH 5BQ7A 4DGYL 5C0DB 2A0LD 4WEUD 5C09B 3OB0H 1G9MH 2YPKB 3DECA 3O6MH 3QULB 1IRAY 2J8UA 4P5MB 1C5DB 2ADGA 4U1KB 3QUZB 4NN5B 5TDPA 1S7WA 4JB9H 3BIKB 4Z7QF 2PR4L 4JFXB 2BRQA 2JJVA 2BNQE 3H6JA 2Z8WC 2MPAL 4UV4H 1JGEB 1CICB 2Z35A 2ZSWB 4Z5RB 1UA6H 3O11A 2PXYA 3TO4B 2B0SL 4ZMAT 2AK1L 5DRWA 4I8DA 1AGCB 5AYQA 1FLRH 2X4NB 1KLFA 2RBLA 2LU7A 1FG2B 2YXMA 5KVEL 3N1QC 4LCWA 2V2XA 1MCRA 1A6UL 1T5XB 1JZ4A 1XGQB 1H9VA 4OKDA 4M4PA 4IDLA 4U7KA 2CDGA 2BRRH 3UZEA 3BE1L 2HJKA 3PABB 5ICXA 4G6AD 4OIAA 1CS6A 1U93B 4WFGE 3ZDZF 1NFIA 1L4IA 4WEBL 1TLKA 2BVYA 1DQDH 1UZ8A 3CFEB 1XF2B 1CIDA 1U2CA 3BD5A 3BGFB 2JIXD 1ND0A 4CADB 5BS0D 4EI5B 1A7PL 3GK8H 3I75B 1FE8H 3QNYB 4ZUSB 2W59A 2ZPKH 3H42H 3M07A 1T5WA 4GT7A 1N5AB 4FFVC 3LKPB 5KANG 4Z77B 1Q9LB 5J11C 5KSAB 1DVFD 3MLZL 4BZ2L 3KPOA 1KXQE 4X5XA 1EEYB 4RNRB 3D18A 1OY3B 3MRDA 1TETH 5SWZE 3T2NL 1C12A 2R23A 3R4DA 4MD5B 3PHOB 5IR1B 3K4DA 2FJFA 5HI3C 1RD6A 4MAUL 4P3CL 5C0GA 4O51A 4GFTB 4MQXD 2MCPH 3IETA 2KZWA 2WMPA 2EXYC 3IJYA 4XP4H 1R0AL 2A74B 4C4KO 4LSVL 3GK8L 4JM2C 3FT2B 3HB3D 3IU3B 1AFVH 3ARBD 4HJJL 1WZLA 2UWEA 4JJ5A 3TGXA 2X4RA 3VFMB 3AAZA 1L6XA 2FL5A 4P9ML 2R15A 4R90L 3VD3A 4JHAL 3Q6FB 2HA1A 2QQKH 2BVUA 4UILL 1YYML 5GS0L 3FFCB 5TE7L 3L5XL 4JFDB 2P8PA 2R0KH 2VXQH 5IMLB 2FH8A 2DTML 2B1HL 5I6XC 3GSRA 3KPPA 4JZOA 3F6IA 1KIRB 2X4TA 5GRJH 1X5YA 4HUNB 5IVZB 2AKRB 5I1LA 3O2VL 1Q0YL 2J6EH 3TPUB 3MNWB 4CN4A 1MHCA 3QJFB 1U0QA 1SY6H 3RX5A 4LCUB 1R5IA 2AJUH 1G7JB 3L3JB 5DHXB 3T0EB 1S7SA 3K74B 3QISA 2D9CA 2XTLA 4L3CB 3STZA 3IGAB 2OSLB 1BF2A 4DKFL 3V6ZA 3DV6A 1B3JA 4G9FE 4LRIC 2HYMA 3H7LA 1G7LB 3ZKND 1CDIA 4XNXH 3GSQA 4UILH 5E8EB 4P59L 1U8MB 2EC9U 4BSVB 4BQ6A 1MLCA 1JGLL 1NFDE 4JKKA 1TNNA 4KDWA 4MNHA 3Q5TA 4G42B 1TJGL 1U3JA 1S9WA 1KJMA 2QSVA 5GRJL 3U9PH 1HSBA 2XICA 4WWID 2BDNL 4K3DL 4GS7C 2BY2A 4JM4H 1WBYB 5KN5B 4R7NA 1VSCA 5ACMA 1BM3L 3PP3K 2VISA 3QIWD 1B88A 4XXDB 1NAMA 5FYJD 2IGFL 2J5LC 1RIHL 4YFLF 1HHGB 2RB8A 2AJZA 1Z9MA 1E28A 3U2SA 1QRNE 3RRQA 1CXHA 5DUBB 1XGTB 3MBXH 1FL5B 1OP5H 1A6ZA 5BVPL 5KSBB 1A6TB 1GZPB 1MY7A 3FQRA 2Y72A 1CLYL 1RZ7L 4P3DA 4JGMA 3SCMB 3AU1B 5DHVB 3QDAA 4X0KA 2PNDA 4GLRH 1I1FB 1CFVH 1I8KA 2MNUA 1PKQE 2YPKA 2RCSH 2IPKA 3HZKB 4NWTH 4RFNB 5B39A 4JFEA 4ZS6D 1BD2E 3UTSE 3UJJH 1VGKB 4E9LA 4CNIA 5T5NF 5GS1B 2OTUB 1LO2L 5DO2C 1UM5L 4KMTH 3FO0L 2ATKB 1I3RA 4OV6F 4QRTA 1HHKA 3WKNA 5FAAA 4K94H 2ZOKB 1KCRH 1LO4H 5JUEL 2DKUA 3TCXA 3GJFA 1NJ9B 5DK2A 2YEZB 4LGRB 3MLRH 4NQED 1DBBL 3ALWA 1F58H 3O3DA 3E6HA 4U1GC 2KZ1B 1NANH 5IROC 2Q8AL 2C5DC 1RUKL 3BGMA 4JGJA 1I1RA 4M43L 5DDHA 3ZSSA 2HJLB 3EOYG 1S78D 1EO8L 1ZT4A 1UA6L 3P2TA 4ODSL 1MCNA 5L2JB 1T2JA 3PGFL 4MXQC 1KLGA 4E0RB 4X6CA 3WHXA 5EOCL 1C7TA 1J0HA 2YRPA 1U8JB 4F8QA 5ID1B 2BC4B 2HFGH 5D1ZD 2EDLA 4LARH 4O2CA 1FVCA 4ZUWA 1V7NL 3SGKC 4FQ2H 1D5BB 2F5BH 4J6RH 1P7QA 3VDBA 4DKEL 3UEZA 1SJEB 3ILQD 2NY0B 4HH9B 1N26A 1Q0XH 3U36B 4FFZH 2W60A 3MRJB 2QQLL 1U9KA 1BFVL 5T5FH 2Z0BA 4OCWL 3U7WH 4L3EB 4NO0D 4WEBH 3ARBA 3TCLB 3QI9A 1TJHH 3SN6N 1G0XA 4U3CA 5SX5H 1VHPA 4U6TA 2FYYB 5I75B 3UO1H 1YA5A 3HE6D 2AGJL 5K33A 5GJSL 4H26A 1Z2KA 3EDFA 4GQPH 3WDHA 1EJ6A 3AUVA 4OGYL 3WIFA 5JLZA 5H94A 1AC6A 1P84K 3NAAL 5D71L 1Y18A 2HG5A 2P45B 4X6CE 1TVHA 3MLZH 3OKLB 4FFWD 5L7XH 5C86A 4X98B 1FFPB 4J4PA 3BH9B 4PY7A 1Z9OA 3I85A 1AXSA 3C08L 3PXJA 4I4WB 3FB7B 1RURH 3CAFA 1NCDL 1OT1A 4MAUH 1UWEL 4CVZB 4GKZA 1P2CB 4FQIL 1R3KB 3OAUH 2V2TB 4KQ3H 3Q6FA 2HRPH 2EDYA 1TFHA 1AR1D 5IVXB 4I5BB 4Y5XC 5DMKA 4PJHB 3VE0B 4R96B 1JNLL 1XGYL 4HT1H 4YHLL 5J1TC 1KB9J 4RGMB 2FBJL 3GSRB 3KPPB 1FSKB 3EHBC 4GRLA 3RVVC 1CTNA 5JW4M 1OL0A 5EPMB 1MHHA 1MFAH 2Z8RA 2FX7H 4KJWD 5LKNA 1E4WH 3RI5F 1Q1JL 3GFUA 4HWUA 4WI8A 1JWMA 4P4KA 2NY5H 2AJSH 3SO3C 3UTQB 3MROA 3WL9A 1RK0A 3L5XH 1ZGLB 4C56E 5B22A 1G7IA 4C57C 5E6YA 5JMOC 3QDMA 1T20A 1IGFL 5JW3H 1AE6H 2CLRB 4RGOL 1NCDH 5FOBB 3X3FH 5FO8A 4KTDL 1U3HC 2O26U 4U3XA 1CGUA 5FM5O 3PGDA 4Z7OF 2ITCB 1LO0L 2BHUA 4K9EL 3UPRA 2PXYD 4PV8B 3KPMB 3NCYS 3HC0A 4HD9A 5HHMB 3LHPL 4LIQL 2RFXB 5FCSH 5SV4A 4LAQL 3B6SA 5CZVL 4RFEB 5E08L 4ZFOB 4WO4A 4RZCB 2CLVA 5LGJB 4UT9L 1JI2A 1W8NA 3QFJA 2NXZD 3PWNA 3HHRB 3D2UB 4YPGB 1NAMB 4K7FA 5ICYA 3SDCC 1YYLH 4UDTA 4AENB 1QYGH 3MLUH 3BFOA 4LSSH 1RZGA 4HXBH 4NFCA 4ERSH 2GTWB 3BPCA 4Y4KA 4DVRH 1FDLH 2XV6B 5HHQA 4TTGA 5LVEA 4ISVB 1J8HA 3DRTA 4RMVA 2VIRA 5DF0A 1NEZG 2Q8BH 3IXTA 4BSJA 1HH9A 1T1XA 2XZAL 1T7ZA 4YXKL 3D0LB 3UAJC 5DD0L 3WEXA 3UBXI 1D5MA 1KLUB 5CWSB 5CZVH 4YGVB 1U8LB 4H1LH 4MJIB 1NCCH 3RWDB 4P9HH 4HWBA 3UTTE 1Z5LA 1H15A 5JPMA 5B3NA 2R9HD 4IRSC 1T89C 4ZPVB 2VXVL 2GY5A 1OLLA 3FZUD 2BJMH 4LPYA 1BJ8A 5CLTA 4X8JB 1E4KC 5KSUA 2B5IC 2Q86A 3MRHA 5I1HL 4IMKC 5LG1A 2XRAH 3MX0A 3HG1E 3T4AA 2DQDL 4KK6D 4QRTB 4R4BA 1P5UA 1IKNC 3B2VL 4KJQD 4Z7VB 1YN6B 1LVEA 4HZAA 5FKAA 3IRZA 3NCMA 3OJVC 1PBYA 5MHSD 1PY9A 3LQAH 3WFEH 4Z7WF 4FXGA 3HNSL 5E1HB 5FXCH 4M7LT 3DPBA 4PB0L 4PTUA 3IJSA 1Z0NA 1KJ2A 5DJDA 2HT3C 5H35A 3B9KB 2GAZB 5HHPB 12E8L 4RQQB 2XA3A 4JJHA 5I18H 3UROR 2FJGB 2K9UA 4QRPB 3RX7A 4PLNC 3GUTA 5GGUA 2VQUA 1R5WB 1MFEH 1PZUB 3P0YH 3V4PL 4PJGF 4H25B 1I9RH 3QDJB 2EIBA 5B8CC 5DK0B 4NZJA 1N64L 4TPRL 1GCFA 2C3WA 2YD7A 3JXAA 4L3EE 1EEUA 4D0CA 5E9DB 1F58L 3EFDH 4O2CB 3X3GL 4GKSA 4PJ7A 4U1MB 3MUHL 1S5IL 5BV7H 3MRCA 3WSQH 3OZ9L 5F97E 3DXAE 3U7YL 4K8RL 2HLAA 4KDTC 3SE4A 5F7EL 1FN4A 4X6DA 1P4BH 1T04B 3E2HB 5CGYD 5F89A 1QR1B 3SE9H 5I1JH 1WF5A 4M7JH 1UH4A 4JFFB 1NMCC 3LKOB 4JN2B 1RZIA 4L3EA 5FOJA 3MJ7B 2WBJC 3ARBB 1YN7A 4QTHA 3DRQB 5D7LD 5DURB 4OCSH 5I1CL 3KPSB 1YEDA 4GAJH 3BZ4A 3I6KB 4M5YL 4M7ZB 4MA8L 3SGJC 2COQA 1FFOB 1JMZA 2AJYH 2HVKB 3T65A 3ZYJA 5D7LB 3WUWG 2XFXB 5JLZB 4YDIL 2CRYA 4PJDB 4UOW1 2OP4L 4HF5H 2NX5A 4EN3D 5D7IF 4OAWB 4N8CH 3U7WL 4X98A 4A6YH 3BD4A 1YMHA 1BBJB 3LZFH 4UDUB 4RMWA 1DEDA 1U8KB 4U6YA 3WMSA 4NP4L 2I26N 4ZQKA 1GH7A 4KH2A 4XC1L 3CZJA 4Y4KC 4EXKA 4DZ8B 4FNLL 1PSKL 4IS6A 5HYQA 1I7RA 1R3HB 3EYVA 2DBLH 1T0NB 3U4EA 4NNYA 2NY4C 3MO1A 5IHUH 1L0QA 1CFSB 1IGJA 3PWJA 3D69A 3K8LA 2B2XL 5TGBA 3V4UH 5SWZA 4JPVL 3DX6A 1EUTA 1AGFB 1IBGH 3MRKB 4LF3B 4U1IB 3QEGH 4ZYKA 1F42A 1U8OA 1X5KA 1ZGLA 3QP3A 4WUUA 3WO4B 5DGRA 1OP5K 1WT5A 1AD0B 4XCEB 2UY7A 4MCYA 4LLDA 5FO8B 5LAXA 1KF9B 3F12A 4JE4B 1IM9D 1S3KH 4GKNB 1IL1A 2A77L 4WU5A 2XPGA 3MRMB 1PX3A 4TUKL 2F8XC 3HI5H 1EEZA 3TFKC 4MJID 3GGWB 1TENA 3EFFB 4KROD 5JW3L 4K7PH 3FT4B 4CJ0A 4UIKL 5C2BL 4F7CB 4ZDHA 2JJTA 4RZCA 3QCVL 5EO1A 1FHGA 1XIWD 1ZA3B 5E2UH 3DUSB 1J05B 4DGIL 1IAKA 2HVJB 3ZHLA 1O7VA 3MRBA 3O4LA 4OF5A 3SDCD 1P4LB 5HGDB 2E9WA 2ZOLB 7CGTA 4Q74A 4EJ1C 4OV5B 3G08B 4ZO6A 4HAGA 3FO9A 2H45A 5E2TL 5A2LH 2DQFA 4IHOB 4U3HA 5GSRB 2V5YA 2FEDC 4XNZB 3DRTB 3QQ3A 1S9VA 2NR6C 4OCYL 4YHZL 5CEXB 4U1SA 2W07A 1F5WA 4N1EA 2WIIA 3OHXB 1U8QA 2F54A 3L3DA 2NY7H 4JPKL 3L7EB 3ALXA 4OZHA 2I07B 3FOLA 4NDMA 4HHAB 5B38G 1UH2A 5EOCJ 5LGHL 2ESVA 2XG5A 1CZ8H 2GJ6D 4Z7VE 1NBZA 4JFPB 3K3QA 2AV1B 4CMMA 3IFNH 1D3CA 1JZ6A 4OZ4B 4PJXE 1MPAL 4GAGL 3X17A 4PLKC 1TPXC 1DDHA 4ZUTB 5DD5L 1HXYB 1N4XL 5BVJB 3EDDA 5J6HA 4NO3B 3QT2A 2H1PH 5EN2B 3LQAC 4WI9A 5ISZB 5GJTL 1FH5H 2WV3A 5LXGH 1C16A 2MHAA 2R56H 1MLBB 1JPGA 2XZQL 4OLZH 1JPST 3B3IA 2NY3B 5F9WC 5DRNB 1FORL 1JRHI 2NY1D 1FYTA 4OJFL 3TBWA 5C3LD 2P5EA 4HBQA 1BJ1J 4YHYB 5AD0B 1PFCA 5E9DE 4FABH 2QBWA 5C0EB 1IKFL 1X5JA 2C9AA 3CH8A 5CMAB 2BHZA 5HHPA 3LCYA 3ZDZE 3VMNA 4U1JB 1IAII 5EZLA 2ZUQC 3MCLH 3MZGB 4HG4K 1WZ1L 3BDYL 2NW2B 2EIDA 2GSGB 2UYLA 4OUUB 2W0FA 3ESUF 3BHBA 4IRJC 1PQZA 4Y4HD 5T1KA 4PJHE 4R26H 2HT4C 3TESA 4JO1H 4N9GB 2YUZA 1M71B 1CICC 1D9KC 4KPHL 3MODH 1N7MH 2GJZA 3C5ZA 3QO0B 5HHNB 4ELKB 4D3CH 5DD1H 5B4MD 3VFSA 4LGSB 1VENA 5D7KE 2UWEF 5KOMC 2IBZY 4HX1B 3RTQC 5BZDB 3LV3B 3VXUB 3ZTNL 3GSUA 1YEIL 3RFZC 3INUH 1ULVA 2VLLA 5ABDE 1R5VB 2X1QA 4H0IA 4IRJB 1OF2B 4XPAH 1KELH 2DWEA 3T65B 1FFNA 3TYFA 1IGMH 3TNNA 2XFXA 1S9YA 1J5OH 2C1OA 2VITA 1BD2B 4EUPA 4TVPE 3ZDXE 2WAHA 1NGYB 3MLSL 3RL1A 1N0LA 4XVJL 4Q9BA 4MVBD 3KYNA 2APBA 1BQHG 3WJLA 5BQ7B 3MLYL 1YNTB 4TUOA 3DTXA 4E42A 5D70H 1MI5D 3NIDF 5L2KD 2JELH 5IOPB 2E7LC 5L6YH 3TO4C 2BNRE 3QRFM 3BO8A 3RVTC 1YEGL 4PTTA 5CIPA 3EYQC 1C5DA 3KPTA 3JZ7A 2P5WB 5J9PA 4OLXL 4XCNB 4I0PC 3MO1B 4IBLT 4NZTL 4AH2B 1AXTL 4QNPE 3KXFA 4J4PC 4NKIH 3VWJD 5IFHH 3W11C 4AEIL 1NBVH 3ARDD 5J56B 5SWZB 3KYOB 4KXZH 3TO4A 1ZVSA 2H8PB 5FYKD 1CBVL 5F9OL 5C8JB 5J4MA 1EV2E 3SJVA 3UPAA 2X70A 1IT9H 2J2ZA 4JRXB 4LSDA 1JNNL 2ZCHH 4GQ9L 1UFUA 5GZOD 2E9IA 5JHLH 2LU4A 1XGQA 4CVUA 5CSZB 4XCEA 5JOEA 3GIVA 2IALA 2ZG3A 4ZXBD 4B0MM 4NNXA 4L5FL 4GKNA 3SDCA 3MJ9H 3DMMD 4NSKA 3MV9B 4D2NA 1GSMA 1EEZB 3SGKA 3G5VB 4AEIH 2YD6A 4OT1L 5IEKA 3DVGB 1XF2A 2DYPD 2GTZB 2DBJA 4FQ2L 5IVXE 4BFIB 3GMNB 1MH5B 3MR9A 2QJDA 4YO0A 1VKXB 2J8UF 5J1SC 1Z9SA 4G6MH 4ZDHB 2P47B 1HDMB 3PQYE 3TWCH 1T5WB 3K4AA 4K94C 5H8DA 4X6EA 3PNWA 5GHWL 1CU4H 3FTGB 4LDOB 1KIPB 1Q9LA 3QIWA 5GRVL 5D2LB 4JDZA 2XACC 4ZS7L 1E27B 1M7IA 1RIHH 5CEZD 2X42A 3BMVA 1L7IL 3G08A 3UO1L 3K7UA 2I60L 4GUPA 4YR6A 1HIML 2QL1A 3QXTA 5C0GB 3KAAA 4HIXH 3GKWL 3IETB 3X14A 2UVEA 2PN5A 3T09A 2YD3A 2YA0A 4NHCH 1A6VH 3DGGB 4AY0A 3D6GA 3ORJA 5IW6A 5FO9B 3F5WA 1FL3B 3V6FA 1NQBA 4P46A 4JGUA 5T3ZH 6FABH 1NSNL 2ICWJ 3NIGF 4RSVA 3RNKB 3SDAD 3BRFA 1ZA6A 1VEMA 2R4RL 3ESVF 4M4RA 4YDJA 2YC1B 2MCG1 2B0SH 3MV11 4YAQB 2AK1H 1Z9LA 2FWOB 3AAZB 2J12B 4GW4B 4ZUTA 3O0RL 3G9AB 4Y1AE 4PGDB 4TNWK 4D9RE 3EO9L 3OMZA 4FFWC 2EC9T 5E2WH 4H0HB 1IKNA 4HUUA 5EZOL 1IAOB 3NA4A 3QPXH 5D5MB 1L0YA 4OTXL 3S5LG 4OLEA 4YNYB 2Q20A 2V7NA 5L9DH 1DQJB 4L9LB 3E8UL 4HDIB 1GPOL 4X8XA 4V2BA 1IQWH 4P2RD 2CK0H 3BKCL 4MA1B 5C1MB 4YXHH 1OWRM 5JHDA 3B2UC 3CFCH 2GT9B 4GMSH 2GITB 4I3RL 4D9QE 4JN1L 2VZTA 5I30H 5FHAH 4D8PA 3JTSA 4G8IB 1W0VA 3AGVA 4OIIH 4ALAH 1M05B 2UYLB 1RVFH 3CC5A 2FGZA 4WFGD 1Y6NR 3VXUE 2APTA 2C7UA 1A5FL 3BHBB 2H6PB 5IMOA 4LSPH 3T0DA 3CH1B 4G5ZH 3I50H 3IFPA 4N9GA 4MNHB 4BZ2H 3TNMA 2VL4A 4YHOH 3A67L 3NA9H 1B6DA 4CGTA 1WZKA 3C60D 2NY4B 5D93C 4ZSOE 4AEEA 4NWUL 5DHYB 4XVSH 2RGSA 1ED3B 5KS9A 1I3UA 3OB8A 3S34H 4J8RB 2R29L 3DX8A 4Z7UA 1DEEA 3B8YA 2HFEB 4PJAB 3CFCL 5KN5A 5DVKA 4LOUC 3QUMH 1Q9OB 4Z7WB 1YECH 3RGVD 4LPVA 3V7AG 2EDNA 3L1OL 4QRSB 4LCCA 1DTUA 1MJJA 3IF1B 4U1LB 5IFJA 4NJAH 4XP4L 4KZEL 1GIGH 1FYHB 4JPIA 1MCPH 4XP1L 2X4QA 1FFNB 2YSSB 1FZKB 1KB5H 2BNQD 5DUBA 2PTTA 3MMEA 2VITB 4PJHF 5FCUH 2I5YL 4YXLL 3QEQD 1C1EL 1K4DA 3KYAA 3CX5J 3CPLA 5E6IC 4XNYL 5HDBF 2WUCL 4NQDE 3BD3A 3H8NA 3KG5A 3QQ4B 4DGVH 2PF6A 1RIUH 1X9QA 4EI5D 3CMGA 1X5LA 4M8QA 4QTIL 1JWSB 3G5XA 1NL0L 1S7RA 4LHJB 1AGEB 4XP6L 1KUMA 1HNGA 3ROLA 1TIUA 5FYLH 4AMKH 3QH3B 1F11A 1XGYH 2Y6SD 2NY4D 3GBLA 4HT1L 3VXSE 2VLMD 1N2RA 3HZYB 5BZWB 2XZCH 3G5YA 1HCFX 5E5UB 3JV6B 4NIKB 5T33H 4DK6A 1MFBL 4MD0A 4HWZA 1U8IA 2X4UB 4CKVX 5I16A 1I7ZA 1SYVA 4FS0A 4S2SB 3JVGA 4Z78B 3STLB 3WXVL 4N9OB 3E6HB 3WD5L 4HUVB 4ELME 2F74B 4W6WB 1FNGB 1ZT4B 1TTFA 4P46C 1MRFH 5C07E 3FHQA 3GMQA 4NT6B 3WKMH 4DUVA 1KTKE 5L2KA 1LE5B 4QTIH 2X44D 3WFBH 3MRGA 3T2PA 1F4WH 3SDCB 2JB5H 1TZIB 4PJFB 1HNFA 4AEHL 1ES0B 1UQSB 2DYPA 4M1CC 2P7TB 1CK0L 3H9HB 5ISZE 4XMKL 1WK0A 5DMIL 4K3GA 1CI5A 4OFIA 5HHOB 4KQ4H 4DCQB 1WWBX 2XZCL 1FSKC 3CX2A 1PGRB 3MV8E 4BZYA 4D94A 3QI9C 4CDHA 1VKXA 2PXYC 5F3BA 2CR3A 3LN5A 2NTSP 3H9SA 4KROC 1G7HA 2E7CA 3U36A 2LFGA 1NGPH 2L7JA 3PG2A 5TFSL 5C0AA 3QG6B 3SO3B 4U1GB 1GZQA 3WUZA 4PJ8C 5IHZB 4C56B 2MMXA 4OZGE 3LRSB 4JVUA 3RA7L 2DM3A 2RCSL 4QRRB 3EBAA 4TTDD 5CGYC 5DTFB 5T5NG 2DD8L 2YD8A 1UJTA 2KQNA 4LKCA 2PXYB 3AY4A 5E8NB 4P4KD 2R4SL 5BOZG 4OZHF 1ETZB 4POUB 4I4WA 4WIQA 2JB6A 4WFED 2CKBH 3PDGA 3EGSA 4J3OC 3FB7A 4PJ8B 4CVXA 1I7UB 2V5TA 3ZO0A 4XAKD 4ZTPH 1A0QL 3VI4F 3VG9B 43C9B 4OKVB 2CJUL 5EZJA 1H0DB 3RPIA 2VDOL 1A7RL 3BZFB 4M02A 2OS7A 3SKJH 3DUUA 5DMKB 2V17H 2Q8AH 4W4NA 1U8PA 4KKCC 1URLA 4BQBA 3B83A 1NBYA 1DUYB 1O7SA 1XR9B 5CUSL 2NY2D 5IROA 4B53A 3MOBH 3MFFB 2VR4A 2Q6WA 1MY5A 4P48A 4K23H 3QUYD 4PS4H 2DL9A 1MQKL 5HHMD 3WL9B 3ARED 5EZOH 2A9NH 4IMLB 2X2YA 2LU3A 4OFYD 3QDMB 2R2HB 3R06A 2NX5D 4EN3A 1HOCA 4GW1A 3S37X 3F58L 1JYVA 3NGBC 3OF6A 2F5BL 4PLOB 5J13C 2M2DA 3ARFA 2H3NB 5DUML 5AG8A 1NMAH 1PY4A 4ODWB 1WIOA 3V0WL 3PGDB 4BKLB 1VFBA 2H6PA 5I74B 2ITCA 1BVZA 3TZVD 3VFPA 5I1KL 1JGUH 4J7RA 2Z91B 5JQ6H 3GB7B 3RAJL 5KTEH 2L4OA 4Y4FC 5DHYA 2PCPA 1DQLL 4N68A 4AT6B 2P24A 3PWLB 2YK1L 4FQCH 4NYLA 5E99L 3ZLQC 4FQ1L 1KIQB 3SE9L 1NGQL 4G9DB 3BQUD 1KBGH 1BREA 1T3FA 4NQDB 3TBSA 5EU6E 1MJ7H 1MNUL 1KCVH 3QFJE 4AENA 4BFGA 1ZAGA 2YSSA 4RWHA 2BRRL 2MQCA 5IB2B 1Y6KR 5HXMA 3DWTA 3FFCA 2KKQA 1OQOA 4WI5A 1D5ZA 3HR5B 4Z0BH 4BFEA 4PJBB 1BJ1H 4KJPC 1CD1A 1RUML 2VABA 5DR5L 1CGWA 3KDMA 1A1OB 2D31B 1XF1A 2OTPA 1S7VB 1F6AB 3ES6B 4JHZA 3QJFA 1MHCB 4YGVA 4G8EA 1PDKA 3CLFL 3PQYB 3S35H 1OGAB 2DJUA 5GIRB 1FZOA 3T0EA 1HKFA 4L4VB 3S35X 2X4OB 3MNVB 4XMLH 3G5XB 3ZKXC 3I6LD 2CKBB 5C0ND 4X8JA 5F9AC 1VFOA 1G7LA 2VDRL 3QH3A 5FGRA 5C70A 1P7KB 3GSQB 1DQTA 3IB4A 4R4BB 1IAIM 3TH3T 2PO6A 4J3VA 5EFIA 2CIKB 2VDKL 3DX7B 5FKAB 5CBEA 4OFYA 1NCWL 2DTSA 5ANME 1RHHB 3W0WD 1BAFL 5KJRL 1KB5A 1QSEE 5I16B 3U0WL 1ACYL 4BQCA 5MEND 3MXVL 3AXLB 3VFUA 5GGTA 2X1PA 4JM2A 3L9RA 4K7PY 3LKRA 3N0PB 2PO6C 1GAFL 1I1AC 3PWVB 5IQ9A 1RU9H 1BFOA 3MRGB 4GLRI 4KJQC 4YWGL 1D5IH 3L6FA 2HWZH 4P46D 4WV1A 3WXVH 4YHMH 5D5ME 3QO1B 4XAKE 2F53B 2DTMH 4J12A 2HAZA 1YYLL 5C0IB 4Y5VB 3OKMA 2HT2D 1JV5A 4K7PL 4Y16C 5C9JB 5FIEA 4LLMA 2CMRH 4L8SB 2IPTH 5FYKH 3WFBL 2DI7A 4LLQA 5FYLE 4U1NA 4HMDA 2ADFL 1QR1A 3KJ6L 4NN6B 2DWDB 2W0PA 5CS7A 5B39B 5C08B 4NCC1 2Q8BL 4C56A 4BH7A 4N0FB 3KPSA 2DQHH 3DI3B 5IKCB 5MP6L 2D2OA 3RWCB 1H3PH 2WWMD 2FECI 4LSQH 2YD4A 2GKIA 3IRPX 3PWPB 4PJ5D 5BMFH 4QHKI 3TN0A 1XF3A 1VACB 3FN3A 3MLXH 4RCAA 2VDPL 2PTUA 3BP6A 3DYPA 4PJEA 1OGAD 4A6YB 4MAYB 4NFDA 4XI5D 4OB5L 2ZUUA 4JLRB 3W5MA 2KPNA 4XRCB 1KJVA 3D3VD 4RMSA 4ORGA 5M94B 3SCMD 1A3LL 3CSYA 3V7MA 1RUAH 5JDSB 3C6LC 4MCZB 1J1OH 4KTEH 1MFDL 4PGCA 1NFDF 2J8UB 2HJLA 1QSFE 1MOEA 4NGHH 4OKVA 4LK4A 4GRWE 3AM8C 5EZJB 5FA4B 3RPIB 1ORQB 3JWOL 4DUWA 3SO5A 1KT2A 1CFSA 2H26A 3WHXB 5D2LF 2XZQH 5TGBB 5IM7B 5I18L 5C07D 5A3ID 3ULUE 1CVSC 4PP2B 5FB8B 2Z31C 3MRKA 4ONGL 3F7QA 4EEEA 4PRPD 3MA7B 3WLWD 5EOQL 4PJCB 1X4XA 4LCWB 2HMID 1U8OB 4NJ9L 5C0BD 1MCDA 1CLOL 1T5XA 3PIQA 2A1WL 2WBJB 3ARBC 5C6PB 3FB6A 3HC4H 4NO2B 3PQYD 4NWTL 2JCCF 1J1OL 1UZ6F 1K5NA 5CUSH 5LAXB 3TZVB 1DLHB 1BQLH 1IQDA 4JFEE 1DR9A 3GO1L 4LRNL 4NQCE 3JTTB 1DN2A 5KVDH 2ED7A 1NFIB 2FX9H 1U8HB 2AJ3B 3VXSB 1K8DA 1A7QL 4FQQB 3VCLB 3ZTJH 4OM1H 4WTZA 3OG4B 5DWUL 4RX4D 1XIWB 3ECBA 4U31A 3I75A 1G84A 1CGXA 3STBA 1NAMH 4UQ2A 2VDNH 3PWLA 4NYLB 1FFRA 5HY9A 2XTJE 2FR4A 4YBLC 1WJ3A 4HPYH 1Y0LB 5GGRA 4OCRL 2DQUL 2ERJB 1YEIH 3J8F7 3CMOL 4N8CL 3BPOB 3SE4C 4WUUE 4ZS7H 2GQHA 5E1AA 5FECA 3KHOA 3RGVC 2FBOJ 3VA2C 3PP3H 1IGML 3ILQC 2J8HA 2VSCA 4H1LB 1EFXB 4I5BA 3UJTH 3P9MB 5IR1A 2JIXB 1OPGH 1I1AA 4WFFD 4I3SH 1QRNB 3Q5OA 5EOCH 5I8OL 3EDKA 4RFOL 1CXLA 5IVNA 3H2WA 1A22B 2OR9L 3TA3C 2X9YA 3CFIC 5DJYB 1I1CA 2YHGA 5C6TL 2OK0H 2IC2A 2NZ9C 3ULUC 4J6RL 5IW3A 2A83A 1NEZB 1JWMB 1B2WL 2E3VA 4P4KB 3D39B 5D8JL 4F9LA 4N8VG 1G7MB 1YQVL 4MXWL 5IFAL 3WN5C 2BERA 1T21A 1DDHB 1JGVL 3D0VA 1JF6A 4QGYA 1WFOA 1YY8A 3KXFD 1A9BB 5EBWB 4K3JL 3OR6B 4R7DB 5EB9A 1UB6A 5IMLA 4YEEA 4RMUA 1QLRB 2OL3L 2UZXB 4PRPE 5I15L 3BIBX 5SWSD 3G6JE 3NIFE 4GRMA 1RHHA 2Z93A 3MREA 3JVGC 3ISWA 1QSZA 2A77H 1RMFL 2HFFA 4NN7C 5F6IC 2H2SD 4CBPA 5JHLL 3FRUB 1YC8A 5CJ5A 1LNUB 3LKRB 3OKYA 3SGEH 4XWGH 1OAZH 3S5LB 4LBEB 1BFOB 5J6GA 4WWKB 3FCTB 2Y5EA 4NOFA 2DOCA 2AAVA 5ECJE 2HRPL 3BPCB 3BEVA 3C60B 4Y4KB 2C4FU 4LSPL 5A43C 1R3IH 3TVMA 3UJIL 3QNXB 1BVKA 4PRHA 5I1EL 1JK8A 3IFOB 5C0JB 4OZGA 1BIIB 3KLHC 1MRCL 1NGWB 5C9JA 2PYEB 1EK3A 1W8OA 4UB0H 1FZJA 3CDYA 1WITA 3I2CH 3BXNA 5M7QA 1D5MB 5HPOA 4X7FC 2BMKB 2EH7H 1FVDA 2K7PA 1FNAA 4U1HA 4NQVA 4R4FH 4BH7B 3GMLA 4RMTA 5D1ZA 5IKCA 4KTYA 1SM3H 1OF2A 3VI3F 1P7QD 3VRIB 1KB5L 2IPTL 4I48A 1VACA 2VDQL 4M1DL 1FL5A 1QSFB 3QUKA 4HSQA 2WWMC 3O41A 3RNQA 1CF8L 5IJKC 4X0KB 5EUKB 4AIXA 4QHNB 3HPLB 4KRPD 3DTXB 4PUBL 4NM4L 2R4RH 5HHOE 1CXEA 3CFJA 4J3XA 5GPRA 5GGTH 4BK5A 5DK3A 1N6UA 4M6AA 5FA4A 4P4RA 1ORQA 5DD3H 4XCNA 4ODUB 5D2LE 4U7MA 4R0LB 3EYFA 1HWHB 3KYKH 3GSOA 4UQ3B 2ATKA 1F3JB 4EDWL 2Y25A 2R0LH 5EDXA 5IM7A 1QVOA 4D0DA 2VR9A 3FQWA 5E6IB 4QRQB 1CE1H 3RY4A 4PP2A 4FFYL 3H7BA 2D7TL 5C8JA 2DQIH 2EDXA 3IDYC 5DSCA 2YKLH 1EHLL 1UVQA 2FEEI 2ATPB 4JB9L 1YNKL 1UWGH 2ZJSL 2YEZA 3IJHA 4GMSL 4JHAH 2VLKA 4NHUA 5I1GH 5F93C 2XZAH 4MSWA 4HWBL 4JRXD 5E56A 2IQ9L 1EO7A 4HIJB 4MDJB 3FB6B 5E00A 4GXUN 5JW4N 4PJAF 4XCYA 2IALB 2VQTA 3AREC 1J1XH 4KPHH 4JKMA 2BOBB 2IBZX 3P9LA 1RZFL 3ARYA 2G75B 3CNKA 3PDOA 4HV8B 4X6CB 5FHBH 4BUHA 4F7TB 3S88H 1EHAA 5E4EB 4FP8L 3HI1A 4EBQL 4Z7NE 5CJOL 4G8GD 3WJJC 4JPWH 5GS0C 3KYKL 5JA8B 1WV7T 2OI9B 3V4VL 1MUJB 3GSXB 2AJ3A 1CLOH 1F90L 1K8DB 3VW3L 1RK1A 3GMOA 3KR3H 2VLJA 4YX2H 3W39A 4ZAKC 3GMNA 4PJGE 3C09C 4XP5L 3B9EA 4HS3A 3O4OB 3V6BR 2R29H 1ZGLM 4WW1A 5HGAB 3GMMA 1RULH 2MCPL 4ZQKB 5DA0B 4PB0H 3MLSH 1J87A 4XVJH 1NCAL 1WAAE 5C0CA 1QSEA 4NJAL 2VN4A 5B4MC 3LRGA 4LL9A 5IBTL 3TN0C 1S7WB 5D2NE 1JF5A 1KNOA 4H1LA 2CUIA 5FHBL 3JWOC 5KSBF 1RZJH 5JPNB 1AQKH 2W9LA 1DBKH 5D1XC 4YUEL 1JHTB 4QXWA 4E5XB 2WBJD 1B0RB 2N7BA 1AGFA 2BSTA 1MEXH 2VJXA 1DUZB 4P46B 5E95B 4JZJB 2VTFA 3IAQA 4YX2L 3S6CA 4DGYH 3C6LA 1YZZA 4KKNA 4P57A 2W9EL 4LRIA 4WU7B 1UC6A 2IAMC 3LKNA 4Z6AT 5IF0A 3ULVE 3MOAH 4CVZA 1OWWA 5TQ0L 4FOMA 1QFOA 1AGBA 5DS8B 2V2TA 1IEAB 3I6GA 4NN7B 5F6IB 3DROB 1J1PH 5IVXA 4KK5C 5F1IA 2K7QA 5AYUL 3OWEA 2D0FA 3IDJA 3HE7C 2MJWA 1JYWA 3T77A 2X41A 3T0BA 3MJ9A 4ESKA 2F53D 1BWMA 2DLFL 3ARWA 4HDIA 3KHQA 2ZCLH 3BUTA 1ZWIB 4LHUB 2GFBB 5E8PB 3KYMB 4KHXL 4P9MH 5EU6A 3SDDB 1JGVH 1W72H 4NN6C 5EG6C 3OR7A 3MRFA 5K9KA 2ZUXA 4FZ8L 3DHMA 1LNUA 2FATH 5GGVH 4LLYB 2W0LA 5BO1H 3P9WB 1XEDA 3SDXA 3RIAK 4H5SB 1GGBH 3MNZB 1DSFL 3VXUD 1H5BC 4XBGA 2Z4QB 1TQCC 2HVJA 5FOBA 2H32A 4X6DF 5LCVH 5DI8A 4X7TA 3H0TA 3VU2A 3MCKB 1F4WL 2E7MA 1BQSA 2A6KB 4WFHE 1FNEA 3EOBA 5ETUA 3SKMA 1BEYL 4WI6A 5JQHC 3TVMB 1XCQB 1EGJA 4NO0B 1DBBH 3MBEA 2QHLA 1KPUA 5DJCA 3C2AH 2CLZA 4L8BB 3LDBB 2RFXA 1U8QB 3L3DB 5TE4L 2W91A 9CGTA 4NZRL 1W72L 5DZOA 3ARGD 3SDYH 1NANI 1HILA 2ILLA 4LPUA 3ARGC 5D1ZB 4XB7A 5HI5C 4ETQB 2HTKC 1N8ZB 5ICYB 2EYSA 3I02B 3RWIB 4JREC 3GZKA 4PBWD 4DKEH 3OGCB 1GOGA 1EJOH 1AGDA 3LKSA 4PJIA 1T2QL 2P8LA 5CD3A 4NZDA 2YZ1A 3O41B 4NUJB 1OLZA 3PL6A 2VIRB 4JQIL 5CJ8A 3S97C 4ZODA 5IK3A 3VFNA 3VI4E 3OBAA 3TPUA 2EZ0D 3PJSA 2P5EB 5AD0A 5D9SA 3OAZH 3AROA 1N6VA 1BQHB 2NZIA 5I66B 2HH0L 2Q7YA 2G2RB 3WFCL 4BQ9A 4M8QB 5CD5D 4HUKB 3ARZA 4MHHG 3N9GH 3S4SA 1H15B 5JPMB 5FYLD 2CJUH 1LMKA 4XNUL 5IHBA 4LMQE 3D25B 1OAKH 4R90H 1A3QA 1UCBH 4C55A 4XVTL 4OUUA 3MGOB 1J8KA 3KLAB 3FQWB 2GIYA 2NY2B 1DL7L 3UTPD 4RGNB 1WFTA 1CFTA 3C9NA 4JKPL 1IAIL 5F9JB 1HEZB 1ADQL 3K81A 3U1SL 3L3GA 2XI9A 2AEPL 4KQ3L 5J12C 1HSBB 3OKEA 4ODVH 3VRLE 5HYSG 4RA0C 1BBDL 3D87B 3EYSH 5GRXG 1A47A 3VFRB 3TJEH 3GBML 1CZ8L 4MXVE 1XF4A 1H8NA 5JW5B 4EDWH 1FNGA 3GSUB 3V8CA 3EJZD 4HIIB 2MKLC 5L2KB 1VPOH 1T0MA 5GGUB 2XWJA 3S34L 1G6VK 1HI6B 5DHVH 4FA8A 1CGVA 3RL2B 2HWZL 3BP7A 3G6AB 1CXFA 2P7TA 1FV1A 3EHBD 4M6OL 4MNQA 1S9YB 4GRWB 1AR2A 5D7JA 1YNLL 2ZUWA 4MX7A 2VL5A 1NGYA 5D1XA 3QEQE 1JHKH 1FE8L 3DI2B 4XGZB 1EAJA 4KI5C 4CW1A 3CSPA 4Z0XA 1ZS8B 3EOTL 3LRHA 3L3OB 4PJEF 2CMRL 1G7HB 5EUOB 1IILE 1R24B 1NUFA 5FDWB 2I5YH 3QG6A 1RZIB 1LO0H 2APFA 3NZ8B 2EYRB 3U48A 1EHNA 4MB3A 5DJ0B 4PJCE 5CIPB 3ARRA 4GH7B 3NACH 4FXLA 2F54E 1ORSA 2OQJB 1CD9B 4HEPG 1M7DA 5D7LA 4J2XA 3DNKA 4LCCC 3PV6B 3KYOA 2NX5B 3VG9C 2F9BT 5TF1H 1MIMH 3BPNB 3P3YA 3WLBB 1CQYA 5DC0A 5KW9H 5FYLL 1JHKL 5CZXD 3H9ZA 4H8WC 1X5XA 4EXPX 2BNRB 3QJHA 3I9GH 25C8L 4JZNA 1OCWH 4B7IA 1LDSA 4ZTOL 1DQMH 3HUJF 2W65A 2KBGA 2NZ9D 3VXNB 5I0DA 5J8OA 5SWQB 3LDBC 4U49A 2AJSL 2VDRH 4NNXB 2EDBA 3OAYH 4UOW0 3K2MC 1FAIH 1NBYB 1MWAL 2NY3D 3BH8B 4U4BA 4YIQA 5KOVC 4U6XB 5K59E 4QKXB 1SHMA 3X3FL 2X9XA 1QSFD 3TYGH 4JY4A 2YRZA 4JRXE 1F4YH 3B43A 3OAUL 3HMXA 4LVOC 3DO3A 1P7QB 2VDLH 3K8MA 3OTTA 3QCTH 4DQOH 3OR7B 5KZCD 2PETA 4GXVL 4X6BA 4L9DA 4IMLA 1DLFL 4Y7MA 4K2UH 4TQEL 3DUHA 4KK9C 1IGCH 3MNZA 5JTWA 1BX2B 1OTUD 2H3NA 4JDZB 1TZHA 3PF2A 1MCOL 1BZ7B 1SJVA 4PP1D 4ODWA 2R2BB 2FYYA 3OGOE 5ID0B 4LRNH 4BSWB 5T3XH 4OLUL 4PJDE 1U93A 2E8ZA 2G9HB 1V7ML 5A2JH 1MCEA 1IGIH 3GHEL 4JAMA 3M17B 1AE6L 5E9DD 3EO0B 3N1PC 1XR8A 1DSFH 1I8IA 5L0QB 3WXWH 3GSWA 4YZFF 1MCKA 1U58A 1NUDA 2VDLL 3QUZD 3QQ9C 5CINH 4QCIB 1ZA3A 1P9MA 3WFDL 4NQDA 5CEZE 2Y06H 4CMHC 1X3DA 1INEL 3MRBB 1R3LB 1IZKA 4YXKH 2HJFB 4O9HL 4RNRA 3VRJA 2ZOLA 1HZHL 1A7NL 2ZWLT 5C09D 3W81A 4HJGB 3FO9B 3DHJA 4XPTH 4PRNB 4F37K 3IVKB 2P8LB 2OXHA 3O4LD 2OJEA 5CHNA 4OQ1A 4AQOA 5EC2A 5GGRY 5HDOA 4AIZB 4POZC 1GRWA 4JY6B 3P4LA 2WIIB 3OHXA 2VXVH 3OAZK 5BOPA 1D9KD 3GSNA 4XT1C 3S7GA 1E4XL 3FOLB 4NDMB 3RTQD 5KSVA 3L5WB 4NQEA 2BNQB 4FQHB 2F53E 3ES6A 2CDFA 4ENED 1DZBA 4PB9H 4WVRA 1OGAA 1S7XA 1QO3A 1FZOB 2AV1A 3MXWL 4CMMB 4QXTA 1QSED 3RHWK 4ZSOA 4OFDA 4FQXA 1ZLWK 1DBJH 2VAAA 2DLHA 5IMMA 5GISH 1C7SA 5HYJB 2Q87A 3QIBC 2HTLD 2QKIB 4PBXA 4GRWH 1A9EA 2P5ED 2C7UB 5IUSA 3MLVH 3VFGH 1CG9A 5C2UB 2PO6B 4XBPB 5EFIB 3DX7A 4XC1H 3KPMA 1QG3A 4P5KB 1NMAL 1U8NA 5I1LB 4NPYA 2GCYB 2WP3O 1WEJL 3VRLF 2VLRA 1TCMA 3AS3A 2WW8A 3O2WL 5FM4A 5EU7E 3KGRA 1S9KC 1NSNH 1DEEB 1AXIB 3L3JA 2WZPD 3WLWC 1PW3A 3NCJL 3REVB 2NXZB 3KNBA 4XBEL 5EZLB 2R1WA 2Q76A 2I9TB 2QHRL 4DWHA 4QRSA 4BK4A 1MJJB 3IF1A 5EU5A 4K7FB 3RUGE 1IAIH 5KAQG 2VLKD 4N90D 1AR1C 5DJ6B 5GISL 3WJJA 3W2DL 3BKYL 3AS2A 1IAMA 1IZJA 1KXVC 1C5BH 3VXSD 1M71A 5I1EH 2CUHA 4PRIB 1XFPA 3BISA 5E8OA 3SOBL 3L3OA 1XGPA 2BY3A 1EMTH 4BH8A 4U1NB 4EI6A 1FCGA 1JE6A 2X89D 3FOMB 5FDWA 3RJQB 3X3GH 1WISA 1OARL 2EEDA 5CJBA 1PZ5A 5TDNB 5IV2B 2ED8A 3BUYB 2EDDA 5E5RB 1CLZL 2JLLA 1TQBB 5GJSH 1ORSB 2OQJA 2EYTA 1M7DB 3BQUC 5ESVA 2R39A 2YXFA 1HYRC 2M26A 3MV7B 4FNLH 4LCYB 1HHJB 4OBRA 2VWEC 1A5FH 3P4NB 4HCRH 2XTJC 4EKXA 2AEWA 3OB0K 4MAYA 5EIIB 2MTPA 3ARVA 1QFUL 2JJUA 5DHVA 3A67H 3NA9L 4IM8A 5D7IE 2FH6A 1DFBH 1QLEH 4MA1C 1I8KB 3GRWH 3CFBA 4HQQL 2BNRA 3QJHB 3MYJA 4NM4H 2B2XH 3CSYB 1XH3B 3QDGD 3HRZA 3GMPB 4K71C 1IBGL 1YQVH 3GMRA 4TRPL 4WHTA 5F71A 1VGKA 4IIQC 5TH2A 5F6HI 3OXSB 2WQRA 1A02N 2OTUA 4U33A 2ADIB 3O6LL 3EOAA 2B7DT 3ZYZA 3D3VB 2BJML 4O58H 4Y1AB 1L0XA 3DYMA 4HKJB 2NR6D 5DGQA 2DYPB 5BJTB 2AXHA 4Y5XA 3NFNB 1FJ1A 4PREB 2BOCA 2R0ZL 2VNCA 2ZOKA 4IOIB 5SWZD 4U1MA 5D2NB 1NFKA 4HH8A 4KXZI 5FFLA 4TVPH 4GS7B 3D85D 1H3UA 1LK3H 4Q9CA 2NY5L 4LP4A 2V5SA 4S0TD 1EFQA 3ZE0E 4CU6A 3PIQB 5HYSB 3SJVD 1A21A 1MCCA 1TCRA 1MFCL 5CSZA 4M93B 4XWGL 4JN2A 1TZHB 3B5GA 2C3XA 3ROOB 5BV7C 1KJ2L 3DRQA 1YMMA 4NKQB 5C2BH 2R2BA 3BZ4B 3FZUC 1KLGB 3I6KA 4E0RA 4FMKA 4HKXA 4E41D 4UTAL 5CJOH 4FTVB 3UDWC 2X4SA 1OB1B 1F45A 5DTFA 4DOHE 3DVGA 1AQDB 5MEQB 3FONB 3ZT6A 2H2PC 2P8MB 4LU5L 4OAWA 5MHSE 2A38A 2XOTA 3LD8B 5DJZA 4HXAH 4OQTL 4PG2C 2P5WD 1KTDA 5IIEA 1KB9K 2AW2A 3HG1D 1I7UA 1KG0A 4O4YL 4UOJA 4IS6B 3R0NA 1JF1A 1VDGA 3DIFB 2FX8H 4M8VA 1J0JA 1SM3L 5I1CH 3O6KL 5ISZD 1U95A 5DEFB 3MJ8A 3BZFA 3HMXH 5J3HC 4PJDF 4PRNA 3IVKA 4DVRL 2IQAA 5I71C 1OSPL 1GJIA 1HWGB 1U8PB 2ICEB 5HYJD 5CINL 1CF8H 1MFNA 1Y18B 2HG5B 8FABB 5KS9F 5DRWB 4XB8A 5KSVB 2HRLA 4QHMB 3EIFA 3KPQB 3MUGB 2X4NA 3D85B 4ZOAA 2AABL 5DQDH 3KXFE 4IRZL 5FA3B 3LEXA 4APQD 1CDCA 1R3KA 2CGRH 2VAAB 2X09A 4CRPA 5HYJA 4O2EB 5FV1L 2LTQB 3ALPA 3P73A 2AVGA 4XHJC 3WIIH 3MV9E 1IKFH 1EXUB 4W81A 1DVFC 3RA7H 1QLRA 4X4YA 3UTSB 4QWWC 2DLFH 1OSPH 4F7EB 1UKSA 4PJAE 1MPAH 2CUMA 2F19L 5EPMA 3ZHDA 3FT3B 3IDIA 1X7QA 3WFEL 1RJZB 1RHFA 1IEHA 3QPQD 1T6VN 2F5AH 4EI5C 3FRUA 3VFWA 4Z95L 4G9DA 5IFHL 1G7IB 1SYSA 3U0TA 3HE7D 4NQDD 4UT7L 1J05A 1TJIL 2CLRA 1IAKB 3VI3E 2J7LA 5EZIH 5ALCH 1MFEL 4Y2DD 4HKZA 3RGHA 1IT9L 4HKBA 1EVUA 4L1DA 1C12B 5DQJA 2XN9D 3S4SG 3IFPB 4KUZL 4R97B 1F8TH 4L4VD 1GC1L 3TNMB 3IS0X 5CEZL 4XNQB 5I17A 2VABB 4NC1C 2V5MA 2GJ6A 1FFQA 1AJ7L 2FRGP 2CLVB 2HFTA 1S7QA 4G6JL 5IG7B 3D2UA 2VE6A 1LE9A 4YE4H 2D7OA 3MNVA 3MODL 2WINB 4JHWL 4X80H 4KI1A 4JQVA 1QQDA 2CKBA 3BRGC 1Q94A 3VRIA 3QUZC 4NN5C 4WUKL 5C0BE 3MMEB 4X83A 4PJXF 3QIBA 1AIFA 5GGVY 1NBQA 1DQQA 3LEVL 4QRUA 3FB8B 5INCB 4JQIH 1CDHA 5JQ6L 2FB4H 3R1GL 2IWGA 2E9BA 4XPAL 4JQXC 3P4MA 5IESH 5CLWA 2AXFA 1AD9B 2D7MA 3TA3A 2FD6L 1P1ZA 3E3QC 5TH2B 3OKNB 4L3CA 3STZB 3IGAA 2VO5A 3PWVA 1KACB 5CJQL 5C0BA 4NRXB 4R0LA 4DVBA 1L9NA 1MRDL 2IFFH 5E94B 5HDLA 1FH5L 4KROB 3KWWA 5LXGL 5BZWA 2W9DH 3BPOC 4WUKH 4Z7VA 5E8DL 1U8MA 1VESA 2BOCB 2ESVE 3V6OE 4MD0B 5EC1A 2YUWA 3RIFK 1T66D 5T1MB 1FORH 4KI5F 1BVLB 3QUYB 4YBLB 1E6JL 4AK1A 5HHNA 4ELKA 2OM5A 1JPFB 1RUMH 2D7PA 2VLKB 4M5ZH 2DMKA 3O6LH 3OKOB 3RVUC 3IAPA 3GJEA 5BXFA 5E00B 4LIQE 5IESL 3HRPA 1LDPL 4OTXH 3B9KA 5F1NB 3ZKXB 3LV3A 3VXUA 3BIAX 1NGZB 5J11B 4M6NL 1JPTH 4PFEA 2GI7A 3BEWB 5IGXH 1OHQA 3RHWF 5SV3A 3FFDA 1UQSA 4WY7L 2IFFL 4P2YA 2PKDA 2ZKHH 4KVCL 4NM8L 4IIQA 3AY4C 4PJ7B 4EUPB 5FHAL 4FMFA 2PO6D 3MRCB 1C08B 4F37F 1J12A 3SCMA 1J11A 1UJ3B 3ULVF 3EOTH 4XRCA 1G7QB 3LIZL 1UM6H 2W1NA 3MV8A 6CGTA 4HIXL 5E2UL 1ACYH 5DURD 1KG0B 4G6FD 1GHFL 5I1AA 1YN7B 4QTHB 4PJ9C 4PRAA 1JF1B 1J0ZA 3DIFA 4FQJH 1SVCP 3IXAA 2VB5A 1S9XA 3W9EA 4FQLL 3CXDL 1NFDA 2VKXA 1RJYB 4X7EC 1JPTL 3KXFB 3SGJA 1QZ1A 4EVNA 3NABL 4NBXB 1H3VA 2DQJL 1W72B 2ZUSA 3QXWA 4WHYH 1CDJA 4LKCB 4F57L 4O4YH 5AUMB 2A73B 1HHKB 4ODBD 3S96A 2BSTB 1DUZA 4NBZB 2WBKA 4JZJA 4OI8A 5K9OB 4RISL 5D1QD 1RIVL 5FO7A 1HQ4B 4PJCA 5LWYL 3DURA 4X4XA 2DLTA 4MQTB 4X6DE 3BP4B 4NCDA 5T1LB 25C8H 1UM6L 3BVNB 2IEPA 3GKWH 1VGEH 3BGMB 5DDHB 4YXHL 1OAXH 1VERA 1C1EH 1PYWB 1I7RB 5FYKE 1ZMYA 1NUNB 2EDTA 4Y8DC 1WIUA 5L2JA 4XZUA 1WBXA 4ZPTA 4Y4FB 1P4IL 2H1PL 2ORBH 1H8SA 5GRZA 3JTTA 4NKIL 3N1FC 4G3YH 3T2QA 3D69B 5ICZA 1J1XL 5BMFL 4YBQD 4MAYD 2AABH 5D93B 1FVCB 4JVWA 5E8PA 5F1SA 1F4YL 1D5BA 2BNRD 2GK2A 4HGWB 4P2QA 3HFMH 2HKHH 4PG2A 4D0BB 1KXTB 3PNWB 3CGTA 2W60B 1EIBA 1MHPL 3HG1A 1RUAL 2H32B 4U0RC 3UPCA 3D39D 3AMLA 3H0TB 4PGZA 5C0NC 1JZ8A 4NRYA 3DX9A 4IMKA 2D03H 4P3WA 5KZCB 4NFBA 1ZGLP 4J4PD 4WTWA 1C5CL 2O5YL 3MRMA 5CKAA 2DB8A 3P9MA 4PYGA 1GGIH 3FKUS 2QR0A 3QEHA 5F88A 4JO2H 4QGTA 1NLBL 4JRYB 1T4KB 3U30B 1UXWA 2VXSH 4AT6A 1FL3A 3V6FB 3LB6C 1CE6B 1WC7B 1PX4A 4ZFFB 3RVVD 1KIQA 4X7SL 1S7QB 5IG7A 3HMWH 4HUMB 2A6DB 4YDJB 4PLJD 3VD7A 5KVGH 2NPLX 3CX5K 4OIBA 2VR5A 2Y36L 1F8TL 5F8QC 2Y06L 3ZL4H 1GC1H 3N1MC 1F00I 3BQUA 4I9WD 1YY8B 4WW2C 5ANMB 1MCHA 1IM9A 3HPJB 1A9BA 2ZZUT 5GSRA 2W38A 1QTYT 3KPNB 4M6MH 3QUML 1MJUH 3BN3B 2V7NB 1PEWA 4PJIE 1MIML 1T89A 5JORB 1KJ3L 1W2KT 3ETBF 4GRLB 5IK3B 1U42A 4S1QH 4OZHB 3RDTD 1OTSC 2J3SA 3MSPA 3DJ9A 3MREB 5EIVA 4ZFGH 4IRJD 1N3NA 1S8DA 4X7SH 5EUOE 1BFSA 2ZCLL 3MXWH 1NC2D 1WLHA 2F15A 1WQVT 4O00A 3P40A 5IJKA 4NQXA 5F70A 3D25A 4RIRA 5JO5B 5DMGD 2H32H 4LCIL 5EULV 5TE7H 1P9MC 3IAGC 3VFVA 2CKNA 3BKMH 1MWAH 3MA9H 1QA9A 1SVZA 3CH1A 1MLBA 3FAWA 3M8OH 1LP9F 4K3HA 5HVFB 4PV8A 1ZVHA 3MBXL 1OP3K 5GRUL 3O6ML 5T1MA 4BFBD 1HEZA 3OPZL 3D9AL 4Y4HB 2JB5L 1NGWA 1HH6A 5BS0E 4JFQA 1FO0L 1B4JL 1IC5L 2NY0C 3GSVB 2VLJD 4JM2B 2WP3T 4QT5B 4M9OA 5I30L 5C0CE 1WZMA 2Y07L 1NGZA 4P2RA 4XPHH 3QFJB 1UYWL 3GHBL 4HGMA 4OSUH 4UIMB 4LSUL 3UTSD 3K0WA 4GBXA 1A4JB 1X5IA 1QFHA 1MJ8H 1HHIB 3UDWA 3MJ9L 5LGKA 2EDEA 3C5SA 3VXME 4ZO8A 1FZKA 1D6VL 1PQZB 3N06B 3BRDA 3FQTB 1F13A 4KU1A 5J1AB 4IIQB 1TVBA 2AQ2A 4BYHA 1OAUH 1LDPH 2UUDK 1J0YA 1KFAH 3KS0J 5EBMA 1JV5B 2B1AL