1T4KA

Crystal structure of unliganded aldolase antibody 93f3 fab
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
DIQMTQSPSSLAVSPGEKVTMSCRSSQSLFNSRTRKNYLAWYQQKPGQSPTKLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAIYYCKQSYDLPTFGAGTKLELKRSDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN IGG1, KAPPA LIGHT CHAIN
publication title The Origin of Enantioselectivity in Aldolase Antibodies: Crystal Structure, Site-directed Mutagenesis, and Computational Analysis
pubmed doi rcsb
total genus 47
structure length 217
sequence length 217
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t4kA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t4kA01
1KB5H 3EYUL 4L4JA 1QKZL 4L4VE 2IJ0C 1MH5B 2QQLH 1NPUA 3B9KA 4JM2C 1NGQH 4V1DD 1MCWM 1Q0XH 2AXFA 4PJIF 5HPOA 2EECA 4YFEA 5T1MB 3A6CH 3QH3A 5JLZB 1LGVA 5ECJE 2Y1VA 2X05A 4QHKI 1FGVL 2O5XL 5H2BA 1KCSH 3WLBA 4YQXH 5KN5A 5L6YL 5ACMA 3KPLA 1MY7A 4IIQC 1WWBX 1LO3L 3NN8A 4PJ7F 3GB7A 2XWBB 1U3HB 3AM8C 3NFPB 3QIBB 3MRJB 5DFVD 5CJOL 5J89A 2X70B 1T21A 2BXZA 2Z93A 5JPMB 1OAXH 1OB1A 1UWXH 4RSVA 1PZUB 1HQRA 1NBZB 5EUKA 1F3DJ 1KB5B 3TH2T 3PXJA 3LD8B 1T03L 4MD5B 3TESA 4FXLA 1RJZA 3O0RL 4ZTOL 5GGRA 3RVUC 1J7VR 3RWDA 3RIFK 5LCVH 2R39A 3FO9B 1KTDB 5EUOB 1FLRH 2IG2L 3QYCA 5F7FA 2ZUQC 1P4LA 2VNCA 4JFEE 3T4YA 5HGGS 1T2QL 5DLML 3F5WB 2FGWL 5GRZA 3UAJD 3AY4C 3N85H 4XVTL 2F54A 1KPVA 1W72A 5GHWH 3C2SA 2BY0A 1XCTB 2OZ4L 2A6KB 4CVXA 2UZIL 1RU9H 3DBXA 3IDGA 3UDWA 3ZTNL 4NN6B 5CHNA 4EI6B 5HSFA 2AQ2A 5C9JA 4LOUC 2GJ6E 1GL4B 5A2KH 3NZHH 3RJQB 1DBAH 4RA0C 5I2IA 4X9HA 1JNLH 3L3DB 3V5HB 5C3TA 1XZ0A 3GK8L 2EDEA 2DQJH 1DBBH 1X5AA 4GO6B 4GW4B 4F7TB 4P9ML 1EHLL 4LCUB 4TOYH 4ODHL 1W8OA 2DWEA 3S3SA 4MWFA 1A1MA 1R24B 3FQRA 4YHLL 2OLDA 4WUUB 4WUUD 1IEBB 4WTXA 5D96B 4TVPL 3IXTB 1T1XA 2AJSL 4LNRB 1IKNC 4AEIH 3DX9B 4H25B 1N3NA 2GJZA 2ZSWA 3VCLA 3WJLC 4GH7B 1N4XL 5IMOA 1IAKA 2PCPA 2R69H 1D6VH 5EU7E 4JHWH 5F8QC 2A6DA 2DQCL 1F5WA 1NFDE 1UFUA 3S34H 2WP3T 1I85C 4P2OB 1QSFD 3VFRA 4P2OD 4U1IA 3QXAA 5BJTA 1G7HB 4L8BB 1CU4H 1D5BA 2AK4A 5IB4A 4ZS6C 2OBGA 4N9OB 3RGVB 1JGLL 3RGVD 3LQAC 2B1HL 4K3EH 2AEPL 3CVHH 1R5VA 4JO1H 4HDIB 1YPZE 1AE6H 1I1YA 2D9CA 2ED9A 4X80L 3OKYA 3BXNA 4RMTA 3LN4A 2HJKA 2VITB 3G6JE 1WIUA 3TO4B 3TO4D 3PXHA 3G6AA 2GSGA 5FYJE 1HN1A 3U9UB 3RKPA 5CEYA 4HIIA 1LQSR 1KYOK 2FWOA 3WFBH 4UTAH 2AQ1A 3JTTA 1S7UB 5I16B 4YHMH 4EDWL 5LVEA 2VDLL 4QKXB 5HHOA 2CPCA 4R8WH 5IBUG 1I1FA 5ID1B 3BGAA 3UZQA 2VLLA 3HKFA 5AWNL 1QBBA 2ADGB 5IB5A 4ZOBA 4PPTA 2H2PD 1QZ1A 4HWZB 4ZTPL 1HIML 3GBNH 3MXWH 2IBZY 3PGFH 5D7LD 4D9LL 3VMNA 1Q72L 1HSBA 2PF6A 4Z7UF 5LXGL 2E8ZA 2PYFB 4LGRB 3RWJA 2YC1A 1CCZA 2X4QB 1KIUA 4YHOL 1N7ML 2LU4A 1LWRA 1TCRB 3D2UB 2H2SD 3GGWA 4YX2L 3D2UD 4XWOC 1S9YA 4S2SA 4LPVA 4PJXE 1ZT7A 1KLFA 1YY9D 4Y5XA 2B1AL 3HUJF 4Z6AT 3TBYA 4PV8A 2VE6B 4NHUA 4JY4B 4FFZH 4AYFA 1V3LA 4JCMA 1DLFL 2W07A 4LLQB 4NO3A 5FA3B 2PTVA 1CD8A 3WFDL 2A74A 1H3GA 1TJIH 5FB8A 1ITCA 4F8QA 2HH0L 5ID0B 4M7JL 3WKML 5KSBA 4L8SC 5KOMC 2F8XC 4K23H 1YQVL 4MCZA 4XGZB 3P11L 5C09B 2ZUYA 5C09D 3AU1A 4DK3A 1U58B 1AJ7L 3U0PB 3QHZH 4HUWA 3NA9H 3MNZA 1RIVL 4LDLB 1P7KA 1FFNA 1QUNA 3V6OC 4GLRH 2GTZB 4HUKB 4YR6A 1IGJB 1DLHA 2BVOB 4XCFH 1ZVSB 4XPBL 3VFNA 5AZEH 5DHYA 5H35B 4OZGF 1F4AA 5E08L 4M5YL 4M6NL 4HBCH 3OTTA 4QO1A 4KDTA 3FB8A 3MGOA 3ARWA 4U0RB 1QRND 3O2DH 1JZ8A 3T77A 3X12A 2Z8WC 2CXKA 3LHPH 4XPAL 5KZCD 2P7TA 5ALCL 4MHHG 3O4OC 4DN3L 2IPTL 1U8KA 3ULVF 3S88H 4PJGA 1H3PL 2D31B 5EPMA 3SDCC 1D9KC 5IQ7L 1U2HA 5ISZB 4ERSL 3UROR 5ISZD 4K7PL 1K4CA 2F9BT 1SVZA 2Q1EA 3H8NA 3MLUH 4YFLI 2AKRA 4UT7H 3HE6A 3W5NA 2D9QB 4QRRE 5K59F 1Y6MR 3M07A 1EEQA 1TZGH 5EULV 1MREL 1OTUC 2VIRB 5DZNA 1BOYA 2XKUA 2DLTA 3MFGB 1JFQH 4NQXA 4L3CB 4DZ8B 5HHQA 3SO3B 2B2XH 2D7OA 1CT8B 4ZFOL 1KJMA 3LKNA 4ODXB 4EQ2A 3BRGC 1UWGL 4U6HB 3FO1B 3QNYB 4WEBL 3C08H 1T5WA 2R0LH 5F6IC 2P8PA 5L9DL 1MIEH 3X11B 1P84K 3IJHA 2XI9A 4TSCH 4ONGL 4YDLB 1T66C 1N6QL 2UY6A 4ALAL 2APVA 3QHFH 5BRZE 2WK2A 4PJCE 4MXQD 4ODUB 1HXMB 3GI8L 4PTUA 5IROC 3W9DA 3P77B 3ILQD 5IW3A 3QWQB 1NCTA 2BDNH 2EYRA 1FSKC 2DN7A 4KXZH 3L3OB 3OR6B 2Y25A 4IOFD 4JRYE 4WHTA 4AM0B 1YEEL 1S5IL 1NJ9B 1U8PA 4NCC2 3P0VL 1OAKL 3GSUB 2ZCLL 2X4SB 2CR6A 3O9WC 4D0BB 2XWJB 5I1HH 4F9PC 4FFVD 2EDOA 2E3VA 3QULB 3QJFA 3FT2A 3RL2A 1DUYB 2HN7A 5B39A 4LLUB 5E5MA 3IU4H 4FNLH 4OLYL 2BSTA 3NIFF 5IIEA 3P4LA 4JFOA 4HPOH 2CDFA 1YN6B 5I19L 4PGEA 4JKWA 4M48H 3DX7B 4Z76B 1VFAA 2FBJL 4JPKL 4FQLL 3RRQA 5C07B 5C07D 2DLFL 1UM4L 5CEXB 1B4JL 1NC2A 5F9DC 1ETZB 3IKCA 2D0FA 3FQTB 4GLRI 1KCUH 1ZT4B 4R7DB 3D25A 3VXTA 4UV4H 3MV7E 4LAQL 5D6CA 3GSQA 2HMIC 1AIFA 4APQC 5IF0A 3Q1SL 4L4TE 1EGJL 5HHNB 5ITFA 2R4RL 1HHHB 1MI5E 5FYKH 3KPMB 3VI3E 2E7LA 1B4RA 3MYJA 4LU5L 5JW3H 4YK4C 4OD1L 3T09A 1YEFH 3QO1A 1ZMYA 3BAEH 5LGHL 2QV2A 3GBLA 3S36H 4JPVL 4JO3L 5L88H 1NFIA 4OLVH 1QVOA 5C0IB 4MAYC 4R6UA 4YHZL 1S9KC 3IRPX 2AV1A 1OCWH 2ZCKH 3IDJB 1G7IA 1VERA 5IR1B 2G9HA 4X6CF 4FFWC 4NWUL 4NRXA 4XCCH 3FONB 1RY7B 4P5TA 3O81A 4NO2B 1X5JA 5FYKD 3QPXH 5ERWB 2F74A 1Z9OA 2VDRH 5D70L 5ACZA 4ZUSB 5DJ6B 1CDUA 2BHUA 4MLIA 5CINL 4U1MA 5E8DH 4I3RL 3G04A 3OAUH 5HY9B 3UBXI 3SDXF 4DGYL 1F3DH 5GGTL 1NEUA 5D1QC 5J6HA 2DQIL 1AQDA 3D0VB 5TQ2H 4XTRD 1WCBB 2C9AA 3O6FC 3AREB 5CJQL 3ARED 4OIBA 3SKOA 1KN2H 4FFYL 2IQAA 3B6SA 4RQQA 3G08A 2W65A 5JXEC 5DD6B 4NSKB 3IGAA 1KYOJ 5MI0B 3ULUL 1L7IL 3RWHB 3ARYA 2V5RA 4R4BB 4E0RB 4OQTH 3U4EA 2BSED 4M3JA 4TRPH 3MLYH 2A83B 4OCSL 4UB0H 1NC4B 4YC2C 2B5IB 1NC4D 4AQ1B 1J18A 2N1KA 4MMXC 4OZFG 3FFCE 2QSVA 3TNMA 3HR5B 1ITBB 4F57H 4KMTL 3JVGC 4GS7C 2D3VA 4JM2F 4NKIL 1AXTH 4HKXA 3PJSA 3JV4A 5E8PB 1ZHBA 4D0CB 5EC2B 4ZUVA 5K9OA 3LQMA 3O41A 5MENA 3GSXA 2Y5TB 3O8XA 4IMLA 5ESVA 1BLNB 2Q86A 4HS6B 1MFNA 3U9PH 3G5XA 1FFPA 2I5YL 1CXLA 1GHFH 5K9KB 1FZOB 4U1HB 1K8DA 3RNKB 1HCFX 1T80A 5F7MC 1W8NA 3MBXL 5CP3A 5T3ZL 1C8PA 1LEGA 4FQXB 3QPQC 3A0OA 3SCMA 7CGTA 4ZD3H 3HZVB 2BHZA 3VFUB 1DE4B 1LO4L 3HPJB 5F9WC 3UXFA 3PDDA 1JGDA 4Y16C 3ZHKA 1P7QA 4UBDC 5FM5M 3QNXA 5E1AB 5B8CC 2XIDA 2YZ8A 4U6VH 3B9AA 4X98A 1G6VK 1KF9B 4R4FH 4DGIH 2NYYD 1T0MA 3UTTA 4PRBA 4H0IA 1B9ZA 1KCVL 3WS3B 1NEZA 1OGAA 5FIEA 4PS4L 5BXFB 3CFJA 1CFBA 4P46A 4PJHF 4HWEH 4OD2B 1KEGH 1ZK9A 3B9VA 4XB7A 5EO1A 1QBLH 4DZBB 3MRCA 4HXBH 2FR4B 3V4PH 1ZWIA 4NQEE 2HFTA 1I8LA 1FZJB 3GKWL 3OAYK 4H26A 5IVXF 1KT2A 1CVSC 4GMTH 5C0CE 4YHYB 3VH8B 1RZ8B 4PRIB 3KXFE 1IL1B 3LH2L 5HHPB 4X6CA 1CFSB 1GRWA 2AJZB 3SJVE 5SWZB 1FIGL 1J8HA 3WNOA 2MQ0A 3DSNA 3RVTC 1IKFL 5HPMB 5M7QA 3OKKA 1LDSA 4PJBA 1TETL 3IS1X 3LY6A 3P4OA 3M8OH 1QNZL 3K2MC 3BIBX 1AXIB 1HXYB 4QTHB 1E0OB 1KJ2L 1N2RB 2OTWA 4ZAKB 4ZAKD 2P43B 3RWGA 4U1SB 1UXWB 4YUEH 5KS9F 3BQUC 3JWOH 5KVFL 1CGSH 4NQCE 3NMEA 1S9VB 4GG6B 2DAVA 2A2QT 3NZ8B 4ZQKA 5HHXH 3BN9D 4JHZA 3UTSA 3LN5A 2HAZA 1IAII 4Y88A 1IGYB 1PZ5A 2MMXA 4Z0XA 1MCCA 1ZSDB 5IVOA 4LKXA 2VB5A 3TFKD 3CZJA 5EOCJ 5EO9A 3MRKB 2V2TA 1VFMA 5GS2H 1ED3B 1DBJH 5C6TL 3RWCA 5J7CC 3IJYB 1ZA6A 1GIGL 3LZFL 2FYYB 4NNPL 4X4XB 3VG9C 5D5MA 1IEAA 3BI9X 1MHCA 1KTKE 1CDCA 2NXYC 1K4DB 3TIEA 3QQ3B 1PKQA 3HC0B 4HWUA 4NUGL 2DM7A 1FNGB 2OJEB 3PP3H 4I3SL 3RPIB 1L7TL 3DYOA 3T65A 2D7NA 4XWGH 2VL5A 3OPZL 4IIQA 4QRSB 1KPRA 5F7KC 1BX2B 3BHBB 5DWUL 3H42H 1KELL 5AG8A 1RUPH 1EHNA 5ABDE 1CD1A 1JMXA 3CFIC 5EWIH 4RAUB 1KTLB 4M5ZH 4RX4A 3OXSA 4JFZH 5GS2D 5ILTH 1KOAA 3RA7L 4JLRB 4N0FB 5JIHA 2CH8A 2D4DA 5C7XL 2AJXH 4W4OA 3VD4A 4QXGH 4KMLB 4HMDA 2EEAA 5TF0A 1AR1D 2VQUA 1ZEAL 3O2WH 4YDJB 4OF8A 1OF2A 3C8DA 4JO2H 2QHRH 4PR5B 2VLKE 4LAJH 4W6XB 1KN4L 4PJDF 3AY4A 2IFFL 4M1CC 3NCYS 1M71B 5IJKC 1MRFH 4X6DA 5SWQB 1CD0A 3D87B 1OAUH 2XY2A 4OM0H 4ZPTB 4L8CA 1EGJA 2PO6B 4G80A 2OP4L 2PO6D 3SQOL 3FB5A 5J11C 4G6JL 1HOCB 5CEZE 3U7YL 1BF2A 3MRHB 2YUXA 4PGDB 4HV8A 1RQ5A 1S7QA 1CFQA 3CPLA 3H7BB 5CGYC 3FOLB 2I27N 1CZ8H 3DRTA 4HMCA 3DIFA 1DZBA 2BHYA 5GJTH 3QCUL 2AV7B 3DVGA 5JOPD 5I9QC 4UQ2A 3V52H 1T1ZA 1IC5H 5DD1H 4M00A 2QQNH 4W6WB 5DJAA 4Q0XH 2CUIA 1QD0A 2DM4A 4JPWL 2BVYA 3INUH 1CDGA 3CFCL 3MLZH 3FAWA 4H20L 5E5RB 3VG0L 1JHKL 3QZWA 5KOVC 3DV4B 4WJ5A 2F8VA 3SPVB 2Q76A 2A1WH 1KPUA 2DL9A 4EEEA 3ARBC 3FB6A 4XP9H 5GRUL 3O4LA 4YAQA 4LSSL 4TUOA 3O45B 4QNPF 1JF1A 3BGFB 4PP1D 5A2JH 5I1CH 2FEEL 4E5XB 5GGTA 3B5TA 1PLGH 4BFEA 1HZHL 2X4PB 2ZUSA 5DRXB 3W11D 1I85A 1A64A 4Z8FH 1XIWA 2XPGA 4PG9A 3CSYB 2EIBA 1CBVL 1QSVA 3BKCL 4AMKH 5GSRB 2BVQA 2OXGA 2R23A 5HVFB 4EOWL 2IANA 2XTLA 1A7RH 1MQKL 5H8DA 4FP8H 3W5MA 4LLYA 5DUBA 1FBIH 5AYQA 2X1WL 1BBJB 5HGBA 3CCHB 1ZHKA 3T1FA 3FKUS 7FABH 4Y5VC 4OTXH 1OVZA 2RHEA 1KIQB 3G6DL 2CLVA 3KPSE 1KIPB 2FECI 3QFJD 2NY3B 2NY3D 2KPNA 3QXUA 3V7AG 1QLEH 4P5MB 1FNSH 3FTGA 4XBPB 2XZAL 2J8UF 3KPQA 1LEKB 4JHAH 2EDFA 2H6PA 3VWKC 4HLJA 1D6EA 5I66A 3ARXA 4YHIB 4LLMB 3QFDA 3S98A 4YIQA 2DWDB 1W0VB 3VXPB 1QLRB 2KUTA 3VRIA 4JB9L 2FX9L 1H9VA 3MLXH 5HHVH 1R3LB 3GI9L 5GZND 2VZSA 1BZ7A 4Z7VF 2ZUXA 1Z9LA 1WC7A 3PGCA 1CQYA 1AKJA 1KB9K 3SOBL 2G5BA 1CE1H 3K8MA 1U8MA 1XF4B 5ANMB 4HEME 2R1WB 3D0LA 3AC0A 4LLAA 3U46B 2VERN 1MFDH 1FAIL 2X9YA 1YMMA 3SDAC 5LGKA 3CDYA 3GMPB 1OQOA 1JNNH 5IHUH 1TITA 1JMZA 4JY6A 5C0BE 1FORL 5IG7B 3QEUB 2GKIA 4QT5A 4HH9A 3BVNA 1YEDB 2P24B 3EZ8A 1OSZA 2FD6L 3IU3B 5F6IB 2CK2A 5I0DA 3GM8A 1T7WA 1S7VA 4XNXH 4XP5L 3CMOL 2XNAA 1QFUH 5DD5H 3W0WE 5IKCB 1JGVH 1JV5B 1A1OB 1LO5B 1G9EA 3EOTH 5MHSE 4KGLA 5E03A 1K8IB 5BV7C 5J6GB 4X7EC 5GS1C 1WIOA 3D1MC 5IEKB 1I1RA 3NOIA 4NRYB 2XKSA 1G9NL 5BS0B 1F58L 3TPUB 1F6AB 5BS0D 5FK9A 3UJJL 1PVHA 3OZ9H 1ZLVH 1NL0H 1I4FA 4K71C 1O7VA 4K8RL 4ZS7H 1JI1A 3IDXH 1KJ2A 5I30L 1NBYB 3F7PC 1TJGL 1R3HA 1JWUB 3Q0HA 4OGAD 4WO4B 4P49A 5JA8B 4WO4D 4M6MH 3WUWB 3WLWC 5GRYA 4NT6B 2JB5L 5EUOE 2EDDA 4P2YA 3U79A 3SGJC 4ZNEE 5BMFL 2BCKB 4PJFB 4WWKC 3RZCD 1QA9A 4W68A 3QUML 5LGJB 4X7TB 5ENWA 2X9XA 4ELKB 2EYSB 4EQ3A 1VEPA 1X6NA 4UZGA 4PJIE 3R1GL 4H1LA 4DAGL 1FNHA 3TT3H 1EEYB 3O6KH 5DC9B 2XQBL 3MACL 1HYSC 2C3GA 3PHOA 1JZ5A 5CSZB 2QSQA 2I60L 2BSSA 4YHPB 4MJIE 5DRWA 4MA7L 4I0PA 3WFHA 4M9OA 4O2CA 5A3ID 1QR1A 4PRPE 1IGFH 3T04D 5B3NA 1YA5A 1UJ3A 1A3RL 3T8XB 2DI8A 1QFWI 4Y4KC 5IGXH 5ELIA 2FX8H 4BZ2H 4U0QB 4JPIB 2DJSA 4XVJL 4DTGH 4XVUC 4FQ1L 5GGSA 3HRPA 4K9EC 4AQOA 2K7QA 4KPHL 1RURL 4NPYA 5EZJA 2ATPA 3UYRL 2YPVH 4QRPB 4UOJA 3DV6B 4YWGH 5KSUA 4F9PA 4JGUA 3BGMA 3GMLB 3PWVA 4PJAF 5CZVH 3V0VB 3ARGA 3B9EA 5DI8A 3AXLB 3MNWA 4YBQC 3TYGH 4CKVX 4KKAD 5DMYA 2NX5B 3HNSH 2NX5D 3TA3B 3TA3D 3F7YA 4UT6H 3I50H 1CFNA 1ZGLP 2XZQL 3B9KB 4WI8A 3B9KD 4CAGA 1VACA 2NCMA 2AXFB 3P0YH 2ESVB 5DJZB 3QH3B 4M7ZB 5JHDA 25C8H 5H2BB 5FHBL 4XCYA 3WLBB 4DEPB 2PW2A 5DR5H 3RGHA 3UCRA 5KN5B 4GRWF 2H32B 2ICWA 1U9KA 2FCBA 2ZPKH 5F7NC 2HFEA 3D9AL 3GSNA 2FH8A 1SJVA 1UYWL 3ME0A 1FRGH 1BECA 1W72H 1ULVA 4KRNA 4LSVL 1T21B 5EOCH 2CDEA 2HVJB 3NIGE 2Z93B 1OB1B 1CLOH 5C0DB 4HWBA 3A67H 1HQRB 4RWYH 5EUKB 1DJSA 5C70A 3HG1A 4LCCA 4TPRH 2ZUUA 2YWZA 1OAYL 4P23C 2MCPL 1RJZB 1ZVHA 4XB8A 3H3PH 1EPFA 4B50A 4ZOEA 3RWDB 3KYKL 1MCPL 4JFFB 4KDVA 1LP9F 4JM4L 4KTDH 4ORZC 2B4CC 1S78D 5JW4N 4TUKH 3QISA 1MCIA 3MOAH 4I0KA 1JE6A 1KBGH 4XRCA 4TSBL 1T20A 3CLFH 5KVGL 1P4LB 3T4YB 3D85A 5I15L 1NCAH 2F54B 5JQ6L 2F54D 1NMBL 1GGIL 1KPVB 1W72B 2GITB 1IC4H 1BVLA 3DBXB 3IDGB 3S5LG 5CHNB 3K8LA 4K55A 5ESQA 4Y19A 4NN5C 1ADQH 5C9JB 3O6FA 2Y06H 1BAFL 4I2XA 5DJYA 1YN7A 1P69B 5I2IB 1LK2A 4AIOA 3F7VA 4NKQB 4PV9B 5IHZA 1S7WA 5JUEH 1XZ0B 1K5NA 5C09E 1I7TA 2HTKD 1DBMH 3MZTA 2Q8BL 3WFEH 1TZIA 2DWEB 4MWFB 4RDQG 1S9XA 1A1MB 1X5HA 3WD5H 4HJGB 4FQHA 3FQRB 4NFCA 5FYLE 3KYNA 3VWJA 43C9B 5IBTL 4JQIL 1M7DA 4UT9L 4JKLA 3EYVB 1T1XB 1Z2KA 4NN7C 3JVGA 4L5FL 4Z7WA 2EH7L 3RU8L 2R0ZL 4GOSA 4MX7A 2GJZB 2ZSWB 3VCLB 1TMCB 5IMOB 3L3IA 1IAKB 4PJAA 3O3UN 3QUYC 2A6DB 1NAML 3IDMA 3MGAA 1RK0A 5DMGD 3H9YA 3EOYG 2DQHH 1BJ1J 4U1IB 3QXAB 1XCQA 5BJTB 1BD2A 1NCWL 3MREA 3HUJE 1D5BB 2NY6C 2AK4B 3BP4B 5IB4B 3VGAB 2AK4D 3QEQA 4OSUH 3CDCA 4G9DA 4NC1C 1S7RA 4OFKA 5C92A 2NXZB 4MYWB 2NXZD 2VXUH 4W81A 5FGCB 4AL8L 2D4FA 1PG7L 2BJML 1CQKA 1MCHA 3BP6A 4HK3N 1DL7H 1I1YB 3ZTJG 3BXNB 1PEZA 4XC1H 2EIZA 4Y16A 4Z0BH 4WI4A 3RY6C 1A0QL 4KI5C 3DXAA 2F58H 4HG4J 4YXLH 2Z91A 4YGAB 5D8JH 5IVNA 4J3SA 4N0CD 1Z6JT 5EU3A 4NQDA 1AR2A 4LF3A 1BEYL 2R8SL 4KK9C 4YXHL 4HIIB 3MA7B 1WWCA 4X9GA 3IDYC 4ONFH 2FWOB 1NCBH 1WISA 1D7FA 3DMMB 1CS6A 43CAA 5KVMC 5DK2A 5B3JE 3ABZA 1F4WH 5CWSB 4FHBD 3QO0A 5KW9H 1JF6A 4WW2A 4OZGE 4O9HH 5HHOB 5ESAA 5HHOD 1I1FB 2NXYB 2HFFA 2JF1A 2VLLB 5D2LA 4OFVA 1B6DA 5IB5B 5HI3D 5TPWL 1FYHB 5DC0A 3BWUC 1H3VA 4M8QB 2C3HA 2XZCH 1ORQA 3MFFA 1RZJH 4Y4HC 1EO5A 5AZ2H 5INDB 4Q9RH 5I1EH 2NZIA 3CH8A 4P4KC 1PX3A 3RUGF 2YC1B 4JN1H 4XPHL 4RMRA 3QDGA 3VD9A 4RMQA 4M61B 1FYTA 3GGWB 1TVHB 5DGQA 3MLSH 1S9YB 4XXCA 3GSVA 5K59E 4S2SB 3VXRA 1YNLL 1ZT7B 4CMMA 3JV6A 4Y5XB 3TBYB 4XC3H 4NHUB 2R2CA 2QADD 3ZE1E 2DQGH 4ONHA 5FCUL 4NO3B 5L2KA 1MNUL 2EXWD 3U4BH 3ULUC 2A74B 1IAOA 2QQKH 1I3GH 2W0FA 5FB8B 4YHNB 3MRGA 2Z35B 4J1UA 5KSBB 3FL7A 1IGMH 2WWKT 4MCZB 4Z78A 3T2OA 4URTB 4G7VH 3AU1B 5E2JA 4FG6C 4XMPH 4HUWB 1OY3B 2VAJA 3MNZB 1P7KB 4C56E 1AD0A 1FFNB 2AK1H 4TTGA 1I3VA 4YR6B 5I17A 2A9NH 3FQNB 1DLHB 2EZ0C 2YD6A 5HDBF 3VXUA 1V7NH 3KGRA 3VFNB 3F58H 5DHYB 3SY0A 1IRAY 4R26H 5DT1H 3L5XL 1RULL 3U2SA 2H1PH 3JSSA 2FSEA 5LWYH 1HINL 3EYUH 4X4YA 1MRCH 1QG3A 3FB8B 1U91A 3MGOB 4IRZL 1IGIH 3T77B 1LNUA 2MFNA 3OAYH 1CDJA 3X12B 3THMH 3DX8A 4PGJA 3MV01 4G6AC 2O5XH 1CK0H 1WUNT 2A77L 1U8KB 2Z8RA 4PJGB 3EZJB 3FMGL 4I48A 5EPMB 5D1ZA 4B5EA 5JNYA 5HD8C 4RISH 1K4CB 1B88A 1LO3H 3GNMH 1AI1L 4F33A 5FYKU 4PJEA 2AKRB 4HJJL 3HE6B 1PKOA 3HE6D 4LPTA 3BO8A 4RGMB 1Y18A 1QRKA 2F5BL 4NZUL 4ZO9A 1HHGA 4U7SA 4U31A 4NQXB 2MHAA 2ZP0T 1T03H 4D94A 1J0IA 1KJMB 1OW0A 5DSCB 3BMWA 4ZTOH 2V9TA 1EH9A 5C0RL 1T5WB 3D39B 5CJ5A 4KKLC 4MJ6A 4OLWL 2P8PB 3PQYE 2IG2H 2XY1A 4M9PA 4OV5A 4KQ4L 1K6QL 5F9OL 3N1PC 3NCEB 5DLMH 2FGWH 4PTUB 2E9BA 3W9DB 5GRJL 1ORSA 2OR9H 1GJIA 4PY8J 5E2UL 5B21A 3VU2A 2EYRB 3DURA 1RUQL 1MCJA 4CL7A 5E6IA 2UZIH 3HPLA 2AVGA 1I7RA 5JQHC 4LLVB 4KH2A 2D03L 1U8PB 1BP3B 2XG4A 5DMIL 1G7QA 1FIEA 3QJFB 3FT2B 4JR9H 3RL2B 1FQ9C 1SBSL 2HN7B 5B39B 5E6YA 2X89A 5E5MB 5JIPA 1EHLH 2QR0A 1VCAA 2QSCL 1UH2A 1NUFA 2BSTB 3SDXE 2E6JA 4JFOB 1BBDH 4PLKC 3ARSA 3MUY1 2F19L 1CXKA 4M62L 4PGEB 4CUCA 3CVIH 2CIIB 2C4FT 4LSQH 4TVPH 3CFKA 4J3VA 4Q97A 4Q58C 1NC2B 2GSIA 3IKCB 1NC2D 5LG1A 5ICZA 2UYLA 3RVVD 5JTWA 4MCYA 4ZDHB 3ULVH 2BSRB 5EA0H 3K0WA 3D25B 3VXTB 5F1IB 1AIFB 4GSDL 4U7MA 5IF0B 2C3XA 3O3EB 4B0MM 5I73C 3MYZA 5ITFB 1VESA 2VLMD 2YD7A 3V4UL 3MOQA 1A6AA 4KC3B 1JGLH 1MHEA 2R15A 4U6TA 2EC9U 2NZ9C 3ZE0F 4ZPVA 2B1HH 5MEQA 1U8JA 2DJ4A 1I8KA 4TVPD 5IB2A 4X80H 1AH1A 3CAFA 1NMAH 4R90H 1NFIB 4PRIE 1QVOB 3LRHA 4Y5YC 2X1QA 3WDHA 4CNIA 3VDBA 1T7YA 5D2NA 4IMKA 1G7IB 3ULVD 5SWZE 2BOBB 2JJTA 4PB9L 1MRDL 2F53A 1NAMA 4NRXB 3I75B 4K3GA 1JZ3A 2J12B 4FQ2H 2FX7H 2VDML 1MFCH 4P5TB 4P5TD 4EDWH 3OR7B 5EBMA 2SEBA 4IM8A 2F74B 1WBXB 4NQTA 3WDIA 5ACZB 3EYQC 4U1MB 3U7AA 3G04B 3QDAA 3BIKA 5J6HB 3M1BA 1AQDB 5IMMA 5GQBA 1Q9KB 3ALWA 3QIWA 3NFNA 3O3AA 4WWKB 1GPOL 1ZT1A 3SKOB 1OPGL 4D9LH 4LGSB 1ZA3A 1JGUL 1Q72H 3JWDL 5F88A 4PJHE 2NY5C 2IQAB 3B6SB 4RQQB 3G08B 5LXGH 3WNNA 5EU7C 2Z8VC 4CU8A 3IGAB 4YHOH 3ESVF 3BPNB 5DUML 4UQ3B 3U4EB 5CP3H 1JPTH 4ZUWA 5B38A 4YLQT 4GW1A 4UIMB 1DLFH 3I6GA 4HKXB 1R5IA 3JV4B 3PJSB 3ZDYF 2VKXA 1ZHBB 2CMRH 4U3CA 5K9OB 1A7QH 2VXVH 3VRLE 3QUXA 1KCSL 3O41B 5MENB 3GSXB 1EFXA 4IMLB 5MEND 3O8XD 3NH7L 4OM1H 1G84A 3WKMH 3G5YB 5ESVB 15C8H 2Q86B 3N1FC 3G5XB 2Y36L 1Q1JH 3MRQA 5E6ZA 4TUJA 1K8DB 3BRDA 4L9LC 3V95A 3MTRA 1EO8L 2GFBA 2O26U 4BH8A 3GSOA 4S1QL 3SCMB 1T1WA 3SCMD 2FATH 2VMFA 5EZIL 3TC9A 3WO4C 1ZGLM 4XPBH 3R0MA 4C55A 5J13C 2Z92A 5LCVL 4M5YH 1P53A 5I8EB 3QWRA 4M6NH 1R6VA 1IAIM 5L0QC 2VZTA 4Y8DC 4NDMA 1SJEA 1IC7L 1P7QD 3QNXB 1FLRL 5DEZA 5I8OH 4Z7OE 4X98B 3MUJA 2X5PA 5DF0A 3NFSH 4Q9QH 3FN9A 1T0MB 4KJPD 3N1GC 3UTTB 4JG1L 4XPAH 3UTTD 3RHWK 5ALCH 1NEZB 2WIIA 1BJ1H 4FTVE 1OGAD 2MNUA 3CFJB 3QXTA 1A6PA 4P46B 3TYFA 4JDZA 4P46D 3TF7C 5GHWL 3VXMA 3RX7A 4HIEA 4WDIA 5IQ7H 5E00A 1IGCL 2HJLB 5EO1B 2VSCA 3BN3B 3MRCB 1RU9L 1ZWIB 2A38A 1FC2D 3IDUA 4C4KT 4KKBD 4H26B 3NZHL 5FFLA 1MREH 1PQZA 2YBRA 1DBAL 1HDMA 4UILH 2QLVB 1JNLL 3T0XA 4JG0H 4LVHC 3IDNA 9CGTA 2DQJL 1DBBL 1WICA 4Y4KA 3LV3A 1RPQA 4TOYL 5FA4B 1J8HB 2PKDA 4C58B 1J8HD 2P42B 2R2HA 3DRQA 1LD9A 5L9DH 4KJQD 4J4PA 5EFIA 3MOBH 4PJBB 4OCYH 2JELH 1XT5A 1ZXQA 5DJXA 4LIQH 4NO0A 3CXHJ 3GI8H 1ZHNA 4MQXD 1D3CA 1AGFA 1PD6A 1QHOA 2R69L 5AG9A 2CLZA 1T4KA 3BDBA 4ZQKB 4ZFOB 4I5BA 1OAKH 2OMNA 3V0AC 2ZCLH 3C6LA 4DCQA 1DQLL 1IM3B 1F13A 3UTSB 5GZOD 3LN5B 3UTSD 5GGUA 3WBDA 1PZ5B 1U6AH 5MERA 4KUZH 3TJHC 3QIUA 4LKXB 1RIUL 4HH8A 4K3EL 3RZWA 1NLDL 3IETA 3RP1A 5EO9B 1GZQA 3CVHL 2V2TB 3ULSA 3F6IA 1R3JA 2P49B 3RWCB 1AE6L 4OLYH 5D5MB 1IEAB 3FT4B 1MHCB 1KXQE 1E4WH 4OFYA 1MCSA 1PKQB 4HUXA 4KI5F 1JPSH 2FBJH 4HQQH 1G9NC 4FQLH 1LE5A 2P5EB 2EDBA 1X7QA 2DLFH 4N8VA 4BZYA 1B4JH 4P3DA 3QJHB 3T65B 3WFBL 4UTAL 2VL5B 2VZVA 4RFOH 1KPRB 2UUDK 4B7IA 4YHML 1SBBA 3OJDA 1NGPH 1CD1B 1EGJH 1XGPB 4YFDB 3RAJL 3ESUF 2R4RH 3SKUD 3OXSB 3NABH 4RX4D 4RIRB 1UT9A 4PUBH 3JV5A 3P9MA 1F6LL 4LU5H 1J9CT 2HFGL 3GBNL 3PGFL 3MXWL 3RVUD 5LGHH 4JPVH 5J3HC 1UQSA 1I1CA 5B4MC 3WIIL 2KL6A 2CGRL 1OF2B 4YHZH 1D5ZA 1SYVA 1P5UA 3H9SA 1C7TA 1MQ8A 3H9ZA 4X6DB 4XMKH 5TE6H 4JANA 1J5OH 5J9PA 1JRHH 4ETQA 4L8CB 5E2TL 4G80B 1T22A 3HZKA 3FB5B 1MUJA 4FFZL 4JKKA 4KJWC 3KDMB 4IDLA 5D70H 1WZLA 3PHQA 5F7YC 4HV8B 1S7QB 5IFAL 1TJIL 3EFDH 4LKCB 3ULUF 1CFQB 4I3RH 3CPLB 4U1NA 4ZUTA 4OF0A 5GGTH 3DRTB 2DQIH 4K23L 3DIFB 4WFHD 3DVGB 1P9MC 4FFYH 3NA9L 2ERJC 3T1WA 1B0RA 3T3MF 3LQAH 2N7AA 2JTDA 4N90D 3QZWB 3R8BB 5JO5A 1D5MB 4WJ5B 1GC1L 1N26A 4XCFL 2GK0A 5CKAA 3ARUA 2NY4C 5AZEL 3VGHA 2IC2A 2Q76B 5CJXC 5A2LH 1KPUB 3EJZC 4DUVA 3FB6B 2RFXA 4M7KL 4HBCL 3SKJL 1WSST 2ITDA 3HN3A 4PFEA 5DJ8A 1FFOB 4YAQB 1M6OA 3O4LD 2WIMA 4JZNA 4TUOB 3T2PA 3TVMC 1JF1B 3BUYB 2WUBH 4FMKA 5KG9A 3IAPA 4J8RA 3O2DL 3MGTA 1AHWC 3LHPL 5D7JA 1BVZA 1KTRL 4Y2DC 1XIWB 5DVOA 2XPGB 3NAAL 4PG9B 1XIWD 4PJFE 2BVQB 4TULL 4WV1C 2IEPA 2IAND 2I5YH 3MLUL 1CL7L 4LLYB 5DUBB 4HWNA 2GY7B 3MBXH 5T3ZH 5HGBB 1TZGL 4KQ3L 2PETA 1ZHKB 3C5ZA 3QQ4A 3OKNA 3SE3A 1OWRM 1CYGA 2B2XL 3VH8G 3Q2CA 1RJLB 2CLVB 3ARFC 1TQCC 2AABL 3EHBD 5HVGB 1DN2A 1CVRA 3QUKA 1NBVL 1VFBB 2C1PB 3FTGB 1Q94A 2X4TA 1MIEL 3DETC 3KPQB 2C3WA 3QHFL 1JBJA 5I66B 1O5DT 1A3LH 2FO4B 1KCVH 5DTFA 3P4MB 3ARVA 4POYA 4PGBA 3DYMA 4YIQB 3WV0A 3ZT7A 3PDGA 4NNYB 1AGDA 2BDNL 5MEPA 2CO7B 4JQXC 3CLEL 3VRIB 5T3ZD 4LPCA 2X41A 4QRPE 4K3JH 3X17A 4ETYA 1BZ7B 1WC7B 2OL3L 3GKWH 3QEHA 1UKQA 5HYEA 3PGCB 1AKJB 4P4KA 1AKJD 2G5BB 1U8MB 1BOGA 1LK3L 3D0LB 5GRWA 4KVCH 1GGTA 3LB6C 3LH2H 1YMMB 1YMMD 3IU4L 4FNLL 1Y0LA 4NM8L 1UXSA 2NX5E 4JY6B 2WUCH 4HFUH 1AGCA 5LAXA 2NPLX 1VKXA 2R2EA 2E9IA 4X7FC 4QT5B 5GJSL 4FQCH 1VGKA 3BVNB 4CVZA 3D5OF 4M48L 1QNZH 1PY9A 1OLZA 1OSZB 2EXYC 3T0EA 1A02N 1BF8A 3ZKNC 1QTYT 5CGTA 2ESVE 4JFDA 5TQ0L 1S7VB 2JCCA 4TQEH 5C86A 2XNAB 1KCUL 3STZA 4JRXB 5DJ2B 3EJYC 1RJCA 4UV4L 5C0AB 1G7MB 5C0AD 3Q6FA 1CG9A 2J6EA 1SY6L 4ACPA 3KR3H 3GMNA 5KSAC 2MKWA 5DEGB 4PY8I 2CSPA 4R97C 5JW3L 1XGYH 3IFNH 5FK9B 5HI4D 5HGAA 4DVBA 3BAEL 3OJ2C 1I4FB 4LRIC 5C6TH 3TGXA 3EO9H 1GIGH 5L88L 3LZFH 1KJ2B 2NY1C 2PYEA 2ARJA 1R3HB 1UA6H 3QI9C 4MHHI 1C1EL 4JFFE 5DHVH 3IFLL 1N0XL 1KJ3H 1OCWL 1TPXC 2ZG3A 4JZOA 1MCRA 5IESL 2NY0B 4ZXBA 2NY0D 3PWJB 4I3SH 1FN4A 3ZT5A 4YO0A 1QA9B 5E99L 2ITCA 4P0DA 3RTQA 3OPZH 3MSPA 3LEYH 5ENWB 1HH6B 3P9LA 4QLRA 2F54E 4FZEL 3DWTA 3ZDXE 5DWUH 4Y0GA 2VDRL 2UY7A 1NBQA 3LDBC 3G5VA 5AD0A 3QNZA 4XNUL 4M1GL 4Z95L 5C08B 4H1LB 1T89A 3OAUL 1MAMH 5IB3A 3MRNA 1OHQA 1OTUD 4S11A 2J1KA 4LFHD 1OD9A 5C7XH 3PHOB 2CK0H 2VR4A 5T1DL 4LSUH 1KN2L 1X5XA 2A6IA 2BSSB 2EDXA 5DRWB 3OX8A 4I0PB 4I0PD 4Z77A 1I3RB 4I18C 4O2CB 3WFHB 1QR1B 4PJ8C 4WNQA 1UJ3B 4GUPB 2NTFB 2EKJA 3SDDA 2IFFH 3MLYL 5GGSB 1NFDF 3M17A 1X4YA 4D0DA 5FO8A 4FS0A 1M7IA 1OTSD 3CDGB 4NPYB 5EZJB 2ATPB 4PRNA 2OP4H 4XNZB 4F57L 3MA9L 4L3AA 1FG9C 5F21B 1AXTL 1PY4A 4Q9CA 3U7YH 3QG6B 3CX5K 3U36A 4L4VA 1YPZF 5T3XE 3BGMB 3EYOA 4XZUA 2XTJB 3ZKXB 2HT4D 2XTJD 1OARH 3ILPA 3SO5A 1A3QA 4YGVA 3ZT6A 3ARGB 5DI8B 5LKNA 3ARGD 3G6JF 3MNWB 3QCUH 1AGBA 4NC2B 1KENH 2ZKHH 2AK4E 3GSNH 1NFKA 4MSWA 2X42A 4ZFFA 1IQDA 3A6BL 3L5IA 3CFCH 3MRLB 3VG0H 4Q6YA 3VGEA 2KQMA 5FGCE 3B5GA 4HWBH 1YMHA 3VGGA 4TYUA 1CFNB 1LO2L 1KGCD 4KK6D 2V2XA 3LEVL 2V9RA 4OZFB 5ACLA 1P1ZA 3MJ9L 1VACB 2QTEA 1ZLUH 1GOHA 2C3VA 5C71A 5ICYB 1NGZA 4U6YB 1XF1A 2DBLH 5JHDB 5JHDD 1U8HA 1HZHH 2PW2B 4K7FA 4HW6A 2EDLA 2NR6D 4XHQA 2HFEB 3GIZH 4HWEL 3U7WH 4CVUA 2EE3A 3OKEA 2YD2A 4TSAH 4EOWH 1QBLL 2CKBL 5HHOE 5C6PB 4R2GC 2CDEB 1JNJA 3V4PL 3GMQA 1A4KB 1MLCA 4HIHB 2A9ML 3HG1B 4LCCB 5KVEL 4M6OH 3HG1D 4MA3A 4PJXF 5I6XC 1OTTC 1KC5L 1GGUA 3K81A 2QKIA 1DQDL 4HZLA 2Y9RT 1FVCA 5KSVA 3S6CA 1N5YL 1WBZA 1DSFL 4XPGH 5KANG 2WZPD 5EIIA 5HI5D 2V9QA 5T5FL 4CRPA 1CFTA 4LVNC 4XRCB 5CZXC 4M4PA 1T20B 1VPOH 2PXYC 5T1LA 2D0GA 2XZAH 3WNMA 3D85D 3ROLB 3HMXL 1X4XA 3MV9A 1L6XA 2WANA 3MROA 5TDOA 1BVLB 4QXWA 4F7PB 2FJFA 2H45A 3SGKA 1RJYA 4YUEL 2O5ZL 3JWOL 5ESQB 5GGVH 4Y19B 2M26A 1YEJH 4JB9H 4Y19D 1UCBH 1BFOA 3O6FD 4I2XB 3AROA 3WHXA 1YN7B 1HI6A 1EEUA 4PLOB 2CRMA 1CD9B 5KSBE 3F7VB 1J8KA 4NYLA 5IHZB 1S7WB 5CJBA 1K5NB 1BIIB 3K7UA 1I7TB 3EFFA 1TZIB 4PLJD 5M95B 4MNQA 1S9XB 2VXQL 2YN3A 4FQHB 3KYNB 3VWJB 4PLNC 1M7DB 3VWJD 3S8WA 2MWCA 4Z7WB 4KZDL 3LAFA 2UVEA 4EIZC 4MX7B 3RUGE 2FRGP 3WUWG 4YDKL 2LE9A 4I1NB 3VI4E 2FD6H 2FH6A 1A6VH 2OL3A 3K74B 4GRWH 4XWGL 3G6JA 3IDMB 4XP5H 1RK0B 3HC4H 4NM4H 2VXTH 4JVUA 1I7UA 1XCQB 2XN9A 4NCDA 1QLFB 3MREB 5I74B 1RUPL 3QEQB 4G9DB 1S7RB 3QEQD 4POZD 4F3FA 5EWIL 1V3MA 4JFZL 3RIAF 5ILTL 3PIQA 5BW7A 3BSZL 1DVFC 3BP6B 4J6RL 3VFSB 3PDOB 1FO0A 2HWZL 5D93C 3TBSA 2FEEI 3UJJH 2EIZB 4PJCF 4QXGL 4Y16D 3DXAB 4UBDD 3R0NA 3DXAD 3O2WL 4IRJC 2Z91B 4OF3A 4JO2L 1OGTA 5ADPH 5EU3B 4NQDB 4LF3B 4NQDD 4LCIH 1C12A 3D39E 3QQ9D 3WJJC 3AB0C 4KUCF 5IW6A 3B2UD 43CAB 4GRLC 4UAOC 2FEDD 3D6GA 1MRFL 5DK2B 1G0YR 5BMFH 2W9EL 1UM6L 6CGTA 5L7XL 1SY6A 1AFVL 3QO0B 4X7SH 4WW2B 4LHUA 1ZHLA 3BRFA 5D7IF 4EKXA 1BWMA 1RIHH 1MJUH 2HFFB 5A2FA 3Q5TA 4PG2A 4W6YB 5D2LB 3C09B 3WN5C 2CXGA 4D9RE 5JDSA 4LARH 3ARDC 4H0HB 3DARA 2J8HA 1ORQB 3MFFB 4NNXA 3L3GA 5GJTL 1FVDA 3HNVL 4PREA 2AS5M 4TTDD 3V52L 5DD1L 2I60H 3L6FA 5BCAA 4Q0XL 3QDGB 1PAMA 3QDGD 2HRLA 3MLZL 1FYTD 4ELMA 3GSVB 3QUMB 1TXKA 2X40A 3BUTA 4XVJH 3VXRD 4CMMB 3JV6B 2VR5A 1JNHB 4XP9L 1INEH 1DANU 5L2KB 5K93A 3W9EB 1U3HC 3D69A 1RURH 5DFVC 5L2KD 3UYRH 1AD9A 1IAOB 3VI3F 2F15A 4MNGA 1PLGL 4P9HC 2X6MA 3MRGB 1XGTA 4P3CH 1M05A 4J1UB 4PD4J 4KU1A 4QRTA 2Z31A 2G75B 5C0EA 5DK0A 3NCFB 1E4KA 1OP3K 4KK8D 1A7RL 2YD8A 1XGUA 2VLME 1AD0B 4BK5A 5EOQH 1BZ9A 1FBIL 3WDJA 5I17B 4G42A 2F5AH 1UM5H 4GQPH 3VXUB 3VXUD 1KLUA 3UAJC 7FABL 3SY0B 3QDJA 4OTXL 2J5LB 1QP1A 3O3DA 4TVPE 2YA0A 2AW2A 3U2SB 5EDXA 4X4YB 4QRRA 5KBNC 1G6RL 1U91B 2W92A 1QOKA 4UDTA 1LNUB 1QLEL 4NN6C 1HHKB 3DX8B 3I84A 3SBWA 3LCYA 4JHAL 2NY4B 4I48B 5F96H 3RKDC 5HYFA 5D1ZB 4F37K 3EAKA 4ISVA 5D1ZD 5JNYB 2W91A 2NLJA 1WIPA 2GTWA 3L5JA 4NKOA 3E0GA 4NJAH 3D9AH 4F33B 2Y23A 3K1KC 4ORGA 4PJEB 2G60L 1UYWH 5BRZA 1M1SA 4HX1A 4PJCA 3BO8B 5HHVL 3M45A 3K2UH 3DYPA 2EC9T 3QXDA 5J12B 2MKLC 2MHAB 3O6LH 3PGDB 2LFGA 2MCPH 3MJ9A 3KYKH 1NLBH 4Y1AE 1DCLA 2OI9B 4JRYA 4JM4H 4PJ9A 1MFDL 4DOHB 3LN9A 4M1CD 2KBGA 1OM3H 5EH1A 1JNNL 1HK6A 3SE4A 5TH2A 4JO4L 5JOFA 2IH1B 4P2OC 4RAVA 4N5ED 4LASL 5GS0H 1ORSB 3MC0A 2ILLA 5JQ6H 1NMBH 1YY8A 2CKBA 3RWEA 1S3KH 4MXWH 3DURB 3LPFA 5GGVY 3T0BA 3RGVC 2AJVL 4KWUA 4G8EA 3HPLB 5E6IB 5CGYD 5E6ID 3GHBH 1I7RB 4LPUA 1OP9A 4XNXL 1VFUA 3ECBA 4WI9A 4PB0H 5DD5L 1JGVL 1BAFH 1N5AA 5MENE 1H5BA 3BFOA 1G7QB 2EE6A 2IH3A 1A4JA 2DTSA 2UZYB 3TO4C 3WXVL 2RBLA 2UV3A 2X89D 2AERT 3RX8A 3MV7A 3KPRA 5EO0A 2UUDH 4HK3J 4OI9A 3OZ9L 4L4TA 5GS0D 3HMXA 2ZSVB 3LPGA 2VZ1A 3GBML 1FG2A 4O02H 1FL6B 4JQIH 2P47B 1N0LA 3CFKB 2GYSA 3JV0A 1MWAH 2A6JB 5EU6B 4C83A 1INQA 1T0NA 2UWEA 3LKQB 4M6ML 1OT2A 3MX0A 3RU8H 4ZUUB 4AH2B 2GSIB 4UV7H 4Y2DA 5ICZB 2H2PC 2UYLB 4MCYB 4P5KA 1JWSA 4WV1A 4Y7MA 3UTTE 4KTYA 2YHGA 1R3IL 1NCWH 1NGYA 4LMQI 4Y4FA 1A6AB 2KKQA 1MHEB 2HLFC 2H2SC 5MP6L 2VC2H 3BH8A 4ZPVB 5MEQB 4GAFB 1HEZA 3VW3L 1U8JB 4KHTL 1PG7H 3EO1A 1U8NA 4G8FA 2KQNA 3HI5H 5HGHA 2R9HD 4ODVH 4X6FA 1A0QH 3MRFA 4BYHA 1H3TA 4UDUA 3L5WA 4CNIB 3GIVA 5D2NB 1IGFL 2XRAH 1C5CH 1BEYH 2NW2A 5IGXL 2F53B 4N1EA 1NAMB 2FX8L 4BZ2L 2F53D 1RK1B 4DTGL 4R96B 2V7HA 3OG6B 5EIQA 1X5ZA 4G6MH 5I1LA 1YEKH 5EBMB 2SEBB 4M1DH 4O2FB 1FPTH 2YPVL 4JFHD 5F9AC 2AGJH 1EV2E 3BIKB 5IMMB 3E2HB 3FFCA 3QIWB 3NFNB 3O3AB 3VFPB 3QIWD 3OSKA 1ZT1B 5CZVL 4S1RL 3NCMA 4J23A 1J1PH 1ZA3B 1A7OL 4U3HA 3TZVA 4J3XA 5BV7H 1KNOA 3TYGL 3UTSE 1CICA 5D7KD 4U0RC 5FECA 3DO7A 1ACYH 1XGQA 4UIKL 1ZTXL 1CGXA 1P2CA 4IRSA 1NH6A 2OSLA 3I50L 3BWAA 5B38B 4EBQL 4GW1B 32C2B 1IFHH 4I77H 2GJJA 5JOEA 3P0YL 1G7LA 12E8H 2BERA 5FCUH 3I6GB 1PKQE 1R5IB 3T08A 1MNUH 5F70A 1K3ZA 4DVRL 3DVIA 2FLBT 4P2QB 1N6VA 3QUXB 2P5EE 4JKMA 3QUXD 3IFOA 1EFXD 5DR5L 3VFTB 3MLRH 5KSAA 3SO3C 2ZPKL 2BNUA 4TUJB 5EN2A 3T4AA 4X5XA 2VLJB 2GFBB 5KTEH 1XF2A 1NKRA 4BH8B 1CLOL 3GSOB 1BIHA 3QXWA 3A67L 4RWYL 4YJZL 4YDLC 4HXAH 4F9LC 4MXQC 3UYOD 2M2DA 4NRZA 3I6LE 2Z92B 3ILQC 4NQEA 1L9NA 4GQ9H 4XBGA 3QWRD 4NDMB 1SJEB 1HINH 5HHME 1RUAL 1RAMA 3MJ8A 3MOAL 1KBGL 5C0CA 3TIDA 2CUHA 4IRZH 4NC1E 1X5LA 3CLFL 4IOFC 1EBPA 3NPZB 3IVKA 1QQDA 3HHRB 4GAJH 2WIIB 5FOBA 1C08A 5DMKB 1FCGA 2VABA 3TYFB 4FFVC 4X6DE 2Z4QA 2ED7A 4NO5A 4JDZB 3WS6C 2R2BA 1LHZA 4HIEB 4WDIB 3VXMD 4LP5A 5HBBA 5E00B 1IC4L 1JL8A 4GKNA 1AI1H 4PGCA 5ETUA 4HJJH 4LBEA 5FGRA 1ADQL 3EOAB 2Y06L 4RDQF 1HYSD 1CF8H 2QJDA 2RIKA 2KZWA 2YBRB 1HDMB 1BGXL 4F7EA 4WI6A 5JUEL 5I1KH 4WFHE 2YD5A 1G6RA 5DEFB 3BJ91 4NQCA 5C0GA 2DQFA 4IOSD 4AIXA 1DBML 1U95A 3WFEL 5C0RH 1RD6A 3LV3B 5B39G 4Y4KD 3FCTA 1L0YA 2R2HB 3OKOA 1JGEA 1JYWA 4OLWH 3DRQB 1LD9B 2C26A 5EFIB 4J4PD 1K6QH 3BPCA 4RFNB 4RMSA 5DJXB 5E4EB 4M3KB 4NO0B 4NO0D 3LKSB 4GRMA 4MA1B 1ZHNB 5GRJH 1KJVB 5DRNA 1AGFB 5J0BA 5D6DC 3O2VH 2VXSH 4WFFD 2CLZB 1T4KB 1PYWA 1DFBH 1CI5A 2D03H 5IW1A 4I5BB 2DQHL 3C6LB 4U05A 3PWUA 3WNPA 4DCQB 3C6LD 5GGUB 2EE9A 3FOMA 1UH4A 3CK0L 1A9BA 5MERB 3QIUB 4LEXL 3QIUD 3DUUA 4JEGB 3IETB 2VXUL 2GCYA 1GZQB 3ULSB 3ULUE 1R3JB 1YQ2A 1DL7L 2X09A 5E2WH 1ND0A 4NKDB 1BVKA 2YZ1A 2BVUA 4N9GA 4Z0BL 1JYNA 4M62H 2VUYA 2F58L 5BVPH 4OFYD 5AUMA 2FB4H 3DPBA 4M4RA 5D8JL 4ESKA 3U4AA 1LE5B 2Q6WA 4IJ3B 1X7QB 4N8VB 4G6KL 4ONFL 4P3DB 1TNMA 1NCBL 4K3DL 4LDEB 5HGDA 3RI5F 4XTRC 5K9QI 5CIPA 2CLRA 3AREC 3OJDB 5KW9L 3B3IA 5CBEA 1L6ZA 3ES6A 4X6EB 3V4UH 5DJDA 5T3ZE 5MI0C 2C4XA 3MLTB 3P9MB 3RDTA 3D3VB 4LPXA 5AZ2L 2B5IC 4Q9RL 4GJTB 5EU4B 1JN6B 3HE7A 1UQSB 2C5DC 4HFWB 4G7YH 4JN1L 1D5ZB 1NGXA 1SYVB 5E9DA 2V6HA 3OV6A 3H9SB 2X1XR 2I9LB 3NACH 3H9SD 3MLSL 1VGEH 1YMME 1YJDH 3PABA 4JANB 1MRDH 2QL1A 4QXUL 1G7PA 1GAFH 2IALA 4N0RA 5D7SL 3UX9B 3FRPA 5CUSH 4ETQB 4BQ8A 1T22B 3HZKB 2LV4A 4XC3L 4P2RA 1MUJB 4BQCA 2VDNL 3S97C 3U4BL 4MJ5A 1TCMA 2ADFL 1K9TA 3PHQB 3PWNA 1F2XK 1HILA 4NP4H 3MUGA 2XA8L 1MCKA 4U1NB 4FQXC 4LSRH 1IGML 3F7QA 2OM5A 4S10A 3G5ZA 4G7VL 4JRXE 1YUHA 4XMPL 5C0AE 1MLBB 1RZFL 1OPGH 5GSVB 1JGUH 1B0RB 1F3JA 5EUOF 2AK1L 1JP5A 3W81A 3VXOA 4HS8L 2NYYC 4JZJA 3NCYP 5DT1L 3MJ7A 2IFGA 5F7EH 3WIHL 4OLUH 2RFXB 4AENA 4Z7QE 5LWYL 2ITDB 5DJ8B 2FHFA 1M6OB 1MRCL 4G5ZH 4JZNB 5DVMA 2BC4A 2CUMA 1N8ZA 4V1DB 5KG9B 4FRWA 4J8RB 1IGIL 3THML 4DUWA 3MCLH 4LDOB 1FL5A 5D7JD 5FKPB 1CK0L 5C0JA 1F11A 1NEZG 1A9EA 3NH7H 4IDJL 4YHYC 2HVKB 3IRZA 1LO0L 3IT8D 2Y36H 4RISL 1PSKH 4XAKE 3GNML 3U0TB 4O4YH 1EO8H 2JJWA 3H3KA 1WAAA 3U30B 1DUZA 5C08E 1NMCB 1UB6A 4MNHA 4S1QH 4LCWA 1X3DA 3C5ZB 3QQ4B 1Z9MA 1WBYB 4WI3A 3IFPA 3C5ZD 1H3WM 3OKNB 5E94A 4KI5D 5EZIH 3QRFM 2EYTA 5F7WC 3QUKB 1GOFA 4BFIA 2WV3A 1UWEH 3HI6H 4ZAKC 4WFGD 4XNMB 1BFSA 1IC7H 3EGSA 4GRLA 4QHUB 1Q94B 2X4TB 3JXAA 5F1SA 1EXUA 1DDHB 4WHYH 1E4XH 3C8KA 2ID5A 1P5VA 3QUZA 4OZIB 4OGYH 3TN0A 3Q3GA 2VDKL 4JG1H 3MBEA 4HKZA 3PV6B 5DTFB 3V2AR 3BN9C 3KLSA 1J10A 5I76A 2OR9L 4PGBB 5F7DA 3N1MC 2R1YA 3WN5A 4L29A 2QQQA 5MEPB 1IGCH 5C0BA 3C60A 3QSKB 3TFKC 2DRUA 5IVZA 4KKCD 4FQQA 2PN5A 4QOKE 3MRBA 1MELA 4LCYA 5BVJB 4KRPB 1U93A 5F1NB 4KRPD 3EUUA 4P4KD 2XTJE 4X9BA 5F97E 1BOGB 3IDIA 3P0GB 3I6KA 4JR9L 4GKZA 5JLZA 2J6EH 4BQ9A 3W0WA 2GT9A 3HZYA 1UH3A 1UXSB 3CIQA 2I9TA 4L8DB 1BBDL 1AGCB 5LAXB 1VKXB 3CVIL 2VTFA 3HAEA 4LSQL 1U3HA 4CVZB 3QIBA 2VZUA 4X5LA 2QHLA 4PJ5A 3T0ED 1ADQA 3NIGF 3EDFA 1T6VN 2XKNA 4JFDB 4RBPK 4JFDD 2JCCB 5JHDE 3ULVL 3STZB 5EA0L 5J57B 4FG6D 3Q6FB 1CG9B 1QSFB 1AR1C 1W2KT 1BQHA 4OZHB 4YFLF 4ONOA 1DQLH 3GMNB 4R0LA 4R7NA 4RFEA 1FE8L 4ZNEA 3X13B 4U1GB 4LGPB 4G3YH 1RIUH 1ZANH 1NLDH 4F80A 3C2AH 5HGAB 4DVBB 1GYAA 4WVRA 1J88A 5I8KH 3IAQA 5BOZG 3RWIA 4E41A 3HG1E 3RL1A 3ISWA 4OF5A 4PJIA 1NMAL 1WFNA 2PO6C 4R90L 4MA8H 2ARJB 2PYED 3VXNA 2VR9A 4S0TD 4O5LH 3RWFA 1ZS8A 2OS7A 4ENED 4ZXBB 1U3JA 1U8IB 4KFZC 4ZXBD 1WCQA 1GZPA 3U0WL 3TPKA 4MJIA 3CUPB 1UG9A 4FQ2L 3RTQB 2FX7L 1V7MH 1MFCL 4PJ7A 4QWWD 3RTQD 3CSGA 5D1XA 3P9LB 2YKLH 4PRPA 4GW4A 2J8OA 3OKLA 3C6SA 3OL2A 5AD0B 3QNZB 1Q9WA 1YNKH 2AEQH 3CVHB 3RAJH 4NZJA 5IB3B 2DIJA 3MRNB 5EU5A 1ES0A 3ZDZE 5HYSA 4Y19E 3BKMH 4YNYA 1J05B 2ZOLA 4KK5D 4WTZA 4H88L 4I2XE 3FAXA 2HFGH 5D7LB 4QHLA 4LRNL 4Z77B 3WIIH 4UU9B 2CGRH 2PUQT 4PP1C 4WNQB 3BGFC 3F65A 3QZWG 3SDDB 4LNVA 3SDDD 1RV6X 2XWTA 1JPTL 3M17B 4D0DB 5FO8B 1S8DB 1G7HA 4HAFA 1OP3H 5IBLD 1M7IB 2ADIB 4G8GE 5E2TH 4PRNB 3S35X 1S9WA 4QTIH 2V2WA 4U2ZA 3DVNA 2ZWLT 2GI7A 4HDIA 2CMRL 4JY5L 1A7QL 2VXVL 3U36B 5IFAH 1E28B 1UZ6E 5IWLC 3EYOB 4L4VD 1PJ9A 4XZUB 3TH4T 4OM1L 3ILPB 15C8L 4OQ1A 4YGVB 1WVZA 1Q1JL 3CJJA 1AGBB 3BESR 2WLYA 4M03A 2YMXH 2NY3C 5FCSH 4RAHA 3P4NA 4MSWB 3QEQE 4RZCA 1HCVA 4CJ1A 2VH5L 2YEZA 5DZLA 1Q9OA 2FATL 5B3JF 1P6AB 5EBLA 1GC1H 3LKPA 2O5YL 3LEXB 4M7KH 5GIRB 1P1ZB 3SKJH 3DXAE 1GGBH 5I8OL 5I1AA 2C3VB 1QRNB 1NGZB 4U1LA 4NQDE 3NFSL 4Q9QL 4HWZA 5GZNC 5KZCB 5FO7B 2W9DH 4S1SH 4WIQA 3EW3B 5CP7A 1AO7A 5A2IH 3R06A 3ARRA 4UTBL 5HYQA 1IJ9A 3NAAH 2PYFA 2J88L 3TCLA 4TULH 3C5SB 4OF6A 1B0GA 1TCRA 1IGTA 3PL6A 4CADA 3GMQB 3O6MH 4ODWB 5DD3H 4NQSA 2HT3C 4EN3A 1CL7H 1MLCB 5D2LE 4WU5A 2Q7YA 2GUOB 2Y6SD 1NCNA 1F42A 2IPKA 3RI5K 1G9ML 4KQ3H 3ET9F 4MA3B 1EFQA 3CU7A 4UILL 3E6FA 3WIHA 2ARWA 3MLVH 4KROB 1HQ4A 5TF1H 1M7XA 2B8OT 2QKIB 4JG0L 4KROD 2NY2B 3H0TA 2NY2D 5FA3A 1FVCB 5KSVB 3ZE1F 5A43C 4N1CA 1WBZB 2X4OA 2AABH 3E1F1 4NBXB 3DHJA 2Y4SA 5EIIB 1NBVH 35C8H 1CFTB 4WCYL 4H0GA 3QDGE 4XGZA 2BVEA 4ZOCA 4KRMB 3W39A 5T1LD 1QO3B 3MOBL 4OCYL 2JELL 2PR4H 4Q2ZA 3U0PA 2JK5A 3MV9B 2BY2A 4LIQL 2XXCB 3MV9D 3EYQD 5E8NA 5TDOB 5I75B 3REVA 2WBJA 1RJYB 2GTZA 3MUZ1 1BFTA 3CLEH 1ZVSA 4HIJA 4NFBA 3WHXB 1HI6B 5IJVB 4Z7UA 4Q74A 1X9QA 2OL3H 4NYLB 2OYPA 3WNKA 2DI9A 4OGAC 1U6AL 5D7IE 2W38A 4WO4C 1LK3H 3EFFB 4KUZL 4JQVC 5FYJH 4MNQB 1EAPA 4MNQD 1YC8A 3OF6A 5FV2A 2NW3A 3RZCC 4NM8H 3HUJA 3ZSSA 3RQ3A 1FO0H 3T2QA 1E4WL 3MRPA 5F89A 5I1IL 5GJSH 1W0YT 3PUCA 1JPSL 4HQQL 5E24E 3TV3H 2CRZA 4K94C 2OL3B 3PWLA 5TQ0H 1Q9LB 4RFOL 1IZJA 1AXSA 2G2RA 4EDXA 4ODXA 1R0AH 1I7UB 2XN9B 1NGPL 1R5WA 5FYJD 2XN9D 2B39A 3FO2A 4BJLA 5LQBL 1SY6H 5EZOH 2R56H 3VXQB 4F3FB 5A3IC 5FUCE 3REWA 3NABL 5J06A 3PIQB 3UPRB 4PJEE 3ZHDA 4H1LG 4PUBL 2VAAA 5IQ9A 4OZGA 4LFHG 2DTML 3TBSB 1U8OA 4YPGA 4LMQE 4EVNB 1CIDA 3SKMA 3WUZA 1NAKL 1TTUA 4KVNH 1EBAA 1OGTB 2P8LA 2WP3O 4LSTH 4NUJB 1Q0YH 4AIZA 4CVWA 2UVFA 1C1EH 3IFLH 1C12B 1N0XH 1NJ9A 1XEDA 2ZUWA 4DOHE 5IESH 5IW6B 4D0BA 3V7AE 5JXAH 4XMKL 5TE6L 1J5OL 3KHOA 5ALBH 3UBXA 5M94B 5E99H 1JRHL 4LHUB 1ZHLB 1BQUA 4LHUD 4LLUA 4KKAC 4FZEH 3OKDA 5DK3A 1VADB 1IM9A 4QEGA 4XNUH 5JDSB 3EFDL 4M1GH 4Z95H 4QYOA 3PWPE 3TA3C 5IEHA 3X14A 4XX1E 3DX7A 2EIDA 2BK8A 4PREB 2HTLD 5T1DH 4HUVB 3B9KC 2EDWA 1JYXA 3CH1A 3KPPA 3MODL 2DQUH 1MSPA 3LQAL 4M7ZC 3OGCB 4ELMB 1ZT4A 1KXTB 5BO1L 4DEPC 4KXZI 4NQVB 2IBGA 4C56A 5E8OB 1DBKH 1TTFA 4DFIA 2VDPH 2VQ1A 4HKBA 5JIKA 5IB1A 2BXYA 2FGZA 5FHAL 3X3GL 5E4IA 1MY5A 1WITA 2WUBL 5EU6E 5HVWA 1AD9B 1I1AA 4LK4A 3MA9H 4MNGB 4X83A 1XGTB 1M05B 1FGNH 1SJHB 4QRTB 2Z31D 3LIZH 4WFED 5C0IA 5DXWA 5DK0B 3TJHD 5FO9B 4RA3A 1XGUB 1S78C 3QG7L 1JZ2A 1BZ9B 2BFVH 4G42B 4WU7A 3A6BH 2FIKA 3FT3A 2IWGA 3WCYA 3QDJB 3QDJD 2H41A 4XP1H 3SKNA 3O3DB 5ERWA 1LO2H 3LS4L 4ZUSA 3LEVH 4QRRD 1VENA 4PP2A 3MR9B 3MJ9H 3FRUB 2CJUL 2IAMA 4ZSOB 4NCC1 5D2NE 1WCBA 5F7UA 2YRLA 2X9WA 4GG6F 2F53E 1A3LL 4RMWA 3BPLB 1ONQA 4ISVB 3WIFB 2HT2D 3PQYA 2NLJB 3ZSTA 2DLHA 4EI5A 2GTWB 4XPTL 3J7HA 1ROWA 3L9RA 1TJHH 4ORGB 4BSWA 1PBYA 5BRZB 2CKBH 5BRZD 4HX1B 4R4BA 3I02A 4K3JL 2GHWB 4Q7DA 2A9MH 1G0XA 5KVEH 5J3HD 3BPOB 5INCA 1KACB 4U1JA 1KC5H 1DQDH 2ZJSL 3LVEA 4KVCL 5FGBA 4JRYB 4KUCD 4LQ1A 1TFHA 4JRYD 4PJ9B 1N5YH 1DSFH 1U42A 4PJ9D 4Z9KB 2YUZA 5D7KE 5T5FH 5J8OA 3VRLF 3C5JA 1BLNA 4YZFE 2DKMA 5K9JH 2WUCL 5TH2B 4HFUL 5DMGC 5JOFB 1HHIA 3EYSH 4RAVB 3SGDH 1WF5A 1P4IH 4FQCL 3HMXH 3OHXA 1YY8B 2CKBB 4ODTL 1ZGLA 3RWEB 4OCRL 3VGAC 3SDXA 2P48B 4G8EB 2NXZC 4Q6IA 4FQXA 2O5ZH 3BDXA 3HI1A 3ECBB 4TQEL 5TDPA 2NY7H 4P2QE 1N5AB 1H5BB 3QAZC 4Q9BA 4LL9A 3TBWB 2IH3B 1A4JB 4HBQA 3Q6GL 1BJ8A 3KR3L 4G8IA 4GFTB 1ZVYA 4OFPA 5KJRH 5GISL 4N0CC 1U92A 4GBXA 2XT1B 4L3EA 1XH3B 4Z7OF 2VLJE 3MV7B 3KPRB 5EO0B 3MV7D 3KPRD 4MB4A 1P84J 1XGYL 3IFNL 3KNBA 3WS3A 2VXQH 3DMMC 2ZUVA 4L4TB 4L4TD 1F8TH 4JFQB 3EO9L 1FG2B 3BD3A 4JM2A 4C83B 3UO1L 1INQB 4XH2A 1T0NB 1UA6L 1K2DA 4RGOL 4P59H 2UWEB 4KZDH 4OUOA 1KJ3L 5HI3C 4HHAA 4BM7A 4BQ6A 4YDKH 4Y2DD 4M7LL 1JTTA 4P5KB 1RZ8A 1JWSB 1SJXA 1WFOA 3NIDE 4PRIA 1RZKC 1JPFB 1C7SA 1MCWW 3LEYL 2EO1A 3SDYH 1CFSA 4DW2H 1FH5H 3AM8A 1NGYB 5SWZA 4F7CA 4Y4FB 5FM4A 4Y4FD 4OV6F 1MAML 1U2CA 1FCCA 2YXMA 3BH8B 1U3YA 4J7RA 1HEZB 1GSMA 5EBWB 5IM7B 3GSRA 3BSZH 1QEWB 1S7SA 4J6RH 3ALPA 3EO1B 1CFVL 1U8NB 4G8FB 2HWZH 4PGZA 2CK0L 1WT5C 4Y5XC 1N2RA 4LSUL 5HGHB 5HYIA 4X6FB 3QWOA 3MRFB 4UDUB 3L5WB 2EXWC 2VDQL 4RRPA 1ODAA 3VFGL 2E7MA 3JTSA 3FQUA 1RZJC 2NW2B 4NZTL 3NZ8A 3ARTA 1FDLH 2DD8H 2ZCHL 2ICES 4PJHA 2V7HB 2BRRL 4ZO8A 4LLDA 3L7EB 2W9EH 1UM6H 1T2JA 5L7XH 3UC0H 1AFVH 2HKFH 1ZSDA 1SYSB 5SX4H 5IVXA 3UTPE 1S7TB 3DTXA 3CFDB 4KAQH 1JHLH 3FFCB 4WFFE 4X4XA 3VFWA 4LHQB 3FFCD 1OARL 2BP3A 2XQYK 5DJCA 3LKOB 3HC0A 3HNVH 3TZVD 1KNOB 2OJEA 5EIVA 4KDTC 1CICB 4WUKH 3RPIA 1KENL 2ZKHL 1CICD 3GSNL 1JVKA 2YRZA 3DO7B 2V7NB 3OJMB 4JVPA 1BX2A 1P2CB 4LVEA 4IRSB 2XV6B 2H8PA 4O2EA 2OSLB 4IRSD 3BWAB 3RIFF 4HWBL 1C5DA 3MRRA 2Q87A 3FQWA 1KCKA 3WEXB 5KS9A 2EXYD 1IKNA 4RAUA 2RR3A 1G7LB 3WJLA 4JLRA 3HE6C 3MZGB 2DBLL 2EH8H 1UADC 3IFOB 4RGMC 5HDLA 3B43A 4FXGA 5IFJA 6FABL 2BNRE 5KSAD 2BOCA 2BNUB 3GIZL 3T4AB 1F4YH 3U7WL 2YD9A 4TSAL 5CD3A 3EKCA 1XF2B 1CLCA 5JZ7C 4FTVA 1M71A 1A5FH 1JTOA 3ZMRA 3S37X 3FHQA 3FB7A 4OZ4B 3VGFA 2P8MA 3B9DA 1QPPA 3GFUA 4M6OL 1RUKH 3D3VE 3UEZA 1I9JL 4NRZB 4NQEB 4XBGB 4NQED 3QFJB 4XPGL 3WSQL 1G6RH 3MJ8B 1GGCH 3I9GL 5C0CB 1UENA 3TIDB 5C0CD 5CILH 3ZKMD 1JZ6A 1VPOL 4D8PA 2GAZB 3RY5A 3SE9H 3IVKB 3H9SE 1P4BH 1CGVA 5FOBB 1C08B 2VABB 4FQJL 1EMTL 3PP4L 5FUZH 2Z4QB 4NO5B 1WJ3A 2R2BB 3TO2B 2APFA 4GKNB 4XI5D 4DWHA 4PGCB 1XFPA 5GGVL 2G60H 5ETUB 4LBEB 1YEJL 3OMZA 1UCBL 4XX1G 5C0NC 4WW1A 2W0KA 4YDIH 4R9HA 4F7EB 2FLRT 1H0DA 1WZ1L 1DEEA 1G6RB 2A0LD 3VD5A 3WL9A 5C0GB 2DQFB 4NQCD 1U95B 4E5XA 2N56A 4PJDA 1MIML 3FCTB 4BKLA 5DRXA 1JGEB 4X8JA 4K2UL 5JDJA 5SX4I 4XPFH 3BPCB 3CSYA 3KJ6H 4OGXH 4PJFF 1HYRC 4XHJD 4JO4H 1P6FA 2GK2A 5B22A 4GRMB 4LSPL 4LASH 5DRNB 2DOCA 2GY5A 1INDL 3I3BA 4NWTH 1MCNA 2P5WA 4M02A 1BBJA 1OSPH 2E7LC 4V1DE 2AJVH 4ZODA 4L8SA 1A6VL 4LVOB 1PYWB 3U6RB 2A73A 1KIQA 3HB3D 4V2BA 3HC4L 5IW1B 4NM4L 2VXTL 3JWNC 4X5WA 4KZEL 4WTWA 3PWUB 4K3HA 1H3UA 4NBYB 5CIPH 4HS3A 3FOMB 1A9BB 2DQTL 1L0QA 1I9RL 4N1HB 3V6OA 4N8CH 4OCXH 3DUUB 3QRGL 3WXVH 4PRDA 3BE1H 1ND0B 3S9DB 5JW4Q 1BVKB 4N9GB 3T0WA 4P5TC 2JIXA 3GBMH 4G43A 5AUMB 1A7NH 5A40E 5ADPL 1A7PH 2Q6WB 1R3LA 3GEWB 1T3FA 4LCIL 5TE7L 3SEPA 2XACC 4EUPA 3P2TA 5HGDB 2VDOH 4KHXH 3RZCB 4QRUA 4U49A 2CLRB 1XF4A 3SDCA 4OZIE 1D9KA 2HRPL 5E2VH 3TBVA 3B3IB 4X7SL 3S96B 1JHTA 4RMVA 5CBEB 5CCKH 1IBGH 1R3IH 2AXJA 1RIHL 1MJUL 4K07A 3ES6B 2E7BA 5JHLH 5DJDB 1JWMA 4LARL 2JJUA 3RDTB 3BPNC 3RDTD 5MP6H 3VJ6A 5C1MB 3VW3H 4KHTH 5KANI 2P24A 3HE7B 3D18A 3HE7D 1YZZA 4OCLC 5DHVA 3IU3A 1NCUA 1QR4A 5CZXD 1NGXB 2L0DA 2J8UA 5E9DB 4S1DD 5E9DD 1KG0A 3ZZ1A 4BSJA 1J12A 1UZ8B 3PABB 1CDHA 1LO5A 1G7PB 5IROA 2IALB 5B38G 2WINA 1FVEA 4P2RB 4WUUE 4Z7NE 4P2RD 1X4ZA 1WV7T 1INEL 1AP2A 3IF1A 4NRYA 3PWNB 4DJMA 4Z7VA 5FOJA 3MUGB 4HC1A 4P3CL 4JCLA 1Z3GL 3O9WA 3SCMC 3LKRA 3TEUA 2JCCE 4MB3A 4WI7A 1BJMA 3G5ZB 1QSEA 3KLAB 1MPAL 4EIGB 1YUHB 1QPXA 4S1RH 3S37H 1QSFE 4HCRA 1UACL 4OZHE 1A7OH 1F3JB 4MZ2A 4WY7L 5EOQL 2F5AL 1A6WH 1UM5L 4X99A 2IMNA 1G1YA 4JZJB 4UIKH 5LGJA 1ZTXH 3B2VH 4X7TA 1MJ7L 1KFAL 1UKTA 2JB6A 2EYSA 4AENB 1JYVA 4P46C 4EBQH 4DQOH 2FDBP 2V5YA 3ZDXF 2BC4B 1ERNA 1N8ZB 3RBGA 4R4NC 3KLHC 1TDQA 1DN0A 4KKBC 4DVRH 1FL5B 5CZKA 1MEXH 3QCTH 5CSZA 4DFHA 2LQRA 5C0JB 1F11B 4XNQA 4JDTL 1KULA 2HP4A 1A9EB 1DTUA 5F96L 4APQA 5T33H 2HJFA 3KPLB 2B0SL 4NJAL 4J2XA 5JR1H 1RHHA 3NN8B 3GB7B 5K9QG 1OLLA 4L1DA 1TVBA 3QXVA 3N9GL 4MVBD 2ICCA 2WM0A 4OIIL 4MNHB 3K2UL 3MRDA 4LCWB 5DMJB 3IFPB 4LCWD 5E94B 5ADOH 2EYTB 3O6LL 3VXSA 5I71C 4MAYA 5GGRB 4R3SA 5D7LE 4MQXC 4QRPA 1NLBL 1OT1A 1SQ2N 2VYRE 1JK8A 3DHMA 1J0ZA 3EGSB 4GRLD 2BVTA 1RUAH 1EXUB 1OM3L 3C8KB 2OR7A 3ZYIA 1EJOH 3QUZB 3TN0B 3Q3GB 3QUZD 4OKVA 3TN0D 3MBEB 4HKZB 5CMAA 3MBED 2P45B 5GS0L 5GZOC 4NGHH 3T0AA 5I76B 2ARJQ 5F7DB 2R1YB 1Y6KR 4HPYL 5D72H 1A6ZA 4UUJA 3HAEH 4L29B 1S3KL 3MXVH 4MXWL 1LEIA 5C0BB 3C60B 3L1OH 4CVXB 5C0BD 3C60D 3EOBA 5D1QA 3GHBL 3MRBB 4LCYB 4PB0L 1F6FB 1U93B 1A21A 3CFBA 3LPWA 1BGXH 3IDIB 4M93B 3I6KB 3RVXD 2ESVA 1L0XA 5DJZA 5IMKA 4GKZB 4LHJB 5JXEA 1I9IL 1UKSA 2OK0H 3W0WB 3EO0A 3W0WD 2GT9B 2WWMC 1BREA 3HZYB 4E42A 2D7TH 3S4SA 5EG6C 2H32A 2I9TB 4ODBD 5MHSD 3C87A 3GJFA 2OMBA 3HAEB 4O02L 1A2YA 1U3HD 1MWAL 4GAYA 2VL4A 3QIBD 4PJ5B 2HVJA 4PJ5D 5C0DA 5DFTA 2XKNB 1N3NB 4UV7L 1MF2L 2PCPB 3OKMA 4N8VG 1C16A 1NUDA 1QRNE 4BA8A 1CGWA 4W4OC 4ZFGH 4JFFA 4J3WA 1BQHB 1KB9J 3VFRB 4GKSA 4GXUM 4R7NB 4R0LB 4RFEB 5KVDL 2BZDA 3CK0H 1KIRA 5ISZE 4RNRA 4LEXH 2VC2L 1T7XA 3VE0A 1S7XA 2VLRA 3IS0X 1R5VB 8FABA 5DUPH 3RWIB 3BZEA 2YN5A 2FL5A 4J3OC 3RL1B 4E41B 2GITA 3BJLA 3H9HA 1G7JA 5GRXG 4E41D 5L8LB 2OQJA 3HI5L 3QAZB 4HZAA 4PJIB 3LN4B 4ODVL 1CIUA 1XR8A 1FJ1A 3VXNB 3VFOA 1H8NA 2HJKB 4H5SA 2XZZA 3MJ6A 1ZLWK 3RWFB 5B8CA 1ZS8B 3G6AB 5DJ0A 2GSGB 2XRAL 1C5CL 5F6HJ 2R0WH 5CEYB 4G6KH 4O51A 1GZPB 4PV9A 4K3DH 4MJIB 3RKDD 4MJID 3JTTB 3U1SL 5KSBF 4PJ7B 1F45A 5D1XB 5DC4B 2FJGA 4G6ML 4PRPB 5D1XD 1YEKL 4PRPD 3OKLB 4PRAA 4M1DL 5T5NF 3TLRA 3C6SB 3MV9E 1FPTL 3N50A 5BOPA 1CLYL 3UPAA 1Q9WB 1J1XH 2E6QA 4HJGA 2AGJL 5EU5B 1FZKA 3NCBB 1ES0B 3TH3T 5HYSB 5BZDA 43C9A 4YNYB 2ZOLB 3EYVA 4PRHA 1LP9A 2VISA 1J1PL 2BMKA 1HSBB 4QHLB 5BV7L 5DVKA 2VQTA 4QRQA 3RWJB 3BKJL 3VI4F 1ACYL 3KYOA 4MNQE 2XWTB 2XFXA 4OJFL 1XIWC 2YPLA 4X9FA 3NGBB 2ATKA 4QXUH 1IFHL 2C7UA 2L7UA 3BP4A 4I77L 5D7SH 3ZYOA 4MLSA 4PJGF 2HKHH 3MCKA 4PV8B 1S9WB 2QADB 2ZOKA 1NSNH 12E8L 3BQUA 5CS7A 2VDNH 2V2WB 3DVNB 4XNYH 1E4JA 1NQBA 2ADFH 5C07E 1KV3A 1T5XA 2XA8H 3QQNA 3IXAA 4U1KA 3MLRL 3UTQA 1FFQA 2Y5EA 3EHBC 4JJHA 2XN9E 5FYJU 3VGDA 1RZFH 1CR9H 1MCQA 2ICEA 3MA7A 5DYOA 3P4NB 5KTEL 4RZCB 5CLTA 3DMMA 1OL0A 5DO2D 3HMWH 2YEZB 1Q9OB 2YA2A 3UZEA 5CWSA 4HS8H 5EBLB 5HJ3A 5ICXA 1ZLVK 4HXAL 1BQLH 1J0HA 3ETBF 3LKPB 4X7DC 5FGSA 3UJTL 3WIHH 4GQ9L 4EJ1C 5IV2A 5I1AB 4U1LB 4M8QA 3BKYL 1CDYA 5F72S 5INDA 2P7TB 4GAJL 2VWEE 4XP4L 5CP7B 1AO7B 1GVIA 3R06B 1AO7D 4K9EL 5HYQB 3FZUD 4IDJH 4HGMA 3TCLB 3S36X 1LO0H 4KRLB 4M61A 1B0GB 2HLFD 1IGTB 1TVHA 3PL6B 4CADB 5FYKE 2FBOJ 3PL6D 4NQSB 2W60A 4EN3B 3LOWA 4H8WH 2ADJA 4WU5B 2Q7YB 4EN3D 1W0WA 5FYLH 1CF8L 2IPKB 1WT5A 3E6FB 3R8QA 1HQ4B 5HHQB 3H0TB 3OQ3B 5I1KL 3LKNB 2X4OB 4WHYG 5F1OB 4YHNA 3ZHLA 4JREB 5HYJA 2Z35A 4Z5RA 5J1AA 1MCEA 5IJKA 3IJHB 3W39B 3MO1A 4ELME 4XP6L 4Q2ZB 2MPAH 2JK5B 2VDKH 3V6FA 5E8NB 4NZDA 3REVB 1QFHA 2WBJB 2WBJD 3ZYJA 3O2VL 3FQNA 2VXSL 5FYLD 1P7HL 2AXHA 4HIJB 5HI4C 4MNGE 4HJ0C 2K1MA 3E8UH 4Z7UB 1DFBL 4WHTB 4MD4A 4JFYA 2Q8AH 1I75A 3BZFA 1CXFA 3S3PA 3RUGA 5IFHH 1NCDH 1QBML 2RB8A 3P73A 4KMQA 4WFEE 2FJHA 5IHLB 4JE4B 5ITBH 2AJYH 3AVEA 3GJFK 3QT2A 4FABL 5CBAA 2YR3A 5AYUH 1EAPB 1MCBA 4GAGH 4Y89A 1I3UA 2NY0C 3BP7A 2NW3B 3RVWD 5HVHB 3OF6D 5DS8A 3KG5A 3HUJB 4QXTA 3F62A 5IIEB 2WLZA 5E2WL 1YYMH 4HULB 2ORBL 2CDFB 3ARBA 3BEVA 1H3XA 3MRPB 3QDJE 5F89B 5BVPL 1HE7A 2FB4L 3B83A 5JW5A 4JKPL 1VFAB 1U8QA 4ZYKA 2B4CL 1A7BA 1TQBB 4CN4A 3V5DA 3PWLB 4ZSOE 3RPKA 1AXSB 2LABA 2G2RB 4EDXB 3G9AB 5DSCA 4IOIA 1R5WB 4HF5H 5D6CB 1CLZH 3GSQB 3FO2B 3D39A 1H8SA 2DM3A 4UMGA 4X4ME 4I0PC 1FE8H 3GMMA 3REWB 3QBTB 1TTGA 1UJ3C 2VAAB 3DUHA 5IQ9B 4OZGB 3MYJB 4NQUA 3WE6A 2EDYA 2HYMA 2V5TA 4Y5VA 4HLZH 5F3BA 1U8OB 3QO1B 5FEBA 5F8RC 4YPGB 5JMRA 1MWAA 3SKMB 2FZ3A 2DMBA 1OTSC 3DNKA 3WHE0 4RGNB 4G7YL 2P8LB 4XNZC 2RGSA 4RGND 4AIZB 2LVCA 4LLVA 2AV1B 4QHNA 1QFPA 3NACL 1K3IA 1MVFA 4OLZH 1VGEL 1DP0A 1YJDL 2G9HB 4RMUA 1MHHA 3VWKA 2HT4C 4JDVA 2XTJC 3UBXB 3U0WH 2E7HA 3ZKXC 1GAFL 2WQ8A 5CUSL 3ARGC 4HD9A 4CW1A 2DB8A 3OKDB 4OT1L 4U7KA 1IM9B 3AMKA 1IM9D 4ZO6A 4NP4L 5EC1A 3WYRA 2ED8A 3TJEL 4QYOB 1T1YA 5F9JA 5IEHB 3X14B 4LSRL 4BSVA 1J0KA 2CIIA 5FDYA 2OZ4A 4GG6E 2R4SL 3F7RA 4H88H 4KK6C 4O58L