1T4KA

Crystal structure of unliganded aldolase antibody 93f3 fab
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
DIQMTQSPSSLAVSPGEKVTMSCRSSQSLFNSRTRKNYLAWYQQKPGQSPTKLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAIYYCKQSYDLPTFGAGTKLELKRSDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN IGG1, KAPPA LIGHT CHAIN
publication title The Origin of Enantioselectivity in Aldolase Antibodies: Crystal Structure, Site-directed Mutagenesis, and Computational Analysis
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 217
sequence length 217
chains with identical sequence C
ec nomenclature
pdb deposition date 2004-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t4kA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t4kA01
5M95B 4KK9D 5CS7A 3BT2L 5IM7B 1X7QB 1CFNA 2JJWA 3FT4B 4ZUTA 4WIQA 3BP5B 1JPSH 4KHTH 2OR7A 4FQCH 4MGXA 1V7NH 2JTDA 4GAYB 5CSZB 5GGQH 4LBEA 1EIBA 2Z4QB 3C6SA 2EDRA 4QRRE 4H0IA 3LIZH 3WXWH 2YPKA 3EKCA 1Z0NA 2HMIC 1EAJA 3I6LD 3CSPA 1UZ6E 3IJYB 2DQJL 3WFHA 4MJIA 4PTUA 5IR1A 4QXTA 5CGTA 3AVEA 5DFVC 3MXWH 1SY6H 2MTPA 3O8XC 2FGZA 3EYVA 4UTAL 2UVEA 4Y4HD 5TDPB 5DS8A 2Y07L 2VZUA 5EWIL 2VQUA 4PLOB 3V7AE 4XCNB 4XXCA 5D7LE 1IFHH 3D0VA 4NQSA 5IJKA 3RGVB 5D1ZA 1GVIA 1G7MA 4K3JH 3QJFB 2ICWJ 5L2KB 3MJ8A 2VLRA 1CGVA 1FDLL 2WIIB 5JW3L 4LVEA 1NC4A 2NY0D 2X1XR 1FYTA 1X6NA 4FQIH 4GLRH 5T1LD 4YPGA 1WV7T 1J0YA 3U0TA 4P2RE 3LKPB 5E8NA 3TT1H 1NEZB 2Z0BA 2HT2C 4H88L 2VRAA 3W39A 4JO3H 5T1MB 4OT1H 5J4MA 1MJ7L 1KPVA 1JGLL 5I1DA 3QUZB 3BVNA 3K0WA 1UT9A 4X9IA 5DRZA 3PWPD 3SKOA 5GRUL 1NL0L 4N0RA 4OCMC 4U1GB 3EOTL 5EBMB 4M1DL 3FFCB 4WDIA 3VD5A 4C56B 5LBSH 4MMZC 2QADC 3B9DA 4M8VA 2ICCA 3MLVL 2XNAB 5BRZD 4WW1A 3P0YH 1CLOL 2VDNH 4JRXE 4F7EB 3PGDB 4KXZH 4LASL 5I1LA 2XZAH 5HXMA 4LRNL 3GGWA 1D7FA 4J2XA 3F65A 4OBSA 1U3HB 4QHNA 4I0CC 4NT6A 3ARFC 4NC0B 4JQXC 2PXYC 2X4TA 1WQVT 4G6KL 4N9GB 4X4XB 4PGBB 4YIQB 5TH2B 3MACH 1PJ9A 2HTKD 4OIIL 4XWOC 2EDTA 2FECI 2H2PC 3GRWH 2O61B 5I2IA 2W0KA 3TBWA 4X9HA 4CW1B 1I7ZB 3RRQA 1VACB 5FDYA 5I1CH 1FPTH 1XGTB 3VH8B 1UB5B 3SDCC 4D0DB 3UJIL 2HKFL 3GIVA 1CXHA 3FB8A 4QHUB 1U8PB 2YD7A 2IC2A 2DKUA 3OR7B 3VDAA 4PUBL 5J6GA 3U4EB 4NDMB 3TJHD 2W9EL 3S34L 3UPRA 2EE6A 4L3CB 3WDIA 1YDPB 2H2SD 1T5XA 3TFKC 4O4YL 1NMBL 1EMTL 3S97C 1CGSH 2BC4A 3FO1A 4GKNA 1Z9MA 1KTRL 4X6CA 5MHSE 1NJ9B 3N85L 3BKJL 4PJ8A 1I3RB 3Q6GH 1MWAA 2NW3B 4G6ML 1KF9B 3OSKA 4ZAKC 4POYA 1A2YB 3SKUD 5KANI 3U9UA 3BE1H 4DKEL 3QEHA 4GAJH 5IGXL 5MEPB 3RIAF 1JGEA 2K9UA 4FZ8H 5INDB 1JBJA 1FSKC 1T1YA 4LSVH 1B0WA 1FIGL 3HPJB 1JYVA 3HE6B 3VFGH 1R24A 4UILL 2XQYK 4J1UB 4ODWA 1RVFH 1OWRM 3JWDL 2VNCA 3ARDB 4HWEH 1HEZB 5HHVL 3OKNA 1ZANL 4JZOB 1CDBA 2BDNL 3C8KB 5TE4H 4Y2DC 3F7YB 4G6JL 3FB5B 2ADIB 4XB8A 5C0IB 3VFUB 1EXUB 4JHWL 5FOBB 4HIEB 1J1XH 2AGJL 35C8H 1KPUA 1MFAH 4BZYA 4TOYH 2DLFL 1DEEA 3MYJB 2LU7A 4X99B 3RTQD 1OF2A 4ZUWA 3GSRA 1BFTA 1T4KA 2ZUSA 3WLBA 1AY1L 2CUHA 4DTGH 3W9DB 5GHWL 4BFIB 1U8HA 5GSRA 2HA1A 1DBKL 3FO2B 3OMZA 5L7XL 3GMOA 3PHSA 4P5TC 1XFPA 3HHRB 5EOTB 2Q8AH 3ZZ1A 2H32A 5AD0A 1ZHKA 3GM0A 5BCAA 3VWKA 1KV3A 4G80B 4OKVA 1AGBB 4Z76A 2ATPA 4PJXE 2UY6A 4HK3N 3CFBA 4Y16C 3QWOB 4OUUA 1G6RA 5I9QC 1RIHH 4YK4B 3BQUB 3ARQA 1GPOH 1G9NL 2P5ED 3QUXB 3ZHKA 1I7TA 2Q6WA 2W92A 3MRKB 3SDXB 4JLRA 2CKBB 2G75B 2LE9A 4ZQKA 5C0BB 1AQDB 2ZCLH 1I75A 4KVCL 4P2QB 3BZFA 3QEQB 2R1YA 4L9LC 4ZODA 1GYAA 3DXAB 4WU5A 3SOBH 3SCMD 3KYOA 1WT5A 4PJEF 5CJQL 1FRGL 1YEGL 1GC1C 1E27B 2YN5A 4AEHL 3RL1A 1FGNL 3S4SB 3IDIB 2X4PB 3KGRA 3T0DA 1Z3GH 4MAYB 1F11A 5EH1A 5HYJB 4HS8H 1U8OB 1C08A 1Z9LA 4LP4A 1FL5A 2HT3D 5F6IC 12E8L 2K1MA 1WBXB 5DT1L 1N0LA 3F7VB 4XGZB 1DANT 4JFYB 2YOCA 4YDJB 4F58L 1A7QL 4URTB 3S3SA 5IHLB 1JPFB 1ETZA 1BIIA 4OAWB 4QRPB 4U6YA 3O2DH 4M61A 2IH1A 4UV7H 4N5ED 2DTSA 2MJWA 2F58L 3SQOL 1NUDA 1YMMD 4BKLA 3R4DA 4ZD3L 5FO8B 3IFLH 3KLHD 2IANA 4D9QD 4M7LH 1UJ3A 3TVMB 1PY9A 32C2A 4H5SA 2B0SL 4R4FH 2BVQA 3RGVC 1IGCH 1UKSA 4F9PA 2HT4C 4HGWA 2EKSB 4RIRA 3WO4B 4GKZA 1ROWA 5HGAB 3GJFH 3INUH 5SWZD 5HHXH 4PLNC 4O5LH 2W60A 1I9IH 1SQ2N 1QO3B 1GL4B 3O4LB 1ZA3B 3UDWC 4NN5C 1JZ6A 2X70B 3VRJA 3PGCB 4IHOB 1VEPA 2YPVL 1JNHA 3IF1B 1BD2A 4ZUSB 6FABH 1IM9B 2HFEA 3CFIC 4KV5E 2NY3B 3VJ6B 5GRVK 3JV5A 1JPGB 2DL9A 1HXYA 1A6AA 4LEXH 3MRRB 4PY7A 4ORGB 4U1GC 5GISH 2APBA 3LKQA 1IAOB 1NAKH 4GSDL 4ZUUB 1AO7D 2V2XB 3MLZL 1GGCH 5BW7C 1JWMB 5EIIA 4LCCC 4X7FC 4WO4A 5F1KC 1KCVH 3C8HA 2DQCL 3O81A 5I66B 1AE6H 3NCFB 4LCUA 1S9YA 1U3HC 4P2OC 1ZV5A 4KRNA 4MXVE 4PJDB 3UTTD 2XI9A 3L7FB 4Y4HB 1BM3H 3MFFB 4HWUA 2A6DA 4LLDB 2V9TA 2GK2A 3ARZA 4FQXC 4HH9A 2GT9B 4HGKC 1LO2L 2FJGA 4FN0A 3BPLB 4IS6B 2F5AL 5I74B 3HZYB 5T5NG 1LO4L 4P9ML 5D2LF 3Q3GB 2BVOA 1C8PA 4NNPH 3DX8A 3U6RB 4JJHA 4MXQC 4U33A 4K7PL 2O5XH 1UA6L 3PP4H 4ODXA 5MI0B 4JKPH 4LPYA 4FFYH 2GJ6D 3LS4H 1BQHG 3BEVA 2GFBB 4MQXD 1K2DB 3X3GH 4N0CD 1WVZA 2NY0B 5D5MF 3B2VH 1RZJH 3WN5A 4K07A 4UAOB 3QIUD 4NIKB 4RDQF 3K80A 4YXLH 4PFEA 2I26N 3DYMA 1D6VH 4OLYL 1PX3A 3HAEH 1WAAE 3TZVA 2YR3A 2VDLH 1D5XB 1HIMH 4PIRF 5E95B 3MRPB 3SDDD 3K4ZA 3KXFD 1FVCB 1TCRA 5GRYA 3PNWB 4RFNC 3PWPB 4UIMA 2EC8A 3A6OA 4GXVH 1F4YH 1EJ6A 2BY0A 3BZDA 4XP6L 3MXVL 5DVNA 4P46A 2XG5A 2ZUQC 4L8DB 2ADJA 5DJ8B 5IHZB 4G6AC 3VFVA 2IADB 2DQEL 4RSVA 4KKBC 1K4CA 1ND0A 1U8JA 2AXFA 2O93L 1DQDL 5BRZB 5DJYA 4YHML 4Q9BA 4LSPL 1TDQA 3JWOC 1KIQA 2WNGA 3FFCE 4PJAE 3ZKSD 1HINL 5C0EA 3EFDH 4DKAA 5DEGA 1LP9F 1MCPL 4D8PA 4HBCL 2AKRA 5E2VL 3IDJB 4YHPA 2I5YH 4Z77A 2V7NA 2EDNA 3A6BL 1QRND 5L8KB 2Z8VC 3TH2T 3ET9F 5K59E 2DQFB 3C6LA 4OLUH 4GW4A 1KT2A 4WEMB 5K9JH 5E4EB 3QISA 1KIPB 2VLJA 3VXSE 5K9OA 3A67L 4F7PA 3LQAL 5A1AA 4XMPH 5C07D 1N5YH 1E28A 4ENEC 2EO1A 2I60H 1YEIL 4ONFH 1QFWL 4CBPA 1T0NA 1LNUA 3IDMA 4KAQL 3NN8A 1XIWA 4NQXB 2OI9B 4GW1B 1T89C 4QOKA 4JKWA 4YEEA 3U7WH 3EJYC 1SMOA 5GZND 4FRWA 3HLAA 5BVPH 1JI1A 4PREA 3PDGA 4M5YH 4KJQD 2DQUL 4Q9RH 3L3DA 1PAMA 1R5VB 1MCOH 1S7TA 5DLML 5C71A 1OAYL 1LMKA 1AHWA 1QYGL 3HCVA 4HUKB 3N06B 4ZYKA 3QUML 3JTSB 1DL7L 3LSOA 4HLZH 4MSWA 1B90A 1UYWH 1XGPA 1QG3A 4LSUL 5TDNB 2EZ0C 5DVOA 2J5LC 1UM5L 3MGOA 1RJCA 1TTFA 3LKOA 5LAXB 3D39A 4LLWA 1BVKB 3VGAC 1MUJA 2AJVH 2ATKB 3QI9D 1QVOB 1XGQA 1IMHC 1GGIL 2IPUK 4W4NA 2GUOB 1U2HA 1UKTA 4O51A 1CLZH 3NZ8B 2EXWC 1XCQB 3LH2H 5H94B 5D7SL 1NCDL 2X4SA 5KG9A 4GQ9H 5IVXB 3DYPA 2NY2D 2FH8A 4JFEA 4YK4C 1EVUA 3CSYA 4AEEA 3CIQA 3QUXC 5ERWB 2VXSL 2OSLA 2JK5A 2WWKO 3BXNB 5F7KC 1FBIH 1NCCH 1HH6B 1J05A 4KMTH 3DPBA 3WIHL 4XX1E 2UZYB 1X9QA 3TWCH 3EZ8A 4KVNH 4ZS7H 4U1LB 1RZKC 1PGRB 3O3EA 4PJFA 5C70A 2MFNA 2DQHH 5I19L 4HFUL 4LSSL 4HJJL 1U3YA 5IBUB 5FDWB 2EYSA 3SE3C 3RU8L 4DGIL 5IF0B 1B0GB 3QO0B 1RMFL 5GS1C 1T0PB 3RI5F 4MAYC 3RTQB 3WNOA 5CKAA 5JLZA 4DW2H 4YBQD 2VDPH 4XBEH 3DBXB 4OD2A 4FQJH 1KB5H 2F19L 4BQCA 3MZTA 4XHJC 4RMVA 1FORL 1A6VH 1RD6A 4AMKL 4OF8A 5CAYB 2F9BT 5KSBF 2ZNXA 3VE0B 1BQLH 3GKWL 2VAJA 1TJGH 4Q6IB 2DI8A 3V6FB 4YFEA 2NY5H 1S8DB 5FO9A 4JVPA 4N68A 3HR6A 2V17L 5DQDL 4NWTL 2V2TA 2ESVE 1KG0A 1ADQA 4ISVA 4G7YL 5ICZB 4KY1L 1W72A 2VDQL 2FIKB 4X8XA 3OBAA 3G5YB 4LCWD 2J8UA 1WCQA 4P4KD 1W0WB 1OP5H 5JW4N 3WO4C 3WS3B 1YY8A 1TCMA 15C8H 1MHCA 2P5EB 4PJBB 4DEPB 5DQJA 4YDIL 4D3CL 3VXME 4NN6C 3OJDA 2AJZB 4ZXBA 3OXSA 2A6JB 2ITDB 5ICXB 3WIIH 5TDOA 4JFFA 4XVTH 5IEHA 2W0FA 3SCMB 1T03H 5C0BE 4KK9C 1GJIA 3FRPA 4P2QE 1T5WB 3QEQE 4Q74A 3PJSA 5IFAH 3C08L 4LAQL 5C2BH 3X13A 3DXAE 1EDQA 3IFNH 1QLFA 3IJHB 5EZIL 1LE5A 2VDML 1Q94B 1ZT4B 4JPIB 1T0MA 5EZOL 1NBVH 4PV9A 2FBOJ 3MJ9H 4X5WB 4S1DD 1WISA 2O5ZL 1PKQA 5C0FB 2OJZL 5I1JL 4IOIA 1TFHA 4JDZA 4JFQA 4BSVA 2P8PA 1YMMB 2APXA 2X1OA 5C8JA 3PQYA 4PJHA 3AB0C 3HNTL 2X1WL 3AUVA 3KYNA 4U1NA 2O5YH 4OGXL 4GOSA 2VB5A 4QRPE 1KNOB 1S5IH 3ECBB 1O7SA 5I74C 4JFDD 3QZWG 4FHBD 2E7MA 4L29B 5JW4Q 4HH8A 1UM4H 1EEYB 3NIDE 4GG8B 5MI0C 4WWKD 2F54E 5SWZB 2GSIA 3CCHB 4J3SA 1ERNA 3UYPA 2QSTA 2R0ZL 2NY0C 3VFWB 3IAGC 4G8FA 3U0PB 3QEUB 4NYLA 4KWUA 5T1DL 3Q1SL 4GMTH 1BVLB 3JV6A 4AIXA 4MDJA 4NJ9L 2I9LB 1HH9A 1HSBA 1MVUB 5GZOD 1ZLUK 1MQKL 2P7TB 4Q9QL 3O4LE 1I3GH 3KG5A 3Q0HA 5IESL 2ZOKA 3QG6A 4OCNC 5IG7B 4FXLA 1MH5B 3O11A 5DRWA 3UZEA 4EI6A 4I4WB 2JJSC 3BD5A 5B38G 5KVGH 1QD0A 4NZUL 4NM8L 4L3AA 5DWUL 4JPWH 1VFBA 1BD2D 4UT6L 3O6FA 3LRGA 4YHNA 3VXQB 4BZ2H 4P49A 4EN3A 4Z7WB 2DQIL 1N2RA 3L3JA 1GC1H 1HHIA 4AEIL 2ERJB 4ZUTB 2YKLL 3D87B 5HVGB 2ILLA 2AJXL 4IEFB 5KAQF 3UTTB 1H9VA 3QR2A 4Q9CA 3G6JB 3FMGH 4LBEB 1TXKA 3KR3L 3TNNB 1SBSL 1WWAX 1HN1A 2HTKC 3D2UD 1EO7A 3BPNC 3EO9H 1YYLH 4J3WA 4M6NH 4PJDE 1YYMH 3WUWG 5IB2A 3MRLA 2AJ3B 4JJ5B 2HFFA 2CDGA 5E00A 4Y4KD 3WFHB 4MJIB 5FHBH 2GJ6B 1KXVC 3SJVD 5CD5D 3MLWL 1JHKL 4WI2A 2IGFL 2KKQA 5ABDE 4YBLC 3BUYA 4PPTA 3QIUB 1P4BL 2EDFA 4FNLH 4S11A 2VQ1B 3BI9X 5HHPA 3V79C 1I9RH 1K4DA 3D0VB 1M7DA 4NQSB 4U05A 1Q9KB 3SDDB 3KXFB 2VL4A 1RV6X 3O2WH 5D1ZB 2P45B 1FNGB 1IBGL 5HDOA 5JIPA 2N7BA 2HG5B 5DDHA 3G5XB 4XNQA 3BIAX 5M7QA 2CO7B 2X09A 4OQ1A 5TPWH 4X7SL 3RA7L 1AKJD 3EDEA 1U0QA 1NC4B 5DEFA 1MIEL 5IB4A 1FYTB 5KSVA 1H3GA 4YPGB 3PWPE 4RX4A 3E6HA 3U0TB 1BZ7A 2DOCA 1GZPB 1OAUH 4BQ9A 3W39B 1A1NB 2FX8H 2XACC 3HMXH 5JO5A 3OXRA 2VR9A 5I1KL 1UB6A 5I1DB 3GEWB 1YJDL 4RAUA 5DRZB 3GI9L 1IKFH 2R1WA 3QG7L 1GHFL 3MLSH 3QNYB 5IB1B 4V1DA 1B2WH 1PVHA 2B1AL 2NCMA 3KYKL 2A1WH 3RP1A 1A47A 3LHPH 4KGLA 3FQUA 4HKJB 4U1IA 4R8WL 1QZ1A 2GTZA 4AQOA 2Z92A 3QDGD 3S37L 5ADOL 5I1LB 4ELMF 3JVGA 3VGGA 1QR4A 1TNMA 3MBED 4M1GH 5C07B 4P2YA 4JCLA 2FBJL 3RVWD 4QHNB 3WLWD 2OR9L 4HQQH 2WUBH 2XY1A 2BXYA 4HS3B 4DZ8A 1VGEH 1EPFA 3IXTA 3JWDC 3O3BA 2QQKL 4JFZH 4BZ1H 4Y5VC 3RTQC 1WLHA 2X4QB 1KFAL 3BPCA 4WUUA 4NZTH 3TP4A 3NMEA 3WV0A 2DJSA 2AXGB 2HH0L 3GMMB 4PYGA 2IPKA 4OV5A 1FO0L 4GAGL 5CJOH 2ED9A 3EDFA 1HKLL 3QXUA 5J6GB 3GMPB 1P6AB 4HJ0C 5EA0L 1LE9B 2UYLA 3SE9L 3MBXH 3CPLA 4KPHL 3QI9B 3UPRB 2AS5M 4XP5H 2WAHA 3MNVA 1T5XB 3C60A 1TNNA 5LKNA 4WCYH 2PR4H 1AD9B 1N26A 3ZLQC 2OJEA 4X6CB 1FL6B 4JN1L 1Q0XH 2YZ8A 4MWFA 4DEPC 4NCDA 5AZ2L 2QHRH 3L5WA 2ZUWA 3BESR 3MCKA 2DLIA 1T2QH 1MWAB 1GRWA 3JWOH 1F6AA 1IAIL 4EI5D 2A77H 5ID0A 1FGVH 3D25A 3U9UB 3SCMC 4QNPE 2Q3AA 4UIKL 1G9NC 4GMSH 1JGUH 4ODTH 2ARJA 3S36L 1CF8L 4IIQA 2VC2L 3UP1A 3T0ED 5ALCL 1RUQH 4Y7MA 5DHYB 4ODWB 4MNQE 3K1KC 4DKFH 3MLTA 2E27H 5C9KA 2HT3C 4LLYA 4RZCA 3HI5L 1NCNA 3HPLB 2UZIH 4DZBB 1ZHLB 2D7QA 5HSFA 1W0VA 1K5NB 1MJ8H 4MA7L 2LFGA 4IRJA 2GHWB 4N5EC 3IU4L 4R26L 3OF6D 4Y4FA 4JDVB 4GO6B 2R0LL 1A4JB 3VMPA 1OF2B 1AH1A 4ZUWB 3DO3A 4WHTB 5CEYA 1I85A 4J6RL 4YWGL 3HTLX 4RQQA 5ILTH 1YUHB 1P4IL 4I3RL 4EEEA 4HF5H 5ADPH 3QHZH 3DJ9A 5DURB 3VCLB 4MQ7B 2DQTH 3GMOB 4MJ2A 3TT3H 5AZEH 4R96A 2NX5E 2AI0L 4PJEA 1S3KL 3LN5A 1UCBH 1I3VA 2LU4A 3M8OH 4L8BB 3LB6D 4U1SB 1CFSA 5CMAB 5GGSA 3C9NA 3RWHA 2AABL 2P5EE 3OKYA 4NBZB 3CLEL 4Z76B 5J3HC 5GGTL 4WI4A 1TJIH 4AYFA 1G6RB 3LEVH 3RL2A 4QTIL 5E99H 3TIDA 4Z95L 5L6YL 1ZLSL 5B3NA 3P77B 3V8CA 3IFOA 1FL3B 3CH1B 3MLYL 4N9OB 5GGSY 4J8RA 2ICWB 2FDBP 2HLFD 1FNFA 1H5BC 3QCVL 1TJHL 1DBBH 3L3HB 1J0JA 4CU7A 1OB1B 4K94L 4HJGB 5CILL 25C8H 4PJCB 4JFFD 3MUGA 4WU5B 2XXCB 3KYOB 4N0FA 4WTWA 4RGMC 2AQ2A 1RPQA 3DVGA 4HMCA 1AQKL 1NUFA 4JREB 2PTTA 3ULVL 5EO1A 5K9KA 2G5BA 5C09A 3BEWA 3GSUA 2AEPH 5D1QA 1JF6A 1TZGL 3ARED 1T21A 1OWWA 5A3IC 1A9EA 1X5JA 2VSCA 1F2QA 5DFTA 3GHEH 1CGUA 1MCKA 3ALXA 4ZFFB 2MOVA 3IDGA 5AYQA 5JXED 1AD0B 4JFDB 3ULVD 4ZFGH 2L4OA 1MCCA 4KUZL 3B3IA 5INCA 3RWDA 3GNML 2GY5A 4G43A 3T2NL 5IB3A 1BIIB 4RBPH 4XPAH 4D9QE 1NGWB 4MQXC 3HC0A 4U6YB 4M61B 4N0CC 5C08D 2IH1B 3HE7C 1N8ZA 3QIUC 3VXNB 3DWTA 1QSEA 3LCYA 1AGEA 2KQMA 2XICA 1RZ7H 4BKLB 3FO0H 2N1KA 5SWZE 2AEQL 5BV7L 2IANB 5E94B 4XAWH 1UJ3B 3W9EB 1CXIA 32C2B 3SDDC 2K7QA 1KJ2H 3DUSA 4HGWB 4RIRB 4YDKH 3RWGA 5DD5H 2V5SA 1V3LA 4GKZB 1DQQA 4KI5C 1X4XA 2HKHH 1EH9A 1GCFA 1WEJL 3RY6C 1WFUA 1KXQE 2PUQT 5EU6A 4O2FA 4RAVA 1EJOH 5FA3A 1BD2B 3KWWA 3CXDH 4E42A 1YNKL 2MPAH 4OSUL 2X05A 4JKMA 4OLWH 3TCLA 3TESA 5F1OB 2CK2A 4P5KB 4RMSA 1HXYB 4I3SL 5F7DB 1RFDH 4PY7B 5CBEA 4HC1H 5CJXC 2EIDA 2LV4A 3LKQB 3EO1A 4Z7WE 3X12B 2FO4A 2M1KA 1EERB 3PHOB 4XWGH 2DIAA 3EYUH 5JW5B 3UTTE 1BFVL 3QPXH 5D5MA 1OAZH 3DSNA 3O6MH 2XWTA 2XN9D 4OZ4B 4Y4KB 2MQ3A 4YUEH 4LCUB 1S9YB 2A9MH 3E1F1 3QZWB 4NCC2 3SJVB 4I77H 1K85A 1V3JA 1MNUH 4X5XA 1NGXB 3AU1A 3TH3T 2P24A 4DGVH 3KPOA 4WHYH 3E0GA 4HWZB 4MJIE 2GJ6E 4Y19A 1UWGL 2BCKB 2JCCF 4P9HL 1M71B 3L3GA 2FJGB 1G7HA 2FD6L 4XNYL 3LQAC 3BSZL 4KJQC 1SHMA 1JMXA 4WFFD 3S96A 3BH8B 5B39G 4WFEE 1OTTD 1AKJB 1YNLH 2YBRB 2R56H 2BFVH 2CK0H 1LP9A 4OCXH 1N3NB 5FB8A 3PWNA 3NZHH 5D7IB 4MA3B 1YEKL 5D6DA 1WZ1L 3VFPB 4NHCL 1U8NB 3QI9C 2FB4L 4ESKA 2D0HA 1FYTE 4ODVH 1TCRB 1J0IA 4MCYA 1HHGB 4FQLL 2RIKA 3GBNH 1EHAA 1UZ8A 4OB5L 2ADJB 2DI9A 2NY2C 2Z8WC 3DI2B 5D6CA 3VFVB 4NPYA 5C0JA 3TBVA 4KZEL 1D5IL 3E3QE 5L9DL 2E7LA 4NKDB 4RX4D 2QSVA 4Z7QF 4LRIA 2EEBA 3QDGB 1KIQB 4OCYL 4ONHA 2YZ1A 4Y88A 2B2XH 43C9A 5C0EB 3MBEB 1P53A 1NL0H 4HUWA 1FNSH 1WITA 4D8PB 1KJMB 4YHPB 1JZ3A 4R90H 2Z93A 4X83A 1RK0B 1ZSDB 5I18H 1PQZA 3T2QA 4PP2A 4ODHL 4NQCA 5C07E 1N5AA 3C6LB 2WUCL 4OZFG 2GJZB 4GW4B 3FFDB 1KT2B 1DBJH 2OQJB 2W38A 3H9ZA 2VLJB 5HVFB 2ZCKH 2B5IB 4F7TA 5K9OB 4ZPVA 4XMKL 1KCRL 2YK1L 1DQML 4Y5YB 4LPUA 3IDMB 5DMIL 1PW3A 4V2BA 3CFEA 5F21B 3OJ2C 4YDVA 4KJWD 5KVMC 5DI8B 3GSWA 3KJ6H 5GGVH 5IKCA 4G9FA 4HFWB 1FO0B 4P4KC 1AHWB 1NGZA 3UJJH 3CFDA 3VXTA 4J23A 3QCUL 3EYSL 4L4VA 3LSOB 5DUBA 5H35A 1WTLA 1I8LA 3MQIA 4PS4L 3HZMA 1A3QA 1RIVH 4JG1L 4NFDA 3S34H 1MJJA 4PG2C 1PEWA 1INEL 5DEZA 5D7KD 1MRDL 4X6CE 5ACLA 4LHUG 1SYSA 1XGQB 3NAAH 5DMGC 2FWOA 4O51B 3C60D 1M1SA 4NO3B 1WWBX 3VFNB 1HHJB 2X4SB 3T0EB 1HHHB 1E4WH 3T4AA 4PG9A 3RJDA 2NTFB 4OTXH 3O2VH 1AR1D 2OSLB 5EN2A 3DUUB 2QR0A 4M7ZB 3T1FB 4QXGL 1DFBL 1J05B 4HCRL 4FQQA 4AENA 1N59A 1UM6L 2F8OA 5I1IL 1ED3A 1H8NA 3KPNB 4YXHL 4EUPA 3BD3A 4PJFB 5DUPH 2E6JA 3KPLB 1TVBA 4QXUH 5FFLA 4HWNA 4TVSa 2DLGA 5C2UB 2D7TL 4O58L 3AXLB 4JANA 5DJDA 2R4RL 4N0YH 2DBLH 3DIFB 2FJHA 4MZ3A 1KIUA 4NUGL 1WZMA 3KLSA 1ZANH 4YHKL 1MAJA 4OQTH 2VMFA 1BP3B 3O6KL 2QQLH 1M7IB 1MFCL 1FE8L 3LPFA 1WZKA 2H8PA 4WWKC 1PYWA 4IRJD 5FO9B 4Q2ZA 4OLEA 2YMXL 1DJSA 1XR9B 4Y4FD 1JN6A 4EXPX 5DMKB 1FLTX 1RI8A 1JNLH 3RBGA 5D96B 1W72B 4CU6A 4GBXA 5GZOC 5GHWH 3IXAB 1F5WA 1DVFA 3U30B 5DJ0B 3M45A 1DBKH 1KIRB 5L7XH 4LHUD 2OK0L 3MJ7A 1E6OL 2VR5A 5LCVL 5BVJB 1DBMH 2EDWA 4JG0L 3RUGB 4WY7L 5IBTL 4PBXA 3NCYS 1CZ8H 4JPKL 3UYRL 2N4IA 3MRMA 3OXSB 3D3VA 1KTKE 5JDJA 2E5EA 3A6CL 4POZD 5L2JB 4QHMB 1HCFX 4JFFB 3U36A 4MD4B 5IEHB 5D2NC 2GQHA 1A9BA 2Q3ZA 4IOSD 2J88H 4NRXB 3WFEH 4KROD 3F6LA 2YN3A 4X6DB 1TZHB 5FUCC 5C7XL 2JB5H 3L3OA 4PJCE 4KVCH 2IBBA 4KRLB 2RFXB 4I3GA 3AREB 3U0WH 1P9MA 3NIGE 4QKXB 2VSDA 5JZ7D 5I15H 5JHDA 1NMAL 5SX5H 5EU3A 4CMHB 3MZGB 1JGDB 1FRGH 4NKQB 2R2EB 3VGFA 4AEHH 3TIEA 4NQED 1HSAA 4LLMA 4Y4KC 1S7QB 4Y8DC 1ACYL 5H37G 5C09D 5HYIA 1JTPA 4JDZB 4ZTOL 5C08B 5CD5C 4JFQB 1VDGA 4LNVA 12E8H 5DT1H 2R2CA 1NAMA 2RGSA 1VPOH 3BKYH 1QSFD 4LCIL 1MHHA 5T3XL 2YRLA 3TC9A 4Y1AD 3TV3H 1OD7A 5AYUH 2ZJSH 3ROLA 2EYTA 4BK4A 1UWXH 1HWHB 3SDXF 5J9PA 1QQDB 3BAEL 4YR6A 1MCWW 4OI7A 2IANE 3SQOH 5J6HA 5FK9A 1P1ZA 2ZUVA 4TRPL 2NY4B 4DN3L 4ETQA 2VLLA 4Z7UA 5BV7B 4HWBA 4FQ2H 4G8FB 1X5XA 2YD9A 5T3XD 5E8EB 4FP8H 5DTFB 3DV6B 3JV6B 7CGTA 1BZ9A 3FT3B 1HSBB 5D1XD 3MRNB 5F8QC 5SWSD 1XCTA 5TGBB 5EORL 1C5BL 5BS0D 3LN4B 1LK3L 1Q9WA 1BPVA 3VG9C 1QNZL 4NKOB 1J5OL 1G7QB 5IT2H 4K7FA 5JMRA 4U31A 1RIUL 1BD2E 1KCKA 3SBWA 1FZJA 4LMQI 1YEHL 5JOEA 3GUTA 5EZJB 3T0AA 3V52H 1EV2E 5HHNB 1S9VA 3QXTA 1M7XA 2CIIA 2VXVH 3D18B 3MMEA 1JV5B 1L7TH 4EI6B 1R0AH 3OKLB 2CIKB 4MVBD 4FQ1L 4P3CH 3O6FB 1YJDC 4XCYA 3WFDH 2XN9B 3BKMH 2GIYA 4RISL 3MBEC 3OHXB 3L3JB 4Z8FH 5EOQH 1BBJB 4GFTB 3GSXB 3RVWC 3O4OC 1CL7I 1LO3L 4RGOL 1K9TA 4JN2A 3VI3F 3K3QA 3ARRA 3SGJA 5CIPB 5I8OH 4KHTL 1HXMB 4P23A 4B53A 3CU1A 3UEZA 4FQCL 2WBJD 2VABA 4RAHA 3SJVE 1MLBB 1V7NL 4HV8A 4OF5A 5GGQL 3VA2C 4MX7B 1FAIL 2A6IB 1OD9A 3STZA 4QXWA 1IGJA 3V6BR 2H9GA 3LIZL 4Y5YC 1D9KA 5KSAA 2Z35A 5CEZD 2IFFH 3D0LB 1DQJA 4UV4L 1JJUA 1LO2H 5EIVA 4Z0XA 3JV4B 3O41A 1QR1B 1LO4H 3T3PE 3DGGB 3DV4B 5CD3B 4Y19D 3MXWL 1SY6L 3SPVB 3GM8A 1ULVA 4K7PH 1D5BA 1R3LA 4QRUA 4AIOA 5FA4B 5ISZD 4UBDD 4G5ZH 4JCMA 3BPOB 2BVPB 3RX8A 1FAKT 2PCPB 4XNQB 1IFHL 4LVNC 2GW5A 3FO9B 3T65A 3G04A 3VFRB 2OBGA 5D7LA 2D4FA 4K3JL 5IB4B 5KSVB 4G8EB 3DROB 1FCGA 1T1WA 1BZ7B 3D85A 3CZJA 3BW9A 4JZJC 4R4BA 1IKNC 1RU9H 5MEND 4FQIL 4EI5C 4XP6H 3RWIA 3Q5TA 1BX2A 2O26U 3TT1L 5CJBA 3CNKA 2R1WB 3QDGE 4QGTA 5IMMA 2CLVA 4JO3L 4OT1L 4P2RA 1R3KA 2YC1A 3T0EC 1R5WB 2EKJA 4U1IB 2CDEA 4M7KH 4UU9B 1ZLVK 1F3JA 1HINH 4M7ZC 2PW2B 1OQXA 1HZHH 4CDHA 2GTZB 4L8SA 2R2HB 1UXWB 4LOUD 5LBSL 1U42A 4YO0B 4KKCD 3U9PH 2CSPA 3SGKA 4HX1A 3P0YL 2VDNL 3H9SA 1ZA6B 5TQ0H 4QRSB 2XZAL 1IEBA 1A1MA 2JLLA 2VLJE 4QCIA 3MGTB 1KYOJ 4DZ8B 4WW2C 2ADGB 4YLQT 3K8LA 1MI5D 2R8SH 3BP7A 3U48A 4JFHE 2JKXA 5ID1A 1I3UA 3GO1H 3MACL 4QOKE 1KTLA 5DVLA 1NBZB 4HK0B 2DM2A 4S2SA 2IPKB 4OV5B 4HUXA 2J7LA 5I1CL 3O8XA 1FPTL 1X5IA 3MREB 3NCEB 5C3LD 1S9WA 1KCUH 1OAYH 2EICA 5DHVH 4LPCA 2P49B 3V8OA 5D96C 4A6YH 3C60B 2WM0A 1C1EH 1S7RB 1TLKA 3REWA 2EH8H 4PJ5A 5JORA 3HR5A 4ZNCD 4NC2B 4ZO7A 5SWQB 2ZG3A 1I1YB 1A6UH 4MWFB 4XBGA 4QO1A 1CGSL 3MCKB 1GGIH 2VITA 3VGBA 1BHGA 3GMQA 3Q6FB 4FFZH 4EQ2A 1YEJH 3BMWA 3QIWD 5DO2D 1NCDH 2R2BB 5ID0B 1QFUH 3G08A 1OSZA 3Q6GL 1CL7H 1NFDF 4L9DA 1HI6A 2IPTH 5LGKA 5CHNB 5CKGA 4WWID 3BE1L 4GAJL 1XH3B 3EOBA 5HPMA 3P30H 1FJ1A 3AROA 1C16B 3AREC 4FZ8L 4PJFE 1XZ0A 4K94C 4H26B 4LSVL 5JNYB 2DWDB 1GOHA 2J8OA 4F9LC 1KELL 3VFGL 3OV6A 2WQ8A 1E4XH 3EDJA 5JXEC 2UWEB 4HJJH 2C7UA 5E9DD 3T2OA 2D0FA 4QT5B 1RVFL 5F96H 3QFJD 3ULVC 1W0VB 3V5HB 3I50H 3RU8H 4HDIA 5SX4I 1CXEA 3ARFA 4HWEL 4DFIA 4JQXA 1GZQB 2PXYA 2VOTA 2VWEC 3H9HB 4IRJB 3OJVC 1R3IL 4GAFB 4M9OA 4Y4FB 4TNVK 5TE4L 5HDBE 3HRZA 3BZ4A 1Y18A 1HOCB 35C8L 1JZ4A 4AMKH 1QFOA 1MFAL 5C92A 5CEYB 4TOYL 3S36X 1B9ZA 3HMWH 4HUVA 1CFTA 5F3HB 5IVXF 4LHUB 1YQVH 5CCKL 4K23H 3DX6A 3SDCA 4DN4H 4LFHG 5CGMA 2V17H 4BFBD 3LN5B 3HNVH 1OGAD 1VGKB 4DTGL 4KI1A 5BV7C 2HFTA 4J3VA 2W1NA 4WI3A 3T8XA 1I9EA 1RAMA 2YXMA 4EBQH 1H3XA 4JFPA 2Q8AL 2BJMH 4Z18A 5BZWA 1EO5A 4H1LA 4KROB 3UBXA 3T0BA 3UXFA 2WLYA 5TQ2H 2FJFB 1J0KA 3OGCA 2EYRB 4JFFE 5EU4A 2XKSA 4V2CB 4TPRH 3EFFA 5GSVB 5F9AC 1U8IB 1J8HD 3SEPA 4J8RB 2P5WA 1RIHL 4X6DE 3THMH 2WLZA 1GPOL 3WFBH 3D48R 1UADC 1U93A 3DX9A 3LEYH 3MUGB 1N64H 4NQEB 3K81A 2ZCLL 3V4VH 4OM0H 2VN4A 3CX2A 2X40A 2BNQA 2R29L 2PTTB 3W0WD 5EZIH 4NQTA 4QHKI 2G5BB 5C09B 1JGVL 3SOBL 3GSUB 5D1QB 2Y72A 2ORBL 4XP4H 4KTEH 1PKQE 2EIZA 1VFMA 4GKSB 5I8EA 1M05A 4FABH 3PE9A 3RY5A 1QSFB 2VWEE 1Z3GL 2FECL 1J87A 5C08E 2YPLA 4Y1AB 4DVBB 4LSRH 5DK3A 4R3SB 1J12A 1MFDH 3GMRB 4PJBF 4HS8L 3IDUA 1OP9A 5HD8D 3HZVB 3HG1A 3GSNH 4XPHL 4K3HA 5IVZB 3RWDB 4RFOH 4G43B 1OTTC 1SJEA 3B5GA 1CD0A 3HC0B 4ODBD 4D9RE 3QQ3A 2FL5B 1I7UB 1MHEA 4OGXH 4P9HC 1F3DH 1QSEB 1DQTA 2Z91A 4ODUB 3OG4B 4JHZA 2LTQC 4U2ZA 5SWSB 5BS0B 3O2DL 2GI7A 4Z78B 2VZVA 2VKWA 2WMPA 2XWBA 4OZHB 3DUSB 3K8KA 3RWGB 3IFLL 1D3CA 4M93B 1DQQB 4PRBB 5FYKL 4M7LL 4Y5XC 1GOGA 4GRLC 4ONGH 3MRGA 3QPQC 4R4FL 2BNUA 2JE8A 3VXPA 4P5TA 3KPRA 1QHOA 3G5VA 4L4TD 3S5LG 4ODSH 3W82A 3EO0A 3VU2A 3ZYIA 4Q9QH 4RAVB 3ROOA 3INUL 5HHXL 1OAXH 4O5LL 4ACPA 1RZ8A 5HGHA 4JKLA 4Y16A 3VRIA 4BQ6A 3E8UH 3PV7A 6FABL 5CBEB 2CLZA 3AS0A 5D2LB 2W91A 4XAKD 3MFGB 3SY0A 3BH9B 3PIQB 4NZUH 2FO4B 4LEXL 1DDHB 1ZTXH 2DQIH 4PRNA 5I1GH 5CP7A 5D5MB 5GISL 4UOW0 4L9LA 1NAKL 2H6PB 2OZ4H 1EAPB 1P6FA 1GGCL 4MD0B 5DQ9B 5SX4H 3N1MC 5F9JA 4ONOA 5ESVB 5IM7A 1X7QA 3KR3H 3G9VA 3FT4A 2IALB 4I18B 3R1GH 2VJXA 1D5MB 3BIBX 1AE6L 4GAYA 3GSQB 1RUMH 4Y19B 5GJSH 3DRTB 1CLCA 2OS7A 1G7HB 1BM3L 5ISZB 1MCQA 3SKMB 1QTYT 3RZWA 1JK8B 3VWJD 3LKRA 4PD4K 5GRJH 3FCTB 1P4BH 3FN3A 2ZNWA 3IJYA 4NNPL 4LIQE 1CR9H 1LP9B 2O5XL 5F93C 1UCTA 3FAXA 4Y8AA 1FNHA 3PP4L 5TDPA 3V6OC 4JKPL 3IRZA 3VA6A 4FFYL 3LS4L 4Z7WF 1DLHB 4W4OA 1I8IB 3B2VL 1RZJL 5MENB 4XCNA 1LDPH 3RGVA 3ZE2F 3K7UA 3G6JF 2EXYC 4UINH 2VDLL 3BP4A 1NBYB 5L2KA 1HIML 1T83C 4U1MB 4XNZC 3PWLB 5C0DA 1LDSA 2WIIA 5D6CB 4NPYB 4U1JB 4MAUH 5HI4D 4YZFF 3UDWA 3FRUB 4GXVL 1JYWA 4V1DE 5KOVC 2AW2A 2QBWA 1ZLUH 5B4MD 4Z7OF 5I1KH 5GS3A 3ZKQD 1UC6A 5DHXB 4HUNB 1NEZA 3GI9H 3WDJA 1OSPH 2CD0A 5K93A 3RDTD 4HUWB 5SV4A 3QT2A 4HLZG 4GXUN 2FATH 3QUZA 2Z93B 4ELKA 4HXBH 1KGCD 2R4SH 2AQ1A 3EFDL 1NMCC 1PQZB 3FFCA 3ILPA 3S37H 4NQCB 3WFZA 1MI5B 5EUKA 2MCPL 4F15B 1ZKAA 2I27N 4C56A 2CKNA 1XF1A 2I5YL 3MRHA 2Q8BH 5BW7A 4NHUB 5IWLC 2XNAA 4LCCA 4PLJD 3CFCL 4JO4H 4KI5F 5DD3H 4F7EA 3F5WA 3PGDA 4F7TB 1U8KA 1Z5LB 4OLUL 4OZIF 3FRPG 4AM0A 2MCG1 3VFSB 5DR5H 1F02I 5K9JL 1U3HA 3V0AC 4F80A 1P69B 2QQKH 3MODH 4J4PA 2PNDA 4WUUE 2EDLA 2FGWH 2FIRT 2IBGA 4N9GA 4X4XA 4YIQA 4PGBA 4XMPL 3DECA 5TH2A 1OAQH 4PGJA 1N5YL 4ONFL 4FQXA 4KK5C 3ZE0F 2O61A 3K74B 3MA7B 1MOEA 2P44B 2KZWA 4WFHD 3ARGD 2F5BH 3U7WL 4CW1A 1I7ZA 4FQHB 3OX8B 5HYSG 3CFDB 4GAGH 5BVPL 2HMID 1IC7L 5D7KE 5L88H 1XGTA 4M5YL 5DUBB 3VH8A 1UB5A 4D0DA 5EA0H 5F7HA 1IL1A 4Q9RL 3ALWA 1MCOL 3HZMB 4JY4B 1AFVH 1OTUC 4LLQB 1U8PA 5DC9B 5HVHB 3OR7A 3KPTA 3QXDA 4XP9H 1OLZA 5ALBH 3W5MA 4MA1C 1QBLH 2BOBB 3WO3B 1QKZH 1UYWL 3U4EA 1EGJA 2MWCA 4TUKH 5T5NF 3QIWB 4PJGF 3AY4C 1YDPA 5DJXA 4J3OC 2AJVL 4KROC 4OF6A 5AZ2H 5CP3H 1C12B 3CFKB 1S7VB 2X4UA 1AI1H 1NKOA 3FOMA 4EDWL 1CLZL 4PG9B 3LH2L 1NJ9A 5KSBB 2QR0B 4H8WL 5DA0B 2X9XA 1INDH 1Q8MA 2PF6A 4GQ9L 4FQQB 4AENB 2ZP0T 4U6XA 2HT2D 2W9LA 5E9DB 4TUJB 4YFLF 5BO1H 1V7MH 3QFJB 4EUPB 1NCCL 3FT2B 4KMTL 4UT7H 5D7JD 5MEPA 2NXZD 2QLVB 2R69L 5INDA 3U1SH 5I75B 3TWCL 1G7JB 4KVNL 4ZS7L 3ZTJH 3HPJA 2DQHL 3EGSB 2C4XA 5J7CC 5HDLA 4U6TA 4J1UA 3HI5H 3F62A 2P46B 1XMWA 5JPNB 3HS0B 2D7PA 3DARA 3ZE1F 3ARDA 1J18A 4MA7H 4X80H 4JZOA 1VADB 4DW2L 3QUYD 4NC1E 4XBEL 4ZUVA 2HYMA 4FQJL 3B2UC 3IU4H 1KB5L 2APFA 2DJUA 3FB5A 2NXYD 2ADIA 2W59A 3VFUA 5C0IA 1EXUA 1PYWB 1DBAH 4RRPA 3P40A 1NFIB 4XP1H 2AK4A 3OAUL 1T7WA 4PRPD 5C86A 1BQLL 1PG7X 1OCWH 1TJGL 2YA0A 2HTLD 2XT1B 3MYJA 4X99A 2NY5L 5D1XC 1H15B 3IU3B 4PJEE 1DVFB 2BNRA 2J6EA 3GB7B 3MJ7B 3UTSD 1A6ZB 4HBQA 4M93C 1PY4A 3VD3A 3W9DA 5FYJE 3ARSA 3FO2A 4JGJA 1MJUH 1J8HB 2AABH 4NUJA 1DZBA 3MRMB 5A2LH 5J1TC 4M7JH 1K3IA 5EOTA 5GGTH 2X89A 4MVBC 3U36B 1AGBA 4AQ1B 3OAZK 5T33H 2FZ3A 5I76B 5LGJB 4PB0H 1DANU 4BM7A 3W0WB 2DKSA 3QWOA 3WIIL 1TQCC 4UDUB 4XVTL 3L3OB 1T03L 3HUJF 1XF4B 1O5DT 3BQUA 1TJHH 3QUXA 4U1HA 3NFSH 4K94H 1X5YA 3MRKA 3SDXA 2CKBA 3J7HA 2G75A 3NPSB 5C2BL 1OOAA 1AQDA 2XWJA 5C09E 2WBJC 3U46B 3F58H 4P2QA 4YHLH 3IFNL 4ZAKD 3MCLH 3MLPA 3QEQA 5GXBB 1XT5A 1HSAB 2P1YA 3DXAA 5ANMB 2XYCA 3PL6D 3E2HB 1QSFE 1E27A 1U58B 3MJ9L 5DD6B 2ENYA 3SE3A 4I18C 3S4SA 3IDIA 5GS1A 4BK5A 4MAYA 1NAMB 5HYJA 3RIFK 3VDBA 1U8OA 3IRPX 3GNMH 1OGTB 4JY5H 4UBDC 4RFEA 1WBXA 5T3XE 1CI5A 4XGZA 1QSEE 3F7VA 3FQNB 4RMWA 5GGRA 5IQ7H 3MO1A 1ODAA 1A6WH 1KPRB 2O5YL 4JR9H 4YDJA 4O2EB 3EJZD 2RJMA 4Y2DD 2V5YA 1S5IL 5J6HB 3T77A 4ETQB 2VLLB 4YGAB 4QRPA 1B88A 1UM4L 2HVKB 2AEQH 4L4TB 4OZHE 2E7HA 4PJCF 3ULUL 2ZG2A 3NCBB 4S1QH 2DAVA 1JL8A 2LVCA 5FO8A 1Q9WB 2JJVA 1I8MB 5GGRY 4K7FB 1QBAA 4UQ2B 3MUJA 4GMTL 1J1PH 2N56A 1QFPA 2EKSA 4KHXL 4IMLB 3GJFB 5CZKA 5DK0B 3T2PA 2YD6A 4C55A 2JJTC 5IW6A 1I3GL 3MROB 3BIKA 1S9VB 2CIIB 1QO3A 1QOKA 3O4LA 1ZA3A 4J3UA 3NVQA 1YN6B 4XCCH 5D2LE 4UI2A 3EOAA 2ID5A 3PGCA 5HHME 1ZWIB 5IEKA 4I3SH 3IF1A 4LOUC 2VYRE 4ZUSA 1IM9A 4KKCC 4WU7B 3I02B 3LKNA 1K8DA 2H45A 3L1OH 4HIIB 5KVGL 3VJ6A 3F12B 3V4UH 3QSKB 3QO1B 5EO9B 1JPGA 4GRMB 5D5ME 4BZ2L 1FNAA 3MRRA 2ZCHH 4ORGA 3ZT5A 3ZO0A 3RZCC 4CGTA 1IAOA 4ZUUA 5CEZE 3VGHA 1JWMA 4HV8B 1KLUB 3TYGL 5D8JH 4CVUA 4Y19E 3MV01 2H9GB 5I66A 1YYML 1QEWB 1XAUA 1DQJB 5GRXG 4P9HH 4N1HB 4PY8I 2A74A 1IC5H 3L7FA 4Y4HA 3MFFA 5KW9H 3PXJA 1BJ8A 5FHBL 4F7MA 2CUMA 3WJLC 3S5LB 1R3LB 4ZDHB 5FM4A 3EHBD 1LP9E 4IS6A 4B7LA 3HZYA 4FNLL 3Q3GA 5F97E 4XRCB 3U6RA 2XOTA 3S8WA 4ELMB 3T65B 3OB0H 1J11A 1XF5A 2GFBA 2BSRB 4NZDA 4OZGF 5HVHC 5T1LA 3D85B 5TPWL 3MOAH 3BW9B 3QQ9C 2BP3A 4R4BB 3NA9H 2F74A 4U6VH 4W6XB 3HAEB 1P7HL 3QIWC 3RDTB 1A7PH 1D5XA 3MRPA 4N0UB 1FVCA 2E3VA 1OAUL 2HT4D 1MCFA 4KZEH 2FX8L 3PWPA 1EHXA 3KS0H 4BSWA 1BF2A 1ZHBB 4L8DA 5DJ8A 1IKFL 3K46A 3MLSL 3LOWA 1F3JB 5KJRL 3WHE1 1B2WL 5C0AD 4PRAB 5L0QB 2JJSA 5BRZA 2A1WL 4KQ3H 4LGSB 4L8SB 3LHPL 4TNVF 4ZG1A 5JOFB 4OCRH 4RA0C 2BY3A 4NQCE 1MI5E 2XTJD 3H9SB 3ARUA 1GGUA 5DZLA 3I75B 4QCIB 5D7IF 4H0HB 4NQVB 4TQEH 4M1GL 3AMKA 2G2RA 1NLBH 5BQ7A 2DQFA 3KLDA 4L3ED 4HQQL 2WUBL 2CQVA 2UVFA 4XT1C 3ARGB 1J8KA 1VGEL 2HRLA 3B9KD 4HIXH 5JHLH 3CDYA 1T6WA 1KIPA 1UGNA 4MB3A 1VESA 2CXKA 4JFZL 5DMIH 4BZ1L 1U6AH 1L0YA 3JZ7A 3OWEA 4HUXB 2NY7L 4P2OD 2XA8L 4NZTL 4NO5A 3O8XB 3T4YA 3EW3B 5ACMA 1NFDA 4NQXA 1ZLWH 2YHGA 4GW1A 4L4VE 1R3JB 1S9WB 1EZVY 1NDGA 5CJOL 3ZDYF 3BGAA 5IBLD 3EYSH 4LDLB 1T1ZA 1SVZA 3ZDXF 3MBXL 1KEML 3CZFA 1CLYL 4JVUA 4XP5L 5JORB 4NCC1 1OY3B 3JTSA 1INEH 1EFQA 3UTZA 1MRDH 2Y36L 4WCYL 3HA0A 2PR4L 5ESAB 1ACZA 4E0RB 2VERN 1Q0XL 4W68A 3EDDA 4ZPTB 5LAXA 1BVKA 2X5PA 2QHRL 4OZFH 2ATKA 4F37F 1QVOA 5KSBE 2E8YA 4YGVB 2GUOA 1DN0A 2APVA 3JWOL 3MPCA 5D7JB 3NZ8A 2XRAH 1A3LH 1XCQA 4NRYB 5H94A 5EU7C 3H7LA 2A77L 4LLVA 1FGVL 4HCRH 5HPMB 5IVXA 4I9WD 4GMSL 1JGUL 4LARH 4ODTL 5I0ZA 3UC0H 2Y25A 3BXNA 4IDJH 3VFMB 5FYJU 1RUQL 1HH6A 4EJ1C 4D2NA 2VL5B 1IGMH 2ITCB 2Y9RT 4DKFL 3QUYB 5HD8C 1JHTB 3DNKA 2P47B 4U1LA 3DO7B 1UJTA 2PXYB 5C0CD 2NXYB 4WV1B 1U95B 2ZUXA 2UZIL 5FDWA 5EU5B 2J3SA 3H42H 5B21A 3I3DA 4PRPB 3HRZB 5IF0A 1CXFA 3QO0A 3BZ4B 1MJ8L 3KYMB 3RTQA 4LDEB 2GKIA 3QEGH 1RY7B 1KB5B 3OR6B 1MFCH 1YA5A 3O3DB 4TVPE 4UNVA 3SDCB 1NCBL 3UTSB 1IC4H 3BDYH 2YXFA 3TN0D 4ENED 2YMXH 2VXTH 3VE0A 2KPNA 2FX9H 3LRHA 1IJ9A 4FMFA 4YDLC 3GMNA 4Q6IA 4HF5L 3V6FA 2P43B 5ADPL 1S8DA 3JTTB 3QHZL 1G9MH 5IFJB 2DQTL 3LEXB 4KGJA 5AZEL 1F8TH 3M8OL 4PYHA 4JFPB 2FIKA 1J8HE 2BNRD 3VXOB 3G5YA 4KMQA 4WY7H 2DN7A 5JMOC 1W0WA 3BWAB 4WW2F 2R9HD 2VXUH 3OGCB 3WS3A 4R0LC 2Q87A 3HZKB 3RWEA 4PJBA 3MA9H 4F57H 4LEOB 4JRYD 5F7EH 3QP3A 5E99L 5CBAB 1A7NH 1PEZA 3W0WE 1PKOA 4G9DB 1P7QD 4JFOB 2AXHA 4GLRI 5I1AB 4ZAKB 2A6JA 2ITDA 3LS5H 3DX9B 2LAAA 3NH7L 1YEEH 3SCMA 5C7XH 5JHDE 1D6EB 1WZLA 1DBBL 2BNQB 2EXWD 3PL6B 5BOZG 2QQNH 3V4PH 1G0DA 1ORSB 25C8L 3QXAB 2XZZA 1WFTA 1YPZB 3BZEB 1YNTA 2EIZB 3IJHA 3CUPA 3ZHDA 5I8EB 4EVNA 1Q94A 1M05B 1ZT4A 3SE8L 1T04A 5HY9B 4Q0XL 4XNMA 2AEPL 5F6HI 3PDDA 4OKDA 3VRLF 1JUFB 4N8VG 3RUGF 2Y7QA 4HD9A 2PTUA 5A2FA 4ZTOH 5T1KD 5MP6H 1NGYB 3VWJC 5JOPE 5KBNC 4Y2DB 4PRHD 3QXWA 5C0FA 4JM2D 3QQ3B 4CVXB 1MHEB 1L4IA 4DCQB 4LSTH 4JY6A 1XIWC 1YMMA 2DLEA 4XC1H 2EDQA 1H8SA 3GFUA 4P59H 1AGFB 4X0KA 1KNOA 2FEDD 3ECBA 1RZ7L 1ZGLB 3FO0L 3FTGA 5EZLA 3GJEA 1S7UB 4YHZL 3VW3H 3P4LA 3KHQA 1AJ7H 4GG8A 1EEYA 4D0BB 4XAWL 3MRGB 2JELH 1KJ2L 5SWZA 3CCHA 3KPRB 3QDMD 2HJKB 5HI4C 3UTQA 5DD5L 3IKCB 1LK3H 4JRWA 2HKHL 3VFWA 3ULVF 3EO0B 2B8OT 2EH7L 3U0PA 3QEUA 5B4MC 4K2UL 5DFWH 5LG1A 5ENWA 1BVLA 1OLLA 1RZ8B 3P2TA 5HGHB 1S78D 3RDTC 2C1OA 4Y16B 2P7TA 3QA3A 3VRIB 3WS6C 2JCCB 1YEHH 4XPFH 4GT7A 2Y6SD 2CLZB 3CXDL 4HZLA 2MPAL 4OLWL 3K1DA 1BF8A 5A2JH 3CMGA 5IG7A 4IM8A 1AO7A 4HC1L 1MH5A 1H5BA 2GAZB 5HDQL 5CP7B 4I4WA 4ZOCA 1IVLA 1ONQA 4L9LB 2Z31D 3LVEA 4R7DB 2CJUH 4XWGL 1IEAB 3EYUL 4Z7WA 2F15A 4XCEB 5F9JB 3QPXL 4OBRA 4IRSD 4PGDB 4QF1A 1QPXA 3ARBD 1WFOA 4DVRH 5HYQB 2BVYA 1OAZL 1MCRA 3O6ML 1OPGH 3UTTA 1L9MA 4YUEL 3PHQB 3V5KB 3G6JA 2A9ML 3TNNA 4I77L 1FAIH 2QSCH 3TO4C 1MNUL 4DGVL 5F6IB 4TN9A 3ARGC 4JB9H 2D7NA 3E6FB 3BMVA 4I8DA 3OKKB 3LKRB 2AJ3A 4JJ5A 4HKXA 4UV4H 4PR5A 2I24N 4M6OH 3MC0A 2GJ6A 4LLUB 1CICD 4F2MB 2FO1A 3JUYA 1KB9K 3NCCB 1EBPA 3QIUA 1T2XA 1YNLL 4GXUM 2GJJA 2APWA 1FFNB 3ZKNC 4ELME 2R56L 2VQ1A 2BFVL 1AXTH 2CK0L 4OCXL 4R4ND 3I2CH 2WZPD 1Q9KA 5AG8A 5EBWA 3NZHL 3SDDA 3KXFA 2COQA 1FNGA 2HG5A 3BP4B 3G5XA 2FYYB 4X98A 2GYSA 4ODVL 5C0DB 2OP4H 3RY6A 2YRPA 1YEFH 4OZIA 4N0UE 5FUOH 3SDYH 5C9JA 4NN5B 3GBNL 3OZ9H 3H8NA 1ZVHA 1KGCE 3KPPA 4K7PY 4L4JA 1MWAH 1GZPA 4ZXBC 1IQDB 1MRFH 3BO8B 1A1NA 1CS6A 1EEZB 1VHPA 2XTJB 3EOYG 4M6MH 3KJ4C 2Z9TA 5JW4R 4QWWD 5D7JC 2NXZC 4EQ3A 1X5ZA 4ELKB 3QNYA 5IB1A 2B2XL 4GW5B 3PUCA 5CJXA 2EO9A 4H8WC 1FNSL 4HG4J 1QRNA 3ILPB 1EHLL 5EUKB 3H9SE 3P11L 2FHFA 4HKJA 1INQB 1JFQL 2H1PH 3MRHB 4R90L 2BY2A 4ZMAT 4LCCB 5I18L 2G5RA 2WK2A 3F5WB 3B9KB 2R0KH 3O3AB 1U8KB 4HZAA 1NKRA 2CUIA 5DA4A 1F3DJ 4AM0B 3NA4A 3QUYC 1LO5B 1DBJL 5C07A 5JQHC 1AR2A 3UYOD 1CE6B 5FKPB 4P2OB 2ZCKL 3S35H 3CXHK 4PJGA 2NXYC 4DGYL 2EDEA 2YSSB 1T20B 4WV1C 1N4XH 4BELD 3L6FA 4HS3A 4FQXB 2R15A 3SHSA 4ZFOL 5ITBL 3SGDI 2HTLC 5ICYB 5B3JF 2X4QA 3AS1A 2WSKA 1BZQK 3AAZA 1I1RA 4S10A 5L8JB 2AXGA 3O45A 3KJ6L 1IL1B 5GGVL 4B41A 5F3BA 3GMMA 3GI8L 3LKSA 4KFZC 3UJJL 3QXDB 3GMPA 2AJUH 3X17A 2NY5C 43CAB 4ALAH 1LE9A 4PJ5E 3GJFK 1RIVL 2H32H 4MYWB 3U79A 3QI9A 4LCYB 2IH3B 4N1EA 4NBYB 3UZVB 3QUMA 5DJXB 2GCYB 4RFNB 5EUOF 1A02N 4G7VH 3FKUS 2UUDH 1G6RH 2X4UB 3NAAL 3PDOB 1AD9A 2ZUQB 3FOMB 3WEXB 1K6QH 1FL6A 3IB4A 3RQ3A 1QFHA 1MF2H 4U6XB 1CTOA 2CDFA 2OTWB 1E4WL 4K8RH 4W81A 4OTXL 3O2VL 3MV7D 3QDJD 3MOBH 3RIFF 4KKAD 2HP4A 5HYEA 3PL6C 5C0CB 4EN3C 5J06A 1YEDA 2D2OA 4UNUA 4XMLH 5E6YA 4UZGA 4XXDB 2G9HB 3GBLA 5DUPL 3SQBA 1KELH 1I1AD 3WIHA 4QXUL 5DHYA 2E7CA 4YC2C 2J4WH 4X7EC 3I9GH 4QLRA 5DD0H 2VLKD 2Y4SA 4HEPG 1W8NA 4N0YL 5T3ZL 2DBLL 2D7MA 1MIMH 2BSSB 3M07A 4PRPE 3HPLA 4ZFZA 4ZUVB 4DZBA 1ZHLA 1R3IH 4WGWB 3UX9B 3DOSA 3EJZC 5BXFB 3JWNC 1FFRA 1K5NA 4G8IA 2F8XC 3CMOH 4OQTL 2KZ1B 2AK4B 4PGCB 2QQLL 1BWMA 4NO0D 2XZCH 1LEKB 3QCTL 4JDVA 4NP4H 3IGAB 5CZVH 3UZQA 5CCKH 1A4JA 2BNRB 4WHTA 4XPGL 4LCWA 4LPTA 3CU7A 4JM4L 1FNEB 4P4KA 1JNLL 1YUHA 5E24E 1X4YA 1NSNH 4M8QA 4P0DA 1MCSA 3SN6N 2J5LB 3VCLA 3ULUC 4MQ7A 2VR4A 4NUJB 4JRYB 1AGDB 4HJ0D 3UMTA 3D69B 3HI1A 2UWEF 3QWRA 1DBML 1P7QB 4QHKJ 4L8BA 3FONB 4OD1H 4U1SA 5CMAA 3VGAB 1VA9A 1CZ8L 5FHAL 2M2DA 3MRIA 2XQBH 3IFPA 2KUTA 3ISWA 3MV9D 2V6HA 2FZ3B 2P5WE 1REIA 2PYEA 2P8LB 2VXQH 4OLZH 3MTRA 3V7AG 3P77A 5IJVB 3C2AH 3KPSD 5D70L 2J88L 3NCYP 4U1HB 3WFEL 1FL3A 1DUZA 3CH1A 5I0DA 2BNQE 3BN3B 4AJ0A 1X6LA 2JB5L 2XWJB 2EDXA 3T09A 2ICWA 3PWJB 2R29H 3L3HA 3U0WL 1OB1A 5DJ6B 2CH8A 4HJGA 1J0HA 3WNMA 4PJCA 5I15L 2EEAA 5T1KB 1JGVH 1BFSA 2QJDA 1X5LA 2DIJA 4PRHB 2PYFB 2ORBH 2YPLE 5A16A 3MNZB 3EIFA 1S5HB 3HG1E 5GS1B 4N90D 3SGDH 1EO8H 4GRWF 1J1OH 3RNQB 5DXWA 5KSUA 4XPHH 4ZFFA 3EHBC 4FS0A 4M43H 4RFEB 1AD0A 4JFDA 5GGRB 1VPOL 3MO1B 1YC7A 3BKYL 1A3RH 4MJ6A 3ZT7A 1KLFA 1U92A 4I2XA 5FGCE 2OL3L 1FVEB 3TV3L 4WWKA 5AYUL 3T77B 2ZJSL 1BMGA 1NGWA 4MB5A 3QDMB 1T7ZA 1NH6A 2CMRH 3OAYH 5DC0A 2VAAB 4QRRD 3CVHL 1VENA 3VXNA 2UY7A 4KU1A 2MKWA 2DQGH 4FQ2L 3KPRE 3B5HA 5E94A 5FYKH 4FP8L 3W9EA 1KJ2B 3K4DA 1CK0H 4R97C 2AK1H 5FOJA 5EBGA 5FGSA 3CVIH 5IT2L 3D5OF 4MJ5A 5IW6B 2HN7A 2FNBA 4CVZB 3BIKB 3NIFE 1HYRC 4NN6B 2JIXD 1SYVB 2JCCE 1AXIB 3ZHLA 4OUOA 5AUMB 3GSOB 1ZT1B 2DF3A 1KTDB 3EOAB 5IEKB 3TPUA 1NC2D 2Z31B 3V52L 5J3HD 2VXVL 4CMMB 1N0XH 3LKNB 1L7TL 1K8DB 2Q1EA 2XTJC 1R0AL 4HAGA 4P3CL 4IRSB 1ZE3C 1B0RA 4WRLA 3P3YA 4P5KA 3WFDL 1V3KA 5F7DA 3BKML 1CQKA 4FXKA 4KC3B 4P57A 4Z8FL 1II4E 5EOQL 4U7MA 4IIQC 1RK1B 3X12A 3TYFB 3D2UA 4OZHF 3O3UN 3PHOA 1WBZB 1HNGA 5JW5A 1Y6KR 3B9KC 5I8OL 1WIPA 2ZZUT 4OZ4A 4LU5H 4Y4KA 1WK0A 1E0OB 1MREH 2YD1A 3VXRD 1SM3H 5DD1H 3RKDD 3QZWA 2DS4A 3SJVA 1CICB 2B7DT 3EYOB 1YZZA 4PD4J 4IJ3B 4W70A 1NGXA 2A74B 4UDTA 4Z7QE 4JRXD 1HQ4A 4F7MB 5A3ID 2BVEA 5CWSB 3AB0B 4H20H 2IFFL 4HWZA 3V95A 3QIBD 5IBLC 2BCKA 1M71A 4JZNA 4HSQA 1DUYB 3BH8A 1JE6A 3QHFL 3CX5J 1AKJA 1XF5B 4G5ZL 1O7VA 2YBRA 1E4JA 1OP5K 2H3NA 3HE7D 5T1LB 3VXUD 1N3NA 5L2KE 2E9JA 2F74B 3AMLA 5D7IA 4MA3A 1WTGT 4XVJH 3CFJB 2FRGP 3VFPA 3TF7C 1U8NA 1CVSC 4XZUA 4KI5D 1HHGA 1RU9L 1IGYB 3O9WD 2PO6D 2XTJE 4BSWB 5KZCD 3SE4C 1KCLA 3LY6A 4JGMA 5E08L 4NKDA 1FFQA 4B7IA 1V8HA 3QDGA 4M7KL 1QBML 4C56E 3UBXG 3MBEA 3R8BB 1HZHL 8FABB 2VDOL 5FEBA 1KJMA 1B4JH 2MCPH 5GRVL 4AH2B 3U9PL 4X6BB 1RK0A 1ZSDA 2G2RB 3CFCH 3TA3D 5TQ0L 1HQRB 1ZMYA 5BQ7B 3BPNB 4N5UA 4YHYB 2GJZA 3FFDA 2OQJA 5HI5C 3U2SB 2R8SL 4LGRB 3GO1L 3MNWB 4Y5YA 3TN0C 2DTMH 3T4YB 4NO5B 4R2GC 1KYOK 4YBLB 4G3YH 3ES6A 1NFDB 3H7BB 1A4KB 1P4LB 1NDGB 1IC7H 1BGXH 1T1ZB 5DI8A 3DX7A 5B8CC 1ADQH 3ARXA 3VGEA 1R3HA 1W72H 2B1HL 4HFWA 5KOMC 3CZFB 1KCUL 5F9WC 1FO0A 2OTUB 2R9HC 3RNKB 4A6YL 3UTZB 3L7EB 3NCMA 4C83A 1C1EL 3DTXB 2EH8L 3AS3A 4JZJA 4Q7DA 2QHLA 4IRZH 1IKNA 1A6UL 3MV7B 1OARH 3QDJB 4EI5A 4NQDD 1I4FA 4FFZL 1DN0B 4EDWH 1JPTL 4NO3A 1YEJL 1WC7B 1EVTC 1S7XA 4LLVB 4U0RC 3VFNA 1HHJA 4H8WH 1QFUL 1KENH 3CDCA 1UEMA 3H6JA 3T0EA 1CL7L 5LVEA 1HHHA 1I1AB 1I9JH 1EUTA 4CUCA 2NTFA 5C1MB 2IPTL 3DUUA 3T1FA 5C0CE 2Q20A 4KK6D 3H3KA 4G42B 3N1QC 3P30L 5I8CB 2YUVA 1CG9B 5J1AA 1QSZA 2R69H 2ZUYA 2X7LB 3KPNA 5CEXA 2GTWB 3KPLA 1E4XL 3RFZC 4JM2C 3GIZH 1JIBA 5F96L 3AXLA 1TZIB 3I50L 3C5JB 3L9RB 4WW2A 2IPUG 4NO0B 4UT9H 3DIFA 3OF6A 2DM3A 3DHMA 5I1HH 5E1AA 5MEQA 4Y5VB 4PB9H 3LV3B 5ECJE 5LQBH 2AK4E 2FEDC 3FB6B 5BMFH 2H26A 1TQBC 2X9YA 3OAUH 1DLFH 3HMWL 3T08A 1M7IA 2BNRE 4WNQA 3GMNB 1YQVL 1OQOA 4FG6D 4K23L 4DN4L 2A6KB 4LDOB 4TSBL 2CXGA 3RGHA 1ZGLM 1XR9A 2DLHA 4GS7C 5DMKA 1BAFL 4PRID 3HNVL 3MV9B 3S3PA 3R06B 3GBMH 1C5CH 4JRYE 5D6DC 3IXAA 1S78C 5DJ0A 3FL7A 1G1CA 1KIRA 2KQNA 5F89B 1MHPH 3G6AB 4LQFH 2Y6SC 3P4OA 4JDTH 3RHWK 4EBQL 3PGFH 4O02L 5BVJA 1MCLA 2BJML 3KPSB 4WGVB 3RWEB 2IAMD 3RUGA 1I1CA 4AL8H 5TQ2L 4GG6F 3K4AA 5KS9F 3QWRD 4U3XA 3PF2A 2D31B 4TPRL 4NZRH 2A0LD 5L2JA 2E7LC 4QHMA 2Z31C 2P48B 4LRIC 3RPIB 1C7SA 1K3ZA 4MD4A 5DMGD 3SDXE 3THML 1NUNB 4YHIA 5J11B 2PYED 4M62H 3WFBL 1BWWA 4PJIB 4NRXA 1X5KA 4IRSC 3LEYL 4X6DA 1N64L 3ARBC 1TZHA 3V4VL 4OM0L 5ELIA 3X14B 2RFXA 1YNTB 3AREA 3CUPB 3OKMB 4EVNB 2WIMA 4PRHE 1U8LA 4BUHA 1T04B 1LEIB 4XNMB 3C5SA 3MUZ1 4F9LA 3SO3C 1MCJA 1T66D 1JGDA 2R1XB 2R2EA 4XP4L 5JXEA 1I1FA 4KTEL 5C6PB 4JQIH 2Y7QB 1ZT7B 2IQ9H 4FABL 3LRSB 5EBLB 5HYJE 3TLRA 1S7QA 2FR4A 4LSRL 1MFDL 3LZFH 1CICC 1FZOA 1KXTB 5C08A 2ARWA 3GSNL 4JY6B 4IJ3C 1KC5L 4RFOL 9CGTA 3NOIA 1PLGH 1KJ3H 3DMMC 1RULH 5FYLE 1CDHA 4X0KB 3QDME 2BSED 5IROA 3EUUA 4R4NC 3B5TA 3FTGB 3K2UL 5EZLB 3GJEB 4C58B 4LIQH 1JZ2A 3VI3E 3QNZA 3UTPD 1XGUB 3ULUH 1QQDA 3PABB 2JIXB 4K3GA 3UTQB 1BLNB 2C3WA 2E8ZA 4U7SA 4ONGL 5E8EA 1TIUA 3T0XA 5DTFA 4CADB 1UH4A 5ENWB 1NC2B 3DV6A 3FT3A 5TGBA 3MRNA 4ZO8A 4ODSL 3P9MB 2DD8H 3LN4A 2IMMA 4KHXH 2C1OB 4WHCA 4CDGC 2AQ3A 3QA3B 1G7QA 1WF5A 2DQDL 4NKOA 1NCWL 1IZJA 3VH8G 1OAXL 3DVFA 3V9FA 4QWWC 4HZLB 1IT9H 1X44A 3E8UL 1P5UA 5FGBC 1S7WB 5EZJA 5F7MC 1AO7B 4OCLC 5HHNA 1JHLH 5J56B 1H5BB 2FSEB 3QJHB 3D18A 1JV5A 5LJYH 3OKLA 2CIKA 4WTXA 1WBYB 1ONQB 1EEUA 4PY8J 2P4AB 5F1NB 1IE5A 2LQRA 4RGMB 2XN9A 1JPST 1ZTXL 3OHXA 5I1GL 3C87A 3VXRB 4QF1B 1BBJA 4YJZL 3GSXA 4KKLD 2OZ4L 4OGZA 4HPOH 4NFCA 1V5JA 4JRXB 5CIPA 3I6LE 4JVWA 1A1OB 3TYGH 4E5XA 2XFXA 1HXMA 1J88A 3QIBB 3R1GL 4OLVH 4HULB 4YHYC 4HKBB 1MLBA 2RCSL 4D9LH 1U3ZA 1RUML 2DL2A 4MX7A 3I3EA 5GJSL 3ULSB 2A6IA 4HKXB 4O9HH 5AAMA 3ZL4L 4PR5B 1IRAY 3MOQA 5IVOA 1FFPA 4XX1G 1TETH 2VQTA 3D0LA 3HE7B 3NTCH 3VXUB 5GRJL 2NLJB 3JV4A 4UTBH 1QR1A 3LPGA 3DGGA 1CR9L 3DV4A 3VXSD 5CD3A 3SPVA 5EBWB 1HDMA 4WTZG 5FA4A 3MR9A 2BVPA 1OP3H 3V0WH 2PCPA 4X98B 4ZOBA 4Y5XA 1JWUB 3O9WB 1LDPL 3ORJA 2PO6B 4OD3H 4F33B 3FO9A 1SEBB 4RRPG 4OZIB 3VFRA 1NCAH 3M17B 1QLEL 4UINL 5C9JB 1KCSL 3BKCH 4G8EA 1IM3B 1FH5H 3DROA 3KPPB 3P9LB 5IIEB 1JNNH 4RGND 4MAUL 3QBTB 1KOAA 2E9IA 1OL0A 4TULH 5EDXA 4KKAC 1MSPA 3UO1L 5BRZE 3I6GB 1OSPL 5KJRH 4NFBA 2ZSVB 2NZ9C 1QRNB 3TA3B 4Q6YA 2FATL 1R5WA 1I1AC 4LHQB 4UU9A 4HXBL 2R4SL 1S7SB 2PW2A 4L1HA 1CIUA 1PG7H 3ZSSA 1BFOA 3GSVB 2R2HA 5C6TL 1UXWA 5E5RB 4YO0A 5IK3A 2Q8BL 5ACZB 4PLKD 4JO4L 2DLTA 5DD3L 1ZA6A 4K9EC 3TJEH 2ADFH 4PJGB 1T1XB 4QRSA 3V0VB 3REVB 5B39A 5DJCA 4PBVC 4I48A 3L6FB 3MGTA 5DR5L 2CRYA 1BQHB 5IMOB 2ADGA 1Q1JH 3MODL 5E2TL 3HE6D 2CO6B 2FGWL 3QUKA 1OAQL 5E6ZA 1NFDE 3W2DH 3AAZB 2NY7H 3DURB 2XA8H 4JQVC 4NKIH 5LGHH 1NBZA 3O45B 4HK0A 5F3BB 2F53D 3MV8A 2F5BL 3LKSB 3ZTJG 2Y06H 4PGEA 5GS2H 4TNWK 5L88L 1T7XA 3MREA 3V6OA 2C26A 1AFVL 2DYPD 4DUXA 1KEMH 4X4ZA 1EZVX 5DHVB 3WKMH 2VISA 1CLYH 4XPBH 1ZOXA 1H3VA 4XP9L 5ALBL 1QBLL 2VTFA 3QUMB 1FYHB 3P4MA 4NQDB 4A6YB 1QKZL 5FYJH 2Y36H 4TUKL 2XY2A 5I6XB 4OFYD 1S7RA 1T83A 1JI2A 3TEUA 2NY2B 3QDJE 5SWQA 1I1YA 2ESVD 3AM8C 2DJ4A 3SBWC 3WNKA 1FV1A 3L3IA 1AI1L 2CDFB 3Q6FA 5IVXE 4X4YA 1JWSA 3VGDA 1G7LB 1INDL 2R2BA 2QTEA 3PXHA 4MMXC 5J11C 1YEDB 2IBZX 4MQTB 5BO1L 3VXMD 1V7ML 1K8IB 5CHNA 4WI9A 3N1GC 2BVTA 2Y23A 4UT7L 1XH3A 3NCJL 2FEEL 5J1SC 1C16A 3U1SL 5KN5B 3ARPA 5IWLA 4H26A 2MHAB 5JNYA 2DWDA 1J0ZA 5C0NC 3A0OA 1UXSB 2UWEA 1QA9B 1OT1A 1ITCA 4QT5A 4ZFZB 3V5HA 3OKOB 4ZO9A 1T3FB 5D72H 1GZQA 4G8IB 4M6AA 3UJTL 4CN6A 5C0RL 4X80L 4BJLA 5KSAC 3H9HA 3ZSTA 1JTTA 4Z7VF 4Q97A 4LSQH 4PRIB 3HUJB 1DBAL 1NCBH 1HOCA 1Q9OB 4XP1L 4RMQA 4LCWB 4P4KB 3IDXH 1GAFH 5JR1H 5F3HA 3O6LH 1OCWL 4FTVD 4LHUA 4M8QB 2ZOLB 4FQPA 3KPQB 5TF1H 1YMHB 3MV9E 1RURH 5F7LB 4Z7NF 4PRDB 1G7IA 3HI1B 4MD5A 1VGKA 5MERB 4EDXB 2AV1A 4POUB 3MRIB 3KPSE 1U91B 3IFPB 1MJUL 2GK0B 3TBYB 4PJBE 5DK2A 4M7JL 2C9AA 4BFEA 3AY4A 5E2UH 5IQ9B 2PYEB 4FFWC 4DQOL 1E6JL 2F54D 3FAWA 5F6HJ 3TVMD 5F8RC 2XZQH 2FJFA 3TGXA 3GK8L 1FHGA 5T33L 1JYNA 2EYRA 3BFOA 4PB0L 3U4AA 1DUZB 2V2WB 5GSVA 3NH7H 1U8IA 2K7PA 1RJZB 4MNGB 2I07B 4YAQA 1YY9D 1J10A 1CE1H 5E70A 1P2CA 3ETBF 1HK6A 3NFSL 3N50A 1F58H 3OB8A 4N90E 4NQEA 3F58L 1VEMA 4YHLL 2D4DA 2PETA 3W11C 3MCLL 4W6WB 4LKCB 2BX5A 2I9TB 2NY3D 4MS8D 5A16B 5SV3A 3RKDC 3SE8H 3WNNA 3V2AR 4Q0XH 1ZS8B 4LF3B 2ZG1A 4MXWH 3STLB 5CEZH 1Y6NR 3MYZA 1OW0C 4P4RA 4GKSA 4IDLA 4X7TB 5KSUB 4YFDB 3QIBC 1QSFA 3IDNB 3O0RH 3U82B 3ZYZA 4Y1AA 4DVBA 4R3SA 1PSKH 1YMME 3GMRA 4MJ6B 3GSNB 2W0LA 1XF2A 3HZVA 5J12B 1U92B 4I2XB 5IVZA 4JY5L 4WWKB 2XG4A 1I7RB 1MLCB 5IQ7L 5FV2A 2FL5A 1I7UA 5E6IC 1A6WL 4JR9L 1SJVA 4JO1H 1MQ8A 1CFVH 1MCEA 1DQLH 4NKMA 2BXZA 3U7YH 4M7LT 4ODUA 3EJJX 5TE6H 4YHZH 1FZKA 3CSBA 5D1XA 4ZTPH 5SWSA 5BS0A 4WEUD 4X6FA 3ZDZF 4Z78A 1LD9B 4X9GA 5DC4B 4MZ2A 3QRFM 3T3MF 1NGPH 4S1QL 4OZHA 1YPZF 5DRXB 1NCTA 1T22B 4WVRA 3WUZA 4X8JB 4PRBA 2EH7H 4MJ5B 2HN7B 1X5GA 1ZVYA 3L5XH 2PO6C 3O9WC 2X4RB 4K2UH 3IKKA 1J1PL 1A14H 3AFLA 4IMKC 2BOCB 2WINA 1CT8A 3KNBA 2DBJA 3TPUB 3U7AA 4XBPA 3C09B 3RWCB 5D2NB 4G6FD 1KULA 1EFXD 3QQ4B 2B20A 1AO7E 4HT1H 4XCCL 5IMKA 1B0RB 1URLA 5GS0H 5IMLA 3WXVH 1F13A 1X5FA 5D2LA 4FXKB 1A0QH 4P57B 2A83B 3L1OL 5HDQH 3V4UL 3TA3C 3BH9A 3PP3H 3PIQA 3H0TA 1SMAA 2QQQA 3ELAT 4PJAB 3VXRE 3D2UB 1J86A 3ARWA 4BFGA 2AJSH 3FJTA 2WBJA 1DDHA 2ZCHL 4NWUL 1JF5A 4OZGB 3ZE2E 3G6JE 3GHBH 3ULUF 2H6PA 1EAPA 2FCBA 4MD0A 1Q72L 3DVNB 5DQ9A 5ESVA 4PJ9C 1BJ1H 5GJTH 4LKXB 4MA8H 4YZFE 2IALA 1Q9LA 4I18A 4UDTB 5D8JL 4Z7OE 1D5MA 5DJZA 1HQ4B 5EG6C 3ZMRA 2G60H 3MGAA 1KB9J 2F8VA 1GH7A 3GSQA 4IOFC 3NIFF 3VXSB 3DRTA 4XC3L 4FZEH 4JZNB 4F3FA 1CTNA 1IC5L 5KW9L 5ISZA 1BBDH 3SKMA 3VXUE 5C0GB 1NBQA 1JK8A 2X4OB 2IJ0C 3CD4A 2CRZA 2VKXA 5HI3D 1LWRA 5IBUG 5JIIA 3FCTA 5F1IB 1U8QB 2WV3A 1MFEH 3KXFE 1WCBB 5DYOB 2H3NB 1SY6A 4AK1A 2QKIA 2X42A 2SEBA 2B39A 4KI5E 2CLRB 4RWYH 4RGNB 2PTVA 4C59B 2DWEB 1DLHA 4XNXH 1I8IA 4OZIE 3VG9B 1TVHB 5MENA 1MCWM 1GSMA 5B38B 2ZSWB 3MOAL 1MPAH 3BHBB 5I8KH 3NA9L 4U6VL 4EKXA 4XZUB 1RUPL 5I6XC 5HHOD 3DRQB 1A7PL 4GRLD 1NBYA 3VFOB 4U1MA 3QPQD 2JJTA 5E8DL 5DSCA 3PWLA 3ZE0E 4P5MA 1X3DA 4ERSH 4U1JA 4OF3A 1A7BA 3FRUA 3RBSA 4KK6C 4LNRB 4XNUH 1FZMA 3L5IA 3NFPB 4I5BB 1QRNE 5CFHA 4K7PX 3ZKMC 2YD4A 2DMKA 5SX5K 5BZDB 4HXAH 4KQ3L 2XIDA 4OGYH 4RCAA 1FN4B 1NPUA 3O4OB 3WUWB 4OCSH 4EUPH 1EHLH 1GXEA 4I0PC 3P11H 4OCRL 2FX7L 3MRJB 2YD3A 1UEYA 3MRCA 5JPMB 1JFQH 2CR3A 4CJ0A 2NMSA 1FG2B 2ED8A 2V5RA 3CXHJ 3IAQA 4HEME 3RZCA 1MI5A 5GRZA 8CGTA 4TQEL 4NHUA 4PJGE 5TE7H 5J13B 5A40E 4KK8D 3ZTNH 3GKZA 1QHPA 1NLBL 1Z0MA 1U36A 1Z5LA 2B4CL 3HI6H 4DGYH 4RNRB 2F53B 1JRHL 4RWHA 2IF7A 4HIXL 3VFSA 5JHLL 4XPTH 5FXCH 3DETC 3W5NA 4LVHB 4B5EA 4QYOB 3ES6B 5ITBH 4FG6C 1U6AL 4MNQD 3H2WA 3RHWF 3MUY1 1UWXK 4OLXH 4OM1H 2DYPB 1QP1A 3WJLA 3GRWA 2WANA 4F8QA 3WJJC 4TVPH 5IHUH 4X7DC 3DX7B 1MEXL 3MA7A 1R3HB 3GI8H 4FQHA 1T2JA 3OX8A 4YNYA 2L7JA 4LVNB 3MV8D 3X11B 1QLRB 2VE6A 4R7NB 4JY4A 2IAMC 4NQDE 4C83B 2ESVB 4Y0GA 3ZYJA 4LLQA 1UACH 4GKOA 4XB7A 4OCWH 2D03H 1F00I 4U1KB 3DYOA 4JZJB 2BOBA 3ZE1E 4LMQE 3WSQH 2A0LC 3HFMH 3GMLA 3QIWA 2W65A 5H8DA 4EI5B 7FABH 4UNTA 5E03A 1I4FB 1ZEAL 3TNMB 1EK3A 5D9SB 2M26A 4RMUA 2EXYD 1S7XB 4HMEA 2NX5D 3VXMB 1C12A 3CFKA 1S7VA 1AGCB 2ZKHH 4QTHB 1JF1B 2ZUUA 2D0GA 2R0WH 2XRAL 1A3LL 1VERA 4AZ8A 1IARB 5KSBA 4NSKB 2PW1B 1T66C 4LARL 3UC0L 3IYLW 5J1AB 5E9DA 1OAKH 4IDJL 4TUJA 5AWNH 3QFJA 5CEXB 3FT2A 4K9EH 1IGML 5CGYD 5EOCH 2HVJA 4WW2B 5T3ZH 1G7JA 3EGSA 5E1AB 5JW4M 5MEQB 3PWUB 4APQD 3WHXA 2HRPH 1NAMH 5JPNA 3H42L 3HS0A 3SDAD 4GG6A 5KS9A 2WBKA 2H26B 4FTVB 2BZDA 3QEGL 3ME0A 4PRIE 5FM5O 1VADA 3HUJE 3L95B 5J12C 3F7QA 4WNQB 3WE6A 4LCWE 2P8MB 3QCTH 1ES0B 1IC4L 3BDYL 1OGAA 1YECH 1NFIA 3WL9B 2Y5TB 4KK5D 4XPGH 2VXTL 4HAFA 4HWBH 2FX9L 4JM4H 1ITBB 1GIGH 4NGHH 1F4WH 1H15A 3IU3A 4W4OC 1CYGA 5GRWA 1DE4A 1G9ML 3G5ZA 3GB7A 3Q5OA 5FGRA 2F54B 1F8TL 4YX2H 3P4OB 3WIFA 3OKEA 5EPMA 1A6ZA 1RZFH 5JQ6H 1HCVA 1OTUD 5FHAH 2PYEE 1J8HA 2VXUL 3FQRA 4ZNEE 1KJVB 3MA9L 4F57L 5F7EL 3C09C 5T5FH 1A7NL 3UCRA 4FMKA 5FF6A 4YHIB 4JFXB 5D70H 5I76A 5LGJA 4MNGE 3LS5L 3N1FC 3NFNA 3JV0A 1CU4H 3W0WA 4UDUA 4KKLC 1YEEL 3QUZC 1XF4A 2EDHA 2AV7B 1QBBA 2QQNL 3V4PL 3C5ZD 4U3CA 1U8LB 2VZ1A 4O2CB 1U8MB 1LK2B 3C5SB 3U46A 2ZUTA 2CRIA 1I1FB 5IB5A 1DSFH 5IOPB 2K3TA 4HHAB 3WFCH 5ANMA 4UUJB 2FR4B 3MJGX 2NY6D 1FZOB 1U58A 5DD6A 5MP6L 1ZHNB 4JFDE 2XA3A 4J4PC 3UTPE 4I2XE 4N8CH 3LQZB 4LSTL 4KQ4H