1TJXA

Crystallographic identification of ca2+ coordination sites in synaptotagmin i c2b domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
156
structure length
156
Chain Sequence
SGGGGGILEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic identification of Ca2+ and Sr2+ coordination sites in synaptotagmin I C2B domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
molecule keywords similar to synaptotagminI/p65
total genus 31
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1tjxA00
4TS6A 3FDWA 2R83A 2Z0UA 2B3RA 3B7YA 3DBSA 1E8WA 1E90A 3HN8A 3PYCA 1BYNA 4L1LA 1RSYA 3TWYA 2WXLA 2ENJA 3N5AA 3R7RA 1DJGA 4FJYA 4KZCA 4NP9A 4F93B 4PS3A 3KWUA 2ZKMX 1WFMA 4WWOA 3ZW3A 4FADA 2CM5A 3LJ3A 2Y3AA 3L13A 5JHBA 4EZLA 1E7UA 2BWQA 3APFA 4LCVA 1DJWA 4WEEA 3ML9A 4HVBA 3L9BA 1QASA 4XE0A 3NZUA 2FK9A 4QJ3B 2N1TE 2NCEA 3PS6A 4FHJA 4ICWA 2A4ZA 3QARA 3FBKA 4A55A 2RD0A 4FLHA 3QK0A 4ANXA 2WXIA 1W15A 1DJYA 5T8IA 3JZYA 2FJUB 2CJTA 2LHAA 1DJHA 2CHDA 4NPJA 3T8MA 4IHBA 2ENPA 2YRBA 2CHXA 3KWTA 3QR0A 2WXGA 3PFQA 4OVUA 2ENQA 2KI6A 5JHAA 2UZPA 3ZIMA 3ZVVA 2WXQA 1E7VA 4Y1SA 2WXKA 2K3HA 4PS8A 3ML8A 2ISDA 1GMIA 3HHMA 3TL5A 1CJYA 5EDSA 2WXNA 1WFJA 2EP6A 3SD5A 3F00A 4AOFA 5H4ZA 1DJXA 4F92B 2CJSA 1K5WA 1UOWA 3W57A 4QJ5B 1BDYA 4FA6A 5CCGE 4OVVA 3CSTA 3APDA 1TJXA 2NSQA 4ANWA 4XX5A 4XZ4A 4L1BA 4HLEA 4FULA 4KZ0A 4WWPA 3L54A 5G55A 5G2NA 1HE8A 2DMGA 5H4YA 3RDJA 1UOVA 4TUUA 4BFRA 4DK5A 4FHKA 5CCHE 3NSJA 1V27A 3CSFA 1TJMA 2WXJA 3IM1A 4WWNA 3W56A 3TJPA 5KJ7E 2WXRA 3L08A 1BCIA 3MJWA 4GNKB 2WXPA 3OHMB 4Y1TA 2D8KA 3P2BA 4PS7A 4G11A 2WXHA 3S2AA 4F1SA 4F91B 3QJZA 4L23A 3R7QA 4LT7A 4AJWA 1DJZA 2CM6A 3F05A 1A25A 4V11A 3L4CA 1YRKA 4NS0A 1E8XA 3RPBA 4ANUA 4NPKA 1DJIA 2DMHA 4J6IA 4KITB 4L2YA 2CHZA 3F04A 3L17A 2YOAA 4JPSA 2V4LA 3NZSA 2K8MA 4EZKA 3QR1A 4LDCA 3PREA 2NQ3A 4MJJA 2WXFA 4QAMB 4EZJA 1DSYA 3F01A 4IQHA 4GB9A 2K4AA 2Q0ZX 3PRZA 3QAQA 3IBEA 4ANVA 3DPDA 3M7FB 1W16A 4QJ4B 5CCJA 1RH8A 2K45A 4ICXA 2CHWA 4TV3A 2WXOA 3APCA 2A5UA 1RLWA 1DQVA 1E8YA 4WAFA 4URKA 2QZQA 4BGDA 4DNLA 1E8ZA 2X38A 2WXMA 1UGKA 2JQZA 2Q3XA 2QZ5A 3GPEA 3ENEA 1QATA 3OAWA 3HIZA 4FJZA 3L16A
chains in the Genus database with same CATH superfamily
2J1KA 1QUPA 4IDLA 3RWJA 4S1DD 5DVNA 2XX1A 4PWGA 1R0AH 1CTMA 2DH3A 2VDNB 1QSEE 3UP6A 2FATH 3H56A 3SGDI 4BZ2A 4X7CC 3A22A 1AXTL 1DSFL 1N8OE 1S7UA 4JCLA 1M1XB 3LRKA 1AKJD 4LRNL 1BBJA 5TQ0H 1S6NA 3GZKA 3VQ1C 4WEEA 2NW3B 3TFBA 1S9YB 3UOAB 5CSZB 2WBJD 5F7NC 5AW3B 2A4ZA 2AI0L 2NYKA 5DJDB 4K5PA 3U1SH 4FABL 2Z1PA 1AS7A 2E0PA 3E6FB 5CD5D 1WS7A 3TA3C 5I15L 2GIYA 2Y07H 4RNRA 3IJSA 4RETB 1KB3A 4HXBH 2FLBT 5AZ2L 1PIFA 5I28A 5A2AA 3E8VA 2W5PA 1D5XB 5T5NF 3NH7L 1U93A 4F92B 1V7NH 3FTZA 1ZA3B 5CCGE 2J72A 5E8DH 3KLHC 3ZKND 1RK0B 1KOAA 4XAWL 5LXGL 2AAVA 1OE2A 2F68X 2MTAA 1QPKA 2XV6B 3QPKA 1P6AB 1KIQB 3UAEA 2J43A 3AY2A 1NAMB 2VDRH 4X4KA 5IWLC 1WO2A 4F7CA 5I1HL 4OFQA 4PJ7F 3NSDA 1DVFB 1DVSA 4JS7A 4OBRA 4ELMB 3RI5F 2QVFB 2ZYHA 3BYYA 4FQCL 5D4IA 5KVMC 1GJWA 1TQSA 3BHBA 3VGHA 5B39B 3NA4A 1FVDB 1WTLA 5BV7C 2X4NB 3CN3A 4LF3A 1BQHA 3OMIB 4A63A 4FFZL 3S96B 3DJRA 5E9AA 2Z35B 1Z5LB 4HP5A 4FQQA 4XBPB 3ULUL 1J8HA 5HHMB 2J73A 2QQKH 3QR1A 5CLWA 4CJ1A 5IB4B 4Z7WF 1T2JA 3DPBA 5TDNA 4IQHA 1RP9A 4JZNB 4XWGH 4AKQA 5IFAH 1N2RA 4XXCC 1A2YA 2TSAA 3X12B 4ZAKB 1O6TA 3IMUA 1SOKA 1D5MB 4OGXL 2AK4E 3LV3A 3IJ7A 3MRIA 4WTWA 3MGTA 2E27H 1A1NB 5HYSA 2R69H 1SYVA 2WYZA 4PBDA 4X6DF 2ZXQA 1BLNB 4KPHL 5KW9H 4WW2F 1TETH 2JJSA 3EF4A 4G42A 4A39A 2G4GA 3RURA 5HHVL 1N0LA 1SY6L 3CSYB 3QFJD 5DJYB 1YMHB 2CO1A 1USQA 3Q3GA 4Y8DC 4PV8A 3K6DA 5GGUB 3KPLA 3H55A 4OZGE 4CADA 1TTGA 3WEXA 4U6YA 2BNQE 3H9SA 4Z7UF 4P9HC 1CK0H 2AMGA 4ODSH 5ESAA 2Z1KA 1A7RL 2Q87A 3BKML 3ZTJH 5DRXA 3L9RB 1RZQA 1SN0A 3L9BA 4MRBA 1EXHA 4Z1PA 4M9PA 2Z4QA 3LZFL 5SWZA 1EEZA 3QZWA 4XCEB 5CM1A 5K33A 2FJGB 3ELQA 4NQVB 3BT2H 1HHKB 3WFBH 3DVNB 1DN0B 1GOHA 3ULVE 3WEMA 2I32A 3FS9A 1EXUB 3ZKMD 3TBWB 3NK3A 2VRQA 2W65B 5CP3H 5BZXA 2WXGA 1N0XL 4KI5F 4N1CA 1GKEA 4NPYA 5DK0B 2WLHA 4OD2B 5MHSE 4Y16D 2K3HA 1U2HA 3RP1A 1NBYB 4AYSA 5E5RB 2OJZH 3FPYA 1BF5A 2YQ3A 3II3A 3N04A 3VSUA 4GQPH 2IBZY 2IH3B 5JMRA 4TVPD 4UOJA 3U9PL 6TAAA 3ABGA 4WY7H 3IGAA 4Y9EA 2B0SL 2FE0A 3QIBC 2UY7A 3SPVA 4KJPD 1LEGB 4FULA 4RFNC 5C0IA 2NNFA 2CUMA 4R2GC 2BWIA 3G6JF 3EYOB 3RDJA 1GYVA 1AJ7H 3ULAB 4NP4L 2KZKA 2ESVB 1FZMA 3N40F 4OKVA 2GUOB 3TBVA 3FSZA 3JWDC 2IANB 5ICYB 3UO8B 4XZUA 3V0FA 1JWMA 3GBNL 3GDBA 1I8LC 1NFIA 1JZ7A 2ILLA 4LBEB 5SWQA 1J8HE 1OY3B 2NT1A 3RPBA 1CN4A 3F84A 3CNKA 4RWYH 2GK0A 5F0PB 4MZRA 2KQNA 43CAB 4G9FD 2NXYD 2A7BA 1KIPA 3II1A 1YEIL 4MD4B 2W81C 3NJMA 5KYYB 3G5YB 3SY0A 1SEBB 2CA4A 2BXZA 1NCBL 3T6WA 3GIZH 4LCIH 5AYTA 5IW6B 4FQHB 1A6TB 1DBAH 2HZHA 3EJUA 3TBTA 1KJ2B 1OARH 4QHMB 1W2KT 3IDUA 5JW5A 2NY0B 2A0LD 5IG7B 4P2OD 1XH0A 2DYPA 4IRSC 4JDTL 3JZ7A 4MQ7A 1FE8L 3Q8EA 3DSNA 3LQMA 2QR0A 1DANU 5IFAL 4XO3A 1GS8A 1TSRA 1J5CA 4MCYA 3H1ZA 4YDLC 2GT9B 3QUZB 3OKKB 4AQAA 3ZZLA 4AIOA 2WLLA 3MRHA 2A74B 3F6LA 5HGBA 2LLGA 1KY6A 2Q2LA 4WFFD 1HDMA 3EJJX 1QFWM 3OAUH 3RWDA 3HZKB 1E8WA 2JV6A 3FO0L 3OHXC 3CVDA 3HC0A 5D2NB 1PSKL 4YDNA 2PP8A 3KL3A 4YGVA 2A9MH 3AG1B 2OW7A 5INDB 1ZTXE 2G5BA 4I7ZC 5EWIH 1BVNT 2PPDA 1JE6A 4MLSA 2IF7A 5E4OA 1C5CH 2XRAH 1JGLL 4GG8B 4BZ2L 2O5XL 2PO6D 3CZGA 5AW7B 2XJLA 1KELL 3RG1C 5AG9A 4B7IA 2WW8A 5FYLE 2RD0A 3VGAB 1G6RL 1WYJA 4HK0A 3BZEA 1F6FB 3ZOAA 4PJGB 3A6CL 3I84A 2XWZA 3OLGA 3MTRA 3NCYP 3ROLA 3HAEG 1LEKB 3GTVA 4X99A 1YECH 2EDDA 3DURA 1X4YA 4YXLL 5I2IA 2JCCB 5E94A 1ZEAH 2EO9A 2ZCHL 5K9KA 9PCYA 1JN6A 2A9ML 2WKOF 4R90L 1OPOA 2Y5TA 5LO7A 3PWPD 1ETZA 2P8MA 2VXQH 3BH8B 5FIEA 2WBJC 3PGFL 4TQHA 4FXTA 2XG4B 5HHVH 4J23A 2AXFA 5AYUH 3D3VB 1GAFL 2A2QT 1B0RA 2IH1B 5T1JA 2WANA 1HE8A 1KN4L 1CFQA 2WLNA 3BKJL 5TDPB 3QAZC 3QXAA 4I4WB 2WXJA 3QEQD 2BSTA 1ZDQA 1F2QA 3C5JA 1QKZL 1K8IB 3PHSA 2LU7A 4OGXH 1BQRA 1C08B 2VC2B 3N6YA 4WV1A 4PGDB 2YKLH 3CVCA 3MCLH 3KBHE 1DQIA 1R24A 1GYCA 3NA9L 4R3SB 3ZT7A 4E41E 2ZCZA 4HKJB 2A4EA 3DOHA 4WTZA 4PVNA 4G70B 3CVBA 3WNPA 4P3DA 1RUPH 1Q0EA 4OCMC 3S3CB 1F4AA 4NZJA 3NIGB 3IJEB 3L7FB 1UD2A 1DDHA 1IKNA 2HRPL 5CBAB 1WFIA 2P80D 4G8FB 1IKNC 2GJZB 3MRKA 3RVUC 1JZ4A 3NPSB 4KQ4L 5IB2A 1ADQA 1WFOA 3DX7A 4A2LA 3NABL 2HRPH 3GFUA 4M56A 4HV8B 4IRJC 5HVHB 4D8OA 1BQLL 4TM9A 3Q05A 1OTSD 3JV4A 2YGOA 1MUJA 5D7KD 5E6UB 1A14H 4Y2OB 3U4BH 4HUUB 1EFXB 3FQUB 4KNUA 4MXQC 4H88L 1QHQA 2AQTA 4L4VE 2FQDA 1O6SA 5DJ6A 3LQZB 1SXAA 4JL1A 3UERA 1UM5H 3GHPA 1SQMA 3NJXA 1ID5I 1JZJA 4GW4A 3U9UB 2AJSH 2JB6B 1AD0B 5K9QI 4NBYB 5IR1A 3EO0A 1QLRA 4IEFA 2W88A 1JTPA 3O3EA 3U4KA 4YSDA 2QTVA 5ALBH 2YARA 3M1CA 1VPOH 1XZWA 4W6XB 4JPVL 1GAFH 5JHBA 4QOKA 1G9EA 3VMOA 4YDJA 4PAZA 4TUKL 1ZS2A 3CFJB 3ARRA 4XVJH 4WF7A 3U2IA 2VXQL 3QDAA 2YJQA 2ZTBA 1QFPA 3JV6B 3U1QA 2ARJB 4QCIB 3G5ZA 1FJ1A 1IGML 1EHLL 3GZQA 3BVVA 3VGGA 3K71B 4YX2L 5C0DB 3DSFL 1JV5A 3EOBA 2VNCA 2KZWA 5EUKB 4OD3L 1TJIL 5I8EA 2P24A 2C7UB 4HJ0C 3NIDF 4NZTL 1OLZA 4Z7IA 3KS0J 4XNUH 3MDJA 4ELMF 5F6HI 4LFHD 1TVBB 3MRCA 5GSRA 5EHFA 2CRZA 3FSAA 3KVPA 2W9EH 1FVDA 3L6FA 3I6SA 2GW5A 3ULUF 3WAJA 4NKDA 3S96A 4ZTOH 4PD4K 2V9TA 5BUAA 3WGUB 3SBPA 1I1AA 1CB4A 4OLZH 4AM0B 2P7TA 1AR1D 3BJLA 3AAZB 4IRZL 5CSGA 3CFKA 4WIQA 1RD6A 1N2RB 1FNSL 4TLTA 1E42A 3KE0A 4GNKB 1D6EB 1CR9H 5E2UL 4EVNA 1A1MA 3H8NA 4DHLA 4RDBA 5GGTL 5TH2B 3NRFA 5T5NG 2Z4TA 3BAYA 3UYPA 4UAHA 1OTSC 1OM3H 5IFHH 3K8LA 4CC4A 4X5WA 1P7HL 1F11A 2WO2B 1P7BA 5JYLA 3INUL 4RGOL 1OF2B 2SODB 2G2NA 1RIHL 3FOLA 3LZOA 4EKXA 1LEIB 1I1FB 2H4EA 3P9WB 4KKLD 3MX0B 3I9IA 3PP4H 4LVOC 4S1DC 1EAPB 2DQFB 4LLWB 1RUAH 1AVAA 3F7VA 3GTTA 5HHOD 2ZUWA 1YQVH 5F72S 2NR6A 1B2YA 3II2A 4OLVH 4N20A 3S98A 4U6TA 2P5WD 4RESB 2D7MA 4LARL 5EZPA 1AD9B 1YN7B 1YQVL 2ZX9A 3AVEA 3BX7C 1W8OA 5FUZL 3RX7A 4Z3JA 4OKDA 1NEZA 2B4CL 3T2NH 2YD4A 3FF7A 3K1KC 3O8XB 4MD5A 4ZMQA 3VXUD 5AVRB 5E4AA 1EEZB 2WGXA 1LO4H 3HS0A 5GXBB 4NQVA 2UXTA 5C08D 4RRPA 3D50A 4HHWA 5DZNA 5J56B 3PU7A 2B3RA 3HE7A 3DBSA 4RISH 4W6YB 4X5LA 5HTSA 4EXKA 3D69A 4XN2A 4X98A 2VN5A 1JYNA 3WKML 2GVYA 2CRMA 2F7QA 3RTQD 3EFDH 4HS3A 5DWUH 4KZCA 2CG9X 4N2IA 1D9KA 1JZDC 1HESA 1JWUB 5C71A 5I75C 2EUWA 3C60C 1L7TL 1PLGH 1RULH 1CG9A 4FNRA 5J4MA 3BUIA 3VUAA 4OCNC 5I6OA 2CH8A 2ZAGA 4G42B 3U1SL 3QUHA 1UVQA 1DHKA 4Z6AT 3QO0A 1B3JA 3QK0A 1WLHA 2EDJA 5AZUA 3U82B 3CSGA 3D3VD 1ZLVK 4LNVA 5E5LA 1BD2A 1SYSB 4EO5A 4NQCB 2R4SL 1B0GA 3VNZA 3M46A 5EOCJ 5D1ZD 4IM8A 3UJTL 1CGVA 5TQ2L 5D9SB 3BCFA 4X7TA 2OCFD 3EFDL 4KKZA 2WKOA 3QYCA 5B4MD 1NBVL 3QXVA 3P11L 3J07A 5D7LA 2YRZA 4QRPE 2CDEB 4MD4A 1WF5A 1QVOA 2EABA 2C26A 4NFCA 4BKLA 5GS0L 2WWKT 4FMKA 4HIXL 4QR7A 1HK6A 3MC0A 2VE6A 5J6HB 2I25N 4MZIA 3UG3A 4Y2NA 4PWEA 1TYJA 4H8PA 5J12B 1BJ1J 4YDMA 1VF5C 2OMXB 2WXPA 2YPLA 3MRQB 4KROC 4CSPA 4ZX6A 1P4IH 5AAMA 4MQ7B 2E7BA 2WIIB 1HL4A 2EIZA 3QUMA 2Z93B 1DBKL 1OCCB 4IHOA 2YPVL 2V0AA 4FKEA 3WTXA 4ZOEA 2X4QB 2C3XA 2VDOH 1YQ2A 2DWEB 1KBWA 3F04A 4X6DE 1E3ZA 1UKSA 4LPXA 4JFOA 2DIBA 2W0FA 2IWGA 3MBXH 3NRQA 1BFSA 1XGYL 5DZJA 1NCGA 4NT6A 1D7DA 4G8IA 3GHBH 4GO8A 4RDQF 4M00A 4TL4A 1EHAA 1I82A 3K5RA 3FH7A 3SDDC 3KLSA 2BSDA 3EJSA 1IC1A 5DMKB 3DRTA 4XWGL 4GIAA 3Q6FB 2JK5B 2QGDA 3PV6A 4OCWL 1L6PA 2WINB 1QO3A 3DRQA 1MI5E 3B56A 1OGAE 3L9EA 4LVEA 2QADC 3H42L 4RZCA 4MNQA 4XNAA 4LE8A 4AJVA 4HGWB 2YK1H 3S34L 4GW1A 4RA3A 5BMFH 2E7HA 3FB8A 3RDTB 2LU5A 2X9YA 2YHGA 1QX1A 3B1UA 4FJZA 5FO8B 1NFKA 4RGNB 4MASA 3MN8A 1J9QA 1CYWA 1GCYA 3TNMA 4PJGF 4KUCD 3L95A 1Q0YH 4YXHL 4DW2L 4MXWH 4Y1AE 1JRHI 3ATDA 3PGCA 2AKRA 4FZEH 3U4AA 2ZF8A 4H40A 1NQBA 4L8SC 5HI3D 4HIXH 3KDMA 1JI1A 4CADB 2WWOA 1CICD 1J18A 5HVWA 1INQA 3PF2A 1R3IH 3DK0A 3PL6C 2GCYA 5H8DA 5KYUB 1RZGA 1ITCA 3CIAA 4GAFB 3HRZA 1NL0L 1FFOB 3U25A 2HTKC 2X41A 1A64A 4MXQD 4P2QA 2XG4A 1B0RB 1OAYH 4KQ0A 1W15A 4AEHH 5CINH 3IE4A 4LNRA 4I3SL 2B9AA 5TDPA 4FFTA 4XNQA 4PS4H 4W81A 3W2DH 3WNLA 3OKNB 4JHVA 1J0YA 2XUWA 4L3ED 3DIFB 1ZLUK 4BGLA 5F3HB 4M1CD 4CJ0A 4PGCA 2DM3A 5CFHA 2JI2A 1PD6A 3ILEA 4WV1B 4M48H 1ES0A 1QLFB 2IANE 2HLAA 3TTSA 2C3HA 2D7QA 4R3SA 3RY4A 4YSTA 3GJEB 1FI8C 3V6BR 4X4ZA 4U7KA 1YY8A 4HKZA 3DV4B 1E40A 1GC1C 3I02B 1REIA 3L4WA 3NIGF 2QT6A 4MA7H 4OLUH 1Z6JT 2GY7B 4OFKA 5K39B 2BVEA 5TQ0L 5DWUL 1KZQA 4OKVB 2WQ8A 4P5RA 3MV9D 3SN6N 3EAKA 2JKLA 1FFQA 5ICYA 1MY5A 3RI5K 5ADOL 1J9SA 3P3RA 3AS3A 1JWMB 2AJUL 1AHWB 1G4MA 3IPEA 4J6RH 1F58L 2DQMA 3A6BL 4U6VL 1YJDH 3V6FB 3BVUA 3CDYA 3P30L 3ZDYE 4GAGL 2FIKA 2VN6A 4HOZA 2WO3B 1QR4A 1T1WA 1J88A 4X8XA 5CZVH 1WT5C 2N7SA 5TF1L 3SQBB 1CL7H 1N6UA 2MHAB 2VRAA 5FUOH 4B5EA 4BCXA 1BJ1H 1FNGA 5JOEA 1C16A 1V3JA 1KIRB 2HT3C 3S34H 3F83A 1N5YH 1ML0A 4ZFGH 4FCHA 5HJDA 4MJID 4C47A 4AT6A 1J9TA 1JGUH 2RALA 1AXSB 1RHHB 1NCCL 3QCUL 4NZUH 1B2WH 3IXAA 2MKWA 4NFDA 5JW4N 3T4YB 3FSWA 4TN9A 1A4JB 1X5ZA 3WMSA 4ZUSA 2WXOA 2MRYA 2BVOA 5CGBA 1QFWH 4S1RL 3QDHA 1WVZA 2YOCA 3HJ0A 1X7SA 4CGTA 5JHDB 4YIQA 1VAHA 5KS9E 1TLMA 3T0DA 4HKJA 3L5XL 2BVQB 3WNOA 5FGBA 1SJMA 5C0JB 5I6XB 4LLDA 1YEIH 1OP4A 3J27A 4QHLA 2OL3L 5C0ND 1FJ1B 1X4ZA 4I18B 5HGBB 3UTSE 1M2VB 3QIWB 1CXLA 2A1WH 1CCZA 1RZKH 1X5IA 3QEUA 1NPUA 4KOBA 4PRHE 5EEWA 4PJHF 4D0CB 1BBJB 4JFDE 5KSAA 5B39G 3FRPG 4RFEA 2GSGB 1TQCC 1YECL 4WSJA 15C8L 3IFLL 3JV4B 1AZNA 3GNML 1BM7A 1JF5A 1NCNA 5MHSD 1JRHH 2F5BL 3Q2WA 4XE0A 3WDJA 4HIHA 1G6RH 1NDTA 3GTNA 1OM3L 1DJSA 4XMKL 4Y4HB 2X1XR 1DEEB 1ZXQA 3NQIA 4ZMLA 5IMMB 3U0PA 4XP1H 3QA3A 4APQB 4HK3J 4RNRB 2VOTA 1AQDA 2JB6A 4OGYL 2FAUA 4WU5A 1CL7I 4DESA 3LPWA 3HZMB 2R0LH 4PRPA 5GHWH 5I0VA 3PPEA 4XP4H 2EIEA 4H1LG 4JFYB 1MWOA 4DN4H 5DEFA 4XOAA 3HN5A 1L9PA 2HN7B 3LXAA 3Q6GL 4BDVA 4H1LB 4PGZA 3BP4A 3UZQA 5HHQB 3EKCA 2JQAA 4NHCL 1DLHB 3VFTB 1RJYA 5KZCB 3WFBL 4XMPH 1B9KA 5B3SB 1CVRA 3TVMD 5ERWA 5JPNC 4ADIA 3T3MF 1UFGA 3CDZA 3IE9A 3FFCA 2VH5H 4WHDA 3ARWA 4K3EL 3CQFA 4G7YL 1A7RH 1QLEL 4L9LC 4WWNA 1DVFA 1DBBL 2D7OA 3FKUS 5HVGB 4AEEA 4M6NH 2GJ6D 1MEXL 1Z32X 2C7FA 2HG0A 2ICES 3EZJB 4RISL 4AYID 5JIMA 2BSSA 3VRJB 1DZBA 1RZ8B 5D2LB 5CCKL 1KN2H 4WKZA 1NDGB 4QXGL 1HINL 2N1KA 3CHXA 2E76C 3IDYB 3GIZL 4LCIL 4YHKL 4PVBA 1XSJA 3GK8H 4FNLL 1ILSA 3KPOB 4MAYA 2VMEA 1MFDL 1JGDA 2O5NA 4L4VA 3O4LE 3CPUA 4UT9A 4WFGD 1AQ8A 2X5PA 5KSBF 1TZIB 4U1JA 5FKPA 4MX7A 3DPDA 3CK0H 4JKLA 5CFAA 1MJ7L 1XD1A 5FO7B 4BCZA 3FSOA 4GQQA 1A1NA 4X9YA 5B7MA 5J57B 1PVHA 3RWCA 5IQNA 3IDNA 4NYLA 5FECB 1FDLL 3MNVB 2FB4L 2PWHA 4M93B 3BUTA 1QSEB 1P5VB 1SMOA 2NT0A 3CZKA 4X5WB 3N43B 2HKAA 1CG9B 1ZK9A 1SEQH 4OD1H 3VYOA 3L45A 5CHNA 3FQUA 5D93B 4YHIB 4W9FC 5L7XH 5DJYA 4UIMB 4UM9A 3RWFB 2BY1A 3MBWA 1L9MA 3L2MA 1FGNH 5D1ZA 5HJBA 3UZVA 2EH8L 2WYHA 4FA8A 3IAQA 1MFVA 1IZKA 3A23A 3T6ZA 4F2EA 5KS9B 3HE7C 2XA8H 4IDJL 3QUKA 4P2OC 4IEFB 2EVFA 3VI3F 4OZIB 4KKRA 1QWUA 5IBLD 2BP8A 4QHPA 2NW2A 1F18A 3B7RL 2ZUQB 4HF5L 1DJWA 1L7IH 1NEZB 3NFSL 2A9NH 4P9MH 5HDQL 4M7ZC 4PJ8D 2QV4A 1I3RA 3THML 4X7DC 5FR3A 3C9NB 4NQUA 1K2DB 2VQ1A 2W9EL 3FT4B 2W92A 1JK8B 1XD0A 1D6VL 5DZ9A 3DI2B 4QEGA 1MRDH 5AVXB 3T0EB 3V7MA 3SB3A 4AQOA 3LPPA 2XVGA 5I0WA 4UYQA 3IWVA 3PWJA 3V5KA 1NBZB 1YO4A 1UZ8B 2W65A 3QJSB 4LSRL 4DUXA 1BD2E 3D9AL 4CBPA 1A66A 3NGBC 3IDXH 4OVUA 3WNIA 2KDYA 5I1DB 4HIJA 4P4RA 3P0YL 3MLYH 5EU3A 4HIEA 3REVA 3VFVB 4WRLA 3BVXA 4JO1H 4Z5RA 5F6IC 2XQBL 1LNUA 2EXWC 2J8UF 3LNEA 1BIHA 5LCVH 4HU8A 1AGCA 4JHZA 1KZYA 1F4XL 1X5AA 5EORH 4ZBJA 5DD1L 5H4YA 5I6KA 1CLOL 1UT9A 5E1QA 1ZEAL 4HAKA 2DQGL 1A8ZA 2EECA 3IM1A 4M7LH 4UDUA 4FP8L 3TURA 3PWVA 2AJSL 4C56D 3S4SG 4LHJB 1R5WB 2WXHA 2ZWYA 4WW2C 4XPAH 4AJWA 1YEJH 5C0CB 3A67H 3HPJA 4GSQA 1H3VA 3DVGA 3WO4B 1C9SA 2DMBA 2XWJA 1DTUA 4RMTA 1ZVYA 5JORA 1DQDH 1F13A 1UT1A 4YNYB 3IN0A 4W9HC 3W5MA 4OD1L 1T5KA 5D5MA 5B7EA 3RUGA 2R29L 3D05A 3PY9A 4X5PA 2Q7YB 5FKAB 4WKXA 1UJ3C 2H8PA 4GSDL 4L8DB 1EAJA 2YPLB 2E46A 5CLXA 5BW7C 4ICXA 1AGEB 3O2DL 4J28A 2AKRB 3GSQB 2EH7L 4L2LA 4UM8B 5BW7A 3HNVH 1AD9A 2Z93A 1A3ZA 4R4NC 4Y1AB 3APNA 5H35A 4HKXA 1V3KA 2NY2D 1Z5YD 3F2LA 1JZ8A 2F58H 2OW6A 2W0FB 1AKPA 4PJIE 4D94A 1EDQA 1MCSA 3VACA 1JXDA 3SE9L 3ISYA 5EH1A 5JDJA 2QSCH 1X9QA 4HCRA 4PREB 3VFSB 1DEDA 1YEKL 4MJIE 2ZWNA 4X98B 4DP8X 5FA3B 2VLRB 4UTAA 4WFEE 1MI5B 1U0QA 4LDEB 4M02A 4TYUA 1F4WL 4M6OL 1MG3C 1F3JA 1CDJA 3QS2A 1WQVT 1IC5L 3GSWA 3H4HA 5FLVA 1SM3L 2YEZA 5C07E 2X3BA 4BFGA 1XCTB 2A6KB 1IEAB 2DL9A 5HDRA 5I16A 1U95B 3QHFL 3ZQWA 4QIRA 2BZDA 2ESVD 2VDKB 2ZYIA 3BPNB 3QQ3B 3ZYIA 3TPKA 3BWUC 3FOMA 5I8OL 4O2CB 2RBLA 3KWWA 1NGPL 3TNMB 2ICWB 4X6DB 4B9IA 1LDSA 2XPGA 1NCTA 3RWHB 4BFJA 1ZSDA 1Z9OA 2VDRL 1G9MC 3SPCA 3UPCA 5F1NA 1ZTMA 3IGKA 1YNTB 4L1SA 1ZXKA 2E9JA 3AXHA 3D18B 4Q9RL 4NNYA 3AMKA 4RRPM 4UOW1 3BRFA 3NP4A 2CO6B 2UZYB 5SWSE 4QRRE 1QAWA 3HS8A 3VE0B 3Q2LA 4LLQB 4ZYKB 4PJBA 2R23B 4BKLB 1UOVA 2NLJB 4KK9D 4G6ML 1ACXA 5H37H 1QWNA 2BSTB 3WXVL 3NJIA 1T6BX 4P5TD 1Y7VA 1OT1A 4DSYA 2Y23A 3FSVA 3L9YA 2F18A 3PNRB 4FTVD 3TO4B 4WI3A 3MLZH 4WI7A 2G3ZA 3DJZA 3S2CA 3I3DA 1S7SA 4Q2ZB 3DO3A 4XMXA 4QRSA 3R0NA 2HRGA 3INOA 1IAKB 1SHSA 2ZKHL 4KXZH 3AU0A 2B5IC 4N2AA 4KJWD 4KGJA 3QZOA 4QAMB 3LEYL 4GG6A 3QZWG 3MOAH 4PRIA 3GD1C 3QIWA 5DRNA 5ECJE 5F3BA 1KBKA 2UX7A 2NX5A 2F5AL 5D1XC 3O41A 1OOAA 2NY1D 1UWYA 5IMKB 5C0GA 5IOPB 2AK4A 4M6AA 3ZRCC 4DKFL 4XMTA 3MOQA 3ZR6A 2VXSL 1SJXA 2YFNA 3Q13A 4ZO9A 4DEWA 4HCRL 4KKAC 4BK5A 2CNYA 4JUSA 4JZOB 4OI7A 4BK5C 2Y4SA 4LSVH 4KUCF 5D2LE 3HHRB 3SOBL 1SJHA 4JPIA 3ZYOA 3IVKB 1BAFL 3QUZC 1AS6A 1AXSA 1B3IA 4YMPA 3QJXA 4JPKH 1NUNB 3O6KH 4OFYA 3IFNH 4MMYB 2GIXA 1E0OB 1QRND 4MNQD 3MTXA 3PE9A 4GT0A 5DS1A 4M5ZL 1WZ1L 3HR5B 3U1PA 2E6QA 5F8QC 5HDLA 2EKJA 3MFFB 3VI4F 1T2XA 3MU3A 3B5GA 1TVHA 3K72B 2O5ZL 3N9GL 3ZYJA 3MXWH 3GZOA 1DVYA 1ACZA 4N85A 2QQNH 4JDZB 3NJNA 4X4ME 2ADIB 5TDOB 5F6HJ 3MJ7A 5IF0B 3AMLA 4AITA 2Z65C 5AUMB 2DJMA 1MJ8L 1LTXA 1XZ0A 2J57A 1AH1A 3CZNA 5KTEL 1OW0C 3P73A 3TIEA 4EI6B 2DLIA 3CC5B 4ZTEA 4DQAA 2GITA 4NXKA 5CWSA 1AIFB 3BLKA 1MHHA 3JWNE 4TSCH 1NC2B 1ZAGA 5LGYA 4L5FL 4RQQB 2PCPB 1H9VA 4FFYL 1CWVA 2TSBA 5T1KB 4EDWL 3FRUB 4LO9A 4B0MB 2K9UA 1A4AA 3D48R 1WCQA 1QEWA 3PWLA 2AGJH 4P2YA 4FERA 4R97B 1CXHA 2H7WA 1AI1L 1GIGH 2P8LA 3E9TA 1KPUA 1EEQA 3MREA 3WFEH 2BPBA 1DEEA 4XPHL 5IMMA 2H6OA 2W9DH 1W80A 2HKFL 3Q1SL 8CGTA 5G55A 5LGJB 1HC1A 2QDWA 1T0PB 3C5SB 1VCBC 4Y2DD 5IVXB 1G7QA 4O2FA 4HC1L 1HL5A 3CGTA 4Q6IA 3E3QC 3JWNH 4MCNA 2DEYX 3EBGA 5CAYB 4F3FB 3WG7B 5BV7B 4IBVA 4OF8A 5DS8B 3RJDA 2IBZX 4PJCF 4WWKD 4YQXL 4K07A 2IALB 3DDFA 3GMOB 3VJ6B 3DLQR 4MDIB 2YGPA 3VCLB 1VFBB 3FUDA 4M3HA 4NIYE 1OOWA 2AJVL 4Y2LA 1ZPUA 2ZX6A 3QJVB 4EJ1C 1L9QA 1UJ3A 4MJJA 1G7PA 1PD0A 3NZ8A 2XQYG 2N7BA 2CIKB 2LABA 4P2RD 1DVXA 4ZI8A 1OHQA 2JXMA 4ENED 1TTFA 2VWEC 4ZUSB 3QNFA 3RZWA 4U3XA 4PGEA 1NSNH 3BZ5A 4CILA 3MJGX 3MOBH 4Q14A 1QUNA 3ALPA 4H8QA 1IB5A 2AP2A 3O8XA 4XC3L 3D51A 2JFCA 5BNXD 1CIUA 3C9NA 4R4FL 3GINA 3HS0B 4EZMA 1XIWA 5KVFH 2PO6B 3VDCA 3EW3B 5A2IH 3GO1L 1C8QA 4GOSA 3ARBD 3KPNA 3NDYE 3CFNA 4YXKH 3WS3B 2EVHA 3C2SA 1ZMYA 1T7ZA 2IAMD 3BGFC 1ZS8A 4HJTA 4DGVH 2YS4A 3KPSD 1NAMH 1P1VA 3V95A 2VM3A 1KLFB 2LLNA 1ED3B 2Y06H 3L5IA 2OTUB 1M1XA 3U0TB 3FCSB 3C60A 3NZHH 1U8NB 4ZODA 1T22B 1XF5A 4I48A 2VISA 4W9EC 3OJ2C 4KHXL 4H25A 1TQBB 3NJHA 3K6SA 3T6XA 3VFGH 1BMWA 1Q9KA 4ZW3A 5IW1B 4CKQA 5F7UA 5CZXC 4JVPA 2M1KA 4PJBF 3WJLC 2GSIB 4Z78B 1KYDA 1MQKH 3GI8H 1PY4A 4LGSB 4N2NA 4BWUA 2YKKA 4KDWA 5DS2A 4KK5D 2WZ5A 1JK9B 2MQCA 4PRPB 2FT7A 2VXVH 1E4WL 1R5WA 3FHQA 1BVNP 4K7PH 2E7MA 1B4JL 1XF3B 3GSVB 2VZOA 2QKIA 4P23A 3O3DA 4ABWA 1D7CA 4J1UA 4MB1A 4NKMA 1A9EB 1XCXA 2NTFB 5HJ3A 3RPKA 3QCVH 3T0BA 4GO6B 4PY7A 5AW9B 4H4NA 1TPXB 3GXFA 3B9EA 3M1BA 1KCKA 2Q86B 3CDZB 3DX1A 2KL6A 2EDEA 4CW1B 1NSNL 5D8JH 1H15B 4L05A 3RZCD 1Y1UA 3P4LA 1EDYA 4WVRA 1HCFX 2X89A 4B3VA 4XXDA 3BWZA 3UO1L 2D3JA 4B27A 1NMBH 4H0GA 1MQKL 4L3FA 1LYQA 3ECQA 5TF0A 2GAZB 1IFGA 2R1WB 5DJXA 1JOIA 3CLFH 3CC1A 1P5UB 3L17A 2ADFL 2FSEA 4XH2A 3FTYA 3S7GA 4H5SB 2P5EA 2PPCA 3P4NB 1EJFA 7FABL 1D5ZB 1F5WA 3AADB 3EUUA 3OJVC 4N0CD 2ZSVA 3HHSA 2Z6FA 2XQYA 1K4CB 4JFXB 3H3PH 1MJ7H 4YZWA 4K55A 5SWSB 4IRSB 2CO3A 4YWGH 3GXTA 2CK0H 4JG5A 4OFPA 1CFBA 4N8VG 6PAZA 1G9NH 3Q7JA 3WU1A 4MNQB 5F9AC 4GP5B 2WNWA 4ZFOA 2P5WE 4UMGA 1U3JA 3P40A 1P5VA 3QPXH 4APXB 3GB7A 4JANB 1UM6L 2A6KA 1O5PA 2WUBL 3ABKB 5AOKA 4XBGB 2ETWA 2X6CA 5I5MA 1PW3A 2C9XA 1JFHA 3OHXB 1WTGT 4PHZA 4F2MA 2JLPA 2A6JB 3B43A 3L95B 5I8CA 3FT0A 3IXTA 3JWOC 4Q6KA 5G4OA 4WGWB 5HHPB 2DQHH 2GI7A 3JV5A 2NYYC 5AEAA 1R5IA 2WXLA 1FG9C 1JI2A 1L9RA 3CHQA 3U79A 4U1KA 4AL8L 5AD0B 3CFDB 3EOTL 1G6RA 4XNYH 4GKLA 3SKUD 3DO7A 3VFUA 4HJIA 3ARGC 1M7DB 1A7NL 1DBJH 2QQNL 4ZZFA 1UOKA 2AJYL 5IVZB 4AQEB 4JDEB 3S8WA 5T3ZD 3V4PA 4HC1H 2VDQL 3D39B 4FQXA 3FU7B 4JFZH 1FIEA 3RBSA 3NEOA 4CDGC 1MWAL 2EAEA 3RGBA 2G0KA 4NHUB 4HS6A 3MR9A 1YAIA 2DMCA 5AYUL 3ARFA 2FHFA 3H9HA 2YR3A 3ZRFC 1U9KA 2O61B 4HPOL 1BZ8A 3P9MA 4NWTH 4MQXD 1HHGB 5D1XE 5EA0L 1BXXA 4BZ1H 4ZS7H 2YC1B 3BEVB 1IAIH 3HC3L 4N0CC 4DEPC 1H3XA 2NCMA 3B9KB 1QA9A 2CBPA 2B1HH 2B2XH 4N8PA 3ZL4L 2Y06L 2Q9OA 5IFJB 5TE4L 4K3GA 3BAXA 1ETB1 4UANA 3BSZH 4EOWL 3SO5A 2CBQA 4YSAA 4KKQA 4ZFFB 5F1NB 2A9CA 1KTRL 2W0KA 4FG2A 3CXHJ 4LBEA 5TE6H 3UBXA 3WGVB 43C9A 5SWQB 4NI3A 4DZBA 5JIQA 4JM2C 4NPKA 4M7JL 2RCSH 4L2YA 3GQFA 2F8IA 2ZWLT 4XTRC 1XAKA 2OMTB 1OALA 4TVSa 1DUZA 4GJTB 4OFYD 2DS4A 1BZOA 1LE5A 3JTBA 4KXAA 3QQNA 1EAOA 4K8RD 2WZ0A 2FB4H 5FV2A 3TBTB 5C9JA 3TZVB 1P1ZA 4PBXA 4JREB 4DP1X 3SDDB 2VGLM 3FQXA 2GYSA 4TQPA 3QISA 1BAFH 1JMXA 2LU3A 3GSQA 3OJMB 5DJAA 2DD8L 3MLWL 4N26A 1FVEB 1T2QH 5J6GA 1NH6A 4AWJC 4LVNC 2G30A 3QC6X 2OSWA 5C0JA 3CWGA 2G75A 4M1DH 5A2LH 2QQLH 3ARSA 1E5UI 3AROA 1F58H 3QCTL 1BVKB 2V8MA 3F5WA 4ZDHB 5LWYL 4RWHA 3BUQA 3BOVA 4O9HH 4QRPA 4WQOA 4IS6B 4NEHB 1MFCL 5D2NA 3G08B 2PYFB 3WFCH 3SDCA 2AANA 3KHOA 2EE3A 3D07A 5E6IC 2AK4B 2JQMA 2N7AA 3ARQA 5TE4H 2ICCA 3TH2T 5KYWB 4OZIE 2VZSA 2WD0A 4QYOA 5CSZA 3PWLB 4AYGA 1SHXA 5I8OH 1IEAA 5I5JA 5I16B 1EEYA 2L8AA 4X6FA 2NY3B 5DMIL 4JB9L 5IUSA 3U0PB 4NC2B 4NKIL 4MB4A 4AGMA 5FYLH 1KLGB 1QEXA 2IFGA 1FHNA 5BCAA 2DICA 3DX9B 4KKNA 4OIIL 4XN5A 5F9JA 3MLYL 4JQVC 1F8TH 3PWPE 2NSMA 4ELME 4UILL 1UXSB 2WHVA 4H1LA 3UZQB 2EE9A 5A1AA 1BDYA 2DQJL 2DY2A 5F0LB 1BX2B 2WCPA 3UACA 3VCLA 3AUWB 3FFCE 4F7TB 4ANWA 4C4UA 4L1BA 4Q9RH 2QV2A 5IQMA 1EMTH 3E8UH 5J1AB 4CC0A 2XTJC 4NB7A 1FORH 2JKNA 1E9OA 2WKLA 4RLDA 2YPKB 1I3UA 1EO8L 5CD3A 3CC5A 2APTA 3PWNA 1ZVSB 2WQRA 2X0VA 2WXRA 3IFNL 1T0NA 1GH7A 2MCAA 3L8QA 2BSSB 1INEL 3FQWB 4FQPA 4ZPTB 5IESH 2A77L 2PTUA 3GRWL 4OT1H 4PFEA 5FX3A 1QUNB 2Q2EB 4JQIH 1EJOH 3OKMB 4EUPA 4PG2C 2IDTA 2ZUUA 1VENA 4ZMAT 5EC2B 3FB5B 4GBXA 2K8MA 2WZAA 1C5DB 1W6LA 4IJTA 5DR5L 3CZFB 4J4PD 3ULVC 3HLAB 3DTXB 3RWJB 4PRBB 3ZRSA 2FSDA 2YZ1A 5F93C 3DVIA 4GP4B 5GSVA 3B5TA 1YMME 5FO9A 5EO0B 1YEHH 4LIQL 3HG4A 2YUXA 4ADGA 4JDTH 4F3FA 2J3SA 1I7RB 3TP4A 4LPTA 3RWCB 2XNAA 3BEWA 4PRHA 4YWGL 3RGHA 3UTQB 1BLNA 4Z7AA 5DI8A 4IK6A 1DP0A 1FG2B 1L4IA 5CZKA 2G3MA 3FB7A 4YE4H 1FRGH 1YUHA 1OAXL 4EEEA 4WFED 1J87A 3Q48A 1OAKL 2YAMA 1HQ4B 1MAML 1U8IB 2B77A 3UZVB 3VM7A 1XGPA 1YEEL 1JF1B 4MCMA 4ERSH 4GW4B 3AREA 1CDIA 4JPWH 3PJLA 4PJXA 4R90H 5TFSL 3R0MA 4IMLA 1H6TA 3H9SB 3K0YA 3QIWC 5JR1H 4X4YA 1PDKA 3MJ8B 1J48A 1I9JL 3KMDA 2WN3A 4HPYH 5KZCD 4Y4KD 1T20B 4Z9KB 3MLVH 5IHUL 4WW1A 3TN0A 1BWMA 1T03L 3QBTB 3PLYA 3LKSB 3SCMC 1P7QA 5FUCE 3EYVA 1OB0A 3VSQA 4Q4EA 5DDHB 3G6JB 2F54E 1VGEL 2HKHL 2XWBB 3RIAK 5T8IA 2CKNA 2FJFA 1UM4L 2APVA 2JCCE 3UTPD 3UJTH 3D7PA 3S5LB 4TSCL 3IBOA 2YRBA 1AG6A 2FH6A 2VLKE 3QJTB 5BOPA 3ABMB 1JPGA 4LKXB 5EIIG 1HSAB 2FX7H 3SEPA 3O2WH 4D0BB 5ANHA 3ML8A 1DQQA 5JHDE 5C0FA 2J1WA 4R4BA 3I6LD 5FHBH 1GPOH 3OJDA 4HEPG 1LDPH 3EOAB 3L5WA 5LGKA 4GKOA 4N1HB 5LXGH 3GYRA 4NBXB 4WJ5A 5C07B 5DMJB 3NFPA 1GVIA 5E8DL 1PLGL 1X5JA 2XKNA 4OGQC 3KG5A 3BUYB 2OX5B 4Y9FA 5AKVA 5KVDE 3QGVA 5K1JA 1IKFH 2NNRA 1T5XA 4IKJA 4NM8L 4XCYA 3VXMB 1FZMB 5J12C 1HWHB 3SPGA 3LSOB 4Q58C 3EJCA 3QQ4B 3RFZB 2IANA 1FDLH 3C5SA 4KROB 4W1TA 1G7QB 1FH2A 4WJKB 3RVUD 5IVXA 5I17A 3VFPA 2CLVB 3O6KL 1Q90A 1RMFH 4M61B 2MH4A 5I76B 2QMJA 1XF3A 5E1HB 1AY1H 3UYPB 2D31B 2VDPB 3ULVL 1URZA 3FRPA 4NQSA 3ECBA 1U8OB 5AOZA 4N9GA 3CVHB 2XU9A 5E1IA 5IMOB 3C6SB 4XC1L 4YVNA 5KBDA 4A66A 4BH8B 2HVKB 3TT1L 1N8ZA 3B9VA 1R34A 4XC3H 4ACPA 2ED8A 3U83A 4B53A 1AMXA 1H15A 2UYLA 3DOIA 3LMJL 3ULUD 1T89A 4NO0D 3CZUB 3WKQA 3G9VA 4XXDB 3FQ4A 5DRWA 2R29H 5JQ6L 4OR1A 3WCYA 3T3MB 5CKAA 2E74C 1LO0H 1NM4A 4PJAF 4Y4KC 4XNXL 2AK4D 1RZFL 2UX6A 5CU5A 4JM2D 1BG1A 5FF6B 4MA7L 4XH2B 4LGPB 3T0ED 3EYQD 1UADC 2UWEB 4MD5B 1PY9A 3WJMA 1G0XA 1XF1A 3ZMNA 1WWCA 3RGVC 1T3FA 2VDOL 3IFPA 2X88A 1AGBA 2D0HA 1O75A 4EBQL 3SBQA 1GPOL 1LXMA 2Y36H 3OSKA 5CBEA 2QVKA 4BE6A 2JCCF 4HJ0D 4KXDA 1E27B 2ICEA 2IPUG 1F3JB 3VMNA 3SDYH 4R5TA 1OQOA 4DP7X 4XNMB 4JLRB 1PG7X 4HIPA 1SN2A 1TVDA 2H3KA 3F7RA 4I48B 2YEZB 2VZUA 5EDXA 4HWZA 4L1TA 3HZYB 2QLVB 3KLHD 1OAYL 4MBRA 1G1OA 1DBMH 4N2KA 1SDDB 2W95A 5FYJE 3P11H 1OAZH 3HAEB 4TSAL 3EH3B 4DVBA 1S3RA 5HYQB 5GRJL 4PJXF 5SX5H 2I85A 3TNNB 4P2CG 5A2CA 1RU9H 5C0CD 2VO5A 3QUXA 4FYRA 4KJQC 1I9RL 2W8CA 1IX2A 1KEML 4WO4A 3ZZSA 4ALAC 4PJCA 1V7ML 1UENA 5T3XD 2RQ8A 3ARVA 5JOPE 4AM0Q 3S36X 3AQXA 1I8KB 1KSRA 1IGYB 1P2CB 1CS6A 1HHKA 2H32B 4QRFA 2MJWA 1N64L 1NL0H 3VGEA 4WU7A 1N26A 5IVNA 3MRRA 4OZGB 5BO0D 4AIZA 2HFEA 2HWZH 1JZ5A 2D0GA 4K9JA 4MJHA 4YFLI 3TWCH 3LKRA 4HZLB 1UACH 4BRJA 1CXKA 2AK1H 3ZYZA 5FW6A 4MXWL 5EPMB 2XZAH 1H3TA 2NY2B 4V11A 4XMKH 3G6AB 1SF3A 2P49B 2FEEI 3BVNA 4K7FB 5GGQL 1S9WA 2X70A 1M7UA 1GOFA 4A04A 3HG2A 1K6QH 3SKOA 3SOBH 3V0EA 1QSED 1JZ6A 4UNTA 3GNMH 5DJ8B 4L8CA 3VVWA 4GQRA 2D7TL 4M29A 2JKTM 5ESVA 2X3AA 1CDBA 4JHUA 1BVKA 3LZPA 4M43L 4PSRA 4BIKA 4KK8C 3QI9A 3UCQA 2K4AA 1ZANL 4QRPB 3IBEA 4JPQA 5SWSA 4FQCH 1W0WA 3AU1A 4QJ4B 1MCHA 3DGGB 4IMKA 1QFHA 3DRQB 4WWKC 1K3IA 4UQ3A 4LEXL 43C9B 4F24A 1NCWH 3FU0A 4MNGE 4EMZA 2QQQA 4R6UA 1MUJB 3HMWL 5E70A 1UT2A 3KM2A 1XL4A 2WXMA 4G80A 4NQXA 2HT2D 4CC1A 3GB7B 1YYMH 3QPXL 4C83B 3HIZA 5DJ6B 3G5YA 3SY0B 1WZAA 4HH9A 3VXRB 4TS6A 5FYKD 5JYMA 3VFMB 2GG1A 5LDSA 5E8OB 2JKXA 3O3BB 4A38A 3FTGA 1V7NL 3IK2A 4L4TA 4JFEA 3HNTL 4YHYB 3GJFK 5IG7A 5L2KA 4BFBD 4QTFA 1KPVB 2VH5L 3X11A 4X6CE 1GGCH 3S8GB 1FN4A 1C1EH 3L5HA 3ZDZF 1RKRA 3CBJB 4QRQB 3MRBB 4A2GA 5HXMA 3MFFA 5J6GB 2X6AA 1RZGB 2V9QA 2CLRA 5KEZA 3NZUA 4RGMB 4EIGB 2ADIA 5TDOA 4MJIA 1L3WA 3CXHK 3FBKA 4QXGH 2PLTA 1G84A 1L9TA 4PP2B 4Z7VE 3MLPA 1SBSL 4NQDD 1MIEL 2O5YH 4P5TB 4AQEA 1UWXK 5CO1A 1L5GB 1Z9SA 3BVTA 3SGJA 2R59A 1E5AA 5CWSB 4FTVB 2PWGA 5DSCA 2AJ3A 2AVFA 4HPHA 1CJYA 2VUKA 3JSSA 4DKEL 3ZUCA 1HXMB 2NY4C 3PG2A 4RMWA 1KGUA 4HX1B 4OD3H 4B9KC 4B6ZA 1NUGA 2GSMB 2D7PA 2AEIT 3CVIH 3JVGC 3COOA 4NKDB 1FNEB 2H5UA 1G9ML 2JELH 5H2BB 3PAUA 4Z3TA 3LOWA 4IU3A 3ARDD 2QQLL 1I31A 2CKBL 3HFMH 3I9GH 4JFDB 4HKZB 5LGJA 2DMGA 3RKDC 3T3PB 5CD5C 4FHKA 3BLPX 3AAZA 1X7QA 1H8LA 3O6FD 2J88H 1J10A 1IM9A 2NY1B 5E94B 3RL1B 2A1WL 4NERA 3ZHLA 5C3LD 1LO3L 1QSZA 3FO0H 3UGEA 2EH8H 3L3JA 1A1MB 4BK8A 3W9DA 1JHTB 3X3FH 4GKZB 3U2SB 2WOYA 5DD6B 2V7HA 2NOYA 2ZSWB 5IB1B 2DMKA 2HJFB 4ZD3L 4AKPA 1VIWA 4FDWA 1A6UL 4DGWC 2F5BH 4IYKA 2BNRA 1Z7JA 4OV5B 1LWRA 2IH1A 5LNEA 4JKPL 3VGBA 4ZXBC 2Q7NA 4L1DA 3KAAA 4X8GA 3WHE1 3PHQB 5DA0B 1LE5B 1CD0A 2HUHA 3RX9A 1AR1C 5IJBC 2NDGA 3KYNA 4HUWA 2VW7A 1JP5A 5EMYA 1B2WL 5CCJA 1AZCA 4L8BA 4UV7H 3FQXB 1M9WA 4X4YB 2OL3B 4JHWL 3D12B 1OL0A 3V5HA 1GGUA 1ZA6B 2Y6TE 2ZUYA 4D9QE 4YDJB 4ZNCD 3B8YA 5IQ9A 3GPEA 2ZYRA 1ACCA 4EUPB 1CUOA 1LGVA 1HINH 3EYSL 1NLDH 4MQSB 4YHKH 2JTYA 1U8CA 4G59C 2LT9A 5DTFB 2I07A 4XBEL 3HE7B 1E9PB 3CN4A 2L7UA 1BZ7B 1ZRUA 1UXMA 3TCXA 1KLFA 3CDGA 1QLEH 1IAMA 1TMCB 3CSBA 4FJYA 1C5BH 3LH2H 4AENB 1TZGH 2EVIA 2VISB 3QPQD 1QTYT 5SX4I 3E1F1 1HIMH 4WWKA 1FF5A 4NRYB 1WFUA 1EFXA 2CR0A 3OKOA 4WJ5B 1OWRM 4JVWA 3ZU8A 4AL8C 2ZCKL 3GMNB 3LQZA 2XKNB 2ATAA 4FLHA 1KCRL 5FHBL 4Y2DB 1G9MH 2JELL 5F9WB 5KBNC 2NDFA 1I7TB 2RB8A 4QI3A 5EU5B 1KGCE 1OPGH 3SDCD 2P7TB 1MFEH 3VM5A 3MRMB 3QR0A 3K5SA 4JO1L 4AL8H 4ZFZA 2R7EB 4HUVA 5F6IB 1QBBA 3DOSA 1HH6B 2B3IA 1N67A 3TYFB 3ZLQC 2R0KH 4F7MB 5DQDH 4BWWA 3NCJH 4FTVE 4QDGA 3TN0B 3A6CH 4D9LL 4NJAH 2J8UE 3LKSA 2D4FA 3FRPB 1A4KA 2E75C 4O00A 4KH9A 1KGYE 5DDHA 5E8EB 1FYTD 4UT7H 3UYRL 1HL9A 2QLYA 3L3HA 4NN7C 4MHHG 1S7XB 3CFTA 1ECZA 5BOZG 4NDMB 5G5DA 1OEZW 5EC1B 1MCKA 2XWXA 3A4AA 5CNHA 4NFBA 3HZ3A 5HGAA 3DI3B 3ASOB 1MFEL 5ALBL 3MRQA 3S6CA 3VA2C 1OP9A 1ONQA 3KPPA 5IMLB 4OGAD 3KLAB 5EO1A 4HQQL 3OAUL 4EAEA 5M94B 4A7UA 1HL8A 2ATKA 2FYYA 3ARXA 3SYQA 1Q1JL 3M8OL 5C0NC 3C8HA 1CFTA 5BO1L 4K23H 4PRBA 3F01A 3T0AA 1QNIA 1BQLH 3G5VB 3L3GA 4DP2X 1MIML 2CJUH 3FHEA 3FONB 3M17B 4U3HA 2HSIA 1Z0MA 2J6EH 4F7PB 1HQRB 1J1OL 3QEHA 1U8PB 1QNZL 4GW5A 2WPGA 3GKWL 1RJLB 1NIDA 1UCBL 3NCWA 3SCMD 2CKBH 3HFML 1JZ3A 1LEIA 3OAWA 3RL2A 1HOCA 1UVQB 3V52H 2F1AA 5A6LA 4I87A 5IESL 1GGIL 1J5OH 2QPFA 3BWAA 3PUCA 1CXFA 2PNDA 4NO3A 4K8RC 1ID2A 4B9GA 2WSKA 5D71H 2EACA 2YKLL 5CP7B 5C08E 2GJPA 4I2XB 4Z0XA 3BYTA 3F12B 2UZIH 3PGCB 4PJXB 3W0WA 3EH1A 1HSBA 1XGUB 4MMZC 2VXQA 4QKXB 1INQB 3QJFA 3RA7H 1VADA 2D3VA 1EMTL 5F0MB 3BKJH 3BN9C 1OTTD 3INUH 3H2QA 4JFHE 3LHPL 4PCYA 1N5AB 5D7LB 5I74C 3D08A 5K9OB 5KAQG 1T3FB 2ZONA 3IDIB 3G6JA 1IGJA 4LSPL 1WV7T 1AZRA 2ZXCA 4NCC2 4XN4A 3N42B 1MVFA 2F7OA 4OZGF 4R84A 4OZGA 5TPWL 5I30H 1KB5L 3E6HB 2H1XA 3C12A 1EBAA 4B96A 5I1DA 1WICA 3ME0B 1ZCRA 3UADA 4WO4C 5IIEA 2I9TA 3QG6B 4TNFA 1JWUA 1DVTA 5C0FB 4TL5A 3V4UH 3N85H 3EXLA 2JKSA 3OJDB 3TBCA 2CO7B 4OZHE 5GISH 4IRZA 5B8CA 5I1CL 1E2WA 2J5LC 3ZKXB 1YDPA 5IB5B 4KBPA 4Y19D 1ZLWK 4ZOBA 1U3HD 1QA9B 4OJEH 3QSKB 1KACB 5TQ2H 1FA4A 3AB0C 3LSOA 1O6VA 4U1HB 4UIKH 2OZ4A 5GS0D 3B2XA 4M8UA 3BP5B 1UASA 4I1PA 2Y5QA 1F0LA 2KC0A 2WVUA 4ZK8A 5KUMA 5F8RC 3GXPA 3L7EA 1MCBA 3SKMB 4NQSB 4LRIC 1RULL 4H0LC 5CGYD 3LRMA 2JKJA 1WBXB 4PJIA 2BIIA 4UUJA 5E2JA 4QLRA 1XGRB 3VWKA 5D5MB 2VE6B 5J6HA 5J11B 3Q9PA 3CCHB 4ZUTB 4W70A 4A2DA 1BOGA 3MCG1 2FLRT 1A02N 2X6MA 4URKA 4GSXA 3ABZA 2OS7A 2O30A 2Y6SC 3GMQB 1HWGB 1XXFC 3VH8A 3ABLB 1I8IB 4PJ6A 2DLTA 2IFFL 1EV2E 1T21B 4G7VH 2AJXL 5DURD 2V9UA 3NIFB 4PJIF 3ATBA 1GYUA 4FHBD 3L48A 1G1CA 4PP2A 2AQSA 1CR9L 3EF7A 2UV3A 3MA9H 3R18A 4P5TA 3BPLC 1X7TA 1BBDL 1N59A 2G0LA 4V1DD 4PB9H 5CBEB 1UXLA 3I6GB 3WLWC 1IBFA 2KZ1B 2ZOTA 3AQZA 3QUGA 4Y5XA 2VLRA 4TOYL 4CMMA 4KUZH 5F3HA 2QVTA 4X7SH 5AVTB 5GRJH 1MCWW 1QD0A 2V37A 4ELKB 2DB8A 4N8CL 3K81A 4HWZB 2VMDA 3ULSB 5HYEA 5I1AA 4Y4KA 4QHNB 3TN0D 5H2BA 4ZX3A 5JW3L 3NPZB 4OZHF 4P05A 2ZNXA 3ESNA 3WJJC 4XAWH 5I1CH 3QZNA 1IEBA 3WN6A 4N90D 1N7ML 3PHOB 2ICWA 3KR3L 3T3PF 3T8MA 5AFAA 3AJ7A 3X3GL 4KV5F 1JZEA 4GXVH 1BIIB 4Q52A 5EU4A 5JIIA 1UD6A 2FRGP 2V7NB 2EYSA 3VXQB 2GTWB 5GS0C 4UTBA 1HXYB 2OSLB 1OAQH 1IQDA 1DQML 4B9JA 5EDSA 3VGDA 1X5KA 2ZD0A 3BP7B 2Y36L 3D0LA 1JZGA 4PYHA 3HG1E 5KG9A 2AEPH 2AV7A 3HBZA 2OYMA 2ZUTA 1MRFL 5I1IH 4NAMA 4S1QH 1I1YB 3RNKA 4Z7VF 2BNRB 1JGIA 5C6TH 1E9OB 4GMTH 2XN9D 1W8EA 4HCRH 3L4ZA 2J8UA 1IO4C 3HMXA 5A2JH 4D9RD 1WISA 1DSWA 2AERT 1A6AB 2NNAA 1KTLA 2K9FB 4M1GH 1YNLH 2BO0A 4LMQE 4LPWA 1AO7A 4I88A 3ECUA 2F15A 4R7DA 1DJZA 1PZ2A 2A83B 2VZ3A 2EDBA 1BQHG 3D52A 5EPMA 1CT8A 3N43F 4XPBH 4KNSA 2PKDA 4PG2A 4DPRA 1WD9A 5CILH 4BH7B 4KOCA 4ZMYA 3HMWH 3LPOA 5IM7A 4OZFG 3A6OA 4PBWD 5ETUA 4K3DH 1MPAL 5K39A 1J8KA 5IK3B 3QXUA 1XMEB 4YEFA 5LN4A 1BZ7A 3ILDA 4MX7B 4U1LB 4YR6B 3K46A 2UVFA 2V3FA 5KSUB 5F3BB 1ZANH 4UQCA 3AG3B 3VI3B 1IMHC 3O41B 1R3JA 1SOXA 3UTZB 4Q9QL 1F3RB 1QSEA 3PAYA 3GHBL 3BDXA 4X9FA 4PRHD 3QDGB 4A6YB 4JFSA 1U8LB 4OIFA 1BQKA 4ZSOE 1BM3L 4F57H 3PHQA 4AYMC 2DQCH 3U9PH 5C0AE 5I1LB 4HLZH 4X4XB 1JF1A 3GXDA 3UO1H 3B6SB 2IXQA 4WTQA 4HUWB 2ADGA 2JIXD 4DVRL 2J88L 2LVCA 1AZBA 1LD9A 1K8DA 2HWZL 3ARED 2R2HA 4OLZL 5FB8A 1FN4B 3V6OC 2P5WA 2EKSA 1WE5A 1E43A 2BCKB 2CXGA 5A16A 3APFA 2EO7A 5IQ9B 1JMZA 1S5IL 1UB6A 3ZO9A 1PBYA 2QHRH 3ZZ1A 1PKQA 1M71B 3LXCA 3RVTC 1F41A 1XB3A 1UEYA 2BNRE 4KXBA 4Y88A 4ZUUA 4EE2A 4GKSB 3PWJB 5L2KD 2NY3C 1U91A 3FFCB 1UACL 1CPUA 2FWLB 1D9KC 5AW0B 1DBBH 3HOGA 1HSAA 3FYEB 4EI6A 5KSVA 2KI6A 4HD5A 4LHUB 1J1PL 5I66B 4O5LH 2ISDA 4GAYA 3WNMA 4AOFA 3RHWK 5D7JD 1K5WA 5SWZD 1I4FB 4JFFA 2OYKA 1J8HD 1OSPL 3OKOB 4DP4X 1OB1A 4PJ8C 4XZ4A 2FDBP 5HVFB 4NHCH 2ATKB 4QNPE 5C3IA 4YFLF 1BVLA 4OUUA 3AACA 2DWYA 3VQMA 4LL9A 2XOTA 2HRHA 1AQDB 4FLOA 4CSTA 4NUJA 1VA9A 2CALA 2A4CA 3SO3B 2YD7A 4M8QA 5EBMA 1A2YB 3QORA 1NGWB 2HB0A 2KQMA 3FONA 2GQHA 4LL1A 4R7VA 4EI5A 3MGOA 3EGSA 5I1GH 4C55A 1BM3H 1P5UC 1T0OA 3F65A 3MJ9L 4UF7C 4H88H 4DO6A 2FBJH 4QTIL 1RJYB 3C5XA 4P3CL 4FQJH 3QHZH 5DEGA 3PUUA 1CO1A 2JJWA 4RDQG 1QSFA 5HGHB 1FSKC 3BQVA 4KWUA 1RXLA 5JA8B 1IFHH 2YD0A 5IHHA 4UM9B 1T89C 5D70H 3FYIB 3ECVA 4UT9H 5EC1A 1ZGLA 5FUCC 4KGLA 1TJHH 1ZHBB 3EBHA 3BCDA 2A5UA 3N0PB 5B38B 2X6UA 4OLXL 4WKZB 2CWRA 1F6AB 2BP8B 2GUYA 4Y5YA 3V0WL 3L9RA 1VFMA 3CBRA 5JDSA 1F4YH 4OIAA 3Q2VA 3FT4A 5DEZA 1MLBB 3N44F 3MCLL 4XP5L 4YFEA 2YMTA 4P8QA 4F37K 3IJ8A 4EI0A 1YLBB 1HILB 3US1A 4ZXBA 4YDIH 1QZNA 4NENB 4X80L 5BRZA 5FKPB 3QFJE 1MFBL 2DYPD 2ICEC 2WC7A 3JV0A 3QNYB 2ESVE 4MSWB 1D5MA 4KX9A 4TNWK 1JNNH 4MJ5B 4MDJA 4MVBD 4P4RB 4OLYH 1Z9MA 3ETTA 2O1AA 3JT0A 3WTYA 3MRFA 2QADD 5FGRA 5D7JC 1Z2KA 2IDCA 5C07D 2FCBA 2XT1B 3WFEL 2MCMA 5AENA 4ISVA 5BZWA 4POZD 3NIDB 4UTBH 3SPVB 2WWMD 1AGCB 3O81A 2AJUH 4AZ8B 3WOVA 3U7YL 5F1SA 3FUFA 3DBXB 4QRAA 2AABH 1U42A 1E4HA 2FGZA 2R7EA 1MFUA 2Z7WA 1BJMA 1OANA 2R9HD 5J3HC 4JFQB 5I0XA 5KWYC 4A2HA 5CEYB 1ZHNB 4HWEL 2EILB 3QUXD 1WAPA 4O58L 2VKXA 2P52A 1KGJA 4E5XB 1VSCA 5K9OA 1TOXA 3T0EA 2VAJA 3RIFK 1F45A 5KOMC 1SLUA 3MFGB 3ARDA 3GLZA 4GKNB 3V5KB 4UUJB 5ALCH 5LB1A 4FQHA 5AZ2H 3ZE1F 2H6UA 4J3BA 4OLWH 2OMNA 3ERXA 1H3UA 4DK3A 5K1NA 4LSTL 1E4KA 2WCGA 2XTSA 5GGSY 5T3ZL 3GGWA 3JYCA 3KHQA 2NY4D 2WZPA 3KPPB 3QO1B 4NZDA 1S7QA 1E8XA 1RZIA 5EO1B 2XN0A 1CD1B 1TYEB 2OMBA 5B8CB 2GTQA 1A6ZA 1RPQA 1LEGA 1NC4D 1P5UA 2MSPA 1MNNA 2RTTA 1YDPB 5IB5A 1IT9L 1LE9A 3EYOA 5CILL 2A74A 2VLKB 2NQ3A 3KCPA 4UB0H 3MLUL 4YSRA 1CFTB 3FU3A 4HKBB 3VWJB 5TDNB 1RK7A 4EUPG 1G7LA 5KVGL 4PWJA 4A2EA 3M17A 1IC0A 5E9DA 5KVEL 1FL3B 3US0A 3V9EA 2WK2A 4ZAKC 1N70A 3LNGA 1COBA 3GSWB 4HW6A 2GB2A 3VQ2C 3CXDH 5ELIA 2OM5A 3ARTA 4Q56A 5I6PA 3ES6A 4Y4KB 4F5CA 3IGLA 1QNZH 1KG0B 3H2PA 2E9GA 1O7VA 2UXFA 2YXVA 1NOFA 4GRWE 4M4RB 3ZTNH 2NXYB 1VEOA 3OKYA 4QO1A 3TFKD 3C08H 2TRYA 3ET9F 5GGQH 1KJ2A 5C0AB 3Q3GB 5E6IB 1U41A 5F7BA 2IOIA 2XIDA 4I9XA 4JL2A 5C6PB 3TA4D 1GGYA 5GGUA 1EO8H 1XGUA 2JKIS 4O4YH 1FORL 1J11A 3QJFB 1FH5L 3L13A 3WHXA 3KPMA 3X3GH 4JG9A 5DO2C 1YNTA 3AY4A 5CF3A 1T21A 2OMVB 2VDMH 4M7JH 2GT9A 3QUZA 1TKWA 1MRCH 4XCEA 3O4OB 3W38A 4HA1A 5JXAH 3HZVA 1YMMB 2XV0A 3IDIA 4LOUD 3IJHA 1DN0A 2WSPA 5I1JH 3ZR5A 4YLCA 1UGNA 2XWEA 4NNPL 4Z95L 4MMXB 5HHXL 3DWTA 2P5PA 3EGDA 2VXVL 2B2XL 2IADB 4OCLC 1NMAL 4U1SA 4KVNH 1OT4A 3OKLB 4JRXE 2ID5A 1MW1A 1VGEH 1C08A 1MW3A 5KANG 2COQA 4PR5A 4UT7L 1QEWB 3E8UL 3AITA 2VTFA 2CPCA 4AQZA 2UVEA 1OAZL 3LHPH 4TSAH 2ZG3A 4QRSB 1HHGA 1H5BB 3PABA 3RNQB 1QYGH 1U6AH 4HK0B 3BZEB 4RFNB 4JE4B 4UQ9A 3IRPX 1JVLA 2NY7L 2HTLC 2QPDB 4NO5A 4ZMPA 2DL2A 2KS0A 5DUPL 1U58A 2OXHA 3O6FA 1GKOA 4OQTH 1E4JA 5DS8A 3ZN6A 2V7HB 5GGRY 3EG9A 4NO2B 4RFOL 2JJTA 5F7EH 1WBYA 1G9NC 2VAAB 3MLXH 4AIEA 1HZHL 3VG0L 2ARWA 1GC1L 3SIKA 4NQEA 4XOCA 4AQ8A 1SRDA 3I3BA 1T04A 3RPIB 2F54A 4HUUA 4IIQB 4IBZA 2IC2A 3TVMC 3VRLE 2JIXA 1JNHB 2FWOA 2PMZA 3PREA 2Z9TA 5ABAA 2R1XB 1XSKA 2L7JA 4NXSA 2VLLB 1FGVH 4CN4A 2A6DA 2H1PL 1MIMH 2BRRL 2CJUL 5JW5B 3MNZB 4L8BB 3GJFH 3R1GH 5EBLA 1IV8A 1V5JA 3HR5A 2BRRH 1VGKB 5INCB 3EHBB 4YHLH 2EKSB 1S7SB 1KJ2L 1UM6H 4BE5A 3WTSA 1BEYL 1V8HA 2ZF9A 3PL6A 4HYTB 1D5IH 4FI7A 4BHUA 4QWWC 4RRPG 1AC6A 4LSQH 3KYOA 5IF0A 2X1PA 3MRHB 5LAXA 4PJEF 2R2CA 4LASH 2NZ1A 2Z0UA 1X5MA 4OGZA 4L4VD 1K5NA 5DHMC 1OCZB 5GGVY 3U7WH 3U4EB 3NIFE 4FAAB 3QUYD 1J0ZA 2GITB 3G08A 4X9HA 4URTB 5D7KE 1R3JB 3W0WD 1ORQA 4RQQA 3QUMH 4PQXA 4MCZB 2G4EA 3WSQL 4D7BA 4E9WA 4H25B 1OLLA 2BVUA 3BW9A 3HA0A 4RGOH 4JVUA 1JHLH 5I1AB 2BSBA 4R26H 5F7FA 2NMSA 2EE6A 3IDJA 4LAJH 4X6FB 4FQLL 4WI5A 5B1JC 3T1FB 1KTJA 1OGTA 2PPAA 1DJHA 4KDTC 4DF9A 3VGAC 5KAQF 4E9LA 1G0YR 4KKPA 4EI5D 2BLFA 1EVTC 5EU4B 1TITA 4P5TC 1LEKA 4CDHA 1NBQA 3MNMA 2NY5L 3JT2A 2GTWA 1OPGL 3W5NA 4P2AA 1JNLH 3CTTA 4XO9A 1A5FH 4GS7C 4AYDC 4KVCH 2B8OT 4QOKB 3D0LB 1UOWA 1SUJA 1MHEA 3WFDH 1BZ9A 4PJCE 1D7BA 4BFIA 1TTRA 1UB6B 2AZAA 2Y7QA 5HDQH 3LQAC 3QRBA 4IGBB 1PX3A 5AUMA 1NC4B 2Z91A 5KSBA 1IC7L 3GBEA 4X0NA 5AAWA 2CJ3A 1F02I 2C7UA 3B2UC 1LK3H 4M5ZH 1UKTA 3ESOA 4XRCA 4A7GF 2DRUA 4ELMA 4XOBA 4F1SA 4ODWB 5D72L 2R9HC 2NY1C 3M7OA 2EO1A 1BXAA 1P4LB 3MUGB 1XXDC 2E9IA 4JPWL 4ZMOA 4R7DB 2HUEA 2EXWD 3ESVF 5L9DL 2IGFL 3UJIL 3P0VH 4IBUA 1SY6H 2P8LB 4UAOC 3FMGL 1FC1A 5GGSB 3KDPB 3VXTA 1JXKA 3OKMA 1KNOA 1JWSB 1CXIA 2X6VA 4I0PC 4WK0B 1PG7H 3L7FA 3AT8A 3B2DC 3FAWA 5IK3A 5GRVK 4ZXBB 3PIQB 3D69B 4WTZG 5FO9B 1AMYA 1DL7L 3M7FB 1AR1B 3QJOA 5IB2B 3POCA 4EVNB 1HQRA 2CRIA 4GXFA 5MERB 1G5AA 2ZT9C 1KFAH 5JNYB 4WI4A 1MCFA 4D0DA 4YDKH 1ZHKB 3CX5J 5DQ9B 1ZLSH 2DAVA 1ADWA 4JM0A 4GUPA 5CLTA 1AGFA 1L0YA 2J2ZA 1LO5B 3LH8A 4PJHB 3UJIH 4YUEL 4G8GB 4FKHA 5E0FA 1KXQE 3B3IB 1AI1H 1GIGL 4MJ2A 5K1VA 3N1GC 4UQAA 1D5RA 5CP7A 4G9DB 2VLJD 4FXKA 2F8VA 3CN0A 5J6SA 2AFNA 2IQ9L 3UJJL 3L4YA 3K2UH 2D4DA 5AD0A 1HI6B 1Q0XH 3FCGA 3NRPA 1FLTX 1ROCA 2ZXWB 3MZGB 1IE4A 3SE3A 4K5LA 3D30A 3O3DB 2CBOA 2J55A 4FI6A 1DDTA 4NKMB 3ZQXA 2IPKB 2QSTA 4ANXA 4FFYA 2FUTA 1UB5A 3MRLB 4PN6A 1QMUA 4NC0B 4Y2DC 5C08B 2AMUA 1I85A 5EUKA 4MSWA 4OD2A 2ENQA 4DCQA 2KUTA 4F8NA 5FS5A 3BIBX 4GUQA 4OGYH 1KFGA 1PTZA 2EP6A 2XZQL 3H9HB 2Y1VA 5DO2D 3V6OA 2AJZA 2LOEA 3LKNA 4U6XA 3L6FB 2IV8A 1HKLH 2DQIL 1OB1B 3PDGA 4TRPL 4TUOA 4G3YL 4WWPA 3V4VL 1FBIL 1RZJL 3KXFD 1SFDA 4YBQC 2DIAA 1GGCL 5CJXC 1WD8A 4NT6B 3CFIC 5IQ7L 2VXSH 1G1YA 1C12B 3FO1B 4TVPE 4M8QB 4HJEA 3D2UB 4N0RA 5CJ8A 5KBPA 3ESUF 4JFQA 1CTNA 2VLRE 4DK6A 4G1MA 1BHGA 2FEDC 4F27A 4EN3B 4N6QA 3UROR 3P2DA 3OAZH 3IWUA 1MFMA 4KITB 4GW1B 3EHBD 2R2BB 3OTTA 2Y7OA 4N8VA 2EDLA 4NSKB 4PRPE 5BV7L 2F61A 3DO4A 4S1RH 3G5XB 4XPTH 1WZ1H 3OV6A 4GUCA 5MI0B 3S35X 3POHA 5FGCE 3X14B 3BH9A 4OU3A 5JZ7C 1JHKH 2X3CA 5KBKA 8FABB 1MNUH 3VWKD 2V8LA 5F7DB 4ZX5A 1N4XH 2VM9A 3GSRB 9CGTA 3KPTA 3RVXC 4PJDA 3SY6A 4LLYA 2MEJB 2YAOA 5F7MC 1F6AA 3IKKA 3QQ9D 4MXVF 4LCWB 1IU1A 3U36A 2QZ5A 1M4KA 3LD8C 2ARJQ 3WTUA 4AQ1A 5B21A 3H4FA 4X6BA 3KJ6H 4H8WH 1MLBA 4EKJA 4E0RB 4P3CH 3QH3B 2PW2B 1ZLWH 2HLEB 4I13B 4LNRB 5I19L 4YGVB 4F8TA 3SDCB 3I85A 1LJMA 3KS0H 3OXSA 1WFTA 2MWCA 1EWHA 1QBAA 1WFMA 3JWOL 3OX8A 2HCZX 4V1DA 4KNQA 3TIDA 2W9DL 5KYWA 4ZW7A 4MMZB 4A68A 4LCVA 3QP3A 1ES0B 1QLFA 2HJLA 5DLML 4U3CA 2W0LA 4DERA 4E9XA 4QOKD 4PRNB 1Y1DA 3GJEA 3DHPA 4Z76B 1U3HB 3D85A 4UTBL 4NUPA 4LU5L 3PDOB 1IIKA 4PJGA 2V2XA 2GHZA 2YQGA 1FYTB 5HHPA 3C09C 4X99B 2YBRA 1Q9LB 3JXAA 1B0GB 1YNKH 1F90L 2GC7C 4UZUA 4KZEH 1JPTL 3O6ML 5ALCL 4AH2B 4NJ9H 4FXKC 3EO9H 2VDQH 3CFDA 1MH5B 3JTSA 5KYUA 1L0PA 4WO4B 4Z23A 5I19H 1HKFA 5DFVC 1UD3A 4WSKA 5E7FA 1FFOA 2AJYH 4JY5L 5IQLA 2VIRA 3L4UA 4HBCH 2O5ZH 2F54B 3G6JE 5DMGC 1Q9OB 3GSOB 4OV6F 1WZMA 2YEVB 1KV3A 3P02A 4BZ1A 2YWZA 4WHYG 1N9PA 4Z7NE 1A6AA 3ULUC 1MF2L 5A3ID 4PP1D 2NNCA 2X1OA 3EGDB 4KTYA 3NJVA 5DQJB 1Q0YL 5DA4A 1M2OA 3WLBA 4DW2H 5KTEH 5HYJB 3OKLA 3TEZA 3AUVA 3CK0L 3QEQA 4JQXC 4NHUA 1TDQA 3H9SE 4L3EB 4WGKA 2IQAA 1CURA 3QO1A 3W0WE 2WZ6A 3QQ9C 4JN2A 2DMHA 4NNXA 2A73B 3RU8H 4F57L 1N3NB 4POYA 1HYSD 3LX9A 3DV4A 4NZ8A 1HEJC 4TULH 1F1GA 3KYOB 1GGBH 5ESVB 4HUMB 4CUCA 3PJSB 1DVFD 1NOAA 1JNNL 4P4KC 3E2HC 4G8IB 5I0DA 5KSAD 1KN2L 1YCSA 5CIPH 5I1GL 5AOIA 2KLSA 3DUSA 3OWRA 4K8RL 3PV6B 2BIPA 5D7EA 5MENE 1H9DA 2HX9A 2PF6A 1UZGA 2R2EB 2FIKB 1NDMB 2X38A 2BDNH 3FO2B 1OCWH 1QPPA 4TSBL 2PXYB 5JIPA 3ENEA 3LKQA 2VRKA 4KRPD 5JQIB 1V3LA 4JRXB 4BSVB 2JJSC 1DO6A 1MCPH 4JG1H 2IXQB 3VFMA 2XSKA 3LRHA 3GSNB 2A6DB 2JE8A 3WNNA 2IPTH 2R56L 5FPIA 3BMWA 3T4YA 4JFEB 3WL9A 4PHXA 1PDKB 3BPLB 3V0AC 3ILQD 4OSUH 1VZGA 4TULL 2YD9A 3OR6A 3TC9A 3DECA 3ZDZE 1K4DA 1KXTA 1UXSA 3QXDB 3ML9A 5E95B 3CFJA 1BX2A 2FK9A 3PL6B 2J20A 2QVMA 1KCLA 1UZ6E 1BMZA 4DKAA 3S35L 3ALWA 2XWBA 3ARBC 2X4SA 5FYJD 3JZYA 3WFDL 1R3KB 3KXFB 1HNGA 2AXWA 2AABL 5E7BA 1WUZA 3FT3B 4DN4L 3B3BA 2UZPA 3FO9B 5DSCB 4RFEB 1UM4H 3E9UA 4LCYB 3VNYA 5KJRL 3SZ6A 3I2CH 1HXMA 1UJTA 5E5MB 3C60D 1FAIL 3MRNA 4N0UE 3OGCB 2ERJB 3MUHL 1F1DA 3LCYA 3GMPB 4NC1E 4ODVL 4EN3D 2M83A 4IU2B 1L7TH 3ZQ9A 1LQBC 4U1GC 3X1NA 1IC5H 4KJWC 3C2AL 3JBG7 4YL4A 4AM0A 3CZFA 1CD8A 4OLYL 5CCHE 2HFFB 1TZIA 1V27A 4U4IA 1BXUA 1NGWA 4TOYH 4QXWA 1V10A 4XVTH 2QSCL 4PGJA 1I9IL 3L3JB 1U21A 3DXAE 4FJ6A 4F91B 2GPZA 3BEWB 4PRHB 1PLBA 3IKCB 2G9HA 4PJAB 1CGUA 1NAML 4BDVB 4U49A 1DBAL 4R9HA 1BZ9B 2VMFA 3MRDB 3SSGA 4HFUH 3ECBB 1RZPA 1QWHA 2CHZA 2FVNA 1MFDH 3SGEH 1Q8MA 3C6SA 5HDWA 3FTVA 3RPIA 4NQQA 3K4ZA 1YY9C 3M45A 5DUBA 3RRQA 3AZUA 2B1OA 4BQBA 2JIXB 4ORZC 3K6FA 3ULVH 2DQFA 4JAMA 1TZ8A 4GB9A 1IAOA 2J21A 2WP3O 2Q8AL 3AREB 3QT2A 3OLEA 3TT3H 4XAKD 4GPVA 4YK4C 5ITFB 4OCRL 1FZJA 3GSXB 2BM3A 3VX0A 1NZRA 5D70L 5B22A 5LWYH 3IPFA 5CGTA 2ZOLB 4EDXB 4WSGA 2BVOB 5DFWH 4LCCC 3NJLA 1QSVA 4QRTA 4AQ1C 3US9A 3T6VA 4XB8A 2NW2B 4YIQB 4FLSA 4M4PA 4DN3L 2GABA 4XB3A 1JTTA 3VXTB 3U6XA 4ODBD 1CZ8L 1U8MA 5A7BA 2J25A 5I6NA 1M3IA 2AQ2A 3DUHA 4NCC1 5D1QD 2X4OB 3MRGA 5BVJB 2UZXA 3S37X 1TNMA 5E2UH 3IB4A 3PJNA 4GI8A 1LMKA 4GEJA 3B7YA 5E9NA 4DJMA 2XFGB 3V4UL 3WYRA 3MRLA 5CR1A 4KTDH 1FNSH 5BJTA 4I18C 5FYLD 4M7LL 5FO7A 3MODH 4QGTA 3O2WL 1S7UB 3QIUA 2UWEE 3MRFB 4E5XG 5JHLH 1D2PA 2VN4A 2DLFH 4IOFC 4ZAKD 3BXNB 2GSGA 4Z7OE 4NGHH 2Y25A 2OPCA 1JTOA 2F9BT 3MV8D 4MCZA 3O3AA 1DQDL 4PWHA 3VD1A 4NLAA 3ZUNC 4JY5H 1EO7A 1I75A 3HB3C 3Q1SH 5C07A 5J13B 2WTRB 2CUAA 3FH5A 1YEGL 4PTUA 3GSUB 5DC0A 3QWOB 4A55A 3QWRA 3MBWB 3QUYA 5G4MA 3PAVA 1SYSA 3RVWD 4IKKA 1NEPA 3QFJB 3QQXA 2BP0B 3MV7E 3HZMA 3FO1A 3DSFH 4LEEA 1MG2C 2VQUA 5DXWA 1NGYB 4RMVA 3HHMA 2XWRA 1AOZA 3E38A 3UMNA 4BFEA 5BS0A 3GHEL 2X10A 2Q5BA 5EA0H 5FLUA 2J5LB 2AQ3A 2QGBA 1I8KA 5IV2B 2PYED 2WKGA 4G5ZL 5JORB 4CMHC 2COVD 1MWAA 1QOKA 1ASPA 4YHNA 4M3JA 2IFFH 5ERWB 4ZFQA 2VYRE 2DYSB 1NCIA 3G5XA 2L7QA 4FQXC 3UIYA 1NAMA 5H37G 5JPNB 3IDGB 3RKPA 2APBA 3TH3T 3SKNA 2VUYA 1WHPA 4O2EA 2VSMB 4M1CC 4AC4A 4X6CA 1P4LA 3EOAA 3L5WB 1RZ8A 1KIUA 4PWFA 3D8MA 1UKQA 3NFNA 3O0RH 1BW8A 3WFZA 1QLEB 3WTTA 2WQUA 3W3BA 1HEHC 3MBXL 3G7TA 1L7IL 3NFSH 4F58L 4K73A 4FQQB 4XBPA 3MV7D 5J11C 3GKWH 3X1BA 2D03H 3IGUA 2CSPA 3DX4A 3A4DA 2A77H 3GRWH 4Z7WE 1UD8A 1V3MA 1MCNA 4KHTL 1MZYA 3QAQA 1BXVA 4K0OA 4PP1C 4QHKJ 4D8PA 3Q6FA 1OGAB 4TV3A 4U2ZA 1XR8B 3HPLB 4QT5A 4JFED 4UIKL 1AGDB 1YJDC 4JLRA 2Z31C 3QEGH 2LV4A 4GUOA 4QD2E 5HDBB 3T71A 4B50A 4Z7OF 4XN7A 1S9VB 1C7TA 3FN0L 3L5XH 1ZLSL 2DLGA 2DWXA 1WIUA 1LO5A 1U95A 4YGAB 5FFOA 3CHSA 3FCTA 2X4UA 3ZMRA 3L16A 4J3SA 2BFVH 3X14A 3ISWA 2OCJA 5FKAA 5C0AA 4NO3B 2ZOKB 4GRWH 8FABA 1LK2A 2A99A 2I26N 2VLMD 5L0QC 1PZSA 1Q9LA 4NQDA 3FFCD 3BAIA 3QUKB 3LXBA 1OQXA 1XR9B 4OZIA 1NA8A 1WAAA 4KMTL 4P2OB 2FBOJ 5C6TL 5DUMH 3JWDH 3PNWB 4ILDA 4DP0X 5LUMA 4W9ZA 1GSKA 2IG2H 4LCWA 2YZ8A 4HKXB 5D7JB 4P2QB 3ZKNC 3FU6A 2NY6D 2ZUQC 4FQ1H 4OB5L 2VERA 2OTWA 1OSZA 3FUEA 4Y5VC 4XAKE 3GSOA 1BAGA 2HH0H 5EIIB 3FU9A 1RURL 4GG6F 1G0DA 4ZYKA 1USZA 5FK9A 5KYNA 4KI5E 4KY1L 2MNUA 4P9HL 5CS7A 2HLFD 4YPJA 3H6AA 3KWTA 3W9EA 4Z0BL 3EFFB 4YLBA 2IADA 1VZIA 3DMMC 4NPYB 4U1SB 3SBWC 1XFPA 1UWEL 1GJIA 4BA8A 3LKRB 1T4KB 3V4VB 3ZDZB 1WFJA 2ZIDA 3VFVA 4E41A 1URIA 1QPXA 3W57A 1QFUH 2KPWA 2VERN