1TJXA

Crystallographic identification of ca2+ coordination sites in synaptotagmin i c2b domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
156
structure length
156
Chain Sequence
SGGGGGILEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords similar to synaptotagminI/p65
publication title Crystallographic identification of Ca2+ and Sr2+ coordination sites in synaptotagmin I C2B domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 31
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1tjxA00
3PYCA 3CSTA 2CHDA 3QR0A 2NSQA 2NCEA 2FK9A 3QR1A 4L1BA 4KITB 1WFMA 4LCVA 2WXOA 4QJ4B 4NPJA 1UGKA 2WXLA 4IHBA 4XZ4A 4A55A 2CM5A 1RLWA 4QJ3B 3KWTA 2QZ5A 2Q0ZX 2K45A 2WXRA 4F1SA 4URKA 3TJPA 3FBKA 4QAMB 1QATA 5KJ7E 1BYNA 2CJSA 1WFJA 1TJMA 2CJTA 1DSYA 2B3RA 2ZKMX 2WXFA 3JZYA 4ICXA 3F05A 5CCGE 2ENQA 3HIZA 3SD5A 3PFQA 2WXPA 3W57A 1GMIA 2D8KA 4WWPA 2QZQA 4FULA 4Y1TA 3DBSA 3PS6A 3GPEA 1DJXA 2FJUB 2NQ3A 5JHAA 1TJXA 1QASA 1YRKA 2N1TE 3L9BA 3QK0A 4OVVA 3NZSA 1BCIA 3IBEA 1BDYA 1E8WA 5G2NA 3R7QA 2EP6A 2ISDA 4BFRA 4KZ0A 2BWQA 3CSFA 5T8IA 3L54A 4KZCA 2DMHA 3ENEA 3NZUA 4ANWA 4EZLA 1K5WA 3L4CA 2Z0UA 4HVBA 2CM6A 1V27A 2YOAA 3IM1A 2UZPA 3P2BA 3ZIMA 2X38A 4AJWA 1E8XA 4GB9A 2ENJA 4MJJA 4LT7A 2RD0A 2WXNA 1RH8A 3F01A 3L13A 4DK5A 4WWNA 4Y1SA 3QARA 1DJHA 1E7UA 5CCHE 4EZJA 3APFA 4NPKA 2K8MA 1DJIA 4L23A 3MJWA 3RPBA 2WXIA 4ANVA 4GNKB 4FHJA 2A5UA 3FDWA 3F04A 3M7FB 4ICWA 4XE0A 5H4YA 3ZVVA 2YRBA 1W16A 2WXQA 1A25A 2K3HA 2V4LA 3OAWA 4L1LA 1W15A 4ANUA 1DJWA 2CHWA 3L16A 4PS7A 4WWOA 3RDJA 4WAFA 1E90A 2Y3AA 3ML8A 4DNLA 3APDA 2WXGA 4FJZA 1HE8A 4JPSA 4TUUA 3B7YA 2LHAA 1UOWA 1DJYA 4G11A 3QJZA 4OVUA 5G55A 2WXJA 4FJYA 1RSYA 4J6IA 5JHBA 4F93B 3TL5A 2JQZA 2DMGA 3TWYA 5H4ZA 2Q3XA 3LJ3A 4V11A 3R7RA 3HN8A 4LDCA 3S2AA 4PS8A 4QJ5B 2A4ZA 3ML9A 3QAQA 4EZKA 3F00A 4F91B 3HHMA 3L08A 3W56A 3L17A 4NP9A 3OHMB 5CCJA 3T8MA 4XX5A 4TS6A 4AOFA 4TV3A 4ANXA 1UOVA 4NS0A 1E8ZA 2K4AA 4L2YA 1CJYA 1E7VA 4FLHA 4IQHA 3PRZA 1E8YA 2R83A 3ZW3A 3DPDA 1DQVA 2CHZA 3NSJA 4HLEA 1DJGA 5EDSA 1DJZA 3KWUA 2KI6A 2WXHA 3APCA 2ENPA 4FHKA 4FADA 4WEEA 4PS3A 4F92B 2WXMA 4BGDA 2CHXA 4FA6A 2WXKA 3N5AA 3PREA
chains in the Genus database with same CATH superfamily
2EDEA 1B0GA 3U48A 3WIHL 2FK9A 3FTYA 4LARH 3GHBH 1AXIB 1ID5I 4R26L 3KPNB 5DXWA 1IM3D 4B3EA 4NM8H 4PRAA 1I7ZB 2NNFA 2X44D 5I6XC 1PG7W 4K3EH 4P59H 3S97C 2VO5A 4GG8B 1VSCA 4F1SA 1ED3A 2IOIA 1VZIA 5KS9F 2J7LA 1LXMA 4BSJA 2AGJH 5DLMH 4IBTA 1A3LH 4FS0A 2XWCA 4GJTB 3QUKB 4LHUB 4OZGA 2ZWLT 4LL4A 2F1EA 3OQ3B 5B8CC 5J12B 3OKYA 2Z1KA 3S3DB 3NA9H 3B9KA 2IANE 1A4KB 3CZGA 3IDXL 1KBVA 3RAJL 3KPNA 2OPCA 4MXQC 5DHVH 4OBRA 3KWVA 3BT2L 3NCJL 4Q9RH 2Q7AA 5B39B 4XNUH 2GBAA 1Z5HA 4JPKL 4GG8A 2BERA 3VXUB 4JZNB 4GG6B 3QJUB 3SYOA 2YA2A 4N24A 4C83B 1QSEB 1Z6JT 5D6DC 2Q8AL 3F7VB 1KENL 1EZVX 4XVJL 4B50A 3BT0A 4KH9A 4LHUA 4L23A 4L8BB 2PN5A 1RCYA 2OMYB 1C16A 3DI2B 3OKOB 1YG9A 4H1LB 1ESOA 4TQPA 4ABQA 5D1QE 3RFZC 3S3PA 4D8OA 1MAML 3NJXA 1ACXA 1BZDA 4Y1AB 1FNAA 1CBVH 4UTCA 3D3VA 1TFHA 3QDGB 3ZX1A 1RKRA 5B39A 3VGAC 3OJVC 2WXGA 3VXUA 1PX3A 4QRAA 4AKQA 4JZNA 4GG6A 2L3BA 4NDMB 4EUPG 2ITDA 3KPSB 4C83A 2I60L 4NQTA 3L8QA 4NT6B 1DJYA 2J44A 3F7VA 3S3CB 3P9LA 3VDBA 1I1AB 3ATDA 4N68A 5DD0L 4DN4L 3HMWL 4LCIH 4AE1A 4JFWA 3TWYA 4HIEB 3I6LD 4BRVA 1V8HA 4Y2DD 1T2QH 3OKOA 5T3ZE 2PPCA 2JQAA 1J7VR 5FUOH 5HI5C 4HUUB 2DL2A 1DLFH 1OT2A 2VH5L 3TIEB 1FIGL 4PG2C 1HHKA 3QDGA 3KW8A 4RIRB 1CJYA 5E1QA 1LHZA 3O3BA 2VQ1B 4PD4J 2D7PA 4X80H 4P2AA 3DPDA 1EX0A 1LO0L 4NDMA 2WXHA 2B59B 4NT6A 1RULH 1I1AA 4X5LA 3DX2A 3QIWA 5L6YL 1ZXKA 4KRPD 4NWTL 4D9QE 3IMSA 5IMMA 3VGEA 3RZCC 4NGHL 3R19A 3CC5A 1T3FB 1WFMA 5JIKA 4F5CE 3CN0A 4AC2A 3I3EA 1M7XA 1X5IA 4HUUA 1JZFA 1PGRB 2VDNH 3KVQA 2XDHA 3TIEA 4RIRA 2MOGA 2FO1A 3AU1B 3RIKA 3K2UH 1IGJB 4JFDD 4RWHA 3RZWA 4OBSA 1M7UA 2HFGL 3DHJA 4M6AA 5I1CH 4HIXH 1HXYB 3MODH 5E6IA 5EUOA 5E08L 4I3RL 4AV4A 2ZICA 3C09C 4JDTL 1BEYL 5LBSL 1TNNA 4LSPL 2DQDL 4H8WC 4DZBB 1TQUA 1B4RA 1W8EA 5C0ND 3FCGA 5B3NA 1X5HA 1FSKC 3KLAB 4G9DB 4I5BA 4JG5A 1TTGA 1B4TA 2AQSA 3RVXD 1RZFL 2WQVA 3U7WH 1T3FA 3DOIA 1K8IB 3V8CA 1AD0A 7PAZA 5DMIH 5B1JA 4BFEA 2NY5L 1ZIBA 5J6SA 2JTYA 2F5AL 2EDWA 4YOKA 5IQLA 1DCEA 1ZWIB 2FEEL 4PMFA 5DFVD 3CX2A 5CWSB 4MJ2A 1DJHA 4LHUG 4NPKA 4MA3A 1MW1A 3SGKC 3KGTA 4DZBA 1KV3A 1ZT4B 1R34A 1CFNA 4PSRA 4FI6A 2E7MA 4FXGB 1JPGB 3KLAA 4G9DA 1WRFA 4ELMF 3QNYB 4HPOL 4BXSV 3INUH 5LNEA 1K8IA 4DP2X 1BQLL 5HHPB 3VFPB 5FYJL 4MAYB 2VLJB 1HHGB 1WJ3A 5DJ6B 5ICUA 5CFAA 3BWUF 2W95A 1HE8A 3M7OA 5J13C 2CUAA 2X4OA 1XH2A 2OSWA 4A37A 1ZWIA 4XMUA 5CWSA 5EO1B 3ECBA 2G75B 5GSRA 1R3JB 4KVNL 4ZXBA 1TLKA 2OJZH 3B1UA 1FNSL 2M26A 4Q74A 4YDIH 5E9DB 3QI9D 3DO3A 3M1BA 4X0KB 2EE9A 2XY2A 1KGWA 1P69B 2H2SD 2OS7A 3VFPA 5HHPA 5E94B 2D0HA 3EO9H 3P3SA 6FABH 2VLJA 4NLHA 1DZ0A 3FU7B 1HHGA 4KO6A 3FU8A 4OCWL 5DJ6A 4POZC 2AQ1A 3MNVB 3QIUD 4KC3B 5L4IA 4HEMA 4NZFA 5FA4B 1N4XH 4FHKA 1MRCL 2UZXB 4KQ3L 5EZLB 1FAIH 3DC0A 4X6FB 3LZLA 1LILA 3B2XA 3T09A 5FGSA 5E9DA 1YEHH 3V6FB 1UADC 4P2RE 3N0AA 4NRXB 4JDZB 4X0KA 3NZ8B 1RIUH 4H8VA 4FFVC 5E9AA 1I1FA 4GT0A 3KYMB 1VZHA 3IS1X 1FL6A 3VWJB 2C9SA 2R2EB 2YAOA 2ZUUA 3DX0A 3FU7A 3FT9A 5D5ME 4TUKH 4N26A 1ZVYA 1JG9A 2OBGA 2EECA 5FGCE 2EE2A 4PCKA 4PV1C 1A21A 1IIIA 3MLUL 1X9LA 2JI1A 2UZXA 5DZNA 5EZLA 2NY6C 3QEGH 5EU3B 3SE8H 5LQBL 5KZCD 1CYGA 2CLRB 5E4EC 4HKBB 1E8WA 4J3OD 4LE8A 1JZ4A 2VUKA 4N2EA 3QO1A 1XR8B 4KZ0A 2QQKH 4JDZA 4NRXA 3NZ8A 2X3AA 2W38A 1WFTA 1FH2A 4YDLC 3KYMA 1CF8L 3JWOL 3VWJA 3TCLA 4AIEA 5IHUH 2R2EA 5AOLA 5L2KE 1SY6A 3VRJB 3Q48A 4ZUSB 3II1A 1FN4B 2XVBA 3QNXB 5IUSA 2E75C 4LVHC 5BJTB 2A1WL 5CO1A 3V0JA 1GY1A 2BHYA 4G3YH 4IRZL 2BMKB 3B9EA 2QADB 3DX4A 2C9AA 5I73C 3KHOA 5E1IA 3CFDA 4XVTL 2VLKE 4XP9H 4N85A 1ZY9A 1KCKA 2PP7A 3X14B 5EO9B 4HKBA 3AM8C 2JB6B 3OPUA 2BRRL 3MLRL 5DRWB 5FYJU 1XR8A 1V10A 4PR5A 4UNTA 5I1AB 5D70L 3IVKA 2JELH 1D5BB 5I6LA 5TE7L 2CDEB 3R0MA 5ACMA 3VRJA 3ES6B 1G6RL 4DP6X 4ZUSA 2DQTH 1FN4A 2EIZA 2LHAA 3BQUC 3QNXA 4FKEA 2BFVL 3SGEH 2Y7OA 5MEPA 5BJTA 3EOYG 1XWVA 4J6RL 1CICB 4KY1L 1PF3A 1LM8V 2WWMD 2BMKA 2FEJA 4TULH 1KJ2H 3TL5A 5E4AA 2ALAA 2W0PA 2XQBL 4IGBC 4I77L 4HU8A 3DV6A 3A6CH 3HG0A 5TFSH 2MQGA 5HP5A 2JB6A 2OJEB 3A47A 4M02A 5DRWA 2OMVB 2F68X 5F7LB 1D5XA 4NAJA 1JDAA 3APMA 4JFQB 3V7MA 5EF3A 1D5BA 3B2UC 1ZS8B 1NWOA 3QA3A 1JNNH 4J8QA 4XOCA 3ES6A 4O5LL 5D4IA 5C0CD 2FB4H 1MFCH 1NGYA 2SEBA 1CICA 1IEBA 1MIMH 3QGVA 5BMFH 4NYLB 4XPGL 3X1NA 2DQUH 3F62A 3SE3A 3H3KA 3IXAB 4Y9GA 3FCSA 2NCEA 3UTTE 2DMBA 5AB9A 1QFWH 4Z76A 1TR7A 4BCZA 4ALAL 2ZP8A 4W9EC 5AW2B 3GSUB 2OJEA 3LS5H 2HJFB 4KMTH 3MLWL 3TT1L 4X7EC 5I66B 4PTUA 2HX8A 3JUZA 5FA3B 2YFNA 3MLSH 4ONOA 1W0VB 3EHBD 1PNDA 4ZNEA 3KLHC 4YX2L 2RACA 3D52A 4JFQA 1GPOL 1RMFH 4IOIB 4GXUM 1ZS8A 4YDVB 3SKJL 3HAEA 1GTFA 3BC9A 2Q8AH 2WMPB 3IMUA 1QBLH 3JTBA 1AQ8A 1LEIB 4W70A 1NBVL 1ZVNA 3PS6A 1WFOA 5D4JA 2Z6FA 3IXAA 3RB5A 4H88L 4OVVA 1INEH 2IH8A 1RZ7L 1LE5B 2XBTA 5AQ0A 5F9OL 3GKZA 1A9VA 3T71A 1E4JA 3BUYB 3GSUA 5DVPA 1M7DB 3DETC 4WFED 4BJLA 5E08H 3C60C 3VA6A 1W0VA 3EGXB 4PJHA 4IU2B 4XCFH 7FABH 3ULUF 4IOIA 4FF9A 3OG6B 4YDVA 2CE6A 4LKXB 1EEQA 3C8KB 3FTZA 2CJUH 4BWTA 2BNRA 1FDLH 3CMGA 3JTTA 4R5VA 5HYFA 4IMLB 1LEIA 1Q1JL 5AW8B 4BIKA 3PGFL 3U0TB 5BS0B 2VDOB 3G3LA 4I87A 4JFYB 2FQDA 1D9KB 1NFDB 3NTCH 2XWXA 3DXAD 2P9RA 3ARFD 3BUYA 5D8JH 2IAMC 4KO9A 5AKTA 3RQ3A 4B9KC 1MJ8L 3MFGB 3FQTA 3EGXA 4M00A 3GSRB 1CDBA 1OTSC 4FJZA 4BZ1A 4F7TB 1MHCB 1URIA 2AJXH 3L1OL 4U7MA 4WEMB 4X9GA 4LKXA 1OCCB 3C8KA 2XWDA 3MZGB 1KELH 2DQJL 2ED7A 1G9NH 3FO0H 3AMKA 4QXGH 3V4PL 2HMIC 3S96A 3U0TA 5BS0A 1L7IL 4MMZB 4NC1E 5LXGL 3QRLA 3B7RL 4WHDA 1XBRA 4X5PA 2AKRB 4JFYA 3W38A 1KOAA 4HISA 1D9KA 4HJ1A 4J4PA 5T1JA 3VFGL 1NFDA 1RK1B 1XXFC 2IF7A 2ZWZA 3HE6C 4FQXD 3TO4B 3E0GA 5KTEL 4LLWA 2WQSA 4TV3A 2AITA 1AR1D 1JF1B 2EINB 3UEQA 4NZUL 3GSRA 3LKOA 2E9IA 4F8TA 2HZHA 2R83A 3HG1E 1BREA 4TLSA 1ZGLP 1WIUA 4DKFL 1DVTA 1TZGL 4LSUL 3U30B 4YSDA 3DJTA 4ZFGH 2VE6B 2OYMA 3EGDB 1ZXQA 2LTQB 1QFUL 3DYMA 2Y6SD 2AKRA 4KX8A 2MFNA 5JHDD 4OR1A 4Y5VC 1RK1A 4UM8A 2CUHA 4AQEA 3N43F 4KPHL 5EOQH 5GGUA 5KYNA 4Z0BH 3WELA 3A67L 1YEKH 3HAEG 3NSXA 2QV2A 4U0RC 2ZXWB 1Z9LA 4PJEE 1JF1A 3O2DL 4F9LA 4MASA 4DW2L 4X5WA 1TJMA 3W0WB 2ARJA 1JI2A 4XX1E 1U8NB 2VE6A 3ZDYF 1WD8A 2Z31C 4HALA 4MLSA 2HFEB 1S9XB 3O4LD 2HKFL 4HKZB 1P6AB 5HY9B 3WIIL 4ADGA 2DM2A 3R7QA 3JWNH 5D7LD 3EFOB 1UXSA 1BQLH 5K9KB 4B9JA 4PM1A 5F7NC 5EBWB 5GS1B 3BDYH 1XCWA 2X4PB 3GF8A 1HIML 4PJGA 3CFJB 2R0WH 2GHWB 3QWOA 4MRCA 2X3BA 3IGAA 5KUMA 1BW8A 2L7QA 3V0AC 5ALBL 3W0WA 2ZTBA 3L3OC 5CCHE 4K3DH 4GIOA 4L4VE 3JUYA 4XO3A 1C8PA 1LO5A 3TA3C 2HFEA 1PEZA 1S9XA 1UA6H 3Q5OA 4HKZA 1KPRA 1IT9L 1MNUH 1AYOA 1MHPH 4HZAA 4MNGB 2LAAA 2EILB 1YEGL 3EFOA 4HC1A 1T20B 3DV4B 4FQLL 4X4ZA 4QTIH 5CHNB 5EBWA 3DPBB 4M1CC 2NY1C 1J0JA 2JCCB 4BUGA 1JPTH 2F7RA 4XNZB 3ILQC 1W72H 2O5XL 3CXFA 3OR6B 2JLLA 4EO5A 2XACC 2C5DC 5IB5A 1HOCB 4LSSH 4G6AD 1A6VL 2QQQA 4RISH 1WGVA 4F33A 3UJTL 3U9WA 3V4VB 5JHLH 3ARDC 3GBEA 2DMGA 5H4ZA 1JD7A 4EZKA 4MNGA 1H19A 2DI9A 4HUWA 3QPKA 3SGJC 2FQGA 4TVUA 1QLRB 1T20A 1CK0H 1EANA 3DV4A 3GNML 3Q6FB 4M7ZC 1AO7E 1FZKB 5CHNA 3DPBA 2WNXA 4AEEA 2DZEA 2GQHA 4E9TA 5DZ9A 2NR6D 4OZIE 3GMLA 2BVTA 1YMMB 3OR6A 3TZVC 2TSBA 3K71B 3UGXA 4APQD 3BLBA 1I3UA 1UH3A 4JO4L 1I8IA 3D39E 3DROA 5BUGA 2PPDA 1IBBA 2GTWB 4JCMA 3V4VA 4IMKA 3RVUC 4IBVA 3FONA 5C09B 3BESR 4Z7WE 3QJXA 1OAQL 4OD3L 4HGWB 4AUYA 3QCVL 4TUOB 2J6EA 1OPOA 4KKCC 5AZUA 4TQIA 2EDJA 5BVJB 5HGHA 1BAFH 4Z0XB 2WSDA 2B0SL 3Q6FA 2FUQA 1P7KA 1FZKA 3LHPL 4UMGA 3K6OA 4DPAX 1H3PH 4GMTL 2A83A 1DSFL 4PHXA 2YK1L 3EJYC 1OV8A 3U83A 4EI5D 2GTQA 3Q2LA 4F1ZA 2Q7NA 5DLLA 5IVOA 2LLNA 2GTWA 2YMTA 3DBSA 1NMCC 4JPWL 3II3A 1E5AA 4UAHA 3L4TA 4BM7A 4FOMA 4Z3EA 4PWEA 2EP6A 1EDYA 4HGWA 3BSZL 4FD0A 4TUOA 3RDTC 2VDQB 5MI0C 4GSRA 4Z9KB 1ITCA 4CDHA 4XCCH 4Z0XA 5D70H 1GGCL 5C0AA 3NCYS 5TE7H 3ZIMA 2ZCKH 4X7TB 3PWUA 4ZS7H 3UPRB 1M2VA 4XNDA 2XPGB 5EZOH 5T3ZH 4QWWC 1DVFC 1U91A 1CL7H 3MXWL 3GMPB 2DEWX 4XXCA 4G7VH 3C5SB 1WZKA 1GC1C 3E80A 2MCPH 3T6XA 4HUVB 4JHWL 3QEQD 5HHVL 5AZEL 2J6WA 2PO6C 3LH2H 4L1LA 4U1KB 3ZQXA 3SKUD 3H7BA 3ARUA 2ZG2A 3KL5A 1IGTA 1MIEL 1ZAGA 3IN0A 1PKQE 1VENA 3WDIA 4AVKA 5J4MA 4X7TA 2E7LA 4MZ2A 3FB6A 2ZYSA 3OKDB 3F6LA 3BKYL 4M8QB 4L0ZA 1BJ1H 3I75A 1OGAB 5D7JD 2Z35A 2J21A 3S7GA 5JXAH 1VGEH 4ZMPA 1T4KB 3BO8A 1EGJL 3C5SA 2PNDA 4NIKB 1JZ2A 3HNTH 2IGTA 4KTDH 4R4BB 3NIFE 2AQPA 3JTSB 2G3ZA 1GIGL 4UT6A 3BP6B 5MENE 3OAZK 3VQLA 1IC4L 3QQ9D 4RZCB 1IGCL 5JOFA 5FV1L 2YPLD 1LP9B 2R0KL 4LSTH 5HYJD 1L9MA 4FE9A 4K2UH 4IU3A 4NQCD 2QHRL 3Q05A 2IPUK 3ESUF 4PCTA 4P4KB 5CEZE 4IRSD 2ZD0A 4MNHB 1L0YA 3OKDA 4M8QA 1G87A 2YR3A 1T1XB 1UWEH 1RQ5A 5HDBF 1NBVH 1T4KA 2VTFA 5A6IA 3QR0A 4FQJL 5IT2L 4IRJD 1PY4A 2WLMA 4HUXB 4L3EB 3BP6A 3EF4A 3CVHH 3O6KL 2DJMA 1IC7L 3VU1A 2D7NA 5FYLL 1LP9A 2YLHA 4QTHB 5AVQB 1EFXB 2VRKA 3SQBB 4TSCH 4N9GA 1XCXA 4JHVA 1JZEA 4AVIA 2V6HA 1FZJB 1EBPA 2PW2B 3Q1EA 4MDIA 4MNHA 4R84A 3TF4A 3BQVA 3HMXH 1JGDB 1GSKA 3QDJB 1T1XA 2E47A 2XKNB 4ODHH 4PJ6A 4LRNH 3S34L 5HVFB 5F1SA 4P48A 5DT1H 5FX3A 3DIVA 1U6AH 2Z4TA 3H85A 5KYUB 4N0YH 4XNXL 4S1RH 4C59B 3W81A 1Q9OB 4L3EA 1A6PA 1CZ8H 1NGXB 2FECI 1WFUA 1PTZA 5KVEL 4QTHA 2J25A 3MNWA 1JFQL 4PJDA 1EFXA 3SQBA 4NHUB 1G9MH 3L1OH 1YUKB 5H8DA 2ENJA 1N6QH 1FZJA 1FO0H 1KCUL 2DM3A 3REVA 1NA8A 2DWEB 2YBRA 1JGDA 4IW4C 5ELIA 2XKNA 4C56E 2JJVA 1A14L 4OKVB 5KAQF 5I6NA 5GZND 3F2LA 4F80A 3MJWA 5CBEA 1IKFL 1MCPL 5KYUA 1J5IA 4O51A 1HEJC 2R4SL 1M71B 5DQ9A 1WIOA 5DC4B 1NGXA 1DBJL 1NANH 1XGQA 3TEYA 1WA2X 5D93B 3L16A 4X7FC 3B5GA 1VADB 3QXVA 1V3LA 1U8QA 1EAPB 1PG7X 1ZPLA 5JLZB 5FYJD 3MJ9H 5D7IB 2FHCA 4HAGA 1GH7A 1HWGB 5IQ9B 1RSYA 4OKVA 5D1ZI 3WE1A 4B9YA 4X5RA 3I6GA 3HS0C 4JUTA 3V0EA 4JM0A 8PAZA 4P2YA 5DZOA 1XGTA 4OB5H 1PFCA 3H2QA 4JQIL 5I0VA 3JWDC 1UHVA 2OK0H 1VADA 3MCLH 2IBZY 3KXFE 4XMWA 1DQDL 4LU5L 5BVPL 3H2PA 4G6FD 3PWNA 5I2IB 3U46B 5D7IA 5IQ9A 2GVYA 1J11A 1E4WL 1GCYA 3WFCL 3CK0L 3IFOA 4JG9A 3EZ8A 5J1AB 4YSTA 3GRBA 3VGFA 5IHZB 3BE1L 1UJ3C 4M93C 2FSDA 3FH7A 3CDYA 5K1VA 4Z7NF 1SDAB 3RLSA 4L4TB 1NWPA 3NFPA 3TNMB 2P28B 4Y4HB 4U2ZA 1ORQB 3KM1A 4BBWA 4GP5B 5PAZA 5D2LE 4TRPL 4MMXB 5LDSA 1E43A 2O5NA 4X9FA 2XPYA 3EH2A 1F4HA 5B1CA 1QPPA 4ICXA 1EHAA 5I2IA 3PWVB 1BQSA 4AG4H 4E9WA 1R0AL 3MRBB 1OANA 4P2QA 5KSBA 1CDCA 1DLHB 3INOA 3ATFA 2C3XA 3WNKA 5J1AA 4G2AA 4ONGL 3VWKA 3O3EB 3B34A 5IHZA 1YEGH 6PCYA 4KOBA 1YY9C 1TG8A 3EJZD 4EN2A 3W5MA 5D1ZC 4P3DB 1ORQA 5CR1A 4PJ9C 3BJLA 5L7XH 3IDNB 4QXWA 3MLXH 2O5XH 1RJYB 4MMXA 2XZAH 2HKAA 2X2JA 3AJ7A 1OE1A 4LLAA 1RU9H 2IPTL 3ILDA 5F96H 1MHHB 3MRBA 3PABA 3SSGA 2FBJH 3PHQA 4YHKL 1J8KA 1IX2A 2OTPA 3FB8A 3IDGB 4QRRE 4OCXH 5K9QG 1A25A 3IDUA 4HP5A 5JHDE 1VKXA 1NGQL 3GNMH 4RAVB 2EDNA 1IQDB 1IC5L 3F3HA 4JMXA 3UYRL 2VR7A 4AVHA 4YHLL 1CDYA 1NEPA 1ZJBA 3PL6A 1QSFB 2EDLA 2GC4C 2AABH 3AWEA 2J8UE 4LLVA 2CBMA 5CNHA 5G55A 3F7KA 3H7LA 3UBGA 2AXGB 1MHHA 1Q9WB 4KX9A 3ASOB 3MV7D 4Z7QB 4YZFE 3QHZH 2B4CC 3IDGA 4FG6C 4PRHD 4M8UA 3X3FL 3BWUC 3ZE2F 1IM3B 5BZXA 4KDTC 2NLJA 3RYMA 5AD0B 4XX5A 4RAVA 2X12A 1UOVA 2K4AA 1BVOA 1V3KA 1KEMH 4KTEL 1IQDA 4P46D 5GISL 1E8YA 5SWZE 1TQBB 1QSFA 3UCQA 5CSBA 3APCA 3V55A 1J5OL 2XYBA 3GC3A 4OFIA 3N91A 4JFOB 2R29L 1KTRL 1ZV2A 5TF1H 1WQVT 2AXGA 3ZE1F 4A7VA 4LCCB 3MLTB 4PJIE 1CXKA 1KJVB 4YQXL 3CZSA 4XOAA 5AW4B 3RNQB 1XTMA 3GS0A 1IM3A 1MEXH 3WY2A 1AZUA 5HD8D 4JN2B 3ULSB 1JZIA 4N5UA 3KLLA 4R5XA 3ATAA 4C4KO 3TFBA 5HHOB 1NL0L 2CCWA 2DBLH 4LSDA 1IL1B 1TTRA 4A6YL 2W07A 3OF6D 3HNVL 4LCCA 2VDRB 2BLFA 3MBWB 3MLTA 4NN5B 4RMBA 1KJVA 4JHWH 4XAWL 3RNQA 2VXVL 1PIFA 2BVOA 5EU5A 2FSEA 1CFSB 4FABL 3JBG7 2YD4A 3RGHA 2XKSA 3RJOA 5ID1B 1XR9B 4D9LL 1KTJA 3ULSA 3QUYB 2CDGB 4B0MB 4ENEC 2ZUSA 1FLTX 1P9MC 1S7SB 1SBBA 2Q2LA 2PF6A 4LGSB 2O4EA 2G2RB 1PAMA 3ZKMD 4OD1L 2XIDA 3FCTA 2VZVA 5E8DL 1OD9A 2FVNA 1OE3A 1QWUA 4TF4A 3MBWA 4HPYH 5KYWA 3A0OA 4G5AA 4AQ8C 3BPOC 4HH8A 1DQIA 3LRLA 1CFSA 4B9FA 4NIYE 4UUJB 2B39A 2CPCA 5CZVH 5ID1A 2ZAHA 3WJMA 5KS9E 3I6SA 3HFML 2CDGA 3OX8B 4UB0L 2DDQH 2N56A 1S7SA 1TJIL 1VPOL 3DBXA 3PF2A 4NZRL 1AACA 2VDPB 2GCYB 2GJ6D 2HFTA 2Z93B 5JPMA 3GXIA 3I9GH 1VB9A 1IGFL 3NK4A 3Q1SL 1R5WA 3T1FA 5IY5B 3JWOC 4NKIL 3SQOL 3L4XA 1SFHA 3MX0B 2VQ4A 4YXHL 3DSNB 3N9GL 1EHLH 3SPCA 2XHNA 3F12B 3FT1A 4MJHA 3GZQA 4Y2DA 5TF0A 4JB9H 1CIUA 1B3JA 3ARED 1F6AB 5DEFB 5DJ0B 5EF2A 2CGRH 2B2XL 3IYLW 3FH8A 1IE4A 1BJMA 4K15A 2X3CA 5IJVB 1KZYA 1WD9A 2Z8SA 3PCYA 4I3SL 3AT9A 3FKUS 3EDFA 4QAWA 2IIJA 4OKDA 4YO0A 5F7KC 2EIEA 5KW9H 4GI8A 4MJ6B 2IV9A 2YXMA 4BFIA 2GT9B 3SHSA 1S3KL 3PYCA 3LXBA 3BVVA 3DSNA 3OXRB 5IM7B 3F12A 5I1HH 2X4TB 1IFGA 1ND0B 2Y36H 1ZD6A 2BVYA 2XT1B 1IEHA 2CZNA 5DWPA 4GS7B 4P5SA 1JFQH 3Q3GB 2OSYA 2R1XB 1AKJB 5DMJB 3VFTB 2FUTA 5C3LD 3NSFA 1VRSA 4MYPA 5CEXB 4JFDA 3T3PB 2CJTA 1HXMB 3VMNA 2OCJA 3N1MC 4EQ3A 4YS4A 4PB9L 1TCRB 2JB5L 2YUZA 1VACB 3VRIA 3CG8A 3OXRA 5CJXA 4HOWA 2WQXA 2W5PA 2AJVL 4KTGA 3VE0B 4ERSL 5M94B 1VEMA 3TPUA 3T77B 1RP8A 5ILTH 5LG1A 3U4BH 2FYYB 3UX9B 3KDPB 1JK9B 2QPEB 4QO1A 1BQKA 4RFEB 2Y2TA 3VFTA 2XFXB 2V33A 4XN8A 3MRHA 5CEXA 4YHNA 3DUUB 1AVAA 5CIPA 2GK0A 3SJVB 4O02B 1N18A 2J56A 2IQAA 4XMTA 4EZJA 1KNOA 3U9UB 2P44B 2WC7A 2G9HB 1TCRA 1VACA 4Z7WA 1I7UA 3RRQA 2XBZA 1Z9SB 2RQEA 2HH0L 3BIKB 3ULUC 2QVFB 3QI9B 5DS8B 1NAML 5E5UB 4WI5A 3T77A 3NEXA 2F19H 4HMCA 4MXQD 2G5UA 4JRFA 1DBKH 3OZKA 4QHNB 1JK9A 1BX2B 2JF1A 5GGSA 2QTVA 1ZHKA 4RFEA 5EIIB 2XFXA 3QIUB 4LU5H 3N41B 2YSSB 3G08B 5B4MD 4O02A 4AEIL 4MD0B 3MO1A 4WRLA 1PCXA 2EDRA 4PRDA 5ESVA 4N2KA 4RDBA 1EZVY 3U9UA 1GYVA 3QUMB 2OL3H 4PJXF 1BLNA 1F3JA 2R51A 5FDYA 5JW3L 2C8NA 1YECL 4Q52A 3BE1H 3K4AA 5E2JA 1Z9SA 2EIMB 2WBJC 5JOPE 3BIKA 3QI9A 5SV3A 2ADFL 1YAZA 1CD9B 3CFMA 2E0PA 4QHNA 1ITBB 4DIXA 2CKBH 2VIRB 4C4KT 4MNQD 3QIUA 1NSNL 3G08A 5FUCC 5ITBH 4JE0A 4PS3A 4MD0A 4KAQL 2CO7B 3IJSA 5GS1A 5K1NA 4ELME 5CU9A 5IJCC 5EU7C 4F7EB 5HJ3B 1AGCB 4NRYB 1WUZA 5IR1A 1E30A 5PCYA 2FATH 2Z4QA 4Z95L 1NH6A 2X53A 3RP1A 5DA4A 1X9UA 2BSDA 2J8OA 1IIKA 4YPGB 3L3KB 5HI5D 2UWEB 3L3JA 4OLZL 4ZMVA 1D6VL 1H3WM 4DF9A 1N64L 4N2NA 1DO5A 3ABLB 2FJGA 3GSOB 1FFNB 2VIRA 4GMSL 4M6NL 4XNBA 5FYKH 1BBDH 4OFDA 3Q2CA 3IXTB 2DWTA 3LIZH 3LQAL 3T3MB 4FEMA 2CO7A 1K72A 5I17B 4WNQB 4IJTA 1NDTA 2WV3A 1XH1A 4NRYA 1FVEB 2YD7A 1UASA 3B3IA 1ZANH 2L7EA 5DZJA 3GMOA 4LVNB 1HSAB 4UMSA 4GY4A 4A38A 5E2UL 1OZUA 1T7WA 1BMWA 3WKMH 1B0RB 1FLRH 4YPGA 3DX7B 1MOEA 4LEOB 2JK5B 1A1NB 4X6EA 3VQ2C 4AQOA 3OAUH 1FGVL 1UURA 1U92B 3NQIA 1UD4A 4MJ4A 1FFNA 3L4UA 3EH1A 1RH8A 4EF3A 4JFED 5DHVB 5E99L 4XVSL 1ILUA 3IXTA 5EEYA 5LB1A 1DEEA 4XWOC 1JZGA 5I1DA 4HX1B 5JORA 1GYCA 1J8HE 1F3DH 1FVEA 3GRWL 4FXKB 4GNKB 4LCWE 3UDWC 4LPUA 3OPZH 4WW2B 4ZI8A 2RH0A 3T6QC 4TNFA 4K3JL 1HSAA 2B1AH 1U3HD 5GRUH 2QGEA 2QFRA 4LEOA 1A1NA 4M03A 4W9FC 2H0JA 4POYA 3ABMB 1Q9LB 1U92A 5JW4M 4PTTA 3B1TA 3NACL 4O4YH 4FNSA 5C0CB 2NY0C 3TGXA 3G6JF 3WHE1 1G5GA 1ZEAL 4FFTA 4LPVA 5JHBA 3LD8B 5C08B 3H55A 4FXKA 4TMPA 1EMTH 1NIBA 4K7FB 1T5KA 3GMRB 2EDOA 3OHXA 1DJSA 3BRFA 4PGCB 1N6VA 1P6WA 5ABDE 1AZVA 5EBMB 1X5JA 3EHBB 4HIIA 1AHWC 4QRPE 5DEJA 3PQYD 4NAQA 4Y5XB 1Q9LA 4PV9B 4PBXA 5C0CA 4GSDH 2ZF8A 1ODAA 1CE1L 4YJZL 3WNMA 1MW2A 1ZOXA 3CXDH 3DOHA 3QB7C 1BFTA 1MCCA 3I2CL 1ZJAA 2Y69B 3SCMC 4YEEA 3CSTA 1KGCD 2FHBA 2VXVH 2P24B 2YD0A 5T5NG 4YFDB 1UT1A 3RX8A 1KXHA 3A3YB 3HZYA 3EBGA 3TEWA 3KWTA 3WUZA 1GGTA 4APXB 5JOEA 1T1ZB 1P4IH 3BJ91 4PJAF 1QBML 2WLLB 5EBMA 1OP3K 1CURA 2DRUA 4DQOL 4NPYB 1LO3L 2OJ1A 3BVNA 4L1TA 5H37H 3VX0A 4Y5XA 2X0WA 4POZD 4UIMB 4XC3L 5HJGA 2EUVA 4KO5A 5L4MA 4X9HA 1HU8A 3QORD 3KHQA 5IVZA 2VDNB 1CGYA 3U9PL 4I0PD 4DO5A 4GKOA 4WZ9A 4NO2B 5BZZA 4YBQD 4QHKI 3SDAC 4AJYV 1HL9A 2XV3A 3L9BA 4J3OG 3HVDA 4M43H 5G2NA 1YN7B 3SKOB 3QHTC 2H4EA 3ZHLA 3ALXA 1CXHA 2DYRB 2FJHB 1TJHH 2Y2WA 3DXAB 4U1SB 4NQDE 4ODXB 1Q1PA 1M3JA 1N68A 3HUJE 4UQ3B 4APXA 1T1ZA 2IWGA 2BIPA 2D7TL 2WLLA 4UB0H 5G4NA 3T8VA 2Q1EA 4NPYA 2DQCL 5E2VL 3C08H 1BYOA 4KHXL 1BG9A 2A4CA 2EAEA 2N0MA 2QPFA 4AW4A 4YHYB 1WG3A 1W8OA 3GHPA 5C0BD 1KIRB 1TPXC 3FU6A 4ODVH 5DHDA 1A4AA 2NDFA 4TM9A 4ZDHB 1EBAA 2NX5D 2ZYIA 4TSAH 3LV3A 2NY6D 1LTXA 3IK2A 3SODB 2F74B 1YN7A 4FG4A 3GDBA 3P0YH 3ZU8A 4CVXB 2P48B 2FJHA 1KTLA 3CFBB 3HR5A 3MOBL 3DXAA 1IV8A 1CIDA 5CP3H 4ODXA 3ARFA 1YUHA 3WENA 3LIUA 5SX4I 3KG5A 3BPNB 4UQEA 1ZT7B 2NNRA 1SEBB 1YEJL 3FT4B 2Z7ZA 3FUHA 3KPRE 5IP4A 2R4RL 1YJDL 4ODTH 4OLWL 4KKLD 1D7CA 4N8CH 4HJTA 4RZKA 1ZLEA 1INQB 1KBGL 1EJOL 2W0KA 4NQXA 5FW6A 1U2HA 1X6LA 3U0WL 1H8OA 5FGBA 1RUKL 5J7CC 4F37F 3QH3B 3VXSD 3BISA 2E9GA 2F74A 3US0A 3ZKNC 3P4OB 1BJ1J 3O6LL 1IAII 3TCTA 5BO0D 4JM2D 5KUKA 3CFBA 2AQ2A 1FNLA 4FQXA 4JKKA 3PUCA 1C1EL 2HX7A 4QGYA 4TTDD 4XNMB 3ULUE 1FVDB 2JFCA 1K5NB 4NX0A 1ZT7A 3FT4A 4IQHA 3TO2B 3HC3H 1TOXA 4UTBA 4WUKL 1X5LA 1OXYA 1DJZA 4Q56A 3AWGA 2YXFA 4OZHB 2VLRD 3BQUD 1NLBL 2BW5A 3MYJB 4GI6A 4NB7A 4NENB 1INQA 3U2IA 2QQNH 2WIIA 2J43A 3OKNB 3PREA 3QH3A 4ERSH 4P5TB 3QW9A 1A5FH 1CFVL 4Y4KC 5JHDA 5D7LB 5KVDH 5E7FA 1O5DT 3MRQA 1KB3A 2H3NB 1ADQH 1G6VK 4XNMA 1FVDA 5JW5B 3GK8H 1DQQB 1K5NA 1G1OA 3BD5A 2P5WB 3QXDB 4KK5D 4OGXL 2BOCB 1OSZA 4HHAB 3B2UD 2CRZA 1U9KA 4H0HB 2Y4SA 1TZ8A 3NFSL 4OZHA 4H20L 5FUCE 4NENA 3MYJA 4RMVA 4B9ZA 5IVXF 3OKNA 4PJ7F 4F2ME 3QWNA 5EU7E 3O4LA 2BP5M 2CD0A 2IO5A 2J88H 1GW6A 1P0SE 1P5UB 1CF1A 5D7LA 5EORH 3N0PB 3SOBL 1MI5E 2YGOA 2H3NA 3NP4A 5DQDL 5JW5A 3MRPB 1DQQA 1G1KA 4M4RB 3WIAA 5KVGL 3O41B 3QXDA 2EDBA 1G7IB 2ARJQ 3GYRA 1TSHA 2WZPD 2EDQA 1GC1H 4DP1X 1D5IL 2EH8L 3JV0A 1A7OH 1MREL 4WI0B 4UOJA 1KYOK 1PIGA 1SGKA 5DEGB 3D34A 5F89A 4P5MA 1HDMB 4LSQL 4OJYA 5CLTA 1QX1A 4Z18A 3VGDA 4CVUA 4PJIA 2PR4H 4PJ5E 3WGUB 4Z5RB 1DBMH 3OXSB 5FYKD 5JHMA 3IU3B 3P02A 3ZL4H 1RIHL 5I0WA 2CIIA 4BK5A 4BZ2L 1P5UA 5IF0A 1NCCL 5F2FA 1I9IH 4NQSB 2X4UB 5CN1A 5FHBH 4PLKC 1MW3A 1WUNT 3F65A 3C60D 3O41A 4I9XA 1H8SA 1PZBA 3PP3K 4GIAA 1FG2A 4P3WA 2H5UA 5HJBA 3ZDYE 1USZA 3NOIA 3DIFA 4WI0A 3X11A 3EBAA 1FA4A 2GY5A 2OYLA 1HDMA 1MXGA 4G6JL 1LEGB 2ZSVA 2I07B 3LHAA 1V3JA 4GRLD 1CGVA 3MROA 3BXNA 1EO7A 1R5VB 2ZJSL 4V11A 2QR0B 2G3XA 3HN8A 4WJG3 2CRMA 2TAAA 3IU3A 5GXBB 3NMEA 4FTVE 4NCC1 2WINB 4RAUB 5B7EA 4JQXC 1I8LC 5F1NB 5A2IH 4NQSA 3U2SB 4DKTA 2IAMD 2LU7A 1KJ2B 4LK4A 3ARBC 4G6MH 2PWDA 1EDHA 4O2CB 3I02B 1D5MB 2NR6A 1SBSH 3QJHA 4B9GA 1A9EB 4DO6A 1UD5A 2OMWB 2P49B 3SDCC 4APQA 2EYTB 4BCYA 3CZNA 4Z8FH 4PAZA 1F4XH 1DP0A 3CU1A 3WJLC 3V52L 1LEGA 1T80A 3QRBA 5JPNB 3T1WA 3EJTA 4R2GD 5C6WH 3H42L 2WUCL 1DQMH 1IARB 1WCBB 3LRSB 4NN6B 4KKPA 3ETTA 1QSVA 4XB7A 4RAUA 5K9OB 3RFRA 3HE6D 1S5HB 1YMHB 2VXUL 3P3YA 5F1NA 3U2SA 5IIEA 2EDHA 4Q0XH 1UM6L 5DU7A 3LPPA 4O2CA 4NP4L 1QPKA 1D5MA 2ICES 3P30L 4G70B 1A9EA 4PWHA 3F05A 2BJML 4EI5A 4RGNB 1X3DA 2EYTA 3B8YA 4BQ8A 4Y1TA 2FCBA 3VTTA 1A7PH 2Y3NA 3ZTJG 4HYTB 1ZGLA 1XGUB 3MUGB 2VXQH 2AEIT 3LRSA 2IOOA 3FFCD 3I9AA 3LPOA 3QEQB 4W9JC 5EN3A 4BFRA 1XV8A 4I48B 3RVWD 4ANWA 4X6CF 3M8OL 1S5HA 2BSSB 2I9TB 5FECB 1TQVA 5I76B 3K6DA 5HDOA 3RVTD 3EJRA 2E86A 1WP6A 4ZBJA 1QQDA 1E7UA 4DOHE 4JO1L 1JV2A 1RUAH 3DUSB 5CLZA 2PYED 4OCRL 3IJ8A 2Z31D 3FN9A 4AT6A 4YLBA 3TNNA 1VEOA 3QEQA 4HAFA 4X6DA 2WBXA 4L1DA 3DTUB 4B7LA 6CGTA 2AW2A 2QGBA 1OGPA 3GPSA 4KQ4L 4Q6KA 2YPLB 5KWYC 4D3CH 2HPOA 3TWCL 2BSSA 3ME0B 4FI8A 4NQCB 4OGYH 1GJUA 5I76A 1TQSA 4LHJB 3D18A 3NP3A 2EE6A 5IFHL 2J20A 4NWUH 1TVHA 4IRSB 2GEQA 2Y1YA 1BD2B 3PNRB 3RX5A 1JGUH 1T04B 1QKZL 1UWXK 4GRWH 5EWIH 3SBWA 2WCSA 4BUQA 2XA8L 5D7JA 5BO1H 1E9QA 1ZS2A 3DUSA 1BXVA 4KK9C 4FP8H 3I74A 3TA3D 3NCFB 2MNWA 3QAZC 3U7YL 1UACL 1XB6A 2G9KA 3JWDH 3W56A 1EEZB 1CD1B 4WK4B 4AQ1B 5EZPA 2W0FA 3VYNA 2YPLA 3O9WD 1MJJB 1KGJA 5HYJA 2ADJB 1SYSB 3ME0A 1FYTD 4NQCA 4DQOH 4XVUD 4EEEA 1JZ5A 4M1CD 4HIHB 3S4SA 4F37K 5I0YA 3MCYA 3VFWB 1EPFA 3B2PA 3L6FA 4IRSA 4TVSa 5DK3A 1V05A 3O3UN 1T04A 4YPJA 3JVGC 3UL4A 2KT6A 4CADB 1DVQA 5FUZH 4G9FD 4EI0A 1AJ7L 3GLEA 4WWKC 3ARYA 4WO4C 2K9FB 2DN7A 2IADB 3P3TA 4ISVB 3LXAA 3QR1A 3B9VA 1CI3M 2XTJD 4OZGF 2CUMA 5D9SB 2AEQL 4IRJA 2E4FA 7TAAA 3MJ7B 2EDTA 3FSVA 4KKZA 3NH7L 4E41D 1CD1A 4AQ1A 5J6GB 3UCRA 4WNSA 3WFBL 4FERA 4JG1L 1FFQA 4H0LC 4Q6IC 4KVCL 3ZY7A 5F72S 4HIHA 5J9PB 2EKJA 1JUFB 1T66C 1I3GH 1BZ7A 4P9HC 2FWOB 1MCDA 2Y7QB 1YYLL 2ZX5A 1T5WB 5K69A 1F1DA 1E4KC 2ZOLB 4CADA 3VGGA 1UM5H 4R7NA 4XTRD 5GSVB 4M8VA 1E50A 8FABA 3D4CA 2DAVA 2R0LH 3D05A 3LEYH 3V9FA 4WI8A 4BINA 3MJ7A 1N67A 2DQIH 1YLBB 5EOCL 3SO3B 1QMUA 5J6GA 3EDDA 2VJ0A 1RURL 3WTXA 3P2BA 4F8PA 4PEEA 1MFEL 2CO2A 2R4RH 1KCSL 3SDDC 3WEXA 5HDBE 3FO2B 1PDKA 1RV6X 4FLQA 2PXYC 2FWOA 2DLGA 4L9LC 1UVQB 2Y7QA 2XG4B 1T5WA 3EJYD 3QJTB 4GG6F 2OW6A 3CQQA 2P8MB 1GYAA 4N6RB 5GZNA 1FL5A 4IM8A 4YLQT 3ULVD 1A4JB 2VMCA 4NN7B 2JXMB 4PWFA 4WUUB 5I75C 5B1AB 5J89A 1JVKA 4MB1A 5AAPA 5C6PB 1A6UL 2VZ3A 3AC0A 1JXDA 4KU1A 5TE6L 1BBJB 5LO7A 4OIAA 2A9NH 4R5TA 2LLLA 2O61B 2XN0A 3ARZA 3ZMNA 2WSPA 4MBRA 4WUKH 1PZUB 4JW3A 4Z3FA 4Q2ZB 2E27H 4NNYB 2XI9A 3IMBA 3WHXB 4G6FB 2ATPB 4Y16D 1LQSR 5FYLE 2B4CH 3WU1A 3UGEA 1DVFD 2OKMA 4LGPB 3QUXB 3UJJH 4B0MM 5HGAA 4J6IA 2P8MA 4I9WD 4QXUH 4KJWC 2R56L 1BVKA 3LJ3A 1YQVL 3ESNA 1W72B 1A4JA 2F7PA 2JXMA 3L08A 4R9HA 3UTPE 3PPSA 5L8KB 3OHMB 5F6IB 3IMRA 3S4SG 1BBJA 1TMQA 4HOZA 2VRAA 2O61A 1J1OL 3E2HC 4ZMOA 2A6IB 3GMQB 5IB4B 4TQ8A 2A74C 3RGVC 4U49A 4JFHD 3WHXA 4IOFD 3SE4A 2ATPA 3K6IA 1PNCA 2WXMA 2AQ3A 1ZHLB 2ICEB 5I1GL 5EUOF 5LCVL 4L29A 5CZRA 5C0FB 3US9A 2I9LA 1SJEA 5HI4C 1DUZB 2JJTA 4AGOA 5FB8B 5FLVA 1O6VA 3PP4L 2QGDA 4MCZB 4AYBA 3EFFB 1DN0B 4AUUA 5JHLA 2E59A 1AH1A 4KFMA 4PJFB 4PRPD 4WNJA 2F58H 2AQTA 5IB4A 1OAKL 1AXSB 1MREH 1P4UA 3MHZA 1E6JH 2D3JA 2HN7B 2XN1A 3HRPA 1ZHLA 5F7DB 3T5WA 1S7XA 3CZEA 2RCSL 1GZQB 4JFFE 1MWAH 5C0FA 4TUJA 4EKXA 2ITCB 1DUZA 3QFJE 5KBDA 2VR6A 5BRZE 3Q06A 2HWZL 1E9PB 5FB8A 2BIMA 5AB1A 3TXAA 3E1ZA 4MCZA 4DK6A 4IBWA 1DN0A 2G0KA 2Z64C 1U58B 3VFMB 2UZPA 4PJFA 3TT3H 1BYPA 3CLEL 5C07E 1R4XA 3MRKA 2O1AA 3O0LA 4QI3A 5I16B 4HPHA 1BIIB 1RZKL 1YZZA 4Z7UE 4JKLA 2Y7NA 2HN7A 1FRGL 3D8MA 3GZKA 1VF5C 4JFPB 4WHCA 4PP1C 3QNZB 1GZQA 4U6VL 4Z7NE 5TDNB 3P9MA 4HJUA 1JTTA 1QUNB 1RJCA 1T22B 2YPKA 4PRHB 2WXQA 3FC8A 2DWYA 4JO8A 1E9PA 1AFVL 5HGDB 4M3HA 5D2NB 2PWFA 4N0UE 3MV9D 2G4GA 4JPSA 4P46B 3JWNG 3VFMA 4LPWA 3HB3C 3TASA 4O2FB 3PNWB 4QF1B 5D71L 3LKRA 5I16A 3ZBMA 1BIIA 3VXRE 4LLUB 3LOWA 4R8WH 1KXVA 1WWCA 1J12A 3FN0H 3V52H 3CZKA 4ZW6A 3GKWL 2OMZA 4R6UA 5IMOB 4M5ZH 1Q0XH 5DRZA 3QNZA 1G6RA 3MV7A 5D72L 3P3RA 5BW7C 4ZFQA 4DTGH 5I5MA 1T22A 1VJSA 2HLAB 1H6EA 1KF9B 2YAHA 4PRHA 3HUJA 3ZE0B 4W6YB 3QJFB 5HGDA 4YDZA 1DR9A 5D2NA 4F7CA 1SJXA 4N0CD 3IGLA 3NJNA 2R8SH 4NKQB 3WTUA 1U8CB 3QRGL 1SOKA 3B43A 4P46A 4BD4A 3IDJB 4NJ9H 2R9HD 3C5ZC 5I1KL 3VW3L 3PNWA 4QF1A 2KI6A 5JZ7C 3T0WA 2KYIA 4LLUA 5IREA 5F6HI 1N8ZA 4WU7B 4RWYH 3QVAA 3RWIB 4ACPA 5I15H 4LP8A 1G7QB 1MCWW 1NGPH 1WWWX 4P9ML 3KBFA 5IHLB 3IFNL 3AAZB 3H2WA 3JXAA 3AG3B 2AV1B 1JNJA 5IWLC 4DEUA 1U8CA 1KLUB 1R33A 1T5XB 5IZ7A 1OWWA 5EG6C 3CVHB 1HZHL 2YQ3A 1ZLUK 3V4LA 3BUPA 4FZ8H 3G6AB 1GMIA 3WNIA 4CVWA 4B53A 3HI6H 4WU7A 3ZE2E 3VI3E 1U95B 2A73B 2WGNB 3C6LC 3OF6A 4YDKL 4BK8A 1A7RL 2ESVD 2ZXEB 3TURA 3QG7L 3MV8E 1G7QA 2Z1PA 4XP1L 3L54A 2J55A 3RL2B 3V6ZB 5IBLC 4BE6A 3AAZA 3FTVA 5DJAB 1DDTA 2XRAL 3NIGB 4Y2LA 3D09A 3HCVB 2MH4A 5IFHH 4BHUI 1KLUA 2RFXA 2GJ6B 3ZE1E 2GSIB 4ZK8A 3W9EA 3WJJA 3LQZB 4L1SA 3UO1L 1S9WA 5EC1A 1GCFA 4ZUWB 3ULUH 4BSVA 1KXTB 3AG4B 3KPTA 2RA1A 2ZKHH 3AMLA 3ZKQD 3RBSA 2QSVA 2X4SA 1U95A 2A73A 3C12A 3T0ED 4MAUL 4Y9BA 1UACH 3AFLA 1FO0B 4LP5A 3ZGIA 1H3XA 1J5DA 3PWPE 3RG1C 1OGSA 2OTUB 4PU2A 2R69L 3Q0HA 3RL2A 1YY9D 3H3PH 1CQKA 1F3DJ 3G04A 4O9HH 3APDA 3HCVA 4JREC 2H3XC 4PJ9D 1EO8H 1ZPUA 3QPQC 43CAA 2GJ6A 4Y8AA 5AZ2H 2EQDA 4UF7C 2A9AA 5TDPB 4I0CC 3D12B 1H5BB 3LQZA 4PRID 4XMKH 1ONQB 2EDKA 2PCPA 3FQNB 4ZUWA 1CLCA 1KXTA 3WN5C 4OZ4B 4AYMC 1JCKA 3LDBB 1OP5H 1OAZH 1ZTMA 1FO0A 1YDPB 1E67A 2XZQH 3LMJH 5AVWB 3LX9A 3WHE0 4P2RB 1YEWA 1ZLVK 4Z1PA 3STLB 2ZSWB 3AREA 4RMQA 1CLOL 4HXBH 2Y5EA 1YEIH 4JG1H 1DANU 3OTTA 3HBZA 5TJWK 2XWTA 1LL1A 3HE7B 2IH9A 3UROR 4JO2H 3S5LG 1J5CA 5FGCB 3LVTA 4NCC2 2JKIS 4QIRA 2L0DA 3S37L 1H5BA 5JDJA 1ONQA 3FQNA 2HT3C 2VXTL 1WPCA 2VZOA 5AENA 5EBLB 2WZ5A 2NZIA 4OZ4A 1ODUA 3VX1A 2PYEE 1ZE3C 4UIKL 3CVDA 5AVRB 2JKNA 1YDPA 3GJFA 3RTQD 3TEXA 4HUMB 1OHZA 3TH2T 3STLA 1M7IA 1Q90A 2ZSWA 1BM3L 1NFIB 5I6XB 1TQCB 3ULAB 2V2TA 3CQPA 2DV6A 2FLBT 5IJKC 1KCLA 2P47B 1CMOA 1D5ZA 4KJQC 5J1TC 4PY8I 4RSVA 2OR7A 1A8JH 2A0LC 3BKCL 4NQUA 2R2BB 4PJHF 5HDQL 4ZUVB 1ICTA 4HS8H 1RPQA 2JQMA 3IMWA 4ENZA 4QKXB 5C2BH 3KZ8A 5DI8B 2ZXDA 4CW1B 3DHUA 4WI9A 1A2YA 2XV6B 1GJWA 1AE6H 3O2DA 3OAYH 5EBLA 1JHLH 2J4WH 3WTVA 2GITB 4YE4L 2YAPA 4AJ0A 1SOSA 2RGSA 4XAKE 4WI6A 2XETA 4JRXD 4EOWL 1NFIA 4S1DC 1OPGL 1U8LB 4AQAA 1JYWA 4UV4H 2LU5A 2ZQKA 1KC5L 2X38A 2VL4A 3MRMB 2BVQA 1DTUA 1MRDL 2R2BA 2XJKA 3ROOB 1N26A 1WEJH 5JDSB 4ZUVA 4P05A 4OLEA 5DI8A 4OV5B 2X42A 4CW1A 4WI2A 5J57B 4WQOA 2Q86A 5FF6B 5TDOB 1JXFA 2GITA 2I5YH 4RX4D 5ADPL 3GRGA 3ALPA 1JRHI 1L9SA 5KVFE 2EYSA 4GBXD 4NFBA 5CGTA 4M9PA 1U8LA 2F54E 5AW5B 4ENED 3VGAB 5ISZE 1C5CL 3ZRSA 1A6TB 3BH4A 3VXTB 2HXAA 1QOKA 4YVNA 2J5LC 1UB5A 4OV5A 1LVEA 5FIEA 2QPUA 2ZOKB 4FX5A 3QQ3B 3MCG1 3SYAA 1GYUA 2FLRT 2W9LA 5T33H 3UAJD 3UTTB 5TDOA 3ZZLA 5FF6A 2RAMA 5CJBA 3Q7JA 1X5GA 3BD3A 1PMYA 2VKXA 4MA7H 4PGBA 5GGQL 2EUWA 2BNQD 4PPTA 4BKSC 2EXYD 3T2PA 3U7AA 3K8MA 4OLXH 3QSKB 1DQLH 4GKLA 4S1QL 4OTXL 4ZPVB 4WEUD 1LO4H 1JF5A 3VXME 5JIDA 3H9SE 4MNQA 3X3GL 1XEUA 4L8SC 4CMHC 1BPVA 1A6TA 3VXTA 3LEXB 3BVXA 2GSMB 1KZQA 4JRLA 4XPHH 3V9EA 1ROWA 1AYRA 2QSCH 3WG7B 2E9JA 1SLVA 1OCZB 2VCOA 1VFBB 1Y6MR 1PX4A 3TV3L 1CLYH 1MFBH 4L1BA 3VACA 2HWZH 1MRFH 2GW5A 3DECA 2OMNA 1U8OA 3QCTL 4XBMA 5L9DL 2PETA 3DX3A 4ELKB 3NZHH 3TF7C 4O58L 1BVNP 1ZT1A 3O3DA 4JJOA 5DJXB 3REWB 4PJGF 5MP6H 5D7SH 4JFEB 4PJXE 5C0RL 3L7FA 3NCMA 3O6FC 4M5YH 5C0JB 3L2NA 1INDL 4NNPH 3C09B 3I50L 5IESL 3IAGC 1VFBA 3QK0A 4WHYG 3K91A 5D7KE 1FQ9C 1EJ6A 1E6OL 5LLIC 3UBFA 3EJPA 1U3HB 5T8IA 2KDYA 3P40A 3W39B 4DZ8B 4ELKA 5DSCB 4LMQI 2YAQA 3ZRFC 5INCA 4FFZL 2IH1B 2XX0A 4PBVC 3REWA 1XDTT 1UATA 2V5YA 2H47C 4JFEA 3OLIA 1OWRM 3C2AH 1NGWB 3APFA 1KB5H 4FMFA 1OB1A 5HVGB 1IJ9A 2ZF9A 2VN4A 2WO2B 3GI9L 2AANA 4XMPL 2CK0L 2CCLA 3PHSA 1W15A 1AC0A 1U3HA 5IROC 5I28A 2A2QT 4NO3B 3VG0L 1ZA3B 4XCYB 5E56A 4DZ8A 1HL8A 1I1YB 5DSCA 3V4VL 1YNTA 2C7FA 3BP4B 3O3AA 3F7QA 4YFLF 2V3EA 5J13B 1XT5A 1ET7A 1HYSC 4XH2B 4D9RD 1F58L 1NGWA 5IBUG 3L4WA 3O0RH 1ZLWK 1YNKL 1KIUA 4A7GA 3CDGB 2ZX6A 2BC4A 5AYQA 5E6SB 2EEAA 1C12B 2XLLA 4K94L 3VFVA 2A6DA 1LE9B 2NXYC 1E5YA 4DVRL 1AZRA 2L4OA 3KPLA 4GAGL 4JDVB 1L6XA 3TBSB 1TMCB 4NO3A 4JHZA 3J8F7 4D7BA 4XE5B 1I1YA 3TFKD 2WB1A 4PJEB 3PQYA 3BP4A 5E03A 1AGDB 4QOKD 3LS4H 3VD5A 2IFFL 3UG4A 4F92B 1SYVB 3K0WA 3TN0D 3QORB 4KROD 4WIQA 1ZLDA 1MCOH 4XH2A 1VCBC 5AWNH 1NOLA 3OJDA 4I0PB 3GXNA 2EABA 3KWWB 3CDGA 3Q13A 2N7SA 3RPIA 5GRZA 4N2BA 5AVUB 2COVD 4G43B 1LE9A 5E8NB 2WBJD 1T89C 4KZEL 4JDVA 2VMEA 2B77A 4NQED 4KVPA 4JPQA 2JIXB 3TJHC 1OAYL 5EO0B 1HK6A 3MV9E 3G6JE 5CSGA 2C3GA 3CZJA 3OKEB 3QPXH 2EIBA 4XVOA 2ZPKH 1SYVA 2GIMA 3QORA 1YNLL 5C0BB 1CN4A 2V3FA 4I0PA 1AXTH 4M56A 4V1DD 4W9DC 2NY6B 3KGRA 1QASA 4K5LA 4MAUH 4M6OL 3ARQA 4PV8B 4WEBH 5DCCA 3WMSA 5CUSH 2ATAA 4G43A 4I2XE 5E4EB 4EIGB 4KNTA 1NIFA 4GFXA 3WTSA 1IAIH 3U1QA 3ZTNL 4NM4H 5EO0A 4YDLB 1IM9D 1F02I 4HIQA 2FGWL 3PAYA 3OD3A 1QSED 4OZFH 3OKEA 2BS9A 4R4NC 4N5ED 2X2HA 4NBZB 5C0BA 3SDXA 1DBBH 4LVHB 4F57L 1RJZB 3JV6B 1SHSA 3ZKXB 1OCWL 1QFWM 2NX5A 4WK0B 3LKNB 4E0RB 5KSUB 5ENWB 4PV8A 2C9QA 3PE9A 2ERJC 1RIVH 4Y1AD 2FD6H 4JM2B 4Z7VB 5TQ2H 1FZOA 4ZPTB 2X4QA 1RERA 4HJEA 3FULA 4YXKL 4FZEH 2YHGA 2XQYA 3BZEA 2ARWA 3KPSD 2ZCLL 4Y19E 4QRFA 4OZIB 1A7NH 3BMVA 2UZYA 5JQ6H 1BA9A 3TJEL 1EAOA 1Z0NA 3BQUB 3LAFA 5I71C 3CDZB 2FL5A 1BFSA 5IMKB 1ECYA 1RJZA 2H0EA 3JV6A 1N9PA 4ZTOH 5AEAA 4KDWA 3LKNA 3MBEC 4E0RA 1Q0YH 1CFTB 5KSUA 5ENWA 5GGTH 3GBMH 5GRXG 3VXSA 5LKNA 2YXVA 1BVNT 4L5FE 1WVZA 4IGBB 4JM2A 4Z7VA 1A6ZB 3KJ4C 3O81A 1QHQA 1J0YA 5FOBB 4B5ZA 3LEVH 3BMWA 1HZLA 3SKNB 2VW4A 4UT7L 4WF7A 1LP9F 3AVEA 1EEUA 5C0EB 1WZ1H 2NY4D 2ZKWA 4MQTB 4GLRI 1Z3GL 4JPVL 1E9OA 2BOBB 2VLRA 3BQUA 3U1SL 2NY0D 2EH7L 1F90L 4JQIA 1MFDL 3CDZA 4TPRH 5CD5C 1LK2B 4KXCA 4U1JA 2VR4A 3WO4C 3BHBB 5KG9B 4TOYL 1CFTA 5JIPA 4YE4H 1AS7A 2WXOA 4HV8B 1PLAA 3GI8H 4XZ4A 4FAAB 4EOWH 3IJEB 3L48A 5CGYD 2Q3ZA 4QPEA 1A6ZA 4PW9A 3QEUA 4HXAL 3S88L 1P7QD 3ZZSA 5FOBA 1OPGH 4OSUH 3SKNA 5JNYB 5DUPL 2MTPA 1XZWA 3VCLB 4PJDF 5C0EA 2LT9A 4XMVA 1AQDA 1JAEA 4P2OC 1NBYB 3MMEA 1IQWH 2CBQA 3A6OA 3B9KC 2EO7A 5FO7B 3SCMD 2YUVA 5SWSD 4EDWH 3BVDB 1Z9MA 5ADPH 4RCAA 2OLDA 3KYOB 1KJ3L 1QZNA 5F3HB 5HYSB 4LQFL 3RY4A 2G5BB 4GSQA 3ZIYA 2O6CA 4QXTA 3C60B 1PKQB 4XBEH 1PPIA 4NEHB 2WZPA 4OGAC 4ZUTA 4JDEA 2EYRA 2NPLX 1RVFH 3UYPA 4GQRA 1QUPA 1X9RA 3RWDB 4JKNA 2E76C 5J12C 2PW1A 4M7LH 4QR7A 3GBDA 2WCPA 5I8KH 1MAJA 4NQQA 5FO7A 4KKAC 2W9DH 1WTGT 3ERXA 2LR4A 5KSAD 3SDAD 1K2DA 5HHME 1AGBA 3L3GB 3NIFB 3MFFA 5IEHB 1FBIL 3KYOA 5MENB 3LIZA 5F3HA 1JZHA 4MAYD 1OCOB 4AV0A 5BRQA 4MXVF 3LNGA 2G5BA 3QQNA 4U3SB 3RNKB 5IKCA 2B14A 3ZLQC 2GI7A 2IAMB 3OLEA 3GS4A 3C60A 2OZ4L 3U1PA 3MV11 3AT8A 3EYOA 3KPOB 3KPQB 5DD3L 5IVXE 4AE0A 4PJ7E 1NOFA 2Q6WA 4Z7AA 4HT1L 5I6MA 3L9RB 4EZMA 1GGBH 4X7SH 2GUYA 4FFWC 3U4EB 1MZZA 3FTGB 4DEWA 1FVCB 1DL7H 5D7IF 3HLAB 3QULB 4GRLA 5HHXL 4FHBD 4LIQL 4L3CA 4FFYH 1KIPB 3CMOL 3TVMC 2O6EA 4TXVB 4DK3A 1HE7A 5L9DH 3HE6B 1UZ8B 2FHFA 3T8MA 1JHTB 4N2IA 2OAAA 1EQWA 2XN9E 4UV7H 1DN2A 1JCVA 2AJSL 1WFNA 2J8HA 1U30A 3KPQA 3TBBA 1EHXA 3NJLA 3B56A 2BDNL 1ZDSA 4OJCA 3S36L 3SPVA 1G5AA 2A6JB 3QIWC 5C0IB 4KDVA 3L9RA 3P2DA 4S0TD 3B2MA 1GOHA 3U4EA 2LE9A 5KVGE 3HLAA 1KGXA 2DTSA 4F2EA 1BPLB 3QULA 3V6BR 5CAYB 5KSBF 4DO4A 1KIPA 3FFCB 4H26B 3I84A 2R29A 4M48L 3NCXA 4Y5VB 1I8KB 1IU1A 1DZBA 2FZ3B 3HE6A 1UZ8A 4P9HH 1Z5LB 1JHTA 2MJWA 3CFEB 4S1SL 4G8GE 5AW6B 4BDVB 4EIZC 1R46A 1NAKH 2DKMA 1A0QL 2ICWA 5AUMB 1M1XA 4KI5D 4U0RB 3VFSA 5E6IC 1WFJA 2ROXA 3KAAA 1S7RA 5B1KA 4I18B 4N90D 2CR0A 4UINL 2VR3A 3BZDA 3HI5H 4DWHA 2A6JA 2Q8BL 1UKSA 5I8CA 4LCUB 1KCVH 3ARXA 3ULVL 5E4OA 4YWGH 3RX7A 2EC9U 3CX5J 3GXMA 1Y6KR 4S2SB 3RUGA 5GS0L 2Z31B 4LMQE 4ECNA 5B1JC 4L8DB 1DANT 2MMXA 3FFCA 2DOCA 2VDMH 1YO4A 1RFDL 1I8KA 4A6YA 3NPZB 3PAUA 1UM4H 3SPJA 3BP7B 2X2IA 3WE6A 1Q94B 3D9AL 4MJJA 2WXNA 3MJ8B 4U1IB 1DDHB 4I18A 3MN8A 2X6AA 4PW3A 2C9VA 1ZDQA 1CB4A 2Y2YA 3L3HB 1OW0A 1WYJA 1CR9L 1JPFB 4LCUA 2H9GA 2AI0H 2PYEA 1S78D 1A3RL 4MJIE 5H37A 2CMRL 3FRPB 1CFBA 2WUBH 4S2SA 2Z31A 3TA3B 1UQSB 3WFZA 1NCGA 1CD8A 1MCFA 4DVRH 1LNUB 1MQKL 4GAGH 5AB0A 4RLDA 5G4OA 2ZXQA 5BV7C 4TSBL 4NUGL 4ELDA 3PV6A 4UTAH 1KN2H 1FYTB 5IOPA 3BP7A 3VYPA 4AENB 2HLEB 2YEQA 1Q94A 3KXFB 5T1DL 3VM7A 4HK3J 5DD5H 4BSWA 4ZXBC 4QRTB 5KJ4A 3N2JA 2V2XA 3BH9B 4GKNB 5IGXL 4G9FB 1JPFA 2WZ0A 1F8TL 2AQRA 4X6BB 3S8WA 3FRPA 4X6CE 3TA3A 4M7JH 2NY7L 4JM4H 4ABWA 5GHWH 3G6DL 1LNUA 4YVUA 3DLQR 4Z7QF 4E41B 2Z34A 2QELA 4TS6A 2M83A 4YSAA 4NS0A 3O9WA 3VD0A 7PCYA 3AS0A 2BNUA 2UV3A 4X7CC 4PLKD 1FYTA 3NAAL 2UUDK 4AENA 5EDSA 4JKPH 4XWGL 3WNJA 1M53A 4HULB 5C9JB 1UD3A 5CP3A 4QRTA 4YSUA 3UTSD 1CU4L 1NUFA 4OF0A 3TZVB 4GKNA 4G9FA 5F7EL 5IOKA 1A4CA 4W93A 4X6BA 5AAMC 3GBNH 3DUHA 2JI2A 2M1KA 3MGTA 4Q4EA 3FBQA 3WKQA 3C5JB 3MSPA 4UNVA 2CM5A 3MGOB 3S48A 4E41A 4IOSD 3MXVH 4ES8A 1ZTXE 2GHZA 1GHFL 2VDRL 2XZCL 2JKLA 4AV5A 3UTZB 4AK1A 3GEWB 2YPVL 3PIQA 5ALCL 3ZYOA 3H6JA 4AC4A 4PLOB 5I26A 5A3IC 2E6QA 2VISB 4R83A 5KVFH 1B0WA 4AGLA 1CVSC 5JHAA 3L5XL 3WBDA 5IB3B 4WCYL 4TLTA 3TBYB 4NERA 5E70A 4EN3D 3C5JA 2GIYA 4JN1H 4EZLA 1GRWA 3VWJC 3GTTA 1Y7VA 4MD5A 4KI1A 1U21A 1UT2A 2X1QA 3KW7A 2NY3D 5FW8A 2EIDA 1V55B 3UTZA 1BZ9B 3RE0A 3R18A 3S35L 2WWKO 1CG9B 5TE4L 4Y16B 1A3QA 3N40F 1DVFB 4OZGE 4HCRH 3VFRB 4CKVX 1HTYA 1EEYA 2A5UA 1ANUA 3ISYA 5KEZA 1XGRB 2VDPL 5GRVL 4FLSA 1HCVA 3UFIA 4ODSL 5I8OL 2IWKA 4B95C 2PO6B 3MNMA 3HBQA 3RDJA 4PJBB 1H9VA 5LDUA 4LF3B 2Y06H 4HWEL 4GQPH 4RESB 1U8JA 1NBQA 2EVGA 2P8PA 1W0WA 3CD4A 5IHHA 1CG9A 2B9AA 1FORH 2BP3A 3OKLA 4Y16A 1KJMB 5AVSB 3WD5L 2QADC 1KT2B 2VLLB 2NTFB 3IDMB 1DVFA 3FRPG 4DN3H 1NCAH 3VFRA 2YFOA 3QISA 1HINH 3Q8BA 1MPAH 4OI7A 1FL3B 5F9JA 3MA9L 3NFNA 3WFEH 2YMOA 2DJUA 3TO4D 4W6WB 2FEDC 1X4ZA 3TPKA 4J39A 1ASOA 3D3VE 1QRND 4PJBA 2KQMA 4FLHA 2VZ1A 4LF3A 2XICA 4OM1H 4PRPB 4U4IA 3UZQB 3VXUE 3WNOA 1A22B 3R06B 1NCNA 5H2BB 5IHWA 4GG6E 1WAAA 1CICC 1W9XA 1JN6B 3MTRA 4BGDA 4FQ1L 1NCJA 3SE3C 2NTFA 3T2NL 1XCQB 4B7IA 2AJ3B 2X40A 3WTYA 3N1FC 1YYCA 2EDYA 4CNIB 4M1DL 3QQ4B 4P99A 2XV0A 2J57A 1UD6A 4W9IC 3U25A 1OM3H 2QZ5A 3ZGHA 4LOFA 2V17H 4TNVF 2BWIA 3QDGE 5CILH 5C6TH 4U6HB 4BQBA 4GXVL 3NDZE 3E9UA 3PJNA 4PRPA 1YEDB 4UT9L 3R06A 4M7LT 4WFGD 5CN2A 5H2BA 3VUAA 1BOGB 1KEGH 1X4YA 1GGIH 3CN4A 4WFFD 1JN6A 1URZA 3QJOA 1P5VB 4G7YL 3T3PF 3W2DL 3PXLA 2D7QA 1K4DB 1ZIAA 2B5IC 1QR1B 2AJ3A 2YN3A 4E9YA 4WO4D 2F6AA 3FZUC 4L4JA 5T5FL 1XL4A 1DVZA 1UCBH 5DEZA 4O02L 4ODBD 4Z7WF 2GBVA 1I7RA 2OSLA 4PUBH 5E2TH 2R15A 2IG2L 5KS9B 2CM6A 1O9WA 1YEDA 5C8JB 4HBCL 5HHQA 1Y18A 1BOGA 3SPHA 3EJSA 1O7DC 5EUOE 4ZRGA 4ETQB 1E4XL 1P5VA 1N0XL 4K7PL 2IMMA 2WGXA 4NZ8A 5I6PA 3C2SA 1OE2A 1K4DA 4ANVA 1QR1A 2GG1A 3IDYC 5CP7B 3SPGA 4XN2A 1OF2B 2YWZA 3BSGA 2UY6B 1FCCA 3C87A 1B2WL 2GC7C 1ZLSL 4WVRA 3PP3H 4NUJB 3QUML 3MV9A 5HXMA 3L3DA 2VXQA 3VD9A 4GSXA 3UMTA 5F93C 4W4NA 3E8UL 3ROLB 4ETQA 2R1YB 4LO9A 4MX7A 4ZO9A 5I8EB 1PJWA 3N41F 1YEEL 3GZPA 5DGRA 1MJUL 1D9KC 32C2B 2NUPB 5CP7A 4R3SB 1OF2A 4GRWB 3GFUA 1E28A 1T1WB 5TQ0L 2VZSA 1BFVL 4IBLT 3FJTA 4GINA 1F18A 5GGVL 4XODA 1KFAL 1R3HA 4KK6C 3KPMB 2VJXA 4AYDC 5FWQA 4AL8C 1S5IH 3WO3B 1FGNL 1BZOA 1YMMD 5DMGD 5SV4A 5C9KA 1TO5A 2DH2A 4LAQH 4CSTA 2IQ9L 1ZE3H 2Q8BH 2XIIA 3ROLA 1II4E 2R1YA 2BFGA 5C09D 2CBOA 1FPTH 2VAAB 4NBXB 5IV2A 4N8VB 4HOXA 32C2A 2NUPA 2E7HA 3C6SB 3GHBL 1HQRB 4LARL 1FUNA 2D3VA 1NKRA 2ESVB 2QSTA 4YE0A 4R3SA 4NPJA 3FUMA 5GJTH 1TIUA 1UGKA 4Q6YA 3K4DA 1R47A 1UJ3B 3MTXA 4K3EL 4HKXA 4M93B 4P59L 3J27A 2F53B 5E6YA 4J3OF 2A77H 2VLJE 3EDEA 4PD4K 1QNIA 1PY9A 1AD9B 4F9LC 1J1XH 3KPMA 4QY8A 4G1EA 3CPUA 2QKSA 3P11H 3V5DB 5AFAA 2V2WA 5BOJA 4PRNB 1QFOA 4HEME 2WWKT 2AGJL 5DLML 3CHOA 3EIFA 3ELAT 1NC2D 1A3LL 3IJYA 4YFLI 3DIDA 1IZJA 5ACZA 2LTQC 3V0IA 1XD0A 2X6MA 2G2NA 4R4FH 3V6OA 1AGFB 3ZHNA 2VAAA 4G80B 3T3MF 2BCKA 3NA9L 4FNTA 4N8VA 5E9DE 1ID2A 1HQRA 1N8OE 3FK3A 2ESVA 1D3CA 3DVGA 3FO1B 3NCBB 4PJCB 2G0LA 5EFIA 3HVNA 3QYNA 2HTKD 4XNUL 1IEAB 1TZHB 2QPDB 4J5VA 1NUNB 3MQIA 3V5DA 4NQVB 1WO2A 5JA8B 4PJ9B 4PRNA 3T4AB 2H6OA 5EZIH 3OQRA 2C4FT 4XBGB 2AK1H 4ZUUB 4L5FH 4W68A 4LOUD 5ABAA 2VJ8A 2NDGA 1F8TH 2ZCZA 5HVHC 3TH4T 4G80A 4G42B 3T0EA 5F44A 4WJ5A 2KS0A 3FO1A 4PJCA 1G84A 3IMTA 5FXCH 3T9WA 2KLSA 1I75A 1CBVL 3BYTA 3LPGA 2NZ1A 3H9HB 4F9PA 3N50A 3QCUH 2NW2B 4NCDA 1IEAA 4M61A 4MAZA 3ML8A 4WAFA 5TPWL 2N7BA 2VQUA 4PJ9A 1OGAD 3T4AA 3ZTEA 4L3AA 4XBGA 2NQCA 4ZUUA 4A7SA 4G11A 2BH0A 4PRIA 4QHUB 4LCIL 2JLPA 5ICXB 1I7TB 1T2QL 4XMXA 4NKDB 2TRHA 5FUOL 3IWUA 1ZVHA 3RTQB 1DLFL 1OARH 2JWYA 3NIDB 1JGEB 4MXWH 4UNIA 3H9HA 4U1NB 4HJSA 4M6MH 4P4KD 2AV7B 4X80L 1DQVA 1XB8A 2OW7A 4ZFFB 5A7BA 4QHKJ 5ITFA 1HOEA 1RULL 2ZUTA 5F1IB 2V7NB 4QEGA 3FCUB 1GR7A 4IMKC 4QHUA 3M07A 1K3ZA 4HU2A 3MOAH 5GGSY 3OGCB 3L5XH 4GUCA 4EXPX 4YC2C 5ICXA 1I7TA 3GXUB 2KLTA 2O6DA 4M62H 2D7OA 4Z6AT 3JT2A 3V7AG 6PAZA 1UUNA 2WO4A 3L9YA 3RTQA 2VDNL 4D2NA 4GIPD 5BUPA 3ESPA 4FQQB 3ZJAA 4U1NA 4Y5YB 2WTRA 4OT1H 3K2UL 1JRHH 3SE6A 3APNA 3GJEA 1UKQA 4WSKA 4PHZA 1EFQA 3EYQC 4ZFFA 5I1CL 3QDJD 4HIXL 3MODL 4XP4H 1UTDA 3O8XD 3HIZA 1DQJB 5F1IA 4L8CA 4WWPA 4CVZA 2VDKH 4JFXA 4OJFH 4TNVK 3VXOA 2COQA 2HVKB 3OGCA 4EVNB 1GS7A 3PDGA 2MCG1 2HPTA 4LCWB 1AIZA 3U7WL 4NI6A 4HGMA 4DHLA 5DMIL 2I85A 3L81A 2D3NA 1HHJB 3KL3A 3EJUA 4JRXA 1UENA 4YDMA 4ZNEE 4FQQA 2E8YA 4GBXB 1MWAB 4Y5YA 2OFQA 2N4IA 4GH7B 2APTA 4BFBD 1MCHA 3HZMB 3HZVB 5FEBA 1U3YA 1Z9NA 3ET9F 2FT7A 4X5XB 4XXCC 4ZS6D 1T0MB 1DQJA 1U41A 2MQ3A 4ZW8A 2ADGB 2GJRA 2AXFB 3BKJH 3K72B 4U3XA 1QLFA 4EVNA 2ZX8A 3D0VA 3INUL 2HVJA 4WGWB 4WK2B 4RX4A 3GEFA 1A1OA 5E0FA 1HKLH 1FNFA 3BPOB 4ZX3A 1D2OA 4PJHE 5IBLD 2E7LC 1JPSH 4GBXA 2DYPD 1MWAA 4QRBA 4MSWB 1VFAB 4BZ2A 3H0TA 3NABH 2BNRE 4YHPB 1CTOA 3ZKSD 5EPMB 4X5XA 3WEOA 1O7DE 1T0MA 2DTMH 2YD5A 3UBXA 4U6YA 2OJZL 3FT3B 3IF1B 4IIQA 1HH6B 3DSFH 1PYWB 5EU6D 3K72A 3UAJA 2ILLA 3D87B 1J0IA 3ML9A 5EZJB 3FSAA 4CC4A 1IO4C 2YMXH 1ACYH 2WZ6A 3N1GC 3A6BH 5SX5K 3UC0H 2V9QA 2BNQA 3T4YB 3EO9L 6FABL 3VG9B 3BVUA 4ZMNA 4JY4A 1UXWA 2LW3A 4HCGA 4BH7B 2IFGA 1F45A 1JWUA 1N4XL 3BSHA 3QPQD 4GEJA 4YHPA 1MFMA 4RGOH 5INDA 5K9QI 1FZMB 1RL1A 1XCTB 2VMFA 3AY4C 3IJ9A 3HNSH 4LNRB 2Y7LA 2FNWA 1FAIL 3FT3A 4YH6A 5BS0E 3IF1A 4OZHF 2G3MA 2NUTB 3K1DA 4MS8C 4OCYH 1YEHL 4IIZA 4HWBH 1NFDE 3UAEA 3QUZC 1YY8B 4L4TD 3F5WA 3MA7B 4Y4HD 3IEAA 1G7PB 1IBZA 4NQDB 1HESA 2IG2H 3RVVC 4NBYB 5L2JB 3EFDH 3OSVA 4TUKL 1KDJA 2OCCB 2X5PA 4AMKL 1JK8B 4HDIA 3SQRA 1FZMA 5DJYA 4LNRA 4GYBA 3SE8L 3QEGL 2Z7WA 4K8RC 2BIIA 2NQ3A 2NUTA 4GP8B 4UQCA 2MKLC 4PJIF 2P4AB 1NMBH 1OSPH 2QQKL 3DGGB 3FMGL 1YY8A 1Z3RA 3WS6A 3MA7A 2O30A 2FBOJ 3QJVB 1G7PA 4HIJB 3EOAB 4YK4C 1OOWA 5DR5H 3V8OA 2N0KA 3MJ6A 2D3LA 1OP4A 5L2JA 5IHUL 5KYYB 2ZONA 4C8XA 5EF0A 5IJBC 1LO2H 4HEPA 4TVPE 3DA0A 4LLDB 2Z7YA 4UDUA 1JK8A 1OVZA 3QXTA 2A0LD 4FQPA 1JVLA 5DUJA 4G3YL 5EU4A 4K55A 2EXWD 4ZSOB 4UZUA 3T6WA 3PGDB 1IBHA 4G82A 4XP9L 3FNKA 2CXGA 5H4YA 4ONHB 5DZVA 3M86A 1AC6A 2V5TA 2WLIA 3DGGA 3DRQB 5ESQB 2ZUQB 5J5EA 4DAGH 4L05A 4PJGE 5LGYA 3TYFB 2V8MA 2JELL 2QVIA 1VIWA 5KYYA 4MA8H 4S1DD 4FA7B 3UBXG 3QZOA 3W0WE 3TN0B 4KROB 1MJ7H 1IKNA 3BEVA 4HMEA 4MA1B 3SB3A 2GSGA 3O2WH 4TULL 4IKKA 1KJ2L 1ZTXH 2DEXX 3PGDA 3SZ6A 5DVKA 3RA7H 1IFHH 4UOW1 5HPMA 1T7YA 4YMPA 9PCYA 3MREB 3A6CL 4ONHA 5TFSL 1NCOA 2G5RA 4A2LA 4WFHD 2H2PD 2WBJB 4HZLB 1P4BH 4RETB 3PFUA 4NQEB 4XGZB 5JIHA 1IAOB 3TYFA 4DGIL 3LTVA 3NSCA 1F00I 4TNWK 3C6EA 1I8MB 5A2BA 2JVUA 1JNNL 4L9DA 4HOMA 4QOKA 5FHAH 2FB4L 1MFCL 4OD2B 3F7LA 3TN0A 4LLYA 1MIML 4AZ8B 1SXNA 5BMFL 1XAUA 2MSPA 2DQUL 1UB6B 5IFJB 4V1DB 1V7MH 4X8XA 4BWWA 1QFWL 4H8QA 3MREA 4KTYA 4MNGE 5FCUH 1I7ZA 4ZO6A 5FO9B 4JZOB 3LS5L 4KMTL 4HZLA 1NCIA 4NQEA 3MLSL 3PLYA 2YGNA 5FPIA 3PWJB 2V5SA 1ULVA 3FQUB 1RMFL 2VSKB 1IM9B 4IBSA 2FO4B 3GUFA 5HHOD 4AEFA 1FNEB 1NEUA 4N1HB 1QBLL 2R0ZH 4OD2A 1XF5B 2A9DA 3KEDA 1HJBC 5ANMB 4G7SB 3QUKA 3H6AA 1JXJA 3CFKB 5IFJA 1UB6A 3VWKC 4V1DA 4KKRA 1A4KA 1INEL 2K4WA 1QNZH 3POHA 5AKRA 5FO9A 4JZOA 1EXGA 3EGSB 3QWRD 5CMAB 3A4EA 3EO0B 3QUYD 2J3SA 3QHFH 1OGTB 4RFOH 5TPWH 3TONA 4X6DF 1JZ6A 1I8UA 4HEPG 4XCFL 3PWJA 7FABL 3FQUA 2BSRB 3VNYA 3EUUA 1IM9A 2X4NB 2FO4A 1FNEA 4B9PA 1QSEA 4YGVB 4X99B 2CJUL 3OZLA 5BOZG 5I0DA 1FDLL 1Z0MA 1IKOP 3BGFC 1HYRC 1PG7H 2HSIA 3CCHB 4BFGA 5ANMA 3NESA 1HC1A 2MRYA 4L8BA 3O6FD 3CFKA 2OMYA 4H1LA 3V0DA 2DMCA 2OV0A 1A6WH 2VO8A 3NTCL 2FQFA 3EYFB 2AXJA 3S3BB 4Y1AA 3EGSA 5D8JL 5TH2B 3SE9H 1CVRA 5CMAA 5DDHB 1X5XA 3PL6C 5C0AE 2Y3AA 5BQ7B 3EJQA 2HT2D 2BSRA 2AJXL 3MRCB 2X4NA 4I1RA 3KPSA 1IVTA 4YGVA 5EULV 1KELL 2NY4B 1G9NL 1TXKA 3BLKA 3CCHA 3FO0L 3NCCB 1R5IB 4QXGL 2NY0B 4YR6B 5T3XE 4HIEA 4LSVL 3T6ZA 1MLBB 3HC4H 3LZPA 3P4NB 4XHJC 1PLGL 1ZLVH 5J06A 3LPWA 2AJUH 3MBXH 3LKPB 4LCYB 4N0RA 4PN6A 3UDWA 4NP9A 4B97A 2EIKB 1E2WA 5TH2A 5DDHA 5IEKB 4GAJH 1P7QB 5T1LB 2VQ1A 4RBPK 4LNVA 4EIBA 3F58L 1HQ4B 3CHRA 3MRCA 4KX7A 2AEPL 3SZKC 2B59A 3V5KB 2ZUVA 3GLDA 3PHOB 5LBVA 1XMWA