1TJXA

Crystallographic identification of ca2+ coordination sites in synaptotagmin i c2b domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
156
structure length
156
Chain Sequence
SGGGGGILEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/exocytosis
molecule keywords similar to synaptotagminI/p65
publication title Crystallographic identification of Ca2+ and Sr2+ coordination sites in synaptotagmin I C2B domain.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 31
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1tjxA00
1TJXA 1DSYA 4LDCA 2X38A 3ML9A 3KWUA 3S2AA 4QJ5B 4ICXA 1UOWA 3OHMB 3QAQA 2D8KA 3NZSA 4ANUA 2NQ3A 3PS6A 1E90A 2CHZA 4WEEA 4L1LA 2N1TE 2NCEA 2QZQA 2ISDA 3APDA 4L1BA 3JZYA 3DBSA 4OVUA 5JHAA 3L17A 1UGKA 4FHKA 4NS0A 4KZ0A 3F00A 4AOFA 3R7RA 4KITB 3L54A 1W15A 3IBEA 2K45A 2Q3XA 1DJXA 1RH8A 3F05A 3FBKA 3R7QA 4TUUA 1E7VA 3ZVVA 2FK9A 3NZUA 2WXMA 2EP6A 5G2NA 3CSTA 4KZCA 3PFQA 2WXQA 4LT7A 2WXOA 4TV3A 1TJMA 4FJYA 3SD5A 4F93B 1K5WA 1DJGA 2ZKMX 3HHMA 3RPBA 2JQZA 4PS7A 2K3HA 2CHXA 4FADA 2CJSA 4Y1SA 1E7UA 3IM1A 2K4AA 2WXFA 1A25A 3OAWA 4PS3A 4V11A 4FHJA 4XX5A 1WFJA 3PRZA 5CCHE 4QJ4B 1BYNA 1DJYA 4TS6A 1CJYA 1E8WA 1V27A 4PS8A 4GB9A 1RLWA 4J6IA 4JPSA 4ICWA 3ZW3A 4URKA 2QZ5A 4A55A 4F1SA 1E8YA 2UZPA 3F01A 4G11A 4OVVA 2WXPA 2YOAA 4NP9A 2ENJA 2K8MA 3PYCA 4WAFA 3TL5A 5KJ7E 2Q0ZX 3CSFA 2CJTA 2LHAA 3RDJA 3L9BA 2DMHA 4ANXA 3QR0A 3M7FB 3T8MA 5JHBA 1DJIA 2FJUB 4F92B 2RD0A 2WXNA 2KI6A 3FDWA 4EZKA 3DPDA 5H4ZA 3HN8A 3ZIMA 4NPJA 4LCVA 1W16A 1DJHA 1WFMA 3NSJA 3QR1A 2Z0UA 2Y3AA 4WWNA 2ENQA 2A5UA 5G55A 2DMGA 3MJWA 3TWYA 1QASA 2WXJA 4WWOA 2CHWA 4DNLA 4Y1TA 4ANVA 2CM6A 1UOVA 4IQHA 1E8ZA 3QJZA 4QJ3B 2B3RA 3KWTA 4NPKA 3APCA 2CHDA 3ENEA 4EZJA 5CCGE 2WXLA 4FA6A 4F91B 3APFA 2WXKA 2R83A 1HE8A 2V4LA 3L08A 4HVBA 4BFRA 3PREA 3TJPA 4BGDA 2A4ZA 4EZLA 2CM5A 3B7YA 4IHBA 4AJWA 1DJWA 2WXHA 4WWPA 3LJ3A 3GPEA 4L23A 5CCJA 3W57A 2BWQA 1QATA 4ANWA 4QAMB 3N5AA 1BCIA 4L2YA 2YRBA 3W56A 1E8XA 3ML8A 2WXGA 1DJZA 1YRKA 3HIZA 4FLHA 4DK5A 3F04A 3L16A 4XZ4A 4GNKB 3QARA 4XE0A 1RSYA 3QK0A 3L4CA 2WXIA 5H4YA 4FJZA 1BDYA 4MJJA 3P2BA 5T8IA 5EDSA 1DQVA 3L13A 4HLEA 1GMIA 4FULA 2ENPA 2WXRA 2NSQA
chains in the Genus database with same CATH superfamily
5BZDA 3K2UL 2ZXAA 3MJ8A 1E5AA 3T4AB 1I7UB 4X5PA 2VT0A 3RDTA 1T5KA 5IHZB 5IZ7A 4L18A 1NANH 3SQBA 4NRZA 2WLIA 3BSZA 3PDDA 2E27H 4UOW0 4GW4A 1TLKA 2ZOOA 1FFQA 5DS8A 1UH4A 3IWVA 5CWSA 1MNUH 1U2HA 4FGMA 1HQRA 3WS6A 5K9OB 2FL5A 5JW3H 3OXSA 1N26A 1A8ZA 3QG6A 5F7AA 3WFHB 4L2LA 5IK3B 4U3SB 3NN8A 3BHBA 4KTDL 3D4CA 4CVUA 1HSBA 1NAKL 3GRWA 2HX8A 4Q74A 1AACA 4LSQL 2BS71 1E9OA 3BUPA 3H4HA 4RMRA 4EDXB 4DOHE 4YSCA 4HS3A 1IGYA 1QFWL 5C07B 1F3DH 3BP6A 4PRIB 3WSQL 1UM4H 5FYJH 1WPCA 2CIIA 3K5RA 1NUFA 4NM4L 5J3HC 5SWQB 2MKWA 4IS6A 4I3RL 4EZMA 5HHQA 4Y89A 1I8UA 1XGTA 1T5WA 1BQLH 1QO3A 4JGUA 4MNQB 1VEMA 3FU6A 4KU1A 1LK3H 1XAKA 5IG7B 2PPEA 1ZMYA 3SDAD 3QCVL 5DFWH 4BKSC 2YXMA 3U9UA 3ETBF 1E2WA 1JRHI 2XTJE 4UOQA 1FH5L 1MN4A 1QWNA 4PJAA 3GBEA 2OMWA 3L4ZA 1TZGH 3VH8B 2WLHA 1G6RB 1WGVA 3P2DA 3MCLL 1GY2A 4HIPA 5C71A 1P1VA 3LVTA 5FECA 1AYOA 4WCYL 1KCVL 4G8GB 3ARGD 4MWFB 3E6FA 4WTQA 3HB3B 4X5WB 2J71A 4UUJA 3N41B 4JZNA 1Q9WA 3GTTA 5AZ2L 1LEKB 2ZX6A 4LKXA 2BJMH 4G5ZH 3RZWA 3EJSA 2DWEB 4OLWH 4L8SB 1HXKA 3WBDA 5DDHA 5DJAA 3IVKA 3X12B 1QQDB 1G7HB 1WFOA 4QO1A 5JIMA 1LD9A 3GB7B 5DJ6B 2ZQKA 2PXYA 1G4RA 5KN5A 5FUZL 3ZE1B 2WTRA 1N0LA 2BVQB 2FCBA 3MX0B 2OMNA 5L4JA 3S88L 2A77H 3WY1A 2AKRB 4ADGA 1BHGA 2PP7A 4AKQA 4NYLB 3EBIA 3TV3H 2ZXGA 4LDCA 4EUPG 5C0IB 2AANA 2QSCL 5KSBF 2F7PA 2XN9E 3V6ZA 4RGNB 1NM9A 1TZIA 1NIBA 4KRNA 2WZAA 4N2EA 4XHJC 2K6ZA 1NCUA 4NZJA 5FA4B 2AGJH 1YNTB 5EC1B 1NGXA 5DYOB 1IC4H 4UQ3B 2GKIA 5C3LD 2YPKA 4HDIA 5IR1A 1INQB 2UZIL 2TSBA 3AROA 2Z0BA 3U4BL 3UAJA 3SBQA 1A3RH 4TLUA 4CC1A 4ZX6A 9CGTA 2WANA 2CALA 2PCPA 3CZFA 3IDNB 2WVVA 1OGAB 3EFDL 5AW0B 3WN5A 2ID5A 2J6EL 2WK2A 1X9QA 2X3BA 1U58B 1VEOA 1YC8A 1G7JB 3NABH 1ZLVK 4A7GA 5EZOH 2EYRA 4J7RA 1MWAB 3BZ4B 1Q72H 1ZWIB 3MGOA 4YR6B 4J5VA 1BYOA 4F7TA 3W37A 1WZMA 4W4OA 4P5TC 4Z0XA 1VSCA 2V9QA 2LVEA 2XQBL 3KVDD 2ALWA 2XCMC 1ZT7A 4CNIB 1QP1A 1PZ5B 3CU1A 1J0JA 3KPSB 2BNRE 2XTSA 2PWDA 1CIDA 4P2YA 4YVUA 5DWPA 1KF9B 2GUOA 5FCUL 4AXWA 4KWUA 4JANB 2ZJSH 4PGBB 1E2VA 3WKNA 1EZSA 4UZUA 5DXWA 4JO4H 3SJVE 3ZTCC 3M07A 2F5BH 3I85A 2YJQA 5E6YA 1E5ZA 2AJZB 5JOPE 2K7PA 4HUWB 3IFOB 3BWUF 2XZCL 4Y16B 3D39A 4XNZB 1F2XK 2GHWB 4FFYA 5GS1C 2JI1A 3RKPA 5KBDA 1M7XA 3GHBL 3ZTEA 3NSXA 1XDTT 2MPAH 4I0PB 4MMZC 3U1PA 5E6IC 2J55A 1KELH 1MZZA 3VCLA 2GQHA 1N70A 4DW2L 4YXHH 4ANWA 5EWIL 3MUHL 3RIAK 4JFFA 4OH2A 4KTEL 1JNLL 3MFFA 1UADC 5DK3A 1CZ8L 4E2OA 3QHZH 4OF3A 3JWDC 4CBPA 4FKHA 2BZCA 1X5KA 3P1VA 5BQ7B 4BE5A 4J27A 1U8KA 3K72A 1MJ8H 4N2NA 3QIWA 4MNHA 3ZYIA 4DKDC 1DN2A 1H3UA 2AK1L 2K9UA 1WF5A 2XQYK 3QZBA 1CL7L 9PCYA 5IB3B 1PFCA 1RUAL 4L5FL 4YHKH 2VR5A 2ZUSA 2PABA 3MTRA 3OLGA 5SV4A 3C5JA 3GSNA 1FNLA 1GVIA 1HHIA 3B9EA 3WFDH 4MGXA 4XVUD 4RWHA 3WTSA 1N0XH 3TBBA 2Z1PA 5TDPB 1PZAA 3RPIA 2ADGA 4AGOA 1ZK9A 3KEDA 2XX1A 2YSSB 1R5WA 1GGIH 2ADJB 2X6BA 3LKOA 1OB1A 43CAA 3ALXA 4Z7VF 2D7TH 3FT3B 2IADA 2V2TA 4HIQA 2FX8L 2BOCB 4GQ9H 4LSRH 1G0XA 3SD5A 3TNNB 4AE1A 3T0WA 1DQQB 1ZGLM 3U2JA 4OZ4B 5EMYA 4ZXBB 1IBYA 4DVBB 1J0KA 1G94A 4FYTA 3LNFA 2YXFA 1INDL 3MJ9L 1XZ0B 4AT6A 2NXYB 3RRQA 3DMMB 4Y5XC 1ZLSL 2VAJA 1ETZB 1KBPA 5GISH 1CF1A 3FK3A 1GHFL 4V2BA 1PU0A 1GSKA 4FZEL 1XGPA 3CH8A 1AR1C 3O4LA 5BZWB 3DSFH 4AEHL 1AQ8A 4GRLD 5F1OB 3DO7B 3DX6B 2VSKB 2DYPB 4K0OA 3T8MA 5GS2D 4N0UE 1WIOA 2EH8H 3DX2A 4WHTA 3O3UN 1KIQA 2H2PD 3L4WA 4WZ9A 3HN8A 5GZND 5KANG 3BQUC 1DVFD 5AVZB 1YYLL 1UD5A 3G6AA 4J23A 2NX5B 5D1XA 1QHOA 4NKOA 4EI5C 2ENQA 4H8WL 4MJ5A 2V5RA 3D8MA 1IE4A 2XX0A 2WAQA 3CN2A 1K3ZA 5JPNA 1IKFH 4R7LA 4XVOA 5DEZA 3QW9A 2C1OB 3WNMA 1CLCA 3AB0C 3OBAA 3OKEB 4P2RE 1SHWA 2BCKA 4PJHB 4QHKJ 2V4LA 2Z8WC 3HHRB 1FYTB 4E0RA 4KXZI 3D2TA 1THCA 1OT2A 1F4YH 3B7YA 5IVXA 4X6CE 4FCHA 1VFAA 5IWLA 2JQMA 4ODHL 5DRNA 5KG9A 1KENH 2P5WB 3D5OF 3FNKA 3FO9B 2ZSWA 2Y6TE 5CZXD 5DQDH 4NUJB 2EYTA 5AD0B 4JDVB 2DOCA 3CSBA 4FNTA 2ZUVA 3PGFL 4G8AC 1FNAA 4C4KT 2OP4H 3UJJH 1MUJB 2OL3B 1A22B 3C8HA 1TJGH 4J4PC 4RBPH 3VI3B 3WXVH 4Y9BA 4K3JL 1BFVH 4JLRA 4UQ2A 2E74C 3FUFA 3KL0A 3QDJB 4RX4D 1RZ8A 3EKCA 5TQ0L 3QDMB 4K9EH 5C7XH 3NZSA 1CIUA 2RAMA 4FZ8L 4C58B 1BYPA 4Y4HB 2DN7A 3QS2A 5CF3A 1TLMA 2F1EA 2YN5A 3BD5A 2BIHA 4N25A 5BJTB 4KKZA 4CW1B 4JN1H 1F42A 4NC2B 3WTYA 4LCCB 3E8UH 1FL5B 2RBLA 1RK0B 2JXMB 5I8OL 2BY3A 1FC2D 2XTJC 4OZFB 1KBGL 3OMZA 2BW5A 2ERJC 1BZDA 1NIAA 1N5AB 2VLJA 5JXAL 2D9CA 4U0QB 4YSRA 1BLIA 3QUXD 1JGLH 1LO2H 3U7YH 1CDGA 1BOGB 1IKNA 4N20A 4A1RA 3JWOH 3R8QA 4OCYH 4QHKI 2GTQA 4MAUL 4G8EA 3WKYA 1LHZA 4XBPB 5JYMA 3IDMA 4YLCA 2HKFL 2IJ0C 3APMA 2MHAB 3BT0A 3FQWA 1AS6A 2QGCA 3FQ4A 1HHHB 3L1GA 4HQQH 5CCHE 3H7BA 4OFYD 4UDTA 5E7BA 4A2DA 1C08A 3SDCD 2K0RA 4BZ2H 4FQQA 1CR9H 5L4FA 2XQYA 4OKDA 2ADFH 4YK4C 2O5YH 5AYTA 2D4DA 4WU5A 4OF5A 3LYRA 2QLVB 3I75A 3NDYE 4JHZA 4JFQA 1Q1JH 3KCWA 4LXFA 4PJ8D 5EZJB 4A7GF 4TNGA 2CBQA 2P52A 1IQWH 4LOFA 2NUTA 1RJYB 4UINH 2JK5A 4JPKH 5E2JA 3HZYB 4ODUA 5EV7A 3R19A 2E27L 4P4KB 4BV1A 5DJ8A 1K5NA 1SRDA 3BC9A 5KW9H 2YGVA 1MNUL 1BBJA 3V4UH 1W8EA 5IMMB 2A9AA 5IQ7L 1XB6A 3EW3B 5JW3L 4QD2E 2B39A 3CFMA 5CU5A 4JY4A 4P2QD 1H9VA 4JG0H 5DHMC 4ZTEA 4MASA 1B0IA 1BZ9A 1FO0H 4BFRA 4Q52A 4X6DE 1QVOB 3QUYD 3PWPA 3SDDD 5J4MA 3ARBC 3TO4A 1NBYA 1ZTXH 5LGJB 1D5XB 5D71H 2OSLA 3QQ4A 5CN3A 4JQVA 1DBAH 4PLNC 1YYCA 2D7NA 4G1MB 4KDVA 4Z0BH 1ES0B 5B3JF 1TSRA 5FW7A 3VFMA 5FC9A 4R84A 3V79C 1SMAA 1UM4L 2BIMA 4G72B 2EXWC 4MJJA 4BXVA 2CR3A 3OMNB 1S7VB 5FYJL 5K9QG 3DOIA 4QRSB 3LZFH 2YPVH 3MV8D 4I8DA 4WNQA 1L6XA 4TUOA 2D2OA 4X4YB 2QVFB 5AW2B 3IMBA 1JMXA 1YPZB 1BQLL 3T2OA 1CN4A 4QXWA 4XXCC 3TEYA 2R9HD 3G5XB 1FV1B 5KVMC 1LK3L 1TZAA 3CDGA 4I77H 2P49B 1MAMH 4JFYA 5EIVA 4X5XB 1VERA 2OKMA 2WLLA 5FO7A 1JVOA 1KTKE 2ARJQ 5F7BA 5IB1B 3QDGD 3OLEA 3QUGA 4H44C 1IJ9A 2AK4E 1JERA 2ITDB 2QKIC 4PCKA 3FCUB 5ABDE 5D6CB 1JK9B 3UTPE 1TZGL 5FUOH 3WFHA 1MCNA 1RY7B 2A1WH 4JFDD 4RIRA 3V6OE 5IW6B 5JLZB 2FK9A 2IALB 2MQ0A 4CA4A 1ET5A 2YAFA 3ULVF 3S3PA 3PAVA 4JO8A 1U30A 1WWAX 4HFWA 4N6QA 3L4XA 5KYWA 4E68A 3FHAA 3E38A 1NMCB 4CL7A 5FKAB 4NQCB 4ABUA 2JQZA 2NY1D 1J8HD 2BJML 1KCRH 1SXZA 1JI2A 3GXFA 4G5ZL 3PPSA 5I1DA 3HCVB 4OLWL 4LQFL 3RWFB 3ROOA 5CZRA 3GSXB 2NY5H 2Y06H 5EEZA 1WFJA 3GZPA 3DVNB 4L3EE 3VE0A 5DR5H 5F72S 5HGDA 3HN3A 1KV3A 4J6IA 4Y2DC 3HBGA 3ASOB 3TT1H 3WEMA 3KPNB 3NFSH 2A77L 3BN3B 1A1OA 2NLJA 4PJFA 5J1SC 3VXTB 5A7EA 1ZVSA 3LKNA 3TV3L 4Y9EA 3MJ9A 3BP7A 4WSKA 1KG0B 3D3VE 2IDCA 2KI6A 2DIJA 1B0GB 1CICB 3DPDA 3DVGA 4OLVH 1DQJB 3HS9A 3SZKC 4ENEC 1KXQA 4OBRA 3VH8A 4CN1A 3RFRA 2Z0UA 5BV7C 4NAQA 5D7LE 3GJFA 4Z3IA 1AZCA 4BH7B 1IC4L 1S9WA 2KC0A 2WIIA 1JF1B 4HIXH 5JMRA 1LO0H 4ZTPH 1WJ3A 1OD7A 1MLBB 3V7MA 3N2JA 4MJ6B 1XGUB 3OAYK 3M1BA 2AC0A 4PCTA 2DQEH 3DX7A 1NUNB 2P80A 3H3KA 4OD3H 1A3RL 3MPCA 5H37H 4HVBA 3EYOA 1BF5A 2HTLD 4AW7A 1DVXA 2ATPB 2Z91B 4BJLA 2XN1A 3IDGB 2DS4A 2Y1VA 4Q2ZA 5I9QB 3NABL 3ALWA 5IFAH 2FWLB 5EZOL 4ZJ9A 4IKNA 2HG5B 4S1DC 1AXSB 1Q72L 1L0PA 3L81A 4CMHC 3RWDA 4OCNC 3D50A 1Z32X 2DJ4A 2WQAA 3EHBD 2FJHA 3HPLB 3MLTA 4W6WB 1P4UA 4IRJD 5CGYC 5IKCB 2E8ZA 1U8QA 3GUTB 3IJYB 2NY6D 1DBKH 1O7VA 2QVMA 3Q9QA 3IAGC 1MDAA 1Y0LB 2ZG1A 4KRPB 4W6YB 2N59A 1X6NA 1T1YB 2CHZA 1ZXQA 2UWEE 3FB7B 4KMLB 3TASA 4YBQD 2XUWA 2IFFH 2ZJSL 4QRTB 4JO4L 2DIAA 4BELD 3K46A 3WLWD 2N7AA 1SMDA 2F5BL 1MCLA 1XBDA 1JXJA 3L2LA 4XWGH 2JKIS 4P46C 4ZMVA 4KROB 3O4OC 3RFZB 1CVRA 1SVZA 4YSTA 3W2DH 5SWSD 2IAAC 4JFHE 4GBXC 3J7HA 4R7XA 4W6XB 1YC7A 3T8XB 4OKVA 1MCWW 1KXHA 3AG3B 4M9OA 4L9LB 3AREB 1FFPA 1F11B 4UIMA 3JV5A 1CFTB 4R7VA 3GSVB 3T0XA 1YA5A 4FEIA 3QIBC 3EGDB 4JO5A 2MPAL 2N56A 1QLEB 1XF5B 2G9HA 1KELL 4HSAC 5ICUA 4YXHL 4PCSA 3BIKB 5CLZA 2H3NA 1NC4D 5E1QA 1XBRA 1FVEA 3S5LA 4I4WB 4WV1C 5DD3H 4QAWA 3QHZL 2OXGA 3GO1H 1FZKA 1MJ8L 1ZA3A 3QUZB 1DDHB 1D5ZB 3RIAF 5CBAB 5E1HB 1EEZB 2X4OB 5EN2A 1MAKA 3M45A 1A7BA 2C7FA 1AGEA 1GOFA 2YHGA 4YHKL 2E6QA 1BIHA 3WFDL 4N68A 2WBWB 4B9GA 4PJEE 3ZDYB 2R7EB 3IFOA 1N0XL 1RPQA 3CXHK 3CFEA 1KTRL 1QG3A 1FGNH 3OKOB 4LZKA 4OZGA 4Q7DA 3IGUA 4WI8A 2A6DB 5EOCJ 5EPMB 1GGIL 3MNZB 1BIIB 2Z1KA 1NCOA 3D2UA 2Z93A 4L37B 2D7TL 1M6UA 2O30A 4QY8A 4Y19E 4N2LA 4CMMB 4GQ9L 4LSRL 1JL8A 1UT2A 4YHPA 3TEZA 1UM6H 2YGOA 3FN9A 3TVMC 4PJ7A 4OGAD 2OM5A 5LN4A 5C6PB 4NKDB 1WTLA 4PP1D 1SVBA 3GIVA 2CO2A 3D69B 1KSRA 4L4JA 4WNSA 2C34A 1EDYA 4EQ2A 1GA2A 1UWFA 5GISL 4F9LC 3FFCA 1UHVA 2FBJH 2FGWH 4NZFA 1D5BA 4OTXL 5BUPA 2ZKYA 1FNEB 5EBLB 3V9EA 1Q94B 3KXFE 3EXJA 4Y5VC 3DSFL 4H8VA 4JQIA 4E41D 1BVNT 4YFLI 4AQ1C 4MLSA 2IH3B 2EH8L 1KWGA 4NHCH 4E5XA 5LBGA 2J8HA 2OTUA 3L7EA 5FIEA 2EUVA 3VFNA 4WRLA 1XT5A 4GAGH 5JHLA 2CLRB 2FEEI 5KJ4A 1X5MA 2AERT 1FDLH 3TEUA 4P5TA 3K0WA 5FV2A 4JNXA 2MPVA 2KYIA 1IKFL 3SBRA 5LVEA 1T22B 5B38A 4PB0H 4R6UA 3OG6B 1IJNA 3L9RB 2X4TB 1IEAA 4JDEA 1I3VA 2I32A 1U8PA 3VNYA 1I9IH 1UD2A 2NY3B 5L9DH 3VFTB 4Y2OA 2H6OA 1OCOB 1GGUA 1UEMA 2VQ1B 3WIFA 4ELMB 4FE9A 4YUEH 1F4YL 4WW1A 2O1AA 2Z7ZA 4QRRD 3QHTC 1KENL 2X2JA 3NCJH 4BH8A 5JW4Q 3BAEH 4FXGC 5DQDL 3GSUA 4R4BB 3TPKA 3CN4A 4L8DB 4TXVB 1TUPA 2PCYA 1OAKH 1S5HB 2OP4L 5ITBH 3UJJL 4EO5A 1TJGL 3GXPA 3NIFE 5JIHA 3MBWA 4MMZA 4QIRA 5E6IA 3CZSA 1Q0EA 3WXVL 1BFVL 3MV9B 3EADA 2XT1B 5D7SH 1PYWA 4K9EL 5C7XL 3CMOH 3JTSA 2ICWB 3A6OA 5JYLA 3AT0A 3FPYA 3PNRB 3L4UA 1XSOA 4AIZB 4O2CB 5AVRB 5G5DB 4M8QA 3LIZA 4JFZH 4JN1L 1M71A 5ITFB 4OSUL 1RHHA 1FYHB 1MFDH 3E8UL 5EIIB 2AJ3A 2X4PA 3MRHB 1D5MA 3CXFA 4L1DA 4FXKB 2WQXA 3EOAB 1EHLH 3FTUA 1IEHA 1EO8H 4J6RH 4LHUA 2AQPA 2QADC 1P1ZB 3HJEA 5E6SB 5KSAC 1JGLL 1LO2L 3U30B 1DTUA 2AMGA 3U7YL 3P9LB 3ARSA 4YXLH 5D5MB 3JWOL 1SLWA 2JMRA 2ADIB 4M61A 4OCYL 4AYEC 2C1PB 1L0YA 5TH2B 4HQQL 3SQRA 3MO1B 2NYZA 1BCIA 1YN7B 4NQXA 5D4IA 2AEQH 3BSGA 1X5JA 2YO3A 3V0FA 5KWYC 1CGUA 4BZ2L 2WYHA 1CR9L 3MKKA 3ZKXB 1OEZW 1RVFH 2ADFL 4WI0A 3HNTH 4MMYB 2O5YL 3NCWA 5DA4A 5IP4A 2H9GB 4TTDD 3ZHFA 4K5PA 4PM1A 4RDBA 2CK0H 3T0EB 3R18A 3UABA 3CFDA 4WFED 4DO5A 1SVCP 2JKLA 1Q1JL 1SOXA 1Y07A 2F54A 4Y5XA 3ZE1F 4WTWA 2Q20A 2KLTA 1IAKB 1RJLA 4ACPA 5GRJH 4JM0A 4HUUB 5C0EB 1IQWL 1MCDA 3G08B 4MCYB 1NDGB 1FFTB 4UINL 4NN5B 4LCWE 4XMXA 4JPKL 2ATKB 3T1FB 2ESVE 3B6SA 2AVFA 4N0RA 1OSZA 1HJBC 1N5AA 3O41A 3KDMA 3RL1A 5KW9L 1CBVH 4OIBA 4FQXB 4Q8BA 4FP8H 3QIUD 1WWCA 3V4UL 4A04A 2HZHA 2X88A 3ELQA 5IW3A 1GY1A 5HDBB 1YNTF 1H3TA 4JG0L 3BQUA 4K2UH 1LK2A 1A6AA 4PJXB 1FO0L 4OAWA 4EI5A 2VDPB 2XICA 3MLUH 1T04A 4AEEA 1ZTXL 5D71L 1LO3H 3QUKB 3QXDA 3AQXA 1A6WH 2K4AA 4QRPD 1DQTA 1N6QH 1BQHG 1DBAL 4EJ1C 2VKXA 2VOTA 5EO0B 3RY6C 1DJYA 1Q9LA 1XSJA 3FC8A 4FLRA 4Z0BL 2GFBB 4A68A 4X8XA 3LZOA 3GGWA 1DVSA 4GLRI 1F3RB 2ZIDA 1QFWM 3BESR 4JRLA 2E9IA 3GJEA 4CC4C 4U0RB 1F4WH 1UYWH 4WAFA 4G70B 3LZFL 2YPVL 3QULA 5KYNA 5HVHB 1ORSA 1WK0A 4ZMWA 3REWA 2WJ7A 1RJYA 3MFGB 4GKZA 3FOLA 3AM8A 3STZA 5HGBB 2YUVA 3W0WE 2VDRB 1BD2D 4I77L 1MAML 1RIUH 3NSYA 1U8NB 3QJHA 5DRZB 1WFMA 4U1NA 2JB6A 2JKNA 3NAAH 1GS8A 4PRIE 1WC7B 3MYZA 1Z9PA 1Q8MA 4H1LG 5FUOL 1OY3B 2A1WL 5E24E 4LPWA 4X9YA 5JTWA 5I8CB 4K7FB 2IWEA 3MLWH 2QR0B 3GBMH 1DHKA 2CJUH 2Y1AA 4G6KH 4A2FA 3EDEA 5FYLD 1NEZA 5CM1A 5JORB 4MNQE 1GRWA 4OJFH 5JOEA 2R0ZH 2DZEA 4Z7NE 4JPIB 1M05B 3GMLA 3LB6C 5AOIA 1KCRL 1P5UB 2BP8B 5C08B 2X3CA 5DMKB 3H9SB 3H55A 2GI0A 4X9BA 2EVJA 2NY5L 2Y06L 3BPOB 3LV3A 1QATA 1MFNA 1QSFB 2OCFD 4PRDA 2IXQB 1C1EH 2L04A 3KPRE 4RESB 5DR5L 2NY4B 3RNQB 1TETL 4KO9A 1NPUA 2AZUA 3TT1L 3FJTA 3TO2A 4JFXB 3BFWA 3LPGA 4G8GE 3NFSL 3VX0A 1HHJB 4L3FA 3BVNA 4NO0A 4MSWB 3MROB 3O6FC 4LDEB 2WXRA 3ARGB 4B7IA 4GW1B 1SQ2N 2ILLA 1YECL 4X4MA 4OLVL 5AFAA 4EOWL 1KNOA 2ZXCA 5D2NC 2W38A 4FHKA 1FG2B 2YJLA 4XCCH 6CGTA 5IW6A 5JLZA 2I85A 1EBPA 4WQOA 3V52H 5KSUB 3JVGC 3JSSA 4LBEB 1P7KB 1ASQA 1CB4A 1MCKA 3MRMA 4KOBA 5HD8C 3KLLA 5CR1A 5LLIC 4HIXL 3DUUB 4ABWA 3U6RB 1LO0L 2P3YA 3AAZB 1UA3A 4GS7B 3QC6X 4Y1AE 2PCFA 3CLWA 4ZTPL 3IU4H 1KGXA 4PBWD 5I1CH 4NO5A 4PRPE 2DQEL 1NINA 2CRZA 4POUB 4OD3L 1HXMA 2WB7A 3NFNA 1C8QA 5CUSH 5E9DD 2OTPA 2ZX9A 4DK3A 2XN9A 3UZQB 4DZ8B 3E2HB 5FHAH 1P7HL 3HAEA 1U8JB 3SGEI 4CSSA 1LEGA 3K8MA 3K6NA 4P3DB 5C92A 1PTZA 1I3GH 2GCYB 3GHEH 3UOAB 5IFAL 4HG4K 3OKMA 4MLIA 3C2SA 4NO2B 3BYTA 4L4VD 3LN4A 4H4NA 1UA6H 4MA7H 5CN1A 5ABAA 1F6AB 4ZFOA 4RA0C 1IM9D 2HVKA 2A6KB 4FMKA 4D8OA 1IX2A 2JCCB 1I9RH 3VRLE 2UY7B 3S2CA 3QQXA 3WS3B 2NXZD 4QHUB 3BJ91 3QG7H 1DBKL 4TF4A 3KCPA 2XQYG 1OGAE 4ZBJA 3T4YB 5J11B 2RACA 4MMXC 3G6DH 1B0RA 4Z95H 5SX5K 1H3VA 3VJ6A 4ISVA 2IFFL 2EKSA 5C0CD 3BAJA 4EN3C 1KLGB 1JIBA 1TU2A 2HRHA 5F88B 4BHUA 1SFHA 2FEDD 3LRHA 5FO8B 2DWXA 1IV8A 2GK0B 3O6KH 4XWGL 1QRND 4MCZA 3NIGB 4B53A 1GYCA 3QNYA 3ILEA 4QLRA 3CH1A 4HJIA 4XXCA 3UYRH 3W2DL 3L1FA 1I3UA 3SCMC 2PTUA 2KPNA 1BG1A 3H53A 3KPSE 2ZCLH 5B8CB 3GSQB 2BNRA 5EEWA 2F53A 2QKIA 4R5TA 4HYTB 4FJ6A 1A4AA 2ZNWA 3N40F 3WIHH 1LXMA 2QHRH 1AXSA 4TN9A 3VFPA 4LLDB 4HH8A 5GGTH 4UANA 3SJVA 2BSRB 3IDYB 2XWBA 4UQEA 3U9PH 1UB6A 5L88H 4NAJA 3J07A 3AS0A 5DD3L 3R8BB 2AQNA 4X99A 5EZIH 4XVSH 3QARA 1JD7A 3GO1L 1RSYA 3KPLB 4IEFB 5I6OA 5LAPA 1R24A 1E3FA 3UBHA 1B4LA 3R1GH 2DH2A 2R27A 1EAJA 1CD0A 1YEWA 4WI5A 2BX5A 1V3MA 1PGRB 4PJ5B 2XI9A 3HG1D 4KJWD 1CD8A 1RUQH 4Y2DA 2EDNA 4KNUA 3VI3F 3ILQD 4JFEA 2YD9A 5HYSB 3UTTB 2VERN 2BFGA 1GZQB 3LKSB 5SWZE 2HUHA 4MXVF 1R3IH 2ZTBA 1A7NH 3C12A 2Q3XA 4B9FA 4LLAA 1FGNL 3F05A 1JK8A 3T8XA 2IFGA 1QUPA 4AZ8A 1ZVHA 2EP6A 3DX8B 4LLVB 1AD9A 4AIOA 5I5IA 4UV7H 3N42B 4I2XB 5HYJA 1AXIB 3EAKA 2ZF9A 4JFTA 4UAHA 4JZOA 1UM6L 1Y18B 2Q6WB 1TXKA 1MH5B 5DD0H 1HILA 5F3HA 1NIEA 3TH4T 4AVJA 4M7LT 3IM1A 3U83A 2WNGA 3BAWA 4UF7C 2CUIA 2N7BA 3CFBA 2Z4QA 3LIUA 3SQOH 1T5XA 1P7QD 4JFSA 3VXMD 5SV3A 2R0WH 3GK8H 2DQCH 3VRIB 4YDVA 5K69A 2YPLB 1NM4A 5I6XC 2FBJL 2FGWL 2X87A 3A0OA 2FNBA 2JV6A 4PRHB 5L2KE 4XPTH 3DI3B 3BPCA 4QF1B 4P23B 5B3SB 4L1HA 1XHHA 5JW5B 3CQQA 3TEWA 2HFEA 4PG2A 4LCUB 3ZSSA 4GKSA 4ZRGA 4P4RB 3MDJA 4I7ZC 2EC9T 3KBEA 4NHCL 3T2NH 5J1AB 2E7BA 3EGSB 3KR3H 4GAGL 3V5KA 2J5LB 4G2AA 3UIYA 2HYMA 1FDLL 4U6YA 4IKIA 5C0GB 1QHQA 4QJ3B 3H1ZA 4QXVA 5I8EA 4HU2A 4PB0L 1UT9A 1OGTB 3G04B 2JKJA 2WO3B 4K5NA 4DGVH 1QFPA 1I9IL 1XF2A 5L9DL 2VLRA 1BZOA 4HXAH 1BEXA 1D2OA 4LPVA 1JOIA 4PRBA 3VVVA 3FQXA 2A74C 4YUEL 1CD9B 4JVUA 2QFRA 5E2VH 2NX5E 3BUTA 4ORZC 2LU3A 4P46A 4NQQA 1GIGH 5DFVC 2MRYA 3I3BA 5BUGA 3NCJL 1SF5A 3BAEL 4JQXC 4GBXA 1GYWA 3BIBX 1S8DA 5F7NC 3QEGH 4G71B 1WD9A 4RAHA 4IBSA 1OAKL 1X3DA 5ITBL 5AW9B 4P2RA 4PJHE 1UXWA 2FSDA 2BHUA 4G9FD 4GSXA 5D1QB 5KUKA 1J8RA 1XAUA 1JYNA 1NCNA 4FNQA 5HPMB 4NFDA 2J56A 4JGNA 3OX8B 5D7SL 4A6YA 5EU6B 4UOZA 2Y5TA 3CMOL 4ODVH 4CSZA 4QHPA 2VSDA 4WV1A 2DWDB 4JKPH 1J9TA 3QGVA 4I89A 3IFNH 4RLDA 4HHAA 4JFZL 4P49A 5EU5B 4V1DA 2GYSA 1PLBA 3G5VB 1MWAH 2BHYA 1MFDL 2X70B 4J1UA 2F2HA 3ZYJA 2Q7YB 4QOKD 1EHLL 1EO8L 3QZPA 4J6RL 5DEGB 4ELKB 1WA1X 3T2PA 1TVHB 3C09C 1TJMA 5LBVA 3QDJE 4LSTH 3TBYB 2JJSA 3NCYS 2DQUH 3CFNA 1OF2B 4NI3A 3CN1A 5ESQA 4YXLL 4IJ3B 1S9VB 2YAHA 5KYYA 4LCYA 1YEKH 1PZUB 4LEOB 4IMLA 2NR6C 3QNZB 4FHBD 1KB3A 1XCXA 3HE7C 1ILUA 3DV4A 1NCWH 4JZJB 2ZYRA 2AJYH 3FULA 3BUBA 2LFGA 4IGBC 4KKLC 2E46A 2AEQL 2P42B 1F3JB 5H94A 3VFRA 5DO2C 3WAKA 1R9FA 5ANHA 3VWJD 1SEBA 1RVFL 4WGWB 3HNTL 3MV9A 3TVMA 3VRJB 5C1MB 4RFEB 5JW4R 4MAZA 1AHMA 4AMWA 2CK0L 5DQJB 1AD0B 4BKLB 5H35A 3VD5A 2GJ6A 3ARYA 1UUNA 2R2BA 3LKQB 4K7PX 3ZT6A 1YEEH 4OT1L 2J8UB 4UZSA 5FW8A 3IDXH 1MJ7H 5GRJL 3HOGA 3ZIMA 3ARPA 2JTDA 4F9LA 3UX9B 2DQDH 1Z9LA 2V5MA 2Y3AA 2O5ZH 4GFXA 4GUPB 3P4LA 5E8OB 3D0LA 3LRSB 4NPKA 4HUVA 1CBVL 3SYCA 1VESA 3KW8A 4FP8L 1WBYA 5BUAA 3RKDC 4CRPA 5BXFA 3I3EA 2WBXA 3DGCR 1RZGB 3O2VH 3APFA 5DVKA 5L0QB 4KK6C 2C1PA 4K2UL 5BS0D 1IEBB 2DRUA 4XNAA 4QTHB 4O2EB 3MLUL 1H3PH 3MA7A 4HZLA 5I1JH 1KJVA 1LO3L 1XD1A 4AZUA 1A6WL 1N6QL 2PN5A 1TIUA 3FTZA 1NWPA 2WTPA 3SE6A 4HFUH 1I9JH 3S98A 4RFNB 2IBZY 1U41A 2VR6A 5HDWA 2CIKB 4QT5B 1F4WL 3HPJB 1UYWL 2R69A 5D9SA 1JGEA 1M1SA 1AANA 2WLJA 2R1XA 3G6JA 3N1QC 5I18H 4FKKA 2F5AH 3MNMA 4X6DA 1N6UA 2TRYA 5ACMA 4FRWA 2WYTA 4FXGA 3ECQA 3MRIA 1N59A 3QUMB 1FVDA 3NG5A 5I0WA 1S7TB 2EDBA 2YXVA 3BMVA 3E9TA 4P0DA 5E8EB 2NW3A 1NFIA 1RIUL 4KBPA 4PMFA 4FQXA 5EORH 3NAAL 3KPOB 5EIQA 3RX5A 2IPTH 2NY2C 4OF6A 4Q4EA 1ML0A 3KWXA 1T1XB 3O3BA 3OD3A 1X5FA 1QLFA 3HVNA 4ABVA 3FQYA 1OOAA 3GF8A 8FABB 1OXYA 2L3BA 2EO1A 3MLWL 3A6BH 3DOHA 4G6KL 3GBML 1YPZE 2CJUL 5DK2A 3B9AA 4A67A 1YQVL 5GZOC 2OXHB 3OC5A 2PW1B 5B38G 1TVDA 4OJFL 5ADOH 2R0ZL 3WN6A 3UG5A 3HC3H 2WQUA 4NJAH 2DLGA 2ED6A 5D55A 3D0VA 4O00A 1F5WA 1ACXA 4OJYA 4RGMB 1H15B 2AK4A 5BO1H 4L8BA 3LAFA 1C1EL 5I0XA 4GB9A 1YMME 1JWSB 2O5NA 2D4FA 4TLKA 4TUJB 3RJOA 5KSAA 1Z5HA 1I82A 1ZK5A 5D6DC 5DJYA 1CGXA 5MEND 4YDZA 1KBWA 2MFNA 4MD4A 3Q48A 1IVTA 2Y7QA 3VI4A 3OF6A 2MNWA 3TM6A 4JM2B 2OTWA 1ADQA 4YAQB 4HJTA 2I60H 3O6LH 1A2YB 1SJEB 3QORC 2CJ3A 1HK6A 3BSHA 2YIHA 1VKXB 3VXSA 3EH5B 1U3HD 3QFDB 3MMEB 5HI4C 5BRZE 2QV2A 4LLQA 3PHQA 4XCCL 3V52L 4G3YH 4K7FA 1VZHA 2OR7A 1IL1B 1A6ZB 4GJTB 1QSVA 2Y7NA 5F7DA 2HXAA 5I19H 1ZDQA 1TZOA 3U25A 5J1TC 3IU4L 2OL3H 1YJDH 2SEBA 1T6WA 4F91B 1RIHH 5I1CL 3HC4H 4QXGH 1XXFC 4AQZA 4IRSD 3D3VA 1SN2A 5FHAL 4YSQA 4JRXD 1R5VB 4WKZA 4YQXH 1D6EB 2VN3A 1I3GL 3GHEL 1L9MA 4XB8A 1RULL 2YRBA 2P24A 4JFXA 1YVLA 4GEJA 1JPGB 1HHJA 1Q9OB 3ZQXA 2OI9C 1UA6L 4MA7L 4F8TA 1J1XH 4IM8A 1X5XA 3NYKA 4XOBA 1I9RL 4OZFH 3L4CA 8PAZA 2FJFB 4LPYA 1DYZA 1D9KD 3SGDI 1E4XI 2X1WL 3QG7L 3RTQD 4PGCA 1AJ7H 4NQVA 2I24N 4C54A 3BEVB 1BLNA 3N9GH 1GGYA 5FUCE 3G6DL 2BCMA 3CCHA 1WFUA 4QHLA 3WFEH 2EO7A 3IE9A 4Z95L 1I8IB 4YNYA 3NT0A 4MJ2A 5HHMD 3C5ZB 3VWKC 4MJIE 1X5HA 3DOSA 2C4FT 4MQTB 5AOZA 3SKMB 1SY6H 1IARB 2WYIA 3UTSA 3O6KL 4OIIH 1YDPA 4HKZA 4MDIA 4PLJD 3BZFB 1BWWA 1G87A 2YXWA 4MJ4A 2P5PA 4XXDA 3UYRL 2F1AA 3GLZA 1ZHBB 2DM3A 5D1ZC 4Q9BA 4RDQG 5CEXA 2FQDA 4FTVD 4ZMQA 3G5WA 2ZCLL 3C60D 3I02B 5C09B 3OKDB 1GZPA 2PW2B 4GRMA 4MXQC 4BCZA 1MCIA 2H5UA 4P3DA 5EBWA 3WIHL 4KJYB 2QHRL 2RQEA 4UTCA 2VITA 1WUNT 5GGTL 4QI3A 2C9PA 5L88L 5IJKC 3U9PL 5CHNB 2DQJH 5E56A 3EZ8A 1QHPA 1GGTA 2D31B 5FCSH 1WLHA 2XN0A 1A7RH 4XVSL 5EZIL 1ROWA 1GCFA 1IQDB 1SUJA 3V0AC 5F93C 2B3IA 1AGBB 3SKUD 3EDKA 3BUIA 3DK0A 1ZDSA 3R1GL 3FB8B 5A3IC 5C0FB 3Q7JA 4QLWA 3WNLA 2A83A 4ZUUB 1RUQL 1S3KH 4P2OD 4W93A 3WDIA 1KBVA 4WDIA 4PWHA 4GO9A 5DMGD 4N2MA 4HEME 1R3IL 1MDTA 3O6FA 1A7NL 2XWZA 2P26A 3L3DA 2EXYC 1QUNA 1UXSB 4XPHH 1J87A 2OMUB 2QLYA 3O45B 4WWKB 5KAQF 3KNBA 4XO9A 1LEIA 1H5BB 3RWCB 4JS7A 5CNHA 4KUZH 1DFXA 4UV7L 2XPYA 5D2NA 2CUMA 3CDFA 2J6WA 3FO2A 2FRGP 1T6BX 3JVGA 5DD0L 4YN3A 3VG9C 1DVZA 5A2LH 2BNQB 3ZDYE 4PJEA 4CC0A 4X4KA 4RMBA 3U46A 2MNJB 3U9WA 3SQOL 4TNFA 1EWHA 1S7UB 3D85D 2R0WL 3P54A 2J12B 3E1ZA 2DQCL 3GK8L 4G1EB 5E99H 3L3OA 4MCNA 1LO5A 1CI5A 2WBJD 4FYQA 3CX2A 3ARFD 4XPTL 1LNUB 3QEQD 2YZ1A 4IYKA 4HMEA 4M9PA 3ZL2A 1PX4A 3FUKA 1YMHA 4BDVB 5HYSA 1Q0YH 3T2NL 1WZAA 1J0HA 4NQTA 1A9EA 3IGKA 4L8CA 2HVJB 2PO6D 3KR3L 5ISZE 4PRNB 4BFEA 4QYOA 2VAAB 2Z31B 3FZUD 4PV1C 3VFOB 3G6JF 3D4YA 3U0TB 2P7TA 3MLSH 3QRGH 5K5YA 1GS6X 1AZVA 4MMXA 4NB7A 5ID1A 4LNRB 4GY4A 2A0LD 2J43A 1Y18A 3MHZA 2JVUA 3EJYD 3UAFA 2ZOKA 4DGVL 1A6TA 1N2RB 1UUSA 6FABH 5EF1A 2ZX5A 3GSOB 4HXAL 3NESA 4EN3A 5DHEA 5E70A 1DUZB 4AENA 3MNWA 3DX9B 3FFOA 3QPKA 5HDBF 4EEEA 4K5LA 1QSEE 1JXGA 1GIGL 1PDKB 4PJXF 3DARA 4IOSD 3HE6C 4JGMA 1M4KA 3LEVH 1TCRB 2KPWA 4U1MA 1SJHA 3HAEG 3PL6C 1OLZA 4PJ9B 3QEGL 4B0MB 4XHQA 3BGMA 1UFGA 1B4JH 4PTUA 4OVVA 5DVPA 1NGYA 1H6TA 3QO1B 5IBUG 2P8LA 2AI0H 4P4RA 3BRDA 3I6GB 2R4RH 3PQYD 4ELME 3ARDB 4WFHE 4Y4KD 3RNKA 1SJVA 3QO0B 1TEYA 2IAMD 3NDZE 4HEPG 3WHXB 4ODVL 4HJGB 3EJZD 4MYWB 5ECGA 3HHSB 1UZGA 4JKPL 2VL5B 1F4XH 3TIDB 3RUGB 1ODUA 3IFNL 3P30H 3D52A 1E3XA 3ULUE 3DPBB 1YEFH 3X1EA 1MWAL 1O5DT 1OGTA 3O2DA 3K6SA 4AVHA 1WP6A 4HD9A 3WTTA 1JTPA 4AITA 3SGKC 3N1GC 5C9JA 1TQBC 3RWGA 3DSNB 3FT1A 1GJWA 2QQNH 3UTZB 2BZDA 3OJDA 4LSTL 1A3QA 4Q6YA 1DE4B 2FX9H 2DQUL 3G5YB 4OBSA 3B7RL 4XR8C 2PP9A 1IC0A 1FFOA 1YEKL 3ZTDC 4XTRC 3N85H 4LPCA 1NCWL 3MRQA 1SFDA 4NRYA 1A7PH 2AJYL 3BP5A 1G1YA 5JOPD 4IU2A 5D1QA 4XGZB 3IMSA 1WZ1H 4PG9A 4WJKB 3Q3GA 5DD1H 3OX8A 1HX0A 1I1FB 4Y5YB 3VNZA 4M6OH 2IO5A 1XX9C 1O0VA 1DSYA 5D5ME 3TNMB 2YGNA 3IXAB 1DLHA 2D03H 4FFVC 1YEEL 5CMAB 4XRCA 4Z5RA 4BWTA 3LCYA 2EUWA 3IDXL 1MJ7L 3OWEA 2YD8A 4TVPE 3WEXA 1VADA 4ES9A 3RQ3A 2DQDL 5EEXA 5DC9B 2Q10A 1W15A 2O5ZL 4AYID 7TAAA 1J0YA 4LKCB 5E9AA 1OVZA 4JHWH 2FWOA 2HA1A 3KYMA 4YZFE 4B50A 4M7JH 3LZQA 5FGCB 1MAJA 1OF2A 4AC2A 1HQ4A 4U1JA 4PP2A 4HOZA 4AGNA 3O2VL 4BQBA 1S9YB 3NCYP 4Y4FB 4J8QA 4DESA 3KG5A 4QNPF 5IOPA 3GMRA 1O6SB 2PWHA 3N50A 2DQHH 5TK2A 4UQ9A 1ZAGA 5A16B 6TAAA 1H3PL 3TA3C 3EUUA 2DEXX 1VFMA 4R7DA 3VU1A 1HI6A 3ZE2E 5I1JL 1U92A 4LCWA 1N8ZA 2ESVA 3GD1C 2BP3A 4JL1A 1CJYA 4HFUL 4I3GA 4Z7UB 1I9JL 4N2DA 3WLBB 1O9WA 1A0QH 1FZJB 2DM7A 1WCBA 2BIQA 4FFZH 3NJKA 4NN6C 2A74A 5KJ7E 3O0LA 5I18L 3VDAA 2F5AL 3WIHA 3NJMA 3LRMA 4GXUN 2MCMA 3P4NB 5GGTA 3FT2A 4OUUB 2H26A 3QJSB 4OZHB 3NSJA 1AE6H 1P5VA 5EORL 3U4KA 2EDLA 1ZTMA 4N2KA 2IPTL 4PQXA 4GG6A 1T4KB 2B3RA 1LE9A 5C7ZA 4WI7A 4ZSOB 5HJDA 3B1UA 2V5TA 1LGVA 3BDBA 3HNSH 2AJVH 1X5LA 3EYQC 1S7RB 1KGUA 2FSEB 3A6BL 4XNDA 4UAOC 2Z9TA 1EO7A 1A47A 1I4FB 1OPGH 2YD3A 3IFPB 3BKMH 1TMQA 3MZTA 5ADOL 1V3LA 5AW3B 4HLZG 3W0WA 4BZ1H 3HC3L 4NJAL 3R06B 5SX5H 4O5LH 2BY2A 1OGPA 2F08A 2OJEB 4IIQC 5B3NA 5BO1L 2FWSA 4NNXB 4QT5A 1QBLH 4FQIH 5EZPA 5MEQB 1MRDH 5HJ3A 5DEFB 3PNWB 4XOCA 3TXAA 4OY9A 5EO9B 1ONQA 4XOEA 1EX0A 2NR6A 4GKNB 3HE7A 3CC5B 1AZBA 2WY3B 2NYKA 3O8XC 4QWWD 3H9HA 1KBKA 2I60L 2WB1A 3O6LL 4K3GA 4MAYB 2ZOLA 3HZMB 1E90A 4IGBA 3H9SE 3TCXA 3ZOAA 1DANU 3B56A 5I1AA 2UZYB 1A9BA 5I6NA 4CVZA 3STLA 2VRAA 4NS0A 1ASOA 5C0NC 1E50A 1Z66A 2CDGA 1NAMA 3PP4H 3WFCH 2CWRA 3KPRA 4G3YL 3CQPA 4Q56A 1WD8A 1E67A 4PGDA 3FU7A 4GEIA 4ZOAA 3ULUH 1L6ZA 1OCWH 1W72A 2DI8A 5I19L 3MLPA 5DUBB 3BH9A 1E9PB 2OXHA 3E3QC 2OL3L 1YJDL 1ID2A 1RIHL 1I7RA 3EF7A 4HKBA 3HC4L 4QXGL 3S37H 4LDOB 2WWKT 3UIZA 5EBMB 1BXXA 5JA9A 5DK0B 5EB9A 5BQDA 2D7OA 3N42F 3KLHC 2QVKA 1EV2E 4YQXL 5J5EA 5K9KB 3DXAB 1BYNA 1USZA 1DVUA 3FO1A 4HU8A 1XXDC 4WVRA 3BQVA 3L4TA 4NT6A 1J1XL 3C6SB 4Y1AA 2GJZA 1BFTA 4LL9A 2RH0A 4PRPA 2HJKB 5DZOA 4GFTB 3WEBA 3GLEA 3LQZB 3RHWK 1B2YA 1XF4A 2GG1A 1AJ7L 3M7FB 4NQED 4BSVA 1QEWB 1M2VB 3N9GL 3UGXA 5H37G 3NJXA 3BLBA 3LD8C 1MI5D 3WFEL 1U8OA 5I76B 1YUHB 1ET8A 4LLMB 2EDDA 5HHOD 1SGKA 4TVPH 1FFNB 3CPUA 4I3SH 3SIKA 1S7SA 1E3ZA 1TNNA 1K8IA 1T21A 1G1OA 1G7PA 1R1CA 1CFBA 2JCCE 4HX1A 4LVHC 4XO3A 1JPFA 1SY6L 3C75A 4MX7B 4CU7A 4OIIL 3EG9B 4IBYA 3UBGA 2E6JA 4V2CB 3C2AH 4J3OC 2F1BA 4KI5E 1TPXB 2FH6A 1WFIA 4NLHA 1P9MC 3FFDB 5HYQA 2ZYHA 3EO9H 3K5SA 4NNPH 3X13A 1EJOH 5E8PA 4MYPA 5LKNA 1T2XA 3CVHA 3FTXA 3KH3A 4XC3H 4TSAL 2YBRA 3W57A 4F3FA 2R1YA 5EFIA 5JHDD 1UACH 2MEJB 3LNDA 5DHVA 1V55B 5KZCB 1EFXA 5GZOA 3NIGE 4ZK8A 1JZJA 2F9BT 3SPVB 1A7RL 2VRKA 4YGVB 1MCSA 2OZNA 4WJ5A 4YHIB 3RL2A 3DBXB 3FS9A 3VXRB 3FXIC 3TA4D 2NSQA 1JGDB 3KYKH 4WU7A 4HJ0C 4GKLA 1ZT1A 5CLYA 5F7WC 5ILTH 1S3KL 3L95B 1Q4NX 2A6JA 4B5EA 5D6DA 1CG9B 1KYDA 1G7QA 2OMZB 2EE6A 2HT2C 4MBRA 3ZQ9A 5F71A 1PFOA 5D70H 2X7LA 4XPHL 4KUCD 1K4DB 3QORA 4DTGH 3QZWB 5C09A 1WFTA 2FVNA 4JRYD 4QDGA 4KUZL 2WXQA 2F7QA 3HUJE 2FLRT 4QHNB 3EYSH 1CDIA 1W0VA 3MBEB 4PJ5E 1G43A 2GIXA 4POZC 4PIBA 1EQWA 3KPMA 4KQ3H 2WZPA 4C8XA 2FR4B 4J3SA 3AG1B 3HG1B 3WNJA 2VDRH 1I1YB 4NPYA 4XT1C 4WJG3 2A73A 3EJCA 3TFKD 5SWZA 5DC2A 1ZANH 1I8MA 3UBXG 3ZW3A 4S1QH 4P3CH 1RZIA 1T80A 1A9VA 4KZEH 1X5GA 3UTPD 5JDSA 5E99L 2PTTB 2DQTH 4ODXA 1BAWA 4I2XE 2QL1A 3QQ9C 3TN0B 5C8JA 2KZBA 1RI8A 1NCIA 1E5BA 4OM1L 4K9JA 1KIUA 2V17H 4QCIB 1KPUB 4X4ZA 5E94B 1XCTA 3WDHA 4GSUA 4ZI8A 1MHPH 4DERA 1Q0YL 3IJHA 3W9EA 5H4ZA 2FQEA 2FQGA 5AG9A 1W16A 3LS5H 2OMUA 4YXKH 4L3ED 2F19H 2EIKB 2J8UF 2VJ0A 5I1HH 3LNIA 3MLSL 3QRGL 1OK0A 3LKRA 5IEKA 4HS6A 4EZJA 3Q8CA 5L2KA 4NXSA 1J11A 3BKJH 1A8JH 3DDGA 1HE8A 6FABL 1Y6KR 1M7IB 2ZUQB 4F7PB 5DHXB 3VWKA 5F1SA 1K2DA 4GG6F 4FFWC 3DROB 1EDQA 3QZLA 3CZKA 1ICTA 4X42A 1KJ2B 2X6AA 4KJQD 5HDQH 5JMOC 1NBZB 5MP6H 3TZVD 2Y07H 3QXUA 5HI5C 3II2A 5D1ZA 3LEVL 1CT8B 1P4IH 1HYRC 3VXQA 2N1KA 3D12B 2VUKA 3CXDH 3LXBA 3UYOD 1B4JL 1JZ2A 1WEJH 3LRKA 2H41A 2V33A 2AI0L 5T1KA 4K3DH 2YAOA 4PD4J 2R4RL 3MSPA 2GSIA 1U9KA 3MLZH 2LAGB 4GINA 5IJKA 1R3JA 3JV4A 1CFSA 1QRKA 3IF1B 4ZMOA 5JHAA 1F4XL 1MHEA 1UGNA 2JKTM 5EOTA 3P30L 4DO4A 3EYVB 1MW0A 2C5DC 4AYDC 1YEFL 4LNRA 4I13B 5FO9B 4YDMA 2Z6FA 1B3IA 1S5IH 2ORBH 4PPTA 4PBDA 1IGTA 2VIRA 2X05A 2QQNL 1LMKA 5KUMA 1ND0B 3L9YA 1NGZB 3MUGA 5E4EB 2Z8VC 3W39A 5EU6E 2FX9L 1CF8H 4ZMLA 1MLCB 3K1KC 4TKWA 2ZUTA 1N4XH 2MTAA 3HR5B 3N85L 4WY7L 3LH9A 1OB0A 5TE6H 1A7PL 1H8SA 3LS4H 2G30A 4YHYB 1A1NB 4OQTA 2H6UA 4POYA 1CYWA 2X4SB 4HPHA 4IOFD 2CRMA 1Z9NA 1WZ1L 1QAWA 4MKMA 1DQLH 1S7WB 3JVFC 4JFHD 5DD1L 2AHIA 1HL5A 2X2IA 2AAAA 1U2YA 2P5EB 4M6OL 2BERA 2J20A 4DCQA 4YL9A 2D03L 5MI0C 3GM0A 3JTTA 3L6FA 2VJXA 4PI0A 1RKRA 5IEHB 3ULVD 2XG5B 3GMOA 4JM2F 4LFHD 3WUWB 4I48B 4WWOA 4ZUTB 1QLRA 1I1AD 2CHWA 3SDAC 1YHPA 2I27N 3BPOC 4JHWL 3WE1A 3GC3A 3CXHJ 4KV5E 1NEPA 3MRKA 1T83A 1MHHB 4LFHG 3C9NA 4M6NH 3BKCH 4M7JL 3K6OA 4X7CC 1KCWA 1BQ5A 2WWMD 3VFWB 4BUQA 4JW3A 2C3GA 4ONFH 4YBLC 5C0BB 4KQ4H 4E9XA 1Q9KB 5IW1A 4YDJA 4I88A 1P0SE 1LO4H 3ARGC 4BEIA 2DQHL 2W88A 3B9KB 3KYNB 2WQ8A 3MREB 4WFGE 3TF7C 3GPEA 5IJVA 5E5MB 1AO7A 4D8PA 4RISH 2JKSA 1CBJA 2WVUA 3B5TA 3I84A 2KZKA 4Z3FA 1CXFA 1WAAE 3EJUA 1KJ3H 2J1YA 1I1FA 3ISWA 1FAKT 2P8MA 3B7TA 1MIEH 2B77A 2BFVH 1A0QL 1DUYB 5CP7B 4PI2A 1E28B 4YX2H 1RJCA 4FFZL 4DZBA 5EDSA 1K6QH 2DIEA 2X4UA 4Y19D 2Z8RA 2BNUB 3CX5K 2PYEB 4DP9X 5DHYB 3NBNA 4OLEA 3N44B 3HBQA 2UY6A 3ET9F 3UAAA 4E42A 4HETA 1CGSH 3VGAB 4AYMC 1QYGH 1KY6A 1RUMH 1AE6L 1TF4A 2XFXB 2JLPA 5D7JD 4ZO6A 1GOHA 2CZNA 4NHUA 1ZHLA 1FZOB 3HMXH 5HI3D 3RZCD 3MV7A 3MOBH 3RVXD 3B4NA 1C5DB 2JNZA 3HNSL 2AJVL 4P2QE 1WZKA 5DGQA 3SPIA 1PQZA 3KD4A 3NP3A 2FLBT 3WXWH 2BVTA 2ZP8A 1OPGL 1R19A 3MCKB 4RMVA 3BKML 4UT6H 2CHXA 3L45A 2DJUA 4NSKB 4BFOA 4H8HA 4ZYKB 4BZ1L 3VD9A 3PJNA 5I24A 1JPTH 4O5LL 2DBLH 1Y7VA 1IM3B 3ROLA 3SGKA 2E9WA 2BWDA 2Y7LA 5LUMA 3D7PA 2H1LM 3QFJB 1M6OA 1GJUA 1QBLL 2EIBA 3OAZK 4FQIL 5AW6B 4ZPVB 5J6HA 1MRDL 3BAYA 3BT2H 1MCQA 1O9VA 3P4OA 5F44A 1ZT4A 3PXLA 4B9KC 1GL4B 4FMVA 3MJ6A 1EEYB 3QB7C 4MRCA 1KCLA 3KGSA 3C5SB 3MV8E 3GMMB 1T20B 2OMTB 3RDJA 2HN7A 4X80H 4C83B 3AMKA 4Z77B 2XBDA 5JHBA 3Q6FA 4MJHA 4U1KB 4OGZA 1A4KB 4WUUB 3ZKSD 3FQRA 5ICXB 4JK0D 3VSUA 4APQD 3QDGE 4PB9H 1SLXA 2W9DH 1XIWD 5I75B 5KBMA 5ECJE 3PP4L 2R1WA 3WFCL 1QASA 3BN9D 2VN4A 1YMMA 4HCRH 2Z64C 1YEDB 1W9XA 2X9XA 3BFOA 3WOVA 1EGJH 1VGEH 1XR9B 3FTGB 5F1NA 4JFOB 1IAII 3ULUL 1OCWL 2VM9A 3PXJA 4JCLA 3WNPA 3RGVD 3NACH 3ESOA 5E1AA 3PPEA 2HUEA 4R2GB 5CP3A 1KPVB 1TKWB 3DX4A 5AZUA 4HWZB 4YPGA 1T0MA 3S37L 4ZFFA 2EDMA 2E7LA 5IFJA 3V8OA 2W81C 2HKHH 2WXHA 3AXLA 5F7YC 4NNXA 2OZ4H 4UU9A 3M8OH 2DLEA 5MEQA 5DJXB 5IF0B 2LFEA 2PYFB 3L3JA 3QNXB 4FABH 3K3QA 3WELA 2BOLA 2Q76B 2ZP0T 4C56D 1J1OH 1E8XA 4HHWA 2NNXA 4ZQKA 2XG4B 2M8XA 2ZXDA 3K2MC 1TZHA 2GVYA 2IDTA 2XV6B 3AMLA 3D6GA 3PWVA 3LPPA 4MB5A 3AGVA 3FUIA 4FCAA 1C16B 1DQVA 1FL3B 3TA3A 4M56A 5CSZB 3KJ4B 2X4NA 1CYGA 3NJGA 2V5YA 3FRPA 3QR2A 4LVNC 1ED3B 5FYKU 2HT3D 1XH0A 1WWBX 2BH0A 2ZE0A 1GTNA 3DRQA 3RHWF 1XTMA 3EFFB 4I3SL 4XVUC 2JLLA 2JCWA 3DYPA 2F7OA 2ZOTA 4GAFB 5DURB 1ZCRA 2AQTA 3T3ME 2G5RA 2DKUA 3C2AL 3MCG1 4N9GB 4U1SB 3S6CA 4PVLA 2B9AA 1XF3B 3EOBA 3EO9L 1UURA 3CDZB 1ETA1 3FSZA 5I1EH 5I16A 5FA3B 2V8MA 4Q9RH 4JG9A 4NNPL 3VXPA 3B3BA 1QI5A 1PD1A 3DXAA 4APXB 1A4JA 1FP5A 4XC3L 3L5IA 4NNYA 5DVOA 4BQ9A 2VLKB 4MJIA 1E8WA 2EH7H 1UACL 4G8FA 1BVLB 1KPRB 2ZP9A 3VYPA 3K81A 4F8QA 3MLYH 1RK1B 3KBHE 3CIQA 3O9WD 5ID0B 5ACZB 1EFQA 1TEGA 4I1PA 3KYKL 2XIIA 5I66A 4PBVC 7PCYA 4LOVA 4IIQA 2EYSA 4X6FA 4GRLC 2BRRH 4PHXA 5ILTL 4UTBH 2AV1B 5DI8B 3SHSA 4Y7OC 4NUGH 2H2PC 2ZONA 5GZNC 2VZ1A 4HAKA 4NQDA 1DVFC 2J2ZA 3GLAA 2B2XH 4IU3A 4OD2A 4RFOH 5D70L 2KDGA 3F6IA 3O8XA 2EIDA 4YMPA 4DTGL 3RUGF 3I50H 1PZ3A 3QP3A 4H25B 3VYNA 4LSDA 1BVKA 3G9AB 3V4VB 2QBWA 4ONHB 5EUOB 4GMSH 1R17A 3EYSL 3TBWA 2VE6A 5TDOB 4PJIB 4A7QA 1HXYB 4BHUI 4ZAKB 4KQ3L 2OX5B 3QUMH 2EADA 2VDRL 1HH9A 3HBPA 5AKTA 5B7MA 4Y9GA 3NPSC 4HEMA 3T09A 1MFBH 1AKJB 1ZANL 5C07D 4UTAA 4S1QL 4P3CL 4PRID 1I7ZA 4KZEL 2XVLA 3NVQA 3ZT7A 3F04A 3VX1A 2CKNA 4WKXA 1PL3A 4Q4IA 1ESOA 2DQTL 5CZXC 3U1SH 2H6PB 3CHSA 3KPPA 1U3NA 5C3TA 3IMRA 5EO1A 4GIAA 4UDUA 1A6PA 1J9QA 4MNQD 1AQHA 2OCCB 2V17L 3L95A 4ZOEA 5FKPB 5I0DA 1DL7L 3BLPX 4X8JA 4ZNEA 2HVBA 1MHPL 1AGFA 2EZ0D 3APDA 3QJOA 1WYJA 3VO0A 4J28A 5DO2D 4PJGB 4LQ1A 4ZMNA 3LS5L 4UT9A 2CLZA 1MCOH 5CN2A 5C0JB 5IM7A 4YXKL 4NOBA 5CJOH 3KDPB 3BVDB 2Z92A 3CBJB 4CU6A 2F19L 5H2BB 1L5GA 5I1HL 2HJLB 1CO1A 4S2SB 3Q5TA 4KC3B 2D9QB 4HCGA 3O3AB 3OXRB 4G8GD 3HB3D 4D7PA 3OJMB 3DRTA 3OLDA 3GZQA 2QVTA 2V2WA 3ARFB 3BKJL 4MQSB 3UPRA 1K9TA 1P4LB 3G5ZB 1N7MH 4LHJB 43C9A 3BWAB 3BD4A 5BOZG 3QUXC 4KK5D 4GW5A 3EO1B 4WEUD 2KQNA 3VMOA 3DIFB 5I1LB 5JOFB 5ISZA 4G80A 3U4AA 2EDOA 2ZCKH 2OMXA 5DSCA 5DZNA 3CJJA 2EQDA 5MP6L 4G7VH 2Y07L 4GPVA 2CKBH 5D8JH 3OKNB 3O3DA 4KK6D 1P9MA 2AXGA 1E2ZA 1P4IL 5DT1H 1NBQA 4LLWA 4NIKB 3UG3A 2J8OA 3CXDL 5J13C 3SDCC 4HKJA 1WEJL 1SPDA 3K71B 3QJFB 1IIIA 4EI6B 2X1OA 4K3DL 4Z7UF 2I07B 1R0AH 4ORGA 3MLZL 2XVBA 1PLGH 1BG9A 1NJ9B 4R7NB 4S0SD 5IV2A 4RGND 3RVTC 5EF3A 2D0GA 4IBQA 1KUMA 2V0AA 4AIEA 4Z7QB 1CGWA 4PJ8C 3TIEB 5F89B 1QSEA 2EXTA 2XVGA 2CMRH 5FYKD 1JWMB 4AM0Q 1I8AA 5CGBA 2HFGH 1CE1H 3VD4A 2CCWA 3LRLA 1PIGA 4G6JH 1SYSB 2ORBL 1S5IL 4OZHF 5JZ7D 3FU5A 2X6CA 1JZHA 4TULH 4XBGB 1OGAD 3DHUA 3PQYB 5AG8A 1EVTC 3UH8A 1CF8L 5GQBA 2VMEA 3F65A 1XTLA 1UCTA 5F96H 1N4XL 3L3GB 1J05B 3HBZA 3QUYC 4NUPA 3SDDC 4ENZA 5TE6L 5KYUA 4HIHB 5IMKB 4DVRH 1HDMB 3LS4L 4FQHB 4EXKA 2XWJA 1I8KB 5T5NG 2ZT9C 1WIUA 4QMEA 3V6BR 3LMJH 3RX7A 4FJZA 3NSCA 1DQLL 3VXNA 2JIXA 5HGHB 3NA4A 3B3IB 3QI9B 3KPSD 3HFMH 1PX3A 4ZW6A 5I1GH 1ET7A 1IBBA 1XVSA 1PZSA 2VISA 5AKRA 2X2HA 1PKQA 1DANT 2VDLB 4NM8H 1FA4A 1ZHNB 3QZOA 1GAFH 2R9HC 3FMGH 2IQAA 1V54B 5KOVC 4XN2A 1BJ1J 1JF6A 4G9DB 4Y16D 4DEWA 4UM9A 1FL6B 4M3JA 4M6NL 1BZ7A 2OSYA 5EUKB 4S1RH 2XV3A 3BKCL 3WNNA 5LG6A 1JYXA 2CGZA 1HL9A 4PEEA 3HTLX 1OP4A 3D2UD 4ONFL 4KQ4L 3E8VA 5IQ9A 4MXWH 5I17A 3HHMA 3ARUA 4JEGB 5GS0D 4I0PD 1LO4L 4Z6AT 4OV5A 1ZS8B 2EIJB 3ESPA 3WO4C 4ZOCA 3KBPA 2ROYA 3LZRA 1KDIA 2NY1C 1MFUA 2LTQB 4RISL 1WVZA 2ZAGA 4D0DB 4NDMA 2LT9A 3D48R 4K73A 5ANME 3NOIA 1KJ3L 3SYOA 1YCSA 2IH1B 2P5EA 3FUMA 1U4FA 1MIEL 2BFVL 5C0AB 2NUPA 3TBVA 1PZBA 2J1ZA 4YX2L 3VXUA 3PWJA 3O11B 1K6QL 3CSFA 3FTWA 4TQIA 4WFEE 1IIKA 2B4CH 3MRJB 2X4QB 3CFKA 5D2LB 1CFMA 5I8KH 5F3BB 3MJ7B 1CGSL 4Z7WB 4YDNA 1AG6A 1QYGL 5IMOB 3WU1A 1AZUA 1RUML 5G55A 1MHHA 2WIMA 3VFUB 5I5JA 1E8ZA 3VFWA 2HRPH 3HMXL 3U0WH 3MOBL 4LAQH 2BM3A 5C0BA 3FB5B 4C55A 1LVEA 4EMZA 2OSWA 4Q0XH 3CFJA 3FOMB 4U3CA 4GUOA 3WXWL 4ZXBD 5DD5H 2UXTA 4UT6L 4I0CC 3FRUA 1RPKA 3M17A 4NZDA 2QTVA 2NXYD 1R3HB 3PWLA 2K1MA 3DMMD 2QQLH 4X8GA 1JPTL 2HTLC 1AQDB 2DBLL 4MDRA 2GBVA 4P5MB 2PMZA 3Q06A 4P57B 3V4PB 1UJ3B 1XGYH 3PHOA 4FLHA 3OHXB 3WHE0 3BT2L 2GT9A 2WLNA 1BV8A 4QRUB 5DUJA 3GFUA 4W9ZA 5T8IA 2ITCB 3KLAA 4K8RH 2Q86A 4RNRA 4FMFA 2DYPD 3PGCB 2B59B 3EHBC 4X80L 4WENB 4HSCX 1BAFH 4IRJC 4LVOB 1UOWA 4LO9A 4RAVB 1TENA 1VDGA 4AYFA 2NY6C 2VYRE 2WCSA 2NX5D 3C6LB 2VH5H 4PB9L 2W9DL 2BWIA 2UXFA 2O93L 4N9OB 4HUNB 2YWZA 1DQIA 2B1HH 4YBQC 4HCRL 2P9RA 2G5BB 4BFGA 4ZUSB 1EGJL 1VGEL 4KO7A 5A7BA 2FDBP 2B9BA 3WLWC 1Q38A 3NACL 4NUQA 5FYLE 4IBVA 3VA6A 1FYTD 1CFNA 5CEYA 1IGCH 1BFOA 2DI7A 4H0LC 4R96A 1HH6B 2C3VB 3MRPB 3SDAA 2AEOA 2HKHL 3HZKA 1VFOA 5ETUB 2P5WD 1L0XA 2OZ4L 3M8OL 1UG9A 3L5XH 4E9YA 3F85A 4R8WH 1CTNA 4FABL 5JUEH 5GSVB 4N8UA 3RWIA 3S3DB 3FQUA 3P4MB 1TVBB 4JPSA 1NBCA 3BWZA 3VAEA 4RZCA 4JHUA 1T1WB 2MQ3A 1E8YA 3O3EA 5DTFA 2J1WA 5AW5B 3LSOA 4XO5A 4M4RA 3FT4B 5MEOA 3QDJD 4RAUA 3QDMD 1H3XA 2CLVB 4Y4HD 1IAOA 35C8H 2NNAB 4K94C 4F15B 1LILA 4WO4B 3TWCH 1HSAB 5LCVH 2BPBA 3SOBH 1E9QA 4MHHI 3VGFA 1FUNA 1YAIA 4BFFA 1P6FA 2OMVA 3ZDZF 3MJWA 3TWYA 4NFCA 2ZZUT 3CFIC 4U33A 5AUMB 2WGNB 4G6MH 4IQHA 3WNKA 4EUPA 4AVKA 1BVZA 1NDMA 2E4TA 4IBZA 5ERWB 1IBDA 2G2RB 3QQ3A 4RWYH 4ZX5A 3GUFA 3IS1X 4DUVA 4OFVA 5E9DE 3PJSB 1AXTH 3F6LA 5C9KA 3ZMNA 1E42A 4NQEB 5I1EL 1OAUH 2VQTA 3P0YH 4PV8B 4Q9RL 5BZDB 3MJ8B 4XE5B 2LW3A 3RDTB 1P69B 3GRGA 4N1CA 3VSVA 1CU4H 3MXVH 4OGAC 2APXA 4L4VE 2FGZA 2EH7L 4NRZB 2WLIB 2HRGA 4DN3H 4PP1C 4GW4B 4XZ4A 3WI9A 1IC7H 4OCRH 2AV7A 4M8UA 5DS8B 3MLYL 3LRGA 5CWSB 1SDDA 2PPCA 1HQRB 4NAMA 4OW6A 4NO3A 3KZ8A 2FL5B 2V6HA 2O6DA 3OXSB 3ARTA 4W9HC 1ZLWH 3QG6B 1D2PA 5EC2A 1FJ1A 1F0LA 3AT8A 2YQ2A 3NN8B 3BHBB 5C2UB 2BRRL 3GS0A 3ZMRA 4UTBL 2J1XA 4HZ1A 2APFA 4P59H 5F7KC 4P4KD 1EAOA 4AE0A 5D7EA 1E9OB 4NUGL 4EAEA 2GBUA 1INEH 3ECWA 4RFOL 2B2XL 4HS3B 1ZLDA 1IGYB 4FG0A 2PPFA 4KXZH 5E6ZA 4N8PA 3I50L 1MNNA 1NIDA 3BP6B 4CKVX 1BOYA 4LEBA 4N8VA 4Y7MA 3T3PB 5E8NA 4LOUD 4F2ME 1MVYA 1B4TA 2CIIB 4GMSL 3LEXA 4CVXA 2AXJA 4IS6B 5HHQB 2LAAA 3J27A 4W9KC 1XGTB 2VLKA 1T5WB 1QO3B 2H8PA 2ZWKA 3QUML 3BISA 4KKPA 1OZTG 1NKOA 2EDKA 3S34H 3U9UB 1MFBL 5ID0A 2NT1A 3U7WH 3FUEA 4A55A 4PJAB 4PU2A 5E6UB 5E7FA 3U1SL 5HPOA 4U1IA 3HUJA 4N2CA 2I7OA 2LHAA 5FECB 2UUDH 4JE0A 5DMIH 2XQ0A 3SKOA 2OQJA 3E6FB 3HG1E 1NUGA 4UUJB 4JZNB 5DJ2A 3S96A 1Q9WB 5JQ6H 2NZ1A 4O51A 4LKXB 3QRBA 2NT0A 3PGDA 1BA9A 4B3EA 1XCQA 4HOWA 4O2FA 5D4HA 1MCOL 4S0HA 2CBMA 5CJOL 4BFJA 5DDHB 5DJAB 5EBGA 1TOXA 3IVKB 4RMTA 4NKIH 5I71C 4QO1B 1LD9B 2PPDA 2PXYB 2DDQH 5H8DA 4FA6A 5KN5B 1ZS2A 2WTRB 4MDJA 1N0LB 3OKLA 1JZ6A 2EVGA 3N1PC 3EYUH 4G42A 1SLVA 4NQCD 4WSGA 4YFLF 3T65A 1AGDA 1N7ML 1Z9SA 4RCAA 5J12C 5FYLH 1X4XA 4HBQA 1PJWA 3INUH 4LP8A 2EABA 3BO8A 2O6FA 2F0CA 5CEZE 5CCJA 2X4RA 3V6ZB 4HIIA 3HMXA 2ZCKL 3VXME 4E9VA 1SOSA 1TZIB 5I6PA 1EHXA 2AEPH 3ZZ1A 4G7VL 1K72A 3PDOA 5BZZA 2CKBL 5D8JL 5I15H 4JDZA 4PIRF 5DT1L 2FNWA 4YSDA 3WJLA 3FCTA 1NCGA 1XH3A 1NGXB 1HZLA 4ZO7A 1Z5LA 2YPKB 1H19A 3R0MA 4HDIB 3REVA 5IR1B 2BK8A 4HC1A 4LOEA 1HEJC 1H8LA 1R0AL 4LGSB 1CICD 3F7KA 4TTDC 4GAJH 1PLGL 4UILH 5KOMC 3CFTA 4BINA 3D4GA 2PCPB 2X0VA 3CZFB 3VTTA 3HZVA 4DPCX 2WVVB 3RBGA 3Q2NA 3WN5B 5FFLA 3IT8D 2ARJA 3FRPG 3N1FC 3MRBA 3WJJC 2CAKA 2CMRL 1OV8A 1FCCA 5EA0H 1QR1A 3N44F 3RX8A 2WUBH 1ZGLA 1XGRA 1OE3A 2FLMA 5CZKA 4D9LH 2HFGL 1DLFH 4Z7OB 3OSKA 4G6JL 1JVKA 4PW3A 4GRLA 3K4ZA 1R5IB 3MGOB 4X83A 3TF4A 2IOOA 4F7TB 1X44A 3BWAA 5AYUH 3QIUC 4TULL 1V3KA 3Q8AA 3V95A 4Z0XB 4ZPTA 5I1LA 5GZNA 1ZT7B 2DTMH 1DVFA 5F96L 2F53D 3TX4A 2COVD 4HCRA 2GUOB 3UP1A 4YO0B 4AXWB 1PS3A 1TQCC 3PXHA 3EFOA 4DVRL 2W80C 3QJFA 4R4ND 5B1KA 2VB5A 4HPYH 3DHMA 3LMJL 1CXHA 4G9FE 1KDJA 4PJBE 3G3LA 3H7LA 5L4MA 4JMXA 3D39B 5TDNA 3HFML 4F8LA 4KRPD 1SOQA 1OANA 5I1GL 2IWGA 4EDWL 2X9WA 3VTAA 1F86A 4A37A 4Z78A 1EAQA 3FCBA 2AXFA 5EEVA 3FSAA 4Y8DC 3BOVA 4NM8L 4Y9CA 2W65A 1GAFL 4FS0A 1DZBA 1RUKH 3FMGL 3T0VA 4DAGH 1I7TA 2J88H 1YO4A 1SMOA 3BI9X 4M1CD 3VCLB 3QDHA 4KROD 3OAZH 4DP0X 4N2IA 4XCNA 1V05A 4JFFB 2GC4C 3MFFB 3MLRH 4S1RL 1XV8A 5LBSA 5A2BA 1VEPA 2AITA 1WBZA 3K80A 1U8KB 3ARED 3K72B 3QIWB 4MNHB 4RX4A 3FONA 3LOWA 4NLAA 2VSCA 2YBGA 4MXWL 2WOYA 2FZ3B 3EGXA 3ISRA 3TESA 3ATEA 3C5JB 3GSNB 3LJ3A 4MAYC 1HHIB 4FTDA 3GBNH 2EC8A 4W9CC 2QVIA 3DIDA 1SBSH 3BGFC 3V0JA 1W6WA 4JHAH 4LCIH 3ZIYA 3QUZD 4FG4A 4ZTOH 1A3ZA 3RPIB 1QPXA 2ADGB 4GSRA 2M83A 3F58H 4O02H 3QUXA 1R5WB 3LKOB 4OR1A 3SOTA 2G75A 3CMGA 2FBOJ 1OB1B 43CAB 4I18C 1X4YA 3ME0A 3VU2A 2B4CL 2IADB 4HBCH 2EEFA 1C9SA 1WO2A 3JUYA 3CHPA 1EJ6A 2WQWA 3LHPH 1G9NL 4PS4L 1J0ZA 3L3IA 4HH9B 3GMNA 5I8KL 1CUOA 4ZFZA 4HKXA 4OFYA 3SDCA 1JNLH 4Z76A 4AT6B 1RP8A 1KMGA 3GSWA 3ZTJH 4XMPH 2HRPL 2LU4A 1WZLA 1DVTA 3U0WL 4L48A 3GZKA 4LAQL 4M93C 1U42A 3BPNB 5AB0A 4WW2C 2BSSB 4A63A 1IBZA 4YHMH 1QPPA 4Q0XL 3RWEA 5KS9E 4PJ8A 3OG4B 1XGPB 3O4LB 1RFDH 5DD5L 2RGSA 4UTBA 5GRVK 3KPQA 4BWWA 4PJDE 1E7UA 2QQLL 4WHTB 3RWHA 1KIQB 4YSUA 3HLAA 2WUCL 4GRWF 3FB6A 5CEZH 3ES6A 3G6AB 1KB5H 3P0VH 3Q2VA 4ICWA 2KQMA 4NKOB 4XH2A 5D1XB 1XGYL 3SDXA 3THMH 4MJ5B 5JPNB 3BAIA 1OP3H 5KYXA 4K8RL 5J7CC 3P9MA 2R4SH 2VQUA 1QFHA 3QUYA 3SDDA 2E6PA 2BCKB 1UWXH 1GZHC 1BAFL 2M1KA 2RD0A 2JTYA 2NXZC 3E9UA 4FLSA 5DRWA 5DS2A 4O58H 4E0RB 3T9WA 3UC0H 5B7EA 2VH5L 5IVXB 5DU7A 1VFAB 4HA1A 3D06A 2LLNA 3BKYH 4R0LC 5DRNB 5KG9B 2B1HL 5CGMA 2XY2A 2WP3O 1SN5A 4B27A 1S4IA 5CFAA 2XWCA 1JV2A 1R46A 2XPGA 2ZSWB 2EYTB 2ZX8A 4N2BA 4AJVA 3BP4A 3MV8A 4GP4B 2FEDC 1M9WA 2NY3D 3UGUA 2Y36H 1DEEA 2YEZA 1TG8A 4QXUH 1IGCL 5KBPA 1OCCB 2W0KA 4JLRB 4KZDH 1RZ8B 5IVOA 4P57A 3QDGA 3GBDA 3L5XL 5DC4B 3RVWD 3TBTA 4FL4B 4R8WL 1X7QA 3DNKA 5JUEL 4K71B 2QT6A 3ULUD 2H0FA 2BOBA 4JFDA 4GIOA 4J3UA 3N43F 1I1CA 1A5FH 2N0KA 3GI9H 3JQOB 3SPHA 3QAZB 2B59A 3VG0H 2XA3A 2G60H 3U36A 3BVVA 5K33A 1P6WA 3MRGA 1IGMH 3NEEA 4FULA 3MV9D 4OLZH 3GQFA 2XC8A 2VLJB 2D7MA 2CGYA 1J8HA 3GMPA 3I2CH 3OHMB 3C08H 1BMWA 1HIMH 4OCSH 3ZE0E 3RPKA 35C8L 3S9DB 3IK2A 2N7SA 1HCVA 2VW6A 3TWCL 1T2JA 1PNCA 5LCVL 3SOBL 1AP2A 4OZIA 4ZMYA 2L7EA 4N90D 1I1RA 2NQDA 4G8EB 5CIPA 2OSXA 4KJWC 3IDMB 5D96B 3AU1A 1JN6A 3ILQC 4G6ML 3FQWB 3H7BB 5INCA 4UDTB 1C08B 4AEIH 5HHPA 1CLVA 4JCWA 3FHQA 1RAMA 1JZ3A 3DGGA 5IUSA 3U0PA 4RWYL 2W9LA 1GR7A 1SOKA 4WK0B 4U1GC 4PJCE 1TTFA 2ZXWB 2ZKMX 1AXTL 5LO7A 4DJMA 1MJJA 3I75B 1XL4A 3JBG7 1OAUL 3P0YL 4BRVA 4JFQB 1U8MA 1CLOH 4JRXE 1ZA6A 3FTYA 2VXSH 3SZ6A 4BYHA 5AW1B 2I9TA 1CU4L 2NUTB 2IGLA 3F64A 3MXVL 4ESKA 2JK5B 4LPUA 2JH2A 3ESVF 2P47B 4ODUB 3WE6A 4AMKH 5ESAA 1IC7L 4OCRL 5DJ8B 1K5NB 3FO0H 2QMKA 4BA0A 2Y6SD 4P04A 3T0ED 1EHKB 4Q97A 1KXVC 3BUYA 4LP5A 3WY2A 1PD0A 4JY4B 2DW5A 5T3ZH 1BZ9B 3D18A 3FHEA 4M7KH 1MELA 2OULB 2HKFH 4P06A 3BGAA 3EF4A 3PWPB 1WT5C 3TO4B 4TPRH 5HHME 2BC4A 3W81A 1NBYB 1JP5A 2MNUA 2VUOA 4NERA 4P59L 2OSLB 3QQ4B 5EOCH 2RFXA 2VTFA 4GQQA 4FQXD 1INEL 4CDHA 2KL6A 2FO4A 3WGVB 4Z7QF 4CBZA 2W1NA 4IRJA 2F74A 3CFCH 4LB8A 4PGEA 3VFMB 4ZFGH 1HCZA 2UVEA 4RMSA 1KT2B 4FTVE 4IOIA 4R97C 3H3BC 2GK2A 5FV1L 4ILDA 4Z3GA 4LLUA 1O5PA 4WNQB 3ZKQD 4TUOB 2FIKA 1PG7H 3GNMH 4TQPA 3EYFA 1PPIA 4PREA 4R9HA 3CDGB 4JFYB 4HUXA 1RMFH 4I87A 2WLLB 4KHXH 4H8WC 5FO7B 3S34L 3EDFA 2GIMA 3U7WL 4C47A 4YIQA 4Z3TA 2ZICA 1JDAA 1QA9A 3I9GH 3QCUH 5SWSA 4D0BA 2R23A 4PSPA 4RIRB 5EUOE 4LSVH 3L5WA 4HGMA 3LDBB 3ATAA 4PJIE 1NGPH 3IKKA 2L4OA 4XXWC 4HFWB 3HC0A 5DMIL 2V7NA 5KYWB 2QHLA 1G9MH 2IPUK 2RR3A 3V55A 5JQ6L 3RY5A 1JPEA 1XB3A 1PSKH 3OGCA 4UMGA 1YNKH 5BNXD 5E4IA 5I1DB 3Q2CA 3ROOB 3V5DA 1OL0A 5G4OA 2XKSA 3EH1A 4NKIL 2R39A 4MQ7A 3VE0B 2UV3A 2EIZA 5HGDB 2IMMA 1TTBA 4URTB 2IANA 4Q6IA 2MKLC 1S2EA 2DDQL 4H5SA 1TZ8A 1VAHA 2APWA 5FM5O 2AQ1A 2Y69B 1U4EA 1IC5H 1NH6A 3EYUL 4JJHA 4KVPA 4UYQA 3M88A 1A1OB 2NLJB 4PJFB 5C08D 5FYLL 2NSXA 4ETQA 2CA3A 1ZVSB 3CU7A 3INUL 3LKNB 3BEWA 3H9SD 4PJGE 4B96A 4GI6A 1LQBC 4QRQA 3BP7B 2GBTA 3C87A 3FQ1A 4F2EA 1QSFD 3DVGB 2N4IA 3MNDA 2QFPA 2NY4D 1D6VH 3PV6A 3UPCA 2W94A 4FLQA 3VUAA 1OARH 4Z8FH 1ACZA 3AC0A 2AEPL 4G43A 3IPBA 5JPMC 5IBTH 3WY4A 5I15L 3GJFB 1F97A 3NJHA 4IRZA 4PR5A 4NFBA 3F7LA 2K6YA 2ITEA 3ZZSA 1S9WB 2ENJA 2WIIB 3QEQE 4A2EA 4GUQA 1VCAA 1DFBH 3QXTA 4B60A 3VWJC 3TP4A 1HEZA 5FEBA 5IREA 1E5CA 3M1BB 5AVSB 1IO4C 3DX7B 4GAJL 4UILL 3KGUA 1XEDA 2YQ3A 4LF3B 4LQFH 3EYOB 1GSMA 2C7UA 2W07A 3SDXF 2BMKA 4BQ6A 1UZ6E 1CGTA 1QW9A 3FU3A 3MRLA 4Z9KB 5D2LF 4Q2ZB 1A02N 4KAQH 4OGQC 5EA0L 2L7JA 3Q2LA 3APNA 1FVCA 2A6IA 4H8UA