1TJXA

Crystallographic identification of ca2+ coordination sites in synaptotagmin i c2b domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
156
structure length
156
Chain Sequence
SGGGGGILEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords similar to synaptotagminI/p65
publication title Crystallographic identification of Ca2+ and Sr2+ coordination sites in synaptotagmin I C2B domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 31
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1tjxA00
1DJYA 1E8WA 3PRZA 3ZW3A 2N1TE 2UZPA 3QARA 4BFRA 2Q0ZX 4DK5A 2LHAA 4WWOA 3R7QA 3PREA 1E8XA 4L23A 3ENEA 3ZVVA 2DMGA 3KWUA 4FADA 1UOWA 5G55A 4LCVA 2K45A 3CSTA 4BGDA 3APCA 1CJYA 4IHBA 1DSYA 2WXIA 4FLHA 2ENJA 1DJGA 2WXJA 2JQZA 1W15A 1WFMA 3QJZA 4NPJA 4PS3A 3CSFA 1TJXA 3L16A 3TJPA 4EZLA 4WWNA 4WAFA 1BCIA 1RLWA 3LJ3A 3W56A 5G2NA 2WXFA 3JZYA 1RSYA 2WXGA 5CCJA 2RD0A 4FULA 3L54A 2CHZA 2Q3XA 3RDJA 4TV3A 1GMIA 3R7RA 2WXOA 2QZ5A 3N5AA 4LT7A 5KJ7E 5JHBA 3QAQA 1DQVA 4QJ5B 3L08A 4QJ4B 4F92B 4NPKA 2CHXA 1DJWA 3HN8A 4G11A 4Y1TA 3F04A 3W57A 4XZ4A 4URKA 1YRKA 2WXQA 2WXHA 3ML9A 4Y1SA 5H4YA 1BDYA 1E7VA 4ANXA 2WXKA 4TS6A 2EP6A 3L17A 2CHWA 4OVUA 2A4ZA 3GPEA 4OVVA 4ANWA 1W16A 1DJIA 2KI6A 5T8IA 3PFQA 4J6IA 2K3HA 2ENPA 3M7FB 3QR1A 4FHKA 4NS0A 3IM1A 2X38A 2FK9A 2CJTA 3F00A 4PS8A 3S2AA 3IBEA 3APDA 1E8ZA 2CM5A 2NCEA 1E90A 5JHAA 5EDSA 4QJ3B 3HIZA 4A55A 1K5WA 2WXRA 4AOFA 4EZKA 3QK0A 3P2BA 4FA6A 2BWQA 3NSJA 4L2YA 4HLEA 3ML8A 3APFA 3HHMA 4QAMB 2NSQA 1A25A 4F1SA 3SD5A 2V4LA 4NP9A 2QZQA 3L9BA 4GB9A 2A5UA 3NZUA 4ANVA 3F01A 2ZKMX 4WWPA 1RH8A 3T8MA 4XE0A 3KWTA 1DJHA 4IQHA 1UOVA 4F91B 2CM6A 3B7YA 2B3RA 4KZCA 3QR0A 2ENQA 4ANUA 4FHJA 2WXLA 4MJJA 4V11A 1BYNA 3OHMB 2YRBA 2FJUB 1E7UA 3FDWA 3L4CA 4L1LA 1WFJA 2YOAA 2WXPA 1V27A 1DJXA 4LDCA 4HVBA 4EZJA 4DNLA 2CJSA 3DPDA 1DJZA 2WXMA 4GNKB 4PS7A 4XX5A 2R83A 2Z0UA 2DMHA 3MJWA 2NQ3A 3OAWA 3TL5A 5CCGE 1HE8A 4L1BA 3L13A 2D8KA 2WXNA 4FJZA 1UGKA 3ZIMA 3NZSA 3F05A 4JPSA 4TUUA 3PS6A 4ICWA 3FBKA 3DBSA 4KZ0A 1QASA 4KITB 4ICXA 5CCHE 4AJWA 1TJMA 1QATA 2CHDA 3TWYA 4F93B 4FJYA 2K8MA 2ISDA 2Y3AA 3PYCA 3RPBA 5H4ZA 2K4AA 4WEEA 1E8YA
chains in the Genus database with same CATH superfamily
4PGJA 2N59A 5DO8A 1EJ6A 1CDHA 3U2IA 3VRLF 5GPRA 4C55A 2OR9L 1UOWA 1CDBA 4UQ9A 2E9BA 4YNYB 3N40F 1CFNB 4URTB 3SJVE 2AJZA 4FAAB 1YUHB 4FQXD 4ZFGH 2KPWA 3HRZB 3F84A 4QOKD 1JYNA 1AHWA 3BT2H 4TQEL 5D1QB 4N3UA 2P3YA 3CSFA 4AITA 3ALXA 4H8UA 4Y19D 6PCYA 3L4YA 1OCWH 2I7OA 2ZXCA 1BAGA 3KH4A 3MV7A 4KKAD 3JTSA 3ELAT 3GSNL 2E8YA 3CU1A 3Q8AA 4N1EA 2A9BA 3V4PA 1E4HA 1IFHL 2O30A 4G7QB 4N0CD 3AWGA 5SWZE 3CFMA 1TZIA 3DETC 3P4MA 3D9AH 3MGAA 1ZHBA 1U36A 2Z31B 5H37G 4MXQD 3TJEL 1RJCA 4TF4A 1H3WM 2CBTA 2AJVH 3CGTA 4MAYA 4EIGB 1E2VA 1F4AA 2HRHA 3W39A 5HYJA 3QEUA 4ELMB 5EU7C 4O2EB 2B9AA 1YSOA 4ZK8A 1H15A 1W16A 3Q1SL 1R4XA 3SKUD 3H6JA 1V5JA 2HN7B 2YSSA 1FL5A 3BVVA 1CFSA 2XX1A 1EO8L 5HGHB 4X7CC 3MNVB 4YHIB 1HC1A 2PCPB 3LMJH 3PHQA 4QT5B 1DQDL 4WJKB 5IQNA 1KJ2A 2IBZX 2BOLA 2CQVA 3X13A 1NEZA 2JKTM 3ASWA 4QAMB 4LASL 4YBHA 2YMOA 3FKUS 5DZVA 1AP2A 1J0KA 1MPAL 4IBLT 3UO1L 1GIGL 2DWTA 2BVTA 4FXGC 4B97A 3IJSA 3LPWA 5A2LH 5DD3H 2EO1A 4RX4D 4XPFH 5IUCA 1WUZA 1UM5L 1NUNB 3MLRH 2EIKB 2UWEA 3B7UX 2IADB 5AAMA 3U36A 5ID1A 4XOBA 4FDWA 2P8PA 5I73B 1INEH 3QULA 5F7EL 4MWFA 3WTSA 1ZHLA 3FT4B 1Q9KA 2HWZH 5DJDB 3EW3B 1A3QA 1QBML 3MV8D 1C5BH 4LRIC 1JYVA 2NY1C 3R06A 4OIBA 3CFDB 1AQDB 3QDAA 5ACLA 4B9CA 4OZIF 3OQRA 2PMZA 2VQUA 3D4CA 4GUPB 1UA3A 1NKGA 1QASA 2XI9A 2IALB 5D2LE 3LRSA 5KSAB 1CCZA 1GMEA 4I0PD 4TKWA 1KCWA 2F19L 5IM7B 2EYTA 3TVMC 3VMNA 3UTQA 3WN5A 3PDOA 1GOHA 2LHAA 2E56A 4H0LC 2X4TB 5IMOB 5FA4A 5L8JB 2B7DT 5G55A 1HYRC 1T4KB 3IWVA 3F6IA 3BRGC 2QADC 4LIQE 4YX2H 1A9VA 1TTAA 2XJLA 4LLVA 5ADPL 3C6LB 1XD0A 3AQXA 2NY0C 3FTYA 5C9JB 4ETQB 5D1XB 4S0SD 3GPSA 5HHNA 3T0AA 4PRNB 3MHZA 3H6AA 2QL1A 4XMXA 4YVNA 1YMME 4HK3N 1OSPL 3ZXAC 3TT3L 3WY3A 1GW0A 1S3KH 3GXNA 4FFYL 3TZVC 2BS8A 2DJSA 3OXRA 3OZ9H 2Q7AA 4L1TA 2I60L 4APQC 2IO5A 2RH0A 4GINA 4EPSA 1HCFX 5JW4R 1OARH 3FPYA 3IDIB 5KUMA 4PJ7F 3DURB 3S96A 3Q2LA 3U7WL 4NN5C 1KBGL 3IAGC 2JIXB 1I1CA 3O11A 4ZFOA 5ISZD 3PNWA 2IWGA 1RU9H 5AENA 4FQHA 1MREH 4M1GL 2AERT 3P2TA 2YC1A 5JPMC 2YEQA 1KXTB 4XMPH 5HGGS 1CLVA 1IGIH 3MFFB 4HUVA 1V05A 2I85A 4MNGB 4K7PY 2X4RA 3II1A 1VADA 1E4KC 5GGTA 2DJUA 3VI4F 1DVSA 2ZOUA 3BP7B 4OZGE 1KGIA 5I6LA 2FO1A 4MAZA 3RL1A 2DWEB 4L2YA 2FWLB 3EFDL 3SODB 5K59E 3UGUA 1IC1A 3ARSA 4PCTA 3V0EA 2MCG1 4Z7UB 2WQXA 2O1AA 3QXDA 1J5CA 4POYA 1NC2B 1DE4A 1QAWA 1RIUH 3FSVA 4X7FC 2YEVB 3V95A 1XHHA 2AAVA 2NYYC 2WO3B 1EDYA 3O6KL 4QRSA 4PWIA 4RESB 1KGYE 2PCFB 4YN3A 1HNFA 2HLAB 3TNNB 1DQJA 2G75B 2VW4A 1K3IA 2JWYA 5FW8A 5TD4A 3FCTB 5ESAB 1NL0L 2VDMH 4X99A 2Q6WB 2OJZH 3QUXA 3PWPD 2XN9B 2Y25A 2Z93B 4Y9GA 1QFOA 1NFAA 3QQ9C 1R0AL 2J20A 1OQXA 3EUDA 2XWEA 3C60C 4X2UA 4HCFA 1NBVH 3SDAA 4PWKA 5CJXC 1R3IH 4B95C 3L3DB 5D8JH 2NY6C 3NIDB 4L8SB 1OP3H 4XP6H 4UV7H 1C12B 1KPRA 3MA7B 5IVXF 3FB5A 4OZIA 1UTDA 2J43A 2CKNA 2G5UA 4NQDE 2VMCA 4OLUL 1HHHB 1DO5A 4ODVL 3RBSA 2F0CA 1AXSB 3HN5A 3NFPA 2R15A 3BW9A 1S5HB 1RZFH 3QARA 4GBXA 4PTTA 1VFUA 1MWAH 2Y2YA 1IC0A 4V2CB 3OJDA 2DLFH 3R18A 4LLQA 5EUOB 4WNQB 1E5YA 4WEUD 3RX8A 3SOTA 4ZYKB 3LB6C 5K5YA 3APCA 3V0GA 5H37A 2HT3D 3U9PH 5F7WC 1ZVSB 4HOZA 2DZEA 3VM7A 1ODUA 3L3IA 3M1BB 1I8LA 4LLWB 5HHXL 5FUOH 4NM4H 1WC7B 2P5ED 3TIDA 4DW2L 1AZNA 1K9TA 5IQ7L 2IOMA 4XNXH 4NQEB 5CHNB 5DEFA 3SPHA 3ZK0A 1D2PA 3NRFA 4X6CF 3QUMB 1IM9A 2JELH 2P5WE 5C2BH 2BY0A 3QGVA 1I7ZB 1M1XA 3LKNA 5AKSA 4E9SA 1NAML 1TQCB 3FQWB 3ZL4H 5HYQB 3O2WH 2DM4A 3NH7H 3G6JF 4MA7L 2F74A 4H5SA 3A4DA 4F7PA 4PJ7A 1X44A 4NAJA 3QUKB 12E8L 3UPCA 5J9PB 3TBCA 5CEYA 1WP6A 4LFHG 4ZW5A 3HNTL 3C6SA 3KWWB 2VMEA 2AKRB 3GPEA 1ZTMA 1SEBB 4FFZL 3R8BB 1IT9L 4AIXA 2J5LC 2XZQL 2W60A 3ZZQA 4JAMB 1SJVA 2FO4A 3UACA 4DHLA 2VL5A 3I9GL 4P2CG 4K7FA 3FQUA 2OX5A 2G9HA 1DDHA 1WZ1H 1JZIA 4M8VA 4OUUA 5GS1B 1A7QL 2EIMB 3CH1B 3P69A 4UAOC 4N0UB 1UM6L 4XBGA 4Y9BA 3D2UA 1XB3A 3WXVL 2I9LA 2ADIB 2X6MA 4CVWA 3KDMB 1GAFL 1MCIA 3QWOB 5SWSA 5GS0C 5GXBB 1OWRM 1CE6B 1KV3A 1N5YH 2O5ZL 4OZ4B 2YZ8A 5B1JC 3C9NB 3MRCB 4A7VA 5CR1A 3ZTJG 5IBLD 1XB8A 4MBOA 1T5WA 3MRBB 4NRXB 2LOEA 2YPKA 1U8CB 3FB7A 1FZJB 3GRWH 1EHAA 3NJXA 1U92A 5D7IB 1Q9OB 4OSUH 5EO9A 1L3WA 3U7AA 3L3HA 1H19A 4BV1A 3UYPA 3DPDA 4PRIA 4EDXB 3SY6A 4AEFA 4PLNC 1OO2A 3OC5A 5CJQH 4ZFZB 1J12A 3A6BH 1GS7A 3BWAA 4LLYA 4EI5B 1I7RB 1OK8A 4TUUA 1PBYA 4KZ0A 1K4CB 3CV5A 1JXJA 2X40A 2P48B 1QRKA 1R34A 1X4XA 4JDEA 1ZK9A 3UG4A 5IVXA 1DN0A 4JPKH 1DVZA 1FO0L 1JTPA 2Y1AA 1D6VL 1E8WA 1TTUA 1ASPA 3IDJA 4F8NA 4YBLC 2BNRE 2Z64C 4KO5A 5KVGE 3ULAB 5D7EA 3D0VB 3LPPA 1XSJA 4L3ED 1G7QA 3MRIA 4AEHH 5C71A 3FH5A 2PWEA 5IJKC 3QWQB 1RK1B 2Y07L 5I0XA 2FYVA 5KVFL 1IL1B 4PJDB 1CTMA 3AROA 3CX5J 3MXWL 9CGTA 1GGBL 2JI2A 4H88H 3OLGA 5CZVH 3NP3A 4NWTL 5IBTL 3L7EA 1O7VA 2G5BA 1AOZA 1QR4A 3MACH 1HILB 3NJJA 4XNZB 5T1KD 2HJLB 4X6CA 1AS8A 4GMTL 2CLRB 5E4AA 3L7FB 3U2SB 2YPVA 1OM3L 3ETBF 4YHZL 3T2OA 2Z35A 1QFWH 4ZOAA 3N3EA 1G9NH 2XNAB 2MQ3A 1JRHH 3RILA 2DQEL 4EI0A 5JXEA 4NP4L 2BX5A 1YY8B 4JG1H 4N24A 2PTTA 1CT8A 1KCLA 1IBFA 2H6OA 2HZHA 2ZYIA 3DX9B 2VN7A 3REWA 5IFJA 5DVLA 2V5SA 3BAEH 4QKXB 4N4YB 3THMH 3DXAE 3SDDA 2VLJA 4PP1D 1NWOA 5EZOL 4RDBA 1KMGA 4LGRB 1U2CA 5LXVA 2KZ1B 4GH7B 1S7UB 3QUYA 4X9BA 1OAZL 3LHPL 1KJ3L 2APXA 2GUOA 3MLYH 2Q87A 3VSQA 4JDVA 2ZYSA 1U58A 1G6RH 5IGXH 4X0KA 3MJ8B 4OAWA 1CU4L 4LQ1A 4RWYH 4FHBD 4H1LB 32C2A 4OIIH 5KVEE 2CM6A 5E9DA 4ELMF 4U6HA 2XPYA 2YZ1A 1O6SA 4FG6C 1J10A 3A3YB 5LAXB 5DJ8B 3Q44A 4XRCB 4P4RA 3BDXA 3U2JA 3KPRE 2YO3A 4M6NH 1MCKA 4IDJH 1XF5B 3N41B 3OLIA 2YXVA 2W94A 1TQBB 3OAWA 5JPNC 4P23B 5FKPA 3W1ZA 3BVDB 2GTWB 3NP4A 3QCUL 2OZ4A 4FJZA 5I15L 3EBAA 4TQIA 5CS7A 3PIQB 1MJ7H 1KFGA 3RWGA 1E42A 2K8MA 1FC2D 2YQGA 4P2OD 1NZRA 5I8KH 5J1SC 4YHOL 5D7KD 4N0YH 4N9GB 3LEYL 2KDYA 1A3LH 3P0VH 3TO2B 2AABL 2AV7B 4DP2X 1TMQA 4HDIA 3IVKA 1J8HD 1I7UA 3UTTB 3FH8A 3VFWB 2DQGH 1JCKA 1UD3A 1E6OL 4PRPD 5FYJU 3OX8A 3M86A 4JDZA 1LO2H 5IROA 1QG3A 2EUZA 5IUSA 2GSGA 5FHBH 3LEXB 3GJFB 3P9MA 2H2PC 5ACZA 1MCHA 2DKSA 3EXLA 1ZT4A 4ZZKA 1PLGH 5ESQB 2EYSB 2BRQA 1A3RL 3RA7L 3S36X 4MNQB 2X2JA 5A1AA 3KGUA 3V0JA 3VNYA 4YR6B 2V2XB 3HE7B 4ZUTB 1KFAH 3B7RL 1OW0A 5GRYA 4ZS7L 3T2NL 5CINL 3Q3GB 2XSKA 5DFWH 1OM9A 4AYSA 4LPXA 1KELL 5GGVY 1OP9A 5IG7B 4CVUA 1ZANL 5CEZE 3MV7E 3AB0B 1WWBX 2VJ8A 1S9KC 5LBSL 1GL4B 4TUKH 4NQSA 4MXWL 4TS6A 4YNYA 2WPGA 1CFNA 5I1LB 3BWUF 4HOXA 1CS6A 1I3GH 2B1AL 5DT1L 3HRZA 4UILH 5GJSL 5C92A 4A63A 5D1QA 2F7IA 3S2AA 3B8YA 4ZTEA 2NSXA 2YKKA 3ZX1A 3HLKA 3Q0HA 3GBML 3ARGD 5HYJE 1UA6H 4K5PA 3P2BA 2C9PA 4G6KH 4PH8A 3ARZA 3ZMEA 1ZIAA 1B4LA 1IC7L 4X4ZA 1HKLL 2CNYA 2EJ1A 3ZKMD 5GGQL 2QZQA 1I1AC 2A5UA 4LLAA 5DZJA 1YEHH 4LSTH 4XAWL 4M6OL 4ZOBA 1B4TA 4JFZL 4GAFB 1ZA3A 2FWOB 4O2EA 1NCUA 1ZLSH 4A2GA 2EXSA 1UUSA 2VN4A 4P0DA 5BS0B 1JZ2A 2HN7A 5E1AA 4OBSA 1GZHC 4AUJA 2WCPA 2ZP0T 4YHIA 3MNVA 1OF2B 4BUQA 2PCPA 4QT5A 3VD5A 3VRIB 2MFNA 2UWEE 3BPNC 5F6IB 2ZKXA 4F2FA 5IMMB 2P5PA 3WHXB 5CU5A 3E9UA 4EE2A 2WUCL 5J3HC 3DKHA 2WVVB 3VWKD 2E47A 1ZT1B 4HCIA 5LNEA 3STBA 43CAB 2LVCA 3WJJC 3DI2B 3EOYG 3HE6D 4HWEH 3WNJA 2M26A 1IO4C 2NY4D 3QPXL 1MI5D 2VLKB 2PYED 3L2LA 4K5NA 2IBZY 1OTTD 2J1ZA 4GSRA 3G3LA 3PHOB 4MRBA 1LMKA 4HK0A 1UWGH 2X4QB 3FT4A 5E8DL 1T4WA 4A2MA 1MW2A 2IFFH 3EADA 1TFHA 5DJDA 3UBXB 4P05A 4GSDL 2RQEA 4UQBA 3VRLE 3VGEA 3GI9L 1AQDA 3NIDF 3IK2A 1LILA 2G4EA 4U1JB 4I89A 3WNNA 1J05B 3GUFA 2HJFB 3F85A 4GUPA 4YHPB 1QFWM 3CFBB 5KS9F 3OAZH 2GJ6D 4FTVB 5KSAA 4X7SL 3ZYZA 5C0DB 1J87A 4NQVA 1SLXA 5TE7H 3BZ4B 5EUOF 4YH6A 2X4TA 5IMOA 2Q10A 5AWNL 3W11D 1T4KA 1KN4L 2FHFA 3EJTA 2UY7B 1J5IA 4ANWA 4FF9A 4KROD 3C6LA 4XVSH 2RBLA 4NS0A 3QHFL 1UWXH 2Y2WA 5D1XA 4ETQA 3CQPA 3DIVA 5I5IA 3FYIB 3ESNA 1I9IL 4UAHA 2EE3A 4KJQC 3WEOA 1QP1A 3OXSB 1F11B 2XRAL 1QPPA 4KMQA 5L2KB 4N26A 2AEPH 1J0JA 4CN1A 3QP3A 5C08B 4NHCL 3HNSL 3IDIA 1DVFB 3LDBC 3BWZA 3DURA 2DQHH 4WWPA 1N3NB 4P4KC 2YXWA 4U1HB 4J12A 5HD8C 4U31A 4ODHL 1BQUA 1T0MB 3FTGB 1NLDL 4JCLA 2XKNB 1M05B 3AS3A 4LF3B 1RPUA 3H1ZA 4ZXBC 1A5FH 1TZOA 1O7DE 2ZXGA 3NG5A 5DD5L 5E2UH 4PJAF 4PS4H 1KXTA 2BCKB 2PO6B 5J7CC 1HYSD 3P4LA 3VWJB 4WTXA 2BSTA 5A3IC 3DO7B 4MNGA 1MOEA 3UBHA 1PJ9A 2H47C 3ET9F 3FHEA 2XV6B 3MZTA 3MJWA 3BP7A 3QRGH 5CU9A 1WV7T 2ZONA 1F02I 4WW2A 5GISH 3TNMB 1OOWA 4QRPD 1YA5A 3QR2A 5TE4H 4YDZA 1NOLA 2VQ4A 2X3CA 2Y5TA 4FJYA 2BZDA 4Z7UA 3QUZC 2K4AA 5IMKB 3ZHNA 3LNGA 5IHUH 3VX0A 1J1PL 2P1YA 1NMAL 4G8GD 4IOSD 3OAUL 2PCFA 5DRNB 5ECJE 4MJID 2HLAA 3TNNA 3NJKA 2G75A 3CSTA 4OZIE 1KBPA 3CCHA 2VR4A 3KVDD 3FCTA 4LVOC 5ESAA 3MLTB 3KPTA 2Q6WA 2BY2A 1KB3A 4JM2B 4Y4KD 1DQLH 2XN9A 2ADYA 4RGOH 3C09C 2Z93A 3D48R 2HG5B 3JZYA 1LMIA 2B08A 3ME0B 4H1LG 3GSOB 2KLSA 3I75A 4DEUA 4DPCX 2CRYA 4L8SA 1C12A 3MA7A 4ZSOB 5FUZL 3R7RA 1I3VA 2P4AB 2ZXDA 5AVSB 1HHHA 2MRYA 1YG9A 1GHFH 3VFGH 1LK2B 1QWUA 1AXSA 4QTIH 3UJIL 3K71A 2MOGA 1KYOK 1LO4H 3JQOB 5EUOA 4WNQA 4AZ8B 3NSYA 4ZYKA 3KLLA 3WE1A 2FECI 4D8PB 1WEJL 5EIQA 4AQ8C 1ZVSA 4J27A 4AIEA 1CN4A 2WANA 2WSPA 2XA8L 5B3JE 3DX0A 4IMKA 4PJDF 4YXHH 2ZJSL 3M1BA 2G60H 4PJ7E 1L4IA 3UOAB 4DN3L 3SKMB 5BRZE 3F65A 2OW6A 4NCC2 5BRPA 4PQXA 5JNYB 4NQEA 5CHNA 1G9HA 4HIIA 4I48B 3HMXA 4Z0BH 1KGJA 3QUMA 4BGLA 3OPZL 3RGVB 1I7ZA 3D52A 2QTEA 3HHMA 3FQWA 5HYQA 1NAKH 3GHBH 3QIWB 4NP9A 3ZO9A 5AW5B 2R29H 1HI6B 1QKZL 2WQSA 5E5RB 1EGJA 1MFCL 3VI4E 3BZEB 1BVNT 1NICA 1P2CA 1D5IL 5J9PA 2WXLA 1H0DA 3X11B 2C1PB 5CZKA 3L4XA 3KWWA 4RMQA 1GGCH 2AKRA 5JTWA 4WV1C 5AVWB 3WY2A 3K8MA 5CUSL 1RIHH 2VXUH 5ABZA 5SWSE 3PWUB 4BM7A 3ESMA 3KPPA 1SHSA 4PS7A 1QLEH 3CLEL 3RDTC 1KULA 4ABQA 1FDLH 2N0MA 3GMPB 4KQ3H 5JOFA 1LLAA 2P46B 3KJ4B 3CVHH 1KN2H 3GC3A 4PW9A 2ESVB 4XI5C 1UZ8B 5GS1A 1R47A 3CH1A 2KHAA 4CNIB 4P9MH 4PRIE 5CO1A 1VZIA 2FGWH 4R96A 4JPIB 2IGTA 3HC2A 5C0CE 2ADIA 3ZE2B 3I9PA 2I24N 1VENA 3KDMA 3QWOA 2UZPA 1CE6A 5C07D 3SPCA 4OZ4A 3SYOA 3MRCA 2JLLA 4LPTA 3GKWH 1K85A 4NRXA 1U8CA 3PG2A 1FZJA 3AT9A 1QX1A 5D7IA 2GTQA 5IVXE 5CJ5A 3TONA 3AS1A 2X3AA 2DDQH 5LBGA 3MXVL 1N8OE 4AENB 4EDXA 4YSDA 1U91B 2IXQA 1WFTA 4RZCB 3IFOA 1BJ1J 4HLZH 4ZFZA 4P5SA 1XH1A 4X7TA 4RCAA 1KY7A 3WNPA 3FU3A 4G70B 1K4CA 2P47B 1SOQA 4RMTA 1SUJA 3ARXA 2BSED 3L4VA 5F0MB 5CGMA 3I6LD 4BQBA 4TOYL 2MKLC 2GCYB 2NZ9C 2FBJL 3I6GA 3OR6B 3HKFA 1KIPB 3BLPX 3PGDB 2IH9A 1CTOA 1E4WL 4TQEH 3LS5L 3ARTA 3FRPB 3D0VA 4PREB 4X6CE 3HVNA 5KYNA 2W8CA 2WO2B 3FUJA 3FB6B 2H41A 4LP5A 4MD5B 3GSNH 1RK1A 1PCXA 4IRSC 1TR7A 1F56A 2R0ZL 3G6JE 4UDUB 5E6SB 1IFHH 1GSMA 1IL1A 4L37B 4YDLC 3T2LA 4BKTC 4PJDA 2CM5A 3IDNA 1PIFA 1A9EB 2CLVB 2J1YA 4IRJB 4ODUB 1K5WA 2QKSA 5K9QG 5FX3A 3TJEH 2ZUUA 1GPOL 4PRAB 1XCQA 5J13B 2VZ3A 4ILDA 5AW0B 3PDGA 1HILA 1QSFD 5E56A 1M7UA 3WV0A 3U2SA 4ZAKC 1TETL 2CLRA 3L7FA 1NCOA 3IFPB 1OGAB 2VLJE 2E7LA 1MAML 1E4XI 1QVOB 1RH8A 1X9UA 2XNAA 4PV8B 4Z7OF 1YEJL 3C2AL 3Q1SH 2QSQA 2HMIC 1PX3A 4ODWA 2F58L 1O9WA 2YD8A 3NK3A 1IAKA 7PAZA 1EO8H 3UBXG 1YY8A 1FIGL 2CO3A 5I75C 4XO9A 2IWEA 3DX9A 3VSUA 2I26N 1DQDH 3GM8A 2ARJQ 1HIML 1ZA6B 3O81A 2KT6A 1W0WB 2C9VA 1DJZA 4QXGL 4R97B 5EO0B 4N2HA 3OKKB 4G8FA 3V0FA 4LASH 5E9DE 1L9PA 1S7UA 4UT7L 1AO7B 1MPAH 3UO1H 1GIGH 3PWLB 2W0KA 1H9VA 2B20A 1H3PL 1I1FB 4ZUVB 1B88A 1GGTA 2B15A 5EN2B 3S5YA 1UM5H 4DKEL 3MJ8A 2L04A 2BIOA 4Z95L 1AD9B 3NEXA 4OD1L 2DICA 4HF5L 2XFGB 4H1LA 4XN5A 1J5HA 3VXMA 1X5GA 3K81A 2C9AA 1G7IB 2YN5A 4EO5A 5F7EH 3I74A 5B3NA 1QBMH 3VXTB 2YMTA 4WGKA 2HX7A 4UUJB 4XO8A 5LAXA 5CD3B 5DJ8A 1XGUB 5I74C 1BEXA 5JXAL 4JKNA 4U0RC 1XF5A 5MEQB 2ED6A 3EZJB 4XP9L 3V5HA 4P23A 2F19H 1K8DA 1RSYA 2GTWA 2WQUA 4KXZI 1I7TB 1E5CA 2Y69B 1Q94A 1NFDA 2UUDH 1MFNA 3PIQA 1UWEL 4Z8FL 3BFQG 3MPCA 2BIQA 1OE1A 3CPLB 5F1IA 2DWDA 2VDPL 2WWKT 4N9GA 3TO2A 5JHMA 5ADPH 1QA9B 3X2QB 3VFWA 2AK4E 5D96B 5JIDA 1U2HA 1D7FA 3IAQA 1KXVA 1NDGB 2Z34A 4RZKA 4CN4A 4DETA 2VB5A 2QMKA 5AZEL 3CZSA 1J9QA 3G6AB 1OSPH 3K0YA 3LEXA 4PAZA 1EEZA 3TT3H 5B7EA 5IQ9B 5IY5B 3O6FB 1ZVHA 4FFYH 3IE9A 1J86A 4LCCC 3IMRA 3QNYB 4OIFA 4TMPA 2NDFA 2OR7A 5ESQA 5HDQL 5H2BB 2NY1D 2I60H 4MNQA 1TQSA 4PJXB 3F7PC 1UADC 2MPVA 2V2XA 3HE7A 4ZUTA 3U7WH 4YSUA 1KBGH 2W59A 1II4E 2NW2B 4IJTA 2APWA 4PD4K 5I71C 4MKMA 3BIKB 3TVMD 5EBMB 5D1QE 4M1GH 2GB2A 2ZKMX 5MERB 2ZUQC 5IG7A 2BVPB 1JPFB 3KWVA 3FOMB 2CGYA 4BQ9A 4JEGB 3SYPA 3W38A 4FHJA 2ZPKL 4JY4B 3WIHL 4ZS6C 2GPZA 2QADD 1AZZC 4LB8A 2MMXA 5I1LA 2DIEA 1D7CA 5DF0A 2NY0D 3ECWA 3FQTB 4UTCA 1RUAL 2BZCA 3EFDH 1ZVYA 4FI6A 5HVGB 1T66C 4F5CA 2ZCLL 1MW3A 1J1OL 4L1BA 1IARB 4MMYB 1XEUA 2GT9B 2WLMA 4R5TA 3TZVD 2J56A 4ELME 3ARQA 3WUWB 3FS9A 4UM8B 2Z7ZA 1RFDL 2XWBB 2OK0L 3P77A 1K6QL 4YDKL 4MA1C 5IEKA 1YNKL 1ZS2A 1OOAA 5BO1L 2J1XA 5FA3B 4FQXB 3ZUCA 1NL0H 2AW2A 1TYJA 2W38A 1FF5A 2EDEA 4DO4A 5KYXB 1YC7A 4L3FA 3I50L 3PREA 5EOCL 3NPSC 5C0IB 1RI8A 2NY5C 1NA8A 4S1QH 1H6TA 2XXGA 4PJ9A 4Y19B 1R0AH 5IOKA 4ZTOL 4GIOA 4HQQL 5CMAB 1Z5HA 1AC0A 1FVDB 2V8MA 5BS0A 4MCMA 3G5WA 1ECYA 5BOZG 1HHIB 2ZAHA 3WMSA 2BS9A 1KEGL 4UMGA 4U3CA 2OTPA 4JFTA 1JV2B 3LEVL 4OLUH 4V1DD 2B1OA 1OF2A 2JXMB 3FCUB 4ODVH 4YXKL 3VRIA 1U8PB 4N2GA 1TZHB 3D1MC 4KUCF 3RWHB 4JFEB 4I7ZC 2NY7L 5AQ0A 1JBJA 2NYYD 2WVVA 4DIXA 4NPKA 1T0NB 1ZT1A 3GMQB 1XF1A 3WE6B 4DAGL 4N28A 43CAA 3G5VB 5I1GL 1CYWA 3STZB 5HHXH 2EVGA 4K07A 1MLBB 3OWRA 4IGBC 4KDTC 4DW2H 4UYPA 5IQ7H 3L3GA 2AZAA 3B1TA 4Z7VB 3NQIA 3V6BR 2VLKA 4NN7B 3DTUB 4WNJA 3QQ9D 5EEZA 3IEAA 5SWQB 1DDTA 3DECA 5EA0L 2X4QA 1NAMH 2FRGP 3C60D 3MRLB 5TF1L 1OAUL 3ABMB 3S3PA 2NY6D 3VGAC 4MA7H 2Q2EB 1VIWA 1NOFA 4U1JA 5DHVH 1J05A 4PMEA 2HJFA 4YHPA 12E8H 2XIDA 3CFBA 4NZTL 5EZJB 3US9A 1IKOP 4FTVA 4Y2OB 3HNTH 2Y0SA 5D1XE 5EBLB 2E4FA 4RAVB 3M6DA 3VDBA 2ADGB 4FFZH 3TCLB 3BZ4A 1IT9H 1N59A 2XZQH 1IU1A 1K72A 1L7TL 1OKEA 2BM3A 3LB6D 4HXBL 1BYNA 1R17A 3MV8B 4CMMB 3PP3K 1N18A 3AXHA 3SGKA 1COBA 2UY7A 3I9GH 4X5LA 1FAKT 3HS0C 2EDOA 4PJCB 2PPAA 4UOW0 4NAMA 3PE9A 1A7QH 5F9OL 1NOAA 2Z0UA 2APVA 2HSIA 2WBKA 3EJUA 4I0PB 1BFVL 4XXCC 3WXVH 5JW4N 3CIQA 2VAJA 4RMBA 1YVLA 3BPLB 1GAFH 3PS6A 4MMZC 4UU9B 5J56B 3BP5B 3OXSA 1F11A 5L2KA 4FG4A 4N5UA 2O5ZH 3UPRB 4E41D 3FRPG 4NQUA 1TQVA 4OZFB 3HS9A 1KB5L 4MNGE 3CFJB 1D9KA 2ICCA 3PRZA 1DVFA 1SHXA 2YMXL 1WPCA 2R1XB 3HN3A 1N3NA 3LH2L 1FZOA 1QTYT 1L6PA 1T0MA 1XQ4A 2AJ3B 3FTGA 2XKNA 4L23A 4B0MB 3WMPA 1M05A 4LF3A 3ULVL 3KYNB 3QS2A 4Z7UE 2E74C 1V3KA 2BCKA 2PO6A 1S7RB 2OMTA 2PPEA 1EAJA 1DCEA 3HMXL 2G9KA 2J8HA 4GP8B 4RRPM 3V8OA 5KZCB 4YL9A 3FO0L 1UOLA 2B4CL 4YHNA 1PSKL 1EUUA 1BG1A 4CMHC 1FO0H 3CZFA 4G2AA 3RTQB 3FF8A 1D6VH 4J1UA 2E7BA 1TCRB 5FUCC 1XGPB 2CR3A 5IVOA 3TNMA 5EZLB 1WAEA 2ZXEB 5ISZB 5EDXA 4JFUA 2XN9E 3CE1A 2XOTA 4L2LA 3ZE2F 4BFOA 1A4JB 2ZYHA 5GS0D 5IMKA 3GIVB 3TJHC 2ZICA 4YZWA 2C4XA 2WGNB 1J9TA 1ET5A 1WFOA 3QDJD 4R3SB 2ZP9A 1FYTB 2Y07H 4UM9D 1T04B 4JVUA 2Q76A 5KVFH 3NIDE 5DRNA 1E2ZA 3MXWH 4XNQB 1GGBH 1SDYA 2CHWA 2OQJB 6TAAA 1AAJA 2X1WL 3Q5TA 4NWTH 5IBTH 3MLTA 4X7DC 3O3AB 4JM2A 4U1MB 3E80A 4GMTH 2IPUK 3J2PA 3IDUA 1LXMA 4JHBA 1OM3H 2X5PA 2LFGA 2HG5A 4YHZH 4N68A 4NC1C 5EUOE 5LCVA 3QK0A 3GSOA 5AEAA 4GQRA 3FT0A 3AAZB 2C4FU 2DQEH 4ZSOA 4LVHC 1AZUA 2CXKA 4U1GC 4U49A 1F45A 2BP0A 4CN6A 5IBUB 4TLTA 1FPTL 1LK2A 1SMOA 2A1WL 3VFOA 1Z9OA 3LD8C 4A2DA 3U48A 3PWPB 3QUGA 3C8HA 2WINA 5EZOH 5C0NC 2X4NB 4PGDB 1EH9A 3CHRA 4AZ8A 5AALA 4D8PA 2CH8A 1JN6B 1SXSA 3FK3A 1T5KA 3LIUA 3ZDZB 4LDCA 2OFQA 1OAZH 2M8XA 3ILQC 3LHPH 4PB0L 1KJ3H 1JDAA 4YMPA 2QGEA 4JMXA 3SKMA 2ZXWB 2VRQA 4XB3A 2R2BB 5JNYA 3HC0B 4ZW7A 1CU4H 1WBYB 4QMEA 3DBSA 2YAHA 3WLBB 2W9DL 3RGVA 3GBLA 3A4FA 2ODIA 1K8IB 3MJ9A 2HVKB 2XN1A 2YGVA 3QIWA 1PZBA 1FNSL 4QI3A 4R9HA 5CP7B 4BWWA 3DO3A 3LYRA 4BA0A 4Y4HD 1MUJB 2FNWA 5FYKE 1BF2A 2CBQA 3TLRA 3BZEA 4F80A 1I4FB 4PHXA 3UG3A 4KO9A 4P2AA 3NCMA 5CWSB 2J2ZB 2C1PA 1HCVA 1BVKB 3Q6FB 1RZQA 1UCTA 3QCUH 2F53D 3GXFA 4N0UE 2CPCA 5IJCC 4MSWB 1V3MA 5I15H 4BZ1L 4LCWD 1VERA 3PWUA 3SE9L 2ICWI 2W9LA 5E4OA 1MZYA 5TPWH 1KCUL 1EXUB 3CPUA 4KGLA 3WUZA 4YHOH 3F7KA 3GMPA 3PL6A 3VI3B 3A24A 1VGEL 1BSIA 1L3NA 3LEYH 4QF1B 5DO2C 2AABH 2CHZA 1XDTT 5D7IE 5IVNA 2ESVA 4FQIL 1MQ8A 5E5MA 4CNIA 3BD3A 1BBDL 1E6OH 4JPIA 1C9SA 2D9QB 2JMRA 5E4IA 3W57A 5I0YA 4TVSa 4FG6D 3MV9A 1WZAA 1UWXK 3RA7H 2AV1B 5AVQB 3BEVB 4Q9RL 5K93A 3C5ZB 1NBYB 4HPYL 3WUWG 3A6OA 4OM1L 1SFHA 2WY3B 3PFQA 2CE6A 4JB9L 4ZS7H 3T2NH 5CINH 4AENA 1U91A 3V79C 2Y22A 4ZOCA 4RZCA 3TV3L 4OCSL 1BGXL 4JPWL 3MX0B 4A55A 1IAMA 3F83A 2EDWA 3LKQB 5D2NC 4HSQA 3BN3B 3DTXA 1KELH 2CPUA 1ZANH 3VCLB 1EAOA 3GRGA 1MCBA 2QGCA 5LBSH 2VERA 4MXWH 1MAJA 2VXQA 2GCYA 2X0VA 2BK8A 4JREB 4PJDE 1KF9B 1FLRL 1KIPA 1HK6A 1I3RB 2B1AH 3PGDA 4NC2B 5DT1H 4X9FA 2BFVL 5GJSH 1OCCB 3HG1D 4X5WB 1CDCA 3RWEB 3SIKA 3FRPA 4YSQA 2R4RL 4PREA 1IRAY 4GIAA 1E7UA 3GBMH 1PGRB 4LRNL 1HZKA 2H2PD 2YOCA 4PBDA 2OYPA 3FB6A 2J88L 1TKWB 4MD5A 2BPBA 1T0OA 4UDUA 4L37A 5GRJL 1IC7H 2DYPD 1HKLH 5DU7A 2ATAA 1A9EA 2CLVA 4G9FD 3L3OB 4IRJA 4ODUA 5GGQH 1U8MB 1S7QB 3II3A 4WKZB 5ERWB 3S8WA 4PRAA 4DH2A 2H2SC 4XAWH 4M6OH 1DQQB 1XGRA 4KITB 2DH3A 4F8OA 4JFZH 3VG9B 3ATEA 4MD0B 4DGWC 5HVHB 3IFPA 1OGAA 4HKBA 3FRUB 4L3EB 4XZUA 4U1SB 4YGVB 1QVOA 4OIAA 4HUWB 4MA3B 4GI9A 4PV8A 2UZIL 3A67H 1CLZL 3QCVL 2WLIA 1M2VB 3GZQA 4B53A 1OSYA 2FQGA 4XP5L 2C5DC 2B39A 2YKLL 1AIZA 2IOIA 3B83A 1PG7X 3OKYA 3LZOA 5FYJD 1ZA6A 1W0WA 5IB3B 1RURL 5T1KB 5HY9A 4P46B 5EO0A 4YFLF 3OKKA 1CGUA 4MHHG 4PM1A 5F0JB 1UA7A 2BOCB 5T3ZL 2J6EL 3PWLA 3LHAA 2HFGL 3DUSB 3SYAA 2VXTL 2BIIA 2XZZA 4ZUVA 1SY6A 3WIFB 3PAUA 5EN2A 1I1AD 3GMNB 1AD9A 3WKQA 1U8KB 3QPXH 1P5UB 1MWOA 4ZMWA 1RY7B 5FCUH 1CD9B 1KCBA 2AQTA 4HW6A 5A2JH 3ULVC 4YLBA 3T0WA 2WXKA 3F7VB 4FNLL 3ZO0A 5JDJA 3VXTA 3ABLB 4G72B 4GSDH 4XO4A 4UUJA 3GI9H 4AK2A 1XGUA 2B4CC 3ARFB 2NPLX 4OTXL 4XVTL 3FF7A 3VMPA 5J0BA 2X38A 3GUTB 5MEQA 4OZFG 5DUPL 5DFVC 4ZW8A 4ACPA 3UTTE 3FT2B 4WO4C 4HC1A 2FBOJ 4X7SH 1D7DA 1F4HA 1I7TA 4W68A 2BMKB 3GI8L 1OPOA 5FIEA 2C1OB 4N8UA 2X4SB 2AC0A 5DC0A 3RB5A 5J3HD 1CDYA 1IBZA 2DM7A 5HDWA 4KJPC 4OV6F 5AWNH 4F1SA 1P6FA 5LUMA 4RVBA 4YGAB 2O5XL 1AGDA 1IJNA 1KN4H 1BIIB 2HYMA 3CPLA 4MNQE 3HZ3A 1ZGLA 4WGVB 4RNRB 2GIMA 1WAAF 1GKEA 5HJDA 4DF9A 5FPIA 2O61B 1CD8A 1HXMB 1QA9A 2JF1A 3QHFH 1NDGA 3ULUF 4E42B 5F72S 4Z7VF 4M1DL 3SZ6A 1I9IH 3OKMB 1VGKA 3JTBA 3BUPA 3G6AA 1L5GB 1U3ZA 5IQ9A 1HJBC 2XRAH 3P0YL 3O6FA 5GIRA 3U9UB 1DQML 3NZHL 2ICEC 2WNWA 5H2BA 3OLEA 1REIA 2C9RA 4GXUM 4P2OB 1W0YT 4EVNB 4NHCH 5B1AB 3VTTA 2KZWA 2UXVA 3HNSH 5L6YL 1XEDA 4PJXA 2BZ7A 3VXRD 1WWCA 4JFQB 5E2TL 5FDYA 1HSBB 4OKVA 1N26A 4ODHH 3QFGA 3UAEA 1NLDH 3HJEA 3BIKA 1T83C 3BUIA 3MLVL 4H0HB 3TEYA 1JCVA 5J1AB 4G3YL 5EBMA 4PRPB 1P4BL 3ZW3A 1BW8A 1RAMA 4Q52A 4CADB 2B1HL 2LABA 3TN0C 2BVPA 1JPFA 4GXVL 5MERA 1LJMA 3AM8A 3FOMA 2GBAA 4LCUB 3HBPA 4JY4A 1C1EH 1ND0A 2XG4B 4ZODA 3NCBB 2WXIA 2E6QA 4PJCF 3SBWC 1F97A 1S7SA 5FCSH 4J2XA 1ILUA 1U3JA 4HLJA 5IBUG 1SM3L 2WXFA 4KI5F 3WY1A 5F93C 4L1HA 4MMYA 3V7MA 3AZUA 1NMAH 1SUHA 2GT9A 4BH7A 4DTGH 1W6LA 3OAUH 4WI0B 3WUWA 5J12B 4UM8A 4X6FB 4JE0A 5BS0E 2X2UA 3ZTNL 2FQDA 5F7DA 4P4KD 1AKJB 3B9KC 2P26A 5FA3A 4FQXA 3Q8FA 5HD8D 4JFOA 2VDMB 1WYJA 1S2EA 4QOKA 5H4YA 5KYXA 3BGFC 3ZTCC 2VN6A 3FTXA 4Y19A 4W9KC 1WF5A 4ZXBD 1QWNA 1G5AA 4Y9CA 4LPWA 4RMSA 4Z7WB 5CMAA 1P4IL 1P6WA 2DWYA 1SVCP 1FVDA 3NJGA 2H9GA 4WI6A 5A3ID 3LKPB 1TSRA 2X1OA 1NGWB 1HHIA 5FUZH 1JV2A 1HAWA 2JXMA 4MKTA 1HL4A 1U8PA 3UJIH 5E24E 1TEYA 4DKAA 4UIKL 4LQFL 4QO1B 2VLKE 1TZHA 3QUZD 2X7LB 5D1ZC 1MWAB 3QQDA 4IBTA 3WEMA 4EDWL 3W5MA 3RWHA 4YOKA 5L9DL 1WEJH 4QHKI 5E9NA 1T0NA 3GMQA 1HHKB 3D12B 3QZWB 2IH1B 4Z18A 4B9PA 4CA4A 2XA8H 2OMNA 4YEFA 1WAAA 3G5VA 2ZJSH 3LXAA 5H35B 1DUYB 4K3DL 3MBEC 4DN3H 5I8CB 1MLBA 3K6DA 2VITB 4FTVE 3U1QA 4KDWA 1U9KA 2NOYA 3BAKA 4Y1AD 1HEZB 2A83B 5SWQA 3OPZH 4XCNB 3QXVA 1HL5A 3MRLA 4JBSA 3P11L 3B6SB 4KOCA 1A6WL 1CK0L 3VWKB 4L4JA 4XOAA 3WSQL 3K8LA 4BWTA 1QKZH 4B3VA 5DS8B 3IDGB 4XC1L 4B9GA 1MFCH 4MD4B 1RLBA 4BCZA 4RX4A 4AYGA 1D5IH 5EZJA 3UZVB 2CDEB 4Y2OA 1O5DT 5L7XL 2AZUA 2VRKA 1N0LB 3OMZA 5EBLA 5I6XC 2PWDA 2NY4B 1KYOJ 2EH7L 2PW1B 2ADGA 5CUSH 2PYEB 3NDYE 4B9KC 1TT6A 4YK4B 5DZAA 5L2KE 1I1RA 3KW7A 3CLEH 5JMOC 1RZGA 1BZDA 3CZLA 2IFGA 3MV8A 3ATAA 4WSGA 3ZDZF 4CMMA 9PCYA 5C08E 1UUNA 3C8DA 2DF3A 4PJBA 4XH2B 4Q6IB 5DMJB 3QQ4B 5MEND 2UUDK 2CD0A 4NERA 3TJPA 4B96A 4PRBB 3VUAA 2GJ6B 3QIUC 4I0PA 4D0CB 3W0WB 5J1TC 1U30A 4FULA 5TDOB 2AQ1A 3P54A 1E27B 3BH4A 4PJ8C 3ZSTA 4TV3A 4F7KA 3UPRA 2C7UB 3QRLA 4OCXL 4OZFA 4Z9KB 1J5OL 1YMHB 3CFJA 2AS5M 2RA1A 3H3PL 1P84K 1RV6X 1NGZB 1UJ3C 2HFTA 3BO8B 2K6WA 3NACL 4KROB 4DK3A 1F4WL 3MXVH 2AJ3A 2WGXA 1ZDSA 2FEDC 3D7PA 1EFXD 3P4NB 4KJWC 1NJ9B 1Y6NR 3GTTA 4UT6L 1XCWA 3KYNA 3UZQA 5BJTB 1XCXA 3MLWL 2WBJD 2BP8A 2QV2A 3DIFB 3UG5A 5I1IL 1D5RA 2FVNA 2A74B 1ORSB 1S7RA 3RDTD 3BMVA 3D39D 1YEKL 1JTOA 2V2WA 1DQTA 4YDJB 4TOYH 3VI3F 1DLFL 2FBJH 2WSKA 5C6PB 3IGAB 1XWVA 2VIRB 3ECUA 4XI5D 1A1OB 1PFOA 2PPDA 2ZXAA 4WWKB 5EZLA 5KBPA 5ISZA 1E4WH 3MVSA 3LS5H 3LSOB 1CXFA 2OL3L 1A4JA 4PVMA 1HU8A 3GIVA 4X5XA 5JHDD 1VFAA 3MKKA 3K7UA 4RSYA 5GGVL 2O6PA 1OZUA 2LU7A 4H40A 4HZLB 4X80L 3U4BL 3ZKNC 4BEIA 3L4UA 3KNBB 4R3SA 4HJ0C 3B9DA 1FYTA 1M71B 2FIKB 2R0ZH 4KKBC 5AW3B 4E9VA 5F9JB 1EVTC 1IMHC 4XNQA 4ZSOE 2OQJA 1H3UA 1A14L 1NPUA 4FMVA 4HZ1A 4R6UA 3VVWA 3ULSB 1GPOH 3O3AA 1BF5A 4KMLB 4U1MA 1L0PA 3KYMB 4QRPB 2Q7YA 2Q86B 3II2A 3I84A 1RERA 1ZDQA 3TL5A 3IWUA 4KRLB 3VO0A 1BD2B 3QPQC 4BA8A 4CILA 5C7XL 1MAMH 4Q0XL 4P2QD 4XAKD 5CSZB 5IJVA 1OZTG 3TV8A 1GYVA 4G8GB 4LSDA 4FA8A 1YEJH 3C2AH 1G7HB 3LY6A 4K0OA 5TQ2L 2CNZA 4GRWB 3AAZA 3DWTA 2F58H 1AS7A 1V3LA 2NZ9D 3ZE1F 5EG6C 4MJIB 4N6QA 3TBVB 1FIGH 1F41A 3Q8BA 4GKOA 3CFEA 1URZA 5ALBL 2DQFA 2PR4L 2NNAB 4HWZB 1HIMH 3PWPA 2OXHB 2B2XL 2CR6A 2QEJA 1K4DB 4NNXB 5GGRY 4QXGH 3U0WL 2EXYC 4TVPE 2X4NA 4PGDA 1E50A 2QDWA 3NJFA 1JN6A 4UT7H 2VABB 4X9GA 4IRSD 1RJYB 4PJHB 1UD6A 3VD9A 1H3PH 5L4FA 4JY6B 5L4MA 2W0LA 1E3ZA 1T80A 4PG2C 3MUGB 4E5XB 4DKEH 4NUPA 4Z95H 2JCCF 4OD1H 2YGOA 3HC0A 4FCHA 4AKPA 1TTFA 4HF5H 3EYUL 4MNHB 4ZAKD 5BV7L 3WLBA 4QXWA 1NCTA 2E7DA 5KJRL 3T65B 4QJ5B 1K8IA 2HVKA 2WJ5A 3MNZA 2UVEA 5CP7A 3ZRFC 4JJHA 4UTBL 5IF0B 4QRQB 1MUJA 5IOPA 3BUQA 3TESA 3ZZSA 2R9HC 5JXAH 3CDFA 3KVQA 5CWSA 3CDGB 2J2ZA 2ESVE 2P5EA 3IPFA 4XP9H 5HSFA 3Q6FA 3BKML 4MSWA 3UCRA 3LKRB 3ZE2E 3F3HA 1O5PA 5I26A 4B9JA 2VSKB 1C5DB 3CC1A 3WFHA 2PP9A 4CRPA 1UWEH 4Z8FH 2YFOA 4TSCL 3ZT5A 1CO1A 2VDOB 3RY4A 5TK2A 4B9FA 1TDQA 3N42F 1TXKA 3TIEB 1QFPA 5KOVC 4E2OA 3VI3A 1IGCL 2VDPH 4LNRB 4QF1A 1B0WA 4FEIA 1KLUA 1F18A 2EILB 5EEWA 4XMKL 5FV2A 3QJVB 2ITFA 4IDLA 4FE9A 2H6UA 4JHZA 3HAEH 2GKIA 2HPOA 3BVXA 1D6EA 3ARWA 1NFIB 5HDQH 2XWJB 2Z0BA 5EBGA 5DA4A 2AV1A 5FM5O 4GQZA 4MB3A 2JJWA 2J57A 3C5ZA 5LWYL 2CRZA 3I3BA 1B3JA 4G80B 1SY6L 5EB9A 4AKQA 4E9YA 1NBCA 2ZYRA 3LQZB 3DX8B 3LKQA 4G7RB 1OY3B 1WT5C 3CTTA 3UPAA 2EEAA 5KJ4A 2BFGA 2WJ7A 3O0LA 1EHXA 3J27A 2YWYA 3WIHH 1AQKL 3F7LA 2VW6A 1XGQB 4KKRA 4DGVL 5MI0B 3W9EB 2ID5A 1WA1X 3NABL 1TMCB 4DEPC 1I3RA 4XOEA 1N6UA 2DB8A 1BQ5A 2VR7A 1RUAH 3BSHA 2VLRD 4X5WA 3RWEA 2NT0A 1N5AB 2NY2B 3HFML 5F96L 1JGUL 4HHGA 2ZCLH 2WKOA 1J1OH 2AEQL 1GA2A 1JWMB 2EADA 2SODB 4TQ8A 3FSZA 3KBEA 1OGAE 1QTPA 2V7HB 2XCMC 2JQZA 4ABUA 1TKWA 3LRGA 3O4LD 1MZZA 5DLML 5E6YA 3R0NA 1RFDH 4JFYB 4R7VA 2OK0H 1NBQA 1K6QH 1L9SA 1ULVA 1YNKH 4WTZG 1J18A 3L3OA 3NEOA 5BO1H 1U8MA 1S7QA 2XXFA 3TA4D 3KVPA 3QZWG 4WKZA 5ERWA 5EZIL 4PD4J 4M3KB 3RIKA 3I50H 5FGBA 1DQQA 5EOCH 4R26L 4ALAL 5LQBL 3TEZA 4MD0A 4YQXL 4I9XA 1B4RA 3FRUA 4FOMA 4ZTOH 4L3EA 2VN5A 4YGVA 3N2JA 1F90L 4HQQH 4HUWA 5DC2A 1JZ5A 4MA3A 1K5NA 4GJTB 4X0NA 4QCIA 1AO7E 4OM0L 2QPDB 1MIEL 1M2VA 4ZS6D 1KEGH 4Z3EA 5LN8A 4YHLL 1AZCA 3DBXB 3LEVH 1R46A 1XMWA 4YXKH 2D03L 2DI7A 2DL9A 1I9EA 1T66D 4I18B 2MNUA 5T1KA 5JQ6L 3EFOB 4Q74A 1NGXB 4RBPH 4AQ1B 2BOCA 2NY7H 1KCKA 1YEEL 2BSDA 5EOQL 1VFOA 5I28A 1HESA 2YQBA 3QYMA 3NSJA 1R5WB 3DUSA 5M7QA 4K5OA 1IFGA 4DAGH 1UEMA 2MPAL 4YIQA 3WIFA 4N2FA 5I1GH 5EOTB 2EDJA 1G5GA 3GMNA 4I1RA 1U8KA 2PLTA 1BX2A 4L9LC 4BFEA 2JKNA 4HUUB 5CJOH 3EJRA 4CSZA 4MCZB 4JFHE 5EA0H 2UY6B 3F7VA 3QS3A 4JL2A 1YN7B 5TF1H 1OAUH 4HMEA 3WLWC 4NO2B 3LN9A 1JZ7A 3BZ5A 1QACA 3H7LA 3POHA 4C59B 4AGMA 3PAYA 4HD9A 4Z78A 1VFMA 3SKNB 1QPKA 3L5HA 4NZTH 1I75A 3FT2A 3VDCA 5AUMA 3WFCL 3BDYL 4PGEA 1AFVL 2B16A 4E9QA 1BFSA 3A5VA 2BMKA 3MLXL 4PTUB 2C1OA 5FM8A 1T89C 2X4SA 1L7TH 4HXBH 2H7WA 3HZKB 2CRMA 5HTSA 2KLTA 2AQNA 4U3SB 1F6FB 1M7XA 4YSRA 3K5RA 3QJTB 4LCYB 2XZAL 3GM0A 3CLWA 4PJXE 5AG9A 1ZT7B 2WQAA 4JY5L 3E2HC 4IGBD 5EU5B 5B7FA 5LHDA 5LAPA 2OCFD 4Z3HA 1LM8V 3E8UL 1CDUA 1KGCE 4MZ2A 3OKMA 1BFVH 4QPEA 4A6YL 3C2SA 1L5GA 3BMWA 3UJTL 3U9UA 5JHLL 2AEWA 3LJ3A 4OCLC 5I76B 2ZWNA 3PWJB 4P2OA 4TXVB 2CSPA 4EVNA 1KB5H 4FXGB 2PTVA 5A16A 2P49B 5E9AA 5F1SA 2DD8L 1EJFA 2YMXH 3HZMB 2FT7A 4JFQA 1X6LA 1HSBA 3LH2H 2DI8A 4POUB 1KBKA 3E6HB 4E9RA 1BZ9B 1KGXA 3N06B 5LGHL 3LS4L 5J1AA 3KCWA 2CK0L 4PRPA 5D72L 3ULVH 5B38B 3LXCA 1X7SA 4HGWB 2MQGA 3ILDA 1SF3A 5AW9B 3PAVA 4BSWB 3HMXH 4W4OA 4LCUA 3B3BA 2NY1B 1IM3D 3FO0H 4OVUA 2B4CH 1PSKH 2ZSVA 2XG4A 4NKDB 4HGKC 2QLVB 2VO5A 4R90L 3CVBA 3IXTA 4W4NA 1QBBA 3M07A 2VR8A 1I8KB 1XH3A 3TVMB 5BV7C 4Y19E 2NMSA 2A4EA 4WI0A 3LPFA 4KU1A 4X6FA 4JRYB 3BRFA 4H8WC 1KTRL 2QADB 3HCVA 4AV0A 2A77L 3IAPA 1AKJA 2CJUL 2NY0B 4F9PA 4RFNC 1XBRA 1P4LA 3KGSA 5L4IA 4E5XG 4GG6B 2EVJA 3BZFB 3VYNA 1U8OA 3MUHL 3ARGA 3SDXA 4L4VD 4GG8B 4Z7WA 4JFEE 4KHTL 5GS2D 5TH2B 4AXWA 5CSBA 4KV5F 1TTRA 3KPOA 4APQB 1NGWA 2CIKB 5DZOA 2D3NA 1C16B 1AZBA 3BLKA 4U1KB 4P99A 5E7FA 4UOQA 4JZJC 1WAAE 1MCWM 2E8ZA 4KDVA 4NT6B 4NN5B 1FPTH 3H0TA 2A1WH 3KLDA 3G5YB 4HAKA 5F7UA 2IVFC 4Z7VE 4QO1A 1DUZA 2X7LA 2P43B 3CHPA 1MWAA 4LEEA 5IESL 5GGUB 3NSXA 1TNNA 3HKZA 2JKJA 4U6YB 3TJHD 2L8AA 4WTZA 4R7LA 4Y8AA 1QEWB 4IS6B 2Z7YA 4HJIA 2IH1A 2XWTB 3QEGL 4PB0H 5ALCL 5H35A 2K7QA 5I8CA 1DQIA 3AWEA 4FLHA 4JCMA 1FFRA 3B8SA 3F7RA 3GXPA 4I4WB 4NKIL 3SB3A 1HNGA 2H1PL 1HEZA 4CC4A 4BZ2L 2W9DH 3P9WB 1NEPA 3B6SA 3CLFL 2M1KA 1FNSH 2WLHA 4HHAB 3VWKA 1IKNA 3S0PA 4FZEL 1A6TB 5DS8A 3IDGA 3O4OC 4U2ZA 5G4MA 3UZVA 2CDEA 1UCBL 3HE6A 4PJCE 4OQ1A 3V4VL 4KH2A 2Y7QB 4IJ3C 4W9FC 4N87A 1MI5A 2CDFB 2PW1A 2IOOA 2PYEA 2EIBA 4KI5E 5C0ND 4OGQC 4BZ1H 3SE9H 3TP4A 4O5LL 3UBGA 1KT2B 3C60B 2PABA 1GJIA 1KCUH 2VDKB 2IAND 2J7LA 2NTFB 4WK4B 3ILQD 4G7YL 4XH2A 1VGEH 4Q6IA 3TO4C 2FIRT 3CVHB 4FQIH 1ZWIB 2J3SA 4RMVA 3T6QC 2GJ6A 3QHZL 2IPKA 1HQ4B 1QEXA 4D0CA 3LNDA 4AT6B 3D4YA 1ACCA 4A7TA 3NN8B 4JO4L 4ALAC 1ZD6A 3QORC 4LARL 3A4AA 2VLMD 5TDOA 2IAMC 1QO3B 8CGTA 1E27A 4OCNC 2C7UA 1EX0A 2OI9C 1IEAB 1PY9A 2EEXA 2HVBA 4PWJA 1YMHA 5DJ0A 4Q9RH 1QHQA 1HN1A 3WNLA 1B2WL 4DO5A 2MTAA 4A2LA 3GRWA 4HPYH 4YLCA 3BO8A 1NGZA 4OM1H 2ZX6A 2FWUA 4JB9H 3MRMB 2IPUG 4V11A 4L4TB 3P4NA 3TV3H 4OCSH 1NJ9A 3HI6L 4Q89A 3DYPA 4JPWH 4FC3E 1T7WA 5ISZE 3IPEA 2FJGB 1ACYL 5BJTA 1PQZB 1WBZB 4G6ML 3DIFA 5AW2B 1DBBH 4NDMB 3LCYA 4HIJB 2A74A 1ORSA 3RFZC 2DQMA 4E41B 4Y2LA 3ZDYB 4EN2A 1YYLH 1AVAA 1UT1A 5T1LD 1DQKA 1FYTE 1BZOA 2F5BL 5E8EB 3RVXC 3S97C 4JKPL 5DO2D 4MB1A 3IGAA 1FLRH 2VIRA 1A1OA 1D3CA 4WWID 2BFVH 3C08L 2WN2A 4ODXB 3B2DC 1FZMB 2R4RH 3MRDB 1SPDA 3VFUB 1RJZB 3QEHB 4LRNH 3GO1L 1J5DA 2J5LB 4HZLA 2J88H 4GFTB 1TTBA 3K3QA 1XV8A 3KNBA 4PVLA 3HUJB 1M71A 2FIKA 5F9JA 3GSNB 1NGYB 1OD7A 3CFCL 4K94C 4TNWK 1DSWA 5GRJH 4BGDA 1O9VA 4F9LA 3VD1A 2WUBL 3A47A 3ASNB 2QR0B 3ULSA 4MZIA 2DPKA 2L7QA 4WGWB 2V3FA 3KYMA 4QRPA 2WTRB 3ILPA 1MEXL 3PWPE 3SOBL 3RL2B 2ZCHL 4UZSA 1P7KA 1ETZB 5CSZA 1BLNB 5IEHB 4G8GA 1BPVA 4FX5A 1SOSA 2UZIH 4ONGL 1CLZH 3QCVH 1T2JA 1G7HA 5IIEA 3QDJB 3ZDZE 1NWPA 4UM9B 3VQ1C 3H4HA 3U0TB 4F15B 4MJIA 4PV9B 4XP5H 3TBVA 5C0FB 3L5WB 3JWOL 2YKLH 3MR9B 3VNZA 5E4EC 4K3HA 2NNAA 5BW7A 4HWZA 4Y4KA 2OXHA 2QKIB 4PLKC 4CSTA 3TBSA 1K4DA 4NNXA 1RURH 5IEKB 3TCTA 5DFTA 5DJYA 4JFPB 4KK6C 5T3ZH 1YNTB 1WQVT 4WU7A 4M7LL 2VABA 2J6EH 2V5TA 1RJYA 3NSDA 4PJHA 2HFGH 3OKEB 4CDGC 2CJTA 2VXTH 4JY6A 3MUGA 2AFNA 3KPSD 4E5XA 5HVFB 2PTUA 2H2SD 1U41A 2LR4A 3VA6A 3SE3C 1GOGA 3KM1A 3T65A 4YHYC 3JWNC 4FNLH 4XPBH 4BK5A 5IF0A 3H2WA 4QRQA 4EF3A 1XR8B 2FJHB 3AACA 4XVTH 4OTXH 3VI3E 4DGIL 1JGEB 5KSBB 3IGLA 3QI9C 4PB9L 5DUPH 3CDGA 1IFRA 1RUQL 3K46A 2EECA 2WXPA 1X5ZA 4HKXB 3EJCA 3EOTL 3GI8H 3LKRA 3CHSA 1LWRA 4Y2DC 1JHTB 5BMFL 2J1KA 2WNXA 4HEPG 5B38G 1QSVA 2O5XH 2VR9A 1MCEA 1MNUL 1YQVL 4LNRA 4YSCA 2PN5A 3BVUA 3IKCA 3G9AB 1ID2A 4FRWA 4M1DH 4AQOA 4U6TA 1Z2KA 5A7EA 2F53B 5ESVB 3PCYA 3MCKB 4FMFA 2ATKB 3DMMC 3ARUA 3P0YH 4LCWB 2DMGA 2Y7MA 4TM9A 1DQMH 3NZHH 3D18B 2ZX7A 5GRWA 1NFIA 2XTJE 2XWJA 3K5SA 3WXWL 4DEWA 3DX6B 4XB8A 3NIGB 4IHBA 1UOKA 5L6YH 3CZEA 3L8QA 1H8LA 5E2TH 5DFVD 2Y2TA 5DQDL 4WO4D 3N44F 2COQA 3QYCA 1MFBL 1SDDB 3MLVH 4G80A 4G3YH 3EH4B 1A65A 1QSED 1E5ZA 1X4ZA 3DX8A 4QRRD 1HCYA 3VXNB 3BD5A 2B1HH 2QT6A 4M7ZC 4GXVH 4PGZA 5C07A 2EDYA 4KJPD 3GSVB 1VCAA 3UX9B 3LPOA 2WLKA 5TF0A 2MSPA 5I1HL 5GGSA 1GC1L 1T22A 1XGQA 3W9EA 3FSWA 2KKQA 2VR3A 4DP6X 5JW4Q 5AAWA 5AB2A 3Q2NA 4NENA 2NR6C 2XACC 2YAFA 4DUWA 5JPNB 3DI3B 3WJLA 1TU2B 1SM3H 2MNWA 4Y9FA 1FH5L 1JWMA 5K9KB 2C34A 2C9XA 4G71B 2NYKA 5LGKA 2ZWLT 1A6UL 4L3EE 4QXTB 4HWNA 4N8PA 3QR1A 3S3JA 3DGGB 4PCSA 1KCRL 3L3KB 2VW7A 3OB0H 5BNXD 3JV4B 2BSEA 5EO1B 3ZTNH 5DMGC 3FQ2A 2XX0A 4GKNA 4FA6A 4JG0L 4MJ5B 2CUIA 5SX4I 4JVPA 4K8RL 4I87A 4N8VB 3HG1B 4KKLC 1N70A 5DD1L 1WZKA 2FX8L 3FQXB 2VZUA 5KSVB 3TN0D 1KTDB 5GRVK 1P4IH 4IKIA 5KVDL 2Y23A 1RZPA 1AMXA 2OYLA 4MJ6B 2GSMB 2WV3A 4NZRL 3NJVA 4HIQA 1PKOA 2DYPB 4KVPA 3DBXA 5BRQA 3ROOB 1U8HB 5F9WC 1X5XA 2CJSA 1JERA 4I18A 4UIKH 4LQFH 3GSUB 3HB3C 4KK8C 1QSFA 3CDYA 2IMNA 4DGYH 1GVIA 3EFOA 2CO4A 3HMWL 4U4IA 1NGXA 4EDWH 4AQ1A 3GSXB 4XMWA 5L9DH 5D5MF 4KXAA 4NLAA 3LIZL 3Q9PA 4KJYB 1R5WA 5C0GB 4C57C 3TURA 2LU5A 4ESKA 1QI4A 1RVFL 4HFWB 3R8QA 5EOTA 4L8CB 4K3DH 3B9KD 5AKRA 1YO4A 2GY5A 4K9EL 2B0SL 2XPZA 4BFRA 3Q9QA 2QQNL 2Z31C 1BMGA 1GH7A 4DK5A 4LDEB 4WZ9A 3K2KA 4CDHA 3F7YB 4HUUA 4MCZA 4HPHA 2UY6A 1YMMD 2ETWA 3P11H 1YN7A 3V9CA 1NAMB 3BAJA 1TSHA 3A6CL 1E2WA 1A6WH 4NO2A 2R23A 3WSQH 2FE0A 4XC1H 5B7MA 4QRAA 4EZLA 3SKNA 5DHVB 4HWBL 2X05A 5TFSL 3GNML 4PI2A 5L7XH 3N6YA 5BVJB 5EIVA 5LG1A 1W91A 4TRPL 3IJEB 2EH7H 1R5IA 2UV3A 3VFMB 2IBBA 1G9MH 4UNVA 4PTUA 2VR5A 2Z4TA 1AG0A 2GJZB 3FFCD 3QWRA 4QRBA 4Y16B 3HZKA 4HLZG 3L95B 4P07A 4U3SA 2FH8A 2GHZA 2KC0A 4LCYA 1YRKA 4Z7QB 4ZMXA 5FECA 3MBED 5EU5A 1MRFL 4GKLA 4QDGA 1UH3A 4R84A 1RIVL 1AIFB 3IJYA 4PRPE 2AJYL 2NUPB 2ZNWA 3D3VD 4AYID 2IPTL 5AOIA 5JDSA 1JNJA 2YD1A 4AL8L 4F20A 5CFHA 2PUQT 2VE6A 3ABZA 3STLA 3ZZ1A 4OCXH 4LSRL 1J5OH 4FXGA 3KBFA 1V55B 3H3PH 3IB4A 5HHOB 3N9GL 3HZMA 4WENB 5MP6L 4HLEA 4NUQA 3NACH 4KPHL 3JWOC 1F4WH 3E6HA 1BZ9A 1WHPA 2DQDL 4ACTA 4APXB 1YY9C 4UT6H 3BUYB 4WHYH 3VXSD 3IFLL 4HEPA 3MO1B 5B38A 3MLWH 3NJIA 2HH0L 3B9VA 2EVHA 4HGWA 1N2RB 2X53A 3GDBA 3BUTA 4PV1C 4F7CB 2YD6A 5I1IH 2Q7NA 5IK3B 3S98A 2X9ZA 4BKSC 1YEKH 2E4TA 4LRIA 3REVB 1V8HA 5AYUL 4NKDA 4I9WE 1DLFH 3BZDA 3VXRB 1FO0B 1YUKB 4PP2B 3QIUD 4J3SA 5DJ6B 3IDYC 1VPOL 3TVMA 3LQMA 2NUTA 4PG9B 2WVSA 5GGVH 4PJ8D 4X80H 1FHNA 5GRUL 3IDXL 3U4BH 4Z7WE 2ZOLA 3WCYA 2YSTA 1WO2A 1QI3A 3DSNB 2B9BA 2XVBA 5DD0L 3FQ4A 1A14H 3QDMD 1P84J 3FL7A 4N1HB 2X41A 1ZY9A 2FEDD 3K6NA 4KJWD 1FZKB 2UZYB 4GG6A 4RAHA 3BZFA 4FXTA 2VM4A 4NFBA 4QKTA 5DS2A 5C7XH 4Q0XH 1DSYA 1SMAA 4GG8A 3PP4L 5E2VL 3TZVA 1TVBB 2DTSA 2L0DA 3MI6A 5TQ2H 3ZDYF 1TJXA 4A7GA 2HTLC 4APQA 4F2EA 2CIKA 1FUNA 3UIZA 1C16A 4U1KA 3LRKA 3QZLA 3LDBB 1DVXA 4NT6A 3CUPA 3VXUB 5FHAL 1OWWA 3L54A 5ALBH 1JHKL 4ATTA 2PR4H 4CKQA 5FOBB 1DL7L 2MNJB 2B2XH 4KO6A 2HKAA 3U0WH 4G5ZH 4WJG3 5ID0B 5ETUA 2XIIA 5GGUA 4AGQA 1ERNA 4ZXBB 3Q48A 4U6YA 1EANA 3ZKND 3EGXB 3UFIA 5JPMA 3D51A 1G7PB 4HJ0D 1SYVB 5FGRA 3KPNB 3PFUA 4KKBD 3HUJF 4NUMA 1T2XA 5FO9B 3AY4C 1E4KA 1KG0B 2BW5A 2VUOA 2XWTA 4BUHA 1J9RA 4LHQB 5EUKB 5HDLA 3DGCR 3N91A 4V1DA 5C0JB 4RBPK 5JUEL 4PJIB 3B9EA 1F8TL 5FC9A 2B5IC 3EYUH 4I4WA 5BQDA 4R5VA 4ECNA 1XZ0B 3FQNB 1R19A 2CZNA 5D2LF 3MTRA 5ANMB 5BV7H 3QPQD 3QUZB 2PYEE 5ITFB 5K9JL 1GCFA 5KJRH 43C9B 2KBGA 3P3SA 4HHAA 4YSSA 2DTML 2YA0A 2VO8A 1GC1C 2AEIT 4UTBH 1A6TA 2VDLL 1EEQA 2R1WA 1Z0NA 4PSPA 3CSPA 5DEGB 3UAFA 2Y7QA 3NFNB 2HJKB 4QRUB 1Q38A 2GJ6E 3BKMH 3P4MB 2CDFA 4TNVF 3W0WE 1U8QB 3S35X 3C09B 2EXYD 5I1AB 1E5AA 2B8OT 2V2TB 2EC8A 2EE6A 1KT2A 4TSCH 3C60A 5CJXA 2ZOOA 3PV7A 1IGTA 4PGCB 2NTFA 1LDPL 3QEUB 1IGCH 4IBZA 1B9KA 4EAEA 5AYTA 1VKXB 3CVHA 1VA9A 3D05A 5FYKU 5L0QC 1ZWIA 4P3WA 4XMKH 4DQAA 4K8RC 1HQ4A 1V10A 4S10A 1Y1DA 4JPSA 4AT6A 2DM2A 3NN8A 2COVD 5J11C 2WYHA 4MXVE 1QO3A 1NANI 2JTDA 3BLBA 1A6ZB 1BHGA 1R3KB 2A6IA 4HSCX 1IEAA 3LZFL 4PY8I 4LHJB 4KV5E 2JNZA 3PABB 1J0YA 5DI8B 4FGMA 2R9HD 1PYWB 3ENEA 2CAKA 5HI3C 3MRMA 5MENB 4HUNB 1HSAB 4TN9A 1C08A 1SY6H 4TTDC 4L4TA 4JHAL 4OZGF 3B34A 1Z9LA 2FJGA 4EMZA 1G4RA 1PQZA 1WBZA 2FTAA 4N8VG 4NDMA 4HIJA 1CLOL 2V9QA 4MS6A 4FQJL 5ID1B 1BCIA 4E41A 4PW3A 1AQKH 5E8EA 4G8EA 4DGVH 4XPHL 5DHEA 5IWLC 3CDZB 1Q9KB 3NABH 3KDPB 4L5FE 3CFIC 1JGDB 4K9EC 4OQTL 4OF0A 3DIDA 4AJ0A 3AUVA 2IH8A 3SQOL 4ODXA 3HFMH 1EFXB 1FZMA 4QRPE 1JGUH 4WV1B 5F96H 1RJZA 3QEHA 1QFUL 3VFUA 2AEQH 5G4NA 4BIKA 4MQ7A 5I16A 3DXAD 1E30A 1BD2E 5CJBA 5ANHA 5HHVL 3H4FA 3BN9C 2EYTB 5GJTL 4G8GE 5DUJA 3HUJA 3PPEA 3D39B 3GSNA 1NGYA 3WN5B 1TQUA 1T03L 4HJGA 1CF1A 2VZVA 2VDOL 5FA4B 1HTYA 4MJIE 4DK6A 2QR0A 1I53A 4UT9L 1YQ2A 1ILSA 1BIHA 3Q2CA 4ZD3L 5EZIH 3SPIA 3PXHA 1IE4A 4ZNCD 2WTRA 4R26H 4M00A 4ALAH 1JNHA 4YQXH 5I18L 1ETZA 5JHDB 5JOPD 1BLNA 1F90H 4BZYA 1YAIA 2JH2A 4OGZA 5B1JA 4I1NB 1W8EA 3D07A 1B2YA 2E0PA 3QDJA 2AQQA 4PJHE 4OM0H 2QVMA 4EI5C 1MIEH 3TF7C 4UM9A 5JIMA 1A4AA 3U0TA 3LZRA 1KGUA 4PV9A 4YHLH 5C0FA 3OXRB 3OC8A 4K7PX 4ZFQA 3MR9A 1E9OA 2D03H 2WBWB 3K80A 3S96B 2Z92A 1JXFA 1MELA 5JQ6H 3FZUC 4UQDA 1AGFA 3SE4C 5IFHL 2UXGA 2LLGA 1OT2A 4JFPA 5B22A 4AL8C 3KLAB 1YEEH 1YNTA 1WWWX 2A4CA 4J3OH 5EOQH 4WI2A 2AQ3A 3OKEA 2CR0A 2MPAH 4LGPB 1B6UA 4GUCA 4HUKB 1AANA 2D3LA 2F08A 1QOKA 5AVXB 3F05A 1VADB 2EKJA 1VF5C 2OJEB 1EEUA 3TTYA 2YQ3A 3ARRA 3X14B 2CHDA 4HJ1A 4PCYA 3V0IA 4WFED 2Z1KA 1IAII 5BZDB 4WRLA 4QR7A 5DGQA 2A6DB 5IJKA 1MF2L 3BQUC 4IRSB 3R7QA 1A7PL 2D0HA 1OF0A 2KYIA 2VMJA 3JWDL 3P2DA 2YN3A 3SCMC 1XR8A 3NA9L 4AYDC 4JHUA 4NRYA 4AGLA 5KSBA 1E3FA 4XN9A 2ED7A 4WJ5A 4FNUA 3RY5A 3WFCH 3VXOA 1Z3RA 3BDYH 3U79A 1AFVH 4HKXA 4UBDC 3PUCA 3QJZA 3I2CL 4ZAKB 3EYQC 3FXIC 1RZIB 4O02A 1TZAA 1JHTA 1ZCRA 4NQCD 2AJXL 4XBMA 5DUML 1SEQH 2D73A 3QNXA 4W9JC 2XZAH 4JQXC 4D9LL 1FI8C 2XWRA 3FQ1A 4JY5H 5I75B 1PX8A 3JYCA 1UYWL 4KWUA 3GBNL 4RDQF 4A6YH 1MJUL 1RJLB 3QFJD 3UROR 1Q0YL 2F53A 3AXLB 2FUQA 2PNDA 2Q20A 3MCKA 5ESVA 2WXQA 4BXSV 4ZUSB 5A2BA 1FV1B 3GMOB 3UJTH 2VH5L 4LCWA 5BUAA 4QWWC 3AU0A 3D18A 4FFYA 4PTTB 3PY9A 1BMZA 3WLWD 4UINL 3DX6A 5D7SL 3OJDB 4IU2A 1NQBA 2DD8H 1JDDA 3SD2A 3TBBA 1EXHA 3W11C 3DNKA 3MYJB 4OGYL 4Y2NA 1AXIB 2HCZX 2HLFC 5LGHH 1SBSL 3LS4H 5EEYA 3L3IB 3C5JB 2CK0H 4EI6B 5D72H 4X4KA 1FNGB 5HJ3B 4NC0B 4G8IA 1ML0A 2BHYA 4A1RA 3JWNH 1XGZA 3GSVA 3D06A 1NDMB 3RZCC 1MHPL 2ERJC 3W37A 1INDL 1SLVA 5AVUB 1ZTXL 5I74B 3T8MA 4DPRA 2E75C 4R90H 4JPQA 2C3VB 3W9DB 3RJQB 5JPNA 4XMLL 4W6XB 2D7OA 3LXBA 4KTYA 2X1XR 5B39B 1TU2A 1WFJA 2F54D 3LNFA 5CEYB 5K9KA 1TPXC 4QXTA 1UENA 4J39A 3DGGA 5B1KA 3L3KA 4KKNA 1E5UI 4GQ9H 1HE8A 5F70A 5EO1A 2A77H 2D4DA 2GK0A 2ZOTA 3ALWA 4HUXA 3BAIA 3SDYL 2CJUH 4D9QE 4MJ5A 1W0VA 5MHSD 4N2OA 4K7FB 3H9SD 2VLRB 3HG1A 2P52A 3V0VB 4G1EB 1DDHB 3FQXA 3OWEA 3POCA 4GT0A 5BZWB 4LMQE 5KSVA 1EAQA 1KTDA 4XBGB 3MOAL 4NWUL 4KHTH 4LCCB 3O4LB 5LGYA 4XMVA 4MJ6A 4GFXA 4YO0A 4WQOA 2DYPA 3D08A 4G9FA 4UF7C 1L0QA 1KXQA 4KFZC 1T5WB 1U8HA 3BPOB 4FFTA 3KXFB 1MDAA 4B60A 5I71B 4HP5A 1NCBL 5D6DC 3V0DA 2DLTA 3GSUA 5IESH 3L3HB 3ECVA 5DRWB 2Y6TE 3GSXA 1R24B 3GKZA 3KEHA 3UZEC 3DHMA 4U1LB 4XC3L 4KJYA 2CLZB 3GIZL 3QEGH 4HFWA 5ALCH 4J3WA 3VE0A 1A1MB 4X8JB 1R6VA 2DQCL 4GLRI 1E9PB 4BCXA 1WE5A 4ZI8A 2YD7A 1ROWA 2H26B 4BFBD 4DP0X 4YXLL 4NKIH 3BYYA 2H1PH 1Y7VA 2EICA 3F7YA 3IMVA 4FZ8L 4BZ2H 2ZXBA 4DP1X 3HBGA 2DI9A 3ES6A 4HMDA 4S0HA 4JCWA 4JN1L 4JLRB 1ZOXA 4XN1A 5SX5H 5B8CC 3CLFH 1IAOB 2C3XA 4U1NA 5EU7E 3VD0A 2KI6A 3G9VA 4M6ML 3BVWA 1PNDA 1G7QB 4FZEH 5BOPA 2XYCA 3IMBA 1J8KA 4MA1B 1BPLB 5DHVA 2E86A 1I1AA 3V4VH 2E6PA 5BVJA 4GY4A 5DSCB 5I1CL 5ICXB 3IJEA 4JGMA 1UXLA 3NPSB 1A8ZA 4Y5XC 3VFMA 4LK4A 4BELD 4X42A 1H9DA 3EGSB 3L7EB 4NZDA 4XCFL 5E1IA 5F21B 2GJZA 4O5LH 4PJEB 2CG9X 3EYSL 3BH8B 4HKZB 2JSFA 1CGSL 3L95A 1CXIA 4X9IA 4AMXA 5FM4A 2R69A 4G7YH 4OB5L 2Z35B 1SJHB 3NBNA 5INCB 1CXKA 1GZHA 4XODA 3WMQA 4WUUD 4DPBX 4K23L 3GBEA 2YEZB 3HG4A 1MG2C 3QHZH 2YUVA 4PJIF 4OFQA 3A22A 3MDJA 1QLRB 1AIFA 3TS8A 2NUPA 1ETA1 4JO4H 4LARH 2PTTB 1CT8B 4R7XA 3MRHB 3REWB 2O6EA 3ZGIA 1XF2B 2XJKA 2HLEB 2BNQD 4BRVA 4JQVC 3WHE0 4NO0D 5E2WL 1ZLVK 1CMOA 3QNZB 1B2WH 2FX7L 4J28A 1IKFL 4NKQB 3HI5L 1LP9B 3WJJA 1BREA 3ZE0B 2ISDA 4IGBB 3QBTB 3QW9A 4APXA 4ADGA 3HI6H 3MO1A 4GW1B 1ACYH 3ZR6A 1UT9A 3LNEA 4G6MH 2HFEB 4K71C 2GW5A 1N2RA 4F7CA 2D0GA 1DSFL 5IK3A 3WEAA 5D5ME 3REVA 2F5BH 3VGAB 4JRYE 1YYML 4JKPH 5DJ2B 5E0QA 3TO4D 5I0ZA 1BVLB 3GLAA 1O6SB 1FO0A 1VAHA 3TA3C 3VXRA 1TF4A 3C08H 1RXLA 2G0LA 5DJ6A 2JKWA 1AD0B 2R0KL 2VKWA 2VLLA 5K9QI 1OL0A 3BCDA 3S34L 3QORD 4PG9A 3GO1H 4N0FB 3VB9A 2IAMD 4GG6E 3INOA 3RAJL 2QZ5A 1Y07A 3CFCH 3VM5A 4U1IB 2A9ML 3DSNA 1IM3B 2WB7A 3JWDC 5ACMA 3SBPA 2VDKL 4LPYA 2WUBH 3BGAA 1ETB1 1MCOL 1E7VA 3BUDA 5BRZD 3UBXI 1FZKA 5CN1A 2UZYA 1MEXH 5CLYA 3SOBH 4D94A 3OB0K 2ZCHH 5C09D 3MODL 4MMZB 3Q05A 2UWEF 3EGDB 5HGDB 4ZX4A 3OX8B 4UQCA 1TVBA 4XPAL 4ONGH 3K2UL 3RVXD 1BM3H 1C5CL 4YE0A 3JWOH 4LSPL 2GJPA 4LAQL 4P4KA 1KY6A 5T1JA 4U05A 4NZFA 5FOBA 2QVKA 5J06A 2DWXA 3W81A 4N1CA 4GRLC 3BFWA 3HLAB 2C3WA 4ANVA 4ZXBA 5DYFA 3AMLA 4P5RA 3EGXA 4NXKA 4M7LH 1SYVA 1H8SA 3KPNA 1UOVA 2KPNA 3V5KB 5FFLA 2DQIL 5FO9A 4BFNA 3T0EC 2YD9A 3M1OA 2YARA 1KG0A 1F86A 1PKQB 3V52L 1Z3GL 4CMHB 4S1SL 5EUKA 3FONB 5C0JA 2D7TL 3BIBX 5HDBB 4NQSB 1OCRB 3QO1B 4PJIA 4N2IA 3OV6A 1SXCA 2G3XA 5JZ7C 1L9OA 2EKSB 1XZ0A 3FQNA 4L48A 4XX5A 5ANMA 3QUZA 1CIUA 4NBYB 5C0CD 5ITFA 2W80C 43C9A 2C9SA 5LKNA 5I8EB 4RISL 1AR2A 3CIAA 4IW4C 1U42A 1JS4A 2FAUA 4DGIH 3DVNB 2MIZA 5AD0B 3QG6B 4PB9H 4PBWD 5DEGA 1RUQH 4C56D 1I8AA 1PF3A 3NFNA 1IC5L 3NA4A 3RUGB 2HJKA 2R7EB 4M48L 4QRUA 1PG7L 5KW9L 2YS4A 1B3IA 3BKYL 4PLKD 1U8QA 5I1AA 4Y1AA 3SBRA 1IV8A 2V2TA 2CA4A 5BMFH 4KK6D 1BVNP 4AUYA 2BSBA 1L9RA 4PGCA 3RHWK 5GS0L 1IILE 1MNUH 1ZA3B 5ADOL 3U46A 1YQVH 4LVHB 2VDPB 4MX7B 4FI7A 1VKXA 3FUNA 3CN2A 3RWDB 2X89A 3BKCL 4WEBL 5E1AB 1M42A 1A2YB 4FI8A 5CCJA 4CU8A 2IGLA 1J11A 3LD8B 4L4TE 1KYUA 2X28A 2X2IA 3EH2A 3HAEB 1E65A 1JVKA 5B39G 1A6ZA 1R3KA 3WXWH 5I1KL 4E41E 3ZDYE 1PVHA 2IANB 3RLSA 1NIAA 3PABA 5DI8A 2BWDA 4AQ8A 1AS6A 4Y1SA 3NCYP 4NJAL 4K15A 3QI9D 1PYWA 4U33A 1G0YR 2H32B 2K9FB 2W65B 4M8RA 5DQDH 1Y6KR 4BINA 5MENA 1HSAA 3MAWA 1MFBH 4A04A 1I9RL 4L8DB 2GTZA 2WD0A 1PZUB 1AC6A 3D2TA 4Y2DD 2XXMB 2ZOWA 4EBQL 2DMKA 3F00A 3K4ZA 5D4IA 3UGEA 4P59H 3GYRA 4L3AA 1TYEB 2H8PB 3A23A 4WY7L 5T3XL 5I1HH 1GC1H 3HUJE 5LBSA 4HJUA 4HK0B 3NJMA 2A9CA 3CDZA 3RWJB 3MLZL 1WAPA 1T3FB 4F3FB 4F24A 4P06A 1JGDA 3S8GB 4FS0A 2DIAA 2Y36L 3CFNA 3N1MC 3T2PA 1MVUB 4R4FL 3U1SL 4AJYV 4B6ZA 3VU2A 4WFGD 1EFXA 2XVLA 4I0CC 4WV1A 3T09A 3FPXA 4RMRA 3E9TA 3DMMD 3VAEA 2ZUSA 5DGRA 4NQVB 5DK2B 2A6JB 1KCRH 3RDTA 4O02L 3D39A 2YIHA 3OMNB 3OHMB 3C75A 3QDJE 5T1LB 1GKOA 3L6FA 5C6WH 3RZWA 1CR9L 1PEZA 2J71A