1TJXA

Crystallographic identification of ca2+ coordination sites in synaptotagmin i c2b domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
156
structure length
156
Chain Sequence
b'SGGGGGILEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords similar to synaptotagminI/p65
publication title Crystallographic identification of Ca2+ and Sr2+ coordination sites in synaptotagmin I C2B domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 31
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1tjxA00
4DK5A 3L08A 1E8YA 2K45A 3DPDA 2WXIA 1DJYA 4WEEA 4A55A 4J6IA 4F1SA 3HN8A 1GMIA 2RD0A 4EZKA 1TJXA 4NP9A 3IBEA 4MJJA 3PREA 4ANVA 3TWYA 2NQ3A 3B7YA 2WXJA 1E90A 5T8IA 4PS3A 1QASA 4AJWA 1DJIA 4LCVA 1UOWA 2D8KA 4NPJA 2LHAA 2QZ5A 3FBKA 5JHAA 2BWQA 2Z0UA 3M7FB 3KWTA 1UOVA 4QAMB 2CJTA 4TUUA 4WWNA 2QZQA 2WXHA 2ISDA 3PS6A 1E7VA 4FLHA 5CCJA 2KI6A 5EDSA 4TV3A 5CCHE 3PRZA 2EP6A 4BGDA 1HE8A 3TJPA 4GNKB 4DNLA 1BYNA 3ML8A 4QJ5B 4XZ4A 3NZSA 4ANWA 2V4LA 3IM1A 2FK9A 2WXMA 3L17A 4V11A 3ZW3A 3QARA 3QAQA 4KITB 3R7QA 3P2BA 3W57A 3F05A 1E8WA 2NCEA 3L13A 1DJGA 1V27A 3L16A 3MJWA 1DJXA 3DBSA 4QJ4B 3KWUA 2WXKA 2JQZA 4FHKA 2K3HA 2ENPA 2WXGA 2Q3XA 2CHZA 3HHMA 3F00A 5KJ7E 3L54A 1QATA 1E8XA 4L2YA 4L23A 4EZJA 3QR1A 2YOAA 3APFA 2DMHA 4ICWA 3NZUA 4GB9A 3RPBA 4FJYA 4TS6A 4WAFA 5H4ZA 3HIZA 4PS8A 2A5UA 4FHJA 4PS7A 4OVUA 1UGKA 2CHXA 4WWPA 3T8MA 4FULA 4KZCA 2CHWA 4EZLA 1DJWA 1DJZA 5G55A 4HLEA 1BDYA 1CJYA 3TL5A 2Q0ZX 4NS0A 2WXLA 3OHMB 1E7UA 1W15A 1DJHA 4ICXA 4F91B 1WFMA 2CHDA 2B3RA 4Y1SA 3W56A 1DQVA 5H4YA 3NSJA 3FDWA 2CJSA 4KZ0A 2Y3AA 4JPSA 3F04A 1W16A 3QK0A 3LJ3A 2N1TE 4OVVA 1TJMA 4LDCA 2X38A 4NPKA 3APCA 3PYCA 3QJZA 1WFJA 3APDA 3JZYA 4XE0A 2NSQA 2CM5A 3ML9A 4HVBA 4QJ3B 1E8ZA 2CM6A 4FADA 4FA6A 3RDJA 5JHBA 3ZIMA 4IQHA 3ENEA 4AOFA 4IHBA 2A4ZA 4BFRA 2ZKMX 2ENJA 4Y1TA 4L1LA 4LT7A 3R7RA 3ZVVA 4F92B 2K4AA 3S2AA 3CSTA 2WXOA 2FJUB 4XX5A 4FJZA 4WWOA 4G11A 4URKA 2WXRA 3CSFA 2K8MA 3PFQA 1A25A 1RLWA 2UZPA 3N5AA 4L1BA 1RH8A 2WXQA 1K5WA 4F93B 2DMGA 2ENQA 5G2NA 1RSYA 1YRKA 3L4CA 4ANUA 1BCIA 1DSYA 2R83A 3OAWA 3L9BA 3GPEA 3QR0A 4ANXA 2YRBA 5CCGE 2WXPA 2WXFA 3F01A 3SD5A 2WXNA
chains in the Genus database with same CATH superfamily
2K70A 2Y69B 1G9EA 5GGTL 4AVKA 4K94L 2WXIA 4OUUB 3FTVA 3G6DL 2XTLA 4QRRA 2OTUB 5EU5B 4X83A 4M9PA 1KIPA 3TBWB 4X6DB 1A6VH 1PLGH 1CL7I 1XB6A 1QLRA 2VXQH 1MEXL 4OCXL 3LVEA 5FYJH 4XNDA 4YWGL 1T6WA 5LNEA 5MEOB 1DBAL 1JL8A 1LDPH 3WJMB 2K6ZA 4RRPG 1S9WB 2JCWA 3B83A 2I60L 5MENE 4JRLA 1WZ1L 1OPGH 2R2HB 4J6RH 1IGYB 4PTTA 3IE4A 1W8NA 1IJ9A 4C56B 1J8KA 1EAQA 4KC3B 1P7KB 2XWCA 4GH7B 4KKZA 2D3JA 4ABWA 4HH9A 5GRUH 5J6GA 3DSFH 1QVOA 4WY7H 4N90E 5I1GH 3TEWA 1UGNA 1DSFL 3D0LA 3WV0A 5E00B 1R1CA 4LIQE 4YHLH 1ZTXL 4A7SA 1EO8H 3MRIA 2V5SA 3BKJL 3DX7A 4JRXB 4KKCC 5T33H 2JQZA 1GGUA 4XPTL 2FJGB 3G9AB 3MRLA 4GRLC 5E5MB 1MQKH 1CE6A 1D6EA 3QHTC 4FMFA 1BQHB 5E6ZA 4JCLA 4HFWA 4ELMF 1HTYA 1GS7A 2IWFA 1YLBB 4IU2B 1DEEA 3HC2A 1KCUL 3ZKXB 1XO8A 3P3TA 2VQUA 5HYQB 5LAPA 4XBPB 3HUJA 5TE6H 1LEIA 2XN1A 4RDBA 3UJIH 4G5ZH 3AUWB 2X4TB 3WN5B 4A66A 4ENZA 1OW0A 2EILB 1YEIH 3K0WA 3KLAB 1NMAH 2Y7QA 4OCLC 1N4XL 5DQJB 4B96A 4BJLA 1SN5A 5DZ9A 2C4FT 2DQFB 4ODWA 2F1EA 3QG6A 3NIDF 4U3SB 3QUXB 3FDWA 1X9RA 3BZ4B 4LPTA 4R0LA 3X14B 4WTWA 1KLGB 1DBMH 1KGWA 4H88H 4OLYL 2Q20A 1BQUA 4GKSB 3MAWA 3MBED 4Y5VC 1SHMA 3I3DA 3DO7A 5D8JH 5KAQF 1CURA 3IXTB 2VLJD 5ICXB 1WC7B 2G2RB 3D85B 5IEKA 4Z0BH 2WJ7A 3VXTB 1ZT1B 2GC7C 4MD5A 1Z0MA 1G7IA 4NC0B 2NY0D 3ATAA 3EFFA 4PGBB 1A25A 1FCCA 2GVYA 2Y7NA 4Y1AB 1GIGL 3AB0C 3OAYK 3AY4A 4QTIH 4RRPM 4HS6A 3STZB 4DVRL 5TJWK 3OR6A 4FQHA 5M95B 3WAJA 4QOKA 1ZJAA 4LCUB 3B8YA 3MODL 4WTZG 4H5SA 3IDNA 2GTQA 4PJHA 3TBSB 3T0AA 3PP3H 3VU2A 4MD4B 1INEH 4S2SB 1NUNB 2IPUK 3FMGL 4U6XA 1KEMH 4TLTA 4V2BA 3N1FC 1KJMA 1OT1A 4HXAL 1FRGL 1SF5A 4N1EA 5HHOB 2Y5TB 3P3RA 3FN0H 1QBAA 5CN2A 4MMZA 4ZDHA 3FOMB 2PTUA 2Y1VA 5HYSB 4M7KH 2ZPKL 2G4GA 1TYJA 2HKAA 2Y1ZA 3Q6FB 4ENEC 4LEBA 5DA4A 5F93C 1MCIA 5JTWA 2EDMA 2SEBB 5HHPB 4QHNA 3ILPB 1RZ7H 5EOCL 1ZWIB 5F0JB 1SPDA 2KT6A 2ZX7A 3EGDA 4ONHB 1A3QA 1O6TA 4MB5A 4JEGB 3IS0X 1JVKA 1QHQA 3T5WA 3KPMA 4QRPB 3MSPA 1E4WL 3P4NB 1HSBA 4HWBH 3W0WA 1YMME 4DQOL 3KE0A 5F7BA 2JB5L 4R7NB 4X5XA 4PWHA 4NO5A 3TBYA 1ES0A 3DHPA 1ZVYA 1ZHLA 4CVZA 5FWQA 3UCRA 4AYFA 1BZOA 3ZDYF 3V0WH 2MHAB 4PB0H 3O6FD 1LE5B 4AEHL 3UL4A 4BV1A 1E9QA 3NJFA 1P2CA 1SLXA 2AQ1A 4G6MH 1JF5A 4L5FH 4QRRE 1JGVH 5CS7A 1RZPA 4Z7OF 5L6YL 3GXIA 1A7NH 4UV7H 3ZZSA 4MCZB 4Z7UF 5F72S 2OCJA 5FWRA 3BPLC 5AAWC 1OSPH 4MXQC 4AEIL 3O3AB 4AM0B 4ELMB 2Y0SA 4HDIB 4L3EE 2E5EA 3OB0H 4Z7QE 4GO9A 3DSNA 3JT0A 2QGDA 3KYKH 4V33A 2VXSL 2N7SA 2EVGA 4NQUA 4LB8A 4RA3A 4AOFA 5HDBB 1RFDL 2V9UA 2Q8BL 1J9TA 4QYOB 1GPOL 2P8PB 3O9WD 4LQFL 2OSWA 4AZ8A 1N5AA 4XCEA 5GZNA 3UJJL 3RFZB 4CVXA 3NIDB 2P1YA 2Z31C 4Y19A 4M4PA 4N0FB 3IDUA 3NCWA 3GXNA 3DDGA 3I2CH 2F1AA 1IGFL 4O51A 2B2XH 2V9RA 1EEQA 3GMOB 4ZTOH 1HI6B 2XWBA 3KYOB 4G7VH 3ZE0E 2OK0H 3JSSA 5CZRA 1X5HA 3S37H 3U30B 3UGXA 1PX3A 4KKAC 3T4YB 3FQ2A 1CFVL 6TAAA 4HHWA 1OZTG 1T83A 1NFDB 4FHBD 4P46A 5I1CH 2FL5A 1J1XL 5FX3A 2Z3FA 3HFFA 5DD6B 3GRWL 4KTEL 3WD5L 3V9FA 2XI9A 1SMAA 4WFFD 2ZJSH 5CGTA 4YLCA 4XPGL 4JRYB 1D7DA 1A6ZA 2CDGB 3G5XA 4PV1C 1U30A 3BAIA 3TH3T 4O9HL 1KEGL 1MHPL 4EDXB 1XSKA 1U8KA 3B2PA 2Q7AA 3M6DA 5D7JC 3AGVA 2C1PA 2ZWSA 2X4PB 4IRZL 3MU3A 1EERB 3A6CH 4JO3L 5DDHA 5DRZB 3E7JA 3MUUA 4CA4A 3LXUX 1H8OA 3TT3H 1JI2A 3SYOA 2Q6WA 2A6KA 5LXGH 2JLLA 1OSYA 3EYSH 1E27A 1H3UA 4IBWA 4GKOA 1H3XA 2AEPH 5DRWB 2F53E 2MWCA 5EU7C 1A7QH 2VLLA 1DEDA 4UI2A 3PNWA 1UD5A 3ARFD 4QR7A 4RETB 3U0WL 1UFUA 3MXVH 2P80D 1G7LB 2WVUA 5CZXD 4PWFA 1G4MA 2Y72A 5FFGA 3WHXB 1PG7L 8FABA 4FYRA 3HE7D 4CKQA 3O4LA 4FEMA 3CAFA 5TDPA 4L5FE 4YK4C 4QRUA 2HFFA 4QNPF 4QOKE 4C58B 1AZVA 1AQDB 1T7XA 3RTLA 2CKBA 4ADJA 3R0NA 1A9EA 4PJHE 1A7OH 1EAJA 4ELDA 1HH6B 4AKOA 3ZE1F 1YNLH 2ZUXA 4QHKJ 5DVOA 4F91B 5ANMB 1QLEH 1CPUA 4WU5B 2LGNA 4RAVA 2DBLH 4LK4A 4HG4K 3JYCA 3QFJE 3EOAB 1TYEB 1C5DB 4FMKA 3AREB 3PYCA 1U91B 4BFIB 2JJTC 5MI0B 4OD1L 1ZGLM 2ITCB 3CUPA 1VESA 4JKMA 4PJCF 1AR2A 4FTVD 3SO3B 3ZDYB 2HVBA 3FRPG 3ELAT 5ADPH 1TQCC 3TWCH 3VG9B 4X7CC 4ODXB 3VWJB 5DC0A 2PWDA 4Z7OB 4E41D 1TTCA 1U3HD 3FCTA 4F8LA 1X44A 4XVSL 5C3IA 1U8JB 4PMEA 2GJ6D 3E1F1 2AFNA 5F89B 1PFOA 2NZ9C 2X28A 3PXJA 4ODHH 1Z3GL 3QDMB 2W94A 4I89A 2ZUTA 4UDTA 4IK7A 5JOFA 5KW9L 4JCWA 4FQQB 2NNAB 3WLBA 3PV6B 5HVGB 3IPFA 4L29B 5E8NA 1MFUA 2CAKA 4QRQB 3U25A 2ZP9A 2O61B 1GCYA 1FYHB 3NCJH 4YDLB 3UMNA 3CIAA 5DF0A 3QO0B 4B27A 2XKUA 3RHWF 1L7IH 2QSCH 5I1JL 1TTGA 2A38A 1S5HA 5I73B 3HKZA 1NZRA 3IMBA 5ILTL 3WE6B 2ZUWA 1NIAA 3GO1H 4PRBA 2BOCB 2CKBH 1IFHH 3GUTB 1LO2L 4N5UA 5EDSA 3PWJB 1O9VA 5KSAB 2DLFH 2PWFA 5CGBA 3OB8A 3U7YH 4P06A 4G2AA 1MWAL 1U8OA 1BAWA 2V4LA 4PRHB 2WMPA 4EJ1C 5FOBB 3CVHB 3X2QB 3ZUNC 5DVKA 4M7LT 4YPGB 2XFXA 2OJEB 4MNHA 2EDFA 4XMPL 5E2VL 5C9KA 1MJ7H 3CLFL 1AQKL 1K4CB 1S7XA 2CJ3A 3WS3A 3VXME 4FQXB 3RTQD 3MV11 1AO7A 3ZLQC 1SDDA 5CHNB 5JQ6H 5C0BA 2Q3ZA 3WBDA 1RIHH 2R51A 4P3CL 2ZXGA 3QPQC 4BK4A 1CYWA 1R0AH 2CMRH 1X5YA 1IGJB 4M3JA 3BN9D 2EYRB 1IKNC 2AQRA 3O6LH 3PGDA 5IB3B 2ADYA 5FCUL 2DPKA 5C0NC 4Y9GA 3TV3H 1I75A 5CIPB 2X6UA 3PP4H 3B6SB 3EYQC 3FT3B 5F7YC 1VSCA 3C8DA 4BWUA 3MV8A 3O3UN 4PFEA 1J8HD 3UAAA 1IGML 3X17A 1QRNB 3D69A 3QDJB 1DUZB 1ACXA 1WLHA 3C6LC 3ULVD 3QI9A 4K9EH 4ACPA 4I0PB 1U9KA 2V2TA 5DQDL 1ZHBB 3B1UA 2A77L 3P02A 3FB6B 3L3OB 2AAVA 3WEMA 3APDA 3VH8G 2L7JA 1R3LB 5DEGB 1P5VB 3I6KB 3TYGH 4PJAB 3DYOA 1BLIA 4B5ZA 5EZLA 4JG0L 1FZKA 1JXDA 3SE9H 4FADA 4P2OC 2WLNA 4ORGB 1CLZL 1NL0H 2ZKMX 4YOKA 3IFPB 4Q8BA 4BFRA 2FE0A 3VRIA 1U95A 1T7WA 3ZE1B 4N2DA 5FK9A 4YHML 2VDLH 1K5NB 2JTYA 4Y9BA 2EH7L 2OW7A 3CSFA 3FQNA 4ZO8A 1T03H 3IS1X 2I9LB 3PL6D 4OV5A 5CEXA 5DWUL 5GGSB 1MCKA 3GMMA 3L45A 2FGZA 3OJMB 3DHUA 4GFTB 4RBPK 3KDMB 5SWSA 2UWEA 4NRZB 1UC6A 3AJ7A 4ODUB 5EORL 5BRZE 2BIHA 4EQ2A 2C3XA 4PJCB 5T1MA 2ADFL 2BIPA 2Z64C 1G6RA 3D07A 3ZHFA 4ZMTA 4Z7WA 1BVKA 4IK6A 3DBXA 5DD1L 1MCOL 3H55A 3NPSC 4TQPA 4BUGA 4CSZA 2VW7A 1E40A 3RVTC 4MZ2A 3V55A 4OLWL 1SEQL 2ZOOA 4LF3A 2R1XA 3KWWB 3IDGA 2YQ3A 4PH8A 3V10A 2ED8A 2J4WL 4JFEA 4LARH 3FQWA 1NCWH 2Y2YA 5C3LD 2EIDA 4KNTA 3DA0A 5F7WC 5T1DH 3S97C 1QNIA 3OZKA 1OCWH 5GSRB 3B8SA 1IVLA 3BJLA 2WUCH 2FWLB 4R2GD 4BH8B 1HE8A 3AT8A 5GS2H 2K9FB 1LJMA 3GJFA 4LLVB 2I5YH 1GH7A 2ZXQA 1ACYL 1UWGH 4KITB 1L9OA 2A9BA 4NSKA 4DUXA 2FH8A 1MCFA 1T1ZA 3IDMB 1U3ZA 1RIVH 3WS6C 3MJWA 2AV7B 4AWJC 4NN5B 3QS3A 3HZ3A 1AR1C 1CICC 3EBIA 4CBZA 3LS5L 4D3CL 5KSBF 4QGYA 4MQXD 4Y7MA 3VI3A 5IJKA 1KIRA 2R0KL 4JKPH 1GOHA 1R75A 2AXFB 4X7SH 2H9GA 1F18A 1HCFX 4W9KC 4U7MA 3C5ZC 4H8HA 1QEWA 4G70B 4XB8A 2FJHA 1KY6A 3TA4D 4KJQC 3TN0B 3ZHKA 6FABH 5F7LB 4JHWL 3RJQB 2ZXDA 5BOZG 4ZFFA 2VR3A 2J6EA 1Q8MA 2Q8AL 4TXVB 3BH8A 1VACB 4V1DB 1KV7A 4N3UA 4MJHA 5KJRH 2B1AL 3OXRA 3OLIA 4QKTA 5E0FA 2O5XL 5E2UH 2IO5A 4N28A 1DQLH 3B9KA 5E9AA 5GGQH 5GRXG 4JKNA 2VOTA 4UT9L 3CHPA 2D9QB 3CH8A 4R3SB 1NLDL 1FIGL 1LXMA 4CJ1A 4QJ3B 3E6FA 1LD9B 1MFCH 1ED3A 4NQCD 5EO1A 4NO2A 4N0YH 1FH5L 4POZD 5DJXB 1DFBL 3DTDA 3P0YL 3RGVB 5C0RH 3LRHA 1K6QH 4E68A 1F45A 1H8SA 2DQIL 3L9EA 1J0KA 3HLAA 4F37F 5ID1B 2E27H 1KPVB 2GBVA 4LSDA 3BH9A 1RI8A 3GJFH 3GM8A 4QF1A 4KO7A 4IKLA 5B38G 1RLBA 5C0IA 1PIFA 3TP4A 2IANB 1D3CA 1KCWA 4FI6A 1MLBB 4WEEA 3QFGA 4CMMA 1MH5A 1WCBB 3DUUB 4QRSA 5KVMC 4JJ5B 3O6KL 1E6OL 4HUXA 4ZMAT 3IXAA 1BG1A 3B7YA 2Z92A 4GSQA 4JPKH 3VXNB 1BWMA 5FHBH 4J8RA 5AOIA 1U41A 5T5FA 1V55B 2IIJA 3D5OF 3U9WA 3MJ9L 1M3JA 2X4NA 4B9FA 2DICA 2R0LH 4YDJA 2HSIA 3LB6D 2NCMA 5D4JA 5EOCJ 1P6FA 2KI6A 3F58H 2NXZD 2J6EH 4EVNB 3L5JA 3FF7A 1SBBA 4WDIB 3NGBB 2FECI 5I82A 3RURA 1WFNA 4B97A 2BSSB 5TDOA 2CLRB 3S5LA 3NFNB 3NPZB 4KTYA 4DP7X 4PJ7A 4XPHL 4JFXA 3P4MB 1JPFB 5FKPB 3MRPA 5DT1L 3F2LA 3KMDA 15C8L 1TR7A 5D1XB 4OLUH 1IIKA 1H15B 3V0FA 1IBDA 1KZQA 5E56A 1J1PH 1UZ6E 4I2XA 5E7FA 2AQNA 3VXUB 5KTEL 3O8XD 5ENWB 2UWEE 1YECH 4IDLA 4H1LB 3BVXA 3TH2T 1ZT7B 4U1NA 2BY1A 4FQJH 1AOHA 3HI5H 2VL5A 4UTBL 5D1ZD 2ZOTA 2ZCHL 3IWUA 1QBML 4XAWH 4X9HA 3HI6H 3VNZA 2VR7A 1MFVA 3OHMB 3FUMA 3LKOB 4QLWA 4WI6A 3GMLB 4KRPC 5AOJA 5KSBB 4OLEA 3VWKA 4OKVB 5ITFA 1A21A 2WYTA 1BZDA 1CIUA 4FQ1H 4PJFB 4E9WA 1P7QD 4JFEE 3R06B 4PJGA 1OM3H 2DRUA 2E8ZA 2N1KA 3W11C 3VFSA 5CNHA 1P0SE 2EO9A 3TYFB 2OMWB 2KZ1B 2W91A 1NBYB 3MV9B 5GJTH 3FPYA 3VRJB 3OPUA 3VO0A 3VX0A 4JFDA 5T5FH 2X3AA 3FULA 2D03L 1YY8B 4L8SC 4YSUA 5FF6B 1PY4A 2GCYB 4FNLH 5CO1A 1A2YB 1F1DA 3IJ8A 4RIRB 3RB7A 3GK8L 4UB0H 3HZKB 3RVUD 2CGRH 4ABQA 1OTUC 3Q1SL 3VI3E 2YRBA 3MUHL 3SYCA 5JPMA 3TEZA 3FFCB 1S9KC 1HFUA 2D3NA 1I7RB 3VXSE 4J4PA 1JPGA 4UANA 4X5WB 5GJSH 4KMQA 5GQBA 3CXDL 2IAMB 2V3EA 2Y24A 3CFJB 4AJ0A 3QCTL 3RAJH 5IJBC 4RMQA 3KLSA 4H20L 5IMMA 4ERSH 3IJYA 5C0DA 4MS8C 3FU0A 1O5DT 1SHSA 1N2RB 1BEYH 1XR9A 2UZIL 3A23A 4XVUC 3GMNB 4TPRL 2NY4D 4I77H 4XOBA 3UGEA 3SGDH 2VAAA 4QD2E 1OO2A 2HLEB 4QAMB 3VXPB 3MR9A 4ISVB 4LLUA 2J8OA 4KI5E 5K9OA 3T6ZA 1YEDA 5KANG 3X3FH 1QBBA 4KJYA 5F3HA 3NESA 1F90H 2X09A 3SKNB 3AG4B 1NLBH 1VZHA 3SSGA 3GI8H 4NIYE 5J1TC 5I23A 5C6PB 5DFWH 2JQAA 4MMYB 5I5MA 2RR3A 4M43L 4NJAL 5H35A 5TF1L 1MF2H 4CAGA 2C9QA 1FNSH 3BUYA 4H2CA 3OKEB 5GGRA 3WI9A 3UC0L 3AG1B 4O5LH 3TJEL 2VDKH 4Q9RL 4IS6A 5CZKA 5KYXA 3EGSA 1HHGB 1NTDA 4KNUA 5GS1C 2FZ3A 4LE8A 2AJXH 2B08A 4JO1H 1P1VA 4YSOA 4LCWB 4ZBJA 2WLHA 3CPLB 4NZDA 3ZT5A 2BIOA 2R56H 3G08A 3KPRE 5HHME 2VZSA 1OGTA 5AOKA 2FBOJ 2ARJB 2DWTA 1CR9L 3LKSB 4JFFE 1IM3A 5C9JA 1NBVL 1OWRM 1I85C 1AQ8A 2OR7A 1JP5A 3NK4A 3HBGA 3K0YA 4MDRA 1F11A 1RK0A 4J1UA 4HIXH 2XYCA 5C2BH 1KJ3L 3X3GL 4F58L 3TCXA 4PI0A 5DHMC 2LLGA 3UYRH 1A1NA 1S7SB 3VQ2C 5C8JB 3DYMA 3QUYD 4OBRA 3VD2A 4F92B 1EH9A 2PR4H 4HALA 4ABUA 4WGVB 1H5BA 2XZAH 3QEHA 2VDRH 43CAB 3FUKA 3P1VA 5CP3A 4A2DA 3PV7A 1Q0XL 2AABH 5DU7A 5JDSB 2I24N 1WWCA 4AC2A 2HTKC 4R97B 3S36H 1I1AB 4BRVA 1IEBB 3NA9H 4Z76B 2XN9B 1AHWA 2ICEA 3DO4A 2EDKA 3BDYL 3R0MA 4I2XE 4OGAD 5HJGA 5SX4H 2BM3A 1N5YL 1FUNA 1BHGA 1OSEA 3O3BB 3C6SA 4A55A 1K3IA 3IVKA 4N8CH 3CFQA 5D71L 1NANI 2OQJA 1NMBH 2VDNL 2YBRB 5ESVB 3RY5A 2JK5A 4JL1A 3BXNA 5E6ID 3V0JA 3LAFA 5FGBA 2VZVA 2WLMA 3KWXA 4WFGD 4IU3A 1A6TB 2AJYH 4JLRA 4QGTA 4ZODA 3MJGX 3CV5A 5DS8B 5I6NA 3OBAA 4IRSA 5ESAB 4GAFB 3SKJH 2A2QT 1I8MB 1WICA 2QZQA 2X3CA 1KCBA 1OD7A 1HIMH 5FO2A 2Y23A 2WSDA 1ITBB 2CO4A 3P4LA 3H0TB 4ABVA 2FTAA 2HVJB 3F7RA 4LP5A 1T4KA 1WA0X 2AJUL 2WXMA 2BC4A 2NR6C 3EG9A 2CA4A 2W0FB 4PJ9A 3Q43A 1MKFA 3V0VB 3MRBB 3FSZA 4MSWB 4WUUE 3MLRH 5KG9A 1IM9B 3H9HB 5LUMA 4JREC 4RZKA 2GUOA 3CQQA 2Z93B 4G6AC 3FQXB 5IVNA 4MTMA 2J56A 3HG2A 1HE7A 5C97A 1D6VL 4GKZB 2XX0A 5FPIA 1PG7W 2NY7H 3EYOB 1MWAB 4G42B 4KO6A 4OIBA 3RDTA 4AGMA 1I3GH 1CDCA 1F41A 4FJYA 2QSVA 1AS8A 1TJGH 1ZIAA 3N9GL 1XBDA 5CP3H 3SDDA 5T3ZH 2BJML 1EK3A 1G7PA 1BOGA 1N8ZB 4QHLA 1F42A 5B8CB 3E1ZA 4JN2A 1SXAA 3K3QA 3L3GA 1PZSA 4WW1B 1PY0A 4TL5A 4NM4H 4URTB 4OIIH 5I26A 1C08A 2A4CA 4K4KA 4UM9A 3QGVA 4Y4KA 4L18A 4GEIA 2PPAA 4HJSA 3GLZA 4PJIE 1OVZA 3L3IB 1BGXH 5DJ2B 2XDHA 4O2CB 4Y7OC 4DPCX 3JZ7A 4PBVC 4W9JC 4NUGH 4XBEL 4AYEC 2FBJL 1W0WB 2F61A 2JIXB 3OX8A 1B6UA 2FSEA 2FYYA 3LD8C 4PP2A 1T04A 3I6SA 5EUOA 1A3LH 3UAEA 4M00A 1RZ8B 1P5UC 5K93A 4NOFA 1GYAA 4LHUD 4PVNA 1X7QB 3MC0A 4LL1A 1BW8A 5F7EH 2IVFC 3MXWL 3V0IA 5FUOL 4K3DL 1OP4A 3RNQA 3BZFB 3EOYG 5JIPA 2WM0A 4QWWD 4IOIB 1CL7L 2EXWC 2B1HH 4PIRF 4E42B 3ABKB 1YEJL 4JUTA 1UACL 4TVPL 2EH8L 5I0YA 4ZUSB 1YEFL 5HI5C 5D70H 2F5BL 1RUPL 5EBMA 2HG0A 2X4RA 1AVAA 2OR9H 4UILL 3QZLA 1EBAA 7PCYA 1R3HA 1UXMA 5E4IA 1YPZA 1VADA 3ETTA 1XIWA 5CEZD 5F1IA 1YCSA 5EF3A 1WGOA 4XP5L 4PBXA 1H3PL 3LPOA 4R26L 1W6WA 3LRSA 1KG0A 4Q6IA 2CK0H 3UTSD 3ZX1A 2J71A 3MUGB 2V7NB 2VISA 3Q6GH 4MA3B 1QUNA 3ZSSA 2J25A 5LBSL 3VFPB 2ESVB 4YHPA 1XZ0A 2Y5EA 4IRJB 5DVLA 3VW3L 2DQUH 3GSWA 4DEUA 3AM8C 2PP7A 4IIQC 3ZYOA 2BSTB 5AUMB 4MQ7A 4ZUVA 3TO2A 5KSUB 3DETC 5IW1A 2OX5A 3H9SD 2OAAA 1CDUA 5AVYB 4Y2DA 3ARDC 1U8NA 5EV7A 4PJ8B 2C8NA 4BQBA 1F1AA 1XGPB 1WEJH 1SFDA 2QDVA 5C71A 4L9DA 3SGEH 3BKYL 1CYGA 1WAAF 3II2A 1E9OA 3L54A 4YHKL 4PPTA 2GHZA 1T0PB 3UBXI 2BNQB 4UQ2B 3LV3A 5CXPA 4QO1B 4XRCB 3MLVL 1D5IL 3KH4A 4S1RH 5HBBA 4P2QD 1DUYB 1L3NA 4MRCA 4OD2B 4JFVA 5FCSH 3JV6A 2AJSL 3IU4H 4LSQL 3SDAD 2V2WB 1M2VA 2HFEA 4FNQA 4PJBF 3HJEA 4UNUA 4WV1C 1V3JA 4RAUA 4U1SB 4PBWD 1YAZA 3B9EA 4JFDD 3UX9B 2DQEH 1EUTA 5K59E 3ZT7A 1RIUH 5DMYA 2VH5H 3NSJA 3WFEH 3DJZA 1FFQA 1QSZA 3B2UD 2KYIA 4QXTA 3KYMB 3L7FA 3SYQA 2Y3AA 4YXHL 5CBAA 1UJTA 1FZMB 5C1MB 4BGLA 1MAJA 1MLCB 1HN1A 3LKPB 2HLAB 3GQFA 4P3WA 3JV0A 3SBQA 2JKSA 4IHBA 2HVKA 1EXGA 1ZLUK 5T3XH 2FJFB 3DOIA 4N5EC 5AOZA 4F9LA 1U8HA 3DUSA 3A67H 1NKGA 4OFQA 2YWYA 3T1FA 3W3BA 5FYLD 5KOVC 2KUTA 5JZ7D 4LEXH 1PKQE 2YKLL 3P9LB 3WELA 4HIPA 3K2UL 1BBDH 1CZ8L 1I9RL 3M1CA 4OZGA 5D7HA 2R29L 5KYWA 4KKLC 2UY7A 1Q0EA 4BXVA 3T2LA 1A1OB 4NM8L 3ULVL 5I15L 4OLVH 1F4XH 1HKFA 4W9FC 3U9UA 3NRPA 3SBWC 1LMKA 4NZTL 1YEKL 3EOBB 1CD8A 3HE6B 4NO0B 2E7DA 3LS4H 1JF1B 1UD4A 4HK3N 4YHYB 5J3HD 2FX7H 3G6JA 3OQ3B 4P4RA 3VU1A 5A2CA 1HYSD 4WKZB 2NTFA 5DYOA 1MCRA 3A4AA 4TUUA 4ALAC 1IILE 3LNHA 4QTFA 3Q01A 4U1GC 2PXYB 4FFWD 1T5WA 5I8EB 4FQIH 2P7TB 3IF1A 4NGHH 5E5RB 2UX7A 2KZBA 2NY5C 4U0RB 4AE1A 4HKZB 4TSAH 1MIML 1NGYA 4X4YB 1AGCA 1WBYA 1QWNA 1OE2A 4OGYH 5C92A 3LEVH 3AMKA 5JOPD 4P9HH 2VLKD 2PN5A 2ZAIA 2BFVL 3MFFB 4YUEH 3V4VA 1ND0A 4ZUTB 3BE1H 2HH0L 3KVPA 3PGCA 1F6LL 3SQOL 4JO8A 2Y22A 3VXRD 4WEUD 2X0UA 5KOMC 4DKFH 1KN2H 3OKDA 1NM9A 4HIJB 4NQDE 4D9QE 3M86A 2EIKB 1U58B 4WRLA 3QORD 4TTDC 4W9IC 3WFHB 3IU3B 3SJVB 3V4PL 5ACZB 3TBTA 1L6ZA 2Z35B 1HOCB 4HPHA 5CINL 1BFVL 1I7UB 4JPQA 2BIQA 2QSQA 2Q0ZX 4NS0A 3VM7A 4AC4A 1JF6A 4JZJC 3SKMA 1U92B 3BVVA 1M71A 4X5QA 2JJVA 2XJKA 4P9ML 2QPUA 3T3PF 5D4QA 2PMZA 1JGLL 1TITA 3FNKA 3F64A 5C0AA 3VGGA 4YX2H 4PM1A 5JHDE 5T3XE 2WTPA 4TNEA 5C09D 4DPBX 3BP6A 2FLBT 5E1IA 1TSRA 1JGEB 3HBZA 4X80H 1J87A 4BCXA 4XBGB 2GB2A 3D25A 1YYMH 3OKYA 4PJBB 4RA0C 4YFLF 3T2PA 1RJYB 1AC0A 1UT1A 3REWA 3RG1C 4WI5A 4HULB 3GPSA 4WUKH 5D5MF 3B2VH 4Z1PA 3N6YA 4F7MB 2Q1EA 5J6HA 1MUJA 1G0DA 5EO0B 3HN5A 1JHTB 1F4YH 1KCVL 3F83A 4IGBD 4G71B 3TVMD 2I7SA 3GHPA 4OFKA 1AG0A 4G8AC 3EZ8A 2HMID 4IBZA 4ZMOA 2YAEA 3QIUD 5I18H 3V4VH 1HQRB 4KUZL 1KYOK 4X8XA 4UQ3A 2FUTA 1N18A 2ATPA 4A7GF 3T6QC 1RP9A 2L3BA 2GIMA 4I9XA 1ZIBA 3HZYA 3L9RB 1MCWW 1Q72L 5MHSD 4K8RL 1BF5A 4LCIL 2JQMA 3TM6A 4I7ZC 2FHBA 3RWIB 4B9JA 1QI5A 2MSPA 3GSUB 3GWJA 4DF9A 3E8UL 3NT0A 4L8DA 1ID5I 4HBCH 4BZ2L 3D3VD 4G3YL 5J1SC 3MUJA 3IFNL 1CG9A 4EN3B 4BCYA 4K7FA 4MNGE 4Z3JA 1F8TH 4G1MA 4XZUB 5G5DB 4UT7H 4P57A 4CVWA 1TCRB 2HN7B 1F97A 3QQ3B 3HS9A 3ZTCC 2WLLB 3RE0A 4AGLA 1NC2A 3FH5A 1D9KC 3CJJA 4XBMA 2F54E 4ONGH 5EC1B 5CZVL 5J9PA 2WINA 4P23A 4K55A 5AKTA 5FYKL 5I1DA 4G8FB 5ES4B 4MA8L 4KXBA 3S7GA 4ZUUA 3LPWA 4NPYB 3QAZC 3QDGE 4EPSA 4ZAKA 3PQYD 1T3FB 1KWKA 2W0LA 4GAJL 2YAFA 1UG9A 3QW9A 5AZ2H 1OF2A 1CXFA 4LSRH 1T0NB 3D39D 3LN5A 4NQEE 1G9NC 2YQ2A 2XV6B 2WBKA 2WQXA 3C60B 3G6AA 4X0KB 3ULUC 3D4ZA 5AVTB 5BZWA 4F7PA 4PRIE 5DJDB 1B0GB 1ETZA 2FWUA 4P2YA 2MNWA 1NCCH 4M62H 4Y1SA 3WJJA 4AMKL 5I1AB 4FNSA 3NFPB 2NPLX 1LM8V 2FRGP 3FHEA 4NHCL 4F33A 1QSFD 3ESVF 3OC5A 4XMLH 5LGJB 2PNDA 4TQEH 3Q8EA 4L8BB 3ULUE 3G6JE 4APXB 4OQTL 2FB4L 4G83A 4UQ9A 4Z3IA 1JNLL 2SODB 3DMMC 1A9BA 4HGWB 1RUAL 3S5LG 4EI5D 1OIOA 4F8QA 4NC1E 1AY1L 3US0A 4G9FA 5I2IB 3P0VH 4K23H 5A2LH 4LPWA 4Y1TA 4S0HA 1QWUA 3ZVVA 4ZXBB 5SWZD 1R33A 3HZMA 5BRQA 5BS0B 1W80A 3KJ6L 4Z3GA 4ZMVA 2DYSB 3MRQA 3PABB 2P24B 3QNXA 4DPAX 2X6MA 4PIBA 1EDQA 5D7KD 1UWEL 5D7IF 1K5WA 4GMSL 3LZFL 4WWKD 4JKWA 4F2MA 3H54A 1B0RB 4BFKA 1EJFA 2XTSA 2BVOB 5I75C 5FYKU 3MBXH 2D7OA 2NX5D 2W81C 4XN8A 1KGCE 5D5MB 5AALA 1DQTA 1MJ8L 4MJID 3GJEA 3O4OC 4Q0XL 5DRXA 3TASA 3SKOB 1RV6X 2P48B 1QACA 2WLIB 4YFEA 1EHKB 1ZT4A 1SYVA 1WUZA 3FSWA 1S9YB 1LWRA 5GGRY 2WQWA 4UZUA 2WQ8A 1QKZL 5BV7H 1A4KB 1A7RL 4OCSL 1LL1A 3HNSH 2DMBA 3UTZB 2KS0A 1E3XA 3TA3C 2UZYB 1CFNA 5C0AE 3L48A 4IOFC 3O81A 5DR5L 3GBDA 3T8XB 5A1AA 2RCSL 2VDNB 4Q74A 2H2PC 5KJ4A 4GSRA 3KZ8A 3DRTB 4ZK8A 1GJIA 3DTXA 1SEBA 4HBQA 4FCHA 4DEWA 4G8GD 1MRCL 1V7MH 1J11A 4KTDL 1DL7L 1WG3A 1HHIB 2VERA 1SJHB 1Q9LA 2Z4TA 2FQEA 3CIQA 3GMRA 3KPSD 3O9WB 1LO0L 4HSAC 1TLKA 1ET7A 3REVB 2CO6A 2DM7A 3GIVB 1F3JA 1Q94B 2PCXA 4KROC 4OUOA 4YFDB 4EZJA 4U7SA 3UOAB 4M48H 1QI4A 4WIQA 2V0AA 3RYMA 2EIJB 2FT7A 2XUWA 1WTLA 3BGAA 4DZ8A 1UD6A 3RWCB 1BJ1H 5DC4B 5IQNA 4MAUL 4WW2C 1JNHA 1MZYA 3ABGA 3HBPA 3L4TA 1RUKL 3MCLH 4HKBB 5ICYA 3D30A 4MAYA 2OXGB 4FXKA 1KUMA 1S9VB 2P5WD 2C3GA 4D0BA 5ALBH 1DVUA 3OSVA 4FCAA 5JW4N 3OKLB 3D05A 3Q06A 4KUCF 2VLRE 4BKLA 1OHQA 5I1EH 2BSRA 4RFEB 4AIEA 2C9XA 3DVNB 5HPOA 4L4VB 1MJUL 2O26U 1RMFH 1SUHA 4JR9H 4UQAA 1MAMH 3DROB 2PP9A 2VDPH 2CM6A 3IDJA 5KS9A 4XP1H 1TKWA 4P5TD 5ESQA 3QZWB 1FVCB 4HK0B 5JR1L 3RZCD 1LWJA 4L1TA 5AW1B 4RMBA 4LSTL 4G11A 4HUCA 1BD2E 1OK0A 1TNNA 1AXSB 2ED7A 2R23B 4PG2C 1T80A 2XTJB 4YBLB 1G9ML 4PRAA 1E5BA 2L0DA 2W9EH 5G2NA 1H6UA 3ARFB 5IHUL 5HI4C 2EYTA 3AS1A 3IDYC 3QFDA 1KYAA 3ULVF 4FG2A 3QR0A 4HZLA 2H3KA 5DZAA 3K2KA 4ZFOL 2X1XR 4RGMB 2XPGA 3MYZA 5I8CB 3HUJF 5CWSB 5GS0D 5L2KB 4G6JH 2EDJA 4E9RA 3CDGB 1IBGH 1WK0A 2NY3B 2Y06L 4MWFB 2EJ1A 4AE0A 4M5YH 1CI5A 2B5IC 3W9EB 5JIQA 1UHVA 3HBQA 5D7IB 5EIVA 1ZAGA 2O5YH 5DMGC 3QCVH 4Q2ZA 3BQUB 2BNRB 4YE0A 2PTVA 2OMYB 5DEFB 3US9A 3EF4A 2AC0A 1G84A 5L2JB 4PJEE 1AANA 4Z8FL 3O2WL 5I9QB 4JHAH 3EKCA 4YO0B 1WJ3A 2FDBP 4HT1H 4U6YA 3FCSA 2XWRA 4HCRA 4G9FE 1IO4C 5MEND 1AZCA 1V3LA 3QIBB 1CDJA 2XN2A 2E47A 3BFWA 1ASPA 4K07A 2PW2B 3RPIB 4IBLT 3T0EC 4E41B 4AL8L 2HFGL 1U6AH 3SO5A 4NO3B 5EOTA 4TQHA 4N90D 4ELKA 1HSAA 1HC1A 2G60L 5AFAA 1R3KB 1FL6B 1UH4A 2BSED 3HHRB 3TNNA 1UEMA 2FT6A 5D2NB 1KCKA 3MOBH 5DJZB 3VX1A 2H26A 4OJAA 5AWNL 5KYNA 2O6FA 5DUBB 1ZLSH 1L6XA 3T0EE 1G6RL 1OTSC 4EKXA 1RURH 2HG5B 3BP4B 3CMGA 3N04A 1I31A 1BVLB 2E9IA 2IWEA 2YD3A 3GGWB 3PHSA 5I0DA 2CJUL 1GGIH 3LZOA 1Y6MR 2GKIA 4OZHF 3V6ZB 1JFHA 2ZSWA 4BUQA 1OAKL 1ASQA 1T20B 2V3DA 1VB9A 2YC1A 2BO0A 3AS0A 3WN6A 3WSQL 3V5KA 5EN2B 2JMRA 4Z0XB 2FR4A 1CK0H 4DO5A 1IGTA 5B39A 2NZ1A 2A9NL 4HEMA 1M7IA 5KYYB 4Z7IA 3PPSA 4WCYL 2Y1AA 3MZTA 4WI8A 1PZUB 3NZ8A 3LPFA 4MVBD 5JPNC 2WV3A 3KLQA 4CC4A 5HGDA 1NC4A 1S4IA 3GI9L 3CZNA 4YHIA 3QQ9C 1NAML 1N0XH 3PXHA 5IBLD 4LVHC 4LCCC 1G7JA 4YC2C 2PYEB 2J7LA 4UF7C 5A2KH 1KT2B 4X50A 3V0DA 3LX9A 1U8CB 4OFPA 3EH3B 3HCVA 2XBTA 1QTYT 2J2ZA 2YAPA 2MQ3A 1OGAA 3N3EA 3TS8A 4PTTB 3RTQB 3CZJA 1SXSA 2HKFL 1KGJA 2R83A 1E43A 1SJEB 1AJ7L 2E7HA 4HCRH 3BISA 5J6GB 3TF7C 4U3XA 3RFRA 2CGYA 3FB5A 3LIZA 3JWOH 2XWTA 3QQ4A 4BKTC 3GMPB 4LOUC 2YIHA 2MH4A 1KB5A 1CDYA 1M7DA 1WWWX 4G72B 3DX7B 2ED6A 4WO4C 1MREH 3GHEL 2ZF9A 3H9ZA 2QDWA 3NSCA 1D6EB 1YJDH 4D0DA 1TU2B 7FABL 4M6NH 1A4CA 2FECL 2IF7A 1CLVA 3EJQA 1HINL 5GSVA 2TRYA 1P4BH 3B7SA 3HUJB 4ZO7A 4W9DC 2A1WH 2D31B 1MG2C 5C0CB 2QPFA 4DIXA 5BVPL 1WFTA 4E9LA 2X05A 1R3JA 3K72A 2A9ML 5B1JA 3QUMA 3OLEA 1WZKA 2JKRM 2IDFA 3MYJB 4G6FD 5F9JB 1O7VA 3NIFE 1OAXH 1JGDA 2IQ9L 1ECYA 2EUZA 3SPVA 1HHHA 3NFSH 1NGXA 4JY5L 3JVGC 4QRTA 2E4FA 4UM8A 2YOAA 4XCYA 4W4OC 3CFDB 3BLBA 5E9DE 2GTZA 1NCUA 4ENED 1PFCA 5CJ5A 2EECA 2K6WA 5IEKB 4I88A 3D08A 3QH3A 5CJXA 1HAWA 1HH9B 4DAGH 2R4RH 2B0SH 1YMMD 2B4CL 3CQPA 5CM1A 3GBLA 3C5ZA 1UOKA 1DCEA 1FZOA 1T1WA 5CEYA 4A6YA 2LAAA 2W5PA 4A2MA 2LQRA 3BPNB 1SBSL 2AJZA 4N6RB 2YKKA 3OR6B 4X7EC 4LPYA 3KXFE 3EDDA 2GSGA 4XWGH 3LIZH 4N2AA 4KZDL 1TJHH 3V4PB 2YEZA 1NGQH 3HG5A 3FU9A 4M7ZC 4QRRD 2EVJA 1KB5H 2PR9A 5DHDA 2ZCKH 4JY4A 2FQFA 3HLKA 2F15A 3MNVB 2I7OA 3LVTA 2IPKA 5KVDL 4JO2L 2CA3A 4U6HB 4U6XB 2YOCA 5I5IA 3FTXA 2ZKHH 4OZHB 5IBUG 2WZ0A 4MD0B 4L3ED 3KLHC 3VGHA 4GS7C 4OGZA 1MCSA 3QUZC 5HHVH 4J3OF 3TCTA 3AGWA 3ERXA 4N3TA 1IBZA 5IWLC 1TEFA 4HQQH 3HG1E 5HHQB 3TF4A 1YAIA 2GSIB 2X9ZA 4FP8H 2EYSA 4PJDF 1PCSA 1M57B 3QUMH 2LR4A 3FO2A 2OP4L 4Y4HD 3MX0A 4IEFB 2N4IA 3TZVB 1E8YA 4PLKC 4FI8A 4OUUA 4XHQA 3N42F 3BSZA 2OTUA 5EU5A 1N12A 4AVHA 2YD8A 1PTZA 3L6FB 4X6DA 3TBWA 4DN4L 3QIWC 4MJJA 4ZQKB 3WFCL 2FNBA 5T8IA 3GSNL 1VZIA 3X12B 3WFDH 3HB3D 2PXYC 5ABDE 5MEOA 1Q90A 1N6QL 4TNVK 1O7SA 4UT6L 4IOSA 5CSZB 1K4DA 1NDMB 2P8LB 3WJMA 1S9WA 5L7XH 3H3PH 5FGCE 1WITA 1QTPA 1WT5A 4CVZB 1H3WM 1H3GA 3NJHA 1YQ2A 2R2HA 2FGWL 2MFNA 2QADC 1PJ9A 2NY6D 4AYFB 5KVFL 2DDQL 3NAAL 3ETBF 4A6YH 3HZVB 2ITEA 5D55A 2BRRL 1P7KA 4L9LC 3GRBA 4O02L 3S48A 3WTYA 3C08H 4GG6A 5E00A 4S10A 1P4IL 3MLSL 3WFBH 2ZCLL 2G3XA 2DIEA 5F8QC 4DGYL 4JRXA 1ZHNB 3WIHA 1YNKH 2FJGA 2QTEA 2Z0BA 5E5MA 4C4KT 1FN4B 3BOVA 1PPIA 1BQHA 1XL4A 2F53D 1OGAE 2X4QB 5EF1A 3QR2A 4LKCB 1J1OH 3CFBB 2C9RA 4X6FB 5HJ3B 4IU2A 3VD0A 1AGEB 4YHOL 3U4KA 2XQYA 4XBPA 3QXWA 1LVEA 4TSCL 1M05B 1HL4A 3GUFA 3U0PB 3G04B 4BSVB 2X4TA 3WN5A 4HPOH 1A66A 4IDJL 5DQJA 3PWPE 5IK3B 3MRDB 4WHTB 4JDTH 3OKOB 2DQFA 5TGBB 4A1RA 1IQDB 4R4FL 3O41B 3K4ZA 4ZFZB 3WENA 3QS2A 4QOKD 1KCSH 1IEHA 3QUXA 3F04A 3ARYA 3X14A 3ARBD 4X42A 5LCVA 1XDTT 1KLGA 3PAZA 5FDYA 5A2FA 3BSZH 5EOQH 5AVXB 1XR8B 1WWBX 2C9UA 3MGTB 5E8DL 1W91A 3BWAB 5HDLA 2JJUA 3RDJA 3UTTE 3C5SB 1JD9A 4NAQA 1CBVH 3QFJD 4WJG3 1WC7A 4WI9A 5SX5K 2G2RA 2Z8SA 3D85A 5DJYB 3VXTA 1Z3RA 3GDCA 4Z7NE 2PO6B 4Y8AA 5DEJA 3IFOB 4WI0B 4Y1AA 1MFEH 2NDGA 4XNZB 5FXCH 3K71B 4L8SA 3STZA 5LN8A 3H3KA 1IU1A 4NRXB 1EGJA 2XCMC 5DD3L 4G80B 2Q6WB 3KLDA 2J88H 1XF4B 3SCMB 2HKHL 3BKMH 1UB6B 4R83A 1OT2A 2VLLB 4MD4A 3WIHH 4S2SA 3ZE2F 4OGXL 3DJSA 3W0WD 5F0PB 5HHOA 2VXUH 4NZUL 1I3UA 2Y5TA 2VJXA 2X88A 1CXHA 1TZOA 3S34L 1F13A 5TPWH 4TULL 3O4LB 3RQ3A 4IMKC 2BW4A 1DQKA 2VDOH 3BIAX 5F88B 4PJDB 4QRUB 3ETBJ 3MBEC 3FOMA 4JS7A 5H2BB 1HAUA 5TE7L 5HYSA 3FKUS 5JXEA 1WIUA 1ACZA 2V9QA 1BYPA 3VCLB 4BK5C 5A6MA 5KVEL 2CRYA 3Q6FA 2D7MA 5SWQB 3F6LA 3N42B 5GRJL 4OAWB 1B4LA 2JVUA 4L05A 3UZEC 2SEBA 5HHPA 3QYNA 3ARWA 3ILPA 1DQML 1ZWIA 5LHDA 2NY0C 5FUCC 2XIIA 3DECA 5LCVH 5INCB 4PWEA 1XX9C 5DMJB 3HC0B 4ONHA 1N6VA 2VLJE 4WJ5B 3OZ9H 4E5XB 2EUWA 3A5VA 3CGTA 1R3IL 4I13B 3TPUB 3G5VB 5IMKB 3ZMNA 2X9YA 4DGIL 4QRPA 3K6SB 2DYPD 3P4NA 2YJLA 1QPXA 2QVMA 4YBQC 2NY2D 5F1NB 4R7NA 5TD4A 2HYMA 1JZGA 1GC1C 1T7VA 3L5HA 1S7UB 1OAUH 4LSSH 3ZHNA 5F3FA 2X42A 3PG2A 4BUHA 5GZND 3MACH 4ZMLA 1CD9B 4Y19D 3V4LA 1S7TA 2MHAA 4G7RB 4UNIA 1LE5A 3JWDH 4ETQB 1GW6A 7PAZA 1F56A 1NCIA 2NW3B 5D2LE 4NLAA 1EGJH 4X6DE 5FECB 4MCZA 1MW3A 3LDBC 1J86A 2VB5A 2N1TE 5AYTA 5JOFB 1J0JA 2XXFA 4UIKL 1HZHH 2GPZA 3O3AA 4AM0A 4ELMA 2EQDA 1O7DE 4HDIA 5HJDA 1WFUA 4FLSA 5E8NB 2X0VA 1IC5H 1T2QL 1YEEL 3AW5A 1KFAH 4JB9L 3NN8A 3VD1A 4DP2X 3WJLA 4S1SH 5FFOA 3SB3A 2A74C 3EYQD 4C56E 2FWOB 3QEGH 4HGMA 2P8PA 4QYOA 1S5HB 4D0CB 3OWRA 4FFYL 2GTWB 5D72H 3RFZA 3UTPE 2O1AA 3PUCA 4HW6A 1TENA 4N0FA 4AK2A 1D5RA 2OYKA 4F9PA 1RH8A 4QY8B 4MB3A 2K7PA 2VRKA 3HJ0A 3QRBA 4LU5L 4XMXA 3UTQA 4XMWA 3GMOA 3VGDA 3T09A 4E9XA 4JRXE 2TRHA 2JI3A 5FO7B 1EHLH 1HI6A 2XOTA 3KYOA 1OHZA 4NZRH 3ZMEA 1SQ2N 3UERA 4DOHB 3C09C 1RL1A 3M88A 3O6FC 4GQ9L 3H4FA 3T4YA 5C07B 1A0QH 4OF3A 5IQ7H 3ZQWA 4P59H 5IESL 1GGTA 4JFQB 1AO7B 1K2DB 2WZPA 1ZLEA 2P28B 4MMXB 4PS3A 1IGIL 1X4ZA 5DVMA 4ZFOB 1JGUL 1HZKA 1X9LA 4EDXA 3ALPA 2DH3A 3V6OA 1VPOL 1LO3H 4K7PX 2A9CA 1CDHA 4PVLA 1RY7B 5GXBB 1TTBA 5AB1A 1UJ3B 2OSXA 5DRZA 4KQ0A 3QJRB 1HCZA 1OAZH 1OGSA 5FAAA 1E9PB 1Y7VA 3NCYP 3CX5J 1E4HA 3CK0H 4JVPA 3ZE2B 3FW6A 4PSPA 2ZWLT 1T89C 4DZBB 2ERJB 3NACL 1SXNA 3HS0B 4LRNL 4LPCA 4MLIA 5DRWA 2YR3A 35C8H 3QUYB 5DLMH 5FDWB 3LKNA 5I1KL 5I6XC 2DKMA 3SY6A 3H8NA 3OXSB 4XP6H 3QRGL 2AP2A 2VYRE 3WHXA 4Y1AE 2OV0A 3OF6A 1NPUA 5H4ZA 4FNTA 1ZS2A 2D7NA 2ZOLB 5A2JH 1GTFA 1X5ZA 3UPCA 2W07B 1FORH 4NRYA 3MRCB 1PNCA 1BX2B 3T0DA 1DLFL 2ZUQC 1I8KB 2PPDA 1JG9A 3EJYD 5CEXB 1HH6A 1AQMA 5IROA 3RWEB 4FYTA 4P5KB 5ANMA 4WU5A 3X1EA 5DC2A 1GKEA 2QPDB 2VZ1A 1JXFA 1TJMA 2QHRL 4OJFH 4WFFE 1CVSC 4K3EH 3ZDZF 1C5DA 3AREA 1G6RB 1U91A 2ZUSA 4BFIA 4JVWA 2V8LA 4BELD 4Z7WB 1BVKB 1SFHA 2ITCA 3DBXB 1AI1H 1T7ZA 5IFHH 5C3TA 4JQIL 5IMLA 1QABA 1BBJA 2AI0L 4GXUM 1FYTB 5T1LB 4ODXA 3VWJA 5C6WH 1LP9F 3RUGF 1W6LA 2R1XB 4WWID 1BG9A 1ZVHA 4GRMB 2FATL 4B50A 3Q5YA 5CZXC 4Z7UA 5J0BA 1UENA 4G7YH 3RPKA 3X13A 1U8JA 5BO1H 5C08A 4H8WC 3HE7C 2ZYSA 1AXTL 2JCCF 2UXFA 3RWJA 1DVFC 3WIIH 3I6GA 1NICA 3L4YA 4ZNCD 3D4YA 3MHZA 1EFXD 2PYFB 2ZTBA 4TTGA 4QRPE 2NNAA 5CD5D 4OTXH 3PV6A 1NAMB 4KXZH 1RVFL 1JNNL 3KPLA 2XHNA 4L29A 2WCGA 4Y16D 4ZNEA 1QFPA 4QRQA 3GYRA 2O61A 3NSYA 4N0CD 2GITB 4QYAA 3K6NA 5I6PA 3VACA 3A6BH 3QO0A 3P11H 2XZZA 3LKRB 1S7RB 5C0BD 1ESOA 5ACLA 4U05A 3N85H 1BM3H 3GLAA 3IFLL 1P69B 2V5YA 3ZL4L 3WE6A 1UM4L 3NJXA 3AT9A 5E5UB 1K72A 2VSCA 1KY7A 4PAZA 4RSVA 5CLZA 1U2YA 4RFOL 5CJQL 2BOCA 3WIFB 5I0XA 1ZV9A 2TSAA 1X6LA 4EBQL 4I5BB 4XPBH 1M6UA 2F08A 5B1KA 4ELME 5KSAA 1RAMA 1RPUA 1FZJA 4AGQA 3BP5B 1JZ8A 1KN4L 4C55A 4PRHA 5GS2D 3ISRA 1U3HC 5FOBA 4OI9A 5BW7C 3CVHA 4GIOA 3BH8B 2AQQA 1M42A 4TNWF 2OJEA 2IMMA 5HDBE 5GS0L 1K4CA 1MW0A 2NXYB 4RFNC 1WAPA 4FQXA 1B6DA 5GHWL 4AUJA 4DP9X 4HOMA 5F6IC 3OKMB 5CHNA 1XVSA 4ZOBA 4POUB 3ARDA 1X3DA 1BVNT 1KELH 3D48R 3UP1A 1DCLA 2GJ6E 2BCKB 1ED3B 5IFAH 1IGJA 3ISWA 3ZUCA 1LNUB 2ZXWB 4NO2B 5DD0L 1QHOA 2EYRA 5IB3A 2VITA 5FW7A 5CIPA 1XGTB 5GRVK 2JI1A 3B6SA 2YO3A 3FT3A 1CGSH 3HLAB 1CJYA 3T0XA 1JZ7A 1BQSA 2R0WH 1FNEB 5SWSD 1NFDE 3C8HA 1QRNA 1DUZA 1TVBB 5DZPA 4ZX3A 4I1NB 4KKBD 4X5LA 3RJDA 1H0DB 2FO4B 4JRYE 4OZIF 3H53A 4X9IA 1ZHBA 2XXMB 1SN2A 4YQXL 2VSDA 2CR3A 5J12C 1R3LA 5DEGA 1P5VA 3UTSB 1MH5B 3I6KA 4GQPH 1KV3A 4QRSB 1EZVY 4NFDA 4HUXB 2XA3A 1HEZB 4ORGA 3IXAB 3IFPA 1E30A 4JFED 2WP3T 3RTQC 3H9SB 1AZZC 1K5NA 4XVTH 3BWUF 4ZFGL 4GIPD 1A02N 2I9LA 1GJUA 4KRPD 2YARA 4RGOL 1RPKA 1OB0A 2E86A 2DMGA 5E5LA 4FGMA 1XGRB 2MMXA 2WANA 3KDMA 5DK3A 3ZDZB 1PGRB 3ZTNL 1JNJA 4NRZA 2IQAB 3QRLA 3BN9C 4ODUA 3CVHH 4HFUH 1AS6A 5JW3H 5HPMB 4FFTA 3OHXB 3V9CA 3RKPA 1IAIM 3GSRA 3W11D 4PJCA 2OMVB 3HI1B 4MYPA 4NUQA 4D8PA 1EEYB 5F3BA 1V7NL 1R19A 1LP9B 3MV01 4PRDB 1J8RA 3V7MA 4JN1L 4PJ7B 4U1LB 2G4EA 1ID2A 5B39G 4YDIL 2XU9A 3MRPB 1DVXA 4LHJB 5K33A 1GHFH 4U3HA 3V5DB 3T9WA 4S11A 3VXSD 3KWWA 1PMYA 5FK9B 1G7HB 2BWQA 2XNAB 3ARGB 1IJNA 3ARRA 3FQ4A 5ANME 2CXGA 5EIQA 4GQQA 1J9SA 4XNUL 5CIPH 4U1NB 4ZG1A 5GGTA 1XWVA 1ZEAL 5GSRA 1KGUA 3HA0A 1A6AB 4DGVL 4XPAL 4DTGH 2Q9OA 4PU2A 1I9IL 4HU2A 4PCTA 4XP4L 2BP5M 3GSNB 3T3MF 3PL6C 4MLSA 5C6TH 3ZDYE 3LRMA 3Q8AA 1ILSA 2MPAL 1DVQA 3QEQE 4MS8D 4KI5D 4PY8I 1FPTL 4HWEL 4XVUD 3SQRA 5I1HH 4Z7OE 3ASWA 3H6JA 2XX1A 4NKOB 2W9DL 2NQDA 1JDCA 1Z9SB 2AXFA 2OPCA 4HJIA 1P84J 3B5HA 4UOW1 5TFSH 1WE5A 4O02B 4QHUB 3IKCA 3K6FA 3QDME 2IBZY 3TN0A 3TBVB 3NCCB 1PLAA 1UURA 4FMVA 3U7WL 4F8OA 2BW5A 4LVOC 4V1DA 4KGJA 3ZT6A 3KS0H 3NP4A 2VR4A 1II4E 2C9SA 3STBA 4Y89A 5LGYA 1KTDB 2FO8A 3ILQD 4R6UA 4UNTA 1JMXA 4JZJA 4R2GC 5DUPL 5HHMD 3WU1A 3ZDWA 4F15C 4R3SA 1UVQB 2QL1A 1U8IB 2NNXA 4I3RH 1LD9A 3IJYB 1HKLH 1BXUA 5DJXA 1NFIA 3FHAA 5DRNB 3DXAA 2NNCA 2WXRA 4PD4K 1ZPLA 3FUEA 4MQXC 5GGTH 4K94H 5ID1A 2EE6A 1KPVA 3F85A 3G6DH 3MR9B 4OZIB 1UZGA 1WAEA 5CUSL 2VLKB 5K9OB 3GPEA 3LXAA 2BH0A 4MKMA 3V79C 1C8PA 1MEXH 4OCXH 3CZFB 4YWGH 3P4OB 5F3HB 5FO9A 4LSUL 1MCHA 1DBAH 2IANA 4N8PA 2DJ4A 4K5NA 1PVHA 2WQRA 1MLBA 1FO0L 2I60H 1OCOB 4FN0A 4JJ5A 1WZ1H 4WO0A 3N2JA 1KYUA 5IB1B 4HD5A 1N10A 5L88L 5CJOL 3FU3A 3EBHA 3ESUF 4PGJA 4GOSA 1A4BA 4WNQB 1QRNE 3CD4A 3QDJE 3FQUA 1Y18B 2ZX5A 1DSFH 2VGLM 5HJBA 2HTKD 4DSYA 5DUML 3V52L 3WG7B 5KYXB 1ZTXH 2EIZB 3BKJH 4GNKB 1Z2KA 5C09B 4EVNA 4POZC 4XPTH 2IH1A 3RZWA 4F24A 2FK9A 2G0LA 3FU7A 4QNPE 3QAQA 3G08B 2ZOKB 1DZ0A 4PJAE 4L2LA 3L3HB 4NQVB 2X4OB 2BSSA 1DJGA 4N2MA 1ZLWK 2CLRA 1IM3B 3RP1A 1KCUH 3NFNA 3OMZA 2AXWA 2GIXA 4NQCE 4LZKA 3P4MA 2WO2B 3ZE1E 2VRQA 2MIZA 3US1A 1A14L 3AXIA 5D1XA 5GGUB 2ODIA 1N4XH 4LSPL 4X7FC 5LGHL 3KPTA 2VM4A 2GJRA 2YPLB 1PDKB 3VXUA 1R6VA 4WUUD 5ENWA 3RL2B 1O9WA 4H1LA 1ZT7A 1KACB 5AB9A 3T3MB 3MBWB 4PJCE 1IKOP 4MNQB 4OLYH 2GT9B 5IVXF 3Q48A 5I74C 3LKOA 1TNMA 3GMLA 3BYYA 5KSBA 4R96A 3ZMRA 3A6OA 2CWRA 3FTSA 3Q8BA 2M8XA 3LB6C 4OKVA 4Y4FB 4AK1A 5EEWA 3QNFA 4OJYA 1AHWB 2NXZC 4EO5A 2ZF8A 2CKNA 1ZANL 4B5EA 1PLBA 4FXGB 1GIGH 2FEDD 1LO4L 2MKWA 2YQGA 1T2XA 3EF7A 4OCRL 4DVRH 3PE9A 4L1LA 1JVOA 2OMWA 2PLTA 2IADB 3TYFA 1NBYA 3MV9A 4GAYB 3VXOA 1ZGLB 2X41A 2X1PA 1LILA 4AJVA 1YY8A 1OL0A 4JLRB 3MODH 1BQHG 2ADJB 4ODBD 5IVZA 1R4XA 1A2YA 3OD3A 1UA3A 4J5VA 4P2RE 4RIRA 2XQYG 3CC1A 3O8XC 4KOBA 4N8VB 3WEAA 1NMCC 3FMGH 4P4KB 4FNRA 1EO7A 3HZKA 4HXAH 1TZGL 1FRGH 2Z9TA 5DQ9B 3P73B 4KZCA 3FFCA 3SKUD 5EG6C 5D1ZC 1I7RA 5BQ7A 3VA2C 3D9AL 2F8OA 3MNZB 2IAMA 3FU6A 2P43B 3CFJA 3FQTB 2R2BA 1HVXA 5KG9B 2ZPKH 1EDHA 3D39B 2R7EA 4WSJA 3UO8B 2YZ1A 1ZTXE 2VM9A 1WFIA 4Q56A 4QEGA 5A6IA 5IKCA 2E75C 4KGLA 2NUTB 3MLYL 4H1LH 5EOCH 5BPPA 4V1DE 1MI5E 3RDTB 2CJTA 4K7PL 3VXPA 2HA1A 1ZHKB 2PETA 4ISVA 4C83B 2EAEA 3L1EA 1BOGB 3UYPB 4J2XA 1U8MB 4F8NA 1XGZA 3GRWA 4ATWA 2ZAGA 1E4WH 5HI5D 4JZOB 1JZ5A 5E4EC 3TA3A 4DQOH 2EUVA 3T4AC 2JB5H 3SKNA 4UM9B 4B9ZA 1S6NA 3KR3L 4MMYA 4KOCA 2ZX6A 2CRZA 3WO4B 2RQEA 4LNVA 3RVUC 2EDTA 4IRZA 4AEHH 4PBDA 1E8XA 1EFQA 5AB2A 4DCQB 1TMCB 5L6YH 4XCFL 3ZTJH 2OULB 3FCUB 1AE6L 2J1ZA 3MCKB 2FSEB 4Q89A 1CYXA 1I1FA 5E70A 5F9OL 4KDVA 3FO1A 3WCYA 4EI0A 3MO1B 1SUJA 1HHGA 3AQXA 3UBXB 4AEIH 3R18A 1B2WL 1MVUB 3IRPX 3N43F 4PI2A 3BRFA 3HRZC 2IANE 4LCWA 2NY4C 3CPLA 2R4SL 3N1MC 1DJHA 4QXUL 4GP8B 4D9LL 4Z78B 2VXSH 3S5YA 4UYPA 5HYSG 1XCTB 2ARJA 3LKSA 4AW7A 1Q0YL 2NY1D 4R5XA 4B9CA 3P30L 1JPST 1RFDH 1EXUB 4WW2A 3D18B 4QTHB 2Q8BH 2J5LC 1GPOH 3CTTA 4LQFH 5F9WC 4AUUA 3MRHA 1U2CA 2EDQA 2VWEC 3UJJH 1WFJA 4HOXA 4DEPC 1FCGA 4PJXE 2CNYA 1JHKL 3ML9A 2Q86B 3ZU8A 3Q2CA 5IMOA 4CKVX 3EJZD 1IGFH 2JJSC 2JKLA 1R3HB 2R39A 2EEFA 4HJTA 1S7SA 4CU7A 1VADB 5C8JA 1S7WB 5IVXB 3AWEA 4PYGA 2VWEE 5G4OA 1MFMA 4IRSD 4X9FA 43CAA 4L1DA 1NEZB 1CFVH 1W0YT 1WIOA 2Z6FA 1J1XH 1QUNB 2NMSA 3FC8A 3PHAA 4X4XB 3GRWH 4KTEH 1SY6L 3WD5H 2DZEA 3GSWB 3BUIA 4DUVA 1IEBA 2FD6L 1WYJA 4XPGH 5D1XE 1RZKC 4PJ9D 4O9HH 1KEGH 2OX5B 1MHPH 1JN6B 1DJYA 5GRZA 3VXUE 4DO4A 2EIBA 3DC0A 3O3BA 4U6TA 1DO5A 1LMIA 3BAWA 5AW0B 4IRZH 5LXVA 4JO3H 1EUUA 1MDAA 1WA2X 5ESVA 2YBRA 1M6OA 5DJCB 3N1PC 2NT0A 4HWUA 1TQTA 4NNPL 1A6TA 4CBPA 5DS8A 2WBJC 2DQJL 2P5WB 5JIKA 5ESAA 4ZTPL 5KSBE 1I8MA 4BFGA 1NM4A 3QXVA 2VW4A 3SDDD 5CJ8A 5E6UB 2ZWYA 3MQIA 3CVCA 3NEEA 3U0WH 4PJFE 5JORA 3FOLB 3JV6B 1NBCA 2WBWB 4GYBA 3H0TA 4R8WL 2HVJA 3DUHA 4QCIB 1PG7H 4H44C 3NCXA 3VRLF 2WZ6A 2W0FA 1FL5B 4Y4KD 3V0VA 5FEBA 2BP8A 2OSYA 3ECVA 4MSWA 1BXVA 3MV9E 1IM9A 4GXFA 5F1OB 3H9HA 2D7TL 3NP3A 2Z93A 1HWGB 1X4YA 3FQXA 5KAQG 1AKPA 3BP7B 4OSUL 4XO9A 1HL8A 3U6RB 3UCQA 4ILDA 1KBBA 2AQTA 2YD5A 1Q9WA 3QR1A 4GKZA 4OGAC 1G5AA 3HPJB 3EYOA 4GB9A 1MWAA 1MJJA 1FF5A 2WYHA 3E2HB 4G42A 2YFOA 3P77B 5D1QC 1XSOA 5HI3D 1EXHA 2CHXA 2WN2A 2X2UA 1DJZA 3H85A 4K15A 2NW2A 1N8ZA 1W72L 4M9OA 5E6IC 3VGAC 4ADGA 3K6DA 4NQDD 5B8CA 2WO3B 2P5EA 4D9QD 4OD1H 4WW1A 5D96C 4C59B 1K9TA 1N68A 2X9XA 3UXFA 4B7IA 4PV8B 3F7KA 3MRJB 4OZGB 2PCFA 5KYWB 3BT2L 5D1QE 1UFGA 4M6ML 2HXAA 2XN0A 3NRFA 3MV7E 4XR8C 3EHBC 3GHBL 5HVHB 4GFXA 3FSAA 1I1YB 2H47C 5EEXA 5EZJA 1J9RA 3L3IA 4XVSH 1KGXA 2LFEA 3ES6A 2EE9A 5DJ2A 3M8OL 4O2CA 4Q4EA 5I1IL 1JWMA 1TF4A 1VFBB 1TZAA 2KPNA 4CDGC 3WMSA 5EULV 1W0WA 1XIWD 2JIXA 2VXTL 4JFSA 1Z3GH 5JHDD 2ICES 5T3XD 5KW9H 3SDCC 4BH7B 2HWZL 3THML 5E4OA 1HDMB 4DUWA 1QNZL 1MIEL 1GMEA 1X7QA 5I17B 1C7TA 3SE8L 5J1AB 4HIIB 1CFBA 3T04D 2NTFB 4KPHL 3IGAB 5MENB 3FB8A 1I3RA 4NUJB 4I18C 1SVZA 4KHXL 3BDXA 3BZFA 4LVNC 4KX9A 1T5WB 3GNML 3CX2A 5F6HI 5I1JH 5K1VA 2NQCA 1S46A 1P9MC 1Y07A 4Y2DD 5ILTH 3BCDA 3MGAA 5HYJB 3FT2B 1LO2H 1Q1PA 3O45B 3FT0A 2MCAA 3GEFA 1IKFL 4X9YA 4LCWE 1AAJA 4AJWA 2D8KA 2AXJA 3BFQG 4HJUA 1MWAH 3OKDB 3M7FB 3NTCL 3IJ9A 1CT8B 3FZUC 3IMSA 4Z7QF 4YGAB 1RP8A 3CQFA 4UMGA 2ID5A 4XMPH 5E2VH 2VXVL 2IAAC 3MUGA 2P52A 2V7NA 2ZKXA 3CLFH 4MA3A 1AQKH 3WDJA 4YHNB 1IGCL 3QZPA 3OMAB 1IC0A 2ESVA 3IRCA 4GRLB 4IRJA 5EU3A 5HGBB 3VFPA 2YRLA 2BSTA 3O2VL 5AUMA 4ANWA 3Q5OA 2A9DA 2L8AA 1CC3A 1TTFA 5KSUA 4P3CH 3BEVB 1Z5LB 2JTDA 4MS6A 3ZQ9A 1M71B 2O93L 2B9AA 1YEGL 3EYFB 1PIGA 2DQ6A 2QGBA 1S8DA 3ZJAA 1XGPA 2VAJA 5FCUH 3TEYA 2OSLB 3HFML 5DHEA 3LN4B 4XMZA 5EU6A 4PQXA 4ZOEA 1N67A 3ULAB 4NWTL 2RIKA 3EJCA 4R9HA 4NEHB 4JHBA 2BNQA 4QHMA 1GZQB 4KVNL 4UQ2A 4QO1A 4FHJA 4XRCA 4OW6A 4KNQA 3OWEA 1LLAA 2VZUA 4OD2A 2XN9E 5DQDH 4AM0Q 3QG7L 2A77H 5F2FA 2XC8A 2V2WA 1BDYA 2CDEB 4Y5VB 5FV1L 4NQSB 1FE8L 3SOTA 1TQBC 3UBFA 5F8RC 5H94B 2IDUA 3OKKB 5GGSY 4JG0H 2YPVL 2X1OA 1Z66A 3M17B 2HJFA 4J28A 1CLZH 4AIXA 5IR1B 4NQED 3KYMA 4GT7A 2JKJA 2B4CC 2H8PB 2EADA 4AYBA 4YHMH 1FZMA 2IOMA 4PRID 5CEZE 4UWQB 1IL1B 2EH7H 2IGFL 5EZOL 3AB0B 2M2DA 1PX8A 2GK0B 4X6BB 1MLCA 1TTAA 1CXKA 2HLAA 3INUL 3LKPA 5DWUH 3RRQA 2WAHA 1OKEA 3JTTA 4XMKL 4KO9A 3C2AL 3ULUD 1A7BA 3MRRB 1ZD6A 2FJFA 5EORH 2YLKA 1KENL 3IPEA 32C2B 3RBSA 1U93B 2AHIA 2ORBL 2ADFH 4RQQA 2PPFA 4IYKA 2MJWA 5IB2A 5T5NF 3P9LA 4UT9A 4G6FB 4YH6A 5DD1H 1MCOH 1BA9A 2OTWB 5IFJB 1CG9B 4ANXA 5IOPB 3CU7A 3KBHE 4OLWH 1SEQH 4QRFA 4GPVA 3SDAC 1A1OA 2J4WH 1IAII 3JT2A 2BIMA 3IAGC 1Q38A 3RA7L 2DQDL 4PLOB 5KSVA 4R7LA 1JTTA 3EOBA 2WINB 3HE6A 3NJKA 4NO0A 5F70A 3B2UC 1QSEE 1WGVA 5I1DB 5C0JB 1JF1A 2WIIA 1XV8A 3SGJC 5BZXA 1ACYH 1KGCD 1R5IB 3QJFB 1J5OL 1ADQL 3ZRSA 4X7TA 1J8SA 5J4MA 4WKZA 4N2CA 3VAEA 5DHYB 5E95B 4AITA 4ZD3L 4OZFB 2PXYA 1FO0B 5BZZA 4D3CH 5FS5A 3LS5H 2CDFB 4AYMC 1S7QA 4ES8A 4XODA 2R0KH 5AQ0A 1A6UL 2FCBA 3LQZB 2FH6A 5JZ7C 3MRGB 5DS1A 2E7MA 5C0AD 4XP9L 3L5XL 2WQVA 4I3SL 4K5OA 1LEGA 4O4YL 5HTSA 2IOOA 3MJ9A 3MFFA 4KK8C 3KL3A 1DBKL 4ZUTA 2K3HA 3CBRA 4Z7QB 4JHWH 1JV5A 4QT5A 4F1ZA 3EO0B 2UXTA 4Q6YA 3W39B 2QKIC 3APNA 1W0VA 4A7VA 1NFKA 5ALCL 1N26A 2Q8AH 4HIJA 3BPLB 1U58A 3WFHA 2B1AH 4IOFD 3IU3A 3SJVA 2O5XH 4CSPA 5ACZA 2DQHL 2Z35A 3WTTA 1HOCA 2C3VA 1NIFA 2JKXA 4FABL 4M93C 4UT9H 4EIZC 1I7UA 4C57C 3R8BB 1NLDH 5HYIA 3MREB 2CHDA 1FIGH 4UTCA 1U92A 3M7OA 3GSVB 4PS4L 1KBKA 1HYSC 1RZGA 2ATKB 1FH5H 1Z9LA 1DFBH 1WAAA 2KMWA 3P0YH 2Z31B 4FFWC 1OAYL 5HGGS 3LRKA 2DQIH 4LAJH 4F7KA 3UIYA 3WKYA 5AEAA 1JGEA 2ZSVB 4UTBA 4W4NA 1REIA 2QKSA 3GJEB 2F2HA 2ESVE 1JWSB 2DQTL 1I8UA 4PJBA 1RJYA 2VLRD 2VDPB 4RGND 4HUVB 2EICA 3F7VA 4GP5B 2IBGA 3N5AA 2WXQA 2LW3A 3HI5L 2YGNA 4PW3A 5EO0A 1D7FA 3O6KH 5GGVL 4LDEB 1E6OH 1TXKA 1BCIA 1JHTA 3QORC 4YDKL 1ASOA 3UIZA 1CGUA 4MQSB 1JXJA 1H6TA 4EUPA 2YSSB 5D7JB 2F53B 1NC2D 2X3BA 4N68A 1DVTA 2BNQE 3GBML 2OBGA 3MJ9H 2AGJL 1X7TA 4ZJ9A 1HQRA 3BIKB 3KEHA 4P23D 3DIFB 2HP4A 4KQ4L 1Q9LB 4DPRA 2B39A 1X9QA 2ZUVA 3WHE1 3VD4A 4ANVA 4ZMNA 2WXJA 4UBDD 1PZ2A 5D7LE 3L9RA 3V4UL 4HC1L 1PY9A 2CO6B 1R34A 3C5JB 1I82A 5EA0L 3RWIA 4GLRI 4EOWL 3GSUA 4PR5B 2AQPA 1MXDA 1TG8A 3K74B 4LOEA 5D9SA 5J11C 4XPHH 3GINA 4JRWA 5DT1H 15C8H 1GKOA 5G5DA 2XIBA 1L9SA 4YK4B 4MFHA 1TCRA 2HN7A 3U48A 5KTEH 3D6GA 1JHLL 2H6PB 1SM3L 3TV8A 2DEWX 2WLLA 4E9VA 5AKVA 4D0BB 5DGQA 5EC1A 1MY7A 1KXVA 4HH8A 4PGDB 4IGBC 4NYLB 3D1MC 1O6VA 3HAEB 4UTBH 3TVMC 4BFJA 3S9DB 4G8FA 2ZCHH 4DERA 1QBMH 3CHQA 4IM8A 4MZ3A 4NQQA 2AKRB 4G9FD 1JTOA 4TRPH 5KS9B 3QIUC 1TKWB 5ESQB 1T3FA 4PS7A 4KFZC 1T0NA 1LO5B 4X0KA 3C60A 3CG8A 2C1OB 5DJDA 3ZRFC 1TQCB 2Y07L 2XICA 1FP5A 5I1AA 4EUPH 3NFPA 3QFDB 4HZLB 2D03H 3Q0HA 2XPGB 2EC9U 4APXA 3SE3A 3ULSB 3VJ6B 1BAFL 1G0XA 2KERA 4HJ0D 3NYKA 4HGWA 1E8ZA 2HZHA 3GK8H 2EE0A 3PP3K 2X4UB 1OTSD 2XXGA 3D3VE 5I2IA 5IB4B 3Q1SH 4ZXBA 2EDOA 4R7XA 4N8UA 5BS0A 4E9SA 4W9LC 12E8L 2V17L 2K8MA 4N0UE 1N6UA 3PABA 2P24A 3FYIB 2FSDA 4YZFF 4QAWA 1FSKC 3CXDH 4NQXB 4J8QA 4W68A 4H1LG 3ZL2A 1OARL 3QCTH 4HS3B 1Z9OA 4Y5XC 2A74A 3MLWL 4H20H 4Q9BA 5CF3A 1I7ZB 1GTNA 1B0RA 4AQEB 2BVOA 2ITFA 1DQQA 2UZIH 3CVDA 4TPRH 2JKNA 2K45A 1RCYA 3SHSA 4G8EA 5DJ8B 1H6EA 4LCYB 3VXMB 2GUYA 5D5MA 3SJVE 3NQKA 3SKOA 5JW5B 4NZJA 2WLIA 1BYOA 2E9BA 2VERN 4LRIC 2AZUA 4XNXL 3T6VA 3WUWB 2XG5B 1KC5L 1SLWA 1S9YA 2VN6A 3AZUA 4NP4L 1PG7X 1PJWA 5CR8A 4CRPA 3WTUA 4ZUWB 1K3ZA 1A4KA 3JUYA 3RX5A 3KYNA 2YMTA 2WLYA 1AGDA 1KIQB 3TNNB 3UTZA 4EI5C 5J13C 5KZCD 2UZYA 3LZPA 1WAAE 4TV3A 4OM0L 3ZTJG 5EN3A 3KL5A 2QQKL 2G3NA 4DWHA 5JXAL 4M43H 4NJAH 3T8XA 1TYRA 4NN6C 3C12A 5B1AB 3UC0H 3I75B 4A7GA 3DRTA 1M9SA 2WBXA 1U8PB 2ZT9C 3TJEH 4IIZA 4XGZB 4PJBE 4Q9RH 1QA9B 1IFGA 2WNXA 4RISL 3V5KB 1HHIA 1SJHA 3R1GL 4WWKC 3O9WA 4WF7A 1J0ZA 1T6BX 3BX7C 3DIVA 1UUSA 3C6LB 3REVA 3GIVA 1Q94A 1INDL 2ZE0A 3NZUA 5D7KE 1CR9H 4WAFA 1NC4B 3GXPA 3TX4A 1FG2A 4YHIB 1BIHA 1NBVH 1PZDA 3CH1B 1BPVA 2VRAA 1A65A 5AVRB 5I76B 3O11B 3S96B 3HR5A 1JBJA 1OALA 1KJ3H 2J3SA 2NX5E 3H6AA 3HCVB 4HKBA 1T5XA 4P2OB 3X3GH 4F58H 4KX7A 4JDZB 3B9VA 3FRUB 5E9DD 2OXGA 4PRPB 2H1LM 5BRZB 1USQA 1S9VA 1CFQB 1F58L 3VGFA 3D4GA 3QK0A 2WB7A 2YZ8A 2NSXA 4F3FA 2VCOA 3OKLA 2OMZB 4IMLA 2PWHA 5DHVB 2GABA 3DVNA 4L4VA 4JDEB 3RLSA 4NB7A 4HOZA 1Q0XH 1W72B 4MJ2A 3DROA 1UT9A 3KXFD 4OY9A 3KPOB 3QZWA 1FVCA 3BWSA 4HK0A 5EC2B 2VKWA 1AIFB 2R8SL 3LMJL 1X5MA 2GY5A 4NN7C 3RIFK 4DP5X 2AMUA 1L6PA 3BDYH 3L1OL 1AXSA 2R23A 2VUKA 3HNVL 1NWOA 3NPSB 3N40P 1N5YH 4PEEA 1UZ6F 3MRFA 5BOJA 2XQBL 4FTDA 1FNLA 3GSQB 1X5GA 2IG2L 3ARFA 5D71H 3TFBA 2VDNH 3P2TA 2XVBA 3BUPA 1OQXA 3ROOB 1CBJA 5I8CA 2AXGA 4FZ8L 1QR1B 5CWSA 2QVFB 2E9JA 5L2KA 5FUZL 5E08L 3CDGA 5DSCB 4F5CA 4P5SA 5LAXB 2Z1PA 1JGDB 5DZVA 4IKKA 1B4JL 3W9EA 2YRZA 4Y2LA 3D87B 5D7IA 1HHHB 4LESA 4JM2C 2AJUH 3C87A 1NGXB 4B9IA 1VKXB 2WPGA 2Z8VC 3IEAA 2F18A 1UZ8B 3BQUA 2BNRA 2WO4A 3I9GL 2OMYA 5DEFA 1CICB 1AR1B 4APQC 3B7RL 3TCLB 2YD0A 3U4AA 2F5AL 2XRAL 3N44F 3PHQB 4P5TC 1KTLB 1KFGA 1IE4A 3RZCC 1MXGA 1RUML 2X6AA 1XFPA 4YO0A 4NJ9L 1T0OA 1D6VH 3C5ZB 2ZXBA 1T1WB 3CVBA 2AJZB 2RQ8A 4FQLL 3QIBA 1HEHC 4MXWL 4NT6B 1K8DB 1ZE3C 2PW2A 2WTRB 3N9GH 3RPIA 5BS0E 2PTTB 4E41A 2EVFA 1G7QA 1JPTL 2BJMH 3IMUA 3BD4A 3HHMA 3IBOA 1F02I 4X4KA 5LBSA 4YSEA 4HOWA 1WZMA 4NKQB 3EADA 4NO3A 5BXFB 4U49A 4NX0A 1R3KA 1FL6A 3WYRA 2MQ0A 4LBEA 4HXBL 3DLQR 4QXGL 1W2KT 4AXWB 5D2NA 1S5IL 3T8MA 3V0EA 2AMGA 4XXCC 2HG5A 3BP4A 1CI3M 1BVLA 5GZOA 3GGWA 5AG9A 1MHCB 2WXLA 3DV6B 1OGAD 1G7MB 1VGKA 5D5ME 3V6ZA 1THAA 1BF2A 3BH4A 4XBEH 2FBJH 2X7LA 1FFOA 3AXLB 3JTSB 3QC5X 5AW8B 1K85A 1T20A 4E36A 4U1KB 2YK1L 3N50A 1NGZB 3TFKD 3T0WA 1CF8L 5KYYA 1O5PA 3MX0B 3PWPD 1I4FB 3MXWH 4WVRA 5FW8A 2ZOUA 4K3DH 5FUOH 4JFYB 2BX5A 4NENB 4W1TA 3IE9A 1CL7H 3LKQB 5IG7B 3SE4C 4ALAL 1QP1A 1YEJH 1UACH 2ETWA 4TVPH 2EH8H 2PYEA 1KT2A 1MNUL 4O2EA 1CTNA 1K4DB 1U8CA 1YEFH 2J73A 4L1BA 2F5BH 1RUPH 3BUTA 1XEUA 2NY5L 3HRPA 3O0RL 4UILH 3UTTD 3L4CA 3RTQA 2BXZA 3T6XA 3ZBMA 4FD0A 4YIQB 1SJEA 2WXPA 3LIUA 3R4RA 4XP5H 4U4BA 1H3PH 3C75A 4XOEA 4R26H 3GFUA 1QMUA 1L4IA 4ZSOA 4GG6B 3GMPA 3P54A 4JFZL 5LBSH 4NDMB 3VW3H 3LRGA 3KPPA 1MFDL 3OJDA 5BMFL 3QWNA 4MA1C 5F7MC 1FBIL 2R29A 5HY9A 4J3XA 1TU2A 4IBYA 1XGYL 1F3DH 1DVSA 2VQ1B 3NJGA 4MVBC 4XMUA 3L4WA 2VDOB 5E24E 1V3KA 4HIEB 2D31A 2R1YB 5IB5B 5C0CA 3IM1A 5IBLC 3FCBA 3GDBA 3CZSA 4L4VE 3BKYH 1YN6B 1L9TA 1OTTD 4YHKH 3EH1A 3NJMA 4BXSV 1CTOA 1IAKB 5JOEA 4L0PB 4N25A 4HISA 2OMBA 2ZKWA 2D4FA 3MLVH 1MCDA 3MYJA 1D5IH 5F9JA 1CIDA 1IV8A 4LSQH 2AJSH 2EDWA 3BVTA 1ROCA 5T1KB 4KRPB 2NZIA 3FHQA 4ODTL 1JTPA 1YEHL 4XMTA 3N44B 2ARJQ 3EOTL 3SPGA 2LFGA 2H1PL 3CFDA 4YXHH 2HB0A 3QULB 3GIZL 4NXSA 3BJ91 5K9QG 1HH9A 5L2KE 1J12A 1S3KL 2QELA 3NJIA 2KPWA 1GXEA 3TO4C 3HC3L 3IYLW 1QW9A 1A3RL 4L8SB 4N6RA 4MJ6B 5D6DC 4AT6B 3CSPA 3V4PA 4WKXA 3AXHA 1J0IA 5FYJE 1OE1A 2OR8A 4YBQD 2BNRE 1IT9L 4TVPE 3RVWD 2YKLH 3DV4A 1A4JB 3MNVA 1L5GA 3K2UH 4IQHA 1WH0A 2AANA 3BE1L 1IX2A 1CZ8H 1I9RH 4U6HA 4HJGB 1TO4A 2FUQA 2R29H 4EDWL