1TJXA

Crystallographic identification of ca2+ coordination sites in synaptotagmin i c2b domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
156
structure length
156
Chain Sequence
SGGGGGILEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic identification of Ca2+ and Sr2+ coordination sites in synaptotagmin I C2B domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
molecule keywords similar to synaptotagminI/p65
total genus 31
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2004-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1tjxA00
4QJ5B 2Q0ZX 2CHWA 4F93B 4L2YA 2WXOA 4G11A 4QJ3B 2LHAA 4LDCA 4Y1TA 1DJIA 2FK9A 4FULA 3R7QA 4FADA 5JHAA 2WXGA 1CJYA 4FJZA 1W16A 4J6IA 2K45A 3CSFA 2NQ3A 1E8ZA 4FA6A 2WXLA 3OHMB 4EZLA 4OVUA 1GMIA 2KI6A 1E7VA 2CJSA 2X38A 3QR1A 3QR0A 3ZW3A 3OAWA 4ANVA 3F04A 1A25A 3JZYA 3ZVVA 4LT7A 3IM1A 3KWTA 2R83A 4QAMB 4BGDA 3B7YA 4A55A 3IBEA 3PFQA 2QZ5A 2N1TE 4XE0A 1QATA 2B3RA 4TS6A 5CCJA 5EDSA 4HLEA 1V27A 4BFRA 1DSYA 3F01A 3QK0A 2K4AA 3RPBA 3W57A 3DPDA 2A5UA 1E8WA 4AOFA 4ANWA 2WXFA 2UZPA 2K3HA 1HE8A 3NZSA 4ICXA 3NZUA 4DK5A 1DJWA 2WXRA 5CCGE 4KZ0A 3L54A 2WXHA 1DJYA 3KWUA 3W56A 4HVBA 2EP6A 2CHZA 3ML9A 1K5WA 2CM6A 2WXIA 3TWYA 1QASA 2A4ZA 1DJZA 2Q3XA 1DJHA 4L1LA 3APCA 4PS8A 3ENEA 1UOVA 1E90A 3L17A 4XZ4A 5G55A 2JQZA 4AJWA 2YRBA 4KZCA 3HIZA 4FLHA 4F1SA 2NSQA 1BDYA 1RSYA 4WWOA 2RD0A 4IHBA 4L1BA 2Z0UA 3F00A 3N5AA 4XX5A 4L23A 4TUUA 5T8IA 2ENQA 2YOAA 5JHBA 3MJWA 2NCEA 1E7UA 1E8XA 2Y3AA 3QJZA 3L9BA 3S2AA 2BWQA 2CM5A 2D8KA 4WAFA 4URKA 4GB9A 3TJPA 3FDWA 3QAQA 2DMHA 4FHJA 3ZIMA 5KJ7E 3PS6A 4JPSA 3NSJA 3GPEA 4PS7A 4EZJA 1DJGA 1TJXA 2ENJA 2QZQA 2ZKMX 3HHMA 4MJJA 3R7RA 1UOWA 1WFJA 4V11A 4ICWA 1E8YA 2WXKA 3FBKA 3M7FB 3PRZA 4FHKA 2CHDA 4WWPA 2WXNA 2V4LA 1W15A 2CJTA 4IQHA 4OVVA 1TJMA 5CCHE 4GNKB 4EZKA 4ANXA 4NP9A 4TV3A 4NPKA 3RDJA 3L13A 4WWNA 3L08A 3ML8A 4F91B 2WXJA 2WXMA 5H4YA 5G2NA 1WFMA 3APDA 4FJYA 3T8MA 3APFA 4QJ4B 3CSTA 1YRKA 4NPJA 3L16A 1BCIA 2FJUB 3L4CA 4PS3A 4LCVA 4Y1SA 3QARA 4NS0A 4DNLA 4KITB 1RH8A 2DMGA 3LJ3A 3DBSA 4ANUA 4WEEA 3TL5A 3PREA 3HN8A 1UGKA 5H4ZA 2ENPA 2K8MA 3SD5A 1BYNA 3PYCA 3F05A 1DJXA 3P2BA 2ISDA 2CHXA 2WXPA 1DQVA 2WXQA 1RLWA 4F92B
chains in the Genus database with same CATH superfamily
4QJ5B 1ZT1A 3N41B 1NMCC 5E5UB 4A7GA 3LZFL 4NO0D 3P77B 4PTTA 2RTTA 2CDEB 4AL8L 1NQBA 1DBBH 3WN6A 1I9IH 4ODTH 4NO5A 2Y06H 4X7TA 3CSFA 2JB5H 4PIBA 1W0WA 5MEOB 1QEWB 1IM3B 5T1DL 3MUHL 3QDGB 5DFTA 3ABLB 3RVTC 3KYKH 2EYRA 1CFQA 3LIZA 2DYPA 5MEND 4OV5B 1U8OA 1MG3C 4XVUC 4P99A 4U3XA 4R7LA 1T2JA 3QORD 4HBQA 5I0WA 4TOYL 4YR6A 3TO4A 1M6OB 3MAWA 3NEXA 1A6TB 4NLAA 1NLDL 3A5VA 4PJAF 4DGIL 1I9JH 4I2XE 5KBKA 1XCQB 1S78C 5CGYD 3WSQH 3D08A 5C7ZA 1G7PA 4JG0H 1LP9A 4TTGA 3RBSA 4QYAA 2NY7L 4L5FE 2EXYD 4CN4A 5C1MB 4DP7X 5D6CA 4IMLA 1I1AA 3L4WA 2O30A 4AUYA 4Z7NB 4K3JH 1U8IB 3IF1A 5KYUB 1YEHH 1CE6B 2LV4A 4JREB 4PB0H 1EEZB 3NP3A 1TEYA 1MI5E 3TBTB 1NJ9A 2XTLA 1QLFA 3ABKB 2YK1H 1H5BC 1EANA 1KACB 1GPOH 2IH3A 4HZAA 2CLRB 1BP3B 3FUMA 3ZKNC 1LEKB 1E7UA 5KVFE 2V2XB 3ARDA 4X4MA 5GISL 5MI0B 1XF5A 5LBSH 3D25B 3A47A 2EYTA 3LXCA 1A1NA 2IBGA 3KG5A 1AAJA 3DX7A 4DVRH 4ZK8A 1KB3A 1MCLA 1F6LL 2TSBA 3BPLB 1OXYA 2FBJH 4PRPA 3VXRA 2J72A 4MA3A 4DUWA 1CL7L 5GZND 5TGBB 2A0LC 4YVUA 3FSOA 3MRKA 2XXGA 2EE2A 3WYRA 1XR8B 3IYLW 4CBZA 2QTVA 4KKQA 2V3FA 3RA7L 5TK2A 3CHOA 3Q6FA 4FXGC 5DRWA 5T3ZE 5D1ZB 1SVZA 4MXQC 3PGDB 3GZQA 1DVXA 4FFZL 1FAIL 3L3OC 3SDXF 1YAIA 3W9DB 4BH7A 2BSSB 1O6VA 3RFZC 1RUMH 4P5TC 2FR4A 2R4RL 1LJMA 4F8PA 2V0AA 4MASA 2ITDA 5FF6A 5JUEL 3W2DL 1RJLB 3CC1A 2ID5A 3K5SA 4RGMC 4YC2C 1PLGH 2F5BL 2H41A 3DOIA 5D55A 1FL5A 2QLYA 1GGBH 2DTML 3ZUNC 5EOCJ 1VEOA 1RFDL 3N42F 4H7VA 5EMYA 1MH5A 3TJEL 2R2BB 4ZX5A 4JFYA 1T83A 2EC8A 5CBEA 1URZA 4LCIL 4PJ8D 3WIAA 3PWLB 4QIRA 5IEHB 4XCYB 5EZOH 1TFHA 3D3VA 4G1EB 1L6ZA 4AIZA 1NIAA 4E9QA 4LP4A 2Y2TA 3P0VH 4AG4H 4NKDB 5I26A 2K4WA 3V4LA 1GAFH 3OLEA 4E0RB 4YSOA 4Z5RB 1E9QB 4W81A 3MLWH 4OZGF 4QRSA 1XAUA 5F1IB 3A0OA 5CCJA 2B1OA 4BEIA 3NEEA 2VWEC 1SXAA 3X17A 3UZQB 1TEGA 3RPBA 1TT6A 2XACC 2PKDA 3IEAA 2Q7AA 2BH0A 5FAAA 1OD9A 4TULL 2R27A 5D93C 2EVFA 2NY1D 4AGQA 3Q2VA 3H9HA 5CEZD 2QSVA 1HKFA 3NAAH 3N6YA 1NBYB 2WN2A 4A2GA 3CX5J 3E2HC 3QS3A 1IBGH 3BWAA 3KYOB 4JN1H 5E08L 4GKSA 4G6KH 4LLYA 1FNGA 1CQKA 1LEIA 2YEQA 2EKSA 2DWEB 2XZQL 4QNPE 3X11A 2E27L 2ZXDA 3DTUB 2O6FA 2IH8A 2XCMC 3CWGA 3OLDA 3SODB 2CM5A 2F5BH 3KCWA 1QPPA 5IHUH 5E56A 3KW7A 5FUOL 1IGML 3GB7B 4QXUH 4JNXA 2JCCE 1C8PA 4K2UL 5EEXA 2AITA 3UABA 1HOEA 1WFJA 1AD9B 2VM9A 1UEMA 4AX3A 4JDVA 5GQBA 3ZTNH 5L4FA 3L3GA 5HYJA 1NBVL 4FQ1H 4GAJH 3LZNA 3MJ9H 4ADJA 1MRCL 2XRAH 4JM4H 4OUUB 4AT6A 1HWWA 2Z92A 5EU6B 2QPEB 2O5YH 5JIQA 1E9OB 2WJ5A 5F71A 3ORJA 1A6PA 4Z7OB 4IK7A 5TDNA 2YQBA 3MNZB 3TCLB 3BH8A 3VXTB 1GS8A 4R5TA 2WSKA 2BNRE 3ATDA 3WS6C 2I32A 3ZE1B 3B2VL 5H35B 2EEXA 3WNPA 1MWAA 4U1IA 5IB3A 1JV2A 4MDIB 2EDOA 2YFOA 4UCFA 5CIPH 5DZLA 1PYWA 3QT2A 4JHUA 1DJXA 3NCCB 1T04B 3UG4A 3TVMA 3HG4A 1CFVH 3M17B 3C2SA 1BZDA 1Q94B 1KEMH 4M5YH 4YGAB 2F74A 4KQ3L 3I02A 5HHPB 4EUPG 1T1XB 4FFWC 4HKJB 4OGQC 4XP5L 5CSZB 1FNEB 1W72B 1LWHA 5DQDL 1MHCB 3CDFA 4GI9A 2N7SA 3OMIB 4S1SH 2P46B 3KLSA 3IDUA 4GKOA 4HISA 2A1WL 1TVHA 1Y6KR 2H1PL 2YD0A 3LNDA 4JM2A 4OU3A 2KS0A 4C55A 4UB0L 2P45B 4WJKB 2YAEA 5B22A 3BIKA 4YSSA 3KYMA 4RFOH 4FI6A 4JO1H 4ODWA 4FMVA 3Q1EA 1L6XA 1A6ZB 1HCZA 4YEEA 2GJ6E 4K8RD 4WI4A 5IESL 3VD9A 2AJYH 1T1WB 4JFHD 4ELDA 5A16A 5J3HC 3ARGB 4PI2A 1HNGA 3TEYA 2CO2A 4HIJB 5T1DH 1RK1A 2KMWA 3DPBA 3TONA 1JPFA 1SGKA 3HC3H 2Y06L 3SE8L 5CLZA 4UYPA 3C60D 4Y8DC 2BP0A 1T6WA 2I24N 2R23B 3GKZA 3NACH 3PWNB 4IDLA 3KCPA 3G9AB 2E7MA 4WFED 1H3PL 3RZCD 3O2VH 3CE1A 4R97C 4XNBA 1JXFA 3BT0A 2M8XA 1WSST 5ACZA 2P5WB 4Y4HD 1RURL 2XPYA 3F12B 4I0CC 2WQAA 4JZNB 5ETUA 2X1WL 3QIBA 1JK8A 4UTBA 1EBAA 4UT6A 1DBAL 1WJ3A 2N1KA 3CC5A 3GEWB 1KPUA 3B3IB 4N5UA 4LOUD 5C9JB 3IAQA 2VDNH 1C8QA 1IEAB 4MXWH 3V8CA 1TVHB 3NN8B 4K3DH 3EGDB 5AAWC 3TGXA 1A14H 4YDMA 3MU3A 4YHML 1G1CA 2CCVA 2VDQH 2M2DA 4U3SB 5ANMB 5I0ZA 4KPHH 2VGLM 2WY3B 1JCVA 2OP4H 2RCSH 5TK4A 4WLCA 2GW5A 2JF1A 3DGGB 3QUKA 4HKJA 5CS7A 3WBDA 4HZLA 1QFWI 5JW5A 2VMEA 4WF7A 1AHWA 2VE6B 4G1MA 1M71B 1S5HB 5CZKA 4JFDD 5F0JB 3U4BL 1Q38A 3NEOA 3UAJD 5DJCA 5E9NA 1OM3H 5JLZB 3HMWH 4LPXA 4M48H 2EXWD 2MQCA 1X7TA 4YAQB 3EXJA 4LAQH 1SQMA 4KMLB 5C0EA 1CLCA 5TD4A 4X7TB 3SDDB 1MWAB 4ZW6A 1UA3A 4RMTA 4J12A 1E8ZA 1CLZL 1G1KA 5ITBL 4WV1A 1IGIL 1ANUA 4X6DB 4WSJA 2A6KB 5IB5B 5E70A 3OC5A 1PLAA 2PW1B 4LT7A 2OXHA 2NX5D 3IETB 4FFTA 4PS4H 1S5IH 4KJYB 1AZCA 2OL3A 1U33A 4BRVA 3BKJH 2WO4A 5A6MA 1C16A 4NQVB 2NT1A 3LH2L 2HJFB 1KSRA 1FRGL 3ILEA 2J44A 4CVWA 4JKWA 4NUMA 3JWOH 4G8GE 1FE8L 1OEZW 1Y0LB 3G5ZB 1UZ8A 3DX8B 4JFFD 4LQ1A 4OZHB 3STLB 4DK5A 3RKDC 4S0HA 1NDTA 1JUFA 3NZHL 4Y9EA 4EDWL 3IFOA 3WIHL 3QZWB 3L7EA 4LCWB 3RIAF 4BHUI 3BZFA 4YXHL 1ADQH 3PE9A 3LRKA 1JZ5A 4U6VL 3I9PA 3KLHC 2ZICA 2OFQA 5DJ8B 5C0DA 5G55A 1R5VA 4K23H 4ZW3A 4PJDE 1GYWA 1SXSA 2H45A 2O72A 4IM8A 1IJNA 1NPJA 4LZKA 3QEGL 5IMLA 3N5AA 1V3JA 2FIKA 4G6AD 3CQQA 1LEIB 4A7VA 1HZHL 1PZBA 3US9A 4Z7OE 2NCEA 3SDXE 2EC9U 2A73B 4JW3A 1XR9A 4MSWA 1NC4D 3QA3B 4ODSH 4Y16D 4NO0B 4KZDL 2PXYA 1AI1L 3RL2B 5B3JE 1LK2B 3EGDA 1JZDC 1LYQA 4QO1A 2C1OA 4G71B 4WFEE 3ROOA 2MCPH 1ZDQA 3INUL 1G7MB 1F4XH 3WE6A 1RP9A 3TA3C 1ILSA 1VZHA 2WBJC 3BP6A 4KNTA 3IGAA 4ES9A 4OD3H 3O9WB 1ORSB 2NXZB 3BFOA 4Y9CA 3WIHA 1ES0A 4AEHL 5DJXB 5EORL 3WJMA 1OKEA 1SEQL 1IAOA 4KFZC 4U6YA 4AQ8A 4EZKA 4GQQA 5DD0L 4MMZC 4H26B 4LASL 4OJFH 1P84J 5FIEA 3AT8A 1SZNA 4BD4A 3MOAH 4ZMYA 2DS4A 3V0DA 1YPZF 5DJYA 4F1ZA 5EUOE 4UQ3A 1AFVH 4MZ3A 4EDWH 5C0BE 3LD8B 4R7DB 4GG6B 3NCWA 4Q9QH 5ENWA 4RIRB 3Q3GB 3KVDD 1F3RB 4Y4KC 5LGJA 4HCIA 2KT6A 2A6DA 2DQDH 4M7ZB 3QWOB 1ZTXH 4JVPA 1NEZB 1ED3A 4W9IC 2R2BA 2AABL 1TZ8A 4QTHB 2VWEE 1E6OH 2K8MA 4J6RH 4RBPK 5I30L 1KGXA 1RHFA 2CHXA 4H1LB 2IDSA 3K2KA 4MRCA 3AGWA 1S7XB 5F9OH 4J2QA 2ICES 3FU5A 3LHAA 3K8MA 1XDTT 2YXFA 1XV8A 2DW5A 2F8VA 3LN4A 3W9DA 5EFIB 3ZRCC 1OZTG 3MC0A 4AENA 4AG4L 4QO1B 3S35X 3T8VA 5EZOL 2LAGB 4KDVA 3TA3A 3MUGB 1KJMB 5C0AE 3UIYA 1OSPH 4IBLT 2BHYA 3ME0A 1FFOB 5C0GB 4N68A 3Q8BA 2WKLA 3QS2A 3VXNA 1KDIA 3FO0H 1HAWA 3BN9C 3WTUA 4OM1L 1XZWA 1IM9D 3C8KA 1UUSA 3CFUA 2LFEA 4ZFFA 5BVPH 43CAB 4O9HL 1E50A 4KZEH 1GGIL 3UTPD 2OMYA 4DFIA 5D96B 5DD1H 3JVGC 3VD7A 5EF3A 1E42A 3V6BR 5CU9A 1YEWA 4N9OB 3TX4A 2WTOA 1JUFB 4KRPB 5GPRA 4BWUA 2XXMB 3V4UL 2XQBH 3INOA 3WFCH 3OR6A 1MVYA 1HXMB 1QO3B 2J88L 4KJWD 2ZX5A 3U1PA 1ZJBA 3TEZA 2Z93A 3NBNA 4PJCA 1I53A 5I9QB 5JORB 2FCBA 3DMMB 1N18A 2AK4D 4ERSH 1TEFA 4UAOB 2JCCA 2VZOA 5LCVA 3I84A 2CH8A 3IF1B 2A74B 3PWUB 4BE6A 1BYPA 1NMCB 4PGBB 4J6RL 4Z3GA 3RWJA 1U8JA 1PX4A 1RK0B 5EU6A 3E1ZA 2ZKHL 3UBGA 2PCFA 3ZKXC 3G5YA 5CSGA 4TKWA 3BLKA 4PRBA 2V4LA 1R1CA 1BM3H 1EMTL 2XG5A 3WS3B 1DFXA 2Y36H 3TT1H 2Q6WB 3QHTC 4KOBA 5JYLA 5D2LB 4IDJH 4GW5A 5FK9B 3X13A 1H5BB 3MR9B 5ALCL 3AGVA 1YMMA 4DP0X 4DERA 3DJZA 3C09B 1PZCA 5L2KA 1YEJH 1JMXA 4F58L 3MGOB 1U8HB 2YD6A 1JDCA 1JBJA 3QUKB 3POHA 2ETWA 3H2PA 1JHLH 1KIPB 2Z31A 5KYWA 3ZE0E 1SN0A 3RBGA 1MFDH 2CUMA 1JZ6A 3PGFH 2C3HA 3EGXB 3IE4A 4MMXA 3LXBA 3FO2B 5B1JC 5HJBA 3HR5A 5AW7B 2VLME 4TQEH 1JPTH 5D7SH 2QSQA 4FI7A 4FJZA 2VJ0A 4UDTB 3S5YA 4CNIB 3PHAA 3QE5A 3AITA 3SKJL 3O9WD 5C3LD 3GKWL 4WJ5A 3HUJB 1D5RA 2C1PB 3SDDD 3W11C 3DX3A 4GS7C 3RB7A 4M8QA 5GXBB 1I7UA 1LO2L 3FOMA 4J23A 1MUJB 3WKNA 5CN3A 4XX1E 3ECUA 4YPJA 3RJDA 3UTQB 5A3IC 2X6VA 1PIFA 5KN5A 2HMID 4R5XA 5LGJB 2EIKB 3FN0H 4M29A 3VWKD 1E8WA 1ZXKA 2J4WL 4QRRD 1I75A 2AQ2A 4Y5YB 1PZUB 3U0WL 4OKVA 2WWMC 4M5ZH 4L4TA 4FABH 4Z76B 4YO0A 1NCBL 3IGUA 1EFQA 5EUKB 3LKSA 1K5WA 3VCLB 2F54E 4ELKA 4EXPX 1OIOA 5I1LB 1KLFA 1Y07A 2RQEA 4L4VA 1FYHB 4TVPD 3BOVA 3IMWA 3ENEA 1ES0B 3II2A 1C7TA 5GSRA 3UTPE 1QHPA 3LKQA 1Q9OA 5L7XL 1OGAD 2EKJA 2ZXAA 4P9HC 1IQWH 1XSOA 3S5ZA 4MQ7A 4D9LL 4PLNC 3BN9D 5HYIA 1CGUA 4JG9A 1I7TB 4YC2B 4F7TB 2GIYA 1RZ7L 3GMNB 3QAQA 5E6ZA 4ZFOB 1I8MA 3RY5A 1S9KC 1A02N 2X3BA 1QQDB 3PWJB 1N3NA 3KPMB 4HUUB 1DBJH 2XIIA 1DDHA 3PU7A 2E7LA 3VX1A 4ETQB 1KC5H 1R5IB 4ZUSB 3S3SA 3FQ1A 3RL1B 2YMXL 3NJNA 5FLUA 4LBAA 4ZUWA 2BZDA 4BQCA 2DY2A 3I3EA 3L3HA 5D7HA 2FEJA 1A1NB 1FFTB 1CN4A 4J7RA 2HKHH 5HGBB 4X7SL 3UCQA 3RVXC 5AOJA 4J3VA 4ZMLA 4I77L 1IV8A 1SMDA 2APXA 2WYHA 3SSGA 4AY0A 3B9KB 3QDJB 4S11A 2DOCA 1IBFA 4KMQA 1WC7A 5TTRA 3APNA 2G2NA 4GMTL 4MX7A 4AV0A 4M7JH 5SV3A 5F3BA 1HL8A 2PPAA 3NSXA 3GZKA 4OF5A 5I8CB 4WV1B 4AWJC 1OZUA 2ICWI 1CC3A 1ICTA 3F6IA 3G6DL 5DHDA 3VQLA 3U79A 4JDVB 3D4ZA 3NABL 2EUXA 3U36B 4HPOH 5FUZH 3QAZB 4GRLD 5D1ZI 4BK5C 4A2EA 1SHMA 1K5NA 3VG0H 3G08B 3BAXA 2BNUB 1U8OB 2G9HA 3FRPG 3KLLA 1JWUB 4BGDA 1ZLSL 4YSAA 1VKXB 1DUYA 4DO6A 3Q8EA 4KDTC 4UT7H 3S96B 1UFGA 1NUGA 4LMQI 2B0SL 4FLQA 2QLVB 1NDGB 2VXQH 2W81C 4EI6A 2L7EA 4H25A 5I1HL 5KYWB 2WTRA 2FX7L 2XUWA 4PTTB 2A1WH 1ZHBA 2H1PH 1I3UA 4KK9C 2C3VB 1CD0A 1KXVC 1MHPL 1OANA 1SY6L 3EJYC 4S1SL 2P5EA 4PGBA 3ZRSA 1JRHI 2K9FB 2X4TB 3IT8D 2OL3H 4Z7VB 2DWDA 1I9RL 5F3HA 2K7PA 1AHKA 3P73B 5EU6D 4NWTH 1F2QA 1QBBA 5INCA 1KCUL 4PWJA 3V8OA 5GGVY 4DN3L 4HJ0C 4MNHA 5EU5A 4FXGA 3ETTA 3EIFA 4LOFA 1N5YH 3EO9L 3L9BA 5FB8A 1EHLL 5JHDA 2FQEA 4QRQB 5DR5H 3LKOA 4OGXL 1IBHA 1OHQA 3LV3B 4R2GB 1PKQE 1D7FA 5GGTA 1ECZA 4NWTL 3M1BB 4KTDH 1HEHC 4ZMZA 1NCWL 2HPTA 2H7WA 1EAJA 1X4YA 3WN5A 1K9TA 4F20A 3E6FB 2XKNA 2J71A 3UC2A 2FX7H 1J0ZA 4NI3A 4J4PA 2Q2EB 3BKML 3UC0H 4BK8A 3QYNA 1R17A 4WUUA 4NFCA 4X4XB 5GS1B 2XWBB 3QUZC 2QPUA 3NH7H 2GTZA 3O41B 4XWGL 2GYSA 4WEEA 1WT5A 4F8LA 4OJAA 1EO5A 3C6EA 1A1MA 4RMBA 3N1GC 3NIGE 2A9ML 2H6UA 5J89A 1XR8A 3CPLA 1EGJA 2HXAA 2WP3O 4ZQTA 3BSZL 3PAZA 2Z4TA 2FHBA 1K4CA 3O3DB 4LCCC 1VIWA 3PWPA 3I6SA 4YO0B 1LTXA 4J3WA 3E8UL 2NY3C 4JRWA 4BUGA 1E9PB 3G6DH 1UQSB 3T0DA 2EDWA 3NABH 3WFBL 5C0RL 5AVQB 1NL0L 5L6YL 3TO4C 4OI9A 1KCRH 4FNQA 2EE9A 5SWSA 5L4MA 3OWEA 5F7EL 2AQSA 2VC2B 4RGND 1SXBA 4ZPTB 4JG1H 4F2EA 5DO2C 3UROR 2CLRA 2EDFA 4TULH 5INCB 1PFOA 4WW2F 1MJJB 3EOYG 4O5LL 2I07A 2Q8BL 3DPDA 3O3AA 1JGIA 1S7WA 1AGFB 4CVZB 1EEZA 5F97E 4B6ZA 2LR4A 2BC4A 3CFCL 4U1SA 1NGZB 3GRWH 3KWUA 4MMXB 4HJIA 1N26A 3MUJA 4PY7A 2PR4L 5E6YA 5C7XH 1UWEL 1Z5HA 1XR9B 4D3CH 4ELMF 1RZKH 5F7YC 1JZ7A 4U1JA 3FU6A 5FYLD 4EI6B 3KLKA 2ADFL 3DRTA 3D34A 1J05B 4UNTA 1NUNB 5GGQL 3PL6C 4JRXE 1DQJA 1GZQA 2XZCL 4M00A 5IJBC 1X6NA 3VFSB 4XN8A 3LDBC 1AC6A 1AXTH 2DMHA 4N4YB 4FERA 4X8JA 3WY4A 4YFEA 4JFQA 4NQUA 1BOGA 2OR7A 3AREB 4M8RA 1UA6H 3AXLA 2PCYA 2WQVA 4GUPA 1DBKL 3W39A 4D2NA 5GHWH 4QAWA 2WWNA 1O7SA 5CCHE 4MMYA 3ZDXF 4WI9A 1EFXD 4N2GA 4NQVA 4ZTOH 3EF7A 4WNQB 3EJJX 3T5WA 4NKOB 4GAGH 3QP3A 5F3BB 2GJRA 4FABL 2A74A 2JJSA 4NQDA 3WHXA 9PCYA 3L7FB 3FCTB 5A2IH 1OP3H 3SJVE 2VQUA 3HS0B 2ZCKL 5AB9A 5J1AB 2CNZA 5D1XA 1IKNA 1Y1DA 1SHXA 2UX6A 2YPVA 4W4NA 3K2UH 5I15L 1SJMA 1MCSA 5KBNC 4IRZL 4GAYA 2EIMB 1YYCA 1OAZH 2NY6B 5T1KD 2AJXL 4ANUA 4ZYKB 2V9QA 1D5MB 3O45B 1Q0YL 35C8L 3FQTB 1H0DB 1AGCB 1KNOA 1ULVA 2NYYC 1KIQB 2RH0A 3PV6B 4X6DF 2V2TA 5FFLA 1H3XA 5FO7A 4XCYA 1U8MB 1P5UC 2Y7MA 1E5BA 2OA9A 1AXSA 2R56L 3FKUS 1WWBX 3ILDA 3QORA 4CA4A 1IM3D 4I8DA 2GBAA 2Q3AA 2AF2A 5TE6L 4JQVA 2E6JA 4GXFA 3TM6A 1JG9A 1X3DA 4PCTA 1J0KA 3OAWA 1BW8A 1OAXL 4Q9BA 4A6YL 1WIPA 3CXHJ 2R8SL 2B1HH 3RHWK 5EZPA 1QKZH 1JD7A 1N2RB 4C57C 2WQWA 3LKRB 4MKTA 3F01A 3T0EB 5EN2B 3FQXA 5KG9A 2EYSA 2XVKA 5EBMB 4G5AA 5CUSL 2FLBT 1F58L 2QDVA 1O5DT 5F7BA 3VH8G 3ZHFA 1WTGT 2ADIB 3IKCA 4HS3A 4IRJA 4ZPVB 3GRBA 3P40A 2GB2A 5MEQA 1ZLUH 4YLQT 3Q48A 2ZPKL 2YD1A 4OCRH 2AS5M 1ETB1 5TE7H 2YPVL 1UYWL 2BOLA 2NY1C 3EDDA 4FLHA 4M03A 2FRGP 2NSMA 4KZCA 4OLUH 5JYMA 2BSED 1XGZA 3DO7B 1H6UA 1OAUL 1CD8A 4Z78A 5CD3B 2WQXA 4R7DA 1P4UA 2X0UA 2FO4B 2PTVA 2XFXB 3WFHA 4PRAB 4PRPD 5DMGC 2XJKA 1J8HA 4F5CE 5DURD 5F9JB 3KZ8A 1TQCB 1KPVB 4EO5A 2YWZA 4OJCA 2AQRA 1XF4B 2O6PA 1BM7A 1EBPA 2A6JB 2GJ6A 3ZPDA 3E9UA 5GSVB 4UQEA 3MV7A 2XBZA 3CU7A 3MBEB 4NZ8A 2NZ1A 4ONFL 1SJEB 2CJTA 2VLJE 3ZYOA 2W0FB 1C5DB 2R2EA 3L4UA 3VA6A 2QPDB 4K7PL 1YCSA 4JZJB 1KY6A 4WCYL 1SYVB 2FYYB 5KBPA 2IVFC 2L0DA 5KOMC 1ZTMA 1QMUA 2PP9A 2P1YA 1OW0A 1HDMB 4JQXC 4YR6B 1TETL 2E74C 3RI5F 2VZVA 3Q05A 2PTTA 1H9VA 1JGVL 4HUWA 5DRXA 4K7PX 1OK8A 4K71C 1A7BA 4OCYH 3LS4L 3L7EB 3EXLA 4BDVB 2VL5B 3IFOB 3PAUA 2B1HL 3CQFA 2YGOA 2LHAA 4JL2A 1YEIL 4P5KB 1KB5A 1KOAA 2YPLE 3QZPA 1VFBA 3GO1H 3EHBD 2ZOWA 3KPNA 4OCMC 4XC1H 5KBDA 4RAVA 5FGBC 1S9XB 2B16A 2IAAC 2XWJA 4J3SA 3QHZH 1YSOA 2DWYA 3WHXB 2GFBA 4XXCA 1CDHA 1HHJA 2KPNA 2NPLX 5A2AA 3FUJA 4RZKA 4XODA 4PR5A 4A2LA 1E9OA 4HXBH 2OCFD 4YHOL 4YSDA 3ZKND 4GQ9H 4NO3B 4KO6A 1QFUL 1MDTA 3IJYA 4MJ5B 5E94B 3R4RA 4XB7A 3OKLB 4HC1A 3B2VH 4AGOA 1GA2A 4YDZA 4PGCB 1T5WA 5C0EB 3VYOA 4WI5A 4QLWA 2DQJH 2VLJB 3FQWB 1XB6A 3TP4A 5DSCB 4HGMA 1F3DH 1R3IL 2VLRD 3GB7A 4Z7OF 5KANI 3LZPA 3L4YA 1OP9A 3D85D 1QLEB 1S7QB 2EADA 3M8OH 2EXYC 2CDFB 4ZMTA 1SEQH 5CMAA 4CMHC 4QHKJ 4L48A 5EU4A 3ZKMD 4PJIF 4W9EC 3OR7A 5ICZB 4GFTB 3MXWH 5CGYC 4RQQA 1PIGA 3RY6C 2EH7L 4JPQA 2AXWA 2CK0L 3HJEA 4N0UA 2DL9A 5B1CA 1K3ZA 5IY5B 3TURA 4XX1G 1F6AA 3ME0B 1PS3A 2MCPL 5HYJD 1E30A 3MLVH 4APXA 2H3KA 3LNIA 4XVUD 1EFXA 1HSBB 3B37A 3K2MC 4Y5VB 5KUKA 5E2JA 1HZHH 3MBXL 1SEBB 3JSSA 3PS6A 3C5ZA 1RP8A 2H47C 2X1QA 4OTXL 4UZUA 2VZSA 1QWUA 4XZUA 3GMMA 3G6JF 3SDAD 5JHLA 1IC4L 1NGZA 4ZO6A 2BC4B 4UNUA 2R1YB 4XXWC 4A38A 2WBJA 4JCMA 4P5RA 1QFWH 1N7ML 3HZVB 5JW3H 2CMRL 1RZPA 2NUPA 3EUDA 2X4RA 4YJZL 1OTUD 1OGAE 4MNGA 3WIHH 4BFBD 1NGQL 4JN2A 4P3DA 3S0PA 1M7UA 1CVRA 4OLWL 5DFVC 2FO4A 2E9JA 4LGRB 4P5MB 4IIQA 4PRDB 2WNGA 3MRLB 3SDXA 3EJQA 4G1EA 4GP8B 4K5MA 1EAPB 1IU1A 1U2YA 4HXBL 3ZYJA 5IB2A 32C2B 5BNXD 4PJ7B 5C09D 1EJOL 2MTPA 3WFEL 1T03L 1EEQA 4D9RE 1B2YA 4EMZA 3QRGH 1RQ5A 3PWPE 4BFFA 4CW1A 3EYVB 4ZMPA 4HHWA 3QEQA 4ZAKA 3GK8H 1QX1A 1F4HA 2CUAA 2FDBP 3UO1L 3NCXA 2I60L 4U6YB 1RJLA 3OVUB 2R29L 3ZRFC 1KGUA 4AW7A 1WGVA 3OTTA 4G7YL 1MPAL 1B0IA 1QHQA 4UU9A 2AANA 5DUBB 4YGVA 5I1CH 1PGRB 1E7VA 1LK3H 2YPLD 2X6AA 3PGDA 4HDIA 1K6QL 5C0BA 1E0OB 3MRCB 4OLXL 3V4PH 3ZKMC 2KUTA 3CVDA 4XAWH 3FJTA 2NY5C 2X2YA 3QA3A 1FBIL 4J3UA 2BNRB 4AKQA 2VXUH 4P2CG 2WVUA 1IL1A 3O2DL 3FTXA 4E5XB 5CSZA 4Y4KA 1S7UA 1CXIA 2HJLB 3N0PB 4MBRA 5FHAL 4DESA 1BD2A 2VO5A 4L1TA 2K3HA 3MRFA 1NC2A 3QCTL 2OP4L 2RCSL 1AE6L 4CSTA 4FKHA 5HJ3A 4YE4H 2AEQH 4OD1L 1Z9MA 1MDAA 2HVJA 4ONFH 1F4WL 2FBRA 3TCTA 2MNUA 4PY8J 5E9DB 2X9XA 3DK2A 4J3OD 1SVBA 4UTCA 4YBQC 3QR2A 1DQQB 4WHCA 1FV1A 2CPCA 4PN6A 1RURH 1C16B 2ZSVA 2W0PA 4HEME 2BIMA 1CPUA 5FA4B 2CBPA 4JRXB 3T3ME 2QR0B 1AZUA 2AJUH 3IETA 4OFQA 4DVRL 2LE9A 3SDAB 3QDAA 3FO9A 1P0SE 5DZVA 3G7TA 4QHUB 5KJ7E 4XCFL 5ECJE 3UDWC 3CGTA 3GPEA 1VFOA 5T5FL 3VD0A 1FAKT 2RIKA 3CXFA 2ROXA 3N85H 3QWRD 3MRHA 4TNWK 3RIFF 4BQ8A 3RUGA 1O9WA 1O0VA 1QEXA 5CJ8A 5AAMA 1CD1A 1LEGA 2YAFA 1DVQA 3V6OE 5KVGL 4RRPM 1NAKL 3FT2A 2NLJB 3T4AA 4MCMA 4PP2B 3T4YA 4H20H 4U2ZA 1OAYH 1VB9A 4UV7L 4YQXH 2PW2B 1JPTL 3CFJB 1EXUA 3GGWB 4FYTA 1BJ1J 5D1XE 3EO1A 5D7SL 1YEEL 4K71B 4QKXB 4D8PA 4X98B 2GABA 4JQIA 2LOEA 4K3JL 5I75C 4XWGH 1JZFA 1NFDE 2WQ8A 2W07B 1WBYA 3EFDL 4UTBH 1JYWA 3DV6B 3F7VA 4W1TA 2ZWNA 4BQ6A 3MOBL 1CIUA 3GTTA 4IKLA 4EUPA 1IE4A 1XO8A 4X6CB 3RY6A 1JPSH 1WBZB 4MB3A 1WAPA 4ZSOB 4F2MB 2VIRB 3FFDA 3A6BH 4DGIH 5CLYA 3QH3B 3QJHA 4HK3J 3CN4A 3VD4A 2IPTL 2CKBL 3MOBH 1LNUA 1WAAA 2WCSA 2ZKYA 3PWVA 4XP5H 2ZXBA 2H0FA 2BMKA 2JJSC 2YO3A 3MJ8A 2ALAA 3BEWB 3MLYL 4N2HA 5FYKU 2DQCL 2V5YA 1G94A 2GC7C 2NX5A 2Z35A 4J3OG 4M5YL 1JIBA 2C4XA 3CDZB 2IPUK 1ORQA 4OZ4B 5HY9A 2JELL 1YMME 5FUZL 4UYQA 3ILQD 5L2KE 3HAEG 2NXZC 4UAHA 3QDME 3UYPB 1CDBA 3MBWB 3L3IA 3ARDD 5JNYB 4POZC 4N1HB 4XE0A 4N0UE 1AO7E 4TS6A 2YUVA 1T66D 1WHOA 1LP9E 1CZ8H 2BDNL 2H3NB 1RZJH 5D1QB 3BJLA 5TQ0L 1L0YA 2XWRA 1I9RH 1M9SA 3N55A 4RSVA 5ESVA 1HE8A 4HKZA 5ANHA 5BRQA 1Y18A 4ODHL 3X12B 4KKLC 3W56A 3TH4T 1FUNA 2IH9A 4K5LA 2IAMA 4E9VA 4GUQA 2XSKA 4X80L 3MHZA 1MIEH 3K72B 1GVIA 4JL1A 2B0SH 3H9SA 5DTFB 2BOCB 3C5ZD 3H2WA 5F9WB 5CO1A 2BOBA 4X9IA 4X4ME 1V8HA 1VGEL 4Y9GA 5FUOH 5IQ9A 4JM2B 3HC2A 1X9UA 1L5GA 4P2OB 2NOYA 2P8MB 4GINA 3G9VA 3DOHA 1CICD 1XQ4A 2MOVA 1JL8A 5DZOA 2P24A 2NXYC 3O3BA 4G6FD 5EUKA 5H2BA 4PP1C 1IC0A 2JIXB 4UV4L 3FN9A 3M7FB 3WMPA 4LEXH 3L9EA 2RACA 3DX2A 3DBXB 1RMFL 1UCBL 2CIIB 4JFOA 3VXMD 5CJOH 4X5XB 1XB3A 1XWVA 3KR3L 4GNKB 5CP3A 3M17A 4JN1L 3CLWA 5IEKB 1I8AA 3MV9D 4OZFB 4LSUH 4PJ6A 3L08A 2ZUVA 3EJPA 4LIQL 5G2NA 1U8KB 3RGBA 4MDJB 3IN2A 2P8PA 4NO2A 4ZOEA 4X8CA 5EIVA 4WJ5B 5FKPB 2I69A 5L9DH 3C6LD 3FFCD 2WGXA 1AHMA 4Z7AA 3P2DA 4EOWL 1GAFL 4X6FA 3MLSH 2JWYA 4BQ9A 3NDYE 4KNUA 3EUUA 3F05A 4JLRA 3CUPA 3KR3H 1ZA6B 3AQZA 1KTLA 1Z3GL 5HHVL 3QUYB 1A4BA 5JPNC 2FGZA 3HZYB 3C6SA 4F9LC 4XMLL 2FT7A 2BSCA 1UKSA 5GRVK 4LLMA 1FZKB 5BUPA 1JPGB 1CJYA 1AD0A 3ARYA 1EEYA 1OT2A 1N7MH 1FZMA 1OT1A 5E6IC 1U8HA 4NB7A 2LT9A 2K8QA 3JV4B 3LNHA 5AW3B 1UENA 2A9MH 1AG0A 5D7EA 3BGMA 4PJGB 2W9LA 4BKSC 2XQYA 2EE3A 1PD0A 2X5PA 3O6MH 1AI1H 4LP5A 3QC6X 2ENYA 3ARBB 1Z0MA 4H8WL 3DXAE 5ALBL 4RRPG 2HRLA 2XG5B 1PD6A 5DCCA 2FWOA 1JNHB 2Q7YB 2Y0SA 5HHMD 3F85A 5GRVL 3GLAA 3SKNB 1IILE 1M3JA 3GLZA 3DK0A 3GT6A 3STZA 5ID0B 1R47A 2BVPA 4ZT1A 1RZ8A 2VDLH 5D96C 3GLEA 3MVSA 4JPKH 1RZGA 2R69H 2Y7SA 4N20A 3BMWA 4N8VG 2XZAL 2J4WH 1BIIA 3FTGB 4YL4A 4ATTA 1A2YB 5DWUH 5I1DA 3PLYA 5K9OB 5FA3A 2VR5A 4MAUL 3D0LB 4IDJL 2GSGA 5FYJE 3V6FA 3OL2A 4EI5A 2EUZA 3B9KA 1OD7A 2G60H 4Q2ZA 5IVZA 5F7HA 2V2WB 4M8UA 1J0YA 1OCCB 5IB1A 4XPGL 5C0JB 4DVBA 3P3YA 3VGAB 2YK1L 5HJ3B 3KVQA 1ZLWH 4KUCD 1P4LA 2PO6D 4N2NA 3D3VB 4AIZB 5GRUL 3EJSA 4W6WB 2NR6A 2NY5H 4KJQC 2LW3A 3PJLA 4HLZG 3T6VA 2YKLL 4ZZKA 4WWKB 3VE0A 1JTOA 5JW4Q 3MRJA 5ERWA 3PWJA 2KZKA 3AG3B 2BNRA 4YN3A 5DRNA 1JGEB 3MKGA 1W0YT 3MUGA 3B83A 1U42A 1ZPUA 3EKCA 4MD4A 3RNQA 5L4IA 1E3XA 3L16A 3LZRA 4EBQL 3P0GB 4K15A 2WMPB 3ARBC 1YYLL 4IJTA 1U30A 3W0WE 4K07A 2R1WA 3MO1B 6PCYA 4PTUB 3QJUB 1T2XA 1TKWB 3FT3A 1I82A 3VTMA 5AW5B 3TL5A 2BRRH 4N24A 5HI5C 5D1XC 3UTSD 3VG0L 1KTDB 4OGAD 4UTAL 3NDZE 2K6ZA 2WGNB 2WXQA 4H13C 3IGKA 1N4XL 4TNFA 2RA1A 1I9IL 4ODTL 4DKDC 2IALB 4TMPA 3VFWA 2Z31D 5ID1B 5B38G 4I3SL 2UXGA 2PMZA 3WNLA 3VMNA 4PJ9A 4LSRL 4OCLC 1J9TA 1UM4L 4B0MB 3L9YA 4P5MA 5EZJA 4R26H 1GGCL 1KG0B 4L4TD 3NFPB 5HDRA 4M1DL 3FB8B 2ZX8A 3GMPB 5IOPA 4Z7IA 1ACYL 1NAML 1A22B 4EUPH 3EJYD 4K94L 3QIBD 1YUKB 4KK9D 1RJYA 3GSNB 3CFIC 3JUYA 4LARH 5E1HB 5FO9B 4PG9B 3RWHB 5T5NF 3SKUD 2VDKB 4P9ML 3M6DA 2GITA 4PWGA 3TV3L 2VZTA 3VI3B 5DD1L 3WE6B 2BSRA 1KV7A 3HC4H 2PYFA 1F11B 1AQDB 3GQFA 1FYTB 4OZHF 2BS8A 3MRRA 5A2KH 5TE4H 2GPZA 4Y5XC 2HTKD 1X5FA 1G7PB 1DE4B 2H6PA 3J8F7 3L48A 4MJHA 4XN4A 4AJWA 3ZT7A 3P9LA 1U6AH 2IGFL 5T5NG 3WI9A 4XMKH 1CG9A 1JGLL 3Q5YA 1U8QA 1JXJA 3A6CH 5KVEE 2QKSA 1TJGH 3ISWA 5BZDB 1OB0A 4DW2H 1B6UA 4BZ1L 2HLEB 1HAUA 4ZZFA 4NP4H 1C5CL 2F53E 4URTB 2ICCA 4QHNA 5CJQL 5LDSA 1H5BA 4XVOA 3GSRB 1FLRH 3QNYA 4UT6L 3MCKA 3HE6D 5L7XH 3QQ3A 4B53A 1OV8A 2G4EA 3OKLA 1QWHA 1U41A 2ADJB 3V95A 2CDEA 1GC1H 4B9KC 3WY1A 2ADYA 1K3IA 4ORZC 2NNXA 3LHPH 1INQA 2VW7A 1DN0B 3JTTA 1P1ZA 5CGBA 5BVJA 1KEML 2CO4A 3I6KA 2Y6SD 2I9TB 4U6VH 4K7FA 2J5LC 1A6VH 1RPKA 4NUGH 1KYDA 4PRHD 1D2OA 3BT2L 1A8JH 4M6NH 2IG2H 1MG2C 1R0AH 4DO5A 2JE8A 3OD3A 5K1JA 3B9KC 4OQTL 4X6EA 1FRGH 1UUNA 4WSKA 1PSKL 5F89B 5E24E 3SYPA 1NGQH 4P2RD 2AJZA 2QGBA 3SO5A 4NUJB 1PNCA 4ZX3A 1ZT7B 1ZHLA 3NJXA 4G80A 1CE1H 1GZHC 1NMBL 2XBTA 3IFPA 4BKLA 3DNKA 4PQXA 3UZEC 4MVBC 4HZLB 4PCSA 1F5WA 4NQDE 2NW2A 2BWDA 1T5XB 1NIFA 2VO8A 3SJVA 3VFOA 5C6PB 4LSTL 2VDNB 1XCTA 1QD0A 4LAQL 3V9CA 5FCUH 1KZQA 1JTPA 5HDQH 3AVEA 4XP4H 3WLWD 3QEGH 5FGCB 1Q9KA 1S7SB 4BFGA 1EHXA 2XN0A 3U4KA 5DEFB 1FDLL 3Q6GH 4C56A 1J1OH 4YL9A 3T8XA 3NSYA 3EFOB 1JD9A 1UC6A 3FMGH 3RDTD 1CT8A 2JV6A 5FM8A 5I18L 4HIHB 1BECA 3EOBB 1U3HB 2YWYA 3S5LB 3FSVA 2VQ4A 4HA1A 3JV5A 3RWGB 1CXEA 3RX8A 2N01B 2ESVB 3T77B 5AG9A 3DO7A 4YLBA 2FUQA 2J5WA 4C47A 3W1ZA 2DM7A 2JFCA 1I8KB 2YUWA 5IVXA 4U6TA 2IAMC 3MJ6A 5DC0A 2XA8H 3ULVD 3EO0A 2KYIA 1CLZH 4ACTA 4YXLL 5IFAL 2BNRD 4L8BA 4L4JA 4XPTH 1MJ7H 5IK3A 3ZXAC 4DKTA 2VNCA 1XGTA 4QTIL 3ALPA 2B7DT 3N3EA 2UXFA 4ODWB 4K3GA 4AQOA 4ZFGH 4HWBL 3KW8A 5C0CE 2NDGA 4FNLL 1DLHA 5EUOA 3RVVD 4HIQA 2OTWB 1OSEA 2MKLC 2QT6A 3IU3A 4OZHE 3HC0B 4KZEL 1ZVHA 3GSQA 1TQCC 1TYEB 4HMEA 3BCFA 2WXJA 4X6BA 5AW2B 1TETH 1BFOB 1D7BA 4LHUD 3VXRD 5GGTH 5J57B 5LUMA 1A0QL 5DS8B 3EHBC 4Q97A 2W5PA 4WW2B 3AB0C 5CEZE 1IGFH 3T3PB 3MV8B 3TPKA 1AXSB 3A3YB 5FV1L 1KCVH 1G4RA 3MRQA 2W38A 1BVOA 5DJ8A 1FAIH 5IJKC 4ZUTA 5FO7B 4PJ9D 5CINH 4HJ1A 3SDYH 3L4TA 5J06A 4AUUA 1U3HC 1XGPA 2IXQB 5AOMA 3D33A 3HA0A 2BCMA 1I8IB 4HZ1A 3BH9A 5IB3B 3STLA 2NY3B 2ICEC 3P3SA 5C0FB 4XP9H 2OULB 1DFBH 1REIA 2AK1H 3OJDB 3RDTC 2ZD0A 3ARSA 2ZAGA 3H55A 1TVBB 4M61B 5EF0A 1PQZA 4NXKA 3QFDA 1YNTB 3UJJL 5F7FA 4ANVA 2FATL 3ZUCA 3BH8B 3X3GH 3RYMA 3HAEH 3WLWC 4QRTB 3AG1B 3MUZ1 3P3TA 3B34A 3B5HA 3L3KB 3RFZA 4Q89A 1QACA 4I4WA 2N1TE 1NCIA 4WEUD 1LP9F 3FC8A 1WICA 3QUZB 3WN5C 2E86A 5EEYA 1UWFA 1YQVH 1BVLA 3LQZA 1MXGA 4WGVB 4XN1A 3W81A 2F53A 4Q9QL 4MMYB 3L3DB 4I1PA 2VQ1B 4WVRA 2IDUA 5F7DB 1A7RL 4WKZA 1EGJL 5HHOB 2APSA 2AXFA 1HU8A 2WXHA 4XBGB 2AFNA 1A7PL 3C2AL 4NHUA 5I1GL 1CFSA 1QRNA 3QDHA 4HBCH 1O6SB 3MRBB 4FQJH 5EPMA 5EOTB 4K5OA 1ASQA 1BQKA 1CBJA 1YAZA 5D71H 1BREA 1FNAA 2D4FA 3MRQB 3KDMA 3ZMRA 4KK8C 1H3WM 3DV4B 3BISA 4AC4A 5BS0D 2P8LB 5ACMA 5DVOA 5KSVA 3V4VB 4OV6F 4LLYB 1S6NA 4UUJB 4Z7QE 3SGJA 1E5YA 3ZTJG 1JF5A 2HN7A 3I75A 2F2HA 3L95B 2AJVH 3DHMA 3OJ2C 1R3LA 2W95A 4NPYB 4PLJC 3H7LA 2IADA 3ABMB 4CKQA 3OKMA 4LK4A 5F8QC 5AALA 1OVZA 3UTZB 3BX7C 5AVWB 2B4CH 2X9ZA 3V52L 5J56B 4P23B 1KJ3H 5AVZB 2XIBA 4GRWB 1IBDA 4M1CD 4K4KA 3MROA 1OAJA 4TVPE 1TO4A 2I07B 4D0BB 2ZXWB 2E75C 4PIRF 3BZ4B 4G6KL 1WZ1L 3KL0A 4KI5E 1SFHA 3HE6C 1KT2B 4E9YA 4MZ2A 2OW6A 5MP6H 3GC3A 3PIQB 1OAZL 4N2BA 2WWKT 4NQED 4JGJA 5F7MC 1KJ2L 2GTWA 4YBHA 1V3KA 3K2IA 4QRRA 1AVAA 4XNXL 3SGEH 3OZ9H 3IPBA 1T21A 1U8CB 4P48A 1DQKA 4HQQL 3ZGIA 1GY2A 3PREA 3CVIH 3VO0A 5EU7C 4B96A 4DPAX 2OMXB 5IVOA 1YZZA 3HE7A 4AM0A 1XSJA 3O2WL 3T2OA 2J6WA 1FIEA 1RJZA 1SOQA 3K71A 2HT3D 2O5NA 4UIMB 1RUQH 3IDJA 4Y9BA 5E1AA 1CGWA 1WWCA 1WFIA 1IC5H 2AVGA 3I9AA 3O41A 3QG6A 4F7MA 2FR4B 1C5BL 1LVEA 5F9AC 3HZKB 1NBCA 3SOTA 1HYSD 2R7EA 1JV5B 5E23A 4G7VH 2FECL 1FL6A 1IUZA 2FHFA 2PWHA 2DIBA 3DX6A 3II3A 3LNFA 5C08B 1HEZB 4G83A 4AXWA 5B4MC 1SXCA 2YXWA 2GUYA 2XZCH 2VDOB 4XPAL 1HHKA 3RDTA 3KLHD 3MNVA 4FL4C 1H8OA 4Y7OC 2PWGA 3SKOA 5D6DC 4A6YB 3U9PL 5DVKA 3OKNB 4L3EE 2X6CA 1VLXA 2ERJC 5HHPA 3Q2LA 2F54A 2FJGA 3Q1SL 5JQ6L 4D9LH 2UUDH 1KULA 3LV3A 1JNNH 4MCYB 2XFGB 4G6JL 3GJFK 4P57B 5HI3C 5KVDE 3S35L 3ABGA 4HCRA 4JO2H 3T3MF 1BZ7A 4G8GA 4GIPD 4QHMA 2LFGA 2X4QA 4PS8A 3VFPB 4OGAC 3JUZA 5HYQB 3V0VB 1JZJA 4Z3HA 2ZAIA 3HJ0A 4FNSA 4IKJA 4DUXA 1RKRA 2Q8BH 1LE9B 1HWGB 4OIBA 5HI5D 1OARH 1CYWA 1JNLL 4LSSL 1S9YB 4DF9A 3M1OA 4P4KD 5I1EH 2DZEA 3RWIB 1CGSL 1H15B 3VM5A 4JANB 3QO1A 1NGXB 1P69B 4JG1L 1K2DA 4NSKA 3ZLQC 2BSTB 1M9WA 3RJQB 4FNPA 4GSDL 1XH3B 4YHKL 4DZBB 1DEEB 3TBYB 3EFFB 4Q6KA 1A8ZA 1TXKA 4BUQA 4LHQB 2J1YA 2J57A 4ZOAA 3OMAB 2G5UA 2ZX6A 3HB3B 3D07A 4TSCL 5FO8A 4ZFZA 4ZW5A 2OMNA 3PCYA 5D8JL 4GRLA 3FPYA 4XNUH 1JDDA 1DQIA 4PBXA 3EBHA 1V3LA 3VFTB 2AJYL 4CBPA 4XO4A 4P46B 1E6JH 3CVHA 4LLQB 1I1AC 4RGNC 1UATA 2IO5A 5BJTB 3C5XA 3NZ8B 4AYFB 4LPTA 5BQ7B 1U92A 3JWOC 4O2EB 2HP4A 2VAAB 3G5VA 3TO4D 4E42B 4GBXA 3VD5A 1LQBC 1QEWA 2ILLA 3PDGA 4WTZA 5IB4A 5DD5L 5HJDA 2GCYA 5CEYA 3S37X 3MRNA 1LO0H 1UHVA 1W91A 1QVOB 1JWMA 3RUGE 1T0MA 4JY6A 1CURA 2XA8L 4G70B 4X50A 4CVXB 2P5ED 1I1AD 3V6OA 1YJDH 5GIRB 5ABDE 5IHBA 1NCWH 3SYQA 2HRGA 1E67A 1HHGB 1N64H 5HSFA 1GGUA 4KY1H 4L9DA 2A83B 4XPGH 2IFFL 4JKLA 1FCGA 4MB1A 1AS8A 2N0KA 4FA6A 3OHXA 1XEDA 5FO9A 3UAJA 2G5RA 3GSNA 2F53D 5E6SB 3UTOA 3DSNA 3NJKA 1HH9A 1UT9A 5F2FA 7CGTA 4NBYB 3K1DA 3UJTL 5JHDD 2DQHL 3WUWG 2BIOA 4DN3H 3I2CL 1KFAL 4OCWL 3LZQA 1SOKA 1D6VH 1JP5A 5C9KA 3BO8B 3L3HB 4FEMA 3U9UA 5F7LB 1YJDL 3Q6GL 1RIUH 3TN0A 1TU2A 4OM0H 3BAYA 2ZX9A 1ET5A 4C58B 1A4CA 1R3HB 2X1XR 2WXRA 3QFJB 4U1KB 3U2SA 1CLVA 3RTQA 3KPMA 3KLAB 2XQBL 3SY6A 1UJ3A 3WFCL 2YGPA 5E4EC 3ZL1A 5B3NA 2UYLA 5DLLA 3VMPA 3VX0A 4ZMAT 3R1GL 5D2LF 1OT4A 4BSVA 4WUUD 1I9JL 4XNQA 1BSIA 3B9DA 2XN9E 4TOYH 2WVVA 3O8XA 1YN7A 3LMJL 4GY4A 4KH9A 4UINH 3SQBB 4LSPH 3O4OC 5M7QA 3MLUH 2VDMB 3ULVF 4YHIA 1IC7L 2B5IC 3HKFA 1USZA 4OFIA 1SLXA 4CRPA 1MLCA 3ELQA 3OMZA 1PKQA 3NSCA 3CHQA 3PAVA 1EHAA 1FQ9C 3FONB 1HCYA 1HSAA 1IARB 1T7ZA 3LB6D 4RMQA 4MJ6A 2WP3T 4TF4A 4NKQB 2FAUA 1DVZA 1L0PA 4F80A 1ZK9A 3RZCB 1MFEL 2FJHA 1OP3K 3BD4A 5B3SB 5EDXA 2AAAA 1N5AB 1TTAA 4DQOH 3TN0B 4AQ8C 4R3SB 2WAQA 3BT2H 1U3YA 4U1HA 5KN5B 4N6QA 4NENB 2G0LA 5FYJH 2HFEA 4PP1D 3IGFA 5JOFA 4WUUE 1BIHA 1ZE3H 2J21A 4AV4A 4HD9A 1R3KA 1UADC 4MHHG 3QI9C 4AW4A 2R2HA 1UH3A 1D7DA 2D4DA 3L1EA 5TF1L 1NSNL 3DXAB 3GMLA 3BUYA 2N4IA 4FJYA 4G2AA 5E1QA 1TUPA 1V5JA 3IDYB 5HHOD 3BCDA 2HTLC 4CN1A 2R1XB 1CDCA 2C3XA 4XB3A 5IVZB 4AV5A 1E4XI 2EIJB 4PW3A 2G0KA 2WO3B 4UDTA 4CNIA 5I19L 4EKJA 1CD9B 4TYUA 3L5WA 1WFUA 3II1A 3QQXA 4S2SA 3U6XS 3GBNL 4EVNA 2ENPA 1HJBC 4OZIB 2HKHL 1NIEA 2PYEB 3GLDA 5D7JC 2VOTA 3OGCA 5EBLB 5B8CB 1WH0A 2BVPB 4AJVA 5ID0A 2DJUA 5GJTH 1LO4L 1T0MB 4JVWA 2O5XH 5FYLH 4A2DA 5GS0H 4LASH 5C0IA 2OTUA 1HN1A 1TLKA 3N91A 4V1DB 2Q7YA 3QNXA 1XCQA 2WB1A 3SGEI 1AO7B 4J3TA 4PJDF 5HGAA 1BD2D 1YEGL 1YEDA 2GY7B 3QEQD 4ZAKD 4ZUUB 3SBRA 3JWNE 4KI1A 4TN9A 5IGXL 4ZW8A 3ILPA 4LKCB 1CFQB 5CFHA 1JN6A 3WKML 3WKPA 1B4JL 4KZDH 1ZLUK 4NIKB 3QK0A 2EEDA 1ZHKB 5AUMA 4AJYV 4LARL 4X5QA 3HN3A 3IJ8A 4MBOA 4Y19A 3H3PH 4ZOBA 3RVUD 4LMQE 3GSWA 1ZT1B 1N9PA 3HAEA 3OZ9L 4JE4B 1RULL 1A9BA 5EWIH 3SBWC 1CZ8L 4L4TE 3VXRE 1JZ4A 3LPGA 4CC4A 4UOZA 3QHFL 4KV5F 1QOKA 2UZIH 1NCAL 3EH2A 3SCMB 4AGMA 3PGCA 4M6MH 2VDMH 1DL7L 3VI4F 3QCVH 1WZ1H 3P4MA 5E8EA 2WZAA 2XQ0A 1FPTH 1WISA 2OQJB 5DJ6B 5SWZD 1N6UA 2Z4QA 1A3LL 4JY4B 2G3NA 2H9GA 4W9ZA 3BUYB 4WUKH 4YDLB 3GNMH 3PNWB 4GB9A 4NRYB 4RMSA 4K9EL 2HKFL 1N0XH 3D39A 2C9RA 3V52H 2V6HA 3D9AL 4NZTL 3UTSE 2WWMD 2CA4A 3KLQA 5EH1A 3IDXL 1V7NL 3ALXA 2X7LA 2EEFA 3U1QA 5BXFB 4HS6A 3WIIH 3CZLA 3FF7A 2HH0H 1HC1A 5FECB 3IDYC 2A74C 3R19A 1U3HD 1JGDA 3SKOB 2CO1A 4NJ9L 2VXTL 1T1ZB 3SCMC 4QRRE 1JHLL 4PJ9C 3P9WB 4DH2A 3GTNA 4GRMA 2HZHA 1X44A 4X7DC 4WQOA 1DSWA 1T20A 5I71C 3ULVE 1TJIH 2LU3A 2DBLH 3QDMB 4HG4J 5IG7A 3NRPA 3LJ3A 4YPGA 5LWYH 4HXAH 2YSSA 1RXLA 3MX0A 1KN4H 3ZZLA 5CCKH 4J3XA 3O6KH 1IC1A 1SOXA 3FL7A 4KOCA 1M7IA 5BUAA 3ARRA 4P3CH 4E36A 1K8DA 2W59A 5HGHA 2K1MA 5C0CD 5C2BL 2Y36L 4J8RA 3B2DC 2CHWA 2J12B 3IFLH 4L2YA 5KOVC 5HGGS 1A14L 4YHMH 4L3EB 1LGVA 4FGMA 3RVVC 3OB0K 3NYKA 4M6ML 2EDXA 1TZHB 1Z9SA 5D7IF 3ROLB 2QQLH 3O4OB 1BFSA 3QCUL 1H3VA 5AVTB 3T0WA 3IAGC 2VDLB 3FRUA 1RHHB 1OHZA 2WLHA 1XTLA 4KY1L 4YDNA 3ZN6A 4AGLA 2XVLA 3HLKA 3O4LB 5FYKH 2IBBA 1U8LB 4M7LH 4G9FA 1CGSH 1EUUA 1RVFH 3ULVC 3W0WA 1A5FH 3K5RA 4EI0A 1OL0A 3EG9A 2IAMD 4QRUA 4H26A 5K9KB 3WTTA 2CLZA 1GS6X 2V5RA 4D94A 2JNZA 3B9AA 2XICA 3O9WA 43C9B 3UAAA 1FJ1A 1W9XA 1ZE3C 1RD6A 1GJWA 1VFMA 2C26A 2XJLA 3KJ4C 3PL6A 4KWUA 4YSUA 1S78D 4YHYB 1INDH 4OF7A 4CGUB 7PAZA 3FT4A 4IBZA 3CLEL 1FN4B 3BP7A 1VFAB 1A66A 3DUSB 5EC2B 3QORC 1I4FA 3T65A 1HHGA 3TWYA 1RAMA 4LLUA 2GJJA 4WK0B 1IKFL 1DJHA 1GYUA 1UA7A 5IFJA 3ARVA 3OV6A 2H32A 4YNYA 3ZTDC 5EO9A 4F37K 2NSQA 2OMZB 2VISB 1YEFH 2WLLA 3D48R 1BBJB 3MRNB 2AQPA 4XAWL 3IFNH 4I89A 2YA0A 4KY2A 4MJID 4FRWA 4KUCF 3I50H 5KSBF 1QSEB 2MOQA 5JTWA 5KS9F 4XHJD 5I74C 3VH8A 2W07A 4AGNA 4G6ML 1SUJA 1OCRB 2ALWA 2X4UB 3NJFA 1IC5L 3QJSB 5D9SA 3OLGA 3WS6A 5TPWL 8FABA 2RAMA 1E2WA 1XGUB 1I7ZB 3BXNA 3LY6A 2D7MA 1CDGA 4XVSL 4H5SB 3NFNA 2A9AA 5I28A 3O3EB 4PUBH 4TLTA 3U25A 3WEMA 3CFDB 3T0AA 4MVBD 1UM6H 2DI9A 3QRLA 2UY7B 4QHPA 4UDUA 5MENE 5AYUL 3C12A 1TG8A 3W38A 2UZXB 5JIKA 3H85A 3LRHA 1UXWB 5GS0D 1UH4A 1K8IB 4DGUA 2QEJA 4C54A 4O2CB 1JTTA 2ZYRA 5IB5A 1LE5A 4LQFH 5SWQA 2BSTA 4QRBA 3N1PC 1F2XK 4JBSA 3CHXA 3OXRB 1RZQA 1CGTA 4X9FA 3KWVA 4FFVD 4P04A 5DMIL 2DLTA 4YHZH 4PLKD 4U0RC 3Q13A 2I5YL 5A2BA 1IQDB 1WITA 4N90D 2WXPA 2PCPA 2FL5B 1BZ7B 2B9BA 4G8GB 4O02A 4N0YH 5I8KL 3WTWA 2V17L 1SBSH 4OZFH 4JX0A 3LPWA 2ZUSA 4JFUA 1EDHA 4X5RA 4CDHA 1QABA 1MJ8L 2VUYA 3K1KC 2VC2H 3KPRB 4FXTA 5FS5A 5LXVA 2DLFH 4NAQA 2GK0A 4DGYH 3OXSA 3JXAA 5I8EB 5L4JA 2P80A 1ZHNB 4B3EA 2CKBA 3QB7C 3CFMA 2D31B 5K39B 2MCAA 1H8NA 4E5XA 5KEZA 5L8KB 3D7PA 4YNYB 5ANMA 4Z0XB 1KIUB 2AHIA 1MJUL 1U58B 4OZGB 3V0JA 4JHAH 4NQCB 5SWSE 4LLUB 2V17H 1V27A 1BOYA 1OF0A 2K4AA 4YWGL 1AIFA 3BPOB 4U05A 3C8HA 3LN5B 3BP5A 1RZJL 2WBJD 4K23L 3CVHL 5BO1L 1JPST 1UD2A 3NZUA 5HD8D 3IWUA 2YD3A 2NUTB 4YXHH 1JK8B 1KFAH 5E00B 1RERA 4JKMA 3CDYA 3IJHB 1XT5A 1QHOA 3PQYE 4KO9A 1XEUA 1OPGH 1MNUH 1CTOA 3A4DA 2JQZA 2OMXA 5DF0A 1YMHA 2H32H 1HT6A 4N9GB 2I27N 2K78A 3QNZA 5IF0B 5IROA 2OMUA 4H8VA 2DB8A 4XC1L 4J39A 1N64L 1Q72L 3Q5TA 5CBAA 4KGJA 4FQIH 4WAFA 4CMHB 5CJXA 1KBGL 4F8QA 2CO6A 3D69B 2I7OA 1NICA 3FQRA 1TR7A 4UT6H 5DD6B 1H3TA 1IVTA 5IJCC 3V5KA 1OF2B 4HCRL 1W15A 3X1BA 2V37A 3BP5B 2RGSA 2ZXCA 2IAND 4FQXB 4JPIA 1WK0A 4HC1H 1SEBA 1W6WA 2OLDA 1FH2A 1YEFL 1GGBL 2DTMH 5D4HA 1MHCA 2WLJA 2ZOKB 2NTFB 1MHEB 1F6AB 3O2DA 4TTDD 1A7RH 1KIRA 4UUJA 2VDOL 5IVXE 3SYCA 2G3MA 2D31A 5E6IA 3EJTA 2WB7A 3CZJA 4LVEA 5EIQA 5KS9E 3ARBD 3IXTB 2WNWA 3QAZC 4B5EA 3TPUA 2XU9A 2X7LB 2F74B 3N0AA 2YUXA 1EX0A 1DHKA 1TTCA 3B4NA 3GMRA 3QSKB 3V0IA 4G80B 1ODAA 5ABAA 1QBAA 4YDVB 3LIZH 2DQEL 2R59A 1A7OL 2FJSA 2LTQB 1RLWA 2ZP9A 3D87B 3EJZC 3RA7H 3BHBA 3ZIYA 5K59E 1CFSB 1QRNB 1SRDA 4XPTL 4GO8A 2QV2A 4Y7MA 3CPUA 4ONGL 1INEH 3F64A 3ZR5A 4NKMB 4PJXF 1T5WB 2VZUA 3F7RA 3GRWA 1LM8V 1A3RL 2C7FA 5H35A 5E8EB 1OARL 3B3BA 1LO3L 1WA0X 3E1F1 4WU5B 2PO6C 4NGHH 2XDHA 4ZRGA 3L2NA 1D5XA 5ILTL 2JVUA 5ABZA 1QI4A 2QADC 4Y2DC 1IFRA 3BUPA 4N6RB 1HOCB 3MCYA 4G6JH 4BZ2A 3G5WA 3UDWA 4M43H 3ARQA 3VGEA 4LCCB 1JFQL 6PAZA 4OUUA 1BAWA 3DROA 2ITEA 4JDTH 1DVFB 5IQ7H 2DBLL 4FXLA 5FHAH 1KYOK 2J6EL 5IBLC 4YZWA 4DP4X 3S97C 4ZJ9A 3BH9B 1IFHH 4GUOA 2JXMB 3EF4A 1MW3A 2ZUTA 4WI2A 1YMMD 4L05A 1H8SA 3RZWA 4TVUA 3UOAB 4KI5D 3DIFB 5DRXB 3MUY1 2V9UA 1RIHL 5LHDA 4NJ9H 3EADA 3L9RB 3C60C 1DBML 3QUHA 5EOQL 5GZOC 3CV5A 1G7HA 4LSTH 4U1NB 2BY2A 4G42A 1V7NH 4H8UA 3BW9B 3RWCA 1O7DE 1M56B 5K1NA 3G6JB 3GI8H 5DQDH 4U1MA 2P7TB 3MRGA 1G43A 3IAPA 1JWSA 3H9HB 4FQXA 4K8RC 3VXUB 1X5GA 4S0TD 4V11A 3S34L 3BDYL 4PJXA 35C8H 1VZGA 3QJOA 1SXNA 4BBWA 2GBUA 3WTVA 1KF9B 2BVOB 4ZQKB 1OAKL 4TRPL 1OALA 5IW6A 4AL8H 4ATWA 1BZEA 1OQOA 4MCZA 3GSOB 2HFTA 3VI4A 4HALA 1ZGLM 2WINA 4HHAB 3T6XA 4WO4A 4NWUL 4P2YA 5IMMB 2WLIB 3VXSD 1QUNB 4FFWD 2PNDA 1CFTB 4AMKL 1IEBB 3M07A 1PAZA 4P07A 4U1HB 1RULH 4FJ6A 2D03H 1KYFA 1VACB 2B4CL 2IWKA 4P0DA 4WI6A 4XPBH 1B4JH 2OX5A 4TM9A 2NX5E 1DBKH 4LBEB 3VXME 2VN3A 4UM9A 4CC0A 5C8JA 4HH9B 1C9SA 1KB5L 3IBOA 4ZPVA 4IRJB 1R33A 5T1KA 3CDGB 4N2FA 1Q0XL 3PQYA 4J6IA 3PUUA 4RGNE 1OY3B 5D2NE 4IGBA 3ZBMA 4OVUA 4I13B 4PJFF 3RVWD 1KLGA 5E6UB 1NUFA 4QXVA 3Q6FB 1VJSA 3VFGH 4NQCD 2H26B 4L5FH 2DICA 2HX7A 2WV3A 4S0SD 3PDOB 5DI8B 2DQJL 2JLLA 4N22A 4LNRB 4HH9A 4Z7UE 1WIOA 2BS9A 1PLBA 5JPNB 5GJTL 5C7XL 4X4YA 2J55A 2DLEA 3VFOB 4PJEE 4DCQB 4CMMA 5IBLD 1AMXA 2M26A 4HX1B 3UBXI 1YQVL 3CXDH 1TTUA 3PXLA 4Y88A 5EU6E 3VWJD 4P9MH 2DIJA 1G6RB 4H8WC 3PUCA 4NC0B 1BAGA 4W4OA 3BO8A 5DXWA 3UAEA 4F33A 2R0ZL 5D7IB 5CKAA 4DZ8A 5K9JL 1JSYA 2PWDA 3D5OF 2E47A 5AZ2H 1J87A 1NAMH 1NSNH 4NT6A 3T2NH 3BIBX 2VDPB 3U9WA 1P84K 2VXQA 2ZF8A 4TSAL 1MCOL 2WOYA 4OLZL 2CD0A 1XF2A 3CXDL 4IRJD 2WIIA 3QUZD 5CIPB 1NL0H 3DC0A 5D1XB 3O11B 5DDHB 5TPWH 3GSXB 2XV3A 3GD1C 3EJZD 3NSJA 4LNVA 4TNEA 5BVJB 4CVXA 1CGXA 5T3ZH 4FXKA 2CHDA 8CGTA 2NY6C 3RWCB 4IQHA 4AQ1B 2V8MA 1G7IB 3IMVA 3V2AR 4R0LA 2VABB 1YECL 3FN3A 4TTDC 3QEUA 5TE4L 4Y1AB 3D0VA 1GZHA 2E7CA 3L9RA 1IO4C 3U7WL 2H6OA 5F0PB 1Q0EA 4TVSa 4KHXH 4JFHE 3PFUA 3VSTA 2XN2A 5DUPH 1SJVA 4P46A 5SWZE 2VMJA 4YDKL 3QEUB 4TUKL 4LP8A 4FXKC 2LQRA 4KHTL 1OK0A 4AQ1A 5K9QG 1MCPH 4XCNB 1QR1A 5AVRB 3ZY7A 1UD8A 2YQ3A 3L5IA 2MHAA 1A5FL 4YK4C 3MMEB 3SE3A 4P9HH 2JKNA 2DD8H 4PRPE 5FYKL 4LDCA 1IZJA 5DMJB 3QEQE 2R0KH 5AZUA 5JHAA 3ULAB 2W9EL 1E4WL 3LCYA 3K8KA 1PPIA 4L3AA 2YPVH 5JPMC 3NIDE 1EHNA 1AANA 3S37L 4N85A 4WFFE 2G2RA 2NY0B 3BH4A 4PJGE 2NW3A 3KXFA 3OKEB 4XN9A 3ZVVA 1QRKA 1UM5L 3DVNA 3T2QA 2ZOLB 1R6VA 2QZ5A 3FB8A 3SE3C 1UXSB 3C5JB 5DWUL 2A38A 3ECBA 4BV1A 4UF7C 3VWKB 3FRUB 1VA9A 4V2CB 4AOFA 1MCFA 3TZVC 2JJUA 1CTNA 2Y72A 4EBQH 5D70H 1UB6A 4HT1H 3VXPA 2FJHB 4AQAB 4J3OC 1QKZL 2V5SA 2FJFA 4L3FA 4F15C 2GHZA 1RIHH 3WXWL 4MJ6B 4M6OL 1OP5H 3F84A 4KHXL 4I9XA 3WDIA 2H2PD 1HHKB 5G5DB 3RDTB 1XIWA 1KXQE 3N43F 1GTFA 2ZZUT 1WUZA 5TE6H 1PBYA 3QW9A 5GGSB 3VI4E 3T1WA 1TKWA 2XKUA 1MFCL 1FL6B 5AWNL 4QF1B 1YNKH 5E7FA 2WZPD 1EAOA 4XWOC 5HDOA 5JO5A 4QUOA 1V54B 4AUJA 1VADA 4WIQA 1V3MA 2F7QA 3KL3A 3SBQA 1QA9B 3K71B 2BNQD 3FCBA 1UZ6E 2JB5L 4Z7VE 5T5FH 3RTQB 5DRZA 1P5VA 3OAZH 4FTVA 2VLKA 3EBIA 4NQSB 1U8NA 1W80A 1VENA 2D2OA 3KPQB 4NYLA 2UXVA 5GRJL 1T0OA 5ISZA 4ZMOA 4OVVA 4JQVC 4ZO9A 4BFEA 2AJUL 1MVUB 2ZCKH 1TYJA 2JJVA 4FA8A 3GMQA 3HI1B 3LEXA 3OKDB 3RDJA 1MFBH 3SKMB 2EDJA 3VG9B 4D7PA 1FL3B 2QBWA 3ARWA 1S7RA 4DVBB 2VDLL 2QPFA 3BEVB 4MJIE 3VQMA 3HE7D 2WINB 3APFA 3FTSA 4GP5B 5D7LD 3A23A 2ZYHA 1IJ9A 2XTJB 3HZMB 3ZYZA 3QPQD 2OPCA 2ZAHA 3AABA 5EZIH 3DYPA 4ADIA 4YBLC 5J9PB 5E00A 3UFIA 2NTSP 3REVA 1XF3B 5DS2A 1I85A 2AV7B 3ES6A 2XA3A 4HSQA 1GXEA 4F27A 1RSFA 1BIIB 1Q4NX 2YD9A 1RCYA 2Y24A 3B5TA 4JO3L 3U9PH 2V33A 4DETA 3WUWB 5KSAC 5ESAB 1MRDH 1G7JB 1A6AB 2EE6A 4DAGL 3NVQA 1EZSA 3ULUL 2VH5H 3VFNA 2J1WA 2RJMA 3BVNA 4XPAH 3IDIA 3LH9A 3R0MA 4U4IA 1NDGA 3KDPB 5IBTL 4F7PA 4ZNEE 4OZIE 5L0QB 3VACA 2VR4A 2GCYB 5IB4B 2WJ7A 3WCYA 3FQ2A 2NR6C 1VGEH 3FUHA 5FWRA 1G5GA 4HIIB 3RGVB 3HUJE 1U92B 3FTYA 5DWPA 1JN6B 1C5BH 1W8EA 4Z7QF 3L1GA 4D0CB 4D8OA 1B0GB 1WVZA 1U91A 4BHUA 4YUEL 3N44B 1QG3A 3MTRA 4XPBL 3HE6A 4KNSA 5I2IA 4NC2B 1MZZA 3O2WH 1Q72H 4PWEA 3ALWA 3LRSA 3GK8L 1D9KA 5KVFH 1AO7A 2MCMA 3TIDB 1RZIB 1VF5C 3JT0A 3KBHE 3OB0H 5GGRB 1P7KB 3U7YH 2N7AA 2OMVA 4GXVH 1GZPA 3OXRA 1AKPA 4JB9H 5C07B 5ACLA 4UZGA 4LIQH 5HBBA 4OB5H 2BFVH 3NESA 5F7EH 1B2WL 3SBWA 3WUWA 4JZOA 1M6UA 4MB5A 1CU4L 2WCGA 1P53A 1PZ5A 4DGWC 5BO1H 2IIJA 3U1SL 2X70B 4UDUB 3GS0A 5HHXH 5E0FA 4YS4A 2N7BA 1N4XH 1GKOA 3QJFA 5JW3L 1OP4A 4KQ4L 4JO5A 1BQRA 2RBLA 5C97A 3KNBB 4WY7H 3QEHA 4ZMQA 4PJXE 2FWLB 4PJCF 4ZFQA 2X4QB 1KJ3L 1OTSC 1TMCB 2Z0BA 4GG8A 3QUMA 4J2XA 1EXHA 4FG4A 2ZJSL 4ZUTB 3WL9B 3GJFB 5IHWA 2AEPL 5GZOA 4XMPH 1EO7A 3P0YH 4JO4L 4FI8A 3MA9H 1P9MA 4G59C 3FSZA 4N87A 5D71L 3GBMH 3ZQ9A 1L7TL 3LRMA 4LNRA 1BXAA 2FGWH 3OG6B 1I8MB 2CDGB 3VAEA 1MLCB 3AS3A 4IKNA 4NLHA 4F7TA 3MRCA 3DMMC 2BW5A 4ALAL 3MLRH 4JY5H 1A4AA 2GC4C 2OKMA 1WFNA 4C56D 5IV2A 5GS2D 2OZNA 3HBZA 4E5XG 4XBEL 1YHPA 4WHTB 2BHZA 4KJWC 1CF8L 3UBFA 4I5BA 1QFUH 1WZAA 2EABA 1II4E 1KLFB 1TTRA 1USQA 3L13A 4KKRA 4R7NB 4YZFF 5J11B 3B6SA 4IBQA 1Z7JA 3KYNA 1QI3A 3WEOA 4NGHL 5ILTH 2V7HA 4XCFH 3UJJH 3S98A 4Z76A 3NQIA 3FT9A 4XR8C 1HILB 1KPRB 1TU2B 3EYQD 5E2TH 1MCWM 4MAUH 2HLFD 2FUTA 5IB2B 2D7PA 5C0AB 3ZE0B 3U9UB 4Z7UA 4YSRA 3KEDA 1FH5H 1MHPH 1SY6H 1S9WA 1A7OH 2E8ZA 3AAZA 3P1VA 2JI2A 5DMGD 3V0WH 4W68A 5IMOB 5DMKA 3AROA 3DI2B 3MRMB 4YX2H 3K6SB 3HZVA 2G3XA 1FZJA 4ZMWA 1I3GH 1UVQA 2X40A 4Y5YC 3LTVA 3OAUH 5IVNA 4HIXH 2NX5B 4F7CB 1DZBA 3DRQB 1AP2B 1BQHA 3EGXA 3MYJA 1HHHB 4Y2NA 1LWJA 3KD4A 3O3UN 1FO0H 3UX9B 1PDKB 2ITFA 1CLOL 5I6XB 4LHUA 2DWSA 3DVGB 3P30H 2J1KA 1WZLA 4FNLH 3L3JA 2W92A 4U6XB 2OXGB 3BPOC 3Q01A 4OLXH 3CFKA 2OYKA 2F5AH 3RTQD 2CSPA 2LU4A 1Q9LA 2BNQB 2FWSA 2VDPH 4OIAA 3U7AA 1JXKA 1XH2A 4MQXD 4HWBA 1WAEA 5LXGH 2BSDA 3WGUB 4GLRH 5F9OL 1IQDA 3MV8D 4U1LB 4Y1AA 5I71B 2XNAA 4UQBA 3VRIA 3WD5L 4I1RA 1BXVA 1T2QH 5D93B 2EDEA 3CX5K 5I5RA 3CHRA 2I7SA 1T03H 3V5HA 2JKTM 4ANXA 1ZTXE 4YXKH 3GIVA 4N0CC 4PY8I 1IGTB 4FQPA 4F7KA 1I7RA 1F4WH 4LOEA 1WPCA 5I1AA 4AYMC 5JW4M 1ZOXA 5FR3A 2DLGA 2NY4C 4MD0B 2QGEA 1J8KA 1A9BB 2BO0A 4LSVL 4PRIE 1INQB 4JANA 3JYBA 3WTSA 1P4BL 1CFNA 1VFBB 2CMRH 1UB5B 4XGZA 1UGKA 4WHDA 3F65A 2JKSA 5D7KE 3RU8L 1IGJB 1QRND 4ZDHB 2Z91A 1IMHC 2ADGA 3FQNB 2IXQA 5DHXB 3ESPA 5D7IA 5FGSA 2FX9H 3QG7H 4ILDA 2OMYB 2VR6A 3C6LA 1D7CA 5AD0B 3V4PL 1SLUA 4KVCL 4OFPA 3VA2C 1KWKA 3IB4A 3GUTA 5CN1A 5K9QI 3WIIL 3MRFB 3WMSA 2XWTA 3CAFA 2Y7OA 4M7ZC 3V4PB 5JQIB 4HH8A 4F7PB 1F45A 1NCGA 3ZW3A 1MJ8H 2HUEA 4OD2A 1NMBH 3P9LB 3MLTB 1MIEL 3JZYA 2OTUB 5LNDA 5BV7B 4B41A 5E2VL 2IPUG 3PABA 2OMWB 4X80H 5F6IC 1DEDA 4IBVA 3GJFH 1PG7W 2PETA 4LCUB 1FFNB 1DN2A 5AL8A 3V4VH 2Q2LA 3W9EB 1MFNA 1QRNE 2K6YA 2WAHA 5E5RB 2BDNH 4YHZL 3KLDA 3RB5A 4N0FB 1KJ2H 5AVUB 4L8SC 4XCCL 3CDGA 4DSYA 3ASOB 3JWOL 3MV7E 1KBVA 2HKAA 5GSVA 5JXAH 5IK3B 4UM9B 4MD5B 4NUGL 1P7QB 2EXWC 5TFSH 5AKTA 4I0PB 1OE3A 2JKIS 3W0WB 2R2HB 3TBVB 1Z9PA 3D39D 4HK0B 5F1SA 4IIZA 1FO0A 2DM3A 1T21B 1OTTD 1U8CA 5CFAA 3OKOA 4L23A 5TH2A 4M7KL 2J3SA 5HXMA 2GTWB 1GYAA 3MLYH 1FC2D 1I8LC 5DO2D 3TBVA 2ZT9C 4ABVA 4FG6D 2FTAA 3IU4H 2J1ZA 5CJXC 1YEIH 3DARA 2DL2A 2X1PA 5PAZA 4AEIL 2G9KA 3HMXA 4JFSA 4B0MM 1PKQB 2QKIB 1HH6A 5T3XE 2Y23A 1TJGL 3IRZA 4X9YA 5JA8B 1KTRL 4LOUC 5IG7B 4W9FC 5J6HA 3S4SB 2R0LH 3HPLA 5HHOE 3M8OL 2A77L 1Z5LA 3RPIA 1DZ0A 3ROOB 4OZFG 1EDQA 3FO1B 5E99H 1B0WA 1N2RA 1A6WH 2VSDA 3ULUH 5M94B 4UBDD 2YZ1A 2AMUA 5TDPB 3C5SA 3I9GL 1DDTA 1FF5A 1FVDA 3E8VA 1CK0L 1KGWA 4XHQA 4NN5C 1RZKL 4NUQA 2PP7A 3FQUB 3RZCC 4KRPC 1ZGLA 3CLEH 1FGVH 1LLAA 3KAAA 3AY4C 4NM4H 4JPVL 3BN3B 1HVXA 1XSKA 3RTLA 4B9CA 2Y7NA 1NC2D 4OT1L 1ID2A 2BX5A 2CJUL 3UPAA 3VFMB 4BE5A 2BCKA 3ZE2E 3ECBB 4G8GD 2J2ZB 4GAFB 1BFVH 3L5XL 4D9QE 2X44D 1AKJA 1Z3RA 2W1NA 3DVNB 3FK3A 3CZUB 1MN4A 4Y1TA 3IGLA 2Z8RA 5DJ6A 7PCYA 4UOQA 4BH8A 3V5DB 4NQCE 5C70A 1OE2A 5AOLA 2J88H 3L3DA 4P4KC 1HQRB 1K4DA 3DSFH 2P52A 3OHXB 1TQVA 3S3CB 4XMWA 4QI3A 2VDPL 5FA3B 4AGPA 3D09A 1LE5B 4HPYL 4OT1H 2EDBA 4A55A 2FB4H 3QIWB 1AE6H 1TZIB 1FZOB 3DHPA 1D5XB 2VN7A 3NCFB 1UXWA 2ZPKH 3MMEA 5C07A 4DEWA 1IC7H 3FFOA 1L7IH 2ARJA 3SE6A 4CKVX 1L9NA 1TVBA 1VCBC 2F1BA 3Q9QA 3C8DA 2OMVB 1CBVH 3FO0L 4KROD 4Q4IA 5IESH 4DN4L 1DJWA 3QQ3B 4G8EB 3CLFL 5I1IH 1AR2A 2UWEB 3WE1A 4DPRA 2HRHA 3RIAK 4CN6A 5LVEA 5DD3H 2VXTH 1XGUA 1N59B 1Y7VA 2HG0A 1G84A 1J9CT 4MNGE 5E4IA 3QXUA 1VDGA 3N9GL 4U7SA 4JQXA 1YEDB 5E6IB 3L3JB 4OR1A 1G7IA 4MTMA 4RNRA 2DMKA 2VSMB 3QO0B 1FZKA 2ZOKA 3QIWC 3GI9L 4PRIA 3EW3B 4HOXA 1UZ6F 3N40P 3LKPA 4JPSA 4NNYB 3WDJA 4K9EH 5HHQB 2C7UA 1AP2A 1BQHB 5GRUH 3KPPA 2DQHH 2ED7A 1UEYA 1ZTXL 2B3IA 3W3BA 2JI1A 3MCG1 4HD5A 5KZCB 3AM8C 3QCVL 1PU0A 2O93L 1Q0YH 3QIUA 4MXVE 3B7UX 2L3BA 4L4VE 1NGXA 4R96B 1E4WH 2HT4C 1LDPL 3REVB 1JHTB 2GIXA 4G9DA 1CUOA 1HKLL 2UZIL 2YBGA 3ZU8A 4R4ND 1WQVT 2UWEA 3ECWA 4AKOA 5H4YA 2Z8WC 4KO7A 2EE0A 1GOGA 1UASA 1H8LA 4Y8AA 3T0BA 4W9JC 1F58H 4R0LC 3MLRL 4JY5L 2XXCB 5DEJA 1RHHA 4TQIA 1IVLA 1NKOA 1FDLH 4CU7A 3FHEA 5DHVH 4JFOB 4M1CC 1KJ2B 1TZHA 1AQMA 1NANH 4MS8C 1BHGA 4HX1A 1BD2E 2OI9C 3QI9B 4JFEE 3DJSA 2BW4A 3MFFA 5MEQB 5IW3A 1FP5A 3RVXD 3EOBA 1G7LB 2ZONA 1P6WA 3H9SD 2OBGA 5HDBB 4A37A 1FNLA 1ND0A 5LN8A 4ISVA 2E8YA 4WU7B 3GIZH 3ZHKA 4YPGB 3QG7L 1FFPA 1I31A 2IEPA 1X4ZA 4WTZG 3K7UA 1MQ8A 4HJGB 2BJML 4QLRA 3UBXB 3JT2A 4XMLH 4XC3H 5DC9B 1HI6A 2VKXA 3WNKA 1ND0B 4JGMA 1T1ZA 2ED9A 1P4BH 4GSUA 5CR1A 3LXUX 1XXFC 4NC1C 5K39A 2P80D 5KUMA 5FDYA 4ES8A 2GIMA 1QBMH 2QGDA 3SJVD 4WWKA 4KXBA 5KTEL 3DVFA 1I85C 3LPFA 4GQ9L 2IPKA 3K0WA 4IEFA 1NEZG 1EV2E 3VXMA 3I02B 3G5XB 4PGJA 1JZEA 4M5TA 5L2JA 3FUDA