2LR4A

Nmr structure of the protein np_390037.1 from bacillus subtilis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
128
structure length
128
Chain Sequence
GAEALPLYYLQITGITSDGNDFAWDNLTSSQTKAPNVLKGNKLYVKARFMGYTKLTVITGKDGKNLLYNGTAKMFKSDAILGQNKVVIGWDKYFEIPMDALQDNSIQIKALSSGTTFVYSQKIDFERE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPBc2 prophage-derived uncharacterized protein yolA
publication title NMR structure of the protein NP_390037.1 from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 18
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16219 DUF4879 Domain of unknown function (DUF4879)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2870 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2lr4A00
2LR4A
chains in the Genus database with same CATH superfamily
2GCYB 1HH6A 4P5TC 1IC7H 1SLUA 3IDNA 4F20A 4Y4HD 4UCFA 2CK0L 5JIHA 1G6RB 2WWMD 3LKQA 3LHAA 4W93A 1MIEL 4FQXA 5ISZD 3D9AL 5EEXA 3RDJA 1OQOA 5I6XC 4OV6F 4HS6B 3KGUA 4PD4K 2HLAA 3VGGA 4F7CB 4IBYA 4CMHB 1LD9B 1KNOA 2HTLC 3OPUA 4HC1L 2A9MH 2WUCH 3KCPA 3UDWC 4WW2B 4TV3A 3P11L 5D72L 4MA3A 5JHLL 4HEMA 4R8WH 3G6AB 1J87A 4W9HC 1CGUA 4E41A 1BF5A 2QV2A 1VGEH 1JYNA 1KTRL 2AJYH 4GS7C 2HKHL 4K3EH 2MWCA 1NDMA 4LSTL 4YDJA 3N0AA 3HOGA 2XPGA 3V4UL 4EXKA 5BZDA 2ADIB 3PGDB 1G7PB 3HRZB 3CVIH 4UDUB 4XVJH 3BPCB 2VDOH 2M8XA 3BP7A 3K6FA 1CFNA 2D2CC 4M61A 1MXGA 4RGNC 1SVCP 1N70A 1NEPA 1NIEA 5TH2A 1UXWB 2C9RA 2CBPA 3P02A 1S78D 4HFUH 3SBPA 1IM3D 3VVVA 3MJWA 4HD9A 1FNEB 4YDVA 4PRAB 2XN9B 3DUUB 3RZCA 1M7IB 2UVEA 1QW9A 2HT4D 5IQ7L 1AANA 4MSWA 4LDLB 4JQVA 4Y4KB 2QSQA 2DLFH 3JWNE 3T0AA 4BK8A 3FCSA 3UPRA 1XEDA 1M42A 3LIZA 3GB7B 1QO3A 1OGSA 4GAGL 4P3WA 2VZTA 4NQQA 4ENEC 3KEHA 2ILLA 2EYTB 2PPCA 1AFVH 1IAIH 3DXAA 4MCYB 3ULSA 4CMHC 4XAWH 1AKJD 1KJ3L 1L9SA 2VZSA 4KQ0A 4IBZA 1DR9A 4R3SA 3TBYA 5A2CA 5D7SL 3LKOA 4NUQA 4WW2C 4EVNA 3RVTC 3GD1C 3TV3L 5C0AE 3KR3H 1GPOH 3BZ4A 3FU7A 1JN6A 3H55A 5EO9A 3B3IB 4FNUA 1NCOA 3WJMA 3X1GA 2ZG2A 1QI5A 1XCQB 2WM0A 2WD0A 5I16A 3WXWL 3DRQA 2GBUA 3HRZC 3B1TA 3TM6A 3WE6B 3CZSA 3Q43A 5CEZH 1XB6A 3NABH 12E8L 2WIIA 3IDIA 4JFYA 5IOKA 1JF1A 5KYNA 4B3VA 4X4KA 1EO7A 3RTLA 5HYEA 3MA9L 3HLAB 1WK0A 1A6TB 4QMEA 5TK2A 3RVUC 4TSCH 4YDIH 5C07D 2ZXEB 4ILDA 1JZDC 3K8KA 1DQQB 3QI9B 5LGHL 1QOKA 4KXZI 1P4LB 3BRGC 3VXSE 4Y4KC 1QEWB 1BXXA 3AREB 2FNWA 5I1EH 2CCWA 2NXZD 1KG0A 3RYMA 2DMBA 4AG4H 4APQA 5JLZA 1G7HA 3PRZA 2W07A 4U1SB 2NX5E 1WZAA 4AYMC 5IWLC 3BN3B 5B1KA 2OXGA 1U3HA 2VXQL 3MOAL 2H26B 2QSTA 3CSPA 3NIDF 4HVBA 1UZ8B 1N6UA 1CLOH 1VRSA 5ERWA 4ZTPL 5C09B 2APXA 4TPRH 2G5BA 3TBVA 4ALAC 2PKDA 3PNWA 1XB3A 4L4VD 3NIGE 1A1NA 1E8XA 3FN3A 3WHXA 2EEXA 1A25A 4FTVB 2HMID 2EICA 3CXDL 1HT6A 1NCBL 1QRKA 1A4KB 1TZIB 1FYHB 1KCKA 2BIPA 3KXFE 4JFEA 5CD3B 1XGYH 2GIMA 2VL5A 4ORGA 1OP5H 3ET9F 3KYOB 3LRSB 4H0HB 1KLGA 1KXVA 4J27A 4MD5B 4W70A 5A2JH 3GBMH 1RU9H 3O45B 1IGYA 2IVFC 2A1WL 2MFNA 3T8VA 3LNHA 1A6AA 1B0RB 4HKZA 4S1RL 4OJAA 3Q9PA 4GIAA 5MENA 3M17B 3IGLA 4NT6A 1TLMA 1H5BA 3EFFB 4HCGA 3AREC 3ZDYE 3TIDB 2GC4C 5IROD 2CBQA 1MLBB 2DJ4A 3JWOL 3MKKA 3IDMA 1KY7A 1KN2H 4PPTA 3NPZB 3U4BH 3VG0L 2V9UA 1Z3RA 2R2HA 3Q6GH 3MNVA 4JM2D 3MRCA 4XC3H 4Z8FL 4XVTH 1G9NL 1UH2A 2APVA 3Q1SL 5DJ0A 2R27A 3D3VD 3L3OB 1KFAH 3L17A 4FFZL 5FO9A 2WTPA 2AS5M 5GGTA 4MZRA 3B7UX 1HI6B 5FFGA 4NKOB 4B9YA 4XB7A 3KLQA 2G2RA 2BO0A 4JZJA 4RMVA 5I18L 3O4OB 3B9KD 4Q7DA 2RBLA 4M1GL 1ITBB 3B9DA 5JW3L 4A2MA 1EV2E 3LS4H 4OJFH 3V6FA 1WTGT 3N06B 3BDXA 3S6CA 4GAAA 4Q52A 3SBRA 2BIMA 3GINA 4OIAA 1DDTA 2UZIH 2HJLA 3HVNA 4ZNEA 4K3HA 4MNHB 4F8TA 5I28A 2DYPD 4A7GF 4NIKB 1TJGL 4ZUUB 2V2TB 3RURA 2Z8RA 5I1HL 2A6IB 3NTCL 3E1ZA 3U4KA 5I6NA 1PZ3A 2R7EB 1SQMA 2I85A 5DFVC 5EHFA 3SPHA 2A77H 2DQCH 1EH9A 2O6CA 3LEVH 4FTDA 4AMKH 1M2VB 4XE0A 2BP8A 1P5UB 3SDDD 1RUKL 2CMRH 2X2IA 1D9KD 4HLZG 5IB3B 4PS8A 3Q48A 3BSHA 2EIEA 1GHFL 3L3OC 2BOCA 5AZEH 3UFIA 4FN0A 3FZUD 4WSGA 4L05A 5D2NE 1BOYA 2GJ6E 1R24B 4P9HH 1PKQE 4YFLF 3GMNB 1KLFB 4UZSA 3O4OC 4FG0A 5IW1B 4XBPB 1D2OA 2FD6L 2GHZA 3PPEA 2WYIA 4WUUE 1NDGA 2W95A 3OB0K 3GUTA 1AR1D 3KWWA 3AWGA 3GM0A 1G7JB 4PJ5A 1AGDA 1KYFA 1DSYA 2CR3A 1AIFB 3FHAA 5HYJD 4U3SB 3KS0H 1EXUA 1QABA 5FO7A 1M05A 3V55A 1TQUA 2DEWX 4PJIB 1D6VL 4PJCA 4JM0A 3IFNL 3LKSB 2EDNA 2YPLB 2WQ8A 2W60A 3GSNL 2F74B 2E27L 4DEUA 1CXLA 2C1OB 2O61A 2R51A 3BMVA 4XPFH 5LXGL 1GGBL 4GRMB 5L2KA 4I3RL 1RUML 3FSOA 2DWSA 1NC2A 1GSMA 1IRAY 4XMPL 4MD0A 5FFOA 5EDSA 5MP6H 1JK8A 5I75B 2VR4A 2DQDL 2ZXWB 4F7EB 1AE6L 3QWQB 4LLMA 4ZRGA 2O26U 5D7IE 1I7TA 2RFXA 2B16A 3ABMB 3EOBA 1HZHL 5KS9A 3MNZA 3LTVA 3MRFB 6PCYA 2XWXA 2J2ZA 2NZ9C 4UI2A 1T5WA 1AGEA 2A0LD 4GG8B 1E43A 3D0LB 4KKBD 5E5UB 4HF5L 1KIQA 2WYHA 4ACPA 3MZTA 1F8TH 5DHVH 4WUKL 1CTMA 5C7ZA 2NSXA 1BZ8A 3HJEA 1GYCA 1IFHL 4XHJD 4BHUI 4P5SA 5KW9H 3WIHA 1J1OH 3MRBA 1FFTB 4FQXB 3S9DB 1G9EA 1CYXA 3CSYB 5JOPD 1GKEA 3ZYIA 3LZLA 2AJXL 2UUDH 4QRSB 4YXHH 3RVWC 2HLAB 3L1OH 4X6EB 2WTRB 1GGIL 3MBEA 1QSEA 3I85A 1L9NA 5ID1A 1NCDH 4GSQA 2UV3A 4F1ZA 1ACYL 2NW3A 4WTWA 4AEFA 2M26A 5IJVA 4PRNA 4JO1L 4E41B 1FAKT 5EN2B 4GAJL 1W0VA 5JHDE 5I75C 3CGTA 3GYRA 3OLGA 3A21A 3QJVB 1ZVSA 1NDMB 4NLAA 5D2LF 4AK1A 2YKKA 5F7DB 4WU7A 2BFGA 3K2KA 1TQSA 4M43H 2X7LA 4QXVA 1IEHA 1V10A 3G08A 3W11D 2E8ZA 3FFCB 3ARBD 1B4RA 2FX9L 2Q87A 2HRLA 1UCBH 1CFNB 4M61B 1A6UH 4LLDA 5KSAD 4E9LA 2DQIH 5HHQB 5TH2B 4BFOA 2EDFA 1S7XB 3ECVA 3LH2L 5CBEA 3BGMA 4Q9QL 3WLWC 3G6DL 1DBBH 4MSWB 1I9JL 4LIQL 3IM1A 3MRIA 4MCNA 4RVBA 1KPUB 2BRRL 3FCSB 3M8OH 4FQXC 4OI7A 1XTLA 3B6SB 3UTTB 3JWDL 2BSBA 5DJ6A 2AMUA 3EYOA 2BCMA 4A6YB 3DXAB 4P2RE 3ULSB 2Q8AH 2PTVA 4GRWE 2QQKL 2OMUA 3RWIA 1JFQH 1ROCA 3HZYA 3ZVVA 5E2VH 5KYXA 1KYOJ 4MJ6A 1A6VH 4W9DC 2P46B 1ZDSA 1GAFL 4Z1PA 2Q7YA 4EVNB 3OJDB 2A3TA 2R1XA 1F42A 5BUPA 4BH8B 2HXAA 2HCZX 1TZGH 3FU7B 2IGTA 5EBMB 4L0PB 1TR7A 2BVUA 3OQ3B 4U4BA 5B4MD 3N9GL 3ULAB 5JIMA 1NCUA 4JRXE 2AJ3A 3WJMB 1LP9E 4IRJD 5DURD 3JTSA 5I16B 3OAUL 1T03H 2QPFA 3GKWH 4L3EA 3J8F7 4BQ9A 1CBVH 2PPEA 3IDIB 5CEZE 4GXUN 3DX4A 4ZO8A 5EMYA 2EEBA 2VNCA 3MBWB 1JV5A 4FFYL 2YGNA 1X5KA 3BP5A 4IDJH 2FDBP 3H42H 4C57C 2DEYX 3UTPD 1QEXA 4UV7H 3ZUCA 5DRZA 4CN4A 2VAAB 4EZMA 4XNDA 1N4XL 2YQBA 3WNPA 3H0TA 3FOLA 3ZZQA 3ZDZE 25C8H 4Z76A 2NXYD 2BLFA 4Q2ZA 3MV7A 4HJUA 1YZZA 2O4EA 4JPSA 3MHZA 2JJTC 1A5FH 2KL6A 4S1SH 1KG0B 1SXNA 4DGWC 3U9PH 4APQB 1NBZA 1G7HB 1U41A 4ZXBB 4JY5H 5G2NA 3P0VH 4Y89A 2YSSB 1R1CA 4ODWA 2OYKA 3S4SA 1DANU 2OYLA 5ITBH 1WFIA 4MZIA 3WL9A 2OXGB 4JN1H 3WS3A 5I15H 5KSBB 2MKWA 4KK5D 1XR9A 2DD8L 2NQCA 2VKXA 4UUJA 3VI4A 1NINA 1TSHA 1GTFA 3SPVA 3TBVB 3KE0A 5C86A 5ACLA 3PNWB 1WCBA 4JFDD 3N1FC 1TJMA 1A1NB 1B0GA 3H4FA 5F9WC 4NNXA 4I4WB 5IBTL 3F04A 1UM4H 4P9MH 2OTPA 1EEYB 4LNRB 1AQ8A 1Q9LB 3OPZL 4HH8A 3FF8A 1WWBX 2VL5B 1H6TA 4ORGB 1JRHL 2X2YA 4EQ3A 2WBJA 3Q6FB 1KJ2A 3LQZA 3MTRA 3WMQA 1M7UA 2DBLL 1CDJA 1LE5A 1CFTA 4UIMA 3PWNA 4YFEA 2Y0SA 1A6AB 4ANWA 5CKAA 4HKZB 5LQBL 3E0GA 3FUDA 2VLJA 2OKMA 4AITA 4HISA 5MENB 4HWEH 4PBDA 3GXTA 2OTWA 4WEUD 2N7AA 2BVEA 4APQC 4XN4A 2G2NA 4ZXBC 2H5UA 4NIYE 2HLEB 2NW2B 4N6QA 3MNVB 3QUZC 2ZOOA 3DX3A 5T5FH 4PJFE 4P4KA 2VTFA 5HGGS 2NY2B 2KT6A 4P2QB 1MFDH 2WSPA 5DEJA 1NBCA 1PW3A 1D6EA 4QLRA 3SKUD 1OGAD 4ICXA 3N42F 1SUJA 1S9VA 2P80D 2ZKXA 1J7VR 2LOEA 4WI9A 2MCPL 4QTIH 2IDUA 4F57L 4I48B 5AB1A 3RY6C 2WLHA 5DUML 2Y3NA 5C0GA 3KDMB 2X5PA 1BMZA 4UT9L 2FBJH 3HAEB 4AGOA 2B1OA 3V6FB 3RZCD 5HYQA 2XX1A 1PZUB 4NOBA 4WZ9A 5D1ZD 5F1KC 4Y1AB 4ZMZA 2IPUG 3BVVA 2CNYA 4N0CD 3ULUD 1VKXA 3A24A 3ARSA 1VDGA 1S2EA 4NWTL 4ZFZB 2ZPKL 4Y9CA 2LR4A 3LOWA 4HJGA 2JKTM 4QAWA 5I76B 2BSTB 4KQ3H 1JZJA 1UQSA 1MRDL 5T1KA 3QJFA 1CLZL 5JUEL 3OR6A 2TSBA 1ADQA 1BCIA 3VFWA 4YE4L 4B9CA 4KKNA 2NT0A 1IQWL 3O6MH 1SY6L 5KJRL 1DN2A 2RR3A 5GXBB 1JSYA 2Y5TA 2BP8B 4KI5D 4A7TA 3IMWA 3QC5X 3D0VA 3ZL4L 3EOYG 3BIKA 1MHPH 2C7FA 4Q58C 2NY2C 4HJ1A 1KTLA 5J6SA 3SZKC 4A38A 5E5RB 1BWWA 2EIZA 2GTZA 3F3HA 4YHIA 3GSRA 1P1ZB 2X0VA 2X44D 3SHSA 2YBRA 3ASOB 3QXAA 3VYPA 1UD3A 3LPPA 1DBML 1MW2A 5F9JA 3LIZH 3KWWB 2NR6C 5FKPB 3ULUH 4GXVH 3VSUA 4WFHE 4M5SA 4C56A 2NY4B 5FK9B 1EXUB 1ZANL 1M05B 2XQYK 3APNA 5ANHA 5D7LA 1OAZH 4PJCB 1LHZA 2R29A 2R2EA 4LCIL 4MJIA 4KKAD 4XPHL 1ZHLB 2O61B 3CU7A 4NERA 4CU7A 4PY8J 1U8HA 1U3HD 5L2KB 4AZ8A 4OJDH 3QJZA 1E67A 5FUZL 2AK1H 3DUHA 4MD0B 3TNMA 1MHCA 3QPXH 1JK8B 1YCSA 2CO4A 3RUGB 1A7PH 2DQUH 4LLMB 4HUKB 1WFTA 5JXED 3HZ3A 2FHFA 2XSKA 1I7TB 1DVFC 5IMOA 1CDIA 2LT9A 4X4XA 5KS9B 4ZFQA 3MNZB 3KJ4B 3JVGC 4N5EC 4FNLH 5CD5C 4F9LA 4KTGA 5AD0A 4IKIA 2WTOA 2H32A 4XR8C 1PNDA 2FE0A 1FLRH 1JMXA 3DHMA 4JFED 1T5WB 4J3BA 4OLUL 4ODHH 1IEAA 1U58A 5HHVL 1JPFA 3MYJB 5FAAA 4PCSA 4H4NA 1FFQA 3GHBH 4GO8A 3CFQA 2GBAA 3NSJA 1DVSA 2F19H 1LK3L 4M7LH 3U1QA 1A9EA 3WUWB 2A6JB 3BDYH 2LFGA 1IGCL 4HPOH 1J1XL 3PWVA 3MRBB 3OKYA 1CXEA 3FN9A 4X5XB 2OK0H 1DYZA 4CJ1A 3EDDA 1XB8A 3WKPA 3KPPB 5JXAH 3PWLB 3ZUNC 3RIFK 2KKQA 5D70H 4FABH 1NCAL 3T2PA 1SGKA 4EOWH 1X6LA 2B59B 1X5AA 3B7RL 3IU3B 5EUOB 2VH5L 4QOKA 2PWHA 3TASA 3WGUB 5F0MB 3MBEB 1QSEB 3NSDA 1E4HA 5C09E 2A9NH 1EEZA 3S98A 5GGUA 4OW6A 5IJVB 4PRNB 3RHWK 3UBHA 3LPWA 4TUOA 4KJQC 4D0BA 2EC8A 2N1TE 4LOUC 1CQKA 4Q6YA 4AM0Q 1KBGL 2EVJA 1ZVSB 4KJWC 4FTVE 3W38A 3Q2CA 4WU7B 3K74B 1NGYB 1J8HB 4FMVA 5CEXA 3KJ4C 4BFJA 5CZXC 4YIQB 5E99H 4E2OA 3S88H 1MCJA 4UU9A 5GZNA 2V5YA 2X4RB 4EN3A 4MVBD 3B56A 3EW3B 2CK2A 2EEFA 1N0XH 3CQPA 4E9TA 4KKCD 1T7ZA 2AQQA 5EEWA 5DO2D 3AGVA 3BGMB 3EUDA 2EIJB 2OFQA 3ARGD 2ATPB 3PP3H 4PV1C 1UOKA 3MRIB 2JJUA 5F96H 5KUKA 4J4PA 3FTUA 4GPVA 5C9JA 1OP9A 5DJ6B 1SLWA 3G6JF 4U7SA 4MS6A 4ZZFA 2APTA 3H3PL 5FM4A 5BV7L 1TETL 1IU1A 5PAZA 2OMUB 4XXDA 3RWIB 5EWIL 4U2ZA 3HZYB 3MBEC 5KYXB 2AW2A 1FZKB 4FI6A 1KTDA 4AI7A 1NZRA 4XWOD 2Q7YB 3WYRA 2YD8A 4OD2A 1EEQA 3BP4A 4O02L 3CPLA 5DRXA 1KTJA 1QPPA 1TVBA 1U8PA 2CRIA 4PGCA 2C4FT 3GK8L 1SMAA 3O6LL 4UTBA 2O6DA 1LQBC 2AJ3B 3RQ3A 5LWYL 4HH9B 4IU3A 1KELL 3PV7A 4DEPB 5ID0A 1R4XA 4HWZB 4L3EB 4TLUA 3L9RA 4YHLH 2IC2A 4JW3A 5DMIH 4OGYH 2JB5H 5FGCB 3MROA 4PJ5D 1VACA 2CO1A 5F1NA 1Z9MA 3BXNB 3BP5B 3UYPB 2F54D 4QHLA 3FO0H 5DRZB 4F7MB 5FYLL 4X6CB 1A0QH 4CC1A 5I8CB 4WNJA 2NTFB 4UNVA 3FOLB 2OCCB 3MRNB 2V6HA 3TBTB 4DSYA 1J5IA 2NRDA 3EHBC 4P57B 1EXGA 1NC2D 1IAIM 2VLRA 4ELKA 2BINA 5H37A 2Y06L 4ODWB 3JV6A 2APBA 2F18A 1GGCH 1M3JA 3TEZA 3VQLA 2R1WA 1ND0A 4NQDD 1PNCA 4XTRC 4B5ZA 4KXBA 4DN3L 4ZFFB 3UPAA 3WS3B 1CICA 5I8EB 3ZHNA 4RSYA 5F6HI 4WHYG 3FMGL 2F61A 3WEXB 1I1AA 4DKDC 2WSKA 4XH2A 3CFKB 4NC0B 3SPVB 2W9DL 5HYFA 1KT2B 2DJMA 1WCBB 1DBKL 3ZMEA 2BC4B 3ULVL 4XCFH 1B0GB 2EIBA 1QZ1A 4NNXB 3WCYA 2BH0A 1XT5A 1EFQA 1HEZB 1TCMA 3NA9L 1KYAA 2XZAH 3J07A 4WI6A 4DEPC 3H53A 5IB5B 1KCLA 3REVA 3HIZA 3LQAH 4C4KO 3CC5A 4N2EA 2XTJD 4A7GA 4PJIE 2WBJB 1KJ2B 3LQZB 1U95A 3MRQB 4R26H 2CPCA 2YPLE 1OEZW 4M1CC 1LE5B 3PWNB 4KKLD 1KEMH 1XBRA 1QW8A 2Z93A 1WHPA 2VLJB 1A7QL 3CDFA 1U3NA 4I85A 3BZDA 2OTWB 3C08H 4N25A 1A1MA 4JO2L 1YEJH 1ZJAA 3D85A 2KZWA 5IHZA 1MRCL 3VH8A 2W88A 2WN3A 4ACTA 2ZKHH 1CURA 1JGLL 2B77A 2F08A 2Z7UA 4CNIA 4P4KB 3RTQD 1JHTA 2PWFA 3ZKNC 4QXGL 2ZJSH 4ZDHA 4TUJB 1QWNA 2A9CA 4XP1H 4FQQB 2YAQA 2YHGA 2KI6A 5GGVY 3V6OA 2BSRB 3WIHH 2GFBA 5J6HA 5LGJB 1AP2B 5E8PA 2MPAL 1THCA 2CIIA 2OL3A 5FXCH 3MGAA 3V5KA 5HYQB 2UZPA 4LVEA 5CINH 5INDA 2WBJC 4WWOA 3M1OA 1VKXB 1HYSD 1CL7H 4EQ2A 4JG0L 4NQVA 5B39B 1CDHA 4LB8A 1AYRA 5TQ2H 3LRMA 4PG9A 2WLNA 4K55A 4HEME 3Q8FA 4FE9A 4E41E 1YN7B 1UQSB 1PY0A 3QJFB 4NWUL 1WA0X 1A4JA 5F0PB 3ZMNA 3VFWB 3REWB 2H4EA 3R4RA 2J8UF 1SHMA 1UZGA 1OP5K 4F8PA 1L7TH 4DKAA 2X0UA 1OW0A 4H8PA 3NK4A 3D0VB 4JHVA 3V4VA 3BIKB 3DYPA 4ZI8A 3FFCE 3CG8A 1IT9L 2WBWB 2J71A 3N3EA 15C8H 5GRWA 2CALA 4N0FA 4O51B 3X3FL 4ODSH 2E7LA 2EIZB 2GTZB 1ZLSL 2KLSA 1N0LA 4YHIB 2VL4A 4KPHL 5E08H 1B4LA 3GSRB 4PJEF 4E68A 4DP2X 3NCYP 2FQGA 2YBRB 3QXAB 5LGKA 4Q89A 2WKOF 1ZHKB 3VI3F 5HVHB 1BW8A 1UM5H 4G6AC 1KY6A 5F9JB 1S5IH 1I1FA 3UTTE 3BKCH 3RA7H 3E9UA 2L3BA 3U83A 1V55B 2ZG3A 4R7LA 1LO4L 2I7SA 3MV7D 5IHLB 4KX7A 2EZ0D 1BVNT 1HWWA 2ZKMX 3DXAE 4NBXB 3VQMA 4PWGA 1E5CA 5D7LB 3L4YA 5E2TH 1FVDA 1UWXH 1IC0A 1LO3L 4CN1A 1J12A 4HLJA 1R46A 2R69L 1Q94A 4A66A 4BQCA 3HPLA 2IDSA 2JI3A 5DC0A 2DLIA 3B43A 3CDYA 3GTNA 2HH0H 3QCUL 4XZ4A 4XCCL 3WNMA 3KGTA 5D2LA 1ETJA 5C0ND 5ADPL 4EMZA 3QORD 5E03A 3UO1H 3D08A 3TT3L 3UX9B 1RPUA 3G5ZA 1EO8L 3TNMB 4PS7A 3BZ5A 5A6LA 2VZOA 3T0XA 3CFEA 3K72A 1GXEA 4EBQL 2VDNB 3L3KA 4X4XB 3ISWA 3RWDA 5D4JA 4X6DF 4Q14A 3BOVA 3LKPB 5ABDE 3GSXA 3W2DL 2Z7ZA 3NAAL 4RMTA 4TNVF 3SBWA 3MZGB 3Q8BA 4QHKI 3OAYH 5BMFH 3LX9A 1ZTXH 1JPFB 4JN2B 1JVLA 1OAYL 4LHUD 2NY5C 2QVKA 1TCRB 1GC1C 3AMKA 4HT1L 3IJSA 5HVHC 2MH4A 4ZMQA 2DQGH 2CA4A 3S37L 1K6QH 1D5MB 3T1FB 1ZEAH 5JHBA 2BHYA 2Y6SD 2MTAA 3WFBH 3SGDH 2IOMA 4JE4B 2IANA 5BJTA 5BQ7B 3GI8H 3AY4A 3GRWL 2AERT 4L4TB 1YMMA 1DTUA 3GNMH 3T2QA 3HNSL 4PBXA 3LXCA 4X7TA 1MVUA 1ED3B 4KV5E 5AL0A 4UILH 1LDSA 4QXTA 5KSBE 2F7RA 3QRLA 1BOGB 1YEWA 2VW7A 3AVEA 3A6CL 1U8QB 3IKCB 1EEZB 4M5YL 5HGBB 3GJFA 3P4NB 1OCWL 3WAJA 4F24A 2GHWB 1ONQB 4YDLB 4LKCA 5T1MB 3NRFA 5K59E 3FQWA 1B4JL 4JUSA 4NO5A 3MTXA 4LL4A 4MJ2A 1Q9KB 4PWEA 3G7TA 2VC2H 3CZUB 3MRPA 2R15A 2YUVA 4GQ9L 1KJ2H 1T1XB 1NCGA 4M6NL 4A7UA 1AD9A 4UU9B 2O5NA 1SDAB 3RDTA 4ETYA 1OSPL 5C0JA 2JKSA 3PHQA 3IBOA 1SJXA 1VJSA 1HKLH 2NMSA 5F3HA 5MENE 1MCHA 1HXKA 2EE3A 3Q8CA 4ELMF 2DF3A 4PBWD 1EMTH 1IGFL 4P5KA 3AT0A 1DUYA 2VIRA 4ONGH 5C9JB 2PWDA 3NIDB 4ZD3L 4XMZA 4MDJA 1ETB1 4BZ1L 4Y16A 2M2DA 1QLEH 4ZMWA 5EZOL 4LNVA 3D07A 4OCXL 4OGXH 1KTDB 4JRYA 4P2QE 4Q97A 3O2VH 1ZRUA 3CPLB 5AQ0A 4YDLC 1U8PB 5AKTA 1YY8B 4EO5A 3WKQA 3T0ED 3MLVL 2UUDK 1N8ZB 2QKIA 1J0HA 5FA3A 3TWCH 4W4NA 4BKTC 1RCYA 3FO2A 5ID0B 1MFUA 1ZOXA 4YHKL 2PW1A 5DYOA 4TULL 1RH8A 4EI0A 3K2UH 1UASA 3L9RB 1GCYA 3UZQB 4Y1AE 3AU1A 3MROB 5F1NB 4ZNEE 1NLDH 2RQEA 3LEXA 5DJ8B 3V7AG 4C56D 2YD9A 3PABA 5AVWB 1B9ZA 3DJ9A 1OF0A 4W1TA 3VFGL 4ERSL 1B2YA 1E4XL 5LBSL 4F7TB 3PGFH 2I32A 3DI2B 2GJZA 4G8IB 5IJDC 1ADQH 4AW7A 3CX2A 4N2HA 3S3SA 4HIHA 4IHOA 4BKLA 4JS7A 5DC9B 3CZEA 2BW5A 3O3BA 5IKCB 4J4PC 3RWEB 2G60L 3T3PF 1BP3B 5ISZB 3Q05A 4NRYA 3L8QA 4B9PA 1D5XB 1DQMH 2OSLA 1HNYA 4XCEB 4AYFA 4P3CL 5KBNC 2X6AA 3JV6B 3Q9QA 4OZ4A 5GRUL 4N2GA 3NN8B 3PG2A 2BY2A 3TBBA 4R5VA 1SOXA 1CYWA 1DEDA 4URTB 3RWJB 2IXQA 1UJ3B 5LBVA 5T5NF 2P8MB 1I1AB 2GITB 4Z7WF 4G6KH 1LMIA 2QHRL 3CVHB 4YMPA 1I1RA 3A67L 4YBHA 5IW3A 2EDMA 3TCTA 5E8DH 1LEGB 1HCZA 4V2CB 3PJNA 4G42B 3IRPX 3TBSB 1WUNT 3SQBB 3G04A 1IKFH 1C5BL 1IZKA 3REVB 2FNBA 4L8BB 4GKSA 5ES4B 3V0HA 4HPYL 4XMVA 1Y0LA 3B3BA 4PVNA 4PJCE 3VFUB 4PRID 5JIIA 4TSAH 3T5WA 5L9DH 2B14A 2OR9H 3VXMA 5I73B 2Z93B 1MF2H 2H0FA 4QOKD 5L2KE 1IM3B 2GT9B 2ZP8A 4U49A 4YXLL 3QHZL 1TT6A 4Z9KB 2WWMC 4X9IA 4G8AC 2QR0B 4KY1H 3RUGE 3QZNA 5DMJB 2V7NB 3D85B 4NM4L 1OPOA 3L5WB 5IHZB 3STBA 1NA8A 4MNGA 2BVQA 2VKWA 1O7VA 1U8CA 3BN9D 3RFRA 5KS9E 4YL4A 2K6WA 4G8FA 2AAVA 3ZTNH 3H9SA 2H32H 1P4IL 2ORBL 1CD1A 3FN0L 4JFFA 4LLWB 4Y2NA 5EIIG 1XD1A 3WLBA 4CNIB 4JM4H 1L0XA 1PGRB 1UJ3C 5FR3A 2K3HA 3VXOA 2DQJH 1I1AC 2KYIA 2CNZA 3LS5H 4ZDHB 5LVEA 4JCMA 4KXDA 4AV4A 4N8VA 2WOYA 4EN3D 5TPWH 1BAFL 1N2RA 1NAMH 2AVGA 4M02A 4DQAA 3GJEA 2GFBB 2JQAA 3CX5J 5J6HB 3L5JA 4ZS7H 5KVFH 3HCVB 1KB5B 1GYUA 3BKYH 1XHHA 2CIIB 1MWAA 3EJZD 3V5KB 4B7LA 2OX5B 3HN5A 4N0YL 1FIEA 2OJEA 5INDB 1CGSL 1GJWA 3DMMD 1ILUA 3KAAA 5EUOE 3IJYB 4GQQA 4OLXH 5GRVK 3MA7A 1QSEE 4J1UB 1IVTA 3V0AC 5DLMH 5I73C 2J88L 3DX8A 3HHSB 1D7FA 2ZZUT 3G9AB 2X41A 5L6YL 1JTPA 5AAMC 1WA2X 5FUOL 4U3CA 2D4FA 1FL5A 5IFJB 4PLNC 1A4JB 2XWZA 1ORSA 4O2CB 4WV1A 1F90H 3PNRB 2IV9A 3ALPA 4LLQA 3RWGA 3PREA 3N41F 3BI9X 2YPKA 3BIAX 2FIKA 1X7QA 5AOIA 1NGQL 3V4VB 3FH7A 5FM8A 3WU1A 1CR9L 2QLYA 3S8GB 2B1HL 4NQEA 1CF8L 1X5XA 4PP1C 3EO9L 4N0FB 4A2FA 1N0LB 2XKNA 1U8MA 4DP4X 4PJAF 4AGNA 4JRFA 1GGTA 2MQ3A 5FGSA 2VJ8A 3VFRA 4CN6A 2IOOA 3A5VA 4FHKA 2WANA 5A3ID 4YK4B 1FUNA 3L5HA 4TNWF 2ZAHA 1XF3B 4RSVA 1XQ4A 1W72H 2CDEA 3U4EB 2VLRD 1FVDB 2Y7NA 3INUL 5H94A 4HK3J 3EJPA 1Q94B 1NTDA 2IBZX 2XX0A 3HN8A 4TRPH 2YWZA 3IJHB 3W39A 1KGJA 4BQ6A 1EJ8A 2C5DC 4GLRH 2GB2A 5TE7L 3OXSA 3G5ZB 4NPJA 3CN0A 1MCNA 1ZGLB 5K93A 3JWNG 3CFEB 4DKEH 2FR4B 4K3DL 5I2IA 4ZMLA 5EORH 3UERA 5DF0A 4L3EE 1WE5A 2RALA 3L3KB 1KBBA 1FPTH 3SDXF 3QZPA 1A2YB 3RG1C 2HX9A 4PTUB 2WVUA 5FGCE 2XPYA 3NJVA 3GSXB 5CR8A 2EUVA 4IKLA 5TF1H 1KJMB 1SUHA 2IBGA 1GOFA 3DECA 2R0ZH 4JO3H 3MLTA 5FIEA 2R4RH 3B2XA 4LLYA 2BHFA 2FX8L 5H2BA 4X6CE 5IB2A 3WIAA 3FUIA 4X0KB 3G6JA 4OLYH 4X8XA 1HSAB 1BFOB 3BEWA 4AQ1C 4GUOA 1S7RB 2J44A 4GRLD 1IVLA 1Z66A 2JELH 1WFOA 1YRKA 5H37H 3D48R 2J20A 5CZRA 1ID5I 2IANB 2AGJH 4WWID 5BJTB 1XGRB 3WO4B 5GRJH 2C3VB 1RUQL 2EIKB 4HAGA 3VVWA 5BZZA 4YDNA 5IHHA 4X7TB 3NZHH 2N3JA 2R9HC 3G5VA 2TRYA 3KPTA 2EUZA 4Y2DA 1CXKA 1T89C 3GJFB 2ZCKH 3QUML 3I84A 4PR5A 3QUKA 3F7VB 2B20A 3N85L 4NO5B 3EAKA 2BDNH 2C34A 4I9XA 5EC1A 3UP6A 5K9OA 4P5MA 4HIEA 4K8RD 5DEGA 3QZBA 3RVVD 1IGIH 1WEJH 2BNRD 1D9KB 3UP1A 2N0MA 4EI6A 3HE6A 4Z7UA 3SOBH 1AD9B 8CGTA 3EF7A 1KPRA 5F6IB 3RDTB 4LSRH 3SBWC 3UZEC 3F58H 4NQCA 4FHJA 2YOAA 3PHQB 2MCMA 3I50L 3QG7L 5KVEE 1BA9A 3JSSA 2ZONA 4NZUL 5K1NA 2VLJE 1C9SA 3MREA 4HUXB 1I7ZA 1J0JA 4D9RD 1QMUA 2BNQA 4CGUB 3DTXB 3WIIH 5CBAB 5F21B 1DUYB 2VIRB 1EQWA 3LRGA 3OL2A 4LARH 4LSSH 4ONFH 3T0DA 3QJRB 2K7QA 3WO4C 1A9BB 2IWGA 4MDJB 4Y16B 5HYJB 2XZQH 1I8LC 4GO6B 1T04B 5AW1B 4JPWH 4P46B 3AZUA 4J12A 3B2PA 4RRPA 2PUQT 4JRYB 4N1EA 3I2CL 2AXFA 2BOBA 5TFSH 1HQRA 1RZPA 3UROR 2WYZA 5F8RC 5EU6A 1OCCB 1N7ML 4GP4B 4XMUA 5INCB 1FO0L 2VLLA 4FFVD 4KX9A 5CU5A 1CDUA 2QKIB 1JZ4A 5FHBL 5FA3B 5DK0A 1XH2A 2OL3H 5EPMA 4PHZA 3TONA 4F2EA 2FO4A 2GY7B 1U4EA 2AJZA 2FQEA 2PW1B 1TSRA 1AIZA 4Y5YA 1D9KC 2AK4D 3FQ1A 4LPVA 4D9LH 1DSWA 1YUHA 5F6IC 2OA9A 1SVZA 2GIXA 4K9EC 3LEXB 3CN4A 1TFHA 3RDTC 4DVBA 1OCZB 2Q10A 5DEFB 3PABB 1RK0B 1TO4A 2PP9A 2O5XL 2KDGA 4NGHH 3BLBA 5ICXA 1IJNA 3UCRA 2GJZB 4PVMA 2ZOWA 2VRQA 3D50A 4J28A 2UXVA 4OCYH 4HIHB 4H8WC 2RD0A 4R7XA 3O3BB 1UKTA 3S35L 1WBYA 4PH8A 3QEUA 1QSFD 3H7BA 2F0CA 2NY0D 4C59B 3NOIA 3OLEA 3IF1B 4AMXA 3FKUS 4Y16C 4AYFB 2ATKA 1TJHL 5AW7B 1Z7JA 2A6KB 5GGVH 2VW4A 1RJYB 4NENA 5C0FA 1VF5C 1YECL 2YIHA 4P46C 4WWPA 1I8AA 4KNSA 2IXQB 2FJFA 4G3YH 4YX2L 1E5AA 4XPTH 3PP3K 1J0ZA 4J7RA 4DW2L 5EO0B 1N12A 3SDAA 1UEMA 3DURB 2R56L 4JJ5A 4GT0A 3BUYA 1ZV5A 3DOHA 4LP4A 2QKIC 4GIPD 5B8CA 1HSBA 3V4PH 5KVGL 3CXHK 2QKSA 3U0PB 5L4FA 1U36A 1DQTA 4YNYA 1NCNA 5HBBA 3BPOB 2P43B 1Y0LB 5D7LE 4DKFL 1AZCA 1GKOA 1IC4H 4APXA 3ZTEA 1DQKA 5CM1A 3CU1A 4H40A 4PN6A 5I30L 4MJIE 4XBGA 2JJWA 1YMMD 2JIXD 2VR8A 4E9SA 5DD0H 2NTSP 3H9ZA 4O9HL 2NYYD 4IQHA 2J8UA 4JJOA 3V6ZA 1KPVA 4H2AA 5DO8A 3UH8A 5F88B 1QKZL 1L9OA 3NCFB 5FM5O 4X98A 4LKXB 1U8IA 4K5MA 4Y2OB 4N6RA 4NZRH 4S0SD 4XB3A 1CE1L 1QASA 2SODB 2BS9A 2VISA 3NMEA 2BVQB 4MNGB 1WZMA 3KLDA 5HDLA 4L18A 4ODTL 1E0OB 4G8FB 1YEHL 3QIUD 2QQLL 5DQDL 2WYTA 2YJLA 3D39A 3H9SB 5GSRB 4HGMA 4IGBD 4PJEA 3FONB 4JFQB 3U0WH 3ATEA 3CSGA 3VXOB 3VI3A 4Z3EA 1F1DA 4FZ8L 1XGQA 3BVNA 1OARH 4G8GB 4ZBJA 4AIZA 4N8VB 1RL1A 5KYYA 1J5CA 1MREL 1PG7L 4WY7H 4L37A 1TNMA 1XAUA 3RL1B 4ZMVA 4MMZA 2QL1A 5IJBC 2OPCA 4GBXD 1GYVA 2JKIS 1MWAB 1AI1H 1O6VA 3SCMA 4LASL 1T1YA 4L4TE 4OM0L 1CGYA 3BPOC 4RBPH 4U1LA 2OJEB 4X9GA 3OWRA 3W11C 3GLZA 3P9MA 4MQXC 1LO2H 2R1YB 3EYQD 4NQUA 1PZAA 2H2PD 1W6WA 2AV1B 5G5DA 1ZD6A 3PDGA 5FV2A 2GSIB 3M86A 4LOFA 2YRPA 3DX8B 5JW4N 1X5GA 5DS2A 2W92A 1LEKA 3PQYD 5LAPA 1QRNA 5EOCJ 3SE3A 4I0PA 1DCLA 1FNHA 1E3ZA 5JIDA 3CN1A 4WV1B 2XQBL 4JDZA 1UOWA 1PAMA 4X6DA 4BFRA 3O6FD 4UQ2B 3RWGB 3VU2A 5IB4B 2YPKB 1OT1A 2DY2A 1X7QB 4UOZA 3QWOB 2VUYA 5BRZB 3QQ3A 4N86A 5EBGA 1DSFL 4NQEB 4X7CC 2IO5A 3GO1L 5D55A 5D7EA 1J8SA 1FORH 4KDTA 4NO2B 1JXFA 1JXGA 4C4UA 4V33A 2ZP9A 5KSVA 5E9DD 1VPOL 2B1AH 2ZE0A 4XP4H 3VW3H 1NIAA 1OTTD 1DJGA 5C0CA 4EAEA 4IMLA 2ITCB 3IBEA 4ODXA 1N5YH 1A7NL 1IV8A 1QWHA 3NIDE 2D7TL 2R0LH 1MCKA 1XF1A 2CDEB 4KVCL 1BJ1H 1ZLWH 5KG9A 4AKPA 1OGPA 3QS3A 4H88H 4PGJA 4U1GC 1ITCA 4FQ2H 1CFVH 2ZG1A 4I9WE 4F7PA 4A2GA 4JVPA 1E8YA 4W9JC 1KBKA 4HS3B 4ODVL 2NXYC 3OXSB 4WV1C 3S97C 5JTWA 3IDGA 4CILA 3QFDA 4G8EB 1UD5A 3PJSA 1RZ8B 1MCPL 1MZZA 2GI7A 4Z0BH 3NBNA 1LDPH 3TO4A 4WEMB 1VESA 2J5LB 4C54A 5AWNL 4HG4J 4Q0XL 5HY9A 1OPGH 4YGAB 2XZCH 3D69A 5FYJL 4NZFA 5KWYC 3VB9A 3QK0A 1SN5A 1XIWD 4O00A 5CCKH 4TQEL 1A6WL 4KUCF 2YLHA 4ELMA 1HL5A 2DZEA 3ZRFC 4LLYB 1JAEA 1QATA 2YUZA 1SF5A 5IB2B 2YMXH 3L95B 2FT8A 3G6JB 5HGHA 3VXMD 1L4IA 1DQVA 1QQDA 1IBHA 2JCWA 1F6AB 5DS8A 5ISZE 3MLWL 3FRUA 3I6KB 5JW4Q 2BVTA 1CZ8H 3VGFA 5EB9A 2FWLB 4C4BA 2HZHA 5D1ZB 5G55A 1HAWA 2EABA 1JPEA 4PY8I 3G5VB 3K71A 3EYSH 4YO0A 5CHNA 3NEXA 4ZQKA 1B2WH 2H7WA 4Y2DB 1AHKA 1WAAF 3P2TA 5BOJA 2ODIA 3BKMH 3BHBA 1I9IH 3CFJA 5IB1B 32C2A 1BJ1J 4P5MB 1T7VA 4JDTH 4LPXA 1HE7A 1U42A 2WN2A 2J5LC 3KPQB 2PR9A 3TVMA 1KXQA 5AUMB 1UWXK 3HE7D 2WWKT 2CLRB 3O0LA 1T4WA 1R3IL 3KWXA 3T2NH 5CJOL 2LLLA 5BXFA 1MY7A 4G7YH 2JNZA 5HGDB 3P3RA 2E76C 4WNSA 3U1SL 4C55A 2BWDA 3CLEH 3MREB 2PPDA 3MRRA 1I7ZB 3X11B 2X05A 1SDYA 2FB4H 1N59A 2IBZY 3NJMA 5AB9A 3WTVA 1KSRA 1H6FA 4HHAA 3MMEA 5D1ZC 5IJCC 4OR1A 4Z7WA 4ORZC 3OAYK 4N0CC 3W37A 5BVPL 1ESOA 1Z2KA 5DFTA 2ZSVA 4AUUA 1BBDH 1ODAA 1U8KA 3EFOB 5HHOB 3JYCA 2XWBB 2QGBA 4OF8A 2BP0A 3DVNA 3MLSL 4PWJA 4Y2DC 4ZOAA 3SDYH 3ZX1A 5EU6B 4N2MA 2VB5A 1NBYA 2DQEH 4ANKA 5C0DA 1ZA3A 3L6FA 1OCRB 3PWPA 5DS1A 1OAKH 3BKJH 4PGEB 4F58L 3DX1A 1ZS8B 3R1GH 3ABZA 5DK0B 1MWAH 2ICES 1QFUL 4KO6A 3V0VA 2FO4B 5JIPA 4JQXA 4ZW7A 5FYLD 2F1BA 5E2UL 1UA6H 4W9KC 4RISL 1OK8A 4AZUA 3MX0B 1BEYH 4OI9A 1YUHB 2RH0A 4AE0A 4DVBB 2QSCH 3EYUL 1ICTA 3Q8AA 4JDEA 2VDPB 3K81A 4O5LH 4JFPA 2UZYA 4KAQH 1T0OA 1OWWA 2V7HA 2CBMA 3FUJA 2ZOTA 3N1MC 4HIJA 4CAGA 2YAHA 4HC1A 3ZE0F 1WBYB 3QEHA 3RI5F 1TITA 2EP6A 2VERN 3QFJA 4KKRA 5JHLA 2VSMB 1TQTA 2D8KA 2E9GA 3DI3B 3VXUA 4X4YB 4N1CA 4D8PB 5C0FB 2VSCA 5KTEL 2AHIA 3CFBB 2BRQA 1R9FA 4U6YA 1RULH 3VXRA 2FJFB 3HNTL 2WOBA 2B3IA 2BK8A 3FB6B 5FDWA 4KK6D 2YPVL 5I1GL 3UXFA 2A9AA 5IJKA 4G70B 2XXCB 4UBDC 3SDAB 2LLNA 3BWAA 2J8HA 3BUYB 4HGWA 5D1QA 1EK3A 1KOAA 4OGQC 1XGZA 1HSBB 4XMXA 4QYAA 1MFAL 5JXEC 2YQ3A 3DX6A 5AVTB 3X3GH 2A5UA 2HX8A 2FJGA 1MI5A 1OANA 2XCMC 4X99A 4AVIA 4AVHA 4JNXA 1ZLEA 4ONHB 4BXSV 5IQ9A 2F58H 1MJ7H 1Z32X 3KPSB 5IHUH 1DQJA 2J55A 4M5TA 3U46A 2XV0A 4M7LT 2XN2A 1RVFL 2AEQL 2G75B 1DFBH 4WEBL 1R5VA 2I9LB 3II2A 3ML9A 3O2DA 5E1QA 4X98B 1U8IB 2OJZH 4GH7B 2K3TA 4ZG1A 2XFXB 3HZVA 4HA1A 4XE5B 1HIML 5B38A 2VQ1A 4MDIB 5GS0L 1F58L 3QJSB 5JPNB 3QEGL 4GO9A 1F11A 3D39B 4XXWC 2FEDD 4PJEB 5ADOL 4M7JL 4OCSL 1FNFA 3NACH 4PJAA 1DUZA 4B9ZA 1YEIH 3VI3B 2H3NA 3HE6D 1BXVA 1XGQB 3BVNB 3E6FB 4ZUWB 1JNJA 1KDJA 5DVKA 3SDAC 3BO8A 5KYYB 3PDOA 3AFLA 3IFLL 5HDRA 4DP6X 4NQCD 4QRRA 3E3QC 2WVVA 4L37B 5ALCL 2WB1A 4MMZB 3B2VH 2GTWA 3OZKA 2XIBA 5ACMA 1BLNA 2IANE 2P48B 3CTTA 2Z91A 3SCMB 2CLZA 4RQQB 1T1YB 1YEEH 4U1LB 1VENA 3CZNA 1UB6A 2EJ1A 3OJMB 3L1GA 4R7VA 4BUGA 2DRUA 4XT1C 3WI9A 4K5PA 3TEWA 5MEOA 5G5DB 4QRUA 5AVVB 4KKCC 4R90H 5J7CC 1RK7A 4UM9A 4I0PB 3ARGC 1RJZB 3SDXA 1PFOA 1R3HB 4XP9L 4HIIA 4X6DB 1I8KA 5I74B 2BVPA 4BHUA 4JFXB 1Z5YD 1NH6A 4HU8A 5JPNC 5A2LH 4JFZH 3GHEL 1KBPA 3EO0A 5E8OA 4NUGH 4EUPB 4NQDB 1E27A 1R5WA 3D30A 3FTWA 2XFGB 4OZGA 4HLZH 5F71A 3T4YA 2AQSA 4P23A 4GUPA 3VWKA 1TZOA 3AM8A 4OZFB 1ZT4A 4UINH 3U0TA 1NPUA 3BVWA 4F9PC 2OS7A 4MMZC 4HCRA 5D7JA 4U1IB 4KKZA 4ODXB 4B95C 5JR1L 4LLUA 1KCBA 3SDCB 5IR1A 4A7SA 4DQOH 2B15A 3ZKMC 5LG1A 3SPGA 2Y5QA 4TVPL 2OZ4L 4JLRA 4XVSL 5GHWL 1J10A 3EJRA 2CAKA 3KBFA 4R2GD 1TTRA 3HG1A 1GJIA 4JRYE 4AIXA 3RWCA 5KBLA 3KNBA 4NBYB 1PIGA 1X4XA 2H47C 5LNEA 1HC1A 3O0RH 1IKNC 4HXBH 5TD4A 1I3VA 4I0PC 4BM7A 3WXVL 4M6AA 5C2BH 1KIUA 4PUBL 1L3WA 1PX4A 3CZFA 1N64L 1QACA 3I75A 3L5IA 3AACA 5I74C 3OLDA 3PJSB 2CR6A 4AUJA 5EUKB 4F8QA 3LZPA 4BZYA 3TO4B 4J39A 1XCWA 1GMEA 1C5CH 4CKVX 2IALB 2YRLA 3AAZA 3MFFA 1YMHA 2QV4A 4PY7A 3RTQB 3CQFA 4D94A 4Y19A 2P24A 3ZIYA 4BJLA 4KDTC 4ELMB 3MXWL 4AENA 4CC4C 3VX0A 4PYHA 4EPSA 4RDQG 5AAPA 7FABL 5D8JH 4WI8A 4CVWA 1TJIL 3ULVF 4N90E 4M7KL 1X9LA 3GS7A 3ZSTA 5HGHB 3SKMB 1MFEH 4OM1L 2EQDA 5J1AB 2ARJQ 4PRPA 4FA8A 5DS8B 3SDCC 1D3CA 1E2ZA 3X1BA 5FA4A 4ABVA 3DV6A 5IT2H 3IU4L 2Y7SA 4JBSA 1TXKA 1BV8A 4X9FA 1BD2A 2VITA 4H0IA 2QFRA 4KKLC 5CHNB 4YQXL 4BSWA 1JK9A 1I1YA 1KENH 3FFDA 5I1IH 3VG9B 3BHBB 2AI0H 2HN7A 3CFJB 4QIRA 1CL7I 4ECNA 4UT7H 1PBYA 4LCCC 5C08A 2Z9TA 3VRIA 4IU2A 3LRHA 2J43A 5IG7A 3TO4C 5F3BA 1RZFH 3FB7B 2COVD 3MV8A 4ELDA 4GSXA 2V3EA 3NSYA 3BE1L 4WHCA 5C0RL 4JUTA 1JYVA 3RTQC 4YHOL 3OVUB 3MV9A 3RU8L 5BXFB 1O9WA 5GJTL 3T3PB 4J8QA 1RY7B 3DTDA 5CJ8A 4OCRL 1E30A 5KBMA 4HZ1A 4PWHA 3DIFA 2IH9A 5AW2B 5FYKH 3RPIA 3W9EA 2WLMA 3A4DA 5DD3H 1N59B 4IRZA 3QA3B 1QUNB 4WHTA 5C6TL 1QRND 1VAHA 4MGXA 4MNGE 3FQRB 3K1KC 1S9YB 1ZE3C 3H9SE 2EH7L 2N59A 2F7PA 4N3UA 5D6DA 4EF3A 3N43B 3P77A 1U8KB 4MXQC 2ZF9A 4FG4A 4K15A 2BP0B 2KZKA 3VG9C 4G8GE 43CAB 1OQXA 2V17H 4XP5H 4IBSA 1NKOA 5IFAH 1HEJC 5C0DB 1ZA3B 3HMWL 3L6FB 4K23H 5D7IF 2Y23A 4LVNB 1YNKL 4NSKA 5CCGE 1WAPA 2UXGA 4DP5X 5C2UB 2BSEA 5BRPA 2QVFB 3K0YA 2MHAB 4MB4A 4TUKL 4KTEL 3TFKC 1BFVH 1VERA 5CILH 4CDGC 3TN0A 3KLHD 2D7QA 3MU3A 4JDEB 2GY5A 3UTPE 3T6VA 1MQKH 3IWVA 1MCIA 4G83A 4NN7C 4JFPB 1CI3M 4AGMA 4LHUB 4ODBD 2R23A 4FULA 4QO1B 5FC9A 2YJQA 4HIJB 4HEPA 3HMXA 4WGKA 5DHEA 1L9TA 4PRDB 5T1JA 1IKOP 1F4XH 4OUUA 3QFJB 1U9KA 3F7YA 1MCQA 4BE5A 2WNKA 4HW6A 5KSUA 1C16A 1G9MC 1QBAA 1EUTA 3Q8EA 4PB9L 3CSTA 5BRZE 2ZX7A 2NCMA 2WMPB 3QXVA 4AYGA 4NQEE 3ATDA 3VXRB 1E50A 2E46A 3CFCL 2FLBT 2AQ2A 3NIFF 3ZHFA 1X5HA 2AANA 1XCTB 2W8CA 1J9QA 4G1MA 4OB5H 4NQTA 1S4IA 4W81A 3QQDA 4LVNC 1EJFA 4XAKE 5GGQH 3KYMB 2BY1A 2CDGA 4HQQL 1NGWB 3QCVH 3DX6B 4FP8H 3F85A 4JFSA 4PJXB 5HHXL 3R0MA 4JHAH 1RIUL 4MJJA 2I5YL 2X70A 1U8LA 5FHAH 1URLA 4AGLA 4W4OA 3RILA 3L4XA 3SKOA 2P26A 2WXLA 5I71B 2WINB 1E28B 5J1TC 1JHLH 1UH4A 4B9JA 1NGPH 2VDMH 4K07A 1EHNA 1E2VA 5DQ9B 5C0EB 2GG1A 4DTGL 3PU7A 3ECUA 4OLEA 4JFHD 4RX4D 4XXCC 5FECB 3T6WA 1LEIA 3U6RA 1R5IB 2X38A 2C4FU 4FNPA 3HZVB 4G43A 3WTWA 1CIDA 2H8PA 3MODL 2ZAGA 4CJ0A 3J27A 2NY6B 3WKML 3GQFA 4YWGH 2VQ1B 4JKLA 5SV4A 5B38B 1BQLL 4OCWH 3NFNB 1JWUB 1YQVL 1E7VA 1B90A 2CJ3A 3TVMD 2HFGH 4PJAB 1DUZB 1RIHL 3N55A 5AVQB 3WTSA 2H3NB 2HVKA 3DGGB 2ARJA 4FFTA 4JAMA 3QC6X 2NNAA 3CIQA 5HDOA 5CJXC 2FCBA 5LB1A 2ESVA 2A6DB 1KC5L 3G6JE 4IOFC 1XV8A 4QRRB 4DAGH 2WVVB 3MRDA 5HI4D 5I1KH 4ZOCA 1MH5A 1DQLH 2GTWB 1IC7L 1BLNB 2H3XC 3HG0A 3IMRA 2Z91B 2CLZB 3CD4A 3BVTA 5E24E 2W91A 1WD8A 1E9PA 1UB6B 2YRBA 3OV6A 5T33H 2X1OA 4EIGB 3RX9A 5I71C 5DJAB 3SO3B 1UM6H 2XVLA 5MEOB 3BZFA 4PGDA 4JY4A 4PJ8A 4P4RA 4UM9B 2A9ML 2WUCL 3NP3A 4M56A 4EKJA 3SDXB 4HIIB 1FRGH 4R8WL 5IW6A 2P42B 5CZVH 2NY6C 1I85C 1VGEL 4IHBA 4WDIB 5GSVA 3PWPD 4TF4A 2IG2H 1KYDA 4K3EL 5E8OB 1T2QH 4ETQB 3ML8A 4K7FA 1L5GA 3QZLA 4MAUH 2YD1A 2WVSA 4WU5B 5H8DA 5B1JA 1HXMA 4RZKA 1BQKA 4XVJL 4MFHA 1RQ5A 3U0TB 1K8IA 2CE6A 1COBA 1FG2B 3T8MA 3L5XH 1QAWA 4XO3A 1KB3A 3CN3A 3T0EC 4HWUA 4YPGB 4HFUL 2OR8A 3II3A 3HHRB 4OD3H 4WCYH 4Q4IA 5IR1B 1X5JA 3UJJH 4ESKA 4U6XA 2DLFL 5IIEA 1IAKA 3ZKSD 1YYLH 1MQ8A 1WAAA 1DBJH 2ZWNA 4AQ8A 3KBHE 3S37X 3SO3C 3AC0A 2FGZA 1IAIL 5HHOE 3VXUD 3RWCB 1WITA 4S2SB 1ORQA 1NMAL 5EU6E 1BAWA 2D3NA 1KIUB 4ZSOB 2XBTA 3CFIC 3CZFB 3Q5TA 1JIBA 2Z31A 3ABLB 1PLAA 3KLKA 4BWTA 1RUPH 2AEPH 1FG9C 2AKRA 3KR3L 4RBPK 1GPOL 4FEIA 1NOAA 1YY9D 5DZAA 2DWEB 5D1QD 1FGNH 3BESR 4M48H 4DERA 2CK0H 3AAZB 3MFFB 4OKVA 3D33A 4HG4K 1FL3A 2GI0A 4Y19B 2P24B 2Q6WB 2WCPA 4UT9A 1MI5D 4AENB 3GMRB 1K4DA 1HESA 3NABL 2EDXA 2D3JA 5FEBA 4QT5A 4RFEA 5EIIA 1SJHA 1P7QD 3D8MA 1VFUA 2FWOB 1TZAA 2NYKA 3O9WA 6PAZA 4OAWA 4QKXB 4TSCL 4YDIL 4JG9A 2F5AH 4JKWA 4U7KA 5A2IH 4ONOA 1RMFL 3PGCB 2A9BA 3NJNA 3HAEG 2B0SH 3OC8A 4G6FD 5CJQH 5KZCB 2P5WB 5J3HD 3DV6B 4IYKA 1P1VA 1QYGL 5CWSA 3BWUC 4P07A 1CGTA 5I19H 5I1EL 4N2FA 4W9CC 4AG4L 4J3UA 1AZZC 1SDDB 4AJVA 4DGVH 3JWOC 2DIEA 2JFCA 3HG5A 1OAQH 3ABGA 4LBEA 3V4UH 1CLVA 1JK9B 4R7NB 1I1YB 4Y8AA 1G9NC 4PIBA 1N8OE 1CLOL 1YG9A 2L7QA 1A21A 3DRTB 1SLXA 3IRZA 5C08B 1CE6A 3FRPA 3C6LB 1CTOA 5IG7B 3MBXL 5CGYC 1ZLWK 2VDQH 4NO0A 2ICEB 3NRPA 1WFUA 2YD5A 3IE9A 3BQUD 3QH3A 3HZKA 1UZ6E 1H3PH 1RV6X 1XGYL 2XWJA 3GIVA 3NCMA 1WBZA 3KPSE 1QBMH 1KJ3H 1RU9L 1ZMYA 3GBML 3O2DH 5CMAA 4KH9A 3L16A 3QYCA 3D2UD 3KW8A 3GSNB 5AW8B 2HUEA 2A73A 1MIMH 3Q5YA 3MCKB 1F6FB 4FLHA 3DMMC 4KNQA 3OD3A 3D39E 1KN2L 3U4BL 4XNUL 2PXYD 4PJEE 3MXVL 2P8PA 3Q01A 3FSAA 1PYWA 4PG2C 4XC3L 3VI3E 4XVTL 3P4OA 5C71A 5F7EH 2VSDA 4TM9A 5SWSA 2Z1KA 4OFIA 4D3CH 4TS6A 1KFAL 1RHHB 5KYUA 4P23D 1OTSD 3T2LA 3VWKD 3ABKB 4E42B 3C6LC 1QA9A 2PTUA 3GPSA 4ZMXA 2ICEC 3M46A 2IDQA 5D7JD 8FABA 4FQJL 4BSJA 4OJFL 5JIKA 1M7DA 2IV8A 4NO3A 4HD5A 5AFAA 2VE6A 4JL2A 5LN8A 1ZK5A 2O5YH 2XICA 1UT9A 2C9VA 4NHCH 4KJYA 2NUTB 5ESVB 1J1PH 1W0WA 4L5FH 1CGWA 3WUWG 5GZOD 4Y4FB 4QHMB 4WSJA 3RAJH 4X6DE 3GTTA 1TF4A 1WAEA 3L4CA 5D4QA 5C0AA 1J5OH 3NJLA 5KSUB 3VFTA 1K3ZA 5I0ZA 3U6XS 3BD4A 1OSEA 2YXWA 3W3BA 1IX2A 5F93C 2DQCL 3LEVL 3OGCB 4AMKL 5TDNB 2VJXA 2C9UA 3Q5OA 2CMRL 4OQTL 2PW2A 4H8QA 3KGRA 5EU4B 5AZEL 4LEOA 4WHYH 3QQDB 4HCRH 2P9RA 5B1BB 4W9LC 1BBJA 2WY3B 1T5KA 1WC7A 3DROB 2A1WH 5DMGC 5C0CE 2CDGB 1NJ9A 1AGCA 3O3AB 1E4JA 1TENA 4P9HL 4UB0H 1K9TA 1ROWA 1TPXB 2AJVH 2CSPA 3O41B 4PJGF 2VMCA 1TEFA 1NCCH 2OI9C 1INEH 2BNRB 2J4WH 2JF1A 3K0WA 4IRSB 5IM7A 2OLDA 2QPUA 4X80H 4OLZH 3SKOB 4AGQA 5IBUB 3TZVD 1G43A 2DH3A 2XNAA 5JQ6H 5HI5D 1FP5A 5DJXA 2NLJA 1BD2D 4KRLB 1WT5A 3Q1SH 3K3QA 5LCVA 4GRLC 3UOAB 3C09B 2DJSA 4Y4FC 4LCVA 5AAWC 2IADA 4G43B 1WRFA 3RIAF 5KANI 3D25B 4CVXA 2ZX5A 5L7XH 5MP6L 4JG5A 1BFTA 5EF2A 3C2SA 4M1GH 3L3DB 5DUBA 1CT8A 5ABZA 1T0NA 3ATBA 5SWZA 3MJGX 3MV8D 4YHZH 2AQ3A 4ELME 5JQHC 2G9KA 1HNFA 1P7KA 4NJAH 4KMTL 4YFLI 4D7BA 4AIEA 5MERB 2FQFA 3MV9D 3Q2WA 5HHPA 5DJCB 4H8WL 1YNTB 1AKPA 3MRDB 1UKSA 3A6OA 1MH5B 4K8RC 3RGVB 2B9BA 1TPXC 3HS0B 1JF6A 1UHVA 3LCYA 1HOCB 3QPQC 1ZHBA 2WLKA 2YXFA 3X2QB 2AK4B 4YAQA 5KW9L 4M5ZH 4X8JB 4IRSC 3DO3A 4CADA 5MHSD 1OY3B 1J1OL 1FNGB 3CJJA 3MO1A 4Y9BA 1E9PB 4W4OC 1WWAX 3AWFA 3VFSB 1CFMA 3JWDC 35C8H 2RHEA 3K1DA 4YXHL 3BZFB 1ZT7A 3L1OL 2YA2A 4JY4B 1AQDA 3FT2A 4PJ8B 4PGDB 4P4RB 1IC5H 1JNHA 3OTTA 4AH2A 4RMRA 2KPWA 3C09C 1NCDL 2J1XA 2PF6A 3GS4A 3V9EA 3SKNA 1JYXA 1NFKA 3K6DA 2BIQA 3LD8B 2IQAA 1QSFB 3CUPB 3LNEA 3TA3A 4FLSA 4QTHA 3FT0A 4JPQA 4RAHA 1KXQE 2E59A 4LRNL 5BOZG 5T1DL 5B22A 3CDGA 1NMBL 3LSOB 5AALA 3GI9H 3TJHD 2BSED 5F89A 2QSVA 3NP4A 1JZ6A 3BAEH 2J5WA 4FG6C 4M43L 4KHTH 4UYPA 4FCAA 3MAWA 1JE6A 5IROA 1KGCE 4MAYB 3WIFA 4EKXA 1ACCA 1U3JA 3O4LB 1K8IB 1KIPA 2AITA 3SYCA 3T3PE 3LV3B 1GTNA 4MMXB 1UCBL 1CXHA 3TN0D 1A6UL 1QPXA 2DQIL 4N9OB 1J8RA 4IRZH 2MCG1 4K3GA 3NJFA 3RGVC 1V3MA 3HS0C 5IVXF 4WKXA 3BGFB 2VDRH 1E90A 1DBBL 4XMPH 1KB9J 1MNUH 3KZ8A 1IAKB 3M8OL 3AW5A 4JR9H 4Z7WE 4JY6B 5H4ZA 2X4QB 3CCHA 1T1WA 3E38A 3PYCA 4LEXH 4PJ8C 2Q8AL 1YNLH 4CVZA 1ORQB 3H1ZA 1N68A 2F8VA 5E2VL 1A6VL 2QT6A 4JPIB 4JFWA 1NUDA 2MOGA 4NXSA 5CEYA 3S5ZA 1SJEA 5EIQA 1QWUA 2JTYA 3ILQC 2Z31B 4J3OC 3LD8C 5D2NA 4HDIA 3ZW3A 4R4BA 4O2FA 1BQRA 2AC0A 43C9B 3DSFH 1IFHH 4ZW8A 1T03L 2DIJA 3W57A 4FOMA 1Q38A 1CBVL 4M1DH 2E3VA 4MAYC 4YEEA 4DGYH 1K4DB 1OLZA 2QQQA 5ABAA 4S1DD 4F33A 1OSZA 3BH8A 4MMXC 3QDMA 4IDJL 4O2EA 3H42L 3HMXH 3O9WB 5EDXA 5AEAA 4MJ4A 2XXFA 4OAWB 2YD6A 4UV7L 4XCNA 3QW9A 1G1CA 1ACYH 1KXTA 5CLZA 4JANA 2C3HA 3QFJE 4JO1H 1NQBA 5IP4A 2VMJA 3DKHA 1UWFA 3OXRA 1XF2A 1DQIA 5CWSB 1A5FL 1OZTG 4S1SL 4AQ8C 1H3GA 3U9PL 3KPMB 3IJEA 1AZRA 2XIIA 5M94B 4JY5L 3S3CB 3P0VL 2OMVB 4GFTB 5D7IA 4LBEB 3VXRE 5FB8A 3OKNA 5I24A 5ITBL 4XX5A 1NIDA 1AQKH 4PW9A 5I6OA 1VEMA 3D05A 4BZ2A 4JN1L 2JMRA 3UYOD 1BZOA 2VN4A 3KPOB 3TP4A 1KYUA 5I15L 2ERJB 5D71H 1F86A 1K72A 2VLKB 1IIKA 2V9RA 1JP5A 3LN9A 5GRVL 5HJ3B 5DRWB 1CO1A 1JNLH 3O6FB 3QR2A 4PJXE 5E9AA 2ESVD 2C9AA 2GUOA 4YVNA 3KWTA 2FZ3A 1HYRC 3QIUC 3ENEA 3DETD 1UM4L 4IGBC 4L3CA 1C7TA 4QHUA 3HZKB 4PTTA 4MDRA 3ZGHA 3SD5A 3GSWA 3T09A 4WVRA 1WBZB 1H3TA 4L3AA 4FXGB 3ZE0B 2HT3D 2HKFH 1Z9SA 2XG5A 2X40A 4AYBA 1GL4B 5CMAB 4B7IA 4OCLC 5GGRB 4H5SA 3OKOA 3OKLA 4QJ3B 4GBXC 3CK0L 4HWEL 2PP8A 5KN5B 5EU5B 1F41A 1FGVH 3ETBJ 5HD8D 1JF5A 4Q9RL 4HKJA 3RZWA 5JHDA 3FU9A 4NC1E 5C0BD 3C5SA 3S35X 3L1FA 4KUCD 2H2PC 4PJAE 3QGVA 4FNSA 5TF0A 5T5FL 2FYVA 5DMYA 1TQVA 3CSFA 1SMOA 2ZNXA 1NKRA 3H3BC 2H1XA 3II1A 4CUCA 2ERJC 1AXSA 1I7UB 1K5NA 3NUKA 4PS4H 1MFDL 4QRRE 2UYLB 2UWEF 3NQKA 2J8OA 4IW4C 5IF0A 3O6FC 2K9UA 1VZHA 3BGAA 4KTDH 1XGTA 3AS3A 4J3VA 2X4OB 4QTIL 1SOSA 1FH5L 2Y22A 1SXZA 2VN6A 3TCXA 5ALBL 2FBJL 3TESA 1UYWH 3EXLA 1OVZA 1S7WB 1VADA 4GI8A 3ME0B 4FX5A 2VE6B 2YC1A 4FXGC 4WFGD 2R4SH 1MJJB 3QZOA 4P2RA 3GRWA 1TDQA 2IPKB 2VAJA 4Y5XA 1NUNB 4X4MA 5EO1B 1IGJA 3MRLA 4KJYB 5ACZA 1R75A 1P84K 2MIZA 2VDKH 4HFWA 4QEGA 3UACA 1BEXA 3NH7H 5MEQA 1W0WB 5DQJA 4XO5A 3APMA 1OM9A 2D73A 4U6HA 3SDXE 3VO0A 4LRIC 4FMKA 1HQ4A 4XVUC 3IMBA 4KQ3L 2H0PA 4KV5F 3VFTB 5E2WH 1PZCA 5KSBF 1BQUA 4PIRF 5IMKA 4Z5RB 3UAJA 3O6ML 5AG9A 3ISYA 3T71A 4X5QA 1LP9A 1ODUA 1S7VA 5BPPA 2PW2B 1I82A 1WWWX 1MAMH 4CU8A 2WLLB 1TIUA 4EDXA 1F4WH 2F7OA 4LEOB 4OF3A 1ETZB 4DP8X 1F1AA 1UFGA 2GW5A 1DBAH 4RMWA 3I02A 3C87A 1F45A 5J1SC 4IK6A 4OGAC 4NJ9L 1PG7X 3LIZL 1R3LA 3ULUL 5IM7B 1C5DA 2ZWYA 5C92A 5ITFA 1XIWC 4GXVL 3DA0A 4M3HA 3TBWB 1OALA 4NP9A 5GRZA 4EI5A 2XNAB 3BW9A 3HG1E 1BVOA 3NCCB 1IGTA 2QTVA 5DJXB 3SIKA 1OAZL 2A83B 3M07A 5EU3A 2NLJB 1EVTC 3LEYH 4JRWA 4N20A 5BV7B 1EFXD 3IEAA 4OCNC 4KK9D 4ZSOE 4OF6A 4WFED 3BT2H 4I0CC 5T3XD 2IADB 2Y7MA 1SXBA 3TLRA 1AD0B 4QHNB 4RNRA 3D12B 1SEBB 2FWSA 2NY3B 2XWTA 4P5TA 3IXTA 5IK3A 3QPXL 4F57H 5LG6A 1FFRA 3FSVA 3RJOA 1A7PL 2DQUL 2GSGA 2OCJA 2YAMA 3MKGA 5DUBB 1CT8B 4NCC2 1T0NB 4Y19E 3GWJA 5SWZB 4NO0D 2CLVB 3CH8A 4UZUA 1HFUA 4FNLL 4N2NA 5ESQA 3CH1B 3H9YA 3FB5B 3W81A 1CI5A 1FCCA 4ODHL 4TNVK 4YXKL 5EH1A 2XV6B 4KUZH 3KYNA 4JB9L 2IGLA 3R06A 4NWTH 3UDWA 1KUMA 4TNGA 1B6DA 4M4RA 1MLCB 2F19L 2NY1D 3NCEB 4M7LL 2K78A 2WC7A 3HE7C 5LBSA 1MRDH 2P5WE 3BDYL 1SJMA 4YAQB 5IBLC 4ZFOA 4P99A 4CADB 2OMWA 3MO1B 4GMTH 3AUVA 3K6NA 4YE4H 2OK0L 2Y3AA 4EXPX 3BSZL 1JG9A 4V11A 5JXAL 5D70L 3CVBA 4KDWA 5ICZB 2V0AA 4EOWL 1ZT7B 2HFEB 1AQDB 3FT2B 5T3XH 4WK4B 3M88A 5BV7C 1WT5C 2CRMA 2X6CA 4WO4A 4YDMA 4AH2B 1I8MA 5JMOC 3GZOA 2O5ZH 5C08E 2A9NL 1VA9A 3T77A 1BVZA 4ISVA 4MXWH 3GSQB 1BMGA 2PYEA 3KD4A 4LPUA 1D5BA 4PLJD 3TA3B 3WNIA 5KOMC 3SE4C 1NDTA 4ZX5A 3Q2VA 5DZLA 1IM9B 2LLGA 2ZUXA 4CDHA 5H37G 3L2LA 3OKMB 5DTFB 1XFPA 5F89B 2IH1A 1ZT1A 1FN4A 1MW1A 2V2XA 4HULB 2IFFH 1H3XA 3ZE1F 1XEUA 2EADA 3STZA 3MLZH 3I74A 5DVPA 1GY1A 2HAZA 5E99L 3S88L 3WMPA 4F7CA 4L0YA 1HOEA 1EJOL 5ENWB 5K1VA 3IFOB 5IV2B 1N0XL 1LD9A 4GKZB 4XPHH 4ZMTA 2R2CA 4BIKA 4WW2A 5I1DB 4FC3E 1NUGA 2BS8A 4N22A 3RVXD 4W9FC 2LTQB 1BXUA 3NJGA 5LN4A 5FUZH 5F96L 3U7YH 3WNLA 3OWEA 1S7QA 2NDFA 3CCHB 1T1WB 3CHRA 4IKNA 4TL4A 3BX7C 3QJXA 5C0AD 1RUAH 2CGZA 5AKVA 3UJTH 3CIAA 1LGVA 2ADIA 3PGDA 3QUXB 4IOSD 4U1JA 5LBGA 4UDUA 1G4RA 4CVZB 2BS71 4PQXA 4UDTA 2PO6D 3BPCA 4OD1H 2Z7WA 5CEYB 2O6FA 5KANG 1E42A 1XTMA 2H2SC 1V3KA 1OXYA 3O8XD 2PR4H 2VM9A 4O2FB 3GMOB 1FNEA 4IK7A 1VGKA 4PRAA 2XN9A 3DUUA 1M7IA 1Z3GL 4Y4KA 3NJJA 1CFBA 3ULVC 1UURA 2L7EA 4FQLH 4Z3IA 2IPUK 3W56A 4DP9X 1OAUH 3WFEH 2EDJA 3VXSD 3CFUA 4KK6C 5BZWA 4YHLL 1H15A 3FTGB 3JT2A 4L23A 4OGYL 4U33A 4WSKA 5DMIL 2JB5L 3RWFB 4F33B 3OC5A 4MCYA 4HJTA 1I31A 1K85A 1U91B 5IWLA 1QNIA 3QDMB 1PF3A 2ZSWA 1U6AH 3GXDA 1UWGH 3KVQA 2NX5D 1LO0H 6FABH 4XCNB 4ZPVB 1FDLH 4LPWA 3MLYH 1A0QL 1KXTB 2FRGP 2KBGA 2Q2LA 2QPSA 4JANB 3PL6A 4W6WB 2LTQC 1EUUA 1UH3A 4BH7A 3ECWA 4AEIH 1AZBA 3IJEB 3KDPB 1D7CA 3FB8A 5FB8B 3QUXC 4XWGH 5FPIA 3OKNB 3WE6A 4NUMA 1WZLA 1GGCL 2YZ8A 4BFKA 2QLVB 4WJKB 1S9KC 1GZQB 1A3RH 3QIWD 1QLFB 3NJXA 3KXFD 1SFHA 3EOAA 1SOQA 1KF9B 2E4FA 2W9LA 3HLAA 3SQOH 1RURL 3X1EA 5DSCB 1UT2A 1IO4C 3D7PA 1DQQA 4KTYA 2GUOB 1JVKA 4OFYA 2X89A 1P4LA 1JJUA 4XCFL 2BNRE 1NEZA 1QEWA 4PSRA 3M7OA 3AREA 2XZAL 3OX8A 4QHUB 4LIQE 3R8BB 3MRJB 3LQAL 4ZYKA 1UT1A 3WHE1 4U1SA 4G9DA 4QYOA 5HVWA 2OM5A 1YC8A 3NJIA 1QFWH 3TPUB 4BDVA 2OP4H 2XG5B 3CE1A 4Q9BA 4R26L 4TQHA 5F7KC 5LCVH 1UZ8A 1KEML 4H5SB 3OKOB 4NKDA 1W16A 3AROA 5C09A 5IOPB 3RBGA 4U1KB 1DDHB 3C08L 4HALA 2QHLA 2XKUA 4H26B 2X4TA 2EXWD 3NIFB 1P9MC 1VFMA 4BWUA 2WLJA 3GK8H 4HKJB 1G1KA 1YEJL 2NY7H 4P0DA 3C5SB 2F5BH 3IFPB 4DCQB 3D18B 2K45A 1GS6X 2ITDB 1NAKH 1EHAA 3RJQB 4GEJA 4Z7NF 4PW3A 4YJZL 2XPZA 4WLCA 3ZTCC 3KYOA 3LRSA 4NP4H 3K4ZA 4MD5A 4PJGA 4YSOA 1AXSB 1K5NB 1X3DA 3F6LA 4WI3A 3TT1H 3MJ7A 3ZU8A 2ZJSL 3O45A 4M3KB 4XP1L 3EXJA 4RGMB 4L8CB 1XGTB 4I77H 4NRXA 2ENYA 2YGPA 2ADGB 3WIHL 2AK4E 1XZ0B 4LQFH 3Q44A 2FEEI 3EFFA 4WJG3 4G6MH 2UX7A 5E5MA 1HCYA 1WIUA 4JO5A 4OT1H 4ZFGH 1J8KA 5F70A 3LVEA 5CINL 2Y06H 5TE6H 1IGJB 1CL7L 3MRLB 3BAKA 1E2WA 1BM7A 2J21A 5TQ2L 4H8UA 3ISRA 4HFWB 3V2AR 5MEQB 3L3OA 2OYMA 3CLWA 3QWNA 2W0KA 4MMYB 1ML0A 1HI6A 4U6HB 4NKOA 2NT1A 2VM3A 4F27A 4YE0A 1QSFE 3APDA 3OAWA 4QWWD 5CSGA 4FYQA 3GZPA 4DP7X 4ZS6C 4JHWH 3AXLA 2DJUA 4LDEB 2GJ6D 2D7PA 2YXMA 2C9SA 3A47A 4CMMB 1L7TL 4R2GC 1LK2B 3NA9H 3DX9A 3I3EA 1S7VB 4HOXA 3WDHA 5JW4M 1FE8H 2YN3A 5LUMA 4WUUD 3DARA 4XBEL 3O4LE 4IBTA 4MAZA 2X2JA 15C8L 2RA1A 2NPLX 4ODSL 1DL7H 4C8XA 2PPAA 3I9GH 4MNHA 5E08L 5EEYA 1ECYA 4RGMC 1EZSA 1GZHA 4ADIA 4K7PY 5FW7A 1BGXH 4DPAX 4NHUB 5E1GA 2RJMA 2Q8BH 1UM5L 3QEQD 2JKJA 2A6IA 1S5IL 3W0WB 3B83A 5DCCA 2P7TB 1HCFX 2R7EA 4JO2H 3LPOA 1RAMA 2IAMA 4EI5B 1J0KA 4NZTH 1XX9C 3EGDA 4M3JA 2B9AA 1U2CA 3OF6D 3EZ8A 5EU3B 3WFCH 5E2TL 5IB3A 1QR1B 3L3HA 1JGLH 2KERA 2KPNA 2Z1PA 3U36B 1MJUH 2APWA 3QO1A 3DO7B 3ZQXA 4UT6A 4PI2A 1M3IA 2YAPA 4RNRB 3OKDA 3UO1L 3GMNA 2JB6B 1KLFA 1YJDH 4P5TB 1DQDH 3IXTB 5IK3B 5IW1A 4OH2A 3ZZ1A 4TLSA 1FO0A 3UAJC 1ASPA 2GSGB 1U93B 2ZWLT 1SHXA 1HL9A 3WS6C 1IGMH 1V27A 4OJCA 3ESPA 2AJSL 3L54A 2XYCA 2D03L 1KJVA 2V8MA 1HHGB 4KXAA 2CHXA 4HUNB 5IVXA 1A9VA 5ESQB 4NN6B 5CXPA 5BMFL 1P4BL 2YPLA 1ZTXL 2G9HB 2F74A 2VR3A 2C1OA 3K8LA 3IMTA 3S5YA 4B0MM 4M4RB 4GRMA 1XF4B 2J73A 3AG4B 5C7XL 4UOW1 4DK5A 2DQGL 1EGJA 1K6QL 1ZEAL 2IBBA 2H1LM 4IIQB 4K4KA 3WFBL 4WKZA 4YPJA 4NDMB 4PFEA 3FCTA 3BDBA 2IOIA 1EBPA 3GNML 5JHDD 4ZODA 4BZ2H 2IMNA 2GJJA 1PLCA 4WO4B 5FO8B 2C9PA 4UILL 1IT9H 3MRFA 4X8GA 2WP3T 5GS1C 1I8MB 2EIDA 2LAGB 1YYMH 4EDWH 2VLKE 3DIDA 1J0IA 3X3FH 4GG8A 4KMLB 1QZNA 4RGNB 3T77B 4ISVB 3D0LA 5CR1A 5JOFA 2PYEB 1D5BB 2Y1AA 4WWKB 3T65A 2WBKA 1MRFL 4P05A 5GIRA 3U30B 5IQOA 3H2PA 1BQHB 1OTUC 4AYDC 5IEKB 4G71B 2VDLH 4N28A 2IH1B 1ZT1B 4PJDF 1SRDA 1FN4B 1T66D 2V2XB 2VC2L 3VD5A 3GDBA 1YEGH 3ZIMA 3CSYA 2FL5B 4I1RA 3STZB 4PI0A 4HV8B 2EVHA 4QRSA 3ZE0E 3PFQA 4X6EA 2WTRA 1AHWB 4NN6C 4HJ0D 5JZ7C 1BZ7A 1LXMA 3P9WB 1PMYA 2LW3A 2OQJA 3IDUA 1HKLL 3FYEB 4P2RD 1MVFA 2DH2A 1DJSA 3FO9B 3ZQ9A 4V1DA 1XSIA 1KDIA 5DFWH 5ADPH 1EMTL 2SEBB 5EN2A 3TT3H 4IIQC 3GTVA 1S7QB 2CGRH 2YGQA 4MCZB 4JEGB 1KB9K 3EZJB 3GMLA 5F7DA 1O7DC 1QLEL 4PRHB 4U1JB 2CUMA 4JRXD 4WO4C 2D0HA 1CPUA 5SWSE 4N8CH 4UDTB 1ECZA 3FFCA 4M62L 4JKNA 4U1NA 5KYWA 4KVNH 2KMWA 2X0WA 3KVDD 3O2VL 5DA4A 4IM8A 3X1NA 3GXFA 5HHQA 5CEZD 1LNUB 1NIBA 2ZUQB 3MLUH 1S7XA 4WWKC 4X50A 4XCYB 4XNMB 5SX5H 3U30C 3D34A 1VGKB 1FJ1A 2AXGB 4LVOB 2YFOA 2Y1VA 2ETWA 4TNFA 2LQRA 2X10A 3TWCL 3S5LA 3UBXB 1KPUA 2JJTA 1XCXA 1SLVA 2FJUB 3B6SA 1IBFA 3UTTA 3RFZB 3K2UL 5E8NB 2MOQA 3ZYZA 5BZWB 3WSQH 4K94H 1HHIB 1H15B 1N5AB 3GRWH 3S36H 4GRWH 4A6YA 4G80A 2VZ1A 1AHWC 2YUXA 1NLDL 2PN5A 2WSDA 3HNSH 4HJJL 4N8VG 4BYHA 2ZSWB 2VW6A 1QSVA 3NZ8A 2JKXA 3LB6D 4MNQA 3OJDA 3PGFL 4QJ5B 4Q56A 1PY9A 3PL6B 4BH8A 5FFLA 3DBXB 4JFTA 5EBMA 4BH7B 4X7SH 1DQML 1IQDA 2P8LA 2YD3A 4ZAKA 3FB8B 2EVGA 2UWEA 2ZYSA 4N2BA 5HPMA 1CG9A 1NWPA 2J56A 2BXZA 4M6NH 3RL2A 3TBCA 3MBWA 5E6IB 3QVAA 3EOAB 5HPOA 1WGVA 2KDYA 4G6KL 1UG9A 2ZUQC 2G3NA 2X4PB 2VAAA 3QNYA 3CMOH 5F2FA 2BM3A 1FIGH 1WZKA 4LVOC 5E8DL 2HTLD 1ZIBA 1KFGA 1NEZB 3UYRH 4TKWA 3WTTA 3OX8B 3JTTB 1IKFL 3ZQWA 3RFZC 4ZYKB 4G9DB 2P44B 4QYOB 4ZXBA 5IESL 2YSSA 3H9HB 4S10A 4BDVB 3QUZA 2O6EA 4TSAL 5L9DL 1IEBA 4X4ZA 1YAZA 2OR9L 4R96A 4TOYL 3SJVA 3QDGA 5KSBA 1RZJH 4NKDB 1J86A 1MF2L 3KLAB 2VR9A 1GA2A 4BCXA 3PL6C 2FECL 4X2UA 2X4TB 2BY3A 3VXTA 1OLLA 4KY1L 2A2QT 4HXAH 4NC2B 4UNIA 4R84A 3RY6A 4O58H 4N0UB 4FQ1L 4I4WA 4ATTA 2UXTA 4QXUH 5J57B 5SWZE 4BUQA 1EEYA 3QUYB 4LNRA 3NCJH 4YSCA 1Q9LA 2OBGA 1VLXA 3ZTNL 2WO4A 4N2KA 3WN6A 2QBWA 3FUEA 1RIVH 5JYLA 1NFAA 3ESUF 3V0JA 1QX1A 5J6GB 4JM4L 1FVCB 4PJGB 4YUEH 5E6IC 3Q6FA 5A6MA 3MJ7B 2DQJL 4GIOA 3FUHA 3LS5L 3A3YB 1K3IA 4K71C 5TPWL 1E4XH 3EJYD 1AG6A 1NAML 2XWDA 4NRXB 5LBSH 2DQTH 4DFIA 1MN4A 5FYLE 5JW4R 5LKNA 4KZEL 5DA0B 4ZS7L 5KVFL 4DESA 5F7FA 5E5MB 2LU5A 3RVTD 5BUAA 2Q3AA 3BEVB 1XL6A 1IBDA 4GW1A 5FWRA 2KS0A 2YARA 4NFCA 2Y7QA 2NW2A 1IMHC 3BZEB 1PSKH 4XN8A 5ICYB 4OLXL 3QARA 3MQIA 2BVOA 5DLML 2CRZA 4M6OH 4P2QA 1E6OL 1IL1B 5AB2A 2FYYB 3HUJF 4NCDA 1K4CA 2BY0A 2QHRH 4X7FC 5GJSH 4ZX3A 1M53A 1DO6A 1MFMA 1T7YA 3TL5A 3QUMB 4FA7B 1G6RH 3ALXA 2FUQA 1F90L 3AXLB 3ESNA 3H56A 4HIQA 4I48A 1NCWL 2AFNA 3F8UB 3QULA 1WTLA 5AYUH 4E9VA 3ULVE 3KDMA 2QVTA 3HAEA 3DX9B 2NR6A 4WI7A 3QUYC 1A3QA 4UQ3A 1ZIAA 4G5ZH 2XUWA 4ZMOA 4LHQB 3C5JA 4LMQE 2FQDA 1YEKL 3OJ2C 4Y1AA 4L1TA 1VEPA 4WFHD 1CGXA 4NUJA 2A74A 2V9QA 3B2UC 3O11B 5HDBB 1GOHA 4XMLH 4ZFZA 3MCG1 5DT1H 1PZ2A 4F37F 5I76A 1T0MB 2BSTA 3F7LA 4XMKH 2ZT9C 4YLBA 5DGRA 3QHZH 1PQZA 3FOMA 2ID5A 5F9OL 2Y7OA 3FC8A 3K6IA 4JJHA 2IAMB 2DLEA 1HJBC 1T22A 1OCOB 2Y36H 3EGDB 3VACA 1OAXH 1W72L 2HTKD 1EA9C 1DVFA 4FF9A 1I9RH 3GMPB 4PV8B 4DHLA 5F7MC 1P4IH 3FN0H 3JVGA 3L3HB 1H8NA 4LDCA 1UEYA 3QO1B 4TRPL 3FYIB 1HU8A 1AQMA 1CGVA 5CLWA 3BVDB 4QRPB 5D93B 3HBQA 1T3FB 3OKDB