2LR4A

Nmr structure of the protein np_390037.1 from bacillus subtilis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
128
structure length
128
Chain Sequence
GAEALPLYYLQITGITSDGNDFAWDNLTSSQTKAPNVLKGNKLYVKARFMGYTKLTVITGKDGKNLLYNGTAKMFKSDAILGQNKVVIGWDKYFEIPMDALQDNSIQIKALSSGTTFVYSQKIDFERE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords SPBc2 prophage-derived uncharacterized protein yolA
publication title NMR structure of the protein NP_390037.1 from Bacillus subtilis
rcsb
source organism Bacillus subtilis
total genus 18
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16219 DUF4879 Domain of unknown function (DUF4879)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2870 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2lr4A00
2LR4A
chains in the Genus database with same CATH superfamily
2V5SA 2XV6B 4NT6B 4P57A 5AENA 3B43A 1DO6A 4POUB 1I9JL 3JVGC 2QBWA 4Y16C 1R3IL 3PU7A 4WFHD 4BJLA 2EDHA 2DLFH 4JGMA 4QLRA 3EJRA 2JLLA 3U4KA 3QUML 4DUXA 1LP9A 4DOHB 3D0LB 4W4NA 3EJTA 5DJXA 3DURA 4HOZA 1CD9B 4QWWC 1TR7A 4U1JA 1JG9A 5ISZD 1LK3H 4F92B 4WV1B 4LLQA 4V33A 5TFSL 5CZVL 4X5XA 5D7LB 1FO0A 4PJBA 3VGFA 5EF3A 3HN5A 3QIWD 1RAMA 1BCIA 1MN4A 3GKWL 4AE0A 2WXIA 4H8HA 2BVEA 4NLHA 5CIPA 2W9LA 5IB1B 2P49B 2CKBA 1DJZA 2JJTC 2ZUSA 4NRZA 5E99L 1MLBB 1X7QB 4IOIB 4NKIL 3EOAB 2FX9L 2JJWA 3CFQA 2P80D 3GD1C 3BKJL 1JPST 2LU3A 4R96A 4XNQA 4FP8H 4QHUA 4GSDH 3GGWA 4FXLA 3QRGL 3RVWD 2EDBA 4UUJA 4D8PB 2F53D 4M03A 1DVFB 3F04A 4G59C 4XN4A 3OPZL 3TM6A 4MQSB 1PTZA 4PCKA 4YSAA 4KITB 2HH0L 5HHOA 5E2TL 3RL2A 2DM2A 3SE8L 1IGFH 4JFOA 1MVYA 3GIZH 2VAAA 5CBEB 2VN3A 5B39B 5DQJB 3FU5A 1RZPA 3LKOB 3O6MH 1AP2B 4PRPE 2C9QA 2LFGA 4W6YB 1TFHA 2VR6A 3C5ZB 4LSQH 3QAZB 4XPHH 2VERA 2UY7A 1AXTH 3NJKA 5DMJB 2QZQA 3ARVA 1CFSA 4B9GA 3FZUC 1OGPA 1Z9SB 3GNML 2O6PA 3KPLA 1A8JH 1MEXH 4LCCB 1WGVA 1CURA 2Z92A 3IGAA 1JERA 3QZWA 4W93A 4DZ8A 5DUML 1YNTA 1XGTA 3K4ZA 1PDKA 3NFSH 5AW7B 2XBTA 4FDWA 5T5NG 4L3EE 3MV7E 3KYNB 3IDNA 4MVBD 3FTVA 4DEUA 1R3LA 1QATA 4QKTA 5ID1A 4MQ7B 4H8QA 4XN8A 4DVBA 2R56L 1DVSA 2DLEA 2WTOA 4JY5L 7TAAA 4G7RB 4NO3A 5HGBB 3WYRA 4XZ4A 5DVNA 1ZGLB 2BIPA 4HCGA 3MRDA 2FYVA 2UWEF 3PHOA 2XXFA 5GIRB 1X5ZA 5EZIH 4OJAA 1JPSH 3NPSB 1VA9A 5CSZA 4LSSH 2GSIB 4FNUA 4Z7NF 2LLGA 1T5KA 3CPLA 4PJEE 3DX8B 2YFOA 5DDHA 1DSFL 3VXUE 2YN5A 2QFPA 3S36H 2UZIH 4PRBA 3TA3D 4RX4A 3BN3B 1J86A 1XF4B 3FUIA 1TVBB 3PF2A 2P5WB 4J3BA 5EC2B 5J06A 5I26A 5I71C 5AZEH 5DSCB 2Y1VA 2PO6C 1FVEA 1NIDA 1ET5A 4HK0B 1Q0YH 3HI5L 4FCHA 3C60B 2NY7H 4UWQB 5IHZA 1RZJH 2QQKH 4PVMA 3U2SA 3GXFA 3F7YB 1A6TA 1FFQA 2VO5A 3S4SB 5MEPA 3IKCB 3JWNE 1C5DB 2FH8A 3WEXB 4WWPA 3AU0A 4QHNB 2OK0L 4TNFA 1KGUA 5DQ9A 4NAJA 2DIJA 2AZUA 3KPRD 4N5UA 3QUZB 1UA6L 4QTHA 5ES4B 3IXTA 3PL6C 4FABH 2FUTA 4ZFQA 4W9GC 3OGCB 3BKML 4PJFF 5ENWA 4G9FD 3ZL4H 1GCYA 5ERWB 3LHPH 3OHXB 2OX5B 4LE8A 3HC0B 2XZAL 1IM9B 1IKNC 3OSVA 3VB9A 1GGCL 1OGAA 3PREA 4KXDA 3P4OA 4QY8A 3MBEC 4Y2DB 4JFDB 5HGHB 4AK1A 3IDGA 3ZKXB 1XFPA 2AJXH 5FKPB 4PJ7B 5IMMB 2NR6C 4YR6A 3SCMB 4HJJH 4KMLB 1W8EA 4GBXA 1X5XA 1A7OH 1D7BA 4DGIL 5I5MA 5BOPA 1F58H 4KRPC 3QNZB 3QA3B 4B41A 4CVUA 3AZUA 4LNRA 2OL3B 1GHFL 5EA0H 1F1GA 2NTFB 1KIQB 1CDIA 5KSBF 1BVNP 2X42A 1FJ1A 3QNYA 4GY4A 4H13C 3RP1A 1DQKA 3D08A 3JWOC 3DHPA 5B8CC 2F6AA 4ADGA 1SQMA 3MV9B 2YO3A 1XD1A 3V0AC 2GI7A 1AS7A 2PXYA 1P5UA 2HKAA 3F6JA 3V0IA 1EAQA 1MJ7H 1E4KA 2OXHA 3TT1H 4A63A 3IJHB 3L3KA 4YDJB 5IBTL 2FX7L 1P4IL 4X9HA 4ONGH 4WTZA 3VDBA 2VXUL 3UPRB 1M9SA 2PWHA 2R2EA 2A83B 4LLWA 3VI4F 5BZWB 1MFDL 1E9PB 3DV6B 1MZZA 2WP3T 2EDTA 2VL5B 5BNXD 5IHUL 5I19L 5JOFB 3AREB 4CN6A 2ZG1A 4NQXA 3OKOA 3ARFD 3SKMB 3VGHA 4PWJA 1QNZL 4OZFH 4R6UA 1WE5A 1XGYH 4ZNEA 4PG2A 1SY6L 3P9LB 4IOSA 4TOYH 1JE6A 1JHKL 4DGWC 3VWKA 5AVRB 4GW1A 1HC1A 1NC4B 2AKRB 3M17A 4F9LA 5JW5A 1U6AL 1P7KA 3ZQXA 1UM6L 1YYCA 2FGWL 4WWKD 5DEZA 3GZQA 4LPCA 4HUWA 2QDVA 3NIDE 5G5DB 1NL0L 4YWGH 2QQLL 3EOBA 3LRHA 1KBGH 1K6QL 1WZMA 4P23D 4WHTB 1P4BH 4JPKL 2R9HD 2CA4A 1JZ4A 2E9BA 1H3VA 3EFOA 2C9VA 3ABLB 3ES6A 3ARWA 5DHXB 3ARZA 1VADA 3CXDL 3H3PL 4CN1A 3HZKA 4YQXL 1HDMB 3ALXA 1TTAA 3D69A 1NGWA 1ODAA 2DB8A 2GC7C 4R7DB 1AGDB 4GMSH 2XN9B 3GSUA 2C3VB 3ILPA 5JXAH 2EVJA 3AG3B 4LDCA 1JYXA 1T3FB 4KKRA 4X7CC 2VR8A 5ABAA 2DRUA 5ESAA 4PN6A 2EDYA 5JW4Q 1SJMA 1U8JB 3IDMB 2HLFD 3QR0A 4XMXA 3RE0A 4DKEH 5AOZA 3MA9L 4AGNA 1YNLL 2AQPA 3KEHA 4GW4B 4NM4L 4JLRB 1UH2A 3D50A 2VQ1A 4NM8H 1MFVA 3D2TA 1FORL 3DX6B 4KV5E 3SQBA 3Q9PA 1IBGH 4WI7A 3UAAA 3N42B 1QEXA 4I0PB 1JZFA 5KVFE 4A7TA 3EJUA 5IJCC 2YAHA 1U8LA 4OGXH 5M94B 1KB5H 4N68A 5HHME 5I6XC 4PHZA 4PTUB 1XIWC 1G5AA 4RFNB 5HYQB 4FQ2H 3PJNA 3MUY1 3ZRFC 1EXUB 2HRGA 4P2OB 1BYNA 1UACH 5C0RL 3GC3A 5D7JD 2HT4C 5DS2A 5ACZA 4AZ8B 1FF5A 4Y2NA 2FNWA 2GTZA 1F4AA 4CJ1A 5ISZB 1ZSDA 3MKKA 4ZPVA 1XMEB 3HNVL 4PG9A 3LXUX 1RFDL 4B3VA 3MFGB 2OI9C 2BOCA 3L3JB 3QIWB 3FYEB 5C0DA 4QRPA 1FNGA 5JORB 4MJHA 1GYVA 1B9KA 3DO7A 1UEYA 5I76A 1XWVA 1F3JA 3NTCH 3EDDA 4X4KA 3A0OA 3GEWB 4KK9D 2W07A 3F5WA 1DQQA 4MCYA 1HYSC 5BXFB 3T71A 4L3ED 3MV7D 4IBLT 3DVNB 2VMDA 4YIQA 3DJZA 3LB6C 4MFHA 3GI8H 3OQRA 2F53B 3GSXA 3KL0A 1SYVA 3WDHA 1KFAL 2N7AA 2E47A 3BSZL 3BESR 2EIEA 3E38A 3BH9B 1PQZB 3EF7A 1XH2A 3LH9A 2C4XA 4MB5A 1G6VK 1SOKA 4OUUA 4GT0A 4PJ8D 4NNPH 3WKYA 1KCUH 5L2JA 2NW3A 4DTGL 2H2SC 1OP3K 3KM1A 4P9ML 3VXUD 4CU7A 1AC0A 3QHFH 2PPAA 4K9JA 3TBYA 1RZGA 2O61A 1EIBA 1ZHLB 2EAEA 1WBXB 2ZXBA 4UQ3B 4G8GE 2BO0A 4GG8B 4P0DA 1QA9B 3KXFA 3TIEA 4QXTB 3QCTH 4A66A 2FIKA 4YH6A 1AQMA 1Q72H 4G6FB 1U8PA 4OZFA 2L8AA 1VHPA 3UGEA 1EANA 1NMCC 3FDWA 1OAYH 4ACPA 4AEIL 3B9EA 1XEDA 3E2HB 2LHAA 1F45A 3RJQB 3SE9L 3ZL1A 3B1TA 3VFOB 1GGUA 3C6EA 3GXIA 4AM0Q 1MH5B 1RJZB 3Q1EA 4QJ3B 4ALAC 1KOAA 4F1ZA 3L5WB 1DANU 4Y5YA 3O3AA 3PXJA 2H32A 1SEBA 4R26L 4J3WA 4FQQB 2B3IA 5BUPA 2WMPB 4UILH 1KXVC 2E27H 3C6LC 1MJUH 5F71A 3AT0A 3FSAA 3WNLA 1NGQH 2PNDA 2CQVA 3D33A 3CLEH 3TA3B 3FRPA 4L2YA 4JFVA 3FH5A 2D0FA 1ECZA 3MLXL 4NN7C 3UTPE 5F7DA 3BJ91 4FD0A 4BFBD 3FFCB 1KGXA 3IE9A 5D1ZA 3WUWA 4I3GA 1JVKA 1JHLH 3S5LA 5SV4A 1SRDA 4H26A 3PWJB 2G3NA 2OMWB 5IVXB 1MJ8H 1WYJA 1UURA 4G1EA 1TIUA 1MCHA 4GLRI 4X83A 3G04B 1NBQA 3G5XB 3Q8EA 6FABL 1JNHB 4ANXA 1KIUA 1UVQB 2X9YA 2I25N 4EI5C 2MCPL 4BZ1A 2APTA 4HIEB 4M7JH 1T80A 3WFDH 5ILTL 4U2YA 3IJEB 5I6PA 1N12A 2G2PA 3TNNA 3DX3A 5F93C 1JK9B 1WFUA 2WQSA 1MWAB 4XP6H 4G9FB 4YHLH 4NP4H 4UQCA 1F6LL 5T1DH 1FH5H 2AJSL 3BGAA 2IGFL 1NCAL 3C5SA 2AP2A 1KGJA 4PJXA 1A7NL 2EEBA 4W9IC 2XZZA 4A2DA 2DBLH 4L48A 1XF2A 3EJSA 5I66B 1L3NA 1FYTE 4NOFA 5LHDA 3FB8A 1QEWA 3CTTA 4TPRL 4WCYH 1A14L 4GP4B 3WDJA 4BWWA 2ZICA 4QHMB 4ELDA 4QNPF 3TYFA 1AO7A 1XH3B 2IPTH 1MW3A 2WTRB 3NCEB 4QAMB 4J23A 5GXBB 3K0YA 5DVMA 4FA7B 4WHDA 5IFHL 2Y23A 4LVHC 4LXFA 5ESVB 2WXJA 3WFHB 4Z6AT 1H6TA 1MW2A 5F72S 3L2MA 3L81A 4X6DF 3N1QC 2WOYA 3VCLA 5F89B 3PJSB 3I75A 1EDQA 1HNFA 1K8DA 3UP1A 3IYLW 3DNKA 3QFJB 3EBGA 2XWRA 2NQ3A 1LM8V 1MHHB 1ZVSA 2PKDA 3EUUA 4ZO7A 4QHKI 5DRZA 5J1SC 1G94A 3DK2A 4AH2B 3HBPA 1BQLL 3MLYL 3PQYA 1TQCB 2B0SL 4JVWA 3NOIA 2D7NA 1MDAA 4G80B 1HEJC 2FWOB 1PNCA 3QDME 3ARBD 1Q0EA 1F02I 4U6TA 1OF0A 4N9OB 4KI5F 3ME0A 1MFMA 3V6FB 2GCYA 4JHWH 2JKRM 4FE9A 5EDSA 2Y1AA 2R2HB 4WWKB 4O51B 2YC1A 5C08A 4PJDA 2E76C 4HW6A 5CZRA 1AHKA 1I1FB 4P3CL 3K6FA 5BO1L 1JV5B 4G5ZH 1KIPB 5IMOA 4NNXA 5JO5B 3B3BA 5HHMD 3SYAA 2PYEA 5HY9B 1CE6A 1S7RB 3HKFA 3OG6B 1AZZC 3ZDXF 3GHPA 1KPUA 1I9IL 4R7LA 3C12A 1V7ML 1A4BA 2PTTA 2A74C 5FYLH 5ECGA 2K9FB 1DHKA 5DK3A 2VQUA 1DCLA 5DZPA 4R4BA 1IGCH 1TITA 2AITA 3UJIH 3OJMB 4DN4H 3JV0A 3L4TA 4NC1E 3ZTJH 2FDBP 2HVKB 3MLRH 4G42A 3U0WH 2BNRA 1DFBH 4L8CB 2BP5M 1S2EA 4WJ5A 3WN5A 1MFUA 3WLBA 1JNLH 2MQCA 3ARPA 5LBVA 3WGUB 3EDEA 2CJSA 1O6SA 4EPSA 1UOKA 3Q5OA 4Y5XB 1OSYA 2Q7AA 3GTVA 4JANB 4LIQL 2IIJA 1ZANL 4KFMA 2FZ3A 1CFQB 4KTEL 1IGTA 3X3FL 4LOVA 1S9YB 3IN0A 3FHQA 2MWCA 2YEVB 3HLAA 3HZVB 5EOCJ 4YHPA 1AYOA 4HEME 4O02A 5KYUA 1R4XA 2CPCA 3DX4A 4M3HA 3OLDA 5D7JB 1YC7A 1T03L 5TDNA 3X1GA 3VXRA 1GPOH 1FBIL 1IGJB 4FRWA 4PRPB 4S1DD 3DBXA 5F1OB 2ZJSH 1D5XB 1UWGL 5EN2B 3ZE2E 5D5MB 3V4VB 2VDQL 3BUBA 2G9HA 4PV9B 1K72A 4YFEA 4WK4B 4G8GD 3UACA 4M48H 3O8XB 3K6IA 5E9DA 4Z7VE 1E27B 3RFZC 2BIIA 4OI7A 5B1JC 2C1OB 2F7QA 4DP0X 4YO0A 1F4WL 1NUDA 2R4RL 3FUMA 3QZMA 5I23A 3BDYL 4FTVB 1ZLSH 3OX8B 2J8HA 1C1EH 2VL4A 3CPUA 4B9JA 4IU2A 1KXQA 2OKMA 4XN7A 1NFKA 2NYYC 2E6JA 1HKLL 1PD6A 1MRFL 4RMUA 4PRDB 3OLIA 4HULB 3QBTB 5DZVA 1MCKA 2H47C 3D5OF 2EQDA 4PV8B 1HL8A 4CL7A 2AQNA 1HZLA 4HFWB 4NPKA 4PJ8B 4UQDA 4KVNL 2PN5A 3DGCR 4LPYA 4R90H 1NCGA 4V11A 3B9KC 2D4DA 5FM5M 3UTTE 4Z76A 3GJEA 1XH1A 3VXUB 4M5TA 3MJ9A 1QZ1A 3QYMA 1MCBA 4RGOH 5DJ0A 3HNSL 3UTPD 5I1GH 1JMXA 1T7XA 3CDFA 3DXAE 3T1FA 5HPOA 4R4FH 4K3EH 4O2FB 2QHRL 4HSQA 3F62A 4OIIH 3QUXD 1NMAL 1IE4A 4Z7UA 5JW4R 1RZFL 1A6VL 3C8DA 1PF3A 2XTLA 3THMH 1CWVA 3JXAA 2JB5H 4L05A 2D3NA 5AOIA 3NCJL 3FCSB 4JZNB 4MLIA 2IWEA 3D0LA 2AZAA 3DJ9A 2UZPA 4RGMC 5ALBH 4WV1A 2YOCA 4NZRL 3ZT5A 2WUCL 2EDXA 4L4VA 2CK0L 2GC4C 1X5MA 2HG5B 4DN3L 3NVQA 4OTXL 2JKTM 4H4NA 5IB1A 5D6DC 1FRGH 5I6NA 1PSKL 1MLBA 1X7QA 4IOIA 4JQVC 1G7LB 3EOAA 3J2PA 4LCVA 1SLUA 2AAVA 4LSPL 1G9HA 2XV0A 4ZFOB 4M7ZB 2A77L 1UB5B 2D03L 1RK7A 3POHA 4BUQA 4WI5A 4D8PA 1DVFA 5A7EA 4BKTC 5EBGA 2J25A 4J3XA 4XMLH 5ALCH 3U48A 5I1KH 3SO3B 5I1LB 5CBEA 5DQJA 4XNZC 1H8NA 2ADIB 3LKOA 1AP2A 3B34A 1IIIA 1XSIA 1EJ8A 3C5ZA 1EEYB 1QBLH 4X99B 3X11B 5KSUB 4KY1H 1M7XA 4ZK8A 4XO3A 1Z9SA 3UC2A 1IFHL 3IGFA 1E67A 4LCCA 2YWZA 4LEOB 1LMIA 4I5BA 1KNOB 3Q0HA 3EGDB 1DBBL 4XCCL 3GRWL 5E2VH 4FL4B 1CLYL 4HJUA 2WWMD 5A2BA 3KYNA 1FSKC 2NUPB 1M6UA 5CFAA 2ZKHL 4V1DB 1BQUA 3BGFB 1XO8A 2YPVH 3A23A 1BVZA 4K5MA 1NFAA 1L7IL 2DWYA 1NCWL 3TBSB 2R29H 5HGBA 5LNDA 3KJ4B 3FH8A 5DRWB 4LPTA 1BPVA 4WFFE 4WK2B 2Z31C 5F1SA 4TVPE 2HCZX 2GITB 5GRZA 3QDMD 3T3ME 2R51A 3L16A 1DQDH 2GSIA 4XN5A 5B4MD 4OR1A 4JUSA 3DX8A 1S7VB 1K3IA 2Q20A 4LKXB 2AEOA 1V3MA 1HCYA 3OTTA 2J55A 3U6XS 3NIDB 3MLUH 4DIXA 3DHUA 4PP1C 1TVBA 2P5WA 3WNIA 5EC2A 1H3GA 5DSCA 3CZKA 4XHJC 4FQJL 2G5UA 1DDTA 5C6TH 5I0XA 3QJQB 2ZYRA 3L4WA 4ZQKB 4HK0A 4HIXH 5LLIC 3C60A 2XG5B 3KM2A 3ECVA 3F7YA 3S4SA 1R17A 4WO4D 3IKCA 5E08L 1CXEA 1MPAH 4HK3J 1C5DA 2J8UE 3NCCB 4NZDA 4R2GC 4QHNA 4W9LC 3WEXA 1T4KB 1XCXA 1J5OH 4GKOA 2BVYA 1L9MA 1I8LC 2BWDA 3D85D 3QUZA 1LDSA 2OQJB 5FM8A 3EH5B 3LCYA 4A38A 5KBPA 1B4RA 2GAZB 3O2VL 1E65A 3S88H 3L1EA 5FGCE 3NACH 2XTJE 3OGCA 3RB7A 3TN0C 1N5AB 4QHKJ 4R84A 5ERWA 5FO7B 1G84A 2BFVL 2OX5A 3OHXA 3PNWB 2ISDA 3GSNB 3HC0A 5IVOA 1A6WH 1IM9A 4LCYB 3FQYA 4Y2DA 3HUJF 4MAYD 4K3DL 4JFDA 5HGHA 1MCPH 5FKPA 3KYOB 4PJ7A 5IMMA 4NUMA 3N1GC 3SCMA 1ZVHA 2MHAB 2W9EH 2OZNA 2EXTA 3HHSB 3MUGB 5HHMB 1NEZG 3RRQA 4UV4L 2IDQA 2B1HH 2OAAA 3QNZA 3QA3A 3VXPB 4K23L 2Y5QA 4KKLD 1ZLEA 2OL3A 4I18B 3LZPA 2NTFA 3NIFF 1KIQA 5CINL 4UTCA 5KBMA 4C4UA 4S1RH 1PY4A 3FUHA 5IBUG 1NFDF 4HVBA 3MV9A 1UQSB 3NJFA 1LVEA 3CZGA 4N26A 5G4NA 4AJYV 1KACB 1MZYA 1BBDH 4HEPA 2VW4A 3REWB 2HTLC 1YEFL 5FYKE 3SPGA 1XGUB 4MDIB 5GHWH 5KTEL 4PWFA 3E3QE 2ADYA 4L8BA 3IJHA 4YDJA 4HWZB 3BFOA 3K6NA 3PV7A 1QKZH 1WZLA 1NLBH 3VTAA 2F7PA 1HYRC 1KELL 3MRHB 4I89A 2LV4A 4XMVA 5LQBL 3UPRA 2A83A 5BZWA 3ZTCC 1E9PA 3DV6A 3VQ1C 4OLUL 2VL5A 5JOFA 4KTYA 4EIGB 1HXMA 3AREA 4HISA 4G3YH 3RDTD 5F96L 2X4RB 4XE5B 2F5BH 2ZUWA 3S0PA 3SKMA 1ADQH 1SMDA 4F7KA 5GRJL 3VFWB 4OLVL 1OCWH 3P9LA 3U1SH 3FPXA 1BIHA 1F90L 1GGIL 1A0QL 2W88A 4JFTA 3S8WA 1NC4A 4OCWL 3KWVA 3UTTD 1T0NA 2UV3A 4TNVK 5CZXC 2MPVA 4QTFA 4K8RD 5TK2A 3UMTA 3IFPB 5G5DA 5EOCL 5K39B 1Q4NX 3DXAD 2EDQA 2KQNA 2YPVA 3KLLA 4H0IA 1KN2L 4WHTA 1T83A 5F7MC 3PP4L 4APQB 4KNTA 1A3RL 5I8OL 4PB0L 4YK4B 5IW3A 4E42B 3SDYH 1RZKL 3A47A 3Q6GH 4G8AC 3RL1B 3CVDA 1E5ZA 1DVQA 3RGVC 5FWRA 4QTIH 1N7MH 4JHVA 1HDMA 2EYRB 4L8DB 1IO4C 4XPBL 3Q2NA 3OXRB 3UZEC 4YS4A 4R7DA 1AGDA 1VFOA 4HIJB 3BEWB 4L3FA 2XN9A 2C3VA 3FUNA 1HOEA 4GQPH 5DJ8B 4D0DA 1TMQA 1T3FA 3P9WB 3NQIA 2E46A 2FCBA 3ZN6A 3IDMA 1U8JA 5DQDL 4B9FA 2ZIDA 2BY0A 2XG4B 1D3CA 2R69H 5D2NC 2D7TL 1AFVH 2YR3A 4GW4A 4NO2B 4JLRA 1OE2A 1OQXA 1YPZE 2E9GA 4F20A 4JG9A 1OK8A 1T6VN 3DX6A 4GXVH 2A0LD 4FQHB 4LHJB 2KMWA 1EZSA 1MWAH 4I0PA 5C0IB 4RSVA 4ZAKD 3QUXB 3TO2A 4H8UA 4PTUA 1UCBL 5HYQA 2NZ1A 4W9FC 2EEDA 3X1EA 4RGNE 1EXUA 2F1BA 2YZ8A 4P2OA 3VFNB 4HXBH 2Y5TB 2B14A 2YXFA 2HT2D 3CVBA 4U6XB 4AZ8A 2ZCLH 3V0FA 4PJ5E 2GYSA 5AFAA 4TUKL 4Z3EA 3IM1A 3DGDA 4ZDHB 2ZWZA 2XXCB 3DHJA 2NSXA 4GQZA 3RURA 5GS0L 4M5YH 4AG4H 1RLBA 3L3JA 3QIWA 2JKSA 4PJ6A 5JORA 4ZXBD 2EVFA 5D1QC 5SWSA 3PLYA 2MNWA 3VQ2C 2ZX9A 3O6FC 2E8ZA 2HT3C 2I32A 4A2GA 3QWRD 5BXFA 2KKQA 3RVUD 2GJZB 1JZ6A 4AYEC 3DVNA 4F8OA 4F8TA 4GSQA 4YUEH 1GC1L 2O30A 1FYTB 2NY4C 3CVCA 2F53A 1C5BH 1S3KH 2W65B 4XVUC 4CVXB 4WFFD 1AHWC 1WK0A 4HPOH 1F3DH 2XWJB 3BH9A 1PQZA 5EULV 1UT9A 2YGNA 4JMXA 3KLHD 1KBPA 3RWJB 4D0CA 4K2UL 1BVNT 4BFRA 4X6EB 1JPTL 1IZJA 2YD7A 2BZDA 1WZ1H 1WIPA 3WJLC 1BZ9B 2AQTA 4ZMQA 4H44C 1WBXA 1H9VA 4UQ3A 4QT5B 3EOTH 4GG8A 4GAYB 3UIYA 2IQ9L 2VSCA 3MLSL 1QA9A 4WI9A 4G7YH 2EECA 1CQYA 2MH4A 2Y5EA 3FAWA 4QXTA 1ETB1 2NX5B 3FT9A 2H1LM 4IRZH 3T9WA 2E86A 3S48A 5JOPE 1OAXL 3NRQA 3H8NA 1CXHA 5F7KC 5C7ZA 4X4ME 1PD1A 3ZDZB 4D0BA 3VFOA 3BZ5A 1BIIB 1GMIA 1MH5A 1RJZA 4GW5A 5IUCA 4X7DC 1BD2E 3L5WA 2Y07L 1A21A 5E4EC 5A2LH 3VYOA 3GLAA 4FFZL 3LPOA 3QDMB 1VESA 4N2NA 3S3PA 1AMXA 2FT7A 2XTJD 3DTXB 4FQQA 3ARGB 1FG9C 2WMPA 4EO5A 5JUEH 2ALWA 3RIKA 5JOEA 1XDTT 3TA3A 3PAUA 5DC4B 1FNSH 1WFJA 2IANE 3PXHA 3DUUB 4AQAB 3FFCA 2OTUB 4HUXB 3S35X 2IFFH 1IL1B 1X6NA 3BPCB 4NQDE 4OVUA 5GS1B 1BM3L 3JUYA 4Q9BA 3PWJA 2OMWA 5IVXA 1KN4H 2OJZH 3Q2CA 3BUTA 4WO4B 5FCUH 4OCSL 3G04A 3G5XA 4DQAA 1JGDA 1JNHA 1NAKH 4H8WC 1UVQA 4AGLA 4MA3B 2R69A 3WN6A 1KBVA 1BDYA 4MA7L 1NCCH 2XHNA 2NQCA 1I85C 4HIEA 3BAEL 4BSWB 1GZPB 5HVHC 4PIRF 4AKOA 4BSVB 3IJEA 3I9IA 1OANA 4U6HB 1QYGL 3EXLA 2CNZA 1R24B 4MQTB 3QDAA 3UAFA 1MSPA 5FYKD 2PW2B 1JK9A 3AQYA 4G7VH 3DTDA 3ZUCA 4G9FA 5AVXB 3DX9B 4QKXB 5I75C 3LOWA 3GSWB 4NI3A 2IDFA 4MAYB 5EEUA 1I7TB 4L37B 3QUKB 3CVIL 5I66A 2ZCHL 4HETA 4MXVE 1KLUB 3EH2A 4XOBA 2VH5L 1HAUA 2I07B 1FPTL 4URKA 4NJAL 1CFBA 3KH3A 4PFEA 4AL8L 2JCCF 4QHMA 5G4OA 3S8GB 3TWYA 4P4KD 3ZHKA 4KVPA 1XH3A 3GKZA 2B59B 2WTRA 5TJWK 3LNGA 2ZKYA 4J4PD 3ULUE 1WBYA 3ZR5A 3ULSB 1EEQA 4PLJC 1KJ2L 4RDQG 1TPXB 3ZE2B 1CGVA 1J9CT 3K91A 5BQ7B 5ESVA 3MA7B 1G6RL 4GI9A 4P9HL 4NBZB 3GINA 3WFHA 4UZGA 3OKYA 1GYWA 5HHVL 5F1IA 5JNYB 4Z7VB 1LE5B 4LL9A 3I9PA 7FABH 5F89A 4AQOA 2VUYA 2DM3A 3N85H 2B16A 2PP7A 1XF3B 3PJSA 4OZHE 3I9GH 5SX5H 5TE7H 3QFJA 3I3BA 1AVAA 3F12B 3P73B 3Q8BA 3IAPA 4H88H 4WGKA 2J8OA 3RVXC 4AH2A 43C9B 1QRNE 3OV6A 2C9RA 1BQHB 3CQQA 2B08A 2Z34A 4J3OD 5DRXB 4KUZH 1J9QA 2OA9A 1TO5A 3R18A 4G80A 2FWOA 3JWNH 4OCYL 4D9RE 4HAFA 2WBJD 4UTBA 3WFCH 4L3AA 4LGRB 3HVDA 4PS7A 4X8XA 3EFFB 3V6FA 2PWFA 5BRZB 2PW1B 2R2HA 4WWKA 4AVIA 4O51A 4GUQA 3TBVB 3KVDD 4K94H 4YPGB 4DQOH 4XNBA 5EU6B 3GDBA 4FMFA 1F8TL 4HWEH 4H1LA 3T3PB 1I1FA 2BWIA 1MW1A 4S0TD 4S0SD 1JV5A 1H9DA 1EERB 1FIGH 1Q0XH 2BXYA 1KIPA 2LQRA 3GHEL 2ZSVB 1KEMH 1NSNH 5JO5A 5CKAA 3TJHD 1ZTXL 5HY9A 1S7RA 3FMGL 5A2KH 4JREC 3QJSB 1EO7A 4EXPX 3QPKA 3KPNB 2HRLA 3EFDL 4UAHA 3F7QA 2QZ5A 4PJ5D 3Q05A 3HMWH 2HXAA 3I2CL 3IU4L 5ICUA 3ESPA 5T5FL 2HVKA 1JDCA 3LZRA 2XACC 4WEBL 5I6OA 1KYFA 4L8CA 3OL2A 1HH6B 4LZKA 3QRBA 4JHAH 1XAKA 4K3JL 2C5DC 1LO4L 2B8OT 3L1OL 4JKLA 4Z95L 1YNTF 4Y5XA 4QRRE 3BD3A 1A7RL 5FX3A 4JANA 3O6KH 1ZK9A 4FFTA 2YD4A 4KUCF 4NLAA 5JZ7C 2IBZX 2W91A 1DVTA 1TQWA 3VGAC 5L4FA 1CFQA 3SE3A 1NGPH 4NKOB 1HIML 2FB4H 2HTKC 4ZAKB 1S9YA 4U6YB 3RWGB 3IDXL 1FNLA 3CFKB 5CBAB 1LQBC 5E1AB 1EXHA 1NBYB 3HZVA 1U2YA 3NK3A 4RA3A 4RAUB 1CLZH 3FH7A 2OW7A 5D7JA 3CX2A 3F83A 3CLFL 4R5TA 4UF7C 3HS8A 5D70H 3SGDI 25C8L 4PRPA 1IGJA 4KJQC 1IAOB 3M07A 1FLRL 5CEZL 5F7BA 1D5XA 3RWHB 5TH2B 1QBML 5D5MA 5ID0B 3V4VA 3A6CH 4K5NA 4NWTL 5F9JB 3IVKB 4PV9A 3TVMD 5H2BB 4Z7WF 4ZXBB 5CF3A 2CUAA 4YBQC 3O8XA 4MMZB 1E27A 3FL7A 1T04B 4WW2B 1CGWA 1A3LH 3CFTA 2C1OA 2EC9T 1GYAA 5CJXA 4M8QB 5JOPD 4FTVA 2L0DA 3CDZB 3QO0B 4H25B 2RA1A 5T33H 2MIZA 3OX8A 1G9NH 4WWOA 1IC7L 1U92B 2HSIA 5E6ZA 3W5NA 4J8RB 3SDDB 3UG4A 2E7CA 1PZ2A 3MRNB 4N2BA 3TURA 4PRDA 3JQOB 4M5ZL 4AQ8C 1NMBH 3OAUL 1NPJA 3GS4A 4M6ML 5EOQL 4ZD3H 2VMJA 2Z8WC 2K6YA 4PV8A 4WI8A 1E3FA 1NCTA 4HFWA 5DLMH 3T3MB 4PJ8A 3PWVB 1JS4A 1IAII 1LO3H 2NY3D 4EE2A 2WVTA 3VXUA 1M71B 3D09A 1YEIH 4FX5A 4NBYB 5IMLB 1X5HA 2IAND 1JHTB 4L9LB 1I8MB 3IMVA 3ML9A 4XC3L 4P06A 4IRSC 4UV7H 4O2FA 3O41B 2FATH 1BW8A 5L9DL 4C59B 2HB0A 3E0GA 4NQDD 1ID2A 3LKSA 3BKYH 3BFWA 1TUPA 3EKCA 2V33A 4LVOB 1TZGL 4L8SC 1W6LA 1M3IA 4JZNA 1OW0C 3WY2A 3BOVA 4Q2ZB 5KVFH 1YEJH 1YQVH 1IB5A 1DQTA 1CICD 4HK3N 2JV6A 4F2ME 1ZLWK 5DD5L 4BA8A 1NUGA 1SOXA 1YUHB 2GJJA 3IT8D 5E8DL 2AXGB 5DK2B 2ZE0A 4KBPA 2QV2A 3MRLB 4K07A 2HG5A 4MWFB 2OCFD 4XAWH 5JA8B 2XTJB 2WP3O 2K7QA 1EA9C 3ETTA 3A24A 4HYTB 1G7LA 3BFQG 5LGJB 1X9LA 4ZJ9A 4RISH 3TCXA 1UYWL 3KGRA 4UDTB 4WLCA 4ZFOA 1P7QD 4JM4H 1UB5A 4GRWE 3WEOA 2QPFA 1FDLL 1PGRB 4N9GB 5CO1A 5DEGA 4AEHL 3IK2A 4LQ1A 2CMRL 1N64L 3ARDA 3M6DA 1GAFL 2UUDK 4X9YA 2BSBA 3MCLL 4V2BA 5I1LA 4XODA 2Q86B 1LO2H 2ADIA 3F64A 3A3YB 4E9RA 4MNQE 3WIHA 1GIGL 2WXQA 1YSOA 1VKXB 1SDAB 3VD2A 1EEYA 4KI5C 3X11A 2AEQH 5KSUA 3E9UA 3HI6L 3NMEA 1V7NL 3FB7A 4A68A 4FNLH 1FNFA 3UO1H 2H0JA 5DHEA 4A39A 4LEOA 2X9XA 1URIA 4NRYB 1KNOA 4QXGH 4H20H 4GRLC 3EGDA 3ZE1F 4NQVB 5TE6H 4ILDA 1USZA 5AOJA 5EBWB 2PP9A 3DRQB 3HCVB 4Z5RB 4FHKA 3P2TA 2NUPA 2OS7A 3FQNB 4V1DA 2ESVA 4OV5B 5IROA 4C57C 2RQ8A 3VFGL 3P0VL 2A9AA 2YOAA 3TBSA 4OJFL 4Z7AA 1NJ9B 5DRWA 1QRND 2Q8AL 2G0LA 2XWTB 1Z9OA 1MIML 1HI6B 3TEUA 2GITA 3HG4A 2HJFB 3WNJA 4P4KB 1EJ6A 4D9RD 3RIAF 3WGVB 4IS6B 3W37A 1S7VA 2UX6A 4DKTA 1AH1A 3DSNB 1GGYA 4LKXA 3IPBA 3C5JB 4Z8FH 2WCPA 5GS0C 1EH9A 4YDIL 3T08A 2OSXA 5B38G 3V6OC 3UTSB 2VQTA 2DEXX 1F3RB 2FLMA 3WMPA 4AV4A 4CC4A 5KYWB 4U1MB 1NDGB 4ZSOB 2ZXQA 1AR1D 5DC0A 2P44B 2XG5A 3E9TA 4WI0B 1RIUL 3UZQB 5IKCB 4FZ8H 5KEZA 3HFFA 3RIFF 5AW0B 2J1XA 2NYKA 2Z1KA 3GDCA 2Q2LA 2VDOH 1IC1A 5ADOH 1T4KA 4U6VH 1I8IA 4HKJB 2DJUA 3QWOB 1XTMA 2UVFA 2C9SA 2VZSA 4M7LT 4U05A 5AYQA 2OQJA 2GAZA 2WBJB 2ENSA 2XI9A 2ZAIA 3TIDB 2DD8H 2L7JA 3VX0A 4JFYB 4BKSC 2Z8SA 1N5AA 1S8DB 2UXVA 4NWUL 5FO7A 3PNWA 4HJGB 4XXWC 3GSNA 7PCYA 1KSRA 4LCYA 1U93B 5CJOL 4DPBX 3GMPB 4FMKA 4LCWE 4Z7OE 4JM2D 2BHYA 3VD0A 3KYOA 4KK5D 1F13A 2NT1A 2MHAA 1NKGA 3H2QA 3KHOA 3HHSA 4MHHG 3MUGA 4MZRA 5BUAA 4RGNB 3BT0A 3N9GL 3TLRA 3VXPA 2W38A 4JN1H 4I18A 1EMTL 2QVFB 2MCAA 4KK8C 2UYLB 1M57B 1QI4A 4JY4B 3FN3A 4IHOA 4KJPD 2LVEA 1UQSA 2HMID 1CXIA 4OD1L 3L5XH 3AXHA 3OD3A 2ZKWA 3REWA 2QMJA 1XGUA 2J43A 4MDIA 1IGML 1I4FB 3U7YH 2E6PA 2BX5A 2FUQA 1R34A 4HHGA 2AERT 3MI6A 5BVJB 5J9PB 4HWZA 5B1AB 4ZS6C 3H2WA 3KEDA 2WQUA 3MRHA 4GEIA 3EBIA 2N59A 3DJRA 4KKQA 2XA3A 4M7LH 2I7OA 3MTXA 4O5LH 4YXLH 4LLYA 4C56E 4LRIA 1OP9A 4HBCH 5CZVH 4WFEE 2Z91B 5LGYA 1G4MA 1UM5H 2X4RA 1VGEL 2XN0A 3ELAT 4GRMB 5E0QA 4JG1H 4QF1B 4FJ6A 4G11A 2IPUG 3GKWH 4OLYL 4QWWD 2RJMA 4I77L 5E6UB 3VFWA 5IIEB 4KXAA 3ZJAA 1SM3L 1DR9A 1LD9B 1T7YA 2VW6A 4PGEB 3HE6D 5E99H 1U9KA 2ODHA 5HDQH 2C3XA 5ITFB 5HGGS 4DVRL 3P40A 2FX9H 1W0VB 5E6YA 3EHBC 3BKJH 4PS4L 3GLDA 3IFPA 1QLEL 3LMJL 4NZUL 4X5PA 3VFVB 3TVMB 3QRGH 5K39A 4WSGA 1CFNB 3MYZA 4IYKA 4XHQA 3GYRA 3GZOA 4APQA 1IKFL 4IGBC 1AC6A 2BRRL 4BFNA 4IBVA 4MJ5B 4DP9X 4FFYA 4FQLL 2FBOJ 3PWPE 4XPGL 5KS9E 3IFLL 5MENE 3RL1A 3AY4A 4Y1AE 1A7PH 2VXTH 3ATAA 3MRCB 3V5HB 2FX8L 4L8DA 1C5CH 2EYRA 4CUCA 3MAWA 4APXB 4NPYB 3OXRA 1L6ZA 4JRFA 3NJGA 4HIJA 3BEWA 3UG5A 4A7QA 3V79C 1BD2B 3D25B 4ABVA 3UC0H 2VOTA 2PCPB 3DX1A 3NA9L 1NDMB 1P5VB 3X1BA 2QKIC 1FVCB 4OIBA 2XG4A 4QPEA 5CGTA 5DUMH 5DEFB 1CS6A 1UOVA 4NO2A 3CIAA 1ROCA 2DZEA 2J1WA 5FUCC 4D94A 1UD6A 4IK6A 4PJXF 4G8FB 1HQ4B 2CALA 3U9PL 4J28A 2IANB 2R56H 3FUKA 4FQHA 2I7SA 2RALA 2DH2A 5C0IA 4G6KL 4I3SH 2JELL 4OJYA 3LXCA 5CJ5A 3KYKH 4NQDB 3QUXA 2VNCA 2NY2B 3IMSA 3K5RA 1S9XB 3CK0L 3J7HA 5IHLB 5J12B 3FT2B 4JG0L 4OLWH 4WEUD 3VFNA 3UP6A 1M53A 2A2QT 2V5MA 2Y5TA 4QDGA 2DL9A 4HZ1A 5I1IL 3MRMB 4MNQD 1N68A 1D9KB 3HC3L 2CBOA 4OZFG 4HIIB 2Q7YB 2FSEA 4ZDHA 5AVTB 4I7ZC 1C08A 5IQ7L 1HAWA 1JYWA 5C0BE 1B4TA 3HBQA 4QCIB 3S35L 5JW3L 2Z4TA 1RIVL 3HI5H 3X12A 3NRFA 2QTEA 4NN6C 5DT1H 3ROLB 3T2QA 1G7IB 3MCYA 1HH9B 1QFUL 2JMRA 4F91B 2GJZA 5KJRL 3II2A 2TRYA 1VERA 1W9XA 4ZX6A 1P7QB 4G7QB 2OK0H 3KVPA 1FYTA 3M86A 3S5YA 3ZE0B 1KULA 4K3HA 3FRPG 3HC4H 4QHLA 2W65A 5HHPB 1ROWA 1UA6H 1GTFA 4P2RE 1M7IB 2XWJA 5EHFA 2WNWA 3D87B 4NSKB 3IB4A 3QI9D 4O2EB 1NCJA 2ZX6A 2C9PA 5FFOA 3BKMH 3VX1A 4Q74A 1MCOL 1TEFA 4DGVH 1GYCA 2YQ3A 5GGVY 4E36A 4X80H 2XZAH 5GRVL 3UZVB 3ZOAA 4PTTB 2FO4B 4MB1A 3QDGE 3RY4A 4PJDF 1BZ9A 1D5RA 2VDML 3EGSB 4QT5A 5HYJB 4GAYA 2K8MA 2NY6D 3MBED 1DEDA 1J8RA 4FXGC 4F93B 1U2CA 4MMXC 2YIHA 2V7HB 2RQEA 2YQGA 4K8RH 3AT9A 4QRTB 1KC5L 2NX5A 1P9MC 4XOEA 3BUIA 2QV4A 4QGTA 4B9IA 3TO4D 3JWDC 1CLOH 3CHSA 5F7EL 2CDFB 1QRNB 2Y2WA 2Z65C 4J6IA 1AGEB 5DZOA 3ZT7A 1RK0B 4PV1C 5C8JB 4JRXE 3QIUC 4E9QA 2ZCKL 5HXMA 4F7TB 4IEFB 3QDMA 3V55A 4P49A 4JKPL 3DTXA 2AI0H 4RQQB 5IBTH 3ARGA 3NZ8B 3CXHJ 2VXUH 1LK3L 2AJVL 3SBRA 4HOXA 1QG3A 3EYQC 3CZLA 2VDNB 3ARQA 2VRKA 2CRZA 1MFDH 1JGLH 5IHUH 5LWYL 2ZNXA 1E4XH 4AQAA 3LDBB 1FA4A 2OTUA 4HUXA 3PP3K 1IL1A 3DOSB 4YZWA 1AR1B 3BPCA 5GS1A 4MJ6B 1MY7A 1A65A 1QNZH 3KGUA 1DO5A 4GQRA 5J0BA 4M1GH 1LDPL 2CO4A 1DN0A 1SY6H 2PPEA 4ZOCA 1E0OB 5FM5O 4WO4A 4CBZA 2PETA 2IDSA 2V8MA 3MJGX 4FP8L 4GSDL 4MA3A 4DP5X 4MDRA 5JXEA 12E8H 4BSWA 2EE2A 4YOKA 3U0PB 4CSTA 4RH4A 2YMTA 4BSVA 1F1AA 1NL0H 2UX7A 2FHBA 4U6HA 2EDKA 3E7JA 2OJEB 2H45A 1HE8A 1R24A 2VIRB 4G8EB 4RAVB 4HZLB 4DNLA 5FHAL 2PW2A 2CRIA 3IWVA 5LG1A 2QGDA 1WAAF 3O6ML 3MCG1 4KZ0A 4XNDA 1L0PA 3DX9A 4N2EA 1HXYA 4QRRB 3QJOA 4GSRA 3GSWA 4GXUN 1WS7A 3D2UD 4LSQL 4XPHL 5CJQH 5TTRA 3MLPA 1BBJB 1I7TA 1AXTL 1KTDB 3CXDH 2NY0B 3G5ZB 3H3PH 3QUKA 4L37A 4W9DC 5E5LA 3ZZLA 1KLUA 4TUOB 1MEXL 4C56D 2CIKB 4E9VA 3QT2A 4WFED 5AB9A 2I07A 4KX7A 5AVWB 4KXCA 5EEWA 1Y6NR 4HEMA 1XGPB 3NFSL 4UQAA 4IMLB 2APSA 2WLHA 3DOHA 2VM9A 1H8LA 2IWFA 2B59A 3VSTA 3ZY7A 4IDLA 2Y22A 1RUQL 2K3TA 3P2BA 1HCFX 4ZUTB 3ULSA 1FORH 2Q3XA 4YMPA 5BQ7A 2ZKXA 3MA7A 2XT1B 4FG0A 5D93B 1RZIB 2F54E 3PDGA 1CFVL 5JNYA 1QSEB 4CVWA 1JPSL 1LE5A 3WIFB 4AGMA 1G9EA 2VTFA 2NW2B 1XF3A 3KPQB 1V3JA 5C0RH 2JCWA 5MEND 2CUIA 3F12A 3P73A 2H6PB 2UZIL 4Y1AD 5K59F 3TP4A 4ONHA 4Y16B 43C9A 4J3UA 3HNVH 5HI5C 1RD6A 5EU5B 1RFDH 2HT4D 1UATA 1BQHA 1A6UH 4IDJL 2DF3A 2Y1ZA 1L9NA 5DRXA 1A4KB 5AAMA 4QLWA 2NY7L 5DUJA 1RZJL 1OALA 4RFEB 5HPMB 5DUBB 1DUYB 1OSZB 2DQGL 4A1RA 1HEHC 2HFGL 5B3SB 2D7QA 3EFFA 2P5EA 2DLTA 2MCG1 5BRZA 1MWOA 2PW1A 5IFJB 1MREH 1UXSB 5CLWA 3VWJD 1N2RB 2VERN 3TBVA 4YPGA 5EU6A 4TTDC 1MHEB 2LTQC 4I48B 3PXLA 4JDVB 1X5AA 4ZFGL 3QORC 4B50A 4FABL 2ZSVA 4HUKB 2H6OA 2Z35B 4HQQH 3ZL4L 4YEFA 3DK0A 3LB6D 3LHPL 1BAFH 2Q3ZA 3B37A 3EOYG 3F58H 3KPNA 2A6KB 1XVSA 4CILA 3OVUB 3DO4A 4AYMC 4DTGH 2XBDA 4ELMF 1SN2A 4FTDA 4F2MB 4HJJL 1OO2A 4ERSH 3SDCC 1T1WB 1H5BC 3OAWA 1JPEA 1A7OL 1KZQA 1LQSR 4YGAB 3SOBH 2K78A 1HH6A 2WQRA 1XR9B 3HE7D 1SXSA 1UENA 4BYHA 4UTAH 4UBDC 2XETA 5EA0L 4YHMH 1NGZB 4JKMA 3RWCB 1DBKH 3V9EA 4FQXD 5AVYB 4AEIH 4NDMB 2X40A 3EF4A 5FYKH 3SKNB 5SX4H 3BQUD 4NKOA 4GRWB 1MJ7L 4ZAKA 3RWGA 4U6YA 1FL6B 4P2AA 3CFKA 5CBAA 3EJCA 5E1AA 1NBYA 1NANH 1WGOA 4P2RD 4BZ2A 4FLOA 3GRBA 4RAUA 4ONGL 4R26H 4DP6X 5DD3L 1U8OB 4MNQB 1KY7A 1SDYA 1IAOA 3O2DH 1OZUA 3RWHA 3H85A 5TH2A 4ABWA 4GUOA 3QQDB 4B7IA 5ID0A 3QDGD 2P9RA 3MLXH 5F9JA 1HTYA 2NLJB 1HILB 3FW6A 3IVKA 3LQZB 4B97A 3M45A 1IAIL 4QRUB 5H2BA 4ZXBA 3C6LD 4HD9A 2AK1H 3RGBA 4FA6A 4B7LA 5FLUA 2X6VA 4MMZA 2Y4SA 4R7VA 4TOYL 3NH7H 2BSSB 4WW2A 1ZLUH 3UJJL 5CGBA 3QWRA 5I71B 3H55A 2PO6B 4H25A 1OCZB 1V05A 1W6WA 3CDZA 4FEMA 1F18A 5EG6C 2L7UA 3OKEB 2BOBB 3RKDD 3FN0H 1ASOA 3DO3A 1U92A 9PCYA 1B0WA 1SHMA 4YWGL 4N0CD 4J8RA 3OBAA 3SDDA 4PR5B 3HAEH 3D18B 4BFGA 1KCRL 1P4BL 3BAIA 3REVB 4JRXD 5DWUL 3MRPB 4FEIA 4LCUB 3PWVA 4N8UA 4PWHA 3ZTJG 1N0LB 2AJSH 4W68A 1NCAH 4J3OH 3PL6B 4PJ9C 5B39G 3QIBD 4GT7A 1M71A 1QX1A 4F15C 4GMSL 1PLGL 5FPIA 1L4IA 5IMLA 4JO1H 1PAMA 2XFGB 2ZUXA 4JBSA 4PJ7F 3D12B 2WKGA 4L9LA 1IU1A 1I8MA 3M1OA 3MACL 3MBEB 4DKEL 3O41A 2D73A 1WS8A 2QADC 1RZ8B 4TPRH 3LKQB 1A14H 1CPUA 4QXVA 1VSCA 5BO0D 4NM8L 4OCMC 1PVHA 3BCDA 4Q2ZA 4KRPB 1LEGB 2IWKA 1IBGL 4Y2LA 5J3HC 5D2LF 1FL3A 4QJ5B 1JBJA 4OGXL 4YSRA 1YUHA 1FLTX 1KB5L 5I9QB 1Z9NA 2AXGA 3LN5B 4WI6A 5DK2A 3NCBB 4MWFA 5B8CB 4Q8BA 2YS4A 1A9VA 5ESQB 1T2JA 1XSOA 3VXQB 3M7OA 2FEEI 1PX8A 4OW6A 1KXHA 1U3HC 4U7SA 2GHZA 5LGJA 5LAPA 4LCWB 4GO6B 4Z7OB 4UDTA 3L45A 1DBAL 1ZCRA 1BQLH 3D05A 1HHGB 1GW6A 4N9GA 1QUPA 2JQMA 3NTCL 3HB3D 5C2BH 3HS0C 2MKWA 4IKNA 1CF1A 4LLMB 2Q86A 1LP9E 2C3HA 4K9EH 4UMGA 1GW0A 2Q8BL 1T1XA 4UTAA 2YAEA 5J1AB 2Y24A 2GSMB 4CGTA 3EJZC 4N6RB 4UM8B 1VKXA 3S4SG 4GAJL 2YJLA 3GI8L 4HU2A 4XVTL 1E5BA 2VZTA 3SE6A 4PJBE 4KNQA 2Q6WB 2F54D 2E7DA 3BLBA 4NRYA 1OCRB 3SDAD 4NNPL 4NQVA 1KCUL 1DLFH 5DRNB 4MCMA 5EBWA 3LNDA 3ISRA 3DRQA 4ZMZA 2OZ4H 5DZNA 3NCWA 3FQNA 4OV5A 2DIBA 3QHFL 4Z7IA 3PABB 4YHNB 5C3TA 3OKMB 4YHOL 4WEEA 4C56B 5D7IB 5LNEA 3LEVL 1NJ9A 2J44A 4K7PL 1K4CB 3O2DA 2R2BB 2XWTA 2BOLA 1P6FA 1HI6A 3QCTL 1A8ZA 2HJFA 3UEZA 3MRIB 4P4KA 1Q72L 3IJSB 4X9BA 1IVLA 4IS6A 1MCDA 1HK6A 1TLMA 4J4PA 4R83A 1YUKB 3GSVB 1MNUH 4QRBA 1JP5A 4Q9RH 2VDRB 3DSNA 3GXNA 5DI8A 3C5JA 1ZANH 4KTEH 5FKAB 1T2QL 3X3FH 4GYBA 1ZHBB 3K8KA 4MZIA 3UTSA 4DF9A 2XDHA 3FQ2A 5JR1H 3MLTB 5KYWA 4U1MA 1NDGA 1WISA 5EO0B 2I26N 4MSWB 1WC7B 1XHHA 4ZSOA 3JZ7A 1TZAA 2WLYA 3LQAC 1K8IB 3UZQA 4WI0A 3X14B 2BS71 1U3NA 4UILL 5IKCA 2E27L 3PWPB 1JZGA 1MJUL 1AJ7L 4TNWK 5MENB 2I5YH 1A5FL 1RPQA 4OF5A 1FBIH 1SMOA 1XIWB 3CLEL 3F84A 4M7KL 5I30H 4LASH 4J7RA 3VD7A 1UWGH 2YA1A 4HKJA 1EZUA 1C7TA 3QWOA 1JHLL 4A2LA 5FGSA 3LRSB 4XI5D 3HPJB 4TL4A 4Y8DC 4OZGF 3TIDA 4YLCA 5GZOD 2IQAB 4JFYA 4DKDC 2OI9B 1A2YB 4NCDA 1DJXA 4EEEA 1AMYA 1JV2B 4HJGA 3V8CA 4B95C 1EDYA 1HQRA 3BVNB 3L2LA 5FHBH 4M7JL 1U93A 2QR0B 1VEPA 3GMPA 4UQ9A 4JN2B 4JRYB 4HOMA 2XQBH 3MJ7B 3S34H 2Z9TA 2KHAA 4NX0A 1H3UA 5DHVH 1INEH 1NBZB 4YHLL 3O9WC 2D2CC 5T1DL 1FH5L 3BAXA 2JI2A 5C07E 4PD4J 2UYLA 3CFDB 4JY4A 1ZMYA 3H53A 1ZA3B 2EIJB 1DEEB 4UNTA 3IJ8A 2NXZC 2UZYB 4ZMXA 3OQ3B 2IAMD 4IKJA 4L1BA 2E4FA 3FBKA 1AE6L 3LN4B 4LPXA 4WCYL 2MQ3A 2GY5A 3IEAA 5C0BB 3X1NA 2QHRH 1I4FA 2XBZA 4POZD 4ANKA 4JDEA 3CHPA 3VXTB 4X50A 2EUVA 5BVJA 2O5NA 1BZDA 5DMYA 1A6VH 5J9PA 5AALA 2NTSP 4QR7A 4EUPB 2OMTB 3NCJH 5KOMC 3RI5K 4HLZH 1WZAA 1DQJB 2CHZA 3HRZC 4C4KT 3P3UA 4RNRB 2QPEB 2Z7YA 4PP2B 1AXIB 2Z91A 1U0QA 4YC2C 1NMCB 1BQ5A 2WUCH 3F7PC 5FW7A 4GRMA 4PI0A 1E7UA 4QF1A 3TOPA 1MCWM 1OM9A 1QI3A 2V37A 2QPDB 1UZ6E 3MJ9L 5IIEA 1NPNA 4OTXH 2J6EA 2FQEA 3VG0H 3RHWF 3VXMB 4OCLC 1LD9A 2PXYC 1XQ4A 1GVIA 4PGEA 1JNJA 1E4KC 1PSKH 2W80C 5BW7A 5ITFA 3LSOB 4WY7L 4QIRA 4CGUB 2IH8A 1W0VA 3OMNB 3L5JA 3QDGB 5D2NE 3LS5H 3VFVA 4LSPH 3U1PA 3TVMA 1DP0A 4HWBA 2OZ4A 3ARYA 4JS7A 3C6LB 2FR4B 2D03H 3GXDA 1CFNA 1EUUA 3ULVC 1F6AB 2DQTL 2G4EA 4WHCA 3SB3A 4I1PA 3Q7JA 3WSQL 1F42A 3AFLA 4OZIB 3ZZQA 2WUBH 4MJ5A 4NN7B 1IAKB 4AYID 5IVXF 1EHLL 2GKIA 1JZJA 4JHWL 3G08B 3B5TA 3SDXF 3W2DH 3TZVD 4CSPA 3MRCA 1INQB 2VJ0A 2EYTB 3OKKB 4YFDB 2BW4A 3T77B 3V5HA 2LU5A 5K9KB 1PCXA 5BZXA 3O3UN 4APXA 4NPYA 1M7UA 3FO1B 4G5ZL 3UROR 3FSZA 2JJSA 3LZOA 1BD2A 3D25A 4EI5B 2PCPA 4PGDB 1WEJH 2IXQB 4ZOAA 1NDMA 3FUEA 1P5VA 2BM3A 1CN4A 3STLB 1DBBH 2LT9A 5E6ID 1WWCA 5DEFA 5CEXB 4YZFE 3F8UB 1CLYH 1NKRA 3CVHH 4IRJC 5D1QE 3UJIL 3GWJA 2ZKHH 4N4YB 4DN4L 3BLPX 5HDBE 3GJFK 1HQ4A 4OFIA 1JD9A 3PDOB 2IANA 1CR9H 1MCCA 3GPEA 1DFBL 4JFEE 4UDUB 5FV1L 2E7LC 1MNNA 3BE1L 2F8IA 5SWZE 1RZQA 5GRUL 1G0YR 1S9XA 3VMPA 4W4OA 3OPUA 1CYXA 4LO9A 4UT6A 2XX1A 4Y4HC 3MRMA 3T2NH 3UBXB 1D9KA 1ZSHA 5JA9A 2JKLA 3QUMB 4HIIA 2Q7YA 1K5WA 4WZ9A 2KC0A 4PWKA 5AVSB 3PJLA 2H2PD 4HHAB 2RGSA 4MKMA 2CXKA 1MVUB 3NZHL 4FQJH 4KH2A 2ZAHA 3GJFB 4LVHB 2GJ6E 4PRAB 1SDDB 1GPOL 4HMEA 3ROLA 2IO5A 1G7IA 2COQA 2OW6A 3DVFA 3H9HB 4PP1D 2ZJSL 2OYMA 1JTTA 1EEZB 3LPFA 3TTSA 2BINA 2GTWB 1IQDB 1P7QA 3K5SA 3RQ3A 1BFTA 3TL5A 5HJ3B 4PQXA 2X4NB 3HB3B 5A2IH 1M7IA 4XMWA 2VE6B 4BDVB 4X4YB 4NSKA 3O2VH 5EU4B 3MNMA 4O2EA 3V4UH 4JO5A 5IG7B 3VM5A 5KG9B 4YSSA 2Y6TE 3LH2L 2BFVH 4GAGH 1EO8H 5JHDE 1C1EL 3FKUS 3QZOA 1BYPA 5GRYA 3UZVA 4PTTA 2FO4A 4K3DH 1JYVA 3X3GH 3C5XA 5D7KE 5I0VA 1EJOL 2VDPB 3TN0D 4QRPE 1ICTA 3VGGA 3TEYA 3EGSA 3PS6A 5HYJA 5FWQA 2X1XR 1Z0MA 4UV4H 5KW9L 2V7HA 4QRTA 4R90L 2VGLM 3HG2A 4KKNA 4ODUB 5DJ2B 5DJAB 3ZSSA 4HLJA 3BIKB 1BPLB 4UZSA 5EWIL 2DKMA 4X9IA 4RGOL 2IMMA 2NUTA 1UA3A 1AZUA 2CDFA 1QRNA 2CJTA 4YL9A 5DR5H 4HXAL 1AGEA 3RPIA 4K3EL 1RK0A 3RWFB 2A74B 1CMOA 4OIIL 5C8JA 4FMVA 4F7TA 4IEFA 2VR4A 4E9WA 2V2WB 4UI2A 1ZHKB 4RQQA 3QXAB 2UZXB 2FD6L 3WHE1 2ED6A 2HTLD 3NZ8A 3RVVD 1Q1JH 5ALBL 5AD0B 5LDSA 2OV0A 3FOLB 3JSSA 5F88B 1KB3A 4NUQA 2V3EA 4RX4D 1WWBX 5LO7A 3FSOA 4Q52A 5F96H 2R0KH 3DOSA 1XAUA 4AX3A 4MJ6A 5MI0C 2HPOA 4QRFA 5GRJH 1OPGH 1F3DJ 1FRGL 4M8UA 4OLVH 2X0VA 1D5ZB 2BY1A 4NENB 4EN3C 1F90H 5C07D 4BH8B 1QZNA 1A0QH 4YX2H 4KGJA 4GRWH 3DOIA 5DF0A 5I1HL 3JV5A 1ZT4B 4PJHB 2WV3A 2Z7WA 3U0PA 5EOCH 4F8LA 2OJ1A 2VIRA 4U3XA 2ERJC 4G8EA 4RAVA 4HZLA 4XMLL 1KN2H 5ALCL 5I1KL 2FAUA 1GYUA 1A3RH 4S10A 4FHBD 1RZKH 1J1PH 4QRRA 3BVXA 1BZ7B 3L95B 2EXYD 3QHZH 3RFZB 1BBJA 1S5IL 1KTDA 3G5ZA 4KY1L 2CA3A 4EVNB 4BQ6A 1CIDA 2XJLA 3FO0L 3H0TB 4TUOA 3ZZ1A 8FABB 4LCIH 5I6MA 2CIKA 3WJMB 3HZYA 4HZAA 1TXKA 4GBXD 4KZDH 5E2JA 3EO0B 3RGVD 2AANA 1N6QL 1D5BB 1XGPA 3IPFA 4IMLA 3SPVB 1EHXA 4CW1B 5EBLA 4PJEF 2YPVL 4M1CC 2R29L 4Q6YA 2IAMB 5F97E 1M1XB 2YMXL 4WW1B 1RZIA 5K5YA 5TK4A 3B9KB 3A67H 1QSEA 3SY0B 3C8KB 1ZXQA 3K8LA 4FFWC 2FK9A 1ZV5A 3WIFA 2E0PA 1DQDL 4ZYKB 2VRAA 2WGNB 1NOAA 2NW2A 3NG5A 3KPQA 5T1KB 3VUAA 4U0RC 3DWTA 2PCXA 2F1EA 3WY1A 3E6HA 2H6PA 1T89C 3JVGA 4Y16A 4TUKH 4K5PA 4A6YB 3Q2WA 5CN2A 3I3EA 6CGTA 1FGVH 5EU5A 3QR2A 5DD1H 4FQ1L 5DGRA 5E7BA 4F33B 3BP6B 4HIXL 5AWNH 3B3IA 4RFEA 5HPMA 4MD0B 5DUBA 3KLAB 2A1WH 4RA0C 1DUYA 1OSZA 2C9XA 1KCBA 4BK8A 3W57A 1X5FA 4OVVA 3WEMA 1Y0LB 2OMUB 1AIFB 5HD8D 3PE9A 1AI1H 5D1QD 1UXSA 5L7XL 5IFJA 1N2RA 3IE4A 5JMOC 3EJQA 1QLRB 3P0GB 2JJTA 4IBQA 1MHEA 4JFED 4OU3A 4E9YA 4FNQA 4JDVA 2QQNH 3RAJH 1OIOA 1JZ2A 4Y4KC 3NACL 5SWZD 2Z35A 3RBSA 3IFNH 5MERB 5FO9B 5L6YL 3TZVB 4MJ4A 1TZOA 2OR9L 1A6WL 4UOW1 3PWUB 2A6KA 2N1KA 3KNBB 2WN3A 1JSYA 3LEXB 1MCPL 4BIKA 2CAKA 4F2MA 1XV8A 4XNZB 1JPGB 1BJ8A 1T1WA 2LFEA 3TONA 5JTWA 3FO9B 3EIFA 1MAJA 1GS6X 2YSSB 2IQ9H 4MGXA 1ZA6B 1XR9A 2EZ0C 4WK0B 4Z78B 1NGZA 3K72B 3RWCA 5IQMA 2G3XA 3ORJA 2YD1A 4OCXL 5DMKB 4G71B 2BWQA 5C08E 4NDMA 4ZX4A 2C3GA 1BBDL 2GABA 3SKNA 1U8QB 5AVVB 4UOZA 1EJFA 2CBTA 3OKNB 5GHWL 1FL6A 1EHNA 4MS8D 1CU4H 4AMWA 1I7ZB 1XCWA 2DMKA 1FFPB 1NLBL 1VIWA 1KMGA 1G9ML 2DQCH 2EUZA 3KE0A 3MUHL 1U8OA 2Z31B 4MNQA 5DJXB 3ZLQC 5FV2A 3KWUA 1WICA 5JHDD 3CXFA 3GBDA 2X1OA 3JWNG 3QQDA 1FO0B 1T7VA 4G3YL 3VD4A 1R0AH 2F5BL 5D7KD 1HILA 2NLJA 2MPAL 1ADQL 4P5TD 1SBSL 3LQZA 3NIDF 1UCTA 4QRPD 4QRUA 4PLNC 3FUFA 5EMYA 2JB6B 3H4FA 4U1LB 1BM3H 3U1SL 5CCKH 2OMBA 5FYJE 2VDRH 1OE1A 4XCYB 3P77A 2VISB 5IOPB 5J13C 4RMRA 2J4WH 4OCSH 2CR6A 2BSTB 2Q0ZX 4PYHA 2PO6A 1PL3A 4JPWH 2Y6SC 4AVKA 3D3VB 3OKEA 2BOBA 4Y5VC 1MCNA 2DI9A 4MA7H 4NGHL 3FTYA 4PMEA 3FT1A 4GOSA 3BAEH 5IM7B 4O58L 4PR5A 2MNUA 3D18A 1JWSB 4R2GB 4E0RB 3REVA 2WW8A 3MRPA 3FNKA 3QQ3B 4GUPB 3UO8B 3VXRE 4LCUA 3Q6GL 1I9RH 3K1KC 4F7CB 3WNKA 2GBUA 4BH7A 1N0LA 4QTIL 5IFAH 5BUGA 1N7ML 3VVVA 3G6JE 3PL6A 2VKXA 3VTMA 5J8OA 3VRJB 5TD4A 3ML8A 4F27A 1CFSB 4OGZA 3TN0B 1PKQB 5L2KB 4KV5F 1YJDH 4KO7A 2Y1YA 4YVUA 3Q5TA 1OEZW 1IKNA 2FEEL 4W9EC 3T4YB 5E9DE 2KL6A 3MBEA 1FPTH 4DEWA 4NJAH 2R69L 3W39B 3KXFD 1RUPH 1RZ8A 5JDJA 3LKQA 1JRHH 2NR6A 1FH2A 3V0HA 1UZ8B 2QSCL 3IDNB 4XCEB 1U4FA 2B77A 3WTSA 1V3KA 3GS7A 3U2JA 1LEGA 4DVBB 4RCAA 1FFTB 1MWAL 3WOVA 4TLSA 2EDFA 3WNMA 1G6RH 1FZKB 3MODH 5D71L 2RB8A 3LN5A 1PBYA 5HHVH 4DEPC 4TQHA 4ZRGA 3B4NA 4Q7DA 4PLJD 5B8CA 3AM8C 5CSZB 5D4HA 4HXBL 5ESQA 3Q5YA 1J05B 4I87A 3VXQA 2Y2YA 3WS6A 5ICYB 3EDJA 3LH8A 4AM0B 4LCWA 4AUJA 3II1A 3ARRA 2IFGA 5FW6A 2P46B 5JPNC 5D1ZD 1WFMA 1HHGA 2DICA 4WSJA 4HLEA 1BZ8A 5IMKB 1RXLA 4FJYA 5FECB 4Z7UE 4P04A 3ESUF 3DROB 3KR3H 3RVXD 1RJYA 2YRPA 1GJWA 5C07B 3VH8G 4LLMA 5GSVB 1T0OA 1QD0A 4LAQH 4DOHE 2ENPA 5J1AA 4YSDA 4IU3B 4YUEL 1ZVYA 4N6RA 3ENEA 4UM8A 3MV8E 2HLAA 3V0WH 5IEKB 1BQKA 1C5BL 1S3KL 2WJ7A 1H3TA 4L4VE 2Q6WA 4HPOL 3ZKMD 2LGNA 3MXWH 1H3WM 5I28A 1ZTXH 4N2DA 4UAOC 3FMGH 3VD5A 4YXKH 5DRNA 1J9SA 1FFOB 3V5KB 3BJLA 4NC2B 1LL1A 2ICWB 4IJTA 5IY5B 1WVZA 3PABA 1EGJA 1WZ1L 4YHNA 3OKMA 2WVSA 5E8NB 4C56A 3R7QA 5D7IA 4EI6B 4HJEA 3IU4H 3T6XA 3EOTL 3KZ8A 2X38A 4GBXB 2HG0A 2GJRA 1K4CA 3RGVB 2R2BA 4G7YL 4WEBH 3QAZC 3U4AA 4KKAD 2X5PA 4F7PB 5KBNC 5TF1L 2RMNA 2XWBB 3MRIA 3IJSA 4XBPB 2V7NB 1AO7D 1BG9A 1JDAA 1LO4H 3L1OH 3WMQA 4IW4C 2DYSB 3GSVA 4JGJA 2YHGA 1A7RH 1Z7JA 2NY1D 5DMIH 4ZW8A 5D2NB 5D72H 1HKFA 1N26A 1MFEL 5FKAA 4AC4A 3JV4B 1ZHBA 3VYPA 1Z32X 3ZBMA 2WB7A 3MLTA 3QB7C 3ZTEA 1CUOA 2ED8A 5EO0A 3P54A 4MSWA 1VEMA 1WC7A 3H7BB 5JZ7D 1DBJH 1UWEL 1K8IA 5F7LB 3QXWA 3X14A 4DGYH 3PWPA 5GJSH 5JUEL 3T0EC 2HTKD 1QHOA 2BSCA 1B9ZA 2EIDA 25C8H 4AQZA 1QQDB 1XIWA 3GTTA 1FLRH 1FNSL 2XPZA 5LJYH 4KDVA 4XNUL 4D9LL 2A3TA 2IFFL 1LO5B 3U30C 2OSLB 1H3XA 2Z64C 1JZ7A 3LRSA 4WKZB 3HPJA 5ANMB 1ZDQA 4BQ8A 1KN4L 2OJZL 3WY3A 2AEPH 2VXQA 5FCUL 2IQAA 4AJVA 5BV7H 3MBWA 1A2YA 1NAKL 5AB1A 1JV2A 2JF1A 1D2PA 2X2YA 5C0GA 5D1QB 5HHNB 2APBA 1NCCL 4DK3A 2BC4B 4P46C 2QR0A 4Y7MA 4OH2A 3O6FB 4PIBA 5C08D 3O3DB 1OGSA 4JN2A 3OR7B 4JRYA 3EUDA 3CHQA 1OTSC 3HZMB 4YHIB 1OP5K 3MJ7A 4YDMA 1CTMA 2P5WE 2YEQA 4JFEB 5AB2A 5E7FA 1AD0B 4I9WE 4MKTA 1E28B 3QUGA 1NKOA 5SWZB 4M6MH 1E4XI 2VSDA 1NBZA 2AMUA 2NY4B 3JVFC 4LFHD 2Y7QB 3V4VL 3NJVA 3TPKA 2HFFB 4U1GC 1AHWB 3ZIYA 3VAEA 1ZA3A 1DEEA 2R1WB 2J7LA 3WJJC 2UZYA 4F9PC 5F9WC 3DSFH 4JR9H 3OHXC 4NKMB 2XWDA 4QUOA 5EOTA 2IGTA 1FHNA 4XPAL 3I02B 3ZDYE 3LN4A 4PJFB 1LO0H 5C0BA 2CO6B 4PBVC 3CSYB 5K9OB 2GJ6B 1P6WA 2M2DA 4LL1A 3VXTA 4B9KC 3K6SB 3WG7B 4HA1A 2JJUA 5K69A 4AMKL 2R39A 4EUPA 2OMTA 4Z3TA 2VDPH 4ZQTA 1PZ3A 2AFNA 5LVEA 2KZWA 1QTSA 1JXJA 1LTXA 1ZGLM 3HTLX 3ETSA 1TQVA 1G7HB 4RNRA 5DD5H 2XVGA 4PP2A 1JZEA 5E8DH 1FZOB 3AB0C 4UT9A 5AKVA 4PLKC 1P7BA 3B5HA 2ZOLA 3DMMC 2ZD0A 3N85L 4AEEA 3TH3T 5KSBB 3I9GL 5GRWA 3TBWB 5TE7L 3VXMA 1L6XA 4ZW7A 3C2AH 3TBBA 3VXRD 4H88L 4GKSB 3BAYA 2H26A 5JHDB 1FI8C 2VUOA 1NM4A 3LSOA 5E4EB 5K1JA 3S98A 1UYWH 2P8MB 3QDGA 2PPFA 2E59A 3PGFH 2ZOKB 4P5TB 5KSVB 2D0HA 3BWAB 2FR4A 4KUZL 1KXVA 2VABA 3C6LA 5FUCE 2VJ8A 4M8RA 1F6AA 1IFRA 2LLNA 3U4EB 4YSOA 4M5SA 2X88A 4U1NB 4UINL 5E9DD 3SBQA 4AEHH 4NKQB 4OZIA 1GAFH 1OY3B 1IAKA 1OTTD 3LZLA 3D9AH 2YAMA 3F5WB 1B0RB 3G08A 1TG8A 1USQA 1IILE 4PVBA 4OZ4B 2X4TB 4BXSV 1JFHA 1INQA 3QZNA 2EYTA 3OKKA 2Y36L 3T77A 2FEJA 3DX7B 4HWEL 4LP8A 4JL2A 3MDJA 1BP3B 3QCVH 5TGBB 1FIGL 1Q0XL 3FO1A 5H37H 2F8XC 1V7NH 1KEML 1NSNL 3V6ZB 1KZYA 5D8JL 5TF0A 4EI5A 4PJAE 2DJMA 2IXQA 1M1SA 1YEKL 5DFWH 1M7DB 3STLA 2XZQL 3VD9A 4FGMA 3QEQA 1ED3B 3DA0A 5E0FA 2ICEC 3U7AA 1CTNA 5CEXA 2WWNA 1PPIA 2BY3A 4X98B 5FK9B 5C9KA 4W81A 3VFGH 4UIKH 4GRLD 4CN4A 3PDOA 3QWNA 4XBEL 5I75B 1EXGA 4OJFH 5IB2B 2MTPA 1I8AA 1ETA1 4UDUA 1KYUA 1FCGA 3QPXH 1BLIA 3T2LA 3U7WH 3OMAB 2DTMH 2Q8AH 3WIHL 4JHAL 5LDUA 3MROB 3OJDB 1MIMH 4R7XA 1UKSA 4K7FB 2AQ2A 1KYOK 2EINB 3IMWA 5DUPH 3SGKC 4XR8C 3O6KL 1L9PA 4DP2X 4LRNH 3BUPA 3UBXA 3GXUB 3Q8CA 4NZFA 3QUMA 1YCSA 3MV8D 5E03A 4GI6A 2N4IA 2DS4A 2Y7LA 3BO8B 4YDIH 3ZE2F 4HHAA 2A9BA 3FONA 4OUOA 4MTMA 5HHXL 4L4VD 1MVUA 3BPOC 1OOAA 3GJFA 4Z7VF 4CMMA 3Q06A 4PRAA 3FTZA 4HKXB 2VR5A 1RZ7H 3H9HA 1EEZA 5I0DA 2GTWA 3K2UH 3AQXA 2WZ0A 1IQDA 4OLZH 3UXFA 1KTBA 2K70A 3U4BH 5HJ3A 5SWQB 4HX1B 3TF7C 2X4NA 3P11H 5E1QA 5LKNA 2VE6A 4BDVA 5SX4I 4TSCL 4X4YA 5EU4A 3UTOA 2ROXA 3WI9A 1QW9A 5IG7A 4A6YH 4AIEA 4ZUUB 5KG9A 5KUKA 5T33L 4RMBA 4NWUH 1NANI 4N8CH 1G9NL 4RMTA 3T0XA 2AC0A 4IKKA 1VLXA 5I82A 3VI3E 3ZUNC 2CBQA 4LVEA 3C5ZD 3CFJB 3FO2B 3O4LE 3LNEA 3IJ9A 1NINA 4ZD3L 1P7HL 1Z3GL 4MQXD 3EDKA 5EU7C 5SWSE 4PWGA 1JTOA 4RRPA 5DLML 1ZPUA 1KCVL 3RVWC 4XP9H 3VXNB 3GHBH 4J5VA 3LXAA 4ODUA 5DJAA 1EMTH 4NERA 2EE3A 3MLVH 1RUML 2XYBA 1YEIL 3CN0A 2OYKA 4JREB 5E1HB 3PIQB 2Y25A 3NJHA 4OD1H 3WNPA 1ZGLA 4UV7L 3RWFA 2A74A 2FATL 4DP7X 3FB8B 4MA1C 2AXWA 5CCJA 1NEUA 4S1SL 4JQXC 4V2CB 4BA0A 4GXUM 4ODWB 2V2WA 4OJCA 1ZHKA 2NY5H 4GO9A 1J0JA 3BDBA 3QXAA 1YEJL 5DFVD 2FECI 1ACCA 2UZXA 4YSTA 3TTYA 3VA6A 3LKRB 4NAMA 5AD0A 3B7TA 3D34A 3FOLA 4ELKB 5F88A 3WE6B 3Q2VA 4WI2A 2P5WD 5AOLA 1AZBA 1MAKA 3SPHA 4PJCE 3MRRB 5T1JA 1KYDA 2XIBA 4I9WD 3V10A 3BUDA 4XAWL 5BPPA 5DTFA 4DPRA 1I3UA 3OG4B 1S7SB 3VGAB 2CLZB 3C60D 3KG5A 3RX9A 4BHUA 1D5ZA 1BG1A 3OB0H 4D7PA 1YEHL 3G9VA 5DRZB 3UADA 2X44D 4RISL 1Z5HA 3UCQA 2XFXB 4LVNC 4WENB 4JM4L 4JFWA 4PS4H 1ZT4A 2Y7SA 4PJHA 4NZUH 3LMJH 2RACA 4KQ0A 4M93C 3QUZD 4S1QL 1KJ3L 3FYIB 3B7RL 3NT0A 3WV0A 1IKFH 2XCMC 2BRRH 3EHBD 3CQPA 4HCRH 4F58H 1LO2L 3NCYS 4GEJA 4BQBA 3ZHLA 4Y1TA 1FGNH 4WW2F 1E43A 2AK4E 5PCYA 5GRXG 1FO0H 1ESOA 1IM9D 1GY2A 2E3VA 1BZ7A 2GY7B 3L95A 4Y2DD 5LXGH 3RFZA 1Z5LB 2ED7A 4JFDD 1L7TL 3K0WA 3SIKA 1M05B 1MXGA 5B1JA 4EVNA 5ADPH 3H0TA 8FABA 3SCMD 3UO1L 5CIPH 2VO8A 5C2UB 3WJMA 4NNXB 2CKBH 1DJIA 2O5XL 3EO0A 4NJ9L 4QXGL 4G72B 5TE6L 3NA9H 5BRPA 1D5BA 2YRZA 2YA2A 2I60H 4TQ8A 2DAVA 2WO3B 3T3MF 3SPVA 1H8OA 1Z3RA 2NYZA 2ZWSA 5DMGC 4GH7B 3V7AG 4CW1A 3B2PA 5DJ6B 5ICZB 4KRMB 1XD0A 4R4BB 1A3ZA 4LOFA 1ONQA 1DSWA 3MV9D 3W9DB 1WLHA 1SUHA 3U9PH 4NS0A 1M1XA 4WW1A 4YLQT 1VFAB 3B9KA 2MOQA 2JELH 2F74B 3SY0A 5LGKA 1BMGA 2X6BA 3OLGA 3C8KA 2IOMA 2J73A 4RSYA 3CK0H 4ZYKA 1TF4A 4JG0H 2WKOF 1TJHL 5T1KA 1BMWA 4PU2A 5E95B 3VFTB 4IRSB 1SJVA 2QKSA 3FCUB 5I1IH 5E8EB 5I24A 2GVYA 4Z8FL 4TUUA 4XN2A 2J8UF 4LKCB 4A6YA 1FL5B 4L8SB 3UPAA 4KXZI 2G3MA 4DP4X 4HC1A 4M3JA 3ARED 5D1XC 5F7NC 3TFBA 4N2IA 5IV2B 1I8KB 5IQ7H 1MCLA 3BP6A 4O02B 4F33A 3U9UA 1FQ9C 3FFOA 4FZ8L 3I6SA 4MD0A 3KLAA 5JHMA 1RIVH 5EN3A 1OQOA 3FQRB 1R75A 2AQRA 2CO7B 2X05A 1E6JH 1JFQH 1NC4D 4OLEA 5C09E 5ADOL 5FC9A 2OMUA 1AIFA 3G6JB 4U6VL 5GGQH 5KJRH 1OTUD 2DTSA 1PIFA 2VLJE 2YXVA 1KWKA 1RPUA 1QLRA 5D6DA 2D4FA 2QSVA 1ID5I 2YKLL 4IKLA 4MB4A 3FT3A 3PWNB 5HP5A 2EDEA 4Z7QF 2YA0A 2DD8L 1U8CB 3VJ6B 4GKZB 4M8VA 5FO9A 2VLRA 5MERA 1KJVB 3RKPA 2RHEA 3ARFC 4HUCA 3W9EB 1F41A 4OFVA 2X89D 2ZUVA 3PWUA 3WFZA 3WKQA 3FTWA 3KNBA 3LEXA 1URLA 4WFGE 4AI7A 2EDRA 5LGHH 1JPGA 2VZUA 4O4YH 3FO9A 3IAGC 2YSSA 5CHNB 4BQCA 1ZA6A 3MJ6A 4PLOB 3WNNA 1XTLA 2DWEB 3EYSL 1EHAA 1TTRA 5EZOH 3OKDA 4Z78A 1U8KB 2C1PB 3K72A 3NFNB 4P23C 4XXCC 3T04D 3FB5B 3ESNA 5DMKA 2R9HC 1M3JA 1ZLVK 3FU8A 3L48A 3TFKD 4Z0BL 4GRLB 3BUQA 5A3IC 1U8QA 4EDWH 1GOHA 2M83A 4I0PD 3L9RA 1G0XA 2KQMA 3OKNA 4FERA 3ZDXB 4QXUL 4YDZA 3U7YL 2EABA 5F3HB 3QRLA 4Z7UB 2V8LA 2B7DT 2ZCKH 3KPOB 3N40F 1I7ZA 1BQSA 1RIHL 4ONFL 4P2OD 1FFPA 3IBEA 4JKPH 2PMZA 3AT8A 5DD0H 2Z31A 2Q1EA 2HLFC 4M7LL 1FZJB 4HCRA 4O5LL 1AZVA 4YXLL 4PSPA 2AJVH 2P48B 3MV8B 5DJDB 5LG6A 4HBCL 3A4AA 4R9HA 5LWYH 4LOUD 3APCA 1UM5L 3TJPA 2IG2L 4RWYL 5MHSE 4L4VB 3MRQB 4XMUA 3QE5A 4JG1L 4ZW6A 5EO9A 4KO5A 2JB6A 5SWSD 2FNBA 1D6VH 1PZ5B 4QRAA 3STZB 4U1LA 1UFUA 1VCAA 4QOKE 3VACA 2A4CA 3EO1B 1LDPH 2MJWA 4Y89A 5AVQB 4XCYA 3GRGA 2IF7A 2VISA 4LEXL 5HDQL 5IOPA 5J6GB 2BSTA 4BV1A 2K1MA 1QMUA 3NBNA 3D3VA 4A7VA 3NP4A 5D7JC 1UKTA 4JE0A 3UMNA 2ZWKA 5E94B 1EZVX 2MRYA 3CDCA 5IM7A 1ZJBA 5FUZH 2GQHA 4R0LC 1AQDB 3FOMB 4J3OF 1JWSA 2QELA 4MASA 2X87A 4E0RA 1Z2KA 4Y2OB 3CGTA 5FHAH 3QQ3A 1CXLA 4GUPA 2AF2A 4Z77B 1A7PL 2VXTL 3BSZA 4YFLI 4F7CA 3D06A 5HSFA 4QD2E 1MFNA 1C5CL 4NQTA 1COBA 2ZUUA 4M9OA 1YPZF 1Y07A 1TEYA 3VRJA 5D5ME 4KK9C 1Z5YD 3TN0A 3BD4A 1PKQA 5EZLA 3OM3B 4ENED 5L2KA 3UC0L 4I5BB 3T4YA 2EKJA 2R0LL 4QHPA 1CVSC 2ZX7A 5KYXB 1OD9A 1PLAA 3W39A 3IDYC 1NBVH 1R3KB 4Q56A 5HTSA 1SNRA 4N8VG 3FS9A 1UZ8A 1IGYB 4XCEA 4FTVE 4G6FD 4G83A 3VFRB 4WGVB 4XP4H 4WKXA 1RUQH 4NUJB 4OF8A 1WP6A 4PJ8C 2DQUH 1FNAA 5DJZB 2WD0A 2OP4H 4I3SL 3ZZSA 3TPUB 1FZKA 3KYKL 2V3DA 4CKQA 1ILUA 1CFVH 4YJZL 5GGRY 4OLWL 3R06B 1AZRA 1RP9A 3MFFB 1IC4H 4RBPK 4C4KO 1IE5A 3KPTA 1J05A 2X3BA 1A1OB 2AXJA 1WFIA 2IH9A 1YZZA 4OF6A 1UKQA 5D7EA 5ICYA 5HI4C 4AM0A 2TAAA 1C16B 2JNZA 5AW1B 3FFCD 2X1WL 3JWNC 2NRDA 1XGZA 4B27A 4IDJH 3L8QA 3P30H 3FU3A 5IMKA 4EIBA 5FECA 1OXYA 1W72B 5DT1L 4I0KA 3DROA 2CRMA 2DQGH 5HI5D 2ZPKH 5GSVA 2HFGH 2X2JA 4UB0H 5C07A 3BZDA 4K94C 3HAEG 5CGMA 4X7FC 2WXGA 4WTQA 1QSFE 4WEMB 1R9FA 4IU3A 1URZA 3ZYJA 5IEKA 1U58B 3UBFA 3LZFH 5EUOE 3HC4L 3IN2A 3NJJA 1HNGA 1SVBA 2ZUQC 2P45B 4NZTH 3ZDYB 4CADB 4ZFGH 3FQXB 3EHBB 1G7MB 3I6KB 4J3OG 1QHPA 1BF2A 2EDNA 3H56A 2FJGB 2E9JA 4H8VA 4TTDD 2QJDA 1FFOA 4X9GA 3V5KA 4DGVL 4MDJB 4X80L 2ICWA 1D7FA 4IGBB 3QORD 1CK0L 2JXMB 3F7RA 4Q4IA 3SO3C 1IV8A 3E80A 5E8NA 4EI6A 1IBYA 1GCFA 1ULVA 4TVUA 2O26U 2XRAL 1HVXA 3RGVA 3SGDH 1FE8H 4K8RL 5AG8A 3FU6A 3UZEA 5EIIG 4F7PA 2QEJA 1AHMA 2XWBA 4WIQA 4XBPA 2V7NA 3BWUF 4M29A 3K74B 2EO1A 2WB1A 4BE6A 5C09D 3U46B 1CLOL 4H8WH 2QKIB 4MXWH 4X7EC 5D2NA 2QSTA 3RWDB 1GL4B 1TSHA 3AGVA 3JV4A 3D0AA 3CZJA 5E23A 3S96B 5MEQB 1A9BB 1IAIM 3OJ2C 4L8BB 2EADA 3H7BA 3U82B 2AI0L 4WDIB 1XSJA 4Z3GA 1KBKA 4GI8A 1KDJA 3QFJD 5DD3H 2MCMA 2DDQH 3FCBA 4V1DE 2ESVE 2BDNH 1R5IB 4MZ2A 1QQDA 1BZOA 1A9EB 1U3ZA 1JGLL 5HGAB 1ASQA 1E4XL 2J21A 1HXMB 4XNAA 4WFGD 5A6IA 5TDPB 1LO5A 2OSLA 1WAEA 2WXMA 4I8DA 1P2CA 5FW8A 1IAIH 1OD7A 3OAZH 4U1HB 4WKZA 5ANMA 2LU4A 2E5EA 4M1GL 4PJAB 4R97C 3NSFA 5FO8B 1XR8B 4U4IA 1N8OE 4PSRA 3UJJH 1RERA 2DMHA 3OAYH 2BP8B 1PEZA 4CC4C 1D6EB