2LR4A

Nmr structure of the protein np_390037.1 from bacillus subtilis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
128
structure length
128
Chain Sequence
GAEALPLYYLQITGITSDGNDFAWDNLTSSQTKAPNVLKGNKLYVKARFMGYTKLTVITGKDGKNLLYNGTAKMFKSDAILGQNKVVIGWDKYFEIPMDALQDNSIQIKALSSGTTFVYSQKIDFERE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the protein NP_390037.1 from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords SPBc2 prophage-derived uncharacterized protein yolA
total genus 18
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16219 DUF4879 Domain of unknown function (DUF4879)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2870 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2lr4A00
2LR4A
chains in the Genus database with same CATH superfamily
4NWUH 2AQTA 3V8CA 5B7EA 1RIVL 2M8XA 3EO9L 2H9GA 2VM4A 3KLLA 1A7RL 4OZHB 4DW2L 1E5CA 4KJWD 3FUKA 3OAUL 2K4AA 5JHAA 3FTGA 5DZOA 1N19A 5E5MB 2JLLA 1F3JA 5I5MA 1SNRA 5FYJL 2PF6A 3RWDB 3DBXB 4OGXL 2F54D 2DEWX 3EHBC 3BP5A 1RZKC 2P46B 4FI8A 4FQJH 4DQAA 3FO0L 5TF1H 3EFOA 5T3XE 3MLVL 3RHWF 2CR6A 4K5OA 1G7LB 4YDLC 4MNGB 1JGVH 1INQB 2WOYA 3IJHB 4PJBB 2QGBA 2XTJD 2E7BA 3L7FB 2L7UA 2A4CA 2RGSA 4ZMWA 5AOLA 4EI6B 3MV9A 3DPBA 2FUQA 3OG6B 1NUGA 1BYNA 3N44F 3FSWA 3N0PB 4MDIB 3CU7A 4F27A 3D2UB 2XTSA 3BUIA 5CZKA 5AVZB 4YXLH 2AK1L 4O51B 3AWFA 2ARJQ 5TDOA 2BNQE 4PJGF 2X1OA 4JREC 5KG9A 1X5LA 1AR1B 1UATA 2AXWA 5DVOA 3OR6B 3TTYA 5IP4A 1HL9A 4PJHA 3UTSD 1FLRH 2Y07H 4GT0A 4UDUB 2R7EB 4OF0A 2X0UA 3SE6A 3SE9L 2OMNA 4ZX3A 3OWEA 1WZ1L 3AQDA 3WFBH 1SBSH 1PDKB 2ZQKA 1NUDA 2D3VA 2DQHL 4F37K 3T5WA 3TNMA 4P23C 3VG9B 1D7BA 1P1ZB 4NB7A 5FV1L 3TASA 3V6OA 1DJXA 2X38A 4QO1A 1K72A 1XR8B 1E5ZA 4LHUG 3CLEL 1I85A 3VI3E 1MI5D 1CZ8H 4KKRA 1OCOB 4WK2B 5KSUB 1KBPA 1AD0A 1GGCL 2Z4TA 4G8AC 4LNVA 3T3MF 5GIRA 1VKXA 5EORL 3MLZH 2C1PA 2BCMA 2H2SC 1BGXL 4M61A 3O11B 2P24B 2Y07L 4AEIH 3MR9B 3T77A 4AWJC 3RGVC 3MR9A 3NSYA 3EGSB 4LGSB 2ENPA 1VRSA 1WIPA 1QRND 3R4DA 3O45B 2V33A 3T6ZA 4X9YA 7PCYA 4OCRL 2HP4A 1URIA 1FYTA 5E99L 3VMPA 3W39B 3CN0A 4XPBH 4YHOH 2DWYA 4JQXA 3VMNA 2VDOH 4LHQB 1EEQA 3S2CA 1AZNA 1EAQA 3GJEB 4UM9A 3W11C 4UAOB 2CNYA 3BMWA 4OFYA 4M43H 1AGCB 3IEAA 4CUCA 1F2QA 4Z6AT 1IO4C 5JIDA 5INDB 4RGOH 3D69B 4JFZL 3ISWA 3B8SA 5I0DA 4P4RB 3PAZA 3L4CA 5J13C 4X9GA 5HVHC 5L8KB 1HL4A 5E6IA 1ZV9A 3T0EC 3KYNB 3LN5A 4HUXA 4RRPM 5EO1A 4ZS6D 3VA2C 5CF3A 4M1DL 4XNYL 1AACA 1LYQA 4PGCB 5T1LA 2N7AA 1KBKA 5IMLA 4ZSOE 1HX0A 2ATAA 1TDQA 2EINB 1VCAA 4A38A 3EBHA 4FKKA 4AYEC 3UCRA 1HE7A 4URTB 1G9NH 1NCDL 3FTYA 2ZOLA 3BVNB 5EFIB 3RUGE 3L1OH 2MOQA 1ZVYA 2Q9OA 3HG1E 3L9YA 2JB5H 3TJEL 1OSPL 2FYVA 1KN4H 1T03L 4ZMPA 1KLUA 3GD1C 2EVHA 1UH2A 4QRRB 4DAGH 1QBLH 2JQZA 5C0FA 7TAAA 2DH3A 4AYFA 2Z8RA 1OLZA 1S7QA 2BSSB 1OM9A 4AVIA 5D7JD 3APMA 3BN9D 3HOGA 2DI9A 4FE9A 5AYTA 5LNEA 1Q9LA 3QUMA 4ZOEA 1K5WA 2Q6WB 3EF4A 1JD7A 1ODAA 3IBEA 5LLIC 4PGEB 2AJUL 3W9EB 4A63A 1NFDF 2BVEA 3G5XA 5KUKA 4UNUA 1MCWW 3D9AH 5IHZB 1X5YA 3MRKB 4I3RH 2BSED 1JOIA 2NY0D 2N7SA 3ROLB 3HI1A 5IM7A 2JJVA 2QTVA 2OMBA 3OGCB 4XOEA 5AQ0A 5FLVA 1PG7H 3MV7D 3DGDA 3QUXA 3RUGF 3HRPA 1WE5A 5IMMB 3CSBA 4TQIA 4X4XB 4OCWH 4MQTB 4JMXA 1YQVL 4I5BA 3B1UA 2Z64C 3ZMRA 1G6RA 2HFGL 1QAWA 4MWFB 3NP3A 2ETWA 2MQGA 1GZQB 4ZFZB 2VDPL 1RD6A 1KJ2A 2WXQA 3QWOA 4MB1A 5TE6L 2QZQA 2J8OA 4P2RA 3ES6A 3WNOA 2PXYD 5C0BB 3SDAA 2FB4H 5ELIA 6PAZA 4FEIA 5AAMA 3EJZD 3QAZB 1IILE 1NMBL 3WUZA 4FQIH 1CLOH 2ZUWA 5E5RB 1LE5A 4OZIF 1EDQA 1RUQL 1KLFA 4BH8B 4HYTB 1ET5A 4B96A 3AITA 4QXVA 2K6ZA 5DF0A 5A2JH 2X6VA 4XNAA 4FP8H 2L3BA 5KYYA 3G7TA 5FEBA 1VFAB 3EOAA 5F7EH 4TVSa 4X0KA 4YPGA 4Z7VF 1FH5L 4R7LA 2VXUL 4NZUL 2EH8L 2YK1H 3SDYH 5I1DB 5GGRY 3V5HA 3GSQB 3HC0A 4M62H 1WK0A 4LLAA 3WD5L 3MV8A 5CZXD 3MLSH 3CVHA 1J1OH 1UC6A 3CV5A 3B7TA 4G1MB 2YAHA 4KC3B 3SB3A 1CO1A 3Q6GL 5TDPB 1B0WA 1C1EL 3L45A 5BPPA 1TOXA 5AKRA 2VDRL 3D85B 4LCWD 1URZA 1NBVH 2P28B 4GS7B 4KO7A 4ZPTB 4OGXH 4KWUA 2LLLA 4Z77A 1FNFA 4UOW1 4A7GF 3GTNA 2FIRT 3T1FB 4DAGL 4LPYA 5JPNB 5KSAD 3QXTA 4P46A 3VVWA 1CR9H 5ES4B 4YNYA 1YMMA 1XX9C 5GISH 4WVRA 4PV8A 1KWKA 3LB6D 2CBMA 2VO8A 1P2CA 3EOTH 1YC7A 3TURA 1JXJA 4POYA 1YN7B 2DLFL 1U95A 2NXYB 2NR6C 3KHQA 4U1GB 5JW3H 3LQAH 2MCPH 2BY0A 1A3RH 3BWAA 4KKLC 3ARDB 5A2KH 4K5NA 1WJ3A 2WBJA 3KCPA 3DOIA 3O2WH 3OJMB 2XWCA 5FDYA 2IH3B 4KKQA 1A7NL 4V11A 3C9NB 1TO4A 2HVKB 3GSUB 3STBA 3VGAC 4BA8A 4CC1A 1NIEA 5H35A 2JJUA 3VYPA 3KPSD 1SHXA 4TVPL 4BRJA 5ILTH 1CQKA 3KWTA 1ZA6A 1HCVA 3V2AR 3SDDB 2H32B 2EE6A 2JQAA 1YNTA 3IVKB 5E9DB 3C5JB 4LDLB 3CSGA 3RX5A 4JAMB 2EEAA 4A2MA 3LN9A 1U2YA 3ABLB 4LPCA 3DVIA 4O4YH 5TDPA 2PW1B 4IU2B 4WNQB 2GJ6A 4UT7L 3R0MA 4MSWA 4PU2A 3VH8B 4LCWB 3P73B 1HHIB 4WJ5B 1RCYA 4JFPA 1I1AB 1MCIA 4WFHE 5DK2A 1OAYL 2KL6A 1KELL 4BELD 2ODHA 2UUDH 5C0CE 1UEMA 2YRPA 4UT6L 5HHPA 5AW0B 4KO6A 1QSED 1AGFB 2ALAA 3GXUB 4RSVA 4YDIH 3UAFA 3ZDZB 2EIEA 3ESUF 1W0WB 5DLML 5F3BA 3AROA 1LO5A 1QFWH 1B4TA 4GMSL 2PYEE 4MS6A 4ZJ9A 4GKSA 4X6DA 4O9HL 1KCSL 1JERA 3HUJA 1UA6H 3LJ3A 5E2WL 2WLIB 4WFFE 4M02A 3MA9L 3OR7A 2YO3A 1U6AH 4N87A 1LWHA 5C3LD 1XXDC 3BEVB 2XWDA 3NIDE 4HXAL 3ES6B 1DQML 5DHEA 1OP3K 1QFPA 1EJFA 1JGLH 2DQGH 2VAAA 2ZXCA 3B9KD 3EADA 3OHXC 3MLXL 4YVUA 4W6XB 3P1VA 3CE1A 4CGTA 4M7LT 1PYWA 1E4JA 3A21A 2B0SH 2BJML 1PZ5A 3NZUA 4M9PA 5I8CB 1QACA 3I6LE 2VDQH 3FT1A 5FECB 3KJ6H 2OAAA 1U4EA 3D6GA 4U33A 4X42A 2YPLA 4DP2X 5F8RC 1SUJA 1F11B 5CGTA 4MQXD 2QQLH 3V52L 4ZMVA 3QEGL 2HUHA 4N2MA 3GMQA 3BPNB 3BGMA 3KDMA 2CO6A 1I1YA 1QQDA 1UD5A 3I74A 3IGAB 5CS7A 1BZ7A 1H15A 1YPZB 1KIPA 4L8SA 4HJUA 1HXYB 4TVPH 1C5BH 3TO4B 4LOUD 3QHFL 3WLBB 5DURD 5JW4M 1AGBA 2WYTA 3TF4A 2ODIA 2HN7B 2YPVL 2V2XA 5B39A 1MDAA 3AG3B 2APWA 4J6IA 2AJUH 4WGWB 3GXFA 1JZHA 2UWEF 2X7LB 4IBZA 4RGNB 3GMOA 4TSBL 5KANI 1MCFA 4L05A 4S1DD 5JTWA 5C0JA 1NZRA 1BFTA 5DMJB 1UHVA 4HHAA 4HCRH 3REWA 4G7YL 4XMWA 3TZVD 4WKXA 1GW0A 3WSQH 5EEWA 5CMAA 2VGLM 1AYRA 1WIUA 5IVXF 5HHQB 4BZ2A 4PGCA 2VR7A 5K9JL 3TCLA 3A6BL 3WUWA 4PCTA 4FNPA 3B6SB 3SGKC 5IQ7H 1OB1B 3BGAA 1JNLH 3ZJAA 3VD3A 4Z8FL 2AQNA 4UOJA 4EN3A 4PJAE 4QOKB 1QFWM 2YARA 1C5BL 1ZVHA 2KPWA 2NTFA 1MI5A 3F01A 1A1NA 2NUPA 1P7KA 2K70A 1HCFX 4X7FC 1NGPL 4N9OB 3QJXA 1BXVA 2F8OA 4GEJA 4ISVA 3ZKXC 5CCGE 3FO2B 4XBMA 2DBLH 1GKOA 4PRIB 3VRLF 1IGTA 5HGGS 3SDCA 4MMZA 3VGBA 4BZ1H 1BLNB 5K1VA 1KFAL 5FC9A 4XP9L 2NT1A 3S3DB 1XSIA 2YUXA 3UP1A 4CW1B 3IU4H 4M3JA 5C09E 3UTPE 4KDWA 4WIQA 1XD0A 4YFLF 1ZT4B 1DQMH 3FOMA 1BFOA 4F3FA 1NH6A 5A43C 4FJYA 1YCSA 2OYMA 1WV7T 1BD2D 1H6TA 1X3DA 2OZ4H 4ODHL 2GSGB 5DYOA 3TPKA 1DHKA 4YUEH 1T0MA 3IMVA 4PJEA 2NY3D 3MV9D 1R4XA 2VN7A 3SHSA 3N2JA 4KU1A 4RX4D 1TJXA 1H3XA 2ATPB 3ZKMD 4HK3N 2QJDA 5HHMD 3REVB 1ORQB 1M7IB 1YEHL 3CHSA 3HJEA 5ICYA 1FIGL 4PY7A 1PDKA 2NUPB 5DD0L 3LKSA 3WKQA 1PQZB 1UA7A 1EQWA 2NX5A 1JUFA 3BSZL 2OTUB 2VDQB 4NN5C 5EO9A 1VZHA 3FQYA 4UMSA 5D1XD 4CILA 4AVHA 3ZL2A 1P9MA 2IWEA 3GO1L 4HEPG 2VLRA 4KKPA 5IB4A 5AOZA 5DA0B 2HZHA 1WTGT 3HB3B 5CZXC 4JZJA 4ZFOB 3L3HA 2Z92B 3JWNH 4LU5L 1QKZL 2YEVB 2YD3A 4XNXL 3ULVC 1FO0H 3K3QA 3BKJL 4S1RH 1AQKL 1T7YA 2WTOA 3JWOL 3GMOB 1DANU 5BXFA 1OAZL 1N0XH 2DMHA 2X7LA 3MRFA 3PFUA 5E2VH 3ETSA 5CEYB 1E4WH 1XGPB 5D70L 3RPIA 3N9GH 1G7PB 3F7QA 4LE8A 5EC2A 5B3SB 2DQEL 1R6VA 2J1WA 1NIDA 5DRNB 1T20A 1JRHH 1RZ8B 1DYZA 2R23B 5ETUB 5JHLH 4LEOA 1OW0A 3ESPA 5TH2B 4NN5B 4BHUI 3GPEA 2J72A 3TCXA 1IRAY 4NBXB 2CUAA 4F5CE 4OFKA 1D6EB 1F3DH 2WLZA 2PCFB 4CN6A 3BP5B 1H19A 3QPQD 1FLTX 4JANA 3QUXD 3W5MA 3O2VH 3GSNL 2IGFL 3BE1L 1NCGA 3BPLB 4G9FD 4I3GA 4AC2A 4UNVA 4ZZKA 4M8UA 1RJZB 1V7NH 1WDAA 3QT2A 2R4SL 4Z9KB 1IKFL 5TDNA 4CKVX 1NAMA 1ZGLM 3F12B 5HHOE 4XCYB 3EBAA 1EO8L 2XFXA 2Y5TB 5H4YA 1L4IA 2W91A 1M7UA 3E2HC 4XMPH 4NPJA 3U4BL 4FTVB 5ANME 3QZOA 2QQKL 4L3EB 5HJ3B 2ISDA 1KEGH 3TFBA 1KCLA 1IGIL 2P26A 3DTUB 1U3YA 2NDGA 1FGVL 3M07A 4LOFA 4Z3HA 1RPUA 4DP0X 2DQFA 5FFOA 1OT4A 2NCEA 2P5ED 4RAVB 2E9GA 3O0RL 3L48A 3RWEA 1PIFA 1PEZA 4BDVB 1HHJA 1PZ2A 4G6JH 4KNTA 2BVYA 4ZX6A 2CBPA 5HYIA 4ZDHA 5ID1A 3P0VL 3KLAB 2I25N 3B6SA 4G6FB 5CD5D 4XP1H 5CHNB 4ZSOB 2CIKA 5EOTB 4TYUA 2WUBH 1AGFA 4UT9A 3T3PF 1X7QB 2BP0B 4AQ8A 4OZIA 2ZX5A 3E80A 2BS9A 4HT1H 5KJ4A 4KX7A 4XO8A 2HKFH 2HT2D 2QQKH 4E0RA 1D5MB 3U4EA 3MUGA 3X14A 4ZUWB 2VLKB 4Z95H 2YXFA 3NABH 3WIHL 5JORB 4HX1B 1I3RB 1E4KA 3NH7H 3PAYA 2VR9A 2CGYA 3ME0A 5KN5A 4L23A 1SQMA 4BSVA 3CFEB 4KZCA 1FL5B 4D9QD 3UPRA 3WD5H 4WU5A 2PW1A 4IU2A 4E9QA 2HLEB 2AQPA 2BINA 1MZZA 3VXSE 4Z7UB 3IGUA 3MI6A 4P2OB 1I1YB 1M2OA 3IGAA 2Q8AH 3IVKA 1Y6MR 4I85A 4ZUVB 2QQLL 1MSPA 3UP6A 1YYCA 3DHPA 2DTSA 3H9SA 1Q9WB 3EYOA 1FFQA 5DZPA 3V7MA 5EA0H 5C0EA 4PRNB 1F4XH 4PSPA 5AVQB 5IROC 1CR9L 4M9OA 5D2NC 4LCVA 1A4CA 5MHSE 1YJDH 5L9DH 1BQHG 4X8JB 4XNUL 3PG2A 2FD6H 4KJYB 5FOBA 5D5ME 1QYGH 5D7SL 5ABDE 1XCQA 3NCMA 4R5VA 2E76C 5HBBA 3ZHKA 4RMVA 5LVEA 2XG5B 3VGAB 2VLJE 1JPTH 4OSUH 2Y7LA 1KIUA 1C08A 3KPRE 1TZHA 4FLQA 5F2FA 4Z7NB 1UGKA 2EO1A 2AEQL 4KQ3H 1LD9B 2EILB 4IRSA 4NKIL 5GS0L 3BAIA 3DX8A 5EPMB 1P6FA 4QD2E 3GFUA 3QZLA 4X6CF 1YEGH 4X98B 4HEME 3T3ME 1T03H 1YYLL 1K9TA 2VLLA 2LU4A 4G8GB 3B8YA 4GO6B 2WZ5A 4IEFA 3GHEL 3PWLA 3GBNH 3FUFA 5I1AA 5CBAA 4WF7A 4W4OC 4MQ7A 4OI7A 4LCWA 4WI5A 1YG9A 1LWRA 1JP5A 3EYSH 4OY9A 4Y1TA 5DEJA 4N5ED 1L6XA 2DWTA 4YDNA 1AQDB 3QIUD 1OOAA 3FTZA 1JZ7A 4FXKC 4BFJA 5I1GH 1PZDA 3EUDA 4M48H 3MUY1 3LD8B 3HNTL 1JPEA 4MBRA 3TBYA 4R83A 4PV1C 1NGXA 4MCZA 5HJGA 1OAXL 2YPKB 3RWHB 4YSRA 1JYNA 2YMTA 3KM1A 3IN0A 4PJXA 2P3YA 3C5ZB 4JRXD 3D12B 3FH5A 3C5XA 5HY9A 1B4JH 3GI9H 1AFVH 4Y7OC 3T4AA 4PP1C 4JKMA 4ZQKB 5HYQA 1N12A 3V5DB 1A2YB 1SVZA 1UM4H 2CGRL 3QQ9D 5BV7L 3CZEA 1ZS8A 4OZHE 3SDAB 4FNQA 3SQOH 1HWHB 5DMGC 3L1FA 1TFHA 1UG9A 4GRWB 4NNPH 1CIDA 4DKTA 5EZOH 3WHXB 4JY5H 4M7LL 4FTVD 2DMKA 5BS0D 2E9IA 2YAEA 3CHXA 4G59C 4H8QA 1AH1A 1CMOA 2Z91A 3QO1A 2J7LA 1E5YA 3EYOB 4L4VB 3JXAA 1HEHC 4JG0L 1S9WB 4WWKB 1S7TA 1NBZB 4TNVF 2CIIA 1FC1A 1A14H 1R3KA 3DDFA 1JK8B 4TSCL 3CFCH 5LJYH 3UTZA 4F20A 1FJ1A 2VJ0A 3PWUA 4MB5A 5SX4H 5LNDA 5ID0B 1ZWIB 2P5WE 4K0OA 1DSWA 2NXYC 2IC2A 5JQHC 3HS0C 1EPFA 2P8PA 1B2YA 4BSVB 4Y5XC 3D48R 2L7EA 4LLVA 4AI7A 3KLSA 2EDWA 3IMRA 2BSSA 4JL1A 3FCBA 2B1HH 2P4AB 4FL4C 4MCNA 1HSBB 1UUNA 4RFOL 5I1AB 3BVTA 3UOAB 2L4OA 12E8L 3DJTA 3TZVA 1DBJH 2ZWSA 3X3FH 2N0KA 4NLHA 1GKEA 1GZPA 4JL2A 4JFHE 2OXHB 3N55A 4N26A 1T1WA 3TEYA 1GYAA 3L54A 4WEBH 1HCYA 3RY6A 3ZL4L 4W4NA 2GK0B 4EDWL 4NRZB 5I30L 5ALBL 1KB9K 2UWEA 5T1LB 4HG4J 4G7SB 1S7XA 5G5DB 2IWFA 1UQSB 4CADB 1AJ7L 1KCUH 5D71H 2VITA 3UABA 4DP7X 3VXQA 4RGNE 1DSFH 4CDHA 2IH9A 1XMEB 1A4AA 4GW5B 2BDNH 5CM1A 4P4RA 3L13A 2GPZA 2E8ZA 3DDGA 3L5HA 4M5ZL 5TK2A 3L3JB 4JKWA 2WXJA 3KHOA 4PY8J 2QSTA 4MA3B 5KYUB 4PCSA 5T1KB 2CRMA 4FTVA 2I85A 3S35H 3Q5YA 1A4JA 1BVNP 1NGPH 4QRUA 1MY5A 2VDMB 4ZFZA 4PVLA 1MCQA 4XCYA 1IEBA 1BX2B 3WXVH 3P0VH 1VFBA 4UYQA 1NFAA 1P84J 2Q2LA 1IAIL 1FV1B 3O3EB 4DK3A 5TGBB 5IFJA 4HH9B 4HMEA 3F5WB 5JW5A 1PU0A 1PZAA 1ETA1 1A6PA 2M1KA 2ROXA 3EDJA 3DX1A 3O11A 3S37X 5C0GB 2J2ZA 5FHAL 4JUTA 3ZDZE 3DSFH 4KNQA 3COOA 2XN9E 2FLMA 3UX9B 1IAKA 3GKWH 4PGJA 4IBWA 2ILLA 1A64A 1GSKA 3G5XB 3K1DA 4LVHC 4QKXB 5SWQA 1WD8A 2JKXA 5KVEE 1ZANL 2BWQA 4OB5H 4LO9A 2WIIB 4H8WC 1WYJA 1OCWH 4OFQA 4ZI8A 4UAHA 3E8UL 3NFNA 2AXJA 1L5GA 2KH2B 4G43A 3DJZA 1RAMA 5CINH 3FK3A 3MXWH 2HG0A 1BMGA 4M93C 2YBRA 2WXKA 1IEAB 3QWRD 4HIQA 4XZ4A 2X9ZA 1ZHBA 4Y0GA 3I6GA 4NENB 2ZX6A 4PJIE 1FDLL 3U0WH 3U7WL 4RWHA 4P04A 4JUSA 5LGJB 1R5VB 4IYKA 1OARL 1SF3A 1KXHA 1MCDA 4D8OA 2DQHH 2HXAA 3H3KA 1LVEA 5ISZE 2UXVA 3KLAA 4C55A 2E5EA 1E9PA 4RZCA 4OM1L 3B5GA 2X6BA 1W15A 5I8KH 1FNGA 1IBDA 3FO1A 5J9PB 4F58H 3ATBA 1JXDA 5IHHA 3JZYA 2QVKA 4M93B 2YSSB 5TDOB 5DD3H 5F9JB 2ICWA 2DLEA 1EHLH 4YSOA 3O6LH 2XBDA 1AHMA 3FZUD 5FO8A 5MEND 3IDIA 2EDQA 3FT0A 1LEKB 3NCYS 3WU1A 2CLZB 2ZUVA 1GXEA 1FPTL 3AZUA 3KL3A 3SDCD 3IBOA 2WLJA 3O6FC 4ONHB 5EH1A 4V1DA 5HI5C 5J8OA 4ALAH 4FCAA 4UZSA 4XBEH 1FGNH 2NQCA 4N90D 4PRIE 5IEHA 3TO4D 1CICD 5IROD 1U58A 1JS4A 5AZ2L 3MLUL 2BCKA 2BXZA 2P5WB 3A0OA 4G9FA 4NO5A 1KN2H 3GXNA 2NLJB 2IAMD 1MJ8L 5CAYB 3P3YA 4JPIA 2WPGA 1PLBA 4FZ8L 2FQDA 3CMOL 4HC1L 1YEGL 4QRPB 3QEHB 5C6PB 4QTIH 4P9HH 1CF8L 3DBXA 5KSVA 4PJ7E 1E6OH 2HRPL 2M26A 1HU8A 4JFXB 1HTYA 1JVKA 4GXVL 4JQIH 4LLWB 4R7NB 5IT2L 5DLLA 2F8IA 5GIRB 1CL7I 1VKXB 1DQDH 4ZXBB 3BZEA 2GG1A 1DN0B 5LGHH 1QFOA 4MHHG 1JK9A 2QELA 1BSIA 1WAPA 5HHNA 5JXEC 4MQXC 1WWBX 1A7RH 4KV5F 4F91B 1GZHC 1EERB 4HIHA 2FQFA 3CSYB 2XWJA 3CG8A 1B2WL 2YLHA 1UZ8A 3TT3H 4YAQB 1NCIA 2XNAB 1FZOB 3EJQA 5DC2A 3HPLA 2MIZA 4A7GA 3VX0A 2Z93B 4YDJA 2D03L 2BIHA 1OSPH 2ZSVA 3ASOB 4H44C 1KIRA 3BWUC 3MJ9L 4LSDA 2A6KB 5CMAB 3UC2A 5T8IA 3MJ6A 3TBWB 1IGJB 4I2XE 3FN0L 1DJSA 5LBSH 1MJJA 1BZ8A 1G1KA 4MFHA 1O9ZA 5TPWL 4Z0BH 3HRZA 3OKLB 2OTUA 3QP3A 3BWZA 1FVEB 3U1QA 1ZLSH 5PCYA 2XVLA 3MRJA 1EFQA 3IETB 2P8MA 1GAFH 5D2LE 3UYPA 4BHUA 2WP3T 3G6JE 1NEZB 5BRZE 4DWHA 4D94A 4OM1H 1OCRB 4HCFA 4ZT1A 1S7UA 1SEQH 1NOLA 5AW5B 2YQ3A 1DEEA 1AR1C 1MWOA 1UOVA 3PWJA 5E6UB 4GI6A 1QQDB 2AJXH 3GEFA 3ZTNL 2YC1A 3GS4A 2XA3A 3K72A 1IC4L 4P8QA 4TLUA 1JZ6A 3VD1A 4ZFGL 5JLZA 3WNNA 1FUNA 2IALA 1CI3M 4LIQE 4HS8H 1KYFA 3D3VB 3QR1A 2QDVA 4N2OA 2Q86A 4H20H 4F3FB 4D9RD 1YNLH 2CH8A 3BP4B 4L8DB 2JKIS 3EKCA 3VRJB 3S3CB 2X42A 5TJWK 1E9OB 4J8RB 1PIGA 3HPJA 4WKZA 1SM3L 2B14A 5T1KD 2EEBA 4XPTL 3VDBA 4GMSH 3OC8A 4XO5A 4ADIA 3QE5A 4GSDH 3F7KA 3EYQC 1KJVB 1L3WA 5I1JH 2DEXX 2JH2A 1L0XA 4HUWA 4JG1L 3X3FL 3QWRA 1FNHA 2WQAA 5HVFB 2XJKA 4GQ9H 3H4FA 4APQC 3O6ML 1IAIM 3WMQA 4Q97A 5I18H 5EIIB 1QFWI 4X6DB 1GY1A 2HG5A 3VXQB 1EH9A 2VXUH 1YA5A 2WXOA 3QRBA 4IJ3C 4H1LH 1LO5B 1KXVA 3DJRA 3QWNA 4TULL 1MUJA 4OJEH 5EOQH 2YD5A 2IMNA 4Y9EA 5L4MA 3NPZB 2HVJB 4K8RD 1MCBA 5T1MA 2ADJA 4U1JA 3GUTA 4PJFA 3QNXB 5A3ID 2A9DA 5DU7A 3RDTC 3JWOC 2YRZA 5C0JB 3T0VA 1IVLA 3FFDA 4WCYL 1FZMB 2IFGA 2XBZA 3LKNB 5E6YA 1U8LA 1ZJBA 1CTOA 1CFVL 2XXGA 4V33A 25C8L 1IKOP 2YUWA 4DCQB 2VT0A 2FSEA 1FRGL 3JTSA 5JA9A 1O6SB 1D5IH 2IO5A 1I82A 1OSZA 1M42A 3IS0X 4KAQH 3SGJC 5I5RA 1WA0X 3SDXE 2UZYB 1HAWA 3RUGB 3MLYH 4FX5A 5I18L 5D55A 1NBYB 1FO0B 2IGFH 3KEDA 4YE4H 5DUBA 2KQMA 1M3IA 3Q8AA 5KZCD 3PWPE 5B21A 2YPLB 2OMXB 3QQ3A 3HNTH 3GINA 3QORB 1ZY9A 4RMRA 1S7VB 4XPAL 3WE6A 3US0A 2VC2H 2XOTA 1AY1H 4QWWD 4F8LA 3VE0A 5I1LB 4WO0A 3BP4A 1J0HA 1XSJA 4L8DA 4R5TA 4B0MB 5IUCA 2N7BA 2RQ8A 2GK2A 2OSLB 3BISA 1MCOL 3HEIB 3DHMA 3RGBA 4UIKL 1JNLL 2UX6A 3AB0C 2GTWA 5J0BA 2E7DA 4KROB 2CHNA 1UVQB 2C7FA 3NZSA 4OCLC 1JYVA 3MRRB 5F7AA 5BRZB 5F6HI 2OX5A 2RIKA 1F4YH 2OSLA 3BN3B 1QSFD 2DW5A 1YN7A 3KS0J 4J28A 4JRXB 5DHDA 5CEZE 3AT8A 1P5VB 1RUKL 3D0LA 5D2LB 1PKQA 1U3HD 4HIPA 2CKBB 4NQCA 4P5TC 5MERB 2LU7A 2DICA 1IGCL 4PJIF 4Z0XB 2WN2A 3I2CH 1ECYA 2OLDA 5C0DB 1N7ML 5E8OA 4ODUB 1ONQB 4XTRD 1P6AB 2VR5A 2BRRH 5C71A 3TPUB 2QPFA 1Z0MA 2WLYA 2XZCH 2YPVA 1OP5K 3MV01 1MWAL 4FNRA 5F21B 3ZSTA 1IE4A 1NSNH 2ZX9A 4ODTL 4ZPTA 3BD5A 1I8AA 3NFSH 4N0UB 1CDBA 1MVUB 3QZNA 5CSGA 2DJUA 3VGEA 4NX0A 1W91A 3ALWA 3HE6B 4GEIA 4UNTA 4HK3J 2DI8A 4GAFB 1CBJA 1WQVT 1KULA 1MH5A 1HHIA 1KCWA 2QHRL 3U25A 3CVHB 3QG6A 4MJHA 4A2GA 1BW8A 5H94B 4KVNL 4MJIE 4QTFA 1IM3A 4E36A 3CSYA 4GQRA 4K9JA 3WFDH 1ZLUH 4WUUE 4ZW3A 4ZMQA 3QUHA 3QR2A 2HWZL 4P5TB 2XQYA 4OLXL 4N0FA 4UTBL 5B1KA 3TA4D 1SN0A 3QA3A 4IBSA 5I1EL 4PV9A 1KUMA 5E56A 4KJPD 1AD9B 4Q2ZA 5SWZB 5EUOA 5JNYB 4GRMA 3I3BA 2VXVH 3FUNA 3ARGA 3GMLA 4PI2A 2Z34A 4L1BA 1HFUA 5ERWA 3UZEC 1DL7L 1JI2A 3NA4A 1H3GA 1DQDL 1TVBA 4OJFL 1QHPA 3MRLA 5J7CC 3TL5A 3WEBA 4GBXA 3BUYB 3NMEA 1A7PH 4GAJH 2ZX8A 5BRZA 2VL4A 3QEQB 4EBQL 3BKJH 2Y36L 2H0JA 4S1RL 4WWOA 1W2KT 2ZYIA 1UD3A 1J1OL 2QMJA 3VRIA 3OZ9H 5F1SA 1C1EH 3BH9B 4HKJB 4I0CC 1OWWA 3HS9A 4EDXA 3OLIA 2AJVH 2MWCA 3HC3L 2AV7A 3QJHA 3UC0L 1Y1UA 1I53A 1VESA 3QO0B 1HIMH 4ELKB 2IVFC 3ZQ9A 3N6YA 3UJTH 5FO8B 4LCYB 1EGJH 3DX0A 1CBVH 2CM5A 5C0AE 2JI1A 2VZOA 3LQZB 1PLGH 3TN0A 2BVQA 3INOA 4LBAA 4TTDC 3SKJL 2MH4A 4FMKA 3PP3H 2YRLA 2MQCA 1VIWA 2OR8A 5ISZB 43C9A 2IANA 2CCVA 2WNGA 2AK4D 4Z7UA 3US9A 1DEEB 4RLDA 3MGTB 2DI7A 3W0WD 3QI9D 3MOAH 3EYUH 1LO4H 3I50L 4RWYL 3IM1A 3BUTA 3T71A 2ZUQC 3HZYB 2W80C 4EO5A 1RURL 4D0BB 2W81C 3GRWL 3DO7B 1U42A 4ZAKC 5IVXE 1MFUA 3K2KA 2FGZA 1UXSB 3A4AA 3X1GA 1L5GB 3LHPL 4ES9A 3ZTCC 4HCGA 1J9SA 4U05A 4DTGL 3IWUA 1Y6KR 3JYCA 1YDPA 3SE3C 4F2MA 4Q9CA 4YSQA 3ARRA 4HJSA 1MLBB 4BBWA 4AZ8A 1NGYA 2QVMA 2X3BA 2HMIC 4GG6E 4J1UA 2NW2B 1CG9A 1R24B 4I0PD 5K93A 2HG5B 1B88A 2L7QA 4OIAA 5GS2H 2VUOA 2YMXL 2KPNA 4I18A 1ITBB 2UZIL 3W56A 4NAJA 4XP1L 1G87A 5EULV 1HHJB 5JW5B 4OGQC 3N91A 2I60H 3Q3GA 2XICA 3QJQB 4YIQB 3MNMA 3LSOB 4TNWK 4KXDA 3G9AB 2X9YA 4P2QD 3DVGA 5E23A 4ZMXA 2EIMB 2EVJA 2YPVH 2GYSA 4F37F 1JVLA 3SKMB 1NWPA 2Y69B 5IQOA 3PWPA 1XZ0A 2ZXQA 4NT6A 2PW2A 3B7SA 2N1TE 2WBJD 4RMTA 3QUXB 1YY8B 2OQJA 3BDYL 4NXSA 4PB9L 5BZZA 5JQ6L 3N06B 5DGRA 5B1JC 3ZKMC 1RUAL 4DESA 1NOAA 1NC2D 3MRKA 5H37G 5JIIA 5F7YC 1A9VA 1P4IL 4WV1B 3N1FC 5HYJE 2X4TB 2OL3L 4AVJA 5GRJL 4XAWL 1RK1B 2APVA 2H5UA 3GIZL 5C08D 3MBED 3GSXB 2HFEB 3KPLB 2LVEA 2CKNA 2B77A 4HS6B 3KCWA 1GZPB 3CDFA 1JGVL 1N8OE 1UWGH 4PW4A 3MACH 2CPCA 4KPHH 1J8HA 1WO2A 4XCNB 3MLXH 4B6ZA 1PKQE 1ID2A 3V6OE 3NJHA 3UAJC 3OB0K 4GQPH 4AEFA 1SOXA 3B34A 2XVBA 4NCC2 1LO4L 3I50H 4RWYH 4TQ8A 5GGSY 5SV4A 2I9TB 3T2QA 3A6OA 4W6YB 3NACH 1OAZH 1EHAA 5B4MC 1LDSA 2C9XA 3PHSA 1ITCA 2A6KA 4C57C 2EKJA 1YEKH 5E2TL 2F5BL 2Z93A 4YDJB 3EBGA 4IU3A 4MNGE 2CO4A 4H7VA 5CUSL 5FYLL 1PZ3A 3BP6A 3BVUA 4HPOH 1AZZC 3V4UL 5D8JL 4P3WA 4N2AA 2AJSL 3RVTD 5TE6H 3KXFE 2WUCL 4LLUB 4UV4L 4V1DD 4EVNB 2X1QA 2DQJL 3MV9B 4XH2A 3NCWA 3BSZA 4OBRA 4FDWA 3CD4A 3O3DA 4KMTL 4KK8C 3IJHA 3U1SH 4Y4KB 4Y89A 1BD2B 4PR5A 3EDEA 4QWWC 5D7LB 4ZMNA 4MZIA 5EUOE 2G3NA 1HXMB 5GGVY 1IC7L 1GOHA 1XH0A 2O4EA 2JELH 3NZHL 4AMKL 1DANT 2ADGB 2BNRD 2VDNB 2N01B 3OWRA 4N24A 4QRPA 3T77B 5EU3A 4HH9A 2H45A 3K71A 2BSEA 2LGNA 3TBVB 4TOYH 1Q9OB 1PKOA 1N3NA 5C08A 2IAND 1I8KA 4H8WH 3LVTA 1WC7B 4X99B 2DKUA 2R0LH 1EAOA 4NAQA 4JFYB 2OK0H 5C07D 1JGDB 3FU7B 3FTUA 4MCZB 3TNNB 3LS4L 5EBWA 2OMVA 1B3JA 3WMSA 1A3LH 3PDOA 4XXDA 2WD0A 3H2PA 3ESMA 1IC5H 1M7XA 4Y4HC 3VM5A 1GRWA 2J5LC 3MRDA 5CD5C 4KQ0A 3GZKA 3S97C 3UO8B 1JWMB 3GHBL 3PJSA 3X11A 4PVNA 4QOKA 5JIMA 2EUWA 1CXFA 4B7LA 3LV3B 3EYVB 1D5BA 4E9YA 4ETYA 1F58H 1MEXL 2FJFB 4FA8A 3O9WB 4N8VB 1VZIA 4XMKH 2VMEA 4IOFC 3KPOA 3QRFM 4MKMA 2DMGA 1E3FA 2UY6A 4Q6YA 1OGSA 2B4CH 2GIMA 4O02B 4FQHA 4KJQD 3SJVB 2KHAA 4JM2D 4HD9A 1FZKB 4WTZA 1TJGL 2VH5L 1GGTA 4KNUA 1KG0B 1OL0A 4EI6A 4FRWA 4F7PB 2P7TA 3JWNG 4MKTA 3BYTA 3NPSC 1SQ2N 2ZKXA 1P4BH 3HI5L 3RX8A 3WLBA 1MCCA 1IAKB 2AJSH 3BLBA 5F71A 5DJDA 3W0WB 4RAUB 1X7SA 4L8SB 4RDBA 5T5FA 3O4OC 4QXTA 1MJ7L 4Y7MA 2CO6B 3K6NA 5F70A 4NJ9L 1EWHA 5C0GA 4HJGB 4CC4C 3MRQA 3T0DA 3CTTA 1BXXA 4GKZB 4PJGB 4WW2B 5DJ8B 5I6XC 3D4ZA 5KBLA 2X41A 4D9LH 4Q89A 3TVMB 1MHEA 5GGUA 2VQUA 4ZMLA 5JHLA 5I30H 4J3OG 5FUZL 4NP9A 3RDJA 2MEJB 1E2ZA 4P07A 3IJ9A 3QYNA 3AG4B 1WPCA 2NY5C 2BNRB 1BCIA 2IG2H 1OAYH 4NQCD 2IDCA 3DV6A 4I87A 3V5DA 5I76A 4EZKA 3IF1B 3TA3C 4FI6A 1XXFC 2VLKE 3CPUA 4NLAA 3MV8E 1KIQB 2VYRE 1I3RA 3B9VA 4FJZA 4KRPB 4XVSH 4CADA 1KPVB 2YEZB 1XDTT 2B08A 4E0RB 3EFFA 5IIEB 3GBNL 3F6LA 5GZOC 3WXWH 3IAQA 2ZCHH 3RVXD 1W9XA 1F4WL 32C2B 5C0IA 3KYMB 2YKKA 3Q06A 1L7IH 1IKFH 3NSXA 4HKXB 1ADWA 1U6AL 4O2FA 4XC1H 5CNHA 2F5AL 4N5EC 3MRHB 1DR9A 3EJPA 4K7PX 1HN1A 3TYGH 2R8SH 4PWJA 1J8HE 1EX0A 1JZIA 4WJ5A 3HN5A 4OCNC 4XP5H 4IJTA 4R84A 3V0JA 1EUTA 5AW7B 2CKBH 1I9IH 1TMQA 3N41B 4QHLA 5I75B 1WA1X 2H41A 1FN4A 1PFCA 3P9LA 5AL0A 4HBCL 4MA8H 3VFWB 3MXWL 2GBVA 2IXQA 3NT0A 3CH8A 4AJYV 2CR3A 5J11C 3UYOD 2F54A 1MNNA 4X99A 1DZ0A 3MGOA 1DLFH 4OZHF 2E7HA 3P54A 2AEQH 4PLOB 4X7EC 5C08B 3SSGA 4F7TB 3IAPA 3UZQA 4FKEA 2Z35B 2IJ0C 2OP4H 3QHFH 2EDYA 2XZQH 4UAOC 3B37A 3DVFA 5I73B 1ND0B 3MACL 2WO2B 3B4NA 3SPGA 1F6LL 2DD8L 3C9NA 4X7SH 4XP5L 4P5KA 2YGOA 3CZNA 4P5KB 4N2GA 4GAJL 2WBJB 3KCPB 6FABH 3PDDA 4UQ9A 3BKML 4QY8B 2VMJA 1TTAA 1J88A 3TVMA 2LAGB 1SYSA 4HOMA 5I66B 4W9HC 4G71B 1AHWA 1G5GA 4KQ4H 4FLSA 5IF0B 5IFHH 4GOSA 3ETTA 2O26U 4WFGE 5E1HB 1YMMB 1E2VA 3RYMA 5FDWA 1THCA 1NEZG 4Z8FH 1R3IL 2RR3A 3AS2A 1YUHA 4EPSA 2YPLD 4APXA 1QRNE 1NM4A 1MCRA 2RALA 3NSCA 4D7BA 4ADGA 1IGFH 4U1HA 4XMLL 2XV0A 5I19H 4YDKL 5DJ2B 3D85A 3SY6A 2X2UA 1VERA 2MPAL 4CVUA 4R5XA 4H1LB 2B3RA 4BKSC 2MHAB 1PQZA 3BQVA 4KOCA 5IV2A 3WIHA 2JJTC 3ARWA 3FF7A 4O2FB 4YWGH 5C6TH 1TG8A 3TBTA 2PP9A 1VPOL 3QUML 5DHYA 3QS2A 1PX4A 5DUPL 4QAMB 2VR4A 2Z3FA 4ONFL 4BWTA 4N2EA 1T6WA 4UT9L 5C9JA 5D7IA 3HZKA 3PLYA 3ZDYF 1QSEA 1M2VB 3VWKD 5G4MA 1T6BX 2G5BA 1O7VA 2R9HC 3N41F 1FORH 4WFEE 3S3JA 2A6IA 2DKMA 4I4WA 4PLJC 4Q9RL 1SXNA 2A2QT 3TX4A 5DJAA 1PZUB 3O8XA 2Q8AL 5E03A 5E94A 4PJ8A 1ZSDB 3PWPB 4LFHD 2GBTA 1JGDA 3FU7A 3V0AC 4X4ME 4B9CA 3H54A 5A2FA 2F8VA 3LRSA 3P2TA 1DLHB 2WJ5A 5DVNA 2XC8A 3E6HA 4XP6H 3HS8A 1O9VA 5IFAH 4IOSD 4PIRF 1E7UA 1RZPA 3ARFC 1F1AA 1XBDA 1DO5A 2NW3B 4QYOB 3WBDA 1G7HA 2WOBA 1VEMA 3C08H 3CZSA 1HNFA 3S2AA 3AS1A 2JI2A 3E3QE 5J89A 2GI7A 4YHNB 2PCFA 1TENA 5EUKA 1HDMA 4DGUA 1XGZA 2NY1B 1OT2A 3PHAA 1RZJC 2ICEB 4M3KB 1GCYA 4KXAA 3W0WA 4WI9A 5DDHB 4U6YA 3MUUA 1RZ8A 2D0HA 3VXMD 1G7MB 2EIBA 5DFTA 3UAJD 5EZIH 1S8DA 4NKMA 3CFEA 3S37H 3ARBC 1A7OH 4YFLI 1QLFA 2AJ3B 3VI4B 2WXNA 2Y2WA 4M1GL 5FAAA 1SFHA 3ULSB 5GS1B 3FDWA 3BAEH 4GSDL 3SPHA 2XWTB 4PP2B 2VSDA 4A7VA 5K1JA 5IUSA 2CO1A 3DV4B 5IKCA 3MQIA 5GRXG 3VX1A 2WTPA 5I8OL 2QQNL 1F6FB 1YO4A 3BAXA 1L7TH 1ESOA 1E7VA 3CXFA 2CMRL 3C12A 3OXSB 5EBGA 1BOGB 3H9HB 3GHEH 3L81A 4L37B 4YSSA 3MCLL 1OKEA 1Y18B 4B9ZA 4ZSOA 4I0PA 2YD7A 3IB4A 3NJVA 4JG5A 1EZUA 1D5BB 1RZJH 3NCJL 3HJ0A 2VCOA 3FSZA 2DYRB 1GS6X 2Q20A 4E2OA 2M2DA 3KBPA 1VSCA 5F89A 2Z8SA 4BDVA 3PU7A 4F57H 5C6TL 1MN4A 2CO7A 3Q01A 4K7FB 4X9FA 3RQ3A 3V9FA 4AYMC 4JKPL 4CU8A 1MY7A 4POZC 2CJ3A 2OI9B 1QWNA 5FKAB 1A7OL 4WI8A 3TO4C 3EJSA 3STZB 1Q0XH 1X5FA 3CMGA 3FB6A 4JPWL 5IMKB 5D8JH 3D3VE 1PZ5B 2W60B 4G8GE 3KGUA 1T5KA 4W9GC 5B8CC 5E08L 2X89D 4XCFH 2D2CC 1MIML 1J5DA 3ZE1E 2XYCA 1J11A 1QRNB 2MKWA 4KVCH 4L8BA 3ZDYB 4NOBA 3BH9A 4HKJA 3CDZA 6TAAA 3VUAA 4HV8A 1KV3A 2EVIA 1QSFB 1RMFH 1Z66A 4WV1A 3S36L 2FCBA 5BVPL 1WA2X 4XODA 1UB6A 1JCKA 4PQXA 2EXYC 2R29H 2WYHA 4MJ2A 4OLUL 4NUMA 5CCKH 5FB8B 2FECL 3K71B 1KSRA 3G6AA 1QNZL 5LN4A 2P43B 3O2DL 1D6EA 4YBQC 4F9PA 1P84K 4GKSB 4W9KC 5EEUA 4LEOB 1IC1A 2JCWA 4GRMB 4JY6B 5L4JA 2DH2A 1CXIA 2VL5B 4HGMA 3PPEA 3Q05A 4MXWH 1QASA 3U4KA 3WNMA 5E08H 3L3OB 2C3GA 4WUKL 3QG7L 4F33B 4IGBC 4KH9A 1INDH 3UGXA 1K4CA 2JCCA 2WIMA 2R56L 3WNLA 3BXNB 1E3ZA 3K2IA 4OZGE 3PNWA 3ZZ1A 3QI9C 4BE5A 1EO7A 4J1UB 4GB9A 1LTXA 1QFWL 2IF7A 4JZJB 1HWGB 4NRXB 5ABZA 1MAKA 3O4LD 3BSZH 1KCSH 5ITFB 2R2EB 5IZ7A 1YMMD 4FZ8H 3CFJB 4U1SA 3P4MB 3DTXA 1TITA 3EGDA 2G4EA 3SCMC 3DRTA 5C8JA 2A9CA 3JT0A 2CMRH 4MAZA 2QZ5A 3CDGA 2NY4C 4LP8A 2IGTA 4PM1A 1D3CA 2AJXL 3UROR 2OL3B 3DNKA 1EZSA 4OI9A 4KBPA 4DP4X 2VN4A 4X5RA 1RZJL 3NCJH 5D5MF 4DP5X 4BXVA 2VXQH 3T65A 1GH7A 1YHPA 3QO0A 1YEEH 4Z7WF 4OJAA 3BUQA 4XGZA 5HDBE 2BP3A 4PJEB 5IW1B 3QJFB 2X4TA 1HZKA 3NSJA 4BXSV 3VRIB 2BOLA 5E95B 5L6YL 4ADJA 3EIFA 4Q0XH 5L2KD 3KVPA 1AOZA 2BVQB 1J05B 3EFOB 3FPXA 5CBEA 5G4OA 1DVFA 1T66C 1QSEE 4HZ1A 4J12A 4M5ZH 3EYQD 3GSNA 4OAWB 4QYAA 5TFSH 2YS4A 4JZNB 4JO8A 3NJNA 3CCHA 2VDOL 3DI3B 3BWSA 2F1AA 4AM0A 3RVUC 2WXMA 2IMMA 1P2CB 3RU8L 3C09B 4PJ9B 5T1DH 1Z0NA 3LQMA 3O2VL 4Y5VB 4XCEA 2WBJC 1TQWA 3KPQB 5JW4R 2CUIA 2EUZA 1TFPA 2QADC 3OKYA 4HD5A 4UQBA 3SQBB 1XGUA 4L5FE 5FA4B 1O6VA 4J3SA 5T5NF 1K8IB 2VQ4A 3EYSL 3BKYL 3KLKA 4Z77B 4DFIA 3BEVA 1A1OA 3HG5A 4YHLH 2G2RB 4MMXA 3VB9A 1GL4B 1HEZB 3S4SG 5CSZB 1T89A 2NTFB 2QR0B 4MD4B 4DVBA 2BP5M 3EH4B 2YN5A 1UD4A 2F7PA 4BKLB 4IK6A 3FOLB 4RGNC 4OB5L 5BZXA 3AT9A 4X6BB 4AGNA 1GGCH 3I6LD 3WUWB 3THMH 2JB5L 1T3FA 5D1QC 2WYIA 3CSTA 2QKIB 1FZMA 3AACA 4PG2C 3MLZL 4TNVK 4Y2DB 5FS5A 3VGFA 4LL1A 5LBVA 3VFMA 4N1EA 5DRWB 1BGXH 3EJYC 3WOVA 1BYPA 1Q4NX 4LB8A 2DQMA 3RWCB 1D5RA 1MVFA 3W9DB 5BV7B 2I27N 2B59A 2R4RL 2PO6D 4PJDA 4KRPD 1I1AA 1F4WH 3ENEA 3SDXF 2QT6A 4BKTC 4ZUUB 1GGIH 5SX4I 2JKJA 4AUYA 1I7ZA 2AZAA 3EH3B 1FVDB 5DO8A 1XH3A 2Y1AA 3UG5A 3GM8A 3H7BA 4KMQA 5BZDA 2EDDA 5D1QB 4MCYA 5LAXA 3UIYA 4DP8X 5I1IL 3EAKA 4UT7H 4L3CB 5L2KA 2BH0A 2NYZA 1JPGB 3ATFA 3ZGHA 4H8VA 3B7RL 3ZE1B 1WGVA 3EOBA 3NIDB 5FM4A 4XCEB 1ZOXA 1BFSA 3R7RA 2PKDA 5J06A 3HPJB 3EZJB 1IIKA 2J8UB 4JY4B 4EI5D 2R0ZH 4JY4A 1UKQA 3CCHB 4QHKI 3KPRA 1S5HA 4A2DA 5HYEA 1YYML 4WJG3 3HI1B 5IM7B 5DHVB 3LIZH 4J6RL 3ZE0E 4HALA 1IC5L 4GT7A 3T08A 2A6JB 2FATL 1DVTA 3RFZA 4LVOC 4YHYB 2IPKA 2WVVB 3NN8B 1WITA 4O58L 3I6SA 4U1NB 1CICB 1IBBA 4GXVH 4RAHA 2ESVE 3OX8B 5FW7A 2Y72A 2WLMA 1NSNL 4LEEA 1I7ZB 1UJ3B 4X4ZA 4YGAB 4ZBJA 5A7BA 3SBRA 1XH2A 4BCZA 1WZLA 3KPMB 3LZFH 5SV3A 2F58H 2GUOB 2ZICA 1AMXA 2J4WL 3CH1A 1EJ8A 4UU9B 3FFDB 4KTEH 4PV9B 4AL8L 3P4MA 2YHGA 1FYTE 1U41A 1FHNA 1T5XA 3CUPA 4K5MA 4C83B 2FWOA 4JFFA 4PJFB 5IOPB 1FYHB 5DK2B 3B2VL 3JV4A 5F9OL 3M45A 2D7NA 2VIRA 4RVBA 5D70H 3U48A 1RZIA 3T3PE 4ORGB 2BIOA 5FO9A 1T1YA 2WKGA 1KBGH 4HAKA 3BDXA 5FFGA 2VSKB 4BKLA 5FW6A 1IGFL 4JPKL 4JKLA 3GSQA 3GBMH 3Q48A 4WJKB 2K3HA 1KB9J 5I1DA 1BAFL 2WNWA 1FQ9C 5F6IC 4KK6D 5DD6A 3P0YL 4JNXA 1CF1A 1UJ3C 2Y1VA 4N2CA 3GUTB 4UNIA 1W80A 2W0LA 1DN0A 4P23D 4POUB 1CQYA 1K8IA 3TYFA 5IB5A 2VOTA 3MFFA 4ATTA 2FX7H 2FO4A 1ES0B 3DXAD 3LQAL 3FU8A 4UIMB 3BRDA 4X8CA 1R34A 1WIOA 4Z7QF 5EIIA 4L3FA 1IV8A 1LL1A 2VXTL 3G08B 1QI5A 3JQOB 4LNRB 1PKQB 3B9KC 3S5YA 3V0VB 5MERA 2BY3A 2MQ0A 3NTCL 3RG1C 4JRXA 1J8SA 1CFVH 4NO2A 1U8IA 3E8UH 4P4KB 3MRRA 5FYKE 3QR0A 2P5WA 5GRUH 4BD4A 1G1YA 5IEHB 1PLGL 4GP4B 4XGZB 1S3KL 3ZBMA 2CWRA 1YAZA 2OMUB 1N10A 3DOSA 4V1DB 1D7DA 5AB1A 4U1LB 3ATEA 4QO1B 1A1MA 4KKCD 4BGLA 2J8UA 4H0LC 1Q0YH 4UILH 4GS7C 5LGKA 1FBIH 2VZUA 5K39B 4I0KA 1UOLA 2XTJC 3CWGA 3TNMB 4DO5A 43CAA 4OKVA 3VD2A 3D39D 5HDRA 2OMXA 4H25A 4EKJA 2CO7B 3MTRA 4CNIB 4WW1A 1NMAL 4F1ZA 1SLUA 5DZJA 3PGCB 2BSCA 3W9EA 1MQ8A 2V2WB 4PGEA 4N68A 2AMUA 1CC3A 3BCDA 4L3CA 4YDVB 4HIEB 2QLVB 2ATKA 4Y8DC 1FFNA 5BZDB 5ESAA 4K4KA 4C56A 2YR3A 4XXCC 1KB3A 1BG1A 1MG2C 5FGRA 4Y2DC 2XNAA 5BJTB 2Y36H 4NP4L 5AENA 3DX7A 4J3OF 4NCC1 3DYMA 4HBCH 2W38A 4MA8L 3CQPA 3ZYOA 3WUWG 1MFDL 1QTYT 3D06A 4AQAA 2UUDK 1RSYA 4JZJC 4P9MH 2GY7B 2MMXA 2APXA 4GSRA 3RZCB 1BVOA 4PRPD 1JK9B 5IR1A 5DT1H 4XWGH 5I1HL 2WXRA 4K55A 5GHWH 3O2DA 3RU8H 4DSYA 4ZXBA 4E5XG 1AANA 2OJZL 2IADA 3FZUC 1U3HB 5ILTL 3S35X 3FT2B 3E2HB 3J07A 4PJDE 5EO1B 3WFEH 1RPQA 1U2HA 4HJEA 1UZ8B 1OF2B 1OGAD 5GS1C 3MO1A 3UMTA 3UDWA 3KNBA 5IGXL 2YSTA 3STLA 4K8RH 1QW9A 3P69A 3BPLC 2NW3A 3JWDC 2DIAA 1JF1B 4I3RL 4FAAB 1RK7A 4KY2A 1WBXB 1ZV5A 3MFGB 1WAAE 4JPVL 2IBZX 2W65B 2CLVB 3QUZC 4FNLH 5CJ5A 5GS2D 3ARVA 5AW6B 4AY0A 4N8CH 4AGQA 4L3ED 1XB6A 2FZ3B 3QDGD 4ONHA 2A9NL 5E8NA 3E1ZA 3UG3A 2SODB 3KYOA 3SPIA 3OSVA 4L1HA 1YPZF 1KCRL 3BEWB 2DQEH 3QEHA 3DVNA 5KJRH 4EUPG 4HWZB 2P24A 4PBXA 4DGYL 3R06A 5JHLL 4M00A 1KNOB 2Q8BL 2K3TA 1DVFB 3FYIB 7CGTA 3GLZA 3DSNA 4Z78A 4LOUC 3OKMB 4G9FB 5GISL 2EYRB 2EADA 3K72B 5D93B 4U0RC 1J87A 5B38A 1RUKH 1CE1L 3RL2A 3SGDI 2GT9A 2V5RA 4HU2A 2Z7ZA 1QLEB 5T5FL 1K2DB 2D3LA 3RB7A 4JPVH 2XDHA 5HD8D 4AYFB 1AZUA 1NMAH 3UBFA 4QJ5B 5J6HA 2Y23A 2HJFA 3BVWA 3QULB 3DURA 2ZT9C 3RZCD 4KXZI 3UC0H 2WXLA 5J9PA 2EVGA 2DF3A 3SCMD 3QI9B 4XX1E 1JFHA 4DN4L 2BFVH 4JDEA 3V4LA 2BXYA 4P23A 1S6NA 1KJ3H 3H85A 2F53A 3GI8L 4AQ8C 4BIKA 3ZSSA 4DT2A 3BAJA 3V4VL 5IMLB 1I85C 3QWQB 4JFFE 1I8UA 4XCCH 3U6RA 1TYRA 1AZRA 3BN9C 1SMAA 3KYNA 4UZGA 4GRLD 5FYJE 2VSMB 1VGEL 1SJVA 4HIHB 4Z5RA 1C8QA 2YRBA 1I75A 4RNRA 1Z1WA 2IV8A 3FB5A 4XE5B 3ZMNA 2P49B 3KVQA 4LQ1A 1SJHA 3M17B 4WWKA 5GRVL 3VNZA 2XACC 2VO5A 5DD5H 2HX7A 3NQIA 2Y22A 2EKSB 3L2NA 5I15H 1MAMH 3ZE0F 2NSMA 1OM3L 4GINA 2NY1C 2VDLH 4PJBA 3LB6C 2R39A 4GKNA 4R2GC 3V6FA 5KAQF 4EF3A 2YXMA 3IU3B 1CLYH 4PJ5D 3OPZL 2EDJA 2WXGA 3MNVA 2GBUA 1GJWA 2CDGB 2F18A 2OPCA 4JQXC 5GJTH 3RJOA 2XVGA 4WK0B 4Z7UF 5IROA 4KKLD 3RWDA 3WDJA 3APCA 1FV1A 2L0DA 3G08A 3O3EA 3TONA 4JHAH 1TNNA 3L3KB 1TUPA 3QFJD 2VDNL 3NOIA 2AJVL 4MAYD 1U58B 2ERJC 3MGOB 3MFFB 3B43A 1YECH 1NL0L 2N4IA 1MREL 5E0FA 4G8FA 2VDRB 4QTIL 5IQ7L 5DO2C 1K5NA 4F93B 1HI6A 2WKOA 1XTLA 5CP7A 1RV6X 4P3CH 1NMCC 4NIKB 1XB8A 3D25B 3N43F 3HBPA 5I8OH 4HISA 3BAKA 2PMZA 3VGHA 1UT9A 1TTCA 2WXPA 3GMNB 3UBXA 4XMKL 2QVTA 4PUBH 3UERA 3VGGA 2ORBL 2N3JA 1UENA 4IRSC 3M1CA 1JVOA 4NN6B 4UDUA 2HT2C 2B4CL 1Q94A 3QDMA 5ENWB 3WIFB 2RAMA 2I5YL 4BA0A 1AY1L 2RACA 3MA7B 1E3XA 2E7MA 4UQAA 5LDSA 2GW5A 1TJIH 4EN3D 5ID0A 2K45A 3H1ZA 2OL3H 2VNCA 3AJ7A 3BPNC 4K3GA 4QI3A 4OCYL 1X4XA 5GQBA 2X4UA 4YZFE 4GAYB 1TZHB 3K2MC 1MHHA 3RVWC 5FK9A 2B5IB 2GFBA 3V4VH 4LCWE 1NMCB 4DKFL 3EHBB 4L4VA 4Q56A 1P7BA 4BK8A 1SLXA 3V4PL 1OQOA 2CUMA 1L9NA 4FQIL 5SWQB 3CZJA 3K6SB 1B0GB 1EK3A 4XWOD 2QBWA 1XAUA 1SDAB 4LPVA 4Y2OB 2YZ8A 3QEQE 4UMGA 4S1SH 1OTSC 3IFPA 2KZWA 3UEZA 2WHVA 5I1IH 5GZNA 1QNZH 1A6AA 2B15A 1VFOA 2HT3C 1LNUA 5I5IA 1KY6A 1EZLA 3QYCA 3FT3A 1KOAA 5D4QA 3CZUB 4B27A 3UYRL 4GLRH 5AAMC 3F84A 3RP1A 2LABA 5KZCB 2BVOB 3MOBH 3WHXA 2C9AA 1KJMA 3CVHL 4ZNCD 1YNLL 1YEDB 2J1YA 4HH8A 2YPKA 2CE6A 3LKRA 4I1NB 4U31A 1AQKH 2X10A 4JFQA 4AIEA 2WJ7A 1TZIB 3L3JA 1N2RB 1Q8MA 3L5WA 4KTGA 1NC4D 2NUTA 3N85L 3VA6A 4J6RH 5B7FA 4RRPG 5T33H 4DIXA 4ZQKA 5HYQB 2VW7A 3C6SA 1PY4A 4TRPH 1Z9SA 4K9EL 4QHMB 3A4EA 4MX7B 3IDMB 2XY2A 3DKHA 3EOYG 1UQSA 4NN7C 4CMHB 3GMPA 4HWBH 3S88H 1XGYL 3UYRH 3AUWB 1BBJB 5ECGA 4OJFH 4S0SD 3I9PA 2EDEA 2B2XH 4H1LG 1ZLWK 3T8XA 5AVSB 5LXGH 5F0PB 2KKQA 1JDDA 4FERA 4HKXA 2WLNA 3CVIH 3FQUB 3MA7A 2H1LM 3VI3B 3CX5J 4BFBD 3AREB 1XEDA 5CCJA 2XWXA 4HLZH 3HFFA 3M1BB 5AYQA 4KGJA 3CFIC 4B3EA 1S9XA 1GGYA 2DQTH 3TZVC 1C5DB 2F61A 2YA2A 4P46C 2CK0H 3C60B 5EU6A 4MNQB 4Y19B 3SBQA 2K9FB 2ENJA 2D0FA 2EC9U 4L4TB 3FCGA 4WEMB 5ALCH 5KTEH 3KWVA 5L6YH 4ZTEA 3GHBH 2ZF8A 2C4XA 2Q3AA 4DO4A 3BH8B 1DVXA 3HZVB 1PD6A 5D4JA 4U6VL 3S4SB 5DSCB 1B4LA 4IJ3B 1OCCB 3S48A 3E9TA 3UG4A 4EI5A 3KR3H 2JQMA 3DBSA 3QFJA 2NY3B 3WTVA 5IT2H 3BJ91 2X53A 1KACB 1Q1PA 5DJ8A 1QPPA 3ZN6A 1GA2A 1OAKL 5FF6B 4A39A 2EEXA 2H1XA 2V2TA 1RUMH 3GSOB 4PJBE 3HR6A 2AF2A 2H26A 2ZAGA 1AMYA 5FHBL 3WNIA 3BZFB 3MRMA 4WI7A 1MIEH 5I6MA 3ZHDA 5ESVB 3B2UC 1A2YA 1P4BL 3BT0A 1UB5B 3HI5H 4L5FH 4TNWF 5L0QB 1QD0A 3QCUH 3QQDA 1H9VA 4KGLA 4LSUL 4PRID 2PCPB 3KAAA 4YGVA 1KG0A 1P5UA 5HDWA 1SJHB 3FHAA 4P3DA 3RBSA 4NUGL 3MRBA 3KEHA 1RU9H 3ZHFA 4FQHB 3HLAA 4Z5RB 3QC5X 3WDIA 3U4EB 3CFJA 2X4UB 1UWFA 1AOHA 2FL5A 3AWEA 3VFWA 2HKAA 2TRYA 4MZRA 1TQBC 3K5RA 3OMAB 1NGQH 1SJEB 3LXAA 5C2BL 1WHOA 2AK4A 2QKIC 1KJ2L 3GXPA 3ME0B 4ZPVB 5E2UL 5F7EL 3BKCH 5EO9B 3TGXA 4HXBL 4IRJC 2Z31B 2DD8H 1PVHA 2H7WA 3FCSA 2WTRA 5FGCE 2PWEA 2VERA 4F7KA 4RSYA 1ZK5A 1JWMA 2YJQA 3UBXB 4B9PA 1IBZA 4IEFB 3K4ZA 1J8HB 4KRPC 1EBPA 1Q9KA 4NS0A 2AMGA 4XXDB 1CFTB 5LCVH 3V7AE 4JY6A 3EYFB 5KVFE 3KYMA 4NUPA 4RA0C 1BZEA 2EIKB 4YHPA 1U4FA 4N1HB 3IDNA 4X80H 5GRYA 4ZDHB 3LXUX 4YEFA 3WJLC 2WAHA 4DKDC 3IKCA 2JV6A 3WN5A 3BHBB 1C08B 3CGTA 5BS0B 3FJTA 4IHBA 1R3LA 2UVEA 4C47A 4R96B 5TK4A 3FB8A 4ZOCA 4CKQA 4DZ8A 4KJWC 5ITBH 5IJKC 4AJ0A 4KX8A 3M46A 1UWGL 5L8JB 5GGSB 3FSOA 3ESVF 5B3NA 2PN5A 2ZIDA 2MJWA 3OPUA 3IJEB 1E65A 3RNQA 1HXMA 2C1OB 4LF3A 2CALA 5SWSD 4ZX4A 1V8HA 3SDCB 5FR3A 3X2QB 1RXLA 4FQ1L 4KZ0A 4Y1AA 2P8LA 1NBCA 1T20B 5H37A 3P0GB 3VG0L 1WBXA 4L8SC 5F7KC 3ZTJH 1AKJB 3DMMB 3BFQG 1PJ9A 1RJZA 3LMJH 3RIFF 2CLRA 4UANA 3HNVL 2VKXA 4XH2B 1AQHA 2D4DA 4E9SA 3TT1H 5CEYA 4QKTA 4LHUB 1XGTA 1BQLH 4ZUVA 4EN3B 2IDSA 4TQEH 1IJ9A 3NIFF 2FH8A 1CDYA 5F9OH 2O61B 4JKKA 2I7SA 2NY0B 5TH2A 1JXFA 4AYID 1FZJA 1TPXB 3CZGA 2ZKHL 4N0UE 3MODL 5HHQA 1C5CL 1D5IL 3DRQB 2KYIA 3OF6A 1QBLL 3RZCA 3MCYA 1XGPA 3RPIB 3HNSL 3FCUB 5JYLA 1OB0A 3VFNA 5F8QC 4N8VG 6FABL 2HSIA 1KBBA 1JCVA 3SQRA 4LVNC 1CB4A 2K6YA 3LKSB 2WBWB 4TN9A 3P40A 4EN3C 5BVJA 1AO7A 2F2HA 1SJXA 1M7IA 3S96B 2HJFB 1V54B 1BXUA 1J10A 4NZTL 4KJQC 3H4HA 2OJEA 2VLRB 4PIBA 4UQCA 5EBLB 3MKKA 3HCVB 4MYWB 5AD0B 3D2TA 5ID1B 2XFGB 1S2EA 3L4ZA 4PJ7B 43C9B 3WGUB 1HNGA 4U7MA 3SDCC 4MMZC 4ZS7H 3PJSB 4JO3H 4MDRA 3MUJA 1OOWA 3RWEB 4Z78B 5F9DC 1C5CH 5E4AA 3BUPA 3G6JA 3EJTA 1TNMA 4B0MM 2OQJB 4JX0A 4E9RA 3DVNB 3FQTB 4BH7B 2P8LB 1H9DA 1JHTB 1PYWB 3KLHC 4U1LA 3ILQC 3K1KC 4XO3A 3B9DA 3LRSB 1R5WB 4YSAA 5DQ9B 4FQXC 1WBYA 1CDCA 3BRGC 2B1HL 3SZKC 1W72L 1BBDL 1HCZA 1CGUA 4G70B 2XFXB 3IDYC 3WO4B 4PMFA 4WW2F 5JIHA 5FWQA 3DUSB 3FB8B 3CX2A 3VFOB 2WM0A 1Z5YD 4PJXE 4PHZA 4EUPH 4A1RA 5IHBA 5FGCB 3PWPD 4P2OD 5KVMC 4FP8L 5LO7A 2YGPA 3S0PA 2IAAC 5GJTL 1A02N 1TQCB 2X9XA 4I18B 4NC1C 5FYKH 1N68A 2XXFA 2Z31C 4PSRA 2J73A 4GAGH 3RWJA 4Y4KA 3EYFA 4J3XA 4QEGA 3VXRB 5JIQA 1FG9C 1P9MC 5GGQH 4FYTA 1RK0B 3P2DA 5C0NC 5AWNH 5K33A 3LVEA 3FQRA 4K7PY 4A6YA 5C7ZA 1IE5A 4JCLA 3LZPA 2C34A 1A6ZB 3K74B 5BZWB 4BQBA 5BXFB 3P73A 1KXVC 3VFNB 4OLXH 1YMHA 3D85D 4XB3A 1CLZL 4Y19D 5IESH 3DO7A 5J4MA 1OO2A 3VNYA 2V2XB 4IOFD 3FS9A 1NGWA 5J57B 1IAOB 5AVYB 3TCLB 5IB1B 3RDTA 1OTTD 1QX1A 3LH2L 4CN4A 3WAJA 1HK6A 2HFTA 4N86A 2R29L 1MVUA 3A3YB 1HHHA 2WKOF 4GRLA 4E41B 1TU2B 3REWB 5I6KA 3CZFA 4LEXH 4AT6A 1UTDA 1LEGA 3VWJA 2F7OA 4K8RL 3K6OA 3DETD 3TP4A 2O6DA 3BOVA 1UH3A 4QHNB 1Z6JT 2ZUQB 3GTVA 1MCHA 1TJIL 1S9VA 3NIDF 4LESA 5K39A 5LDUA 3BO8B 1LO0L 3DC0A 3GC3A 2ZYSA 4OU3A 1W0YT 3KJ4B 4Y1AB 1F42A 3LXCA 3VXSD 1ORSB 4UTAL 5JPNC 1NLDH 5KBPA 3HW7A 5EF3A 4PYGA 3FTWA 2BOBB 3BYYA 4DGYH 2PXYB 4HJTA 2YD0A 1M1XB 2WSKA 4Z18A 3C09C 2B1AL 2ROYA 4YDMA 5DQJB 3UZQB 5E5LA 2ZPKL 1FFTB 3SQOL 2NNAA 3G5WA 2Q10A 2XQBL 3LYRA 3WNKA 2VLJB 4H5SA 4JRYA 1T04B 5EZOL 4OGYL 1T0PB 3RL1B 3WJMA 4M5SA 3WN5B 1QI3A 4PV8B 4DK5A 5IB3A 1T4KB 3TYGL 1N59A 3ILPB 4H8PA 2R8SL 2JSFA 1V3MA 2AW2A 2C9UA 2CR0A 3IDNB 1BQUA 5DSCA 4PJHE 5F3BB 3ULUD 4KI5D 3T1FA 1CFTA 3O0LA 4LL9A 1XCTB 2MRYA 2Q7AA 1C12A 1NBYA 3IJSB 4WY7H 4WTWA 4PB0L 1WG3A 2ZD0A 4PJDF 4HFWA 2OR9H 5DD6B 4K8RC 3TWYA 4WI2A 2VISA 1IIIA 1RMFL 1XVSA 2ZXWB 4TVPD 3S36H 4L1LA 1WEJH 4AQEA 2EDTA 2AHIA 3BPOB 4XBEL 1KC5H 1HHKA 1U8OA 4N6RB 4O02H 5D2LF 1S3KH 3T2NL 4NN7B 3G6JF 5E8EA 1E4KC 3VI3A 1WAAF 5SX5K 5MEQB 2ZZUT 3N1GC 1PZBA 4Q0XL 1OP4A 4AENB 5L88L 2DJ4A 4F92B 4NO3A 7FABL 1MFMA 1ZIBA 4N0UA 5GGTL 3MRNB 5D6CA 3QXAB 4U1JB 1N7MH 4PWEA 3QJVB 4U6HB 3HLAB 4PJAF 4I48A 2B2XL 1LP9E 4P06A 4OW6A 5HHMB 5DWUL 4DPAX 5C0DA 3UZVA 1U33A 2WXIA 1QR1B 4RCAA 3MRCB 4H0GA 3WY3A 5JOPE 3UO1H 2UYLB 3LMJL 3GJFB 3B3BA 4JM2A 3IPBA 3GNMH 1YPZA 5TE7H 1O75A 3VWKC 3IDJA 3TT1L 2J1XA 3L08A 1E4WL 2QV2A 5E00B 5EWIL 2J5WA 3LNHA 4Z3TA 5ISZA 3IFNL 2NR6D 4JHAL 2OCJA 4R6UA 5DHVA 4XN4A 1GOFA 3TN0D 2R29A 3BESR 1O7SA 4R9HA 1QABA 4OD1L 4PJGA 1YECL 3SGEH 4UV7H 1ZHNB 4MDJA 4OJCA 3QFJB 1K8DB 4K3HA 1GOGA 3VXTA 1NAML 1QBBA 5GJSH 1FLRL 1JMZA 1EZVX 3LNIA 3WL9B 3BW9A 3C60C 4DVRL 2MPAH 3PQYD 2XWBB 5D7KE 2C3XA 3RVVD 4L3AA 3QJFA 3ZUNC 2J3SA 4PD4K 3ZE0B 1JE6A 4LOEA 2QPUA 1ILUA 3I85A 2Q76B 4B9GA 2NNXA 2W8CA 4XMPL 1G0DA 1WFUA 5F3HB 3ZK0A 2EIZB 4P2QE 4MNQA 3UMNA 4QXWA 5T3ZH 1MRCH 3LRLA 3QRGL 1V55B 1UWEH 4YEEA 4O02A 1UYWL 3NJLA 2FEDD 1A4KA 3FF8A 4XPHL 1CJYA 1DDTA 3HC0B 4QHUA 5D1ZB 5EFIA 1CFQB 3FQUA 4Y16A 1AFVL 2B59B 2D7TH 4PJDB 4MD0A 3W9DA 4JPKH 1SY6L 4FXKA 4JDTL 2MNJB 3LV3A 5SWZE 4FG6D 4NO3B 2ED6A 1KC5L 4O02L 2B20A 2ZWKA 5T1MB 4KK6C 4Q58C 3NIGE 3AC0A 1NUNB 4G6KH 2FEEI 3IDMA 4JMNA 4JBSA 1DVSA 2WO3B 4HUXB 2G75A 1UGNA 1Q1JH 3HAEA 2R0WL 2BMKB 2BWIA 3ARXA 2DBLL 5HGAB 1A65A 1TVHA 5T5NG 5KS9B 3HE6A 2J8UF 1HEZA 4V2BA 4MJ5B 5DGQA 1I1FA 1UWEL 1XGQB 5AOIA 5EZJA 5AG9A 3FFOA 2QTEA 4PS4H 2W95A 1TR7A 1IL1B 1P53A 5ESQA 3G6DH 1KJMB 5FA4A 4QMEA 4W9DC 3THML 5CD3B 2XSKA 3MNZB 3O6FD 5F96H 4I5BB 4JGMA 4NM8L 4QRTB 5JDSA 2F58L 1LE5B 1E9OA 3F7YA 3U46A 3OKNA 5D2LA 4KTEL 1D6VL 3MCG1 4JHBA 1RVFL 4GI8A 4RIRB 1BQHB 2HVKA 5EO0B 4RZKA 4TM9A 3RTQA 2AVGA 1WS8A 3MV7A 4FQPA 4PREB 1FNLA 1MFBL 2CRZA 3V0EA 4AKPA 1BD2A 4PR5B 2BCKB 4NO5B 4EZMA 3ML9A 1GZQA 4OGZA 5HJDA 4ZW8A 1JXGA 3AW5A 3LZRA 3HHSB 2VMDA 1J9RA 3CDZB 3CN2A 2X1WL 4UZUA 5IW1A 4CBZA 2EKSA 2EIDA 2PWFA 4ZTOH 3S6CA 4J3UA 4HMDA 5T1DL 4DP6X 1CFNA 1GGBL 3HS0A 4XPGL 1LEKA 1OM3H 4CJ0A 2R1WB 1YC8A 3FMGH 3GB7A 2IWGA 4KUCD 4E41D 2YQBA 3H53A 3JUYA 5C09B 3CVIL 4R90L 2AEOA 2QFPA 2B9AA 4Q74A 4TSAL 3S98A 2NX5D 1U3JA 2ZX7A 4WHYG 4WFHD 2E6QA 1AZCA 1MRCL 3FU9A 3QRGH 4PJCA 1U8CB 5D1XA 3EXLA 3WIFA 5I23A 1N0XL 1OGTA 4U7SA 5D1XB 4A2HA 3CPLA 4XB8A 1VZGA 3ABZA 2VR8A 3MGAA 3RY6C 1HT6A 4KITB 3UAJA 1II4E 3SN6N 5DT1L 5I1HH 1CFBA 5AOKA 1EHKB 3CDYA 4UIKH 2VXSH 1E40A 3I6GB 1I9JH 1MRFL 1N70A 3QRLA 3SPJA 3HHRB 3AS0A 3D2UA 1MOEA 3QJRB 2NT0A 2H4EA 1KYDA 1XL6A 2R0KL 1N6VA 3FQRB 3PL6C 4PJFF 2UXTA 4QHPA 1A6UH 1H0DB 1RP9A 2CM6A 3GJEA 4K9EC 3U7AA 5KSBF 2ZUSA 3II1A 3L3IB 2FGWH 1MUJB 3X1NA 4MNGA 5JW3L 4B41A 3NSDA 1HSAA 4S2SB 3TC9A 5DJCB 3MTXA 5E6IB 2Q7NA 3R06B 4HJ1A 4GYBA 3WSQL 1IMHC 2YD4A 2Y7QB 2DQIL 3D69A 1V27A 3F5WA 3TBCA 5FHBH 1XZ0B 1G7HB 4M6NH 1WFTA 4LSRL 1A47A 3BC9A 1BIHA 4HOZA 5MI0B 4HUCA 1U93A 1FRGH 3VW3L 3WFZA 1YPZE 3HBZA 4Y4FB 3AU1B 4BINA 3JV6A 3Q2LA 1R19A 2G30A 2Q8BH 3O8XD 3BIAX 4IDJL 2ADFL 3LZNA 1U93B 1KGIA 4PJ8D 5KSUA 2XN9B 2XUWA 1NOFA 2Q3XA 2WGNB 4NNPL 5C3TA 5INCB 4N0YL 1NTDA 4Z1PA 2X4SB 1MWAB 4M7ZB 1N26A 5K1NA 4OQ1A 4LBEB 1E4XL 2P5EA 1KFAH 4NQEB 4YBLC 4KH2A 2OM5A 2V7NA 5C97A 5I71C 3MLPA 5JXED 1NGQL 5JDJA 5C0CA 2GTZA 2FJHB 1DTUA 2HJLB 3BGFB 2YC1B 1PG7L 3JVFC 1MQKH 2J56A 4ZOAA 5C0RL 1Q9LB 2V17L 3QUMB 4JG9A 2BSTA 3VAEA 5IGXH 1ZDSA 4J4PD 4XAKE 3VTAA 5DYFA 1YSOA 4S1DC 1IB5A 1HC1A 4RFNC 5KG9B 3OXSA 2NZ1A 4NQEE 2R0LL 3BUBA 4WU7B 4PCYA 1ETB1 5BVJB 1ZTXH 2CSPA 4BSWA 4FN0A 4ZZFA 2YBRB 4Z3EA 5AW8B 5CILH 2CJTA 1J12A 4M1CD 3T04D 4HFUL 4YHIB 1OGTB 5JO5A 4G82A 1UD2A 2D7QA 4LHUD 2W07B 3WELA 3O6FA 4JLRB 3GS7A 5K9QI 3IJYA 4JPQA 4TL4A 2RD0A 3FN3A 3LN4B 4C4KT 3LQZA 4MAUL 1FJ1B 4R97B 3ZO9A 4ZD3H 1OV8A 3VFPB 1A6UL 2ED8A 1A0QH 3EUUA 2X9WA 5B22A 2VN5A 3OPZH 4S1QL 2QMKA 3OQRA 1EGJA 3HHMA 2Q2EB 2NY6C 3US1A 1AR2A 3B9KB 4TMPA 3JV0A 4CL7A 5KVFH 5HP5A 3SPVB 2X4NA 1PTZA 1SGKA 1SF5A 1SLWA 2NXZB 2VDNH 1HKLH 4R3SA 4CC4A 1SDYA 3PWVA 3N0AA 2C4FT 3PYCA 2HWZH 5DVLA 5JR1L 2JJSC 3M8OH 4MQSB 4NM4L 1U8PA 3ZXAC 1E67A 1X5GA 2Z9TA 4MJ4A 3MJ9H 2C9SA 2R1XB 3GRGA 1UOKA 2OJZH 5CJ8A 3WIAA 5JXEA 2IPTL 3WKML 4OF7A 4CSPA 1OWRM 3PUUA 5JPMB 3C2SA 1QPKA 3ARGB 3GMLB 4H8HA 2FSDA 4R97C 1QSEB 1EFXD 3B83A 3EOTL 4TQHA 5DJ6B 3GKZA 4JFEE 1M56B 3MKGA 1H0DA 2XV2A 3RIAF 1VGEH 1CLVA 2D3JA 4QRRD 5EZJB 3TXAA 4NDMA 3IMUA 2CLZA 3PPSA 4N2HA 3QIWB 2W0PA 2YEQA 3CZLA 5FO7B 3GSVA 1A3RL 2PTVA 4FHBD 4UQDA 1IM9D 4HU8A 2OZ4A 2WQRA 1TZGH 1NPUA 3I02A 4M48L 5D7JA 2IBGA 3AGVA 4YZWA 2ITDA 2CD0A 2VISB 3GBLA 5HVWA 4RZCB 1NCCL 5HJBA 3AT0A 1SEBB 3MC0A 4UT9H 3VYNA 3OMZA 5CFHA 2QSCH 1AG6A 2BLFA 3NCEB 5K69A 2PO6B 1KGCD 1J86A 4TNFA 4WFGD 5FXCH 2ID5A 3OKOA 3BD3A 4ICWA 5ICUA 3X3GL 2O93L 1RVFH 4AW7A 1H6FA 3HKFA 2OXGB 4FYRA 5E8OB 5FDWB 1DJYA 4XHJD 1RFDH 5HHOB 3RPBA 3FXIC 2YEZA 4P4KC 1T04A 1V5JA 4LMQE 4W9JC 1DQJB 1DDHB 2XTJE 1DE4A 2ZNWA 1ID5I 3QQDB 2ED9A 4A6YH 4GW4A 4ODWB 3QDJD 5EU5A 1IGML 3VFVB 2PXYA 1A3ZA 4AEEA 1G7LA 3UTQB 3LS5H 1S9KC 1NCCH 4X8JA 3GNML 3VSQA 5DK3A 4XR8C 4TSCH 2G4GA 3I9GH 3O3BA 2BNQD 3U6XA 5GGUB 3V0VA 4FQXD 5EU7E 3BO8A 4J3VA 5FPIA 4WDIB 3L7EB 4ABUA 5ACLA 1QHQA 1MFCH 5CD3A 1SLVA 5IB5B 5CUSH 4AV4A 3ZY7A 1U8MB 1Z9NA 4BV1A 4W9FC 3P3SA 5DC4B 2X4QB 1Z3GH 5FYKU 2FT7A 3ZU8A 3CLFL 4B9YA 2UZYA 2HTLD 3VSTA 1JPST 1I4FA 4HULB 1YUKB 1Y1DA 2K7QA 3SKJH 5IESL 4ZO7A 1AHWC 5IVXB 5MEOB 1PZSA 1IFRA 4OFPA 3OTTA 3HG2A 3Q44A 4XN9A 4JHUA 4ZMAT 1OXYA 5AKVA 5EBMB 3QXUA 1RULH 4NQSA 4DUXA 3UGEA 4JK0D 4NRZA 2KLTA 3FRUB 3VG0H 1E5AA 1IC7H 3ARZA 5FWRA 1B2WH 3Q7JA 1QUNB 3SGJA 4MD0B 1L6PA 2HFFB 1JZ8A 1GHFH 2DQCH 1F45A 2GC7C 1GTNA 1CFQA 2C3WA 4OCWL 2GUOA 32C2A 4FFVD 4QHUB 5C0IB 1YN6B 4U6TA 1ZGLA 3EYVA 4N6RA 4N3UA 5JMRA 1BM7A 1I7UA 3E6FA 3EG9B 3PL6D 4LLYA 3H3BC 1I8MB 1MAJA 2A6DB 4PWIA 3L95A 5H4ZA 1XBRA 3RB5A 4YDIL 4Z7AA 2PTTA 3SE9H 1X9LA 1T0NA 3WFHA 2P47B 1E4HA 4M4RB 2Q7YA 2Y06L 5BO1L 2EDLA 4OZFA 1AYOA 2O30A 2BSBA 1KJVA 3PDOB 2R59A 1ZWIA 3L5IA 4WZ9A 5BUGA 1RULL 3F7PC 1P7QB 2UY7A 5CU9A 3BW9B 2I9LA 2X40A 4WKZB 1NBQA 5DD5L 1S5HB 1WC7A 2OTWA 4JFDA 4MB3A 4KUCF 4U1IB 5AVTB 3ZTNH 1ZHNA 2BVOA 5I0XA 2LLGA 1MHPH 4G6AC 5B3JF 1O7DC 3O8XC 1JFQL 1BPLB 2AFNA 3QO1B 4PJ8C 1A8JH 5DJXA 1DSYA 3ISRA 1DBMH 1DFBL 2X4PB 4BSJA 2AJZA 4NZJA 3PV7A 4DOHB 3N40F 3Q9QA 4KTDL 4DEPC 4AEIL 2VLMD 1A25A 3KPRD 1LLAA 5K9KA 4DGVH 5D2NB 5AD0A 3D3VD 1W6WA 1RU9L 1WEJL 2A4ZA 2WLHA 3O3DB 3QDJB 5HGHA 5C0AD 4XP4L 3GBDA 4LAJH 3AABA 5HHVH 5B38G 1NWOA 5F6HJ 4EXPX 2WUBL 4EVNA 5MEPB 5HY9B 1THAA 4GW1A 4L8CA 2FYYA 2BM3A 5DTFB 1D5ZB 1FVEA 1ADQL 4UQ2A 1XCWA 2K4WA 3DTXB 3EGDB 2HKFL 4BFNA 3NQKA 2BIIA 4JFTA 5DEFA 3TBWA 4YXKL 3W0WE 2A83B 3ARBA 4C4KO 5CFAA 4F2EA 1EAJA 1FZJB 1IAOA 3QDMD 5BQDA 5CEXA 1XF1A 1BFVL 4AJWA 3TO2A 2W1NA 1OAKH 2G60L 1N67A 1K4DB 2BIMA 2F8XC 3OZ9L 1RUML 4EQ3A 2YOAA 4HDIA 4U6XA 3UZEA 5ADPH 5F7WC 4JRXE 3BSHA 1RIVH 4X9IA 3NIGB 4A6YB 2H6OA 3LXBA 3QHZH 4TF4A 5B7MA 4JFVA 1IM9B 1DEDA 5I6PA 3VSUA 4GBXC 2MNWA 4B5EA 1FGVH 1I9JL 4HMCA 3VXRA 3DIFA 5DMKA 4L4JA 2OMVB 1JZ2A 3RWJB 3UBXI 3VFSB 1J0IA 3IT8D 3ZR5A 3GGWA 3QS3A 3QFDB 1FFOB 4GFTB 3E1F1 1UKTA 1G7JB 3GO1H 3JYBA 2RTTA 1PG7X 2F9BT 4XVSL 1LQBC 1KF9B 1TTGA 2FQGA 2N56A 4ZXBD 3NRQA 1EFXB 3F12A 3APFA 2I07B 2HH0H 4PJCF 5CXPA 1BVLB 1DQVA 1P1VA 3DXAA 1XEUA 3MLVH 5BS0E 1QYGL 5D7SH 2BSDA 2FJSA 4R0LA 4PWHA 2AXFB 2DWDB 3B5TA 1XF5A 4H4NA 1NANI 5FUOH 3MYZA 3W2DL 4DKEH 4EDWH 4XVTL 2PYEB 4KKAD 4JN2A 1FG2B 4G42B 3IKCB 1AKPA 1J9TA 1KXTA 2ENYA 2Y2TA 3MNVB 4ELME 4YHZL 3NTCH