2LR4A

Nmr structure of the protein np_390037.1 from bacillus subtilis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
128
structure length
128
Chain Sequence
GAEALPLYYLQITGITSDGNDFAWDNLTSSQTKAPNVLKGNKLYVKARFMGYTKLTVITGKDGKNLLYNGTAKMFKSDAILGQNKVVIGWDKYFEIPMDALQDNSIQIKALSSGTTFVYSQKIDFERE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPBc2 prophage-derived uncharacterized protein yolA
publication title NMR structure of the protein NP_390037.1 from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 18
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16219 DUF4879 Domain of unknown function (DUF4879)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2870 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2lr4A00
2LR4A
chains in the Genus database with same CATH superfamily
3RTLA 2B77A 4U1IB 4QRRD 3UTOA 1NC2B 4BQ8A 5I76B 3WE6B 1CFVL 1AHWC 4WI9A 1NOFA 2WTRA 2X7LA 1S9KC 2IJ0C 1OGAD 2BDNH 4J2QA 4LPXA 3BW9A 3OKLB 3H53A 4ODHH 4TOYH 3RFZB 2Z8SA 4OQTA 2BSSA 4JVPA 1PZAA 2AJYL 4OIFA 4Q9RH 2ZNWA 1U2HA 1UATA 2Z8VC 4RAVB 1HYRC 1JFQL 3CC5A 4OF8A 1XSOA 4WHTB 1KZQA 3FCUB 4KITB 1J0YA 1GGBH 2VZSA 3OLIA 4E42A 2A1WH 4GQRA 4C59B 1RZIA 3K8LA 4DWHA 1YEGH 4YX2H 5KSUB 5C0FA 1E4JA 3MODH 4LMQE 4WUUB 4A6YH 1JUFB 1T5KA 3HNSH 4ZOBA 1XSKA 4P23C 4P2QA 3HZ3A 1FIEA 3MRBB 3D8MA 4O51A 1FL6A 1KGWA 3D2TA 4PRIA 5TQ2H 1QNZL 3SY0B 3WDHA 2K0RA 5DMGD 4AXWB 4S0HA 4Z0BL 5TK2A 4X0KB 1A3ZA 2BRRH 4OLYH 2FLMA 3NJGA 3IDJA 1R3HB 5DVMA 3SBQA 2F19H 2XQ0A 3EF4A 4HK3J 4HLZG 4X4YA 2E9GA 3EBAA 4PS7A 1T2QH 1P4BH 4FG2A 5KS9A 3IPBA 1ACCA 2ADFL 3HI6H 4IIQC 3D4GA 5A2BA 4RWHA 1JF6A 4M6NL 4ATTA 1TVHB 2E7BA 1GXEA 4R5XA 3K4DA 2PCXA 4WNSA 2OSWA 1D5MB 1RJZB 2ICEC 4XCNA 5KBLA 3MBWB 3DX3A 4YHLL 3T0EA 2XX1A 4QRRE 4YHML 4FULA 1YYLL 4Y5XC 3MHZA 2FYYA 2D73A 3KXFD 3QBTB 4KRPC 1NMBL 1KYDA 1VACA 5B39G 4LEXL 3EH3B 2BNQD 2XKNB 2FGWH 4LASH 1FO0B 4P5KB 1OGAE 3NIGF 2CLRA 4M5YH 4X6DE 4Y4HA 4D8OA 4NFCA 1O7DE 2YA1A 3NSCA 2LVEA 1VGEL 1M6OA 1MHEB 1PY0A 5C08B 1TFHA 1LP9A 2A77H 2D7MA 4R26H 4GBXC 3NFSL 1CU4L 5CEZD 1R47A 2TSAA 4LLUB 4F33B 3NCXA 2EEBA 1K4CA 3BT0A 4U1NB 2AK1L 5I1AA 2X40A 3ZDWA 1NKGA 1D9KB 4QF1A 4R9HA 3FTGA 3PWVB 1UADC 4NUJA 2EYSA 2XJKA 1I8IA 4ZTEA 3L7FB 4KKRA 4KNSA 2F7RA 5FLUA 2J8UF 4IRJA 1A4JB 5GQBA 2DQUL 5CLWA 2EDYA 1TJGL 3KVDD 3TBYB 2ATPB 3BEWB 3EYQD 2ARJQ 2VIRA 3V4VB 4PB0H 3LAFA 5HYFA 4KY1H 3ETSA 3TEUA 1N3NA 2A74A 3COOA 4YLQT 5DRWA 1CD9B 1AXTL 1WZLA 2CDGA 4ZOEA 4AMKH 3SDCC 1H8LA 1NEZB 3IXAB 4L2LA 1CLZH 4ZUVA 5CZRA 2EH8H 5E6ID 1AZZC 5DFVD 4PJFB 2V37A 1AGEB 2QQNH 3MSPA 4KUCD 1Q9WA 4N1HB 4X80H 2OI9B 1EJ6A 5LBSH 1SF5A 3KL3A 4DQAA 2BX5A 4QIRA 1DQLL 3DK2A 2H7WA 4TSAL 4BFGA 2CDEA 4WFFE 1P7QB 1S5HB 3P73B 2X1PA 3HE6D 2DN7A 3RA7L 1DZ0A 1WWCA 1OAUL 5J1TC 1J1PL 2IBGA 4PJ8A 3O4LD 3BSHA 1JPSH 1TU2A 1FAIH 3BZ4A 3KXFE 5HYJB 4KK6D 4H8QA 3PWPA 5I5RA 2GITA 3ZKSD 1QSFD 4XE0A 3O81A 3WIHL 4W9IC 4D8PB 1I7ZA 3B3IB 4E5XA 4YDKH 5I8OL 4F8PA 3RDTC 1U92A 4L4VD 2B1OA 3VFOB 1MLBB 3JWDL 3X12A 1RK0B 2E27H 2NY7H 2CBQA 5CEZE 2NY0C 4NKMA 2B9AA 4TN9A 4HEME 4BFFA 5HY9B 5JXED 1I3RB 4KJQC 1F18A 5HHVL 1RQ5A 1OAKH 2BW4A 3JVFC 1KC5H 4ODUB 2Q87A 3GUTB 4F7KA 4YNYA 1CK0H 5GGSA 1M1SA 2CKBL 1KOAA 4YGAB 1CG9A 5EU6A 5GZNA 3RIAF 1B0GA 3MKKA 5T3XD 5AZUA 4WO4D 1MVUA 3B7UX 5CN1A 4CDHA 2DQJL 2FAUA 3L2LA 4HIPA 1BD2D 3VQ1C 5E9NA 5ILTL 1CF8H 2WVSA 2XRAH 3GJFA 1RIUL 4PS3A 2Z7YA 3IKCB 3O3AB 4XNDA 1W91A 2B4CL 4UOJA 2R23A 3V4PB 3QZLA 4GAYB 2E9IA 2GIMA 3OKMA 4J12A 1QBLH 4DP7X 1KULA 1SHMA 1RK1A 3T2NH 1MCCA 2XWTA 3MZGB 3PDDA 4KMTH 3FQ4A 5CCJA 2KS0A 2OTWB 2Z31A 4JG1H 4UQCA 2WWMD 2YUVA 4D0CA 2F54D 1THAA 3CVHB 4H25B 4LSPH 5I6OA 4FQCL 2LV4A 4FTVA 3LRSB 3O4LE 4UB0L 1JL8A 3JV0A 4DGIH 3KWWA 3OWEA 4Z8FH 1H5BC 1T83C 1MFCH 4G72B 1IU1A 1DBKH 5KOMC 5KYNA 4XPTL 1QSFE 3QA3A 3HG3A 3ULUD 3MJ9L 1QFWM 4KTDL 5D70L 4MNGA 3ARDD 3K0WA 1LJMA 1A02N 4JFVA 4PLNC 2AKRB 2K6YA 5BVJB 4F93B 1GOHA 5DD3L 5CCKL 5AKRA 4L4VE 4Y9BA 1ZPLA 4NJ9H 3DTDA 4RGNE 1RZ8A 3WE1A 5CEYA 1J9TA 3T8XA 2ZXDA 1WZAA 3W0WA 3DTXB 1CD1B 4LSSH 2XV0A 2R8SL 3WO4B 3E8UL 2E7LA 3FONA 3MRGB 4CBPA 1YN7B 3B2VL 2BHUA 4PV9B 5FO2A 3U46B 2GB2A 4GKLA 3PGCA 4XNUL 1MW2A 1T89C 1DVSA 1MAJA 1TEGA 1VEMA 4R3SB 5DJAB 2AERT 4Q6IB 1L9TA 5F9OH 3BVWA 1PZDA 1BVLA 2WO2B 5BQ7A 2YAQA 3QUZA 4X7TA 2RFXB 4YR6A 3TYFA 2WC7A 4XOEA 2X4UA 4PJXA 2FSDA 3QORB 4WW2A 2WBKA 2DWEA 1BD2E 4PJIB 1F1AA 4X6EA 2AQNA 3KYMB 1X9QA 3QUKA 3LKOA 1F58H 4JDEB 3WLBB 3BVNB 1CI3M 1HOCA 3DJTA 3JWNH 4TUJB 4E41D 4FABH 5I0VA 4G7SB 5IMMA 1AJ7L 3O2WL 4QOKD 3RUGE 1A7QL 1KJ2L 3QJFA 4KK5C 2PCPA 5HVGB 1UWEL 4GRMA 4HFWA 5D4JA 3U4AA 5D7IF 3IGAB 3LVTA 1CE6A 4DKAA 2F54E 4D0BB 3Q1SL 4ZYKA 5AAMC 3RIFF 4F9LC 1RK7A 4TNFA 1N9PA 3ORJA 5E2UH 1R1CA 1A1NA 1IGIH 2GT9A 4FQ1H 3BAIA 4ICXA 4PY7B 2Z3FA 1JV2B 3QXUA 2P48B 3JWDC 4EUPH 2FB4H 1M56B 2LU4A 2B5IC 2X2YA 1KBPA 3CN4A 3MUZ1 4TTGA 2H47C 3Q2WA 1IKFH 3CHRA 4GO8A 5KG9B 3ULUE 4K5MA 1TQWA 1BOGA 3MFFB 5CWSB 4J2XA 4NNXB 1U33A 1ZWIA 2ORBL 4B9JA 2GTQA 3FQXB 3BESR 4PJHB 2V5RA 3CHSA 4P05A 4HC1L 3ZK0A 2YD7A 1S7RA 2MOVA 1ZT4B 3OKKA 3AMKA 3BVDB 5DK3A 2EDHA 4E9RA 3Q5TA 1B88A 1H8OA 1CD0A 4UT6L 1IT9L 2W88A 2JCWA 4X42A 5IJKA 3V95A 3PCYA 2GBUA 3CSTA 3MKGA 5F72S 2K9FB 1RUKH 2QV4A 5DQ9A 2B4CC 4GLRH 1AQMA 5DRNB 3AGWA 5F1IA 1AAJA 1IFGA 1U8NA 2C7UA 2FJFB 2YXVA 4I1RA 4TVSa 3NCEB 1WA1X 2OAAA 2CR3A 2ZOLA 1OCCB 5FM5M 1MCWW 1QFUH 5A2AA 2K9UA 3QJQB 2NY1D 3C6LD 4BZ2H 2D0FA 2GAZA 4Y1AE 3LB6C 4DF9A 5IWLC 1SHSA 2BVUA 3BKML 3B2PA 3MRJA 4MA1B 3F58L 1QEWB 1J88A 1X3DA 3ZDXF 2G60L 3EDEA 3GBNL 1F8TH 3QUMA 4AWJC 2OTUB 3C9NA 1EUTA 2G5BA 2NLJB 3CSBA 4PRHB 2XTJD 4DHLA 1FGNH 1FC1A 1WCBA 4HHAB 1BZQK 1L6PA 1QOKA 1V7MH 1WF5A 2ZXQA 4JFDD 1YY8A 1M6UA 5BS0B 1KACB 4KVCH 5FLVA 3QPQC 3Q1EA 4PJGF 4WWOA 1FNFA 2LLNA 3LKNB 1B0RB 3GPEA 1H6EA 4TM9A 2CJTA 1E2VA 5B4MD 3BAWA 1C5BH 3OMNB 3U7AA 1QUPA 5F89B 1OD7A 3GTNA 5IM7B 4YXLL 2X1OA 3BKYL 3PDOA 1E5BA 4OGQC 3TA3A 2VO8A 4DAGL 5DR5L 2BSCA 1RIHL 1RZ7L 1UA3A 2M26A 2W9EL 4KQ3H 3IGFA 1L7IL 1RIVL 4LLMA 1KTDB 1MIML 3I3DA 4LO9A 1WDAA 4Y2DB 1UWXH 3VFRA 4G9FA 1OSEA 2GG1A 2UZXB 4XAKE 4C56D 4HWEH 1DN0B 4HU8A 1CQKA 2J6EA 1CFMA 2OJZL 3L1FA 4YUEL 5F6HI 1CLOL 4YS4A 2R2EA 3K6IA 2VN4A 5EU7C 4NN6B 2AI0L 2WKOF 4P5TD 1YNLH 3C6SA 3HG1A 4MYWB 2FJGB 4J3OG 1HNGA 4Y9FA 2QTEA 4NO0A 3S3DB 3E6FB 1U3HB 3FQNB 4V1DB 3C5JB 3CMOL 3PWLB 4Q56A 1A3RH 4Y89A 3U9PH 3IPFA 1DEEA 5DF0A 4ONGH 1T4KA 3AROA 4K9JA 4PUBL 1UUSA 3NIFB 4I18B 1PU0A 3IFOB 2LAGB 1NKRA 5I8EA 4EZMA 3SGJA 3P4MB 1EZVX 1E9QB 4X5LA 5ADPL 5FOBB 1A9BA 3TCLA 1ZSDA 4RZCB 4JDVB 3QHFH 1T3FB 4Y16A 2XTJE 5F6HJ 1MVFA 3OV6A 3CIQA 2FEDD 5EOTA 4CVXB 4RDBA 5I1HL 1OK0A 2F1AA 3ARPA 3HR6A 1KF9B 4LDEB 1UACH 3QJXA 5E7BA 4JN2A 1MAKA 3OZ9H 1OT1A 2FX7L 4GPVA 2RR3A 2HT4C 3ECQA 4Q9CA 4Z78A 2Z0UA 1X5HA 3PXHA 1A9EA 2D0HA 2EDXA 4ODSH 1Y07A 3IFNL 4ETYA 1KPRB 3TA4D 4WU5B 2ZOTA 4O02L 5EORL 1T1YB 1XGRA 1EIBA 2FLRT 3LKPA 4G8AC 1S7UB 4QHUB 3ZGIA 4ODTH 4YZFF 3GIZH 5DRZB 5F1OB 4FHBD 3VWJB 2H2PD 2D7PA 3GSXB 3O6FB 4IOFC 1Q94A 4N2MA 4OD1L 3SKJH 2J5WA 2NDGA 1H3WM 2EXTA 4MKMA 4NQTA 5FM5O 4F57H 1M7DA 5L2KA 3GMQA 4EMZA 3CSFA 1ZAGA 2ZUQB 4Y2DC 1DVFA 4IBZA 4Y4FD 3VACA 3V0WH 5DEJA 4RFOH 3FQRA 3DIVA 1UXMA 1ZHLB 3D18A 3H9HA 3PWUA 4Q9BA 1A64A 3LNEA 2GCYA 3HN8A 4J3SA 1DUZA 3QDJE 4LL9A 5C08E 3T0DA 1MREH 3MI6A 4HKJA 2HT3D 4LDOB 5B1AB 1ZDSA 4QY8A 4JZJB 4DO4A 2HJFB 4J6RL 4BFKA 2YD3A 2FWOB 2ENPA 5GSRB 5FYLD 3ENEA 2HLAA 3EGXA 1E6OH 3AG4B 3GI8H 1G9NL 1DHKA 2WB7A 4Q52A 1MH5B 1F02I 1FL3A 1XAUA 1FORH 1BM3H 2EDFA 1WFTA 3DMMD 1XIWC 3FFCA 1O75A 2DQCL 5TQ0H 1JZJA 4M9PA 3D0VA 2K7PA 1TUPA 4G7RB 4N5UA 7CGTA 3BO8A 1I3UA 3QFJB 1DJYA 1ORQA 3PHOB 4HPOH 1N59A 1YEGL 4FFZH 4N4YB 4YX2L 3DX6A 5E1IA 2H1PH 1AO7D 1LNUB 4JY5L 4HJ0D 3MODL 5IROA 4A6YL 5J6HA 4LRNL 1RVFH 3HNSL 2VC2H 1HJBC 2APXA 1INQA 1FFRA 3UZQA 1EAOA 2C9SA 2I25N 1LDPH 3LRMA 5TQ2L 4JG5A 2YD5A 3T1FA 3V4LA 4B50A 1S9YA 3R4RA 5K69A 4HOXA 4UOW0 4PJ5B 4C55A 4QRSA 3MNMA 1LE5B 3I74A 3AJ7A 3UP1A 1XR9B 1EFXA 3X3GL 3UJJL 5K9KB 2R15A 4G8GD 1IM3D 2WXQA 3REVB 2F19L 5FYJU 3GKWH 1E7VA 3PL6A 2NDFA 5J12C 4X6BA 3REWA 2B14A 1T2QL 5AVWB 3O6FC 1TNNA 3BVVA 3VH8B 2V9RA 4NQQA 3MJ8B 3EH2A 3FULA 5B1CA 1G0DA 5BUPA 1CURA 4V33A 1OHZA 3BIKB 1U91B 1OALA 1WTLA 1FI8C 4JB9H 4N0UB 4Y2LA 4ANKA 2XFXB 4XN2A 1CWVA 3LEXB 1LEIA 3PAUA 5CD5D 4N0FA 4Z23A 4G70B 4LCVA 4NSKB 3HPLA 4AVIA 3C5SA 5I1KH 4JFPB 4B3VA 4PJ7F 3ABGA 4X5XA 4LASL 2J1ZA 2CBPA 4PQXA 1AG6A 5B8CB 1R9FA 3BEVB 3MRDB 3OJVC 4BK8A 4JFOA 5KUMA 4M5YL 4ICWA 3HUJE 1F4AA 4AGQA 3PQYA 4B9GA 3R8BB 3EYOB 4GQ9H 3RPKA 1HHHA 4JVUA 3DSNA 5BNXD 4O2FA 5T8IA 5EDXA 4U1IA 1O9WA 3A21A 4QJ4B 2LU7A 4M56A 5JZ7C 1NC2A 1W6LA 1ZE3H 4GAGH 4BE6A 4KNQA 5I76A 1AO7E 4YZWA 3MLWH 3WE6A 1D2OA 4C57C 4JO4H 3TBSB 2FEEL 1K4DB 1QRNA 2P24B 1NQBA 5E2WL 5EEZA 3MV8D 3II1A 2XOTA 4XZ4A 2R59A 4KO5A 3GMLB 4TQIA 4PYHA 3K72B 3EH5B 1AG0A 5D1QA 1UJ3B 2D4DA 1NFDE 4RAVA 4S2SB 5EOQH 4OT1H 2XWRA 4DW2L 5GS2H 5DDHB 4MCZB 3LIZA 1C08B 2BVQB 3PRZA 3QUYC 4YDIH 5C09D 5DK0B 3KVPA 5EEWA 1OM9A 2QKIC 4G8GE 3TJHC 4LXFA 3VGEA 3MUY1 1IL1B 4YE0A 4JKWA 5FKPB 1WQVT 3NJHA 3QFDB 1JUFA 3GLAA 3EGSB 3HN3A 3X11B 3B2UD 5JA8B 3MRBA 5LBSL 4ZNEA 4X80L 3P3UA 4AXWA 4IKKA 4X0KA 3EJQA 4XNYH 1BAWA 3KH4A 1HINL 3T8VA 2C1OA 1BECA 4ZD3L 1VSCA 2GK2A 5EOCH 4KKZA 4PGEA 3DXAD 5C0GB 3EZ8A 3N5AA 1R3HA 4GY4A 5KZCB 1M7UA 1ID2A 1JPSL 2YUXA 35C8H 2RACA 2NNAA 2W07A 2K1MA 5A2JH 1L9RA 2HX7A 2Z9TA 5DS1A 3KGSA 3FO1B 3QR2A 1NWOA 3UYOD 1M7XA 5CLXA 4X5RA 2NZIA 4D9QE 2ESVB 1TOXA 1SLWA 2IANE 3SYAA 5IBLD 3MLVH 1TVHA 2VSCA 5DI8B 4IHBA 3GGWA 1RJZA 5GSVB 2ZICA 4ZXBC 3MBWA 3MV11 4YVNA 1CUOA 1F3RB 2VDRH 2NY7L 5B8CC 3DHMA 5IG7A 1GW6A 3OJMB 2FO4A 1DSWA 2ERJB 4KDWA 3VB9A 2IPTH 2QGDA 4P5KA 2IEPA 2WMPB 3KPRB 1NANI 1XF5B 5SV4A 2G9KA 1CICD 4FS0A 1UEMA 2HJKB 4G6AC 2VLRB 4KQ0A 1UH2A 5HGHB 2Q7AA 2QPFA 5HSFA 1MHEA 1V8HA 1AC0A 4L8SB 4F7EB 4NRXB 4UWQB 3DIDA 2PKDA 3NP4A 4FQXD 4LLUA 3O11B 2EDNA 1YSOA 2X4TB 3ISRA 4OF3A 5C09E 4F33A 3IDXH 2OMYB 3RVVD 3QEQD 4PS4H 4UYPA 4GG6F 1D9KA 2E9BA 4M8QB 4OD2B 4RGMC 3W82A 3PY9A 1W6WA 1X9LA 4J4PA 1KN4H 3PWVA 3IPEA 3II3A 1JPTH 4PS8A 5I0WA 1HKFA 3DJ9A 1EHLL 3VXRE 5I1GH 2UUDH 3K3QA 1IIKA 3CK0H 3BUDA 2EUZA 2H3KA 3VXSE 3B8YA 2EUXA 3H9SA 2EXSA 4PJ9B 4ACPA 2GABA 3TBYA 2ATPA 2BZDA 3ZXAC 4KPHH 5SX5K 1OE1A 3V4VA 4FG6C 3AQDA 2Y2TA 4WK4B 1M53A 4QXGH 1UCTA 3MRHA 1IC7H 4RFEB 2KMWA 5DU7A 4Z8FL 1ZRUA 3IXAA 1MFCL 3MLTB 4BFRA 1HDMB 2ZWZA 4PJFA 2JQAA 1AGEA 1OZTG 2HFGH 3KGUA 2H1XA 5ANME 1RUPL 3CH8A 4R90H 1IGFH 5DT1L 2AJXH 3C5ZB 3S2CA 5TE7L 1P7QA 1S5HA 3B9KC 4N1EA 5SWQB 4HG4K 1N18A 4UZSA 1U42A 2AV1B 3V4UH 3FRPB 1YQVH 2P49B 4KJPD 1ZVHA 3BDBA 4H8WL 2UX7A 5HYJA 4WHCA 2NY3D 4LOUC 2Y7NA 1WISA 3FT0A 3O6KH 4LSRL 3DURB 2KQMA 2P4AB 1HFUA 3IN2A 2H3XC 1FVEB 5T1KB 3HC2A 1IAOB 4WW2F 1AS8A 2W9LA 3I6SA 1H0DB 2LOEA 3VFOA 2ERJC 3IE4A 3MXWH 1E9PB 4NQUA 1MLBA 3I75A 4ELKB 1RK0A 2OLDA 3ALXA 2VAAB 1PPIA 1TMCB 4UV7L 2JELH 3DECA 1Q9KA 5HY9A 1V7NH 5F8RC 3VDBA 1I3RA 3QEQE 3O3DB 4ZDHA 3QQ9C 2HYMA 4S10A 3GUTA 1X5IA 3D0LA 4GRWE 4MNQD 1IIIA 2IWKA 4H26B 4JCWA 1KGXA 3F7RA 1MG2C 1OP5H 2E8ZA 4OSUH 3DVIA 5E24E 3DOIA 4NHCH 3AY4A 1TZGH 12E8H 2GVYA 1QLEB 4OJDH 2ZX5A 2XJLA 3OM3B 4DCQB 2EO1A 1QZ1A 2OMWB 5DSCB 4KHTH 1BG9A 3VUAA 5F7AA 1K8DB 2W94A 3GEFA 4YOKA 2C9RA 1T2XA 3RWDA 4GUPB 1QSEE 4OD3L 1R5WB 4FQ1L 5G55A 4L3ED 5GS0H 3AXLB 3IKCA 3O3AA 1FBIL 2FB4L 4AIZA 4PJ9C 2QLVB 1S9WB 4Y5YA 3V4PA 4GAYA 1JHKH 2P5WD 1CYXA 3IDIA 1CF1A 1O9ZA 2FX8L 5GXBB 2VMDA 4IBSA 4XH2B 5A3IC 3NVQA 3H6AA 5D93B 1N64L 2OTWA 3GF8A 1I9JL 3OWRA 3CVHA 4H25A 2C3HA 3LRSA 1T5XA 3L9YA 1D7DA 4XRCB 4ELMB 1IGJB 1TXKA 3IE9A 3UBXI 2EE3A 1XGUA 4BSWB 5FFOA 3BDYL 2FT7A 5LB1A 4XPHH 4XTRC 4YC2B 1RUKL 2LQRA 2AKRA 4JRFA 4Y4KB 5BVJA 3OAZK 3U0PB 4LCYB 4EKJA 3OSKA 5I16A 5JW3L 5IB4B 4OCWL 4IU2B 1B0IA 2YKLH 2F8IA 2GJ6D 3MYZA 3O6ML 2YGNA 1MCHA 5D2LE 2K78A 4H0IA 2ZOUA 3CAFA 4QRUB 4S0SD 3DTXA 1CD1A 1FRGL 3HS9A 4UQ2B 1S7QB 1Z9SB 4PCSA 5FV2A 3MRGA 4AITA 1VRSA 3LZFH 4PV9A 4M7KH 3U46A 4MJJA 2NY4C 1LO2H 3TJEL 3CHQA 4QXVA 1IGYB 1CC3A 1J1OH 2WXNA 3CHXA 1OP3K 5DJAA 4R3SA 2AJSL 1OW0A 5FYJE 3NK3A 5E08H 4OLVH 1D6VH 1V7ML 2RFXA 4WWKD 2COQA 3PGDB 3TM6A 3QORA 4KVCL 4RX4A 2VMEA 1EMTH 1ZTXE 5IEHB 4PJIA 4S1RH 3KPLA 3KYMA 4L3EE 2APWA 4JDEA 3OPUA 3QG7L 2R2BA 3WLBA 1UOLA 2IWEA 4XO8A 3BVNA 4KV5F 2IH9A 4LVEA 4TUJA 3UABA 3V52H 1A3QA 4OBRA 3BXNB 2FEEI 2I85A 4HOWA 4IEFB 1MCPL 3N43B 4JAMB 1J87A 1A2YB 4POZD 3BMVA 1R34A 3EFDH 1UKSA 3IGAA 4G6FB 1HSBA 4XBEL 5DWUL 1N5YH 1QWNA 3ATAA 3DHJA 2WCGA 1K6QH 4NUGH 5EU3B 4PY7A 1JV2A 4QCIB 3QPXH 5D93C 5FGCE 4H40A 3SOBL 1BQLH 5HJ3B 2Y7LA 4MS6A 4PWJA 5CIPH 3T2PA 5B38A 1M71A 5CWSA 3MC0A 4DZ8B 2XTLA 1AFVH 4I77L 3H3PL 1BIHA 3FQXA 4PJHA 3UACA 4KQ4L 3V8OA 3JWNC 2VNCA 5I6XB 3FCTB 3OKNB 3T3MB 1ZT4A 2W80C 2NNFA 2GJ6E 1A3RL 3FK3A 3OQRA 4HZLB 4NP4H 3U9PL 4ONGL 4XWOC 2GTWB 2Q7YB 3PNRB 5FO8A 5B3JF 3SO3C 1UH3A 1MFAH 4PRBB 5DURD 4HZ1A 3IDNB 1AP2B 1NCJA 4H7VA 2X4PB 5DUMH 2J6WA 3O8XD 3CN1A 5CZKA 4DKEH 4EDWH 5L9DH 2PW2B 3OHXB 3KXFB 4XPGL 4FEIA 3ZTJG 5D7LB 2BNQB 1YMHB 2CA3A 5CSZB 5DRNA 4C56E 3D87B 3QHFL 1F6AB 4Q89A 3IBOA 1UFGA 4TL4A 2FJFA 4XNAA 3VFSB 5L88L 1VEPA 2YPKB 4K7PX 4HV8B 2ARWA 3US0A 3WXVL 2ZUYA 4PTTB 1FNSH 1OGTA 5DFWH 4HS3B 3MN8A 5KVDE 5B1JC 3CUPB 5TPWL 1FLRH 2WWKT 2WXKA 4UI2A 4FXGC 5JW5B 1QEWA 3AQZA 3CDZB 2L4OA 4G8IA 3UBXG 3MROB 4LCUB 5D1XB 4LPVA 3T3PF 6TAAA 1YNKL 2NLJA 1A8ZA 1A6PA 1ZLDA 1CVSC 4PJCF 1QYGL 3TU6A 4ODTL 4A2GA 3RKDD 2AXFB 3AXHA 2QT6A 1PIFA 4KX7A 5BS0A 2R56H 4CC1A 1FZJB 2ENSA 2MWCA 1FDLH 2HPTA 5GS1C 1RP8A 4IRZH 1R33A 3NRQA 3WMSA 1X4ZA 3WNNA 4IQHA 1CGTA 3BUYB 3NSJA 1KJ3H 1F41A 4BQCA 5IM7A 1YEEL 2OS7A 1CFTB 4XCCL 3SPVB 3ILQC 1WH0A 4Q8BA 1DE4B 1NBQA 2E75C 5E6IB 1A22B 1KTDA 5FKAB 4ADIA 5LUMA 3SPGA 3FTSA 4J3XA 4M8RA 3M7FB 4PH8A 2FL5B 4XB3A 4UOQA 5IVOA 1J9CT 3RY4A 4MWFB 3C2SA 5I74B 1MREL 2UZXA 1QPKA 5GGVL 2HH0H 3HE6B 1F0LA 3QCTL 4Q9QH 1NLBH 1ETZB 4YAQB 2XWEA 3DGGB 4OJCA 5E4OA 1H9DA 2IBZX 1JTTA 4WI6A 1E6OL 5ITBH 1SHXA 4M03A 3ABMB 5AW1B 4BE5A 5IW1A 4D0DB 3HPJA 4K3JL 5TFSH 1HHIB 1QSFB 3FTYA 5E94B 2HB0A 3E6FA 3WFBL 1B4JL 1U3HA 1U8OB 3C60B 3C5JA 3FUFA 3PWLA 2JJUA 4LSDA 4W9EC 5TQ0L 2ZUXA 32C2B 2OJEB 3NIDE 5I73B 4L4VB 4P2OD 5IQ7L 2PCYA 4I18A 4NOFA 3IFOA 2Q7NA 2HXAA 3HB3C 4I3SL 1NJ9B 2X0VA 1SBSH 2OA9A 1IEBA 1E9QA 1GYCA 3Q6GH 1RUMH 2FJUB 3TESA 5DMJB 2APBA 1RVFL 4RZCA 4JDVA 5CP3H 2HTLD 1T3FA 5JIHA 4WUKL 1CXKA 1LL1A 5PCYA 5I24A 4NC0B 4CVXA 1BMWA 3DV6B 1RJCA 5DHXB 4P46D 3JZ7A 3WNMA 2V9QA 1KENL 4LBEB 5D1XC 4WO4B 5E8OB 4TUUA 4OVVA 4ABQA 3IJ9A 2WIIB 1UB6A 4XVJH 2UZIH 1BD2B 2Q9OA 1OLLA 2O6CA 3GKWL 3UDWA 5LHDA 4UTAA 3V5HB 2PWFA 4DKDC 3H0TB 2RQEA 2VLKB 3QCVH 1QFPA 5AVRB 3L3KA 1E4XH 4WU5A 1QHOA 4GP5B 5CGBA 5IY5B 1KCWA 1T1YA 4JQIH 5AWNH 4EXPX 1S7UA 2VCOA 4QHUA 4P4KA 3ECVA 3VWJA 4Y16C 2V6HA 1KB5H 1G87A 3I9GH 4KY2A 1YRKA 1OP9A 3O9WD 2PW1A 4J23A 4TSBL 3CDFA 3IRPX 5F96H 1A6TA 3L95B 3S6CA 3VWKD 4OTXL 1MHCB 2VC2B 5BOJA 2OZ4A 4UDUA 4N0CD 5AVYB 1YPZE 3C8DA 2YO3A 3NJXA 1J8HA 1W0VB 3CZGA 4M8VA 5F7KC 3OAUL 3P0VH 4KU1A 3WFEL 1YYCA 4U6XB 3D12B 2BY2A 4M1GL 3S48A 1N68A 2Y1AA 5D71H 1OARL 4W9LC 3ARFD 2DQHH 2VR3A 1PDKB 3NCCB 4JZJA 4M4PA 4JPVL 5HYSB 3KBPA 4N85A 2HJFA 2VW6A 2YWZA 4GAGL 2XVKA 3CLEL 3DRQB 3KPTA 4JO4L 4FHKA 4V2CB 1R5VA 1FE8H 4GRLA 3NSYA 2A2QT 3CVDA 2BMKB 1OE2A 3MBEB 1JVOA 3SDDC 1EEUA 2MFNA 1BZ9B 4M7LH 4U1LB 4BH7A 3NG5A 3T71A 3QHZH 1N6QH 1QP1A 3SE8L 1JGEB 3IMWA 5EZOL 3DX1A 3LIZL 4NENB 4NN7B 4OT1L 2A4EA 3QFJA 5IZ7A 3PHOA 1EO7A 1BMGA 2YIHA 3CNKA 4S11A 4YDIL 1P7KA 4DVRH 1KXVA 3ZDZB 3RZCD 2X4OB 4NQDE 1LNUA 1NAML 5AOMA 1LO0L 2BERA 5F88B 4DGWC 1G6VK 2XY2A 4OY9A 1ED3B 2X9XA 1OSPH 4J3OD 3DYOA 4R2GC 1ACXA 1UZ6E 3WI9A 2WZ6A 3RBGA 4E41B 4N5ED 2XLLA 5FIEA 3RVWD 4PJ5A 4QOKB 4QXUH 2JLPA 4BGLA 1LE5A 4KVNL 4EIUA 5EFIB 1HOEA 3BWZA 5I1CH 4J3WA 1WWBX 4OUUB 1XR9A 2C9XA 5GGRB 5GGQH 1DBJH 4BBWA 1IAIL 3NEOA 1Q90A 3LD8B 2AJVH 1EEZB 4YO0B 35C8L 2YUWA 3IEAA 2CRMA 5CD3B 4NDMB 1PX3A 4GMTH 1RZFH 1IC4H 4XHJC 4UTCA 5HD8C 1E2WA 1J0KA 1HZHH 4L3FA 3V0VB 4IU3B 1GMIA 4YHYC 2PWDA 1TSHA 2BVYA 4YVUA 4LB8A 1U91A 3MLVL 3MO1B 3BWAA 4DGVL 4N0UA 1YO4A 3TZVC 5JPMB 1BVOA 2XFXA 4M7JH 4P99A 1JGDB 1L3NA 3E7JA 1UOVA 4IYKA 1CFQB 3LEXA 4I1NB 2VXSL 1CDBA 2Q5BA 3IK2A 3QIBA 4WFGE 3GLDA 1F2QA 5F9DC 4Z3TA 4NSKA 1VF5C 2UV3A 2X3CA 5ELIA 3SDAB 2BVEA 1XWVA 2HCZX 4KAQL 1PY4A 2IPTL 2XT1B 3VXPB 3BEVA 3MRDA 3CGTA 3FT1A 3ATFA 4R7DB 5KYYB 5HBBA 3OX8B 3WS3B 4UF7C 3MTRA 3EYOA 3RTQC 1M42A 3HFMH 2MCPH 3TNMB 3V7AE 2CO6B 3RWFA 5DHYB 4Z7NF 2YGOA 4I0KA 1Z9OA 3BMWA 3IDXL 2X6BA 2OL3A 2C4FU 2AEQL 2NY6C 3C6LB 3TBSA 4JL2A 2P24A 2BIQA 2HZHA 2BW5A 1MAML 4XBMA 3EFOB 2PP7A 1SEQL 5ACLA 3GMLA 4TQEH 1RU9L 3K72A 4DK6A 1UJ3A 1N0XL 4KKPA 4S2SA 2VDRB 1XEUA 3WIIL 4ODBD 4M9OA 5GRUL 4KPHL 4MCZA 4NPYB 1C08A 2JSFA 2BVQA 4JFDB 2WNGA 1CGWA 4JDTL 5DK0A 4OAWB 4QXGL 4ZT1A 4LVHC 1T7XA 4R5TA 1A21A 1IC7L 5AVQB 1IL1A 5FKPA 4Z0XB 1XX9C 3EGSA 4NC2B 1BGXH 3X11A 1TTRA 5IQLA 1FH2A 3LVEA 1INEH 1E27B 1ZE3C 5HI5C 3NRPA 1BXUA 4F27A 5DJ0A 3B4NA 1IGFL 3LD8C 3ROLB 1KTKE 1IFRA 5FOBA 4W6WB 4FG4A 4X9HA 2WPGA 4BEIA 1WT5C 5C0GA 3MV7D 1GMEA 1SPDA 3BZEB 1SN0A 1VHPA 4XN7A 3PUCA 4GAFB 1IGCL 4ISVB 3LCYA 4XOBA 5ACMA 5CM1A 3MA9H 4ZSOB 4Y5VB 5IJVA 1A66A 4M29A 4R8WH 1XGPA 2ESVA 2PTTB 3EJYC 4XP1H 2EZ0D 2DY2A 5DI8A 1A7NL 5FS5A 1W0YT 1IC1A 4HIXH 1AC6A 3EF7A 3MLZH 4ALAH 2K3HA 2BP5M 4HU2A 3ZTEA 3H56A 3Q06A 2ZF9A 1WV7T 2JELL 4GAJL 3D85A 3VTMA 1EO8L 1DLHB 2OZNA 3I9PA 1ZGLM 3E80A 5E6RB 3OKOB 3SN6N 1PG7W 2C34A 2B15A 1II4E 3KPRA 3BUBA 1CI5A 4M6MH 2VLRA 4NHCL 5HGHA 1KBWA 2P5EE 1G7MA 4E9YA 3ARGD 1ZLWK 3CVCA 4E0RB 4OZIA 1YC7A 4NKIH 3EGDB 4L8SA 4OF7A 4F7EA 5FUZH 4KRNA 3HE7D 4MJHA 1LK2B 1NBYA 4KHTL 4NRXA 3W11C 3O11A 1AZRA 2V8LA 1YQ2A 2D9QB 2Y4SA 1O9VA 2WLHA 3WXWL 2OMYA 1ZHNB 3UGUA 5GS0L 3VNYA 2EEDA 4OD2A 4M8QA 1HQRB 4OGYL 1FPTL 1PY9A 3F65A 4FKKA 4JRYD 2W0KA 5CGYD 1JHKL 5DEFB 4OF6A 2C4FT 4TUOB 2HKFH 4FFYA 4QKTA 3N1GC 2CO1A 4NT6B 2IH1B 1GPOH 5DJ2A 4P5SA 3SYPA 1OTUD 4MRCA 5AAWA 5DJXB 1BVNP 3QRLA 1FSKB 2ZSWA 3MV7E 2OMUB 2F74B 1NGWB 1ITBB 2FD6H 2EVFA 2G4EA 5I0XA 3QZWG 3SPCA 3SBWC 3TT3H 2XWDA 1TDQA 3FNKA 2G3ZA 2QFPA 3MLTA 4X6CB 2JJTC 1HDMA 1MFMA 4M5SA 1BIIB 4P59L 1JWMB 3MJWA 2QFRA 4P3DB 3W38A 3AADB 5EIIG 1BYPA 3G9AB 4F7MA 2Y2YA 3WFCL 4KXZH 4WEUD 5ID1A 5F3HB 3ZIMA 1P5VA 3C5ZA 4AIEA 1SXAA 1Q9OB 4XXCC 4L9LB 1JZDC 2C1PB 4N68A 5DJYB 3EYUH 2IH8A 1FNEB 3FRPA 2CBTA 4NXSA 2ZIDA 3CSGA 4MJIE 5DJ8B 3KGRA 3FB8B 1JP5A 4X9YA 1SDAB 5CUSH 3LZFL 3WUWG 3DURA 5H37H 3WELA 1FVEA 5T1KA 2FHFA 3L4VA 1FFNA 1NCDH 1IAOA 2EACA 3CFJA 3AS3A 3MLYH 4G7YL 2YSSB 4O9HH 1H0DA 5IKCA 1D6VL 1E9PA 3VRIB 4ELKA 2DTMH 1WFUA 5GGVY 3ZDYF 2DLIA 2VAAA 4FQHB 5IW6B 2IOOA 1EMTL 4NKQB 1RUQH 4PRNB 4JZOA 3RIAK 5JOEA 3O3DA 5CU5A 4UQIM 4F9PA 1GGIH 1MQKL 4OV5B 2VN6A 3MRFB 4H26A 1Y6KR 1AO7B 2ZOOA 1GZHA 3CIAA 1RZQA 3LEVH 2X4RB 3LDBC 3TVMD 2AMUA 3ZE2F 3BGFC 5CJOH 5HGDA 3QYCA 2A83A 1O6TA 1R75A 3SKNB 2OMWA 1IGML 4TVPH 5DEGB 5DSCA 3S35H 1EEQA 1HE8A 1K8DA 2L8AA 3QCUL 4ZW6A 1OT2A 5FOJA 1N5YL 1WP6A 2WLZA 2AXWA 3F83A 1NM9A 5A43C 1OCZB 5FWRA 1QWHA 2B16A 3AXLA 1AZVA 2BP0B 1F42A 1SXNA 5HGGS 4FKEA 4JCMA 5ERWB 2WBJD 1JK8A 4G8GB 3TC9A 2VQTA 2KZBA 1TITA 2QV2A 2Q0ZX 1BA9A 4XH2A 3V0GA 4UZGA 4F24A 3ZZQA 5D4QA 4FQPA 2PYFB 4NBZB 1KGJA 4O2EB 4UNVA 5L6YH 1EZUA 4MXWH 2VXQA 4OCYL 4CC4C 1I85A 1VPOH 3HNTH 2I69A 4NP4L 4AGNA 5KANG 5DZOA 1DEDA 4XRCA 4ELMA 1IGJA 4A7GA 1IAII 1N5AB 5IHBA 2QKSA 4JHAH 1P6AB 3UAJA 2XPZA 2VRAA 3ABKB 4EDWL 5GS0C 4GKOA 4JG9A 2CGYA 1FCCA 3MCKB 3ESOA 1E43A 4HWUA 4LCYA 4DFHA 2HG5B 2AABL 1IKOP 2ED7A 2ZWYA 3BFQG 1NC4D 1U8QB 4IU2A 2GJRA 4FZEL 4I13B 1CT8B 5KSBB 1GS6X 3QIWC 2B0SH 4NI3A 3FUKA 4QRUA 3LRLA 1NAKH 3K1DA 2WLLB 1T03H 2X44D 3Q5YA 1I8LA 1GHFH 1S7QA 1Z9SA 4UQ2A 4WLCA 2HVJB 2HT2C 3P3YA 3QRBA 3VI3F 3GS4A 1U8LB 2ZAIA 3QS3A 3LH2H 1IGYA 3AB0C 5EOCJ 3OC8A 5F7MC 3V9EA 5I19H 3NCFB 4EQ2A 3BX7C 4CVUA 2ODIA 3MV8B 2VM4A 1A7OH 3PGDA 4NAJA 1M4KA 1D7FA 1H9VA 2XWJA 1KCBA 2YXWA 4QWWC 4B60A 5BVPH 4FQLH 2XIDA 2ZCLH 5IEHA 3WN5C 2WP3T 4IRZL 1T2JA 5CHNB 3GDCA 1XF4B 2PPFA 4OB5H 2OCFD 4PRID 2KZKA 4ZW7A 3BPNC 5C09B 3BP5A 4PCKA 3TH3T 2I5YH 3BXNA 1QFWL 5LNDA 3TFKD 2O5YL 2CLZB 1CDHA 4IEFA 3RIFK 2V4LA 4JAMA 4BK5C 1A2YA 2GUOB 3Q7JA 3KNBB 4KDTC 4F7PB 2UXGA 4BZ2A 4YE4L 2DRUA 4LPWA 3MQIA 1HCVA 1H3XA 4H88L 4L5FE 2HH0L 4QCIA 4GUCA 3DXAB 3K4ZA 4MDRA 2VXTL 3EJRA 1XTLA 2A9AA 2O4EA 3HR5A 15C8H 3BOVA 1KBVA 4XMWA 5HJ3A 4OLUL 3G6AB 4ZQTA 3W56A 2O5XL 5D72H 2DJMA 1BBDH 3D09A 5TFSL 2MMXA 5F70A 3SGDH 2R1WB 25C8L 2P7TB 2A9MH 3FCTA 3OKNA 4G1EB 4K9EH 4FQ2L 2DQEL 2V7NB 4FL4C 5TF1H 4HXBL 2GTWA 1FFPB 2Q7YA 5F7NC 2PXYC 3SIKA 3S3JA 2L04A 4PRBA 2Y7QB 3IDNA 1AP2A 2RCSH 2X4PA 1X4YA 2JQMA 3K8KA 1NDMB 2DTSA 3KXFA 3OHXA 4LU5H 5D7LA 2BNQA 1YMHA 3IF1B 4KROC 2CSPA 4XN9A 5CSZA 2AJ3B 1MI5D 4JM4H 3S4SG 1F6AA 1MCOH 3QAQA 4UT7L 2X12A 4L8DA 3VCLB 3VFSA 1P53A 4PWGA 4HV8A 4DETA 5F2FA 4XN1A 4DN3H 1PZUB 4PTTA 1F13A 4JG0H 4LVNC 4HS3A 3BQUC 4P2QE 1JD7A 2OMTB 2XYCA 4W4OC 4PRIE 1U3ZA 1NL0H 5IBTH 5JW5A 2YEVB 2VOTA 1KYUA 1MXGA 3BHBB 3MROA 3QEQB 2R4RH 3PXLA 4LCUA 4YSPA 4OZGF 3T77A 1E4XL 2X6VA 2Z1KA 1SVZA 2X6UA 4KTEH 1MQ8A 5C9JB 5AWNL 1VGKA 4I87A 1R3KB 2AXFA 5I5MA 3NEXA 1FZJA 3I9GL 2COVD 5KS9E 4QYOB 5GRXG 2VYRE 5F96L 2XIBA 3BUYA 3TBTB 1L6XA 1X5FA 3GSNH 4HKZA 4OR1A 4RMVA 2IAMD 4IGBD 3SE6A 4I85A 5F9JB 4NGHL 4ZW3A 5LXGH 3RBSA 1CFTA 3SPVA 3AWFA 1BQSA 1DE4A 5F44A 1GS8A 1I75A 5E6IA 5FCSH 4U1HA 4ZW8A 2O6PA 4JKPL 3T0EE 5I0ZA 5FKAA 5D71L 3FTUA 2D03L 3DBXB 1JHTB 1FIGL 1BQRA 4TLUA 4MWFA 3PWPD 3HE6A 5AZ2H 3U4KA 2VSDA 4YAQA 3NJJA 4P2CG 4I0PB 2H0FA 3EJPA 5AW0B 4BK4A 1SJXA 1NUFA 1CGYA 5HDBB 2NY3B 3W2DH 1LP9E 2EAEA 3ULVE 4Z7IA 2GSGB 1HHIA 1QSFA 1MI5E 2NCEA 3BKCL 4FQIH 1KB5B 4NQSA 5E94A 4B9YA 4HVBA 1S7VB 3C60A 1U8OA 3VG9C 4CMMB 4XMTA 4D3CH 4ZAKC 2VXVH 2A38A 32C2A 1CL7H 1ZHKB 2KPNA 3QXDA 1IC0A 4L4VA 4OM1L 2YAOA 3TF7C 3UTQA 4XO9A 1JZ6A 4DKFH 5DD1H 2L7JA 1NJ9A 4MVBD 5TE4H 4BQ9A 2GBAA 2R1XB 2ATKB 5JXEA 3AUVA 1TEYA 1MUJB 1RFDL 2OMBA 3OJDB 1E4KA 1OSPL 1AQKH 1PLBA 4MYPA 1GAFH 3BKJL 1OLZA 5DHEA 1V05A 5E5UB 1YVLA 4MNQB 2CJ3A 1AS6A 1UZ8B 4PSRA 4M5TA 4JNXA 1PLAA 3DETD 3BLKA 4NQEB 5E99H 3DV6A 4DP1X 1WEJH 4OKVB 2RB8A 4GEIA 5D5ME 1T1WB 4WO4A 2DF3A 3RVUC 1VFOA 5E8OA 5I1CL 1I7TB 2WIIA 4KDVA 4L3CB 2PF6A 3L1OL 2JKSA 3KJ6H 4MDIB 2WB1A 2AJVL 4UIKL 2GEQA 1BD2A 3MLSL 4NJAH 4LFHD 3AC0A 4PWFA 2CRYA 3B9VA 3V5HA 4EN3D 4NZUH 3BRFA 3H0TA 4OZFG 2VLKA 5B39B 4ATWA 2WYIA 1RZFL 5G4NA 3RNQB 4IRSB 3K71B 1HZHL 1Z3GH 3IAQA 1CQYA 3HBQA 3WFDH 5BO1H 3OL2A 3PHSA 2P5WB 4L0ZA 2QVMA 3VD0A 3LOWA 4FTVD 1CIUA 2BFVL 4JO8A 3ECWA 2APVA 4O58L 2C9AA 3VRLF 2EDJA 4HJJH 3I3BA 3PWPE 1XB6A 4P04A 3WAKA 1WZ1H 3L95A 1MHCA 1CPUA 4NLHA 1D3CA 1FYHB 1NMAL 2K3TA 2XVGA 4GI6A 3RAJL 3WN6A 1YEKH 3FUIA 1W0VA 2BRQA 2EIZB 3UDWC 4HWBH 3CZJA 4U6XA 3AM8A 2CWRA 4YDVA 2N1KA 4KKLC 4MMZB 5E4IA 1XSIA 3TXAA 2CXKA 4J39A 1SVBA 4B3EA 4G8FB 2MCPL 3MRPB 5HYSA 4HJGA 3DI2B 3IXTB 2GJ6B 4QHKJ 4QT5B 5E4EC 2OL3L 1CD8A 2JXMB 5EU6E 1DFBH 1NIAA 3RGVD 3GZOA 4E9LA 3MLXH 5IHWA 3OB0K 3LYRA 4UT9H 5DVKA 3JVGA 3S37X 1MWAB 1BZ9A 1EPFA 4U1LA 4MXVE 4FCAA 2ZCHH 1JGEA 2BWDA 3VAEA 4NFBA 4NENA 4QD2E 3FOMB 4I89A 5DD5L 4WWKB 4AGLA 2A9CA 2EC9U 3FO2B 4GKZB 3UYPB 1GS7A 2YD0A 5ETUB 3WJMB 5IF0B 2DV6A 3HI1B 1VIWA 1EO5A 3GI9L 1E5AA 4JPKH 1HCFX 3FUMA 4M48H 5D2NB 4XMPH 5HVWA 3SE4C 5JHAA 2SODB 2ZUVA 2RTTA 4GRLC 4E41A 5IMKB 4KFZC 3K2MC 2DLFL 2P8LB 3D51A 4FTVE 4QOKA 3NJNA 3QAZC 5C86A 5EFIA 4G5ZH 5KVGL 3IDYB 4OUUA 4NWTH 5GGRA 4LARL 4NERA 2FNWA 1UURA 4YHOH 1EEZA 4YO0A 4ETQB 4HUXB 1ECZA 4EBQH 4M1CC 5CD3A 1I1YB 4IBYA 5DZVA 2UXFA 1GSMA 1TKWB 1WGVA 4OFQA 1QG3A 2WYHA 2CHNA 3CZUB 3NTCL 4IU3A 1QFWI 4R8WL 4AEFA 1V54B 2WGNB 4XP1L 4Q74A 5E5MB 5J57B 3W0WE 3MO1A 4YBQC 1J5CA 5JPMA 4HGKC 3CZLA 1SYVB 3A4AA 3D30A 1JGDA 4LLQA 1CFQA 4ALAL 1WUNT 3FZUC 4WV1C 3ZKMD 2F5AH 4FFVD 4MS8C 1KGYE 5L8KB 2FNBA 4Y8DC 3T0BA 3SDAA 2ZJSH 1RPUA 3INUH 1HH9A 2FH6A 3DGCR 5K5YA 4XMZA 2L7EA 1A4KB 1LWHA 3O45B 1H3PL 5DURB 3Q5OA 3VXPA 3EYSH 3F8UB 4OZIF 2ZWSA 3O8XB 1CGSL 2VB5A 4PJXE 5KYYA 1P2CB 1TTGA 1R3IH 1Q1PA 1TTUA 3OX8A 3HG2A 4JL1A 3QP3A 2Y0SA 5LO7A 4FMVA 3G6JF 3HAEH 5HVHC 2OYPA 4YLBA 3ZKXC 5DHYA 5JHBA 1OWRM 1JMZA 4PJDB 3HC3H 1WFIA 2DD8H 5CZXC 5E1GA 3C6LA 4P57A 4QAMB 3QH3B 1KLUB 4LF3B 2AEPL 4PJEE 3EXJA 1A65A 4JR9H 3EFOA 4X50A 4RQQB 3AAZA 3UFIA 2HKFL 3KPQB 2EVJA 1MFBH 1GPOL 3KYOB 3VSVA 4FNUA 4NNPH 4I4WB 3AWGA 3FB7B 3D39D 4JFDA 3I2CL 1XBRA 4OAWA 2FD6L 1OT4A 4YBLB 1NCCL 2KH2B 4PGDB 2UVFA 2EC9T 1BG1A 2G3MA 1ZT7B 5FHAL 1SGKA 4Z0XA 3ZRCC 2FLBT 1XGQB 2IG2L 2A4ZA 1JZ4A 3UTTB 1E27A 1IB5A 4XMLH 3E2HC 1E4XI 5DMIL 4NM4L 3KGTA 3ROLA 5F7EH 4GO9A 4DTGH 1N6UA 4K8RH 4WHYG 3BZEA 2UWEF 2EEAA 3S5ZA 3N85L 4R97B 4A67A 3EYUL 3MCYA 4J6IA 3VXMD 2XN1A 3HG1D 3QK0A 5C3LD 4B0MB 4X8JB 5D7KD 4X7SH 4CN6A 1FFQA 4NKOB 5IVXB 4NRZB 1NUGA 5FUCC 4Y5VA 1G7JA 2ODHA 5FWQA 1OM3L 1ZLSH 3QWRD 4DH2A 4HPHA 2PTTA 4ORGB 3SGKA 1NCDL 3VFPB 2XZCH 2XCMC 1UCBH 1UZGA 2PNDA 3QQXA 4F8NA 2VH5H 1XVSA 2YMOA 3CLFH 4DFIA 3S9DB 4ZODA 1R6VA 1XL6A 3ESNA 4R6UA 3RURA 3QEHB 3T6WA 3IMBA 5CCGE 2ZXBA 2W8CA 1FHGA 4H4NA 1DLHA 3MJ7B 2RIKA 3QQDB 3VGAC 4P2OB 4QJ3B 1ODAA 4CC0A 3OKOA 5JPNA 2LTQB 3GQFA 2X6MA 1P4IH 1C5DB 4YLCA 5KAQF 4FLQA 1ZV5A 3GJFK 3RVTD 2HAZA 1JWSB 1LD9B 2XBZA 4BKSC 1NCOA 2W0FA 3GRWH 4AV4A 4BQBA 4E9SA 1DQDL 2N0KA 4E0RA 3EGDA 1LK2A 3MLUL 4X7FC 4XT1C 3S35L 1BYOA 4HCGA 4G71B 3D39E 2J4WH 1FYTD 4JJHA 1ZHNA 3WFHB 4XI5C 2Z8RA 2WSDA 4ALAC 3L3JB 1HQRA 2J88H 1Q8MA 1T0OA 1MRDH 2B3RA 5DEFA 3MRNB 1K5WA 1T66C 4TUOA 2CHDA 4ZFQA 3DK0A 4NT6A 5BXFA 2IH1A 1RXLA 1WICA 1UVQA 1YY9D 4G9FE 5I8KH 2QQKH 1PZ3A 5DJXA 2WWKO 1Z1WA 4MXWL 2GIXA 2K45A 1VPOL 3VVWA 4JN1H 2OMUA 2F74A 3ARED 1NGWA 2YOCA 3MRRB 2PO6C 3HG1E 4X6CA 1NCUA 1E50A 4JPSA 5SX5H 2HPOA 5D7KE 5C97A 3B34A 4JM2F 4N2GA 1MJ8L 3MRLA 5E6UB 5C0NC 2VDQH 4LQFH 1PZ5B 2XWZA 5E2VL 5F3HA 4Y4FA 1O7VA 3LPFA 1F3JB 4HSAC 4Z7OB 1E6JH 1IRAY 4L9LA 1TVDA 2C1PA 3HMWH 5HHOD 5DJYA 2R0WH 4W70A 1FNEA 2BINA 1JPEA 1NAKL 1WITA 3KHQA 2JNZA 4IKLA 3HIZA 1B9ZA 2VGLM 1EBAA 3DTUB 5BOPA 5DJ8A 2JTDA 3FB8A 5GGTA 2WNXA 3H1ZA 3MGOB 2EILB 4M62L 1U58B 3SB3A 1P9MA 1BVZA 2K8MA 2NYKA 3OXRB 1NLDH 3LH2L 4X6DF 4GSXA 4CSTA 4GIAA 5I19L 5J0BA 3V0IA 4B41A 2M83A 2Z64C 1U95A 3STBA 2VISB 4IHOB 3N41B 4NYLA 1OAQH 2Z93B 4WO0A 2LTQC 3VRIA 3J07A 3UTSD 3CBKB 4FQLL 3V6ZB 4FQHA 1U8IB 2AGJL 5IW6A 4XPAH 4Y8AA 5IROD 5H2BB 3KLQA 4AQ1C 1JZ5A 2ZWKA 4HHWA 3KLLA 5GRJL 4TNVF 3APDA 1MHHB 3KR3H 4RA3A 3SGEH 1G9MH 2IPUK 3L3GB 4NXKA 1IKNC 3N0AA 3NCJH 3RZCB 1AO7A 3M45A 2I5YL 1EJFA 3MFGB 3QR1A 2AQRA 5F7HA 4YDZA 2X4RA 5DVPA 4P23D 1JNJA 1TETH 4G3YH 1T1XA 5FYKU 5ITFA 1FN4A 2HKAA 2NY5L 2OX5B 4PJ6A 3SKNA 2UY7B 3D9AH 5DEGA 3VXTB 5BV7B 1FH5L 3R19A 5IV2A 4NZRL 1JWUA 4NIKB 1NFDA 3VSUA 3PL6D 1YAIA 1AZCA 1I3GL 2ZZUT 4D2NA 3GINA 3HS8A 5B3SB 3BUTA 5ERWA 4EI5C 4G8GA 1RY7B 4U3CA 1GGTA 3RL1B 3TWCH 3EDFA 4UTBL 4HMCA 2CGRL 4CGTA 3U30C 2DS4A 5HPMA 2ZWLT 1U8HA 2PYFA 2QVKA 2ZYSA 4O2EA 1ZEAL 2J1WA 4AYID 1SJEB 2ZP8A 4K9EL 4Y19B 5HHOE 2F6AA 2Q8AH 5EF2A 4DN4L 5TF1L 4Y7OC 4LSTL 2HLFD 1IARB 4N3UA 5E8PB 1AKPA 1N5AA 1RZGB 1A7BA 2PR9A 2RCSL 5CBAB 2CLVA 2VJ0A 4QMEA 3FFCE 4KRPD 4LU5L 1V5JA 3MCKA 5KVFE 4P2YA 1E40A 4BZYA 1I1RA 2HG5A 2QSTA 3IFPB 4M61B 1U8QA 3L5IA 1GL4B 3BVUA 3UTSE 5SX4H 2XHNA 5KSBA 3QWQB 1A8JH 4FNQA 4G6KH 1PD6A 3W81A 3O2DL 3OAZH 3F64A 3DKHA 4MCMA 2WLLA 4AGPA 4WW1B 4TNEA 4ZUUB 3WG7B 5CEZL 3MACL 4WWPA 3KYNB 3GO1H 4LCCB 4OJFL 2HVJA 5K1JA 1N12A 4GIPD 5GHWL 5DEZA 1U8LA 2FIKB 1MIEH 3KLHC 4MA7H 1UM5L 5TH2B 1KCUH 4KTEL 2XPYA 5C0RH 3MV8A 3RY6A 1GGCH 1A6AB 4X2UA 1KIPB 4JM2C 3TBWB 4QRPB 1E4WH 1OP3H 4WUUD 5GJSL 2E7MA 2YMXL 3EAKA 4NWUH 3WKPA 5CJXA 2ISDA 3GBMH 1XF4A 2TSBA 3L81A 5C09A 1JNLL 2F58L 4MJ5B 3SDCD 4KUCF 3CPUA 4D7BA 3NGBB 2DLHA 3L5WB 2CLZA 5MEQB 3KAAA 4PTUA 2XZAL 5LWYH 3P9MB 4Y7MA 2GUOA 3TFBA 3ZRSA 4F7PA 2IMMA 1T5WB 2P52A 1AGCB 3VA2C 3R7RA 2WO4A 1O7DC 1EGJH 5EO1B 3TIDA 4L1TA 4OFYD 2J43A 3DXAA 5FUOH 3T4YB 3DLQR 2CDFB 3P4NB 4AIXA 1I7UB 5A2LH 2MQGA 3PQYE 2WYTA 4IOSD 2QADB 4NN5B 1YEWA 1HE7A 5CR1A 1YUHB 4WI5A 3WY2A 4AG4H 4FQIL 2R1WA 5CINH 2P7TA 3T2OA 5ANMA 2JI1A 4G1EA 5EBMA 1W80A 2V7NA 3S36X 4UV4L 5LQBL 1Q38A 3KMDA 1FFPA 3GSNB 5DMGC 2K70A 3ELAT 5DYOB 2YPVH 4DKFL 2Y7QA 4LPYA 3QS2A 4UILH 2NY0D 5ICZB 4F7CB 3QZPA 2R1YA 4KJQD 3MXVH 2GQHA 1CFSB 1NDMA 5DHVH 4JFEB 1QKZH 2Q2EB 3IF1A 1TQTA 4JQVA 1G6RL 1MOEA 2AJ3A 3MUHL 1GAFL 3CBRA 3VCLA 4IIZA 1IBFA 1DJWA 4LCCC 1NOAA 3GSVB 2MCG1 1F6FB 4O2CB 5E6SB 5E99L 3CSYB 4AYGA 5F7DB 3NPZB 1I9IL 3ARGB 1UD3A 4KVPA 4WUUE 4Y2OB 3U36B 4JO2L 2O1AA 3JYCA 5F21B 3MRIA 5JUEH 1A7RH 3ARRA 3DVNB 4J4PD 3SO5A 4K9EC 2OMTA 1RULH 1EK3A 3OSVA 4NJAL 4PVLA 3WKQA 2VMCA 5DO2C 3BHBA 3QEQA 3EOAB 4NZUL 2IPUG 1W16A 3RUGF 1JGIA 1Z3GL 4YXHL 1LVEA 4JRYB 3SKOA 5C9JA 5EIVA 4KZ0A 3U0WH 1R3KA 3RJDA 1AYRA 5HHMD 3V5KB 4EUPG 2NQDA 1F4YL 4N8VG 3APFA 4K0OA 3ZRFC 3ZE0B 3BJ91 1O5DT 3TTYA 3LY6A 4DP8X 4QYOA 3DO7A 1S7XB 2Y06H 3TBTA 3CQFA 4X8XA 5AOZA 4EZKA 4LZKA 5CP3A 1U8MB 5F9JA 1BZDA 2BVPA 1MDTA 3DUSA 3QEUB 3ULUF 4MQTB 4LMQI 4ZFZB 4YFLI 3UMTA 1IE5A 2XN0A 3OPZH 5C1MB 3ULUL 3FYEB 1GYWA 1KJVB 4GOSA 1MJ7H 3G5VB 3K2KA 1PJWA 3QC5X 3Q8FA 3HLKA 3DBXA 1KXHA 1JHTA 1SY6H 2DKMA 3ATBA 4GG8A 4BSVB 5BUGA 1RHHB 1RZJL 4OFDA 5I9QB 4ZTPH 4TRPH 4A7TA 3QJTB 5D96B 1DYZA 4XNXH 1RJYB 5GISH 4QEGA 3UJTL 4F8QA 3WO3B 4CW1B 1NFAA 1TJIH 5KW9H 4JQIA 4NB7A 1IM9D 1E9OB 3MLXL 2NUPB 4R4NC 3MGAA 1TTFA 1VLXA 5AAPA 1KB5A 1OAYL 2Z7UA 5J13C 4G2AA 4GJTB 5F7YC 2DJUA 2B9BA 4LSUH 3BT2H 4J8QA 3BFOA 5ALBL 1PLCA 3AG3B 5FYKD 3U7WL 1FG9C 3F85A 4DEPC 2WLIB 5D2LA 2IC2A 2R1XA 2Y23A 3TT1L 1EJ8A 1MUJA 3OJDA 4HAKA 4XMPL 4PGBB 2QHRH 2XVBA 2YPLB 1AD9B 3NCWA 5HDWA 1G43A 3KD4A 4MNQA 3VX0A 1R0AL 5DJ6B 3P4LA 5FYJH 3F7VB 4NQEA 5HHME 2D2OA 3BRDA 5ISZD 4OKVA 4PJBB 3TVMB 2LU3A 4KK5D 4MQXC 1T1WA 2NSMA 3CXFA 3QNXA 1EV2E 4M7ZC 1SDYA 2EJ1A 2EKSB 4JFZL 5AZEH 5BRZD 1ZTXH 1I7TA 4ZTOL 4L3CA 1KBGH 4MDIA 4PJFE 2QQLH 1HILB 4LEBA 3EG9A 1EWHA 3WTXA 3PABA 1WWWX 1F11A 4RGNC 1A6VL 3U25A 4I8DA 3UJIL 2LU5A 2UY6B 3ZE1E 5B39A 4GFTB 1E8XA 2IOMA 3RNQA 2ZUSA 4IRSA 3K71A 2D7OA 2G5UA 3LHAA 3NABH 2WBJB 5L2JA 2P5WA 2QSCH 1EJOL 4H1LA 1JI1A 2MHAB 3EO9L 3QC6X 3QISA 3FUNA 5E56A 4HUNB 5EF0A 2WLNA 3V2AR 4X5WA 5DJDB 5HYJE 2IALB 1F2XK 3CSPA 2D7NA 1NGXA 4MD4A 2M1KA 1PFOA 3H3BC 2N7AA 3S7GA 5IT2L 2LLLA 4GEJA 2FUQA 2EIZA 3AQYA 2VXUH 5HDRA 3UG3A 1OOAA 3EYSL 1CXLA 3IM1A 1BFVL 3DX9B 1F97A 4MMZA 5F7UA 2GFBB 3HNVH 3WS6C 4G8FA 3L4CA 2IQ9L 2WNKA 1QRKA 2JB5H 5CLTA 1BF8A 4N2BA 5FYKE 2WXGA 3HC3L 2B1HL 2DI9A 2GJ6A 4QT5A 2Q76B 1TYEB 4G6ML 2JXMA 2TRHA 1RUAH 3O3UN 1FVDB 4D94A 2BIMA 4LP4A 3ALWA 4R0LC 2R69A 5AVVB 4GIOA 2A6DB 1URLA 3EYFB 5TGBA 4CSPA 1MWAA 3TP4A 3MV01 4OI8A 9CGTA 1EZVY 3IU4H 1MFBL 2YD9A 5ISZE 4NNPL 4LSQH 3FOMA 3WY1A 4AYMC 1QD0A 3U4BH 5T3ZD 4HCRH 4WWKA 3ARDC 2F0CA 1MHPH 3U82B 4OGAD 2LFEA 2DDQH 5ETUA 2EYRA 5B3NA 4OU3A 1OTSD 5IF0A 3HI1A 5D2NA 4M6OL 4IDLA 2WV3A 1JYNA 4YSRA 3HTLX 3HVDA 8FABB 1UTDA 4DOHB 1I31A 5IMKA 4F15C 2CAKA 4JJOA 2WVUA 4R4FL 1YMMB 4DTGL 3MLPA 3WBDA 1JYXA 1ZXKA 1PJ9A 2CQVA 5JDSB 2YK1H 1MFUA 5DXWA 1FHNA 1IC5L 4OZHB 3LQAL 4ETQA 4JJ5B 4WTWA 3FMGL 1J05B 4M8UA 3RWIB 2W65B 3CVIH 2EDKA 1HH6B 1TKWA 4GI9A 1OIOA 4Q6YA 1VEOA 5TE6H 1NZRA 1SEBB 3P11L 1UHVA 5E5MA 4LAJH 2F9BT 2IH3B 2F2HA 2QEJA 4AC2A 4WF7A 1RJLB 3R1GL 1HN1A 4RGOH 1SYVA 1ZANL 4AQEB 3CLFL 3MNWB 3JV4A 3ARSA 5K93A 1YEFL 4JLRB 1KXQA 5KVEH 5HVFB 1G7IB 2ZNXA 5ICUA 1A4KA 3O45A 4JUSA 3WEXB 4KTYA 3C09B 3LN4A 3FQ1A 1OL0A 3VXUB 1VB9A 2XZQL 2YFOA 1J0HA 1TYJA 4WEEA 3O8XA 2CRIA 5BJTB 2NOYA 3PF2A 1P2CA 2VDKH 3N40F 4J3BA 1D6EB 2AK4D 2HLEB 2MKLC 2VJXA 3MCLH 3EO1B 3GBLA 4PJIE 3CFDB 1MNUH 1MI5B 1NKOA 3Q05A 4POYA 5T3ZE 2NSXA 2ZYHA 3RI5F 1WIPA 3NYKA 1P84K 3FU9A 4WY7H 2YAMA 1T0NA 5E2TL 6CGTA 3FU6A 4GS7C 4PRHD 3A5VA 3QH3A 4P2RD 3UEZA 1KLUA 4LF3A 1JK9B 4UM9D 4AYSA 2HT4D 1KEGL 4UU9B 1C8PA 1FV1B 4RQQA 5TDOB 5CF3A 3KPQA 3ZSSA 3KYOA 4RDQF 5I8KL 4TULH 2H0PA 4I4WA 5ALCH 5KWYC 3EDJA 1KELL 4JFYB 1XV8A 3FB7A 2PYED 3HC4L 4IOFD 4JN1L 3ZYOA 1MXDA 1L3WA 3N42B 5D6DA 4PGDA 1QWUA 3FAXA 3OXSA 1A6WL 4XX1G 1ZT7A 5K1NA 1XF2B 1XGQA 4TS6A 2VL4A 4PJHE 3K6NA 2OK0L 1LWJA 3VB8A 4XN5A 3NJKA 1VESA 2J5LB 2NY1C 3FQWB 4IGBB 4Y2DD 4AJYV 1A5FL 1KN2H 5B21A 2WP3O 4Z0BH 1DJXA 4UQ9A 1TQCB 4NPJA 4UQEA 1EUUA 2R83A 3ZX1A 3VDAA 2MOQA 1EHNA 3KPMB 4P5RA 4BA0A 2WINB 3HMXA 4FHJA 3IDGA 4GNKB 4KBPA 4AQOA 1I8KB 5GGTL 5SWSB 3GDBA 5I15L 4X8JA 1LHZA 4K7PL 2GSMB 4NKOA 5IVXA 2ADFH 4NRZA 1C5CL 3QGVA 4V1DD 3ZT5A 4ZO9A 2H32B 2B20A 1C12B 3F6LA 4MLIA 5K39B 3AU1B 3HUJF 1J48A 4ORGA 3PHAA 3FUEA 1B0WA 1JOIA 1OF0A 3VFPA 3KL0A 2ZD0A 3HEIB 4YSOA 2ZE0A 4PLKD 3X1EA 3SCMC 3ZT7A 3GLZA 5B7MA 3EXLA 4YHLH 1B6UA 3LSOB 4U33A 3T6XA 1AXSB 3K6DA 3QEHA 1JZFA 2B3IA 4RAUB 4U0QB 4YHMH 1XF3B 1SRDA 1YYLH 3PWNB 2AAAA 2ZP0T 3KLDA 5I0YA 3MJ7A 4OVUA 4LEXH 4P2OA 4K8RC 4Z7WE 1QASA 1A1OB 4PRHE 2VDQB 1C5DA 2YAEA 1IAKB 4CU6A 5BPPA 3LQAC 5DLLA 3QXAB 5BS0E 1PCSA 4JRLA 3IU3A 5A16B 1LQSR 4G3YL 1NFDF 4AL8H 5KEZA 2QGCA 3NZSA 4P5TC 2XX0A 2HVBA 2DQDH 1XB3A 1ZD6A 2XC8A 4JKKA 1UGNA 1SUHA 2D4FA 1QSZA 2AK1H 4P4RA 4N1CA 4P46A 1ZLWH 3H9ZA 4GSQA 5CLZA 2E9JA 1JPGB 4YEFA 4LCWD 3EBGA 5EBGA 4I48B 3DRTA 1PBYA 3GMNA 1FP5A 5DJZB 3O6FD 3FKUS 3K7UA 4LKCB 1TJGH 2ZAGA 3H2QA 3V0DA 4EO5A 4OGXL 4A7VA 1M2OA 3TN0C 3MPCA 1Y0LB 5IIEB 3MRRA 1AXTH 1XXFC 1AMYA 2CUMA 2DQTL 1RI8A 3O9WA 3UGEA 1JZ8A 1FVCB 4TLKA 4A2FA 1GA2A 2G2RB 1UD8A 4V1DE 4BKTC 4DEUA 1M9WA 4FFWD 1D5XB 1YZZA 3MREB 2CHWA 3M86A 1PZ5A 4PGCB 5AKSA 3UBXB 4AZ8B 1I4FA 3BC9A 4F3FA 2EIJB 4UQ3A 1F3JA 4JE4B 1NGZB 3NIFE 3RA7H 5E6ZA 1BJMA 3IMVA 1OAUH 3GKZA 1J1PH 2WCPA 2YLKA 5EF3A 1DL7L 1BOYA 1D2PA 4B27A 5JZ7D 1INDH 3SKMB 2YN3A 1U58A 3WIHH 1A7PH 1AOZA 5DHDA 3OXRA 5EO0A 2X42A 3QFGA 3V6OA 2UVEA 2VISA 5I5IA 1GCFA 5HDLA 2Z93A 3JWDH 3EDKA 3PJNA 3K5SA 1LYQA 4AENB 4HS8H 3V6ZA 4TV3A 1U8IA 2A6KB 2CIKB 1GJUA 3ZZLA 3W9EB 3BE1H 5ICYB 1VDGA 5A7BA 3QUYD 1MHHA 2ZKHL 4LRIC 4LCWE 4ZZKA 1LO3H 2VZ3A 2XI9A 2HT3C 3L3GA 4A2EA 3RZCA 1VCAA 1HIML 4FF9A 3DBSA 4PJ5D 4U7KA 4AYFA 1S7SB 1KLGB 4AV0A 1NWPA 1A6UH 1RH8A 4WCYH 2Q86B 2OX5A 4WTXA 2UY7A 2DQJH 1XMWA 3BUIA 2XWCA 3BP6B 3GHPA 3DA0A 4N90E 2BVOB 1RIUH 3RX7A 3QIUB 4HMEA 3DMMC 4IBLT 4Z7QB 1YNTB 4UBDC 1COBA 2B4CH 3UPRB 3EYVB 1P7HL 1HHKB 3U6RB 2B7DT 3WNPA 3RL1A 4Y9CA 1F4HA 2OXGB 4YEEA 4KZDL 1PKQE 1AZBA 5KBKA 5K9OB 2ZKYA 4JREC 5JOPD 2V2TA 1SJEA 3FTXA 4MB3A 4FLSA 1E5UI 4Y19A 2XPGB 5DD6A 4FQCH 3SQOH 4XVOA 2IQAB 4UB0H 2Z1PA 2BP8A 1O0VA 5E8PA 1DDHB 2X87A 4ZXBD 3ESPA 1GR7A 5T1DL 2YPVL 4FP8L 5JW4R 4L1DA 4R83A 3VD5A 5JHLA 4K73A 4KTDH 5D70H 4DNLA 4GW4B 5IGXL 5MHSE 5DD3H 3FHEA 4XXWA 5CCKH 2DKSA 3I6KA 3F2LA 3TO4B 3IFPA 4G6AD 3T04D 3F00A 1BJ1J 2Y5EA 1CR9L 1U2CA 4OM0L 2XQYG 2DQIH 4Z3JA 4QGTA 5C07D 1BEXA 5JUEL 3GZQA 3S3PA 4WW1A 3P9LB 4ZUUA 3E8UH 4JBSA 2J56A 5JQ6H 3KYNA 4IMKC 3B2VH 4PCYA 1DQTA 3HOGA 4GRWF 2F7IA 4XNUH 1F5WA 3SDXB 2FIKA 4X9BA 2IGFH 4XNQB 1DQKA 1NSNH 4PJ5E 2WM0A 3RWJB 5TH2A 5IEKB 3HKFA 1ADQL 3BAJA 3LQMA 3UH8A 1A6AA 3T2LA 1KIPA 3UTZB 2VM3A 3TBWA 2WQRA 4CADB 4MAUL 3KLAB 3NUKA 2YA2A 5L0QC 4PBWD 2ENYA 2G75B 2HRPL 2PCFA 4FG6D 4NAQA 2NXZC 5E8NB 2NTFA 4WGKA 1KTRL 4M93B 4MD5A 4MJ5A 1AJ7H 4Z7VB 2B39A 3OKEA 3L5WA 3Q2VA 3B1UA 1A7QH 1KJ2H 5EUOB 5MEQA 3HZYB 1OZUA 4JFFD 3U7YL 3P9MA 5JOPE 1G9EA 3Q1SH 3QI9B 4L8CB 5JNYB 4PREB 5CILL 4QDGA 1T5WA 3QSKB 1EQWA 3FH7A 3UZEC 1AGCA 4RSYA 1MCLA 4YK4B 4HD5A 1TEFA 1ZGLP 5JIDA 3P4NA 2QDVA 2AQQA 1TZIB 2GY5A 3UIYA 3PAVA 3MMEB 4JK0D 3VXMB 1TJIL 3N55A 5KW9L 3JTSA 1PNDA 4LOUD 5ICXA 2WSPA 1X5KA 1YUHA 2H45A 1QABA 1T0MB 5C0EB 4HC1H 2A73B 2ZAHA 1L9NA 4NKDB 2HMIC 3B2UC 4BZ1L 5D2LF 2VR6A 3LKQB 5T1MA 5MEND 4LSUL 3BT2L 4UT6H 1IT9H 2Q3AA 3GIVB 3TO4C 5ICZA 3MAWA 2QZ5A 2BSBA 4F7CA 1Q0XL 3U1SL 5KSAC 1MLCA 5F3FA 1CFSA 3QQ9D 4JFEA 2R9HC 3JTTB 2HVKB 4DPBX 1PG7X 3QXWA 3VGFA 1JCKA 3GSVA 5FYJL 1Q72L 3OF6D 1JVLA 4G42B 4O2CA 5F7DA 3NQIA 5BZDA 4QRQB 3ARGA 3U36A 3CFEA 3A67L 2JCCB 4H5SB 4XNMB 2CH8A 1P5UB 2L3BA 3DVNA 3HE7A 5KJ7E 1ZTXL 2QQLL 1KCSH 1MPAL 3F7YB 3DDFA 1FYTB 5ACZB 2G60H 3GBNH 5LBVA 2HWZH 3GSRB 3PGFL 3BH9B 2J72A 4PJ9D 4FFTA 3SGEI 2PPCA 4JRYA 5JO5B 3PP3K 4JFFE 4YL4A 5KBPA 2QSCL 2WXIA 2DL2A 2VITB 4L9DA 5KVGE 5CFAA 5E9DB 3BIAX 4HUVA 2CCVA 5DQDH 4HG4J 2O93L 5B38G 3DC0A 5JHMA 3ASOB 4JDZB 4NEHB 1CICC 4Y0GA 4XMUA 4WFHD 5EC1A 2VR7A 1J86A 2F1BA 1S7XA 2FHCA 4WU7B 3TWYA 2WQWA 2P46B 1J5HA 5DO8A 3KJ4B 1ZPUA 3AREB 4YXLH 4FA6A 2Q8BL 1JBJA 2JJSA 2WQUA 2ESVE 3QI9C 4NCDA 2VKXA 1RIHH 1RZ7H 2X2HA 4FQXC 5AUMB 3I9AA 4ZFZA 2W9EH 4ZMPA 4ZX3A 1L7IH 1BAGA 1RIVH 3FFDA 3NZHH 5E51A 1MIMH 3G5VA 1I1AC 4RZKA 5SWZD 3ZHFA 1NFIA 1RHHA 2VO5A 5INDB 3IJSB 5MENE 1G1OA 4PB9L 2OR9L 4E9QA 1G7QB 1T04B 4YUEH 2OJ1A 4ZW5A 2Z91B 1RJYA 1P4UA 3CFQA 4TKWA 3S34L 2AI0H 2NQCA 2FT8A 4CW1A 2R69L 2P3YA 2VLRE 1NANH 1A25A 3WJLA 3JWOL 1E67A 5JYMA 1OO2A 1IEAB 2XN2A 2E3VA 2JKNA 4N87A 4XOAA 3VA6A 2C9UA 4LIQE 2NY4D 4AMWA 3CMOH 1AHWB 2C9VA 3Q3GA 1M2VB 1NGQH 5AVTB 2J71A 4XVSL 1KCRL 3EBHA 2ZP9A 2PWHA 3BJLA 4PUBH 4ZS7H 2K6WA 2EO7A 3E6HB 1CDIA 3QYMA 4GQQA 2ED9A 3UTSB 3TEWA 2DIAA 1X5AA 4Z7UE 2WLIA 3ARYA 1KGIA 4C4KO 3WKYA 4K7PY 4Z1PA 5KVDL 3OAYH 1AQHA 4PRPD 3DX4A 5LG6A 5GS3A 3RLSA 4R4BB 3GSUA 2YPLA 1RLBA 2YAHA 3WFZA 4N20A 5DA0B 4KK9C 4WJ5B 4C58B 2BOBA 2DMCA 1NGPL 3F7VA 4MAYC 2BXZA 3GS7A 3KWXA 3OKDB 4P23B 4PJBA 3TVMA 4PRDA 2YOAA 3MR9B 3MVSA 1ETJA 2VDOH 2HFEA 4WFHE 1WFMA 2EKSA 2Q3ZA 2FX7H 1G5GA 1KXTA 4HK3N 4J1UB 4WI8A 4APQC 2XQBL 2XA8H 5C7ZA 1NIDA 1GOGA 3QJUB 3IFNH 2UY6A 4JFSA 3UGXA 3CVIL 1OAZL 1M7IB 3NK4A 4J3UA 5EORH 5TE6L 2WBJA 3EHBC 4L0YA 5CNHA 5ABZA 2MHAA 3ECUA 4OD1H 1DSFL 1HHJB 4DZBB 5DJDA 3V8CA 4PD4K 1WAAA 2LR4A 4RGOL 4RAHA 5LAPA 2IALA 4IIQB 4IBTA 1UM6L 4Q2ZB 4H20L 4XN8A 4NI6A 3W39B 3QEGH 4L5FH 4TQHA 4XWOD 4FLOA 4WHYH 1AY1L 4JW3A 2CO2A 4EI0A 1BYNA 2ICEB 4Y4KD 4RFNC 3IS0X 3OGCB 3VXNB 3SBRA 1M3JA 1JPFB 1E7UA 1PZCA 4Y5XB 4KRPB 3QUXC 5IREA 3EJCA 1ZSHA 2IBZY 2F5BL 3MCLL 2GFBA 3OG6B 1XD0A 3NIDF 4Q6KA 1D7CA 3E3QE 2DI8A 4J6RH 1NC4A 2AQPA 2Q76A 2Z4TA 3LNGA 4WY7L 4FXKC 4WRLA 3QZWB 2WCSA 1FVDA 1G9NH 5FFLA 4GBXB 1MEXL 4LP5A 1IBGL 1Z5LA 4OQTH 1GYUA 2A6DA 3SQBB 1CZ8L 2R4SL 3EYFA 2QPDB 2R29L 2FIRT 5EIIB 3L3IB 1XGZA 1A4BA 2DQCH 4IJ3C 4TULL 5IBUG 3RFRA 5BO0D 3OB0H 1IBBA 4I3RL 5ALCL 4ZFFB 3ZTNL 3LQZB 4KX8A 1DN2A 4OCXL 1TJXA 5KVMC 4JY5H 4Q4IA 3L2NA 4LRNH 3ZHLA 2FRGP 3NZ8B 3LRGA 2VDML 3PIQB 2DMHA 2YRPA 2VDKB 4U2YA 5C7XL 4WWID 8FABA 2X2JA 2OSLA 4G6FD 2F53D 1KN2L 2LLGA 1AHKA 3F3HA 3JZYA 4WJG3 3SDCB 3ILQD 3WUWB 4YWGL 4A2DA 4ELME 1J0ZA 1DVQA 4YHNB 1YMMA 3JWNE 3HMXL 4ANWA 1CDGA 3GD1C 3UJJH 3X3GH 4ONFH 2JJVA 2NXYC 2HSIA 1BQ5A 1J1XL 4WIQA 5E9AA 3PAZA 4H13C 1JZ2A 3FN0L 2DH3A 4JJ5A 2YQ3A 4U4BA 5EWIL 2NNCA 1B4LA 1J05A 2CJUL 3GB7B 4PP1C 1YPZF 3RWIA 3L8QA 3D2UD 2DEXX 4AUYA 1ULVA 3GSOB 2E6QA 5IOKA 2P43B 1KB9J 5C0BB 1SEBA 2CUHA 4G7VH 2CR0A 5G4OA 1HKLH 4DK5A 5FK9B 2AFNA 4P49A 1RJLA 4FMKA 4G8EB 1LMKA 2YLHA 5AYUH 2WZ5A 2BCKB 1VADB 4FLRA 4AQEA 3MNWA 4POZC 3H3KA 3RDTB 1A14L 4X4KA 2GJPA 2CGZA 4JLRA 4F7TB 4GP8B 1S2EA 1JXKA 5D7LD 3MX0B 2HRLA 5IHUL 1G7IA 4AW7A 2ZXWB 3HB3D 1JXDA 3NCYP 4FTDA 4YGVB 3VXUA 2NY0B 4ZUSB 3OTTA 2M2DA 5BJTA 2LT9A 1D6EA 1UH4A 4KRMB 4G11A 3ULVH 3EO1A 4HZAA 3CFDA 4AL8L 3FSVA 4YDNA 4AEIL 1MI5A 3P30L 2DQDL 4LAQL 1KWKA 1TTCA 5HJDA 2VDNL 4IJTA 4AC4A 2JMRA 1I8AA 5D1XD 3L5XL 3IFLL 4YSTA 1PCXA 2VLLB 5E2WH 4BA8A 1JK9A 2GIYA 1UZ6F 2QVIA 1MCIA 3L3OC 2DWSA 2PN5A 2ZX6A 1FV1A 2OW6A 4Q58C 5EC2B 3SE3A 4ERSL 5KSVB 4PWKA 1FG2B 2AQ2A 4HKXB 4MMXB 1NCBL 1KIRA 4DW2H 3T4AA 4RVBA 5G5DB 2D2CC 4JFYA 4YHKL 3K80A 5HHMB 5D5MA 4IKNA 5E00B 4X9IA 1D5IL 3NIGB 5DTFB 4ZFGL 1XF2A 4ILDA 2IO5A 5AALA 4RWYL 1OCWL 4Z7OF 3FQWA 4LHJB 2IAMA 4IGBA 1GIGH 3O41B 3T3ME 2OV0A 1OGPA 1H5BB 4NQCD 2BZ7A 3ZE1B 4KC3B 2AHIA 1HINH 4ZD3H 1TQBC 4GXVL 5BZXA 5HHNB 4PR5B 5JORB 3KPMA 2WINA 4L23A 3V0AC 4XZUA 3V55A 2G0LA 5D7LE 1I8KA 2BNQE 4BHUA 3IJEA 4JHUA 1INDL 3L4YA 1Q9LB 4OI7A 2ICWI 1JNNH 3C60D 2HFFA 2H32A 4ZMLA 1A7PL 1C12A 2XNAB 5AW7B 2J8UB 3MU3A 5K39A 5J11B 3AU1A 1XF1A 3H8NA 2FGZA 3MRCB 3QNZB 4FGMA 1IM9B 1S9VB 5A2KH 2WXLA 3SDDD 2WQSA 2IV8A 2N56A 3M17A 1G94A 3LSOA 2YGPA 1AXSA 2H26B 3O0RH 4HS8L 3CZEA 4RAUA 3V9CA 3PWNA 3BE1L 1W0WB 5D1XE 4NFDA 2YJLA 3CFIC 1W72L 1A1OA 1IAKA 1LO3L 1U3NA 3IDUA 2Q20A 3QXAA 4ABWA 3NN8B 1NBCA 5A16A 1DO6A 4R2GD 3PP4H 4L4TD 1A6UL 4WCYL 2CO7B 2D3NA 3I50L 5EU5B 2ICWJ 2JKXA 1IMHC 5EEUA 3BISA 3GJFH 2YEZB 5ISZB 1TTBA 3KBEA 4I5BB 2VLKD 5BRPA 2PPAA 1SFHA 1XGTB 5BW7A 1JPGA 4MMXC 4PHXA 4AH2B 5BRZB 1CO1A 3QDGD 1FZKB 3G04B 4MB5A 1EHLH 5C0CD 4U2ZA 5IVZB 4L18A 5DZLA 5DJZA 4EN3A 5HD8D 4LKCA 4W68A 4EXKA 4HA1A 2B5IB 1YC8A 3S4SB 2C8NA 1Y0LA 5IIEA 3SQOL 4YQXL 2KLTA 5KBMA 5DVOA 2IADB 1WS8A 1HHGB 2VMFA 3FHAA 2BP3A 3TZVD 4MXQC 2N7SA 4AL8C 1GCYA 5HYQB 1UJTA 3BQVA 1N7ML 4FQJL 1RURL 2CKBB 5JHLL 5TDNB 2WAHA 1PX4A 1FVCA 1S6NA 3B7TA 1GKEA 1MCSA 2G2RA 4ANXA 1KT2B 1RUPH 3BGMB 1D5XA 3MREA 2H2SD 4PGCA 5JMOC 3UBXA 5DT1H 3NACL 4F58L 1BZ7B 5TE7H 1UENA 4HQQL 4I88A 4WTQA 4RMBA 2XXCB 1NGZA 4E2OA 3HLAB 2BNRD 1UXSA 3HJEA 2YD6A 3RTQD 4BH8B 3A6CH 4XNBA 2DQIL 4CBZA 4OKDA 3UAFA 3GYRA 5J11C 2UZYB 4H8WH 1T7WA 3U83A 2IDQA 5JQ6L 1ONQB 3MBED 3TX4A 3PE9A 1SVCP 3SKMA 4LSRH 3RX9A 3INOA 2HRGA 1O6SB 2VW7A 2NY6D 3O9WC 2IGFL 3U0TB 3RGVA 3HRPA 1NSNL 4AEEA 1R17A 3HRZC