4HC1L

Crystal structure of a loop deleted mutant of human madcam-1 d1d2 complexed with fab 10g3
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
213
structure length
213
Chain Sequence
b'DILMTQSPSSMSVSLGDTVSFTCHASQGIGRNIGWLQQKPGKSFKGLIYHGTNLKDGVPSRFSGSGSGADYSLTISRIESEDFADYYCIQYVQFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucosal addressin cell adhesion molecule 1
molecule tags Immune system
source organism Homo sapiens
publication title A Different Fold with an Integrin-Binding Loop Specialized for Flexibility in Mucosal Addressin Cell Adhesion Molecule-1
rcsb
total genus 39
structure length 213
sequence length 213
chains with identical sequence N
ec nomenclature
pdb deposition date 2012-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hc1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hc1L01
3RWIB 2FIKA 3TJHD 4UTAH 4HUWA 5JORB 1IC7H 1XIWA 3MGOA 4BSWB 4WWID 4CNIB 2Q76B 4ZNEE 4PJBF 1KJVB 1IEBB 3MV9D 3MC0A 5C92A 2VXSH 2B2XL 4NJ9L 2AV7B 4MNQB 3ZMRA 5D5MB 4LHQB 5EOCH 2NY3C 4P2OA 1HK6A 2F5BL 3I2CH 1BVLA 3GHEL 5T1KB 5BMFH 4YK4C 4C59B 5JIHA 1A6UH 1NSNH 5CJXC 1X6LA 3A6CH 2YSSA 3WDJA 2OL3L 4JRXE 4XVJH 1QP1A 1QSVA 1ZOXA 1OQXA 3ARYA 1VENA 5FO9A 5SWZB 4BZYA 3VGBA 5F89B 2IG2L 3MV01 2R1XA 4MZ3A 5IHUH 4Z0BH 1A6VL 4HKBA 4QNPE 4PJGF 2VZ1A 4PRHD 3WSQL 4MD5A 1X5KA 1QA9B 2EDFA 3TT1L 3D0VA 5DD5H 3BGMA 1AGCA 5BZWA 3DSFH 4CW1A 1BOGB 5CJXA 5JHLL 2VLLA 3P73B 2OCFD 5HHOD 1YUHA 4L4VE 4DTGL 4KHTH 2QQNL 5FCUH 1QBMH 2X9YA 2MJWA 5MHSD 1BFOA 5D2LF 1QFWH 5TF1H 1REIA 2OSLB 5KBNC 4MXVF 1U6AH 1ULVA 5EULV 4I3SL 4LHUA 2BHZA 1AXTH 4BFBD 4L8DA 5I1CH 3LPFA 2NY3B 3GSVA 5DHVH 1INDH 1YYLL 4PRIA 3V0WL 3ULUC 2AXFA 2ZSVB 4R26H 1TVHB 1T2QH 3HCVB 4XNQB 3BPCB 3GSXB 4Z7VE 3WXWH 3D0LA 3VFUA 1OAKH 3DVGB 3QUYD 4JRYD 1S7UB 3LQAL 2D2OA 3HFML 3OB0H 1DQJB 2VYRE 3BP5B 3E6FA 3FL7A 4MJ6B 3U30C 4PLOB 32C2A 5FO7B 1QEWB 2EC9T 4MAYB 2WP3T 4JM2D 4LL9A 1J05A 4C56A 4LVEA 4HGKC 3HE7A 3ZO0A 2Z8RA 3SE9H 4OLYL 4IEFB 4P3CH 5T33H 4OZIE 1TQCC 4NUGH 1F2QA 4I13B 4P2QA 2B0SH 5KSVB 3EOBA 4UQ2B 3INUH 3QCVH 5I1IH 2NNAA 4DN4H 4V2BA 3DXAA 1QLFB 5GRZA 3BQUD 5FUCC 5ILTH 1AE6L 3PHSA 4X6BA 2AERT 4D2NA 4OQTL 1H5BA 5FUZL 5IHBA 3IFPA 3TCXA 4IJ3B 3QDHA 4JFFD 4AIZA 3OKDB 5L2KE 1SM3L 1PG7X 2WZPD 1RHHA 2D7OA 4B7IA 4NQXA 4OSUL 4TSAL 4HWEL 1U58B 2BC4B 1MCDA 4P99A 2R0WL 1IGMH 4U1JB 4CNIA 4UINL 3OB0K 3EOTL 2H8PB 4EUPG 4LCWD 4G8IA 3LN5A 3BMVA 5E9DB 1NAML 3OR7A 3QUMA 1R0AH 4GAGH 4FTVD 4LF3B 5DD3H 3SY0B 1A9BA 5TE6H 2UVFA 3GK8L 3EGSA 2A2QT 2OJZH 5J0BA 3MGAA 3T4YB 2P48B 3I50L 3GIVA 3ARBB 5D96C 3VG0H 4GMTH 4BZ1L 4ONOA 4X7FC 5FV1L 3DXAD 1FNAA 2V9QA 3DGGB 3MO1B 5IR1B 3T1FA 3O6FA 5BXFA 1NBZB 4URTB 1HQ4A 1IKNC 2NR6D 3MOQA 3S5LB 1IT9H 1S7QB 4X4YA 4OZ4A 1MOEA 4YUEH 1OGAA 1BREA 3O6LH 4LKCB 3DURA 2EDLA 3TBVA 3DVIA 1D6EB 2ZJSH 4YNYA 4NQUA 4K9EC 3IJSB 4PJXE 4EUPH 1IFHH 1OSZB 1UFUA 3VFGH 1QQDB 1BJMA 4KKCD 3NTCH 4UV7H 2H6PB 1FZMB 3PWNA 3WE6B 3S88H 4L8CA 4M6AA 1RZ7L 2BSTB 2C3GA 3GSNA 2VXTH 2FX8L 4QRQA 1UVQA 2AK4E 4QRPD 3BOVA 2ZUWA 3I75B 4P23D 5CP7A 1MJ7H 3P11L 4FQIL 1WZ1L 5J12B 4GKSA 5GGTL 4FQLL 4NO0A 1T4KA 3LD8B 5HVHC 5L2KB 2P5EE 5FM5M 2V7HA 3NCJL 1AKJB 3U2SB 4OF3A 1KT2B 4KROC 4NSKA 4WTXA 3RDTC 5E1AA 5DJ2A 3UJIH 1CQYA 2NX5E 5BOZG 4PJDE 1ZT7A 1HSBA 3GMMA 3JZ7A 2EEBA 4LLMA 4D9RE 3JVGA 5ENWB 4LLUB 1WK0A 3SO3C 1A6AB 3FZUD 5J6HB 4YHZH 3G04B 3RVUC 1HDMB 3DTXA 4O9HL 3DX7A 1BIIB 5EU4B 2D3VA 5DJ8A 3QRFM 1XF2B 3DV4B 1GYAA 4NWTH 4XNQA 1KCLA 3O6FB 3LKQB 4HS8H 5ALCL 5CJOL 3B4NA 4XHQA 3LKOB 1CXLA 5LGKA 5D7LE 5E8NB 4HZLB 1HE7A 2ORBH 4G8EB 5I19L 3F7PC 4M7ZC 5MEQB 4UNVA 2AAVA 2CKNA 4YNYB 4F80A 4KY1H 1AHWC 3BN9D 1PKQA 4E42B 4I0PA 4ZO6A 4XHJD 3QEUB 2UYLB 15C8L 2ID5A 3SE9L 4G9FE 1C08A 4X6CB 3MBED 4NQDD 4M1DH 4DUVA 5MHSE 2GAZB 3O4OC 5HY9B 1S7RA 5E5MB 3P0VL 1MJJA 4PJIE 5IJVA 5ACZB 4N5UA 3TBSA 4BK5A 1LEGB 1CF8H 1NBYA 4P3WA 2XV6B 5FYJH 4H5SB 1FFPA 5KG9B 1BJ1J 1S9VA 1Q9WA 3OXSB 4KGLA 3SKMA 3IDJB 3VWKB 1ETZB 2VL4A 4NC1C 4OCRH 1BFVL 2QL1A 4MZ2A 1CDHA 3LEYH 3IRPX 2XTJB 3CFEA 1FG2B 5JNYA 5JW4M 5TDPB 4HK3N 2Y25A 3STLB 2GK0B 1SJXA 2BNUA 1Q72H 1Y6KR 4JFFA 5HHOE 2IQAA 5JOFB 2ATKA 2KH2B 3Q3GA 3Q6GL 5EA0H 4MSWA 1NC2D 4YUEL 1M7IB 3MUGA 4Q6IB 5D7LB 2WUBH 3T0ED 3O3BB 2CRMA 5I9QB 2JK5A 1DN2A 4DEPC 1N6QH 3FT2B 5D70L 1WWWX 2M8XA 5EUKB 2P8MA 2DKUA 5EPMA 3TJEH 4NHUB 1EX0A 2Q8BL 2DJ4A 1NGYB 2DQHL 1NCWL 1NCCL 1A3QA 1IBGH 5H2BB 3DV6A 1CFVL 3PWLB 1RY7B 5JA9A 5IGXH 3MO1A 3S6CA 1HHGA 4A6YH 1I3RA 1PYWB 1JGLH 4UDTA 3RPIB 1MCHA 5C2BL 3AREA 4HF5L 5CS7A 4L8DB 1T1ZA 3K4ZA 2X09A 1FGVL 4WFEE 4Z7QF 3IFOA 3FO9A 4K55A 3OAZK 2J88H 4DQOH 4XMPH 4HAFA 5FGRA 4TNWF 5AUMB 2A6IB 1Y18A 1CXFA 2IEPA 5A43C 4OQTH 3K80A 1I7UA 3RL2A 5K9JL 4PJ5B 1T83A 5HYQB 5I8OH 3X13A 4NN6C 5E6YA 4YXLH 3K1KC 3U83A 1DLHA 3B2UD 3HZYB 5MENE 2ZOKB 1S5HA 4UT6L 2WLYA 3VFVB 3FRPA 5L8JB 5E6IA 4ELMF 1EK3A 1IARB 3QUZB 1IL1B 1RIVH 3QJFA 1N0XH 5F1IB 1KTRL 4F33B 2ZSWA 1X44A 3BSZL 3GJFH 5FO7A 1ZLUH 1J12A 4M6NL 5C0JA 4P2QE 3E8UL 4YHYC 2C3HA 1QO3A 1HEZB 1T7WA 1FGNL 1EDQA 2DB8A 5F70A 1CU4L 2JIXA 3U6RB 4XI5D 4U6VH 4ZODA 4F8TA 5CD3B 3KGRA 4KDVA 5EOCJ 3G6DH 5ESQB 4DZBA 4MCZB 2AXHA 3L1OL 4JY6B 4LRIA 4PRHE 2VKWA 4XBEH 4R4ND 4J3VA 4ZUSB 3DX6A 5D5MF 1Q1JH 1R3IH 4UOW1 5JOPD 3WN5C 1BQUA 2UYLA 2F5AL 2QKIB 5FB8A 3DUUA 1KB5B 1T5WA 1U8QA 1F8TH 4NQSB 1P4IL 5JORA 5J1AB 3PHOB 2F53D 2WWKT 3H9HA 4FZ8L 1Y6NR 5MEOB 3BYTA 2E27H 1KPVA 1F6AB 2AV7A 4JKMA 5MEPB 5EBMB 1AD9B 5FYLL 1MJ8L 5GGSY 2R0KH 4KRPB 2VXSL 4ORGB 1VFBB 2DMKA 1GPOH 1Y6MR 4AT6B 1ES0B 4TNWK 1ORQB 3ZKMC 4P49A 2IANE 1A5FL 2VN4A 2BRRH 5E08L 5A1AA 4NBXB 4MQ7A 5FO9B 2R2EB 3AU1B 5DK2A 1LMKA 5I2IB 1JP5A 3MLRH 3I85A 3L3KA 2L7UA 4UIKH 1KB9K 4LU5H 4XRCA 1QLEH 1BD2D 5B8CA 3O81A 4DN4L 3UTQB 3MLTA 2CLZA 5I1LA 3MMEB 1FVCA 3PWJA 4PUBL 1QFWI 1YNKL 3BW9B 3QUYC 3W5MA 4OCXL 1YUHB 2P47B 1CFVH 1VEPA 2R1WB 4GMSL 3ROOA 5F9JA 4P3CL 1AO7D 3FTGB 4WRLA 1DL7H 4K3JH 5CJ5A 2FO1A 3V5DA 3H9YA 3RBSA 1NUFA 1S7VA 2X89D 1LDPH 1T4KB 4HMCA 4I0PC 5HHPB 2FIKB 1IGTA 3UJIL 4OD1H 1KFAH 4ONGH 1PBYA 1A8JH 4NQCB 2OMNA 5CGMA 4KUZL 3U36B 1J8KA 3KHQA 5C70A 1JYXA 2V5YA 4Z18A 1KEGH 5DR5H 5C0FB 3NFSH 4P2OC 1IAIH 5DK0A 1G7QA 5FYKL 1GXEA 1HDMA 1HNGA 3DTXB 4OBSA 4M7KL 2D4DA 3FN3A 2XG5A 3CFKA 4KJQC 5KSBF 5FHAH 4M48H 1ZMYA 3QHFL 3S88L 4R9HA 3UO1H 4XMLH 3VFSB 4NFCA 5DUMH 2NY2C 5HGHB 3QIWD 3UTTE 2Q3AA 2Y07L 3GM0A 4TUJB 2UWEB 4RWYH 3HE6A 1G9NH 4G8FB 4JRXB 5C6PB 4MYWB 3SPVB 2VDMH 1CT8A 4NQDA 3BKMH 4L4VD 5F1NA 2Z35A 4DW2H 4S1RH 4M6ML 4RWHA 3FB7B 5DMKA 1DL7L 5FYKU 5AYQA 2W0KA 4RMRA 2GK2A 1FFRA 4OAWB 2MFNA 3GSQB 4P46A 5JTWA 3STBA 5CLTA 4Y5XC 2NNAB 4RAVB 1R0AL 2ZG1A 5I16B 4QHKJ 1YEFH 4HUXA 4LPTA 1Q38A 4WW2C 1JI2A 1CGTA 4Y19B 2OQJA 1IRAY 3MXVH 4B5EA 4EN3C 5CJ8A 4V1DA 4KGJA 4TSAH 3ULVF 1A22B 5C07D 2BVOB 1G7IB 2UZIH 2C3WA 3ZTJG 3B8YA 1JMZA 2AEIT 3WHE0 1T1WB 4QWWD 5IM7A 4K94H 2YD9A 4LCUB 4OLXH 2J88L 4CVZA 4DQOL 2ZSVA 1MELA 1QSED 2G5RA 5F7UA 1RUML 3MOAL 3HG1A 2VLMD 5MP6H 5J1AA 4RDQF 5GRWA 1H3GA 5ICZB 2FJFB 4EN3A 3LEXA 5J06A 4G80B 5JHDE 1JHLL 1A4KB 1FFOB 4R4NC 1GGIH 1N6VA 1A47A 3QXTA 4N0YH 4IRJA 5FKPB 2ENYA 3LDBB 4MVBC 4BH7A 4F7TA 4EQ3A 3ZZ1A 1ORQA 5HXMA 1PZ5B 2Q3ZA 3MRIB 5IFHH 3BHBA 1O7SA 1C5DB 4B41A 1TVBB 5T3ZH 3FZUC 5BCAA 2YS4A 2BVQA 4LBEA 3OF6A 2I9TA 4NO3A 3PQYB 5I16A 1FFNB 3C5SB 1KYOK 1RJZB 2JLLA 5HYEA 4F15C 3L3HA 1NDGA 3R0MA 5TDOB 1GZQA 3UTQA 5I1LB 3D3VE 3O4LD 1NMCB 5D7IB 4DVRL 4WO4D 1I4FB 3D0LB 5DZOA 5D72L 2CUIA 4YGVA 1CU4H 3MLYH 3TLRA 1WBYA 5DHYB 3T65B 5I71C 1J88A 3WS6C 4N8VG 1GC1H 3E6FB 3MRBB 3RIFK 3AS3A 1A7BA 3HZVA 5EU6A 3JV4B 5DMJB 4XP9L 3FKUS 1DFBH 4XCCL 4ZUTA 3CD4A 5K9QG 2AK4A 3OKEB 4HIIA 4KDWA 4ONGL 4X6FA 5FKAB 4TOYH 5AEAA 5B8CC 1WAAF 4I48A 2ZUXA 3VRIA 3HR5A 1NCDH 4PJIB 3ELAT 3NH7H 5DJDA 5DVKA 2ZKHH 4MWFA 3TESA 4DFHA 3SJVE 1JWMA 1INQA 4S1SH 1A2YB 4LGRB 3RI5K 1P7QB 2X10A 4U6HA 2V7NA 4F37K 4PJ9D 1IGFH 4OV5A 4HXBH 4GRLD 2EDYA 4YZFF 2EXWC 2Q8AH 3S9DB 2E6PA 3R06A 3SGKA 1QRND 4Z0BL 2WBJB 3A6BL 5GSVB 5EU6E 3MACH 1HWHB 5DDHB 5D7SH 2WV3A 4M1CC 2FB4H 2H26A 2AW2A 5IBLD 3L95A 2YD2A 1NFDB 4U1MB 4Y5VC 3UTZB 2C3XA 3BZDA 5FM8A 3NCYP 1F3RB 3LEVL 2XACC 2IMMA 1AQDB 1BJ8A 1G1YA 1J0YA 1RJYA 4JR9H 1TZIB 1ZHNB 1P6FA 2OXGA 2Z91B 4H26B 5KZCB 4NO2B 1A3RH 2H9GB 4K7FA 3TYGL 5JR1H 3HZVB 5EU6B 4L29A 2PCPB 3VWKA 3KAAA 4FP8H 4P9HL 4W70A 4CU7A 1D5IH 4LIQE 3BEWA 3W11D 2DLFL 4KZDH 3MYZA 2IPTH 4K71C 2ILLA 3K46A 3MV7B 3P2TA 3G6JB 2FO4A 3X14B 4UI2A 1CICD 1S5IH 5HD8C 3WBDA 4OZHA 1CGWA 5GRUH 1FHGA 4ZUWB 3QULB 3ARDB 4XGZB 5TJWK 1MHCA 1MUJB 5GZOD 4XAKE 1WSST 1LO5A 3SGDH 1TMCB 3VXMA 2EC8A 5C0RH 1A0QH 5E7BA 3V0AC 4N5EC 4P5TB 4EUPB 4EN3D 1F6FB 2FRGP 2DKSA 5FGCE 4AY0A 5I75C 1VEOA 1JFQH 3ZYZA 1IGCH 3PDOA 5BRZA 2A73A 3M1BA 1UEMA 1YYMH 3C6LB 4AYFA 1C7SA 3REWB 5KJRH 1IAOA 1XGUA 3GO1L 4KK9C 1Q9OA 2NY5H 1MAKA 5D4QA 2BXYA 6FABH 2XTJE 3PJSA 1F3JB 3ZT6A 4PJDF 3H9ZA 3NZHL 3G5XB 2IGFL 3MGOB 5HGAB 4BSWA 4LSTL 5I17A 4HGWA 4P59H 3EOBB 4UQ2A 2GJ6E 4WU5A 2Y07H 3VCLB 2VSCA 4IRZL 1UKSA 4WI6A 5IHUL 5KS9A 1KJMB 4LPYA 3OPZL 4QNPF 3BP7A 3OX8B 4HJGB 4GRMA 1ZK9A 4HH8A 4XP4L 3MFFB 3IFLL 2EIEA 3RA7H 1A6UL 2GY5A 2CIIA 4JZJB 4LOUD 1TZHB 3QWQB 4PJAE 2BFVL 4DKAA 4DVRH 3GBMH 1WFOA 4PP2B 3KYOB 3WO3B 3SEPA 1Q0XL 1ZLWK 5I18H 4PJ8A 3W81A 1AH1A 1YEDA 2MKLC 1SEBA 4YFEA 4X8XA 4G6JH 2R9HC 2F54A 3ULVC 4ZUTB 2PYFA 1E4XH 1DZBA 4A6YB 5JIKA 4OTXL 1OSPL 3R8QA 1BZ7A 4W68A 1MIEH 4MJID 3GIVB 15C8H 1E6OH 4JFDE 2FDBP 4DKEH 3SGKC 4WUUB 5E2UH 4HLJA 1UEYA 4I9WE 4HWBL 1FJ1B 5I8KH 4U6HB 1F3JA 3RIAK 3IJHA 4HDIA 4O51A 5JDJA 4ZYKB 1IC5H 4IDJL 4LP5A 1LP9A 4CN4A 3FMGL 1UXSB 5LAXA 4G6MH 4DN3L 3KPOA 4O9HH 1QSFA 3FFCA 3RVTC 4LSPL 3DUUB 4MQSB 5DC0A 3HMWL 5ESAA 3CSYB 4FQCL 4MXWL 2R0ZL 1MCKA 4FS0A 4K3DL 3VFNA 1NGZA 3WIHA 3TCLB 2NX5B 2Z4QB 3TO4C 1J87A 5MEOA 2IPUK 1QFHA 1F5WA 4XC3H 5IKCA 3O3BA 5C08E 3QUML 5JO5B 1JPFA 3OPZH 4KRNA 3U7WH 5T3XH 1FAIL 3HC4H 3MV9A 4Z9KB 2ITDB 2X4RB 3ARVA 3MRNB 4F57H 1VFBA 3QDJA 2NY0B 4M1CD 3QJHA 5B3NA 4QRTA 4OCLC 2JCCB 1KPRA 1QZ1A 5DD6B 2D03L 2R0WH 3PWPB 2YD3A 1IC4H 3KWWB 4OUUB 4JO4L 1SJEA 3BQUA 4ELMA 4FZEL 4GOSA 5A2LH 1PQZB 4JZNA 1LWRA 4OV6F 4JFOA 4P2OD 3IU4H 2JIXB 2PYEE 3U6RA 4NZDA 3JXAA 2XWJB 2DM4A 4HWNA 3CJJA 4KXZI 4JFHD 1BZQK 4Y5YC 3X17A 1DEEA 5FIEA 5DJYB 1M6OB 1OPGH 2CKBB 4LNRB 1CTOA 4YWGL 3VWKC 5FHAL 3VMOA 2YXFA 4YHMH 5KS9E 3O3EB 3QIBD 4PRAB 1IQDB 4KKAC 1ADQL 4NWUL 2VLLB 2CRZA 4G7VL 4PYHA 1SYVA 2WQRA 5ID1A 3VD4A 4XCYB 4UINH 2EO9A 2OSLA 5HGAA 2EECA 4K94C 1NAMB 5I74C 3EO0B 4X7DC 3EYUH 1JTOA 1KG0A 2NY4C 3H9HB 4UT6H 4FFWD 1JHLH 3TYGH 1KCRH 2D7TH 1JNHA 2J8UA 3NPSC 2I27N 3B9KC 1OGAD 4KJPD 2GFBB 5C0AA 5ISZE 4IMLB 2VOTA 4OIIL 1A7NL 2FIRT 4EDXB 1F4AA 2VLKD 5E8DL 5IWLA 4OLXL 4GS7C 2GKIA 3CUPA 5D2LA 3PG2A 1N3NB 3NFNB 4Q9RL 2OP4L 4JFPB 2E7MA 2F74A 4JCMA 5DQJB 2EDNA 2MKWA 3MACL 2PETA 3VH8G 3QB7C 3LKRA 1CE1H 2JB5L 4WU7A 5J11C 4HPOH 2DLEA 2A77H 3HC0B 2BSRA 2DQEH 1NCBL 4LVOB 5EFIB 1HYRC 5L2JA 3TIDB 1YN6B 2OTPA 2PXYA 1YEJL 2AJ3A 1LD9A 3U9PH 3G08A 2VDOH 1MIMH 4XCEA 5KJRL 1LP9E 3UZVB 2AJVH 2BVUA 1S7WA 3SDXB 3VWJC 3NH7L 4Y4HD 4GAJL 3VXSB 1N2RB 5HYSB 1OM3L 2P5ED 5IV2B 1Z0MA 2XZAH 2MOVA 4U1SA 1RZKL 5L8LB 4HKXA 5ENWA 1IGML 5LXGL 4X6EB 4UQ3B 3MFGB 1B2WH 2KDGA 2Q7YA 1UB6A 3ARUA 3O3AB 2PKDA 3QUZC 3CFJA 5D72H 4Z8FL 3SKJL 4K71B 4OZHB 3SDAC 1AO7E 1BQLH 3QEQD 1KB5H 4NHCL 4JFDD 5CMAA 3ZE2F 3PGDB 5IKCB 1QFWL 1X5FA 3BAEH 4U1JA 5HDBE 4H25A 1CFSB 1F4XH 2QTEA 4XZUB 4LCCB 4WW2A 4LRNH 2NZ9C 1NBQA 1N4XL 4P2RB 3RVTD 3AAZA 5GS2H 4ZDHA 5KN5B 4M9PA 4MAUH 1B6DA 1FCCA 1L6ZA 5EG6C 1NCBH 4KV5E 2H1PL 4NZTL 2DF3A 3LS4H 1AC6A 2CSPA 43C9B 5J9PA 4NO3B 4LVHB 3GRWH 4PG2A 3THMH 3GB7B 3VXOA 4Z7OE 1OAQL 4HCRA 3GSNH 4XC1H 4AH2B 4KRPD 2XWJA 3RNKB 1JWSA 4Y1AE 4XNXH 1W72B 5A40E 1ZHBA 1G7QB 5ANMA 3CFBA 4BFIB 4RMTA 4CDGC 4QRQB 3CFEB 4JZJA 1I8KB 3GBML 3MNWB 3TPUB 2IPKB 3PABB 4FA8A 3O3AA 4YFDB 5LQBL 4XCNB 1H8OA 1JL8A 2ZKHL 3B43A 1FBIH 4PBWD 1U8HA 1DBKL 3UC0L 3QXAB 4ZAKB 3HI6H 4Z95H 1I3GH 2HFTA 2A6JA 1JGLL 5BW7A 1S7UA 3P3YA 2AGJH 3SE4A 4JG0H 5BO1L 3RWFB 5FDWB 2ZUQC 4YBLB 3P30L 5EBGA 2GSGA 1OM3H 4XNZC 3H0TA 3AXLA 3K4AA 5KOVC 4XXCC 1RJLA 5DRZB 4Z7UE 1HOCA 3OKNA 4DTGH 4G7YL 4K8RL 5L88H 1IGJA 1KC5H 2EDTA 4PJHF 2X4SA 4X4XB 4U6TA 2A9ML 4UV7L 1HHHA 1T0PB 1CICA 5EIIB 5JMRA 3C8KA 2NY4D 1F97A 3VXOB 3GUTA 3QEHA 4XMKH 1F00I 3BQUC 2QADB 2R56L 2GSIB 2IH1B 4WV1A 2JB5H 1MWAH 1YQVL 3HLAA 1ZVYA 5IT2H 1NFDA 4H88L 4GUPA 2X4NA 3C60D 5C0EB 4JO4H 4LHJB 1T21A 1H5BB 4X98A 1RUKH 5BZWB 3L3DB 4CW1B 5EBWB 2C4XA 4R4FL 1M7DA 1X3DA 3RWGA 1GAFH 1GGBL 5KANI 4FMKA 1JZ2A 2ICWA 5HHOA 3LOWA 1KENL 3QIWB 4NCC1 1AO7A 2DAVA 1RIVL 4NO5A 3HNVL 5DLMH 4IRJB 4LCIH 3QBTB 1J18A 3DETC 3SY0A 3QJFB 1IL1A 1KTDA 1SMAA 4G8IB 3MXWL 25C8L 1XF3A 2EH8L 2MQCA 4LDOB 5C0FA 2OZ4L 1QHPA 4U3CA 5TE7H 4RNRB 4MJIE 2BDNL 3HPJA 4P2YA 2CDFB 2VZTA 5F9AC 2AJYL 4OF5A 1QVOA 2A1WH 35C8H 3KPSE 4TTDD 1KN4L 2EYSB 2HFFB 1RUPL 5C07B 2CIKB 4GKNB 4U05A 3OKKA 3GRWL 1AP2A 5C2BH 3DX6B 1H3UA 2F58H 1CD8A 5BRZE 1HXMA 5C09D 3O3EA 4GAYB 3PL6A 4XWOC 32C2B 1T89A 2W60A 3J8F7 4R4BB 3J7HA 1D9KA 3MNVA 3WO4B 4XPGH 1T7ZA 1PG7H 4M6MH 1KIUA 2QADC 1NKRA 3RWGB 3T8XB 4LSRL 3HPLA 3D85B 1MRFL 4HUWB 2WINA 2R0KL 1ZHLB 3B3IB 4YC2C 2VAAB 1K6QL 3MQIA 3U1SH 4HIEA 2QQQA 1A3LH 5F1OB 3T0XA 4NN7C 3V6OC 4OQTA 5I18L 4NKMA 4Q9CA 3DJ9A 1EHLL 4Z6AT 1RUQH 3GJFK 4FQIH 1A6WH 1RQ5A 1CE6B 5FA3B 2EYTB 3NACL 2OZ4A 4YDVB 3C5ZB 3LMJH 3O41A 3DX7B 1OTTD 4W4NA 2WWMD 4I3GA 3WDHA 1IAIL 1NPUA 3MV8D 5C0BA 4X99A 2O61B 3DUHA 4NBYB 3RHWK 1C5CL 4ZAKC 4L3ED 5BS0D 3ES6A 3H7BA 2XWTA 5M95B 4JJ5B 2XZAL 5FYJL 4I3SH 4FXLA 2DQIL 1D9KD 4LPUA 4NGHH 2HT2D 4O2CA 3EJZC 4OD1L 5LGJA 1FFOA 1YJDC 3BN9C 3K74B 3GEWB 2AS5M 3AREC 5BJTA 4FABL 5LGHH 2VDRL 4YQXH 3D3VA 1JYNA 1H8NA 4HMEA 5CINL 5D7JB 2FNBA 4LF3A 3Q1SH 3FN0L 3UDWA 1UWGH 1KNOB 4K3JL 4Q0XH 1X5IA 2JB6A 1YY8A 3D18B 3LKNA 2PXYB 4CJ0A 2HH0L 5HPOA 3OKNB 1HOCB 1RPQA 1B0GB 2AP2A 1J5OH 3QDGE 1IM3A 3STZA 4WV1C 1J1OH 2A38A 1A14L 3BESR 1DQQA 3ZHLA 5ACLA 1G9MH 2R69H 1KACB 1SJHA 5F96L 3WFEH 2R4RL 5I19H 5CFHA 2IAMB 1UM4L 1CLZL 3O45B 5INCB 4NM8H 3V0VA 1G7PB 5F97E 2Q7YB 3U46B 2L4OA 3ULVH 1DANU 4XNMB 3QDMD 5CEZD 1VKXA 3RTQB 5B4MC 3FB6A 5EBWA 5E8EA 4BKLB 3ALWA 1DN0B 4YO0B 1GCFA 5I1IL 4O00A 3S7GA 4HW6A 2VQ1A 2FECI 1NCAH 4K9EH 2YXMA 3LZFL 4G8FA 4M4RA 2YUXA 1OY3B 1A6PA 1LO2H 3DARA 2CGRH 4ZUUB 4NRXA 2PUQT 3ARFB 1R6VA 4C83A 2FEDD 2EKJA 3BD3A 2APFA 3DSNA 1J0JA 4MA1C 3VCLA 3EZJB 3TA3A 2E9IA 3SQOL 2RQ8A 3I3BA 4LGSB 3DO7B 5KSAD 1LK3L 2Z92B 1DANT 3RQ3A 3HS0A 3I6LD 5BZDB 5KSBB 3RZCC 2ZG2A 4MAYC 1FYTB 4XH2B 4XMLL 5C0ND 4QHNA 3WD5H 3G6DL 4Z0XA 1F3DJ 5JZ7D 2IAMA 1H3VA 3WDIA 1NL0H 3KPOB 2E9WA 2WLZA 3M45A 3JV5A 5DRNA 3FQXA 1U8IB 1JK8B 4NM4H 4I18C 1VFOA 4ZD3H 2BNQB 3X3FL 1YEHH 2M2DA 4KRLB 4Y4KA 4FOMA 1IJ9A 3I6KB 3EO0A 4TTDC 1WIOA 3NCCB 2BOCB 4U1HA 2AGJL 4HIJB 5EWIH 2VAAA 4A2LA 2H3NA 5FF6A 5GS3A 3RU8L 3BD4A 4AK1A 1EGJL 1G6RL 3FONA 5IFJB 1ZHKA 3A0OA 4IMLA 4YXLL 3GM8A 2YR3A 3UTSB 4M62H 4JPVH 5DHXB 4KZEH 1HILB 4JM4H 1J8HE 4EOWH 1T22A 5FXCH 1RUAH 1O5DT 3TT3L 4MB5A 5GISH 3T0AA 5SWZA 4JHBA 3NABH 4M1GL 2VR9A 5HHNB 2H2PC 1MFBL 4XPHH 4YE4L 3S96B 1F45A 5JQ6L 3DURB 2DQJL 4IDJH 3O2WH 4POZC 1AQKH 3RWCB 4UIKL 3ARDC 3DRTB 3MRDA 4NUGL 4ODWB 4KTEL 3IDNA 5DJAB 5DEFB 3AS2A 2NX5A 2XKUA 1XGUB 3REVB 2BX5A 3CDGA 4XAWL 1JMXA 3UBXB 2I9LB 5HHMD 3UEZA 2D7TL 3CLEL 3OR6B 3G5XA 2ATPA 4LRNL 2QQLH 4R8WH 3NCFB 3NN8B 4ZUVB 2AEWA 5LGHL 1FO0B 2DMBA 4ONHA 1MFDH 2R8SL 3CX5K 4P4KD 4MJ4A 1A7QL 4YHIB 4YEEA 5MP6L 4ELKB 3V6FA 4PP1D 3ARED 5T1MA 3HFMH 1LK2B 1PG7W 3GSVB 5K59E 2XG4A 3IXTA 1ACZA 4L1HA 4ZPTA 4CUCA 3EYFA 4PJAF 3IFOB 3P4OB 3EBAA 1ERNA 2F19H 2W91A 3L3OB 2NY0C 3WUWG 3LMJL 4M7KH 4F7CA 1N8ZA 4G9FA 3UP1A 5CSZB 1CFSA 5HYQA 3VFTB 4X0KA 4AIOA 4WW1A 3GMRB 3LD8C 3NFNA 5HVHB 5DJYA 2VISB 1GHFH 3ARGD 1IFHL 1K9TA 3CX5J 1YJDL 4YHKH 4KDTC 1D5ZA 3Q5TA 4P57A 4KHTL 1J05B 1XGYL 3O11B 4P3DB 4PJEA 4YBHA 4DUWA 5BV7H 1KLFA 2X89A 1NEZG 3ROOB 3NA4A 3BN3B 1BP3B 2FX9H 3BJLA 1WIPA 5EH1A 3X11A 3RX7A 3QHZL 4QYOA 5FK9B 3GI8H 4FNLH 5JPMA 2OJZL 3F6LA 1IEBA 4JDVA 5SWSE 4KPHL 1I8IA 1JGUL 2ATPB 2NW2A 4WHYG 4ZFGL 5DI8B 3ZYJA 2ICWJ 4H5SA 4HC1H 5HHPA 1ZWIA 2CO7B 4ELME 2BNRD 5F9WB 4EQ2A 1OL0A 4GRWE 4ZS7H 2DTMH 4D9LL 4HUKB 3CVIH 4NN7B 4QHNB 3TVMA 5GRUL 5ERWB 2WP3O 3VWJB 3QCTH 3QUXB 4HWBA 4MXWH 4WO4A 5KOMC 5IOPA 2XPGA 3D6GA 2FWOB 4UBDC 3UPRB 4KUZH 1OTUD 1YC8A 4OLVH 4FXGB 5JOFA 4PRIE 2CKBL 1W72H 4KK6D 4XNZB 3WJJC 4POYA 4NQEE 4EI6A 3L5WB 4JRXA 4YBLC 3RZCD 1J7VR 4NN5B 5HSFA 3SDCA 1G7JB 4JHWL 4Y2OA 3TV3L 3MXVL 2DWDA 3IFNL 1OOAA 5EZIL 2DDQH 1R3JA 2APXA 3D39B 5DJDB 4GQ9L 1P9MA 3QDGA 3TYFA 4HIHB 5D1ZD 3C09B 2VH5L 4OZGE 3S34L 3BKJL 5DK3A 3VXNA 2FGZA 2BSSA 4ODUA 4ONFH 4AMKH 4ZO7A 4C4KO 4CVXA 4DWHA 4PD4J 2YC1A 4OKVA 3WLBB 4JRYE 1TQCB 4X6EA 4XPBH 5GS0D 1G7IA 3OX8A 4HJGA 3SKNA 2P8LA 3WEXA 3OKOA 1R5VA 2PO6B 4EBQH 3OHXA 2CLZB 4BSVB 1KYOJ 4G6FD 2ICEA 1XCTB 2EYRA 1VPOH 3H6JA 5F8QC 2XRAH 4CVZB 4M7JH 2FHFA 3S37L 4LLYB 4K8RH 5EZOH 1B3JA 5L88L 4HX1B 4LFHG 5IOPB 4HFWA 4S2SB 2R1WA 4HUVB 1KIRA 4D0CB 3OXRA 3S4SG 1XGTB 1AKJA 1GSMA 3CXHK 3DNKA 3MROA 3NIGF 1U9KA 3OBAA 5E00B 3HAEG 3BPNB 1S5HB 2FJFA 2IFGA 1H3PH 4FZ8H 4NT6B 4G8GE 4POZD 1IAMA 3VFVA 3WFBL 1QNZH 4HC1A 1NCUA 1A7RL 1NMAL 3QFDB 2PN5A 2X1WL 3QUMH 4ZAKA 5SWQA 2YZ1A 1M05B 4GG6E 1TJIL 3D87B 4L8SA 2ZCLH 5HDLA 4POUB 4NDMB 4MGXA 1F6LL 4JVUA 5HYJB 4IJ3C 5BV7L 3DBXB 3HZMA 3UAJC 1MCFA 2VC2L 4NOBA 2W38A 3DVNB 4UB0H 4UMGA 1RK0B 5I15L 2V5MA 3TNMA 3QYCA 2XIDA 5DFTA 1B88A 4OF0A 1HQ4B 1G1CA 5HGDA 4EUPA 3SBWC 4PP1C 3HS0B 3IS1X 4MA7L 4Y16B 5HGHA 1UZ6F 1F58H 1FFNA 1MJUL 4NZUL 4Q2ZA 1QLEL 4PJHA 1MRCH 3U82B 2ESVB 3NGBC 4OD3L 1MCWM 5ESAB 2P5WD 2BSRB 4DFIA 3UTPD 3OKLB 5DUPH 4H20H 3H9SD 1I4FA 4JFDB 3TN0D 3D85A 4U1IB 4G3YH 2F5BH 3Q5OA 1D5IL 1TCMA 3QSKB 4ODTH 2AEQH 4JO1H 1XGTA 3JV4A 3GSWB 2MCG1 4RGNE 4PB9L 2IBZY 1RMFH 5DA4A 4LPXA 3SJVB 4F9LC 3RJQB 4LARH 3CLEH 1KPVB 5MEPA 2FECL 3P9MB 3QQNA 1CGUA 1HHJA 1MF2L 4ZPVA 2AV1B 4NNYA 2P5EA 3BH9B 3I6GB 1A7PL 2ZWLT 3DUSB 4CADA 1S7SA 3ZSTA 4I48B 5E5RB 2DYPA 2V17H 2YBRA 3IVKA 2J7LA 5IVNA 3EJYC 4KK8C 4G7VH 2FX8H 1F11B 5JHDB 1MAMH 4MQ7B 3QIBA 3H7BB 1OW0A 3ZKNC 2XZZA 4M43L 2G60H 5JQ6H 3WIHL 3PGDA 4XCFH 1QFUL 3EOYG 2Z31B 1RZKH 3ZL4L 1XR8B 1U8NB 4XNUH 2R2HB 4JREC 3D3VB 3VXQB 2HJLB 4DUXA 1DUZB 3I6LE 1U2CA 4QHMA 1RAMA 3O4LB 3UTZA 3KYMB 4GAJH 1VESA 3V7MA 4MAYA 4YHLH 5DMIH 5F6IB 1JUFB 3QP3A 3QIUB 1P7KA 4FQJL 1TJIH 2BSSB 3F6IA 5C0AD 4H8WH 2DQGL 3CMOL 3WYRA 1TZIA 1W8OA 4PRPE 3MLSL 1DFBL 2AKRB 4Z7WA 2FEDC 4QY8A 2IANA 5FM5O 2W07A 3WIHH 3BJ91 1OAUH 2VDPH 3KLAB 4G8GA 3KLDA 3B2VL 5IEKA 5KSAC 5GGVL 1FRGL 4ODXB 3V4VH 1EERB 4Q9RH 1YPZA 3IFPB 3SDDD 1I8KA 1TDQA 3MNWA 4M7JL 3S37H 4G9FD 4NP4H 4DCQB 3P4OA 1QFWM 4R97C 1NCTA 3OAYK 3U7YL 7FABH 1A64A 3ARGA 1OLZA 1DE4B 1ZTXH 5HDQH 4JO2L 4AENA 3TP4A 2BNUB 4MQXD 4I4WB 4XHJC 2P42B 2P5WE 2R1XB 1WITA 3DX9A 4PG9B 4NPYA 5GS0C 1EV2E 4TUJA 1FZKA 2ZSWB 4M7LL 3T77B 5C0DA 4EXKA 3QUMB 1MCLA 2Q20A 4ALAH 4QHMB 4R3SA 1AGCB 3KPSB 4F8QA 5GRVK 3FQUA 3V5KA 4WFGD 5E99L 5F1SA 3LEVH 3QQ3A 1YMME 5EUKA 4OLWL 4XCEB 3V6OA 1UM6L 4OD3H 4M93C 2DMCA 4PY7A 4NNPH 3VXUD 4WI5A 3QWOA 3IDJA 3KNBA 1BGXH 4XXDB 1UH3A 3EYSH 2FZ3B 2R23A 1P4LA 1U8KB 3GKWL 1D6VH 4OFIA 5KS9B 1IGFL 3LRSB 4QRRB 1IILE 1Z0NA 4OGXL 5IESL 1N7MH 4R6UA 3T2QA 3UTTD 2GK0A 5IG7B 4KHXL 5IM7B 5L6YH 1MWAA 4MDIB 2A83B 3MXWH 3G9VA 3ARDD 4PRHB 4FFVD 4NQEA 5IFAH 3RJDA 3Q3GB 1X5LA 3V6OE 2CJUL 1W0WA 3DX8A 2FHCA 3ULSB 1UWEL 5I1KH 3NA9H 1G7LB 5BJTB 4EN3B 3M8OH 1QUNA 2RGSA 1ZHKB 2LAAA 1N64H 4N0RA 4BK4A 1FAIH 1FZKB 5GZNC 4ZDHB 1KELL 4LLWB 5KN5A 4PB0L 5IHZA 1CTNA 1UWXH 3L7FA 5DD1L 3QUZA 3GI9H 1C12A 1CDIA 5JHLH 4BM7A 4QHLB 2ENSA 5TQ2L 1CCZA 2EDHA 3LV3B 4JFEB 4U49A 3TZVC 1WCBA 4WJ5A 1FLTX 1LP9B 3C09C 4OCSL 3N1FC 3NFPA 3C5SA 4TVPE 4ZFOA 1EHAA 5DQDH 4R96A 4NBZB 4Z7WE 5T3ZL 1ZEAL 5ALBL 3DWTA 4KQ4L 3V6BR 3LRSA 2H32H 4FFZH 1QYGL 3QUYB 4JRYB 1FORL 1MHHA 5C9KA 4L3EB 3BRFA 2JE8A 3KS0H 2BCKB 4G43B 2DBJA 4S0TD 3P4MA 1BBJA 2EH8H 3MLXL 4G6KL 4PLJC 1OF2A 4PTUB 5I1AB 4ODHH 5IW3A 5EZLB 1FZJA 4QRTB 5FDWA 4QOKB 5AD0B 4YBQD 4G9DB 5MENA 3HZKA 5SWQB 1MCCA 2LTQB 1VGEL 1VB9A 3JUYA 5DLML 1OARL 5HHQB 4LLAA 4PGEA 1RUMH 3EW3B 1QSEE 5E56A 4C83B 4UDUB 2SEBA 4NFDA 1J1XL 1BQHG 4PRID 3RIAF 3CFJB 4KI5E 2V2XB 7FABL 2B1AL 1C12B 4F7CB 1TZHA 3E3QE 5J8OA 1ZT1B 4RMWA 4R4FH 3AM8C 2ADFL 4OCWH 3IFLH 1D6EA 5JDSB 2ARWA 3HRZB 3HE7C 1F58L 1MJUH 3PWPE 4NZUH 1KGCD 1BOYA 1AGEB 1YEKL 1S7TB 2DWEB 4LGPB 4R96B 4RAUB 1BBDH 1NLDL 3QZWB 4JKPL 4HV8B 1LDSA 2OR7A 3FQTB 4Y4KB 2QSVA 4U0RB 4M62L 3MV11 1VADA 2JJTC 3EYQC 3LSOB 2WM0A 1O0VA 1T3FB 1B9ZA 2GIYA 3QISA 3L6FA 2HRPL 1ZHNA 1SYVB 3C6SB 4YGAB 4Y5VB 43CAA 4MNGA 1MFEL 4NRZA 4ZQKB 2XZCL 1NJ9A 4Q9BA 3ARBD 3JUZA 4U7MA 4O51B 4J8RB 5F3BA 5FO8A 1AR1C 4F7EB 1UZ8B 4QT5B 5CJBA 3VRJA 4ZTOL 2C1OA 5T1LB 3VFRB 5K9OA 3BH8B 5CP3H 5DGRA 5I1KL 4JE4B 3QG6A 4CMMB 1LO0H 1N59B 5HYSG 5I66A 5DMGC 4BFIA 4M48L 4V1DD 3SDYL 2H32A 3FFCD 2W0LA 3MYJB 4N0CC 4KHXH 4EDXA 5L6YL 3C9NB 1VKXB 2WIIB 3L3KB 4J3TA 3HE6C 3P4NB 4OQ1A 2FD6L 1I3VA 3MLVL 3LKOA 5DQJA 2DLFH 5ESVB 4KZDL 1UXWA 2F74B 1U93B 5LCVL 3HTLX 3FRPG 3VFTA 4P5MA 5IB3B 3U1SL 5T3ZE 1FVDA 3MJ7B 4F2MB 1HIMH 5FCUL 3SGEH 1DQLH 5LJYH 5CZKA 3M1BB 2YN5A 3OSKA 4NNPL 1S9KC 3MA7B 4JLRA 3QJHB 2APWA 1FGNH 2G9HB 1QLRA 3RPKA 1P69B 2XN9B 5TDNB 5I1DA 2QSCH 5DJZA 5I71B 2BRQA 5DF0A 3O9WD 3U0PA 5L2JB 1HEZA 5E99H 2HMIC 2H1PH 3WKMH 4X5WB 1WBZA 3CK0H 1UCBL 3PQYA 3NPZB 2AXGB 3KPNA 5ADOH 3LZFH 2HAZA 4M03A 4D3CL 2OR8A 3UAJD 3OKYA 2GTZB 2Q7NA 3NIDE 5HJ3A 1SVZA 3KDMB 5D1QB 1FNFA 4ETYA 5F7EL 4OCWL 1HXYA 1H9VA 3MJ9A 4L8CB 4WWKB 3RUGE 1ZXQA 4RZCB 1MCSA 1KB5L 4YDIH 4JFYA 4XPTL 3FQWB 1HH9A 2HYMA 3VG9B 2B1HH 1BFSA 5ID0B 4HS6B 1B2WL 3LHPH 4QHUB 4TNVK 1WEJL 2AK4B 3OKEA 4HIIB 1SBSL 4ODHL 4MLSA 5GGRA 3ZYOA 3MBEB 4LCCA 5LGJB 1LO0L 4NQDB 3C08L 5E1AB 3QG7L 2JF1A 3WNLA 3PP4H 3MRPB 4HC1L 4PD4K 3FT2A 3VXTA 4OF6A 4M5YH 3WNMA 1YMMA 4KMTL 1NAKH 3TBWA 4R0LC 4NJAL 3KXFB 2QSCL 3U48A 1IKNA 3QPQC 3VD3A 2CQVA 1VA9A 4PJDB 1CIDA 1FZOA 3QDGB 4U1LB 3UZEA 1Q1JL 3TNMB 5H35A 3RGVB 5D70H 5FA4A 4QTHA 5SX4H 2D31A 3HB3C 3SQBA 3AREB 2XXCB 4RX4A 4DZ8B 1Z9OA 3PV6B 5K9KB 2P45B 1EEUA 3FQNB 4IM8A 2BVQB 5B21A 3SQOH 3BZFA 5F71A 5H94B 4PLKC 3QEUA 5C08D 3AB0B 1FIGL 2AJZB 5E2VL 5E6ID 2F8OA 3LEYL 3HG1B 1RZJL 4MNHB 3CDGB 3T0EB 4MDIA 5E8EB 4BKLA 4AM0B 5B3JE 2EE3A 1ZLVK 4XCNA 4KVNL 1YMMD 4HFUL 4PJEE 4QXTB 1EA9C 1YEEH 4ISVA 2XZCH 3DMMB 1E28A 4FQ2H 5KG9A 3QG7H 1OTSD 2A6JB 2BJMH 4OZGF 1A7QH 1KOAA 2P8PA 2BHUA 2IAMC 4N9GA 4NT6A 1BVLB 5IBTL 4MD4B 4Y88A 2YPKB 1EUUA 1VCAA 1YDPA 2NY2D 3GJEB 1P1ZA 1N59A 1RJLB 4XAWH 5DRZA 1KB9J 2B4CH 4FQXA 2MCPH 2Z31C 1IQWL 1JV5A 4OUUA 3AXLB 1IEHA 4JFQA 2Y4SA 3T08A 4GO6B 1YC7A 3FCTB 4RIRA 4HT1H 2M1KA 1DDHB 2YRZA 2E7CA 4TRPL 4X4XA 4MD5B 4O4YL 4H8WC 2HJFB 4X7SL 3V8OA 2PO6A 3QAZC 5FAAA 1VACA 3WKNA 2DQJH 4UT9L 3CFIC 3JTTB 5DWUH 3BXNB 4PJHB 1XF5A 4O5LH 1OT1A 2CR3A 3HNTL 5DO2C 5H2BA 4Q6YA 3O8XB 4LPWA 1R3LB 4GKSB 3RNQA 1OSPH 2BY2A 5F93C 1CD9B 5EU5B 1K85A 2BVTA 2VITB 1KJ2H 3DXAE 5L7XH 3RZCB 4NO5B 4WEUD 3BKML 1PYWA 3WFDL 1TETL 4PGJA 1P5VA 1JIBA 1HSBB 1X6NA 3N1MC 4EIZC 1KJVA 5MERA 3MLZL 2FSEA 1QSZA 1KENH 1N64L 5GGTH 1TIUA 4YDKL 3IGAB 2YPKA 4N1EA 4U1KA 3T3PE 5FM4A 1ZHBB 3ZE1E 5J12C 3BH9A 5FGBC 5TFSL 3VJ6B 4Y5XB 3ZE0F 3RTQA 3EDDA 3FFCE 3ISWA 5I76B 1IAKB 3EIFA 4MVBD 4GSDH 2CDFA 1DDHA 1R3IL 2BVEA 1NGPH 2FHBA 3TWCL 4Y16A 5I1CL 5IBLC 3RKDC 3NCEB 2NY5C 2ZJSL 2IF7A 3B83A 1CK0L 3UDWC 4JHAH 2IADB 2NY7H 3CFCL 1CWVA 2WK2A 2HT4C 3MRHA 4F7TB 5F9JB 4J1UA 1DJSA 2VH5H 3BGFC 4MLIA 1XGPA 1NMBH 4QEGA 5D1XD 2F58L 3TA3B 3OR6A 4J4PD 3MV7E 4BQCA 4OZFH 2VITA 4MHHI 4MNQD 1MNUL 5JW4N 1KCUL 4TUOB 5DS8A 5ACMA 3U0TA 2O93L 4NNYB 4HG4K 1UXSA 5LAXB 4HH9A 4HGWB 2N56A 4RGMC 2C1OB 5T1LA 3VFRA 2PO6C 4WV1B 1MCJA 1GZQB 4W6XB 4YX2L 2EEDA 3F7YB 4ZOBA 4D8PB 4MMXC 4X83A 1OGTB 3BRGC 5FOBA 1JBJA 3KLAA 3HI1B 3FQXB 3GSUA 3BGAA 1N7ML 3QWRA 5HI3D 4XPFL 2B4CL 4NQSA 4FFYH 1J1PL 2AQ3A 4EVNA 3ULSA 3D5OF 3S4SA 2GW5A 2H8PA 1ADQA 2YD5A 5A2JH 2GUOA 4GW5B 1FE8H 1ONQA 3HMXH 3MLWH 4XVSH 4Y4FD 1P4BH 3TO2A 1S3KL 2GTWB 4KVCL 1ORSB 4JM2B 4PG9A 2DIAA 4N9GB 3LS4L 3DYPA 1MPAL 1X5JA 2XN9A 4BA8A 4YR6A 3DRQA 3JVGC 2BVYA 2VDRH 3N0PB 1P7QA 4HWZA 4OGAC 2KBGA 2AJUH 1GVIA 2VLJD 5H37G 3Q1SL 1WV7T 3A6BH 2VZSA 4B53A 5KSVA 2Z93A 5J1SC 4LHUG 5ABDE 4LCCC 4AG4H 4CN1A 5GRVL 5CEYA 1MEXH 3CPLB 2K9UA 1YEIL 3MRLA 2HT3C 3SOBL 1E4KC 2R23B 4NRYB 5C0RL 4L8SC 5E8PA 3C5ZD 1R3HA 1ACYL 1L7TL 4E41D 3OZ9H 1Z9MA 3TBTA 1FRGH 1AXSA 3CZJA 5IW6A 2J4WH 5CZXC 2YOCA 1T2XA 2D0HA 2HVJA 5C9JA 1JGEB 1K8DA 4FTVE 4TULL 2VUYA 1XH3A 4G5ZL 2DICA 1BIHA 3S36L 3NN8A 4ZUVA 5F88B 3ROLA 3IAPA 4GBXA 5D9SB 4GXVH 5CUSL 3WFDH 3EYQD 1R5IB 5EU7C 3SKOA 1LEGA 4BH8B 4ZFZB 3CXHJ 4MS8D 4R90L 2JCCF 4UTBH 3A6OA 1T5XB 4NN6B 3MRRA 5B38A 3IXTB 3G6JF 5BQ7B 1JHKL 4GW1A 1QKZH 1ZANL 4JFFE 3OWEA 1NGQH 1WAAA 2Y36L 5D2LB 1AR1D 4Y19D 1FJ1A 3BP6B 1RHFA 1T80A 2FX7H 4FQCH 1I1AA 3BHBB 1G7MB 3NAAH 4WNQB 5D6CB 5EUOB 3HC3L 4MX7B 5HGBA 5I8EA 5JPNB 2QHRL 3FB5A 1A7OL 3UCRA 4M43H 2BXZA 4DZ8A 5DVLA 3L3HB 2IH1A 3HE6D 1DQDL 1VGKB 5LBSL 1MFBH 3DGCR 5CKGA 4MJ5A 1AY1L 2E7HA 3IXAB 3K1DA 3GJFB 1CXIA 4PS4L 3TBYA 1ND0B 4N8VB 1ZGLA 5E08H 1R3HB 3SE4C 4PRNA 1CGXA 4EOWL 4PJFB 4P4RB 3SDXA 4Z7NF 3VGAB 2Q87A 2Z0BA 1IZKA 1P7KB 1MFCH 1WLHA 1KLGB 3RTQC 3T2NL 4BQ8A 2EDDA 1KCRL 2CK0H 3NCMA 1IM3B 1QBLH 4L4VA 3STZB 4M5ZH 3S3PA 5ISZB 3MRMB 2ZPKH 4ZS6D 4JFZH 3O9WC 4NKDB 5EO1B 3U2SA 3BAEL 2IANB 4IRSA 4FQXD 4XXCA 5EA0L 4KI5D 3Q5YA 4AZ8A 4GRLA 5IUSA 2MWCA 1GOHA 1TJHH 4LKXA 3S35H 1A6AA 3S3JA 1SQ2N 2ICCA 4I77L 4XVUC 3D9AL 3HNSH 2RR3A 3LPWA 5ADPL 5ANME 5TF0A 4RISL 1P84J 3U4BL 1AGDB 3AY4A 2ZUQB 2CR6A 4L9LA 2P46B 2VXUH 3EDEA 3NIFE 2HFFA 2P8MB 3WNNA 4J12A 1I1FA 4AG4L 5A3ID 5IVXB 3GI8L 1IKFL 2Q1EA 1BZ9B 3DECA 3GHBL 3BZ4A 3QO0A 3MRDB 5T3XD 2PYEB 4S1RL 3IJYB 4UUJA 1GJIA 5EZJA 1FL5A 4MDJA 3GMLB 5HVGB 43C9A 4X6CA 2HKHL 1KIPA 1XGYH 1R5WA 2ICWI 3R8BB 1QFOA 2CH8A 2NQCA 3BSZH 3SDAA 2GTZA 2VERN 4WENB 2DOCA 5CEZH 1T3FA 1WF5A 1JWSB 3C2AH 4ODSH 1DBKH 3U7WL 4C58B 3K0WA 4H0GA 4AJ0A 1RUPH 5IB5A 4J8RA 2VLKA 5F3BB 1Q94B 4YAQA 1BX2B 1CD1A 1U8PA 3IVKB 5EIQA 4OCNC 4I77H 3OF6D 2ADGA 1AIFA 4HKZB 3VJ6A 1SM3H 2Z9TA 3X14A 3N9GL 1XGRA 1KB5A 2CD0A 1WAAE 5FUOL 5IB1B 2I60L 5HHVH 3GIZH 5E6IC 2ZCHH 3VFMA 2X4PB 4NQED 4HUUA 2DQCL 3Q2CA 4RCAA 5C7XH 1IGIL 3KYKL 3K8LA 2IH3A 4DOHB 1S9WA 4XP5L 2IPUG 1SY6L 3CZFA 1LNUB 3HKFA 4JY4A 3LSOA 4P3DA 3VFOA 1W2KT 3DIFA 4Y4HC 3QDJD 3ZSSA 5GGUB 4MDJB 4MAUL 5JPMB 4NKIL 1RUKL 4OZGB 3QQ4A 2YPLA 2MPAL 2APBA 4PJEF 3BPLC 4XBPB 4O4YH 3BVNB 4M93B 4U1SB 5J89A 2EDKA 5IWLC 2O26U 5JPNA 3GFUA 4OCSH 2I5YL 1MLCA 5HHVL 1NC4B 1UM5L 2QSTA 1AD0A 5I6XB 1MI5D 2R2CA 1JJUA 1HKLL 5C8JA 3MUZ1 1IT9L 3SCMC 3U7YH 1YPZB 5EOQL 5I0ZA 3G6AA 1AI1L 3U46A 4LPVA 1CS6A 5IBTH 5CMAB 1INDL 1YYLH 1JE6A 5C71A 3I50H 2NZ9D 4MQTB 1DLFL 2WIMA 4JM2F 5CJQH 1NGXB 4KVNH 4ORGA 3MNZA 2GITA 5EZLA 2VO5A 1FO0L 4GW4A 5KANG 3FOMA 4RRPA 2HTLD 2A6KB 4LLMB 3TZVA 3HN3A 5KAQF 4A6YA 2IGFH 3WIIH 2VDLL 5KVFH 1MRFH 3RWFA 5C0CA 4PJBA 1JZ8A 1C7TA 3L3JB 5KVGL 2E9BA 4ZXBA 1JF5A 4KJWC 3CXDL 1W0VA 1XMWA 4WDIB 5T5NF 1GZPA 4PJDA 4ENED 4X6CF 1FNEA 3DXAB 4X9IA 1U8LA 2JTDA 2AJSL 1N5YH 4NKOA 1KJ3L 3W82A 3SO5A 2KKQA 1Z9SA 4Z7OF 1ROWA 1TPXB 3JSSA 4NNXB 2R0LL 2VAJA 4P5KB 2E6QA 3CSYA 3O11A 1HHKA 4F7PA 2QV2A 4QF1A 3I02B 3T09A 1T04A 2Y6SD 4KK5C 1NGWA 2K7PA 4YH6A 1F02I 1U3HC 3VXME 5FK9A 2DL2A 3QUZD 3GSQA 4P46B 5B22A 4PJCE 4R7DB 3SDAD 2ICWB 2DI8A 3SKOB 5L2KD 2I60H 1JRHH 3K4DA 4WCYL 1CDYA 1K2DA 4AEHL 4Q7DA 4KTDL 5DRWB 3WNOA 1X9QA 2VQUA 4GMSH 3TNNA 4OM1H 3IDXL 5EWIL 1NFKA 3W5NA 3TH3T 3RVVC 4FXKA 1RZJH 4O2EB 1ZA6A 1UM4H 2FH8A 2E7BA 2P1YA 4TUKL 4W6WB 4TTGA 5EUOA 1E4WH 3R06B 4FXGA 3C60C 1SEBB 4O58L 2ICES 1T1YA 3RRQA 3MJ8A 1T7XA 4UOJA 2P24A 1U42A 2X4OA 4XRCB 4P59L 1FVDB 5C0DB 2ERJB 1EEYB 4TNVF 4M7LT 4MJ6A 4ODWA 3VGDA 5E2TL 1HNFA 1Z6JT 1BJ1H 4PGBA 5HDOA 4J3WA 1HHKB 4F7PB 3GHBH 1JGVL 4PR5A 4WUUA 3ZHDA 5L2KA 5T5FL 5GRXG 4PGDA 2CUMA 3MRIA 1JYVA 2OQJB 4APQC 3QA3B 3PP3H 4Z7VB 1RZFH 2F54E 1FZJB 4XP9H 3GMMB 4S11A 3ZL4H 1S7XB 5JIPA 5EO0B 4M3JA 2EDOA 2NY1D 4NCDA 4NQCA 3X3FH 1HXYB 3EFFB 3FO9B 4TPRH 3UO1L 4TVSa 1Y0LB 2XNAB 3R0NA 2VDKL 2EYRB 4I9WD 5EIVA 5DTFB 3VI4E 4Y2DD 1CGSH 5DJ0B 1F90L 3MJ9H 3O2VH 3U4AA 1LE5A 4DN3H 4G8EA 3P0GB 2LAGB 1KIRB 4D0CA 1D7FA 3QIBB 4OB5H 3KPRE 1BVKA 4PRDB 3WN5A 3SBWA 5KSUB 4B7LA 3OKMA 4PJBE 2AJUL 4PB9H 1YEGH 4ERSH 4X6DF 1SEQL 2XYCA 5D7LD 2WBWB 2YWZA 3ARFA 1NFIA 4M00A 4KKLC 5GRYA 1EFQA 5IR1A 2AJ3B 5GIRB 4MA3B 1LO4L 5SV4A 4OZIF 3I3EA 1BD2E 3LDBC 3LKNB 1FDLL 1GGYA 1NJ9B 2VDNL 3QA3A 4U1NA 4F9LA 2C4FT 3BGFB 4KFZC 4BELD 3GKZA 3E6HB 3T0EE 2FX7L 4QGYA 4Q2ZB 1BM3H 4ORZC 3EFFA 3KR3H 1FCGA 3LIZH 1CYGA 4AL8L 3QNYB 4U1MA 2FYYB 4WHTB 3KLHC 3NCYS 5INCA 5J6GA 4KZEL 4L3EA 4NO0B 3PHOA 2FATH 5DJ0A 5D96B 3WNPA 3RWIA 1FL6A 4R2GB 4NC2B 3NACH 1Q9KB 1MJ8H 1AD9A 1KCUH 1QPXA 4HUUB 4HGMA 3D3VD 3SJVA 4JQXC 4WW2B 4FHBD 4PRPB 4XTRD 5DJ2B 1L0YA 3DLQR 1ZS8A 4EDWL 3ALXA 3UTSA 5LKNA 1EEZB 3GJEA 1QLRB 3WFHA 4JDZB 2VE6B 2FX9L 5KVDH 2CLVB 4ZFFA 4FG6C 2WBKA 4WNQA 3A67H 4YHPB 5E2TH 1KEML 1IVLA 1PG7L 2X9WA 4Q97A 3F58H 4RFEA 2HG5B 4APQA 1S9YA 3HI5L 1JTTA 4JG1H 3IKCB 3FHQA 2RHEA 2OM5A 5CZVH 3ZDXE 1BWMA 4OCYL 5F7YC 1G7HA 3TIEB 5DC9B 3PWVB 1MQ8A 2X4OB 3H3PL 4PJ7F 3OKKB 5D93C 5ANMB 2L7JA 1U8JA 2R1YA 1MCOH 1R5VB 3HC0A 4AMKL 1AR2A 1I9RL 2BY0A 4PRNB 4BZ1H 5HYIA 4QRRA 4L5FL 3F65A 1RULH 1MPAH 3EDJA 4GRWH 4LCWA 3NFSL 2VB5A 3G08B 4RGMB 3BT2H 3BUYA 4HFWB 2A83A 4OM1L 4S2SA 1JWUB 2AQ1A 4YHNB 3BDXA 4ZQKA 1N0XL 5SX5K 2WANA 3KHOA 3PP4L 4JG0L 3QFJB 3NIFF 1ZHLA 3B3IA 1OAYH 3OXSA 3UZQA 1SHMA 4GW4B 5EU7E 5IFAL 2VUOA 3HMXL 3MLWL 4XVSL 3MGTA 4JZJC 2C1PA 2OTWA 2FSEB 2N7AA 1I1RA 1L4IA 4ZPTB 5GGSA 3WLWD 2YA2A 1U91A 3EDKA 2NXZB 2G2RB 1P7QD 3ARBA 5D1XB 4OD2A 3TA3D 3V95A 5JW3H 3P11H 1JWMB 1Q8MA 3KS0J 3LN4B 1X4YA 4TSBH 3B5TA 2PR4H 5EN2A 5CIPB 5C0BB 4X9FA 4OZ4B 5GGVH 8FABB 5GS1B 2AJSH 1N5YL 4TPRL 1OAQH 3B6SA 5CILH 4UILL 3GMOA 4W4OC 3NFPB 1OP9A 4NZRL 5INDB 3ZYIA 2HTKD 3K3QA 5EC2B 2I24N 4PPTA 2XWBB 1DUYB 4JKLA 1NGQL 2Y36H 3I75A 5IROC 3L7EB 4ZOCA 3UPAA 3GI9L 2JJTA 1T2JA 3LKSA 4PTUA 3KPNB 1N5AB 4UT7L 3WFBH 4JFEE 5IJKA 4JN2B 2N7BA 2J6EA 3O2VL 4ODVH 2F15A 5BO1H 1DBML 1ZE3C 4J3OC 2B20A 5GQBA 1I7RB 1TITA 1ZT4B 4PJ9B 1I1AB 2VXTL 3GDBA 1XGRB 4M4PA 5T1KA 5M94B 1QR1A 1FBIL 4I2XE 4U3XA 3RDTD 4OCYH 1OHQA 4YDKH 2A0LD 3LN4A 4L4TE 1QVOB 1CN4A 1KPUB 3VFMB 3ARDA 2Z4QA 3QDJE 1NC2B 1PY4A 1PLGH 3MBEA 4GS7B 2VMFA 3F58L 4WU7B 4GKNA 1J11A 4JFZL 4N8VA 3BWAB 2EEAA 2IFFH 2AJVL 2ITDA 4LARL 2OJEB 4P46C 5DMIL 1JPSL 1TTUA 3QUKA 1SVCP 2W60B 1K4DA 3WFHB 1UQSB 2VSDA 3UJJH 4HV8A 5DRXB 4I5BB 5CWSA 5HY9A 1K8IB 1KLUB 3CDFA 5GHWH 4CVXB 4IBLT 2ARJA 4MNGB 1A1NA 5IP4A 2FGWL 4JZNB 1IGIH 3ZDZF 5I30H 3CC5A 3V6ZB 3PWUB 4P2RE 3HLAB 4XPHL 4M1GH 5IQ9A 2XA3A 1M6OA 2FL5B 2AJZA 4HX1A 1VERA 1UB5A 4R0LA 2BFVH 5DC4B 3RVXD 3G5ZB 2IQAB 4DKFL 4E41A 3MJ6A 4HKJB 2B5IC 4MNGE 5E00A 4YDJB 5C09B 1X4XA 1EGJH 1G6RH 1E28B 3LCYA 1V8HA 4P5MB 5IB3A 3HE6B 4LQ1A 1YNLH 4PRDA 3WN5B 1LE9A 1OAYL 4Y1AB 4NSKB 2JJSA 3BP5A 1TJGL 5EO9A 4KK5D 4G3YL 5FYJU 1AXTL 1CDGA 3KYNB 5IVOA 1JF1A 1NH6A 4KKAD 4HXAH 2HH0H 4FN0A 4MMZC 1W0VB 1PQZA 4MHHG 5T5NG 1MAJA 4WTZA 1HQRA 3SDXE 2VDOL 3BWUC 4RAVA 1I8IB 3HR6A 3TYFB 1I9RH 4JHZA 3NOIA 5EU3B 3SOBH 3GB7A 2V2TA 4OZGA 2DQFA 1G9MC 1ED3B 2BVPB 4JDTL 4CN6A 2D7PA 4GBXC 5I1HL 1HH6A 4K8RC 2R56H 2VLRD 2W65B 3V6ZA 4JG1L 5L0QC 1HINH 4QXGH 5B8CB 1T1ZB 3BPOB 1T2QL 3JV0A 1PVHA 4GG8A 3B9KD 2G60L 5A16B 3U4BH 2O5YH 5D8JH 4I18A 2FEEL 3TBYB 3HI1A 5FYJD 3SKNB 3TA3C 5DEFA 3MLUH 1RFDH 5IFHL 3N1PC 3ARZA 2DM2A 4XNMA 3MCKB 2ZUVA 2LU4A 3BKJH 2Q76A 4JEGB 2ED7A 5E8DH 3L5WA 2YD7A 3RZCA 2YHGA 1IGTB 5TE6L 5BS0E 1EHXA 5GGRB 2NY0D 3MRCA 3W9EA 1G7LA 4HS6A 4HUMB 4P9HH 3VW3L 3P9LA 4IRSB 4I2XA 3PUCA 1ZS8B 3KJ4B 5D1ZA 3MRQA 3H0TB 3ECBA 2EH7L 2BK8A 1T6VN 4L4TA 1I8MB 1MREL 4P5TC 4F3FB 1M05A 1CL7H 3AS0A 3LRHA 1H3WM 4LSVH 4KTEH 1J10A 2DQDL 1EJOL 1XIWC 2YD1A 3CFKB 2G75B 5E8OA 3GZKA 4OCXH 1PEZA 3HA0A 5IHLB 1T1YB 1AE6H 1XZ0B 4HLZH 4GAFB 3U9UB 5ILTL 4DOHE 2V5SA 3CPLA 2XA8L 4O2CB 5C3TA 2PW2B 4JY6A 5HGDB 3TIDA 1YECH 1V3KA 2EDJA 5IIEB 2FLRT 4M6OH 5BRZD 1BHGA 4MNHA 1ZV5A 4G6AD 4X9GA 2ZOLA 3AB0C 4EKXA 1LO3H 2BRRL 1N2RA 5EZIH 2A0LC 1TNMA 5DGQA 2X1XR 2IQ9H 1DQLL 3KYKH 1V3JA 2EXYC 4K23L 2GEEA 3QI9B 4HLZG 5HI4D 3QNXB 2CMRH 3RP1A 4KU1A 4LIQL 4U0QB 1E6JL 1KJ2B 1MHPL 3AVEA 4MD4A 3NCJH 3VRIB 1M71B 4LSSL 2M26A 1XF3B 5DUBA 4MCYB 4AT6A 5DQ9B 3AMKA 2KZ1B 5GPRA 3BPCA 3CSGA 4JAMB 3VWJA 4OGZA 4L3CB 5HDBF 5TFSH 3DV4A 1VFAB 3S35L 5D2NC 1NC4D 5GSVA 2QSQA 3FO0L 3M17B 4BFEA 8CGTA 1LK3H 4KRPC 2J8OA 4G80A 3B9EA 2KPNA 4JN1H 2NTFA 1RZGB 4U6VL 4JKWA 4MXQD 1R3JB 1PX4A 3D39A 5I1JL 3F7RA 3QH3B 2Y7QA 2X05A 4LCYB 5KTEL 4U6YA 1MFCL 4N9OB 1BOGA 5E6ZA 3P73A 2VDQL 2I25N 4U1LA 4JANA 5CD3A 1NAKL 3V5DB 3UROR 3U0WL 1C5DA 3KNBB 5TQ0L 3BP4A 4N1HB 3QIUA 1SYSB 1X7QA 3RGVC 1K3IA 4JN2A 3QNXA 4O58H 1TFHA 4E9LA 5I1EL 2B39A 1LEKA 1L9NA 1UWXK 3ARPA 4KK8D 5K9OB 3CFDB 4G42B 3IJSA 3CX2A 4F15B 2VWEC 1NSNL 1OVZA 2YSSB 4AL8H 2MHAB 2VR5A 2YD6A 3QEQB 4WI8A 1EO5A 4C54A 2H41A 3QXAA 3BIKB 3DO3A 5I6XC 1TVHA 1XGQB 4JGUA 1VFAA 5J13C 1UA6L 1YN7A 3MROB 4GBXD 2VISA 5DXWA 5I30L 4LSUL 3ARQA 5F7FA 5GGQH 4PJ5D 5FECA 4N68A 4PJIA 4LFHD 1H8SA 1RZGA 1V5JA 3RWHB 5FKAA 3BT2L 3E1F1 4JLRB 2X4QB 5GS2D 4PJBB 4Y4HB 4RAHA 5JW4R 3L3JA 4MXVE 1AY1H 4XP5H 4U7KA 4U6YB 3X11B 1R5WB 1JV5B 3JWOC 4NWUH 2W9LA 5D1XC 4J4PC 1HHGB 4OAWA 3HPJB 3QEHB 4LVHC 4LQFL 5GIRA 4MX7A 4MA7H 1L7TH 3LY6A 3K2MC 4QRSA 2JJSC 5DS8B 2GJ6B 4QGTA 5D71L 2R1YB 3DETD 2ZNWA 1FVEA 4NQVA 1F4WL 1CXHA 4JB9L 2EE6A 2GJZA 1NEZA 4JO3H 1KC5L 1FNGA 4RZCA 4IIQB 2IPKA 3R1GH 3PABA 4N0FA 1T20B 4ZXBC 5DMYA 1RD6A 2UY7A 4QXUH 4WHDA 3VGHA 2OLDA 1K5NB 4R7DA 5MENB 4QWWC 3IRZA 2E3VA 3OGCB 2IH3B 1W0WB 3CMOH 3DX8B 4LLUA 3P9MA 3HC4L 2CJUH 3BEWB 2Y06L 3QXDA 4MA8L 4NFBA 3BRDA 5EBLA 3GRWA 3KVQA 5DSCA 2Q86B 1INEH 3UYRL 1R24A 1WISA 2W92A 5DJ8B 1XF2A 1BWWA 1B0WA 3DRQB 4KMQA 1DQTA 2QR0A 2X6MA 5K9JH 1FYHB 5KSBE 2NPLX 1RVFH 3LVEA 2Z93B 2VZOA 4P5TA 4BZ2H 1CE1L 4CKVX 3MPCA 4F58H 1AQKL 5CILL 3EO1B 2XWTB 4CVUA 1W0YT 3BUTA 2B0SL 4KAQH 4ONFL 1EEQA 1IAOB 4IS6A 2IADA 2VR4A 3TM6A 3IAQA 3ZTNH 2XN9E 1EAPB 1C16B 1VADB 3L7EA 5GXBB 1KIPB 3PJSB 1HSAB 4IMKA 2NY6B 1OW0C 1NCCH 3G6JE 4KTDH 1KCVL 3MR9B 1DVFB 1WT5A 5AZ2H 3BZEB 1GPOL 2EICA 5EU6D 1S9VB 3O3DA 4Y4FB 1KJMA 1UA6H 3T4YA 3P9LB 5IFJA 2Y06H 3EJZD 5BV7B 1IM9D 2GY7B 1PFCA 3P77B 3QFJA 4D9QE 3MOAH 1I85A 4PJ9A 5CGYC 5B39B 4XPAH 1GGCL 2YD4A 1TCRA 1BX2A 1CD1B 1U8PB 2XKSA 4G5ZH 1T03L 5BXFB 2DLHA 1JNLH 3QUXA 4ODXA 3SKJH 3HZMB 4L5FH 3KPTA 3MV8E 1H0DA 2WQ8A 1G7PA 4JFQB 5IBUB 1MHEB 2WSKA 1A4JB 1MQKH 2DTML 4LASL 1UYWH 2AQ2A 1YQVH 1OPGL 3FQRA 2MMXA 4XBEL 4PJ8B 4XX1G 1GH7A 3KPMA 3SO3B 3C60B 3AGVA 1MRDL 4PJCA 1UJ3B 2BSTA 5I1HH 2ZOKA 4RA3A 1NMBL 2E6JA 3L5XL 2ERJC 3GJFA 2AJXH 3T04D 3L95B 1KN2H 4RMVA 2DWEA 1HXMB 4NO0D 1TQBC 1KJ2L 2XFXB 4JRXD 4OGYL 3VXNB 2NY5L 4M7ZB 3P40A 1Z2KA 3E8UH 5IROA 4P4RA 4KMTH 1LO2L 3GSRA 2OL3B 4XCCH 3T8XA 4HQQH 4WVRA 4AH2A 2AK1H 4ZS6C 4F57L 2E5EA 3QWOB 2VXUL 3JTSB 4LPCA 1LK2A 3RKPA 3TFKD 3QAZB 1V05A 3V0VB 3FN9A 1FH5L 5FYLE 3CFBB 1KBGH 4HBCL 2ITCA 2NZIA 2ICEB 5IB4B 3T3PF 2DLTA 5GGVY 4NRYA 4NWTL 3F7VB 5TPWH 5C0CE 4JPIB 3C5ZA 4WHTA 1DLHB 4WI4A 5E8NA 4Y16D 4XP1H 1KCKA 3QT2A 5EOCL 5D7IE 1YY9D 5E2WL 4U0RC 1LO5B 2I5YH 3IDMA 2XICA 4EI5C 3PGCA 3I6KA 3DROA 5DT1L 1PEWA 3RIFF 3MRPA 2B8OT 4F33A 2EC9U 2F53A 3TZVD 3OR7B 5DD6A 2A73B 3HUJA 4OM0L 4BH8A 3KPRD 3FO2A 3N1GC 1JF6A 3MRFB 3MBXH 3RGHA 1ZA3B 4R2GC 2PXYD 4O5LL 2HRLA 5BVJA 4ZXBD 1SEQH 1V3LA 3BQUB 4WI9A 3MRJA 1YEGL 4ERSL 1K4DB 1WWBX 4BSJA 2Q8BH 1U8MA 3ZTNL 3MX0A 3VXRD 3PWLA 4J3UA 2OL3A 1E4XL 3SDDA 3BPOC 4OB5L 2ZCHL 5DD0H 3U0TB 5ECJE 5IT2L 5CZVL 1I7RA 1PLGL 5F6HI 2AXGA 1G7HB 3TIEA 4OLVL 2H32B 4GLRI 4ESKA 2H6PA 3PWNB 3WE6A 3MRKA 5C0EA 3ETBF 2VNCA 1Q0XH 3KG5A 3QWRD 3O45A 4YBQC 4D8PA 2CIIB 1HHIA 2A9MH 3A67L 5BS0B 5T1DL 4LCWB 1V3MA 1MCNA 3VFUB 4D9LH 3B5HA 2D7NA 2EDQA 2R15A 3DVGA 3NGBB 1DBAL 1P6AB 2ZCKH 4N8CH 4ZTOH 5ICZA 5F3HB 5IQ7H 1A6WL 4LOUC 3PGCB 3OKMB 3TEUA 1ZT7B 3C5JA 1MFEH 3VXSE 3P4LA 1CF8L 3L3IA 5I1DB 3NZ8A 5E4EC 5AZEH 1RSFA 3PWPD 3RVUD 3U7AA 4Z7UF 2C3VB 4MD0A 1FL3A 1RFDL 2DYPB 2YBRB 1MCIA 5F6HJ 1A1NB 3DIFB 1RZKC 5E8OB 4KDTA 3QNZA 1B0RB 4XPTH 1G0DA 4PY7B 3WSQH 5IMKB 2RFXB 5E9DE 1JGDA 3B9VA 3K2UH 1N8ZB 5D71H 5E70A 3W9DA 3WCYA 5F7EH 3PQYE 2Z8SA 4HS3B 3VXQA 1S7TA 5CGYD 4C56E 2K7QA 4XC1L 1EFXD 1I1FB 1T7VA 3INUL 3QCVL 4QOKE 4H1LG 35C8L 4FQQB 1QBAA 1AKJD 1UCBH 5DJXA 3SPVA 1T0NB 1YPZF 3OJDA 4DKEL 5J6GB 2DQDH 4JREB 4LSSH 5E5MA 3SN6N 1FL5B 2J3SA 4ZSOE 4XPAL 2XY2A 1KTLA 4OLZH 3FOLB 2ADJA 1QTYT 4GRWF 4N0CD 4LDLB 3MNZB 4HJJL 2R8SH 1D5XA 4RGND 4LAQL 1E4XI 3MV9B 3QFDA 5E9DA 1N4XH 3G5YA 1P5UA 3UTSD 4GT7A 4HUXB 4XNYL 4O2FB 1MCPL 3V79C 3TO4D 3QG6B 1EO8L 2OK0L 1UACH 1IC7L 5IK3B 4QRRE 4L3CA 2VLKB 2P49B 1XAUA 1GGBH 3QEQE 4M8QA 5TPWL 1BQLL 3CVHB 5KSAB 3OAZH 5D6DA 3CVIL 4RFEB 4RMQA 1RV6X 2F8XC 5GS0H 3B2VH 1I85C 3JWDC 4PJ9C 4WEBL 4WY7H 4ETQB 5EC1B 1FN4A 2Z8WC 1IEAA 5HTSA 5KSUA 5ICXB 3AAZB 3EO1A 2Q8AL 3MLSH 4ZFGH 3P0YH 1FC1A 3HHRB 4X9BA 2DWDB 3FB7A 2VQTA 2IALA 3L9RB 4F9PC 2DQTL 1K4CA 4KROB 4YXHH 3BW9A 4HK0A 3BIAX 4XX1E 1C16A 3CLFL 1R3KA 2QQNH 3SCMB 3QQ3B 2Y6SC 4Y16C 3QCUH 5HVWA 1QHOA 2JJVA 2WW8A 5JUEL 1CG9B 5D2LE 3VXSD 3VWKD 3RU8H 1U3JA 2X1PA 1KTLB 2NLJB 1GOGA 4AIXA 1QLFA 5CGTA 2KUTA 2YKLL 3KYAA 3MRQB 1H3PL 1KG0B 3F5WA 2FD6H 3DHJA 3RL1B 5GRJL 2VXVL 4K2UL 3C87A 4JFED 4CADB 2OYPA 1QSFB 2UZXB 5ADPH 3BISA 3O0RL 4AEIL 3D69B 1ZGLP 4OZIA 5FV2A 2ADFH 1H0DB 1ZT1A 4PRHA 3KPLA 4XB7A 1X5AA 4RQQA 3QEGH 1L6XA 2X5PA 4EBQL 3QDMA 2YRLA 4YDJA 3T65A 1FVCB 3PWJB 2EKSB 3RUGF 4XNYH 3FAWA 4PTTA 1AP2B 4M5ZL 4P2RD 4PBXA 2B2XH 4FTVA 5DO2D 1XF5B 1JF1B 2E8ZA 1MVUB 1MY7A 2DQTH 3O4LE 4JR9L 4O02H 5EUOF 5HHMB 4C57C 1FAKT 4HXAL 4RFOH 2PYEA 5T33L 5EFIA 4KTYA 4NZTH 3N85H 2VLKE 4PLKD 3UJTL 3C08H 3RI5F 4OFKA 1B0RA 4APQD 1YNLL 5ESQA 3QO1B 4DZBB 4JJHA 1H15A 5GGQL 4JANB 4XWGL 5HPMA 1EVUA 2B1HL 4BFGA 3RBGA 2XKNB 2CXGA 3FB8B 4N90D 2EYTA 2VL5B 4GXUM 3FQNA 1FZMA 1RZ8A 3VWJD 5DURD 4OIBA 1W72L 5IEKB 5AG8A 3LPGA 1KV3A 4ZSOB 1LEKB 3VA2C 5FUOH 3ARSA 2IAMD 4WUUE 2MCPL 4U4BA 3V4PH 4Y19E 3ARGB 1RJCA 2DIJA 3PIQA 3QEQA 3V52H 3K8MA 3UPRA 1CR9H 1BVKB 1EMTL 3RY6A 1MFAH 1T0MB 2FGWH 4PJ7A 4NPYB 3QXDB 1QNZL 2HT4D 1MNUH 1YN7B 3JWOH 4EI6B 3VD5A 2FR4A 2MQ0A 2OI9C 5E9DD 4ZOAA 5D1ZB 3UJJL 3FO2B 3ILPB 6FABL 3RX5A 1UT9A 3T4AA 1MIML 4S1DC 5L8KB 3AUVA 1KLUA 2KQMA 4YQXL 3AU1A 3OGOE 4I3RH 2X4TB 4WIQA 2VABB 4FXKB 1CQKA 4JFPA 5IMLA 1LEIA 4JHAL 4ZUWA 4HD9A 1MRDH 5ITBH 2HJFA 1V7MH 5HPMB 1P4LB 1U8KA 2XZQL 4PJ7E 5DUML 5HJ3B 4G6FB 2CIKA 3O8XC 4QRSB 3PDDA 3MOBH 4I0KA 1U8NA 4X6BB 5JQHC 1NDGB 1AQDA 5TDOA 1ZSDA 4IHOB 4OF8A 3SDYH 2CRYA 4GAYA 2J1KA 1MWAB 1RHHB 3EDFA 3G6AB 4TVPH 5E2UL 3MR9A 3GHEH 3OKDA 3TCLA 3OL2A 1IC1A 3OG4B 4I0PD 4HKJA 1AXSB 2GUOB 1UACL 1A4KA 4GW5A 1C5BH 3ORJA 3P30H 3ZKND 3VXSA 5HYSA 2GT9A 4KI1A 5DYOA 4OTXH 4CDHA 1IGYA 4BH7B 4L8BB 2EZ0D 1EEZA 5I66B 1J1PH 5HYJD 3QFJE 3MZGB 1T89C 3KWWA 4OGAD 2ED9A 2BZDA 2W59A 1ZTXL 4FG6D 2FJGA 3TFKC 5F7WC 2BOBB 1BD2B 3TH4T 2HG5A 4KKBC 2WMPA 2WIIA 2X7LA 2Z31A 3RHWF 5BW7C 4PBVC 4I1NB 2IWGA 3C60A 2LE9A 3V4VL 3V4UH 4U3HA 1WC7A 5E03A 2NTSP 3QIWC 2HT3D 1CDCA 1U93A 1WBXB 5IEHB 2R4RH 2X2YA 2UWEA 4D3CH 1DEEB 2GSIA 1IMHC 2P5WB 2H45A 3FB5B 1QQDA 1HCFX 2AK1L 4L9DA 4OLWH 5C08A 2F54D 1J8HB 3KJ6L 1NGYA 2Z35B 3HI5H 3ZT7A 5DJXB 1OWRM 1XFPA 5KTEH 4OGYH 3EAKA 4JY5L 4M7LH 2OXHA 3HRPA 4YHOH 4R2GD 4E41E 3MODL 2DS4A 3C2SA 1CLCA 1CFTB 4LEXL 4XVTL 5HDQL 4JGJA 3O9WA 3QEGL 2RIKA 4MA1B 1BAFH 4Z7QE 1RURH 2CO6B 2P5EB 1X5GA 4XCFL 1AIFB 4HKZA 4PP2A 4X7TB 2AABH 4HWEH 3FAXA 5BV7C 2FWOA 1MCOL 5T1DH 1FLRL 3EHBC 1OCWL 1JPST 3O0RH 4AEIH 2W9EL 3QNYA 3T0BA 3VI4F 1I9IL 2W0FA 2IC2A 5C09A 4XGZA 4OZFA 5DDHA 2EYSA 2ESVD 2KQNA 5ELIA 2APTA 4JPWH 1S9WB 3L5JA 4IS6B 4WW2F 4X4MA 1FV1B 3IDNB 2ED8A 1ZGLB 2R2BA 2EIZA 4X6DB 3SDCD 3ALPA 3JTTA 2R29L 2O5ZH 2GSGB 4NYLB 3DOSA 3KYMA 1Z3GL 5IHZB 4PGZA 3L5IA 1BZ9A 1KLGA 2H9GA 4K7FB 3CAFA 2V5RA 3C5ZC 1XEDA 1S3KH 4KVCH 3JWOL 4JQIH 2DDQL 1TZGH 3KXFE 4CRPA 5IV2A 3QFJD 1TJGH 4CGTA 2C7UB 1HH6B 5I17B 4BQ6A 4EI5A 4QXWA 3VRJB 5MERB 1ETZA 2EE2A 3U36A 1QSEB 1CIUA 3RDTA 2QHRH 1QRNE 2CKBH 3D39E 3BP7B 4WO4C 2OR9H 1RVFL 3DYMA 2NYYC 1HZHL 2DL9A 3QUYA 4JRYA 1T20A 5KVEH 4NP4L 4AEHH 3WJJA 5K93A 1BGXL 4RQQB 2V2WB 3BUYB 3MRBA 4U1GC 3WL9A 4LAQH 4LLWA 1I7TB 4JJ5A 5CSGA 4IIQC 4Z78B 3EJJX 3O8XD 1A1OA 3BMWA 5JXEC 4KQ3L 4G9DA 2C1PB 4QHLA 4CU6A 5D7JA 4ZAKD 5IMOB 3QIUD 4RGNC 1R24B 5EORL 1JNHB 3KPSA 2HKHH 4H1LH 2D0GA 2DQHH 1SY6A 2F5AH 5DK2B 4FFZL 2CDGB 4HBQA 5DJ6A 4OD2B 3WFCH 4I5BA 5CWSB 3GMPB 3FFDA 1JPTL 4E0RA 1IKFH 3BKCH 3CUPB 2BNQE 2DIBA 2R4SH 4FQ1L 2PF6A 5HGBB 4L3EE 3K2UL 3RWCA 1A6TB 1SJHB 4OUOA 4IRJC 2EZ0C 3SDDB 1NFDF 4XXDA 5EOTB 2J5LB 1AGBB 4XPBL 3WIFB 3DMMC 1A0QL 1TNNA 2PTTB 5TH2B 3S5LG 2X4UB 4K7PY 4MJ5B 3GBNH 4GQPH 4Z8FH 4ZSOA 3PL6B 3TF7C 4JFYB 4PJ5A 4LCUA 2C5DC 4R4BA 3ET9F 5KVDL 3QZWA 1S5IL 3IDYB 2A6IA 4LLQA 4RMUA 1TLKA 3VFNB 1M7XA 3K8KA 1T03H 4NO2A 4PB0H 1N6UA 3ZE1F 3T0WA 4XVUD 4QOKA 4N0UA 3TN0A 1IZJA 4GQ9H 4UNTA 4KJQD 4XVTH 5FECB 4WWKC 4QXUL 3LS5H 1HHJB 1JNJA 4Y1AA 2FR4B 3W11C <