4HC1L

Crystal structure of a loop deleted mutant of human madcam-1 d1d2 complexed with fab 10g3
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
213
structure length
213
Chain Sequence
DILMTQSPSSMSVSLGDTVSFTCHASQGIGRNIGWLQQKPGKSFKGLIYHGTNLKDGVPSRFSGSGSGADYSLTISRIESEDFADYYCIQYVQFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Mucosal addressin cell adhesion molecule 1
publication title A Different Fold with an Integrin-Binding Loop Specialized for Flexibility in Mucosal Addressin Cell Adhesion Molecule-1
rcsb
source organism Homo sapiens
total genus 39
structure length 213
sequence length 213
chains with identical sequence N
ec nomenclature
pdb deposition date 2012-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hc1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hc1L01
5JIHA 1J86A 2OM5A 2FH8A 5KTEL 2ICWB 2WINA 3KPQA 4BKLB 5F7MC 1SVZA 3BPCA 1TZHB 4NP4H 1PG7H 3K8MA 1U92A 3D9AL 4MA8H 2DQEL 1S9XA 3EGSA 3Q6GL 2XZZA 4ZS6C 1OY3B 4R6UA 4IRZL 4D9QD 3R06A 1U92B 3A67L 5IFAL 4OD1L 4QXTA 2OX5A 1S9XB 3EGSB 1AXTL 3OXRB 3QPXH 2O5XH 2XPGA 3V8CA 2XG4A 4YDLC 1RUQH 3HAEG 1QBML 1ZLUK 4YZFF 3C5SA 3E6HA 1A6WH 4QXTB 3SE3A 5GZOC 4OBRA 3CFEB 5TDNA 4OFYD 1M6OA 2FZ3A 2XPGB 4UBDC 4ZNCD 5IBLD 1JL8A 5I74C 2I27N 5D96C 3KDMB 2CKBH 3N1MC 3C5SB 4JFQA 1FDLL 5TDNB 1OAXL 1G0DA 1JWMB 1FVEA 4FQPA 2IBZX 4OZ4A 3D0VA 2B5IB 4YK4C 5TDPA 4JFQB 5CIPB 5EO0A 3F12B 5D1ZC 5LAXA 5JXED 4LPCA 1DQLH 4AEHH 1A6UL 3W9EA 1FVEB 3ILPA 3OAYK 3VG9C 4AIZA 4OZ4B 3D0VB 1OCWL 5EO0B 1XGUB 2WLYA 2ESVD 1QLEH 1QPPA 4QRPE 3BKYL 3CDFA 2YR3A 1T5WB 3EYSL 1ROWA 1J5OH 5CEZH 2GCYB 3BZEA 4YHYB 1WITA 3DXAA 4AIZB 1MJ7L 3K4AA 2EDXA 3B9KC 3IFNL 4OFPA 5LXGL 2XXCB 1AD0A 2YSSB 1FNSL 1GGIH 1GOGA 3BZEB 1CR9H 3T2NH 3KVQA 3DXAB 4UQ2B 1PX3A 2HLFC 2VDNH 1G7IA 2JIXD 4Z7UE 4QRSA 3VG0H 1AD0B 3BW9A 2VLRD 1KGCD 2VE6A 3ULVE 2QV2A 5SX4H 3BEWA 5EOCJ 1X5HA 1SY6H 4PGCA 1JWSA 4XBGA 3W9DA 4JPIB 5KVDH 1G7IB 1RUPH 2OZ4H 4GXVH 4X7SH 3BW9B 4OCRL 1B88A 1IT9L 5IQ7H 4PP2B 2FX7L 4WNQA 1EAPA 1AKJD 4PGCB 1JWSB 3HE6D 3QHZH 3W9DB 2JJWA 3DI2B 2CDEA 2EC8A 1QP1A 1YPZF 4GG6F 2Y7QB 1OAKH 1RZJH 4JFDA 4QHMA 4WNQB 1A14H 1EAPB 1LD9A 2EXYD 4JHWH 3RX7A 3DPBA 4MNHA 2CDEB 1G7PA 1KSRA 4NN7B 2VQTA 5E9DD 3PABA 2DQFB 5D7IF 2JCCE 1MRFL 1S7TB 4JFDB 4KFZC 4ODHL 3KR3L 1KPUA 4MNHB 1G7PB 4KHTH 4X5XB 3S8WA 4CAGA 2B8OT 2JJSC 1GC1L 5HYJE 4RISL 1IGJA 1F3JA 1P6AB 3SOBL 1NANH 3C5ZA 1MELA 3K7UA 5BO1H 4KK6C 1CLYH 3BWAA 3G6DL 4MAUH 2X4SB 1J18A 1KPUB 4L3ED 4XPAH 4KRPD 4LSVL 2HFFA 4P3WA 1NMCC 7FABL 2R2BA 3PQYD 1IGJB 1F3JB 2UY6A 2V5SA 4I3SH 2Z35B 3BIAX 2D0GA 4BA8A 3BWAB 2DBLL 1DBML 4GKNB 5FGSA 2R2BB 5TQ0L 4ODWA 5C6TL 1AI1H 5A16B 5DLMH 1JYWA 2HTLD 1YNKL 4I1NB 5C08E 5DMIL 5T1KA 4OKDA 2LAGB 2FSEA 5ICYB 4LHUA 4F2MA 1JHLL 4I3RH 3LN5A 3BQUD 4ODWB 3T4AB 2QQKL 2D9QB 4HIXL 1A21A 2WIIA 4P2OA 3QP3A 2R0KL 1QFWI 4JY5L 4MD4A 4NCC1 3RTQB 1C08A 4WFFE 4RA3A 4JRXA 4L4TD 4LSTH 5CAYB 5CGMA 4KUCD 3SJVD 3RPIA 2MJWA 3IS1X 1Z9SA 2A2QT 2CJUH 4XC1H 4MD4B 4RGOL 5AWNH 3ZZ1A 4GLRI 1HXYB 1S5HB 2DYPB 4OCYL 3HNTH 4JRXB 4TUOA 4RGNE 3G5XA 4PGDB 3MUGB 5EPMA 3CXHK 3UTPD 1KELH 4AIXA 4QOKA 4NCC2 1JF1B 3SKOB 2OQJB 1AC0A 4RAUB 1I7UA 4GRLB 5F9JA 3WXWL 4HUVA 4OCSH 4C58B 4TUOB 2PO6A 1AFVH 3G5XB 1K8IA 3AM8A 5CCKH 4EOWH 5FCUH 3GSNH 4EN3B 5FM8A 2N7BA 1I7UB 2Z31B 3PWUA 1BZ7B 3T3ME 4HUVB 4GUPA 2PO6B 3Q48A 4JVPA 1K8IB 1F8TH 3TZVC 4ORGA 3L5WA 4K8RC 5J1AB 2HKFH 5BVPH 2WWMD 3BDYL 1WBZA 5EH1A 1HCFX 3QEUA 4JDVA 5DHXB 4FFZL 5HGDA 4W6WB 5L0QB 2OR9H 3L5WB 2AXJA 3I75A 4YXKH 1PGRB 2H8PB 4U1JA 3D85D 2G60L 3QSKB 3QEUB 5EDXA 4K9EL 3GMNA 5D72H 4NZJA 1YN7B 3Q3GB 4ZOEA 3QFDA 5A2JH 1HOCB 5F93C 4IEFB 4EUPH 4JZOA 1IZKA 1ZHBA 2RFXA 3GMNB 2DM2A 4GAYA 3QFDB 1CZ8L 3LEXB 4O5LH 1MWAL 1T1YB 4NFCA 3L5XL 1CN4A 1T04A 1LVEA 4JZOB 2HJKA 2RFXB 3NH7L 5HYQB 2XZQH 4N90E 1F00I 1XCQA 5EZIL 3AFLA 4OI8A 3EJYD 1RZFL 1Q72L 1MFBL 2E7LC 4EUPG 3QWRA 3P4NB 1T04B 4RFEB 1UWXH 3QG6A 5D70H 1BZQK 2A77H 2WLZA 3TV3L 1HHJB 1XCQB 3L3DA 2VZSA 3L95B 3WFCL 3BOVA 4NSKA 4ZTPL 2P44B 2GTZA 4RCAA 4RDQG 3K4DA 1RIVL 3QG6B 4XVSL 1QKZL 1YEIL 1KBGH 4JGUA 4ODUB 2HAZA 4M02A 4L8SA 1CICA 3L3DB 3AS1A 2CXGA 3I3DA 4YHKL 5A2FA 4NSKB 1T21A 4BQCA 3SDCA 1IJ9A 1SQ2N 1LGVA 2YD6A 3CDCA 1RZ8A 4L8SB 5I30L 1CICB 3N85L 1P84K 5EZJB 2GI7A 3K74B 4PRAA 4RMWA 1T21B 4PV8A 3VI4E 1FYTA 2R1YA 3SDCB 4U1IA 2HFGH 4RIRA 4YEFA 2X2YA 1RZ8B 5D6DA 3LRHA 4PJXE 4TSBH 3UTOA 4UV7H 3VI3F 2J3SA 3HB3C 1A7OL 3GB7B 1WTLA 3DX9B 3ZTNL 1CFTA 4PV8B 4TSAH 2R1YB 4LDOB 3BKCH 4U1IB 4Y5VA 1AGBA 3L6FB 3HE7A 4HKBB 5D6CA 3X17A 3CSYA 4JN1L 2FEEI 3AU1B 3DROA 2C7UA 5H94B 3RUGE 4W6YB 5JDSA 5I2IA 1CFTB 4L9LA 5IMMB 3DV4A 4P2OC 4Y5VB 3U1SH 1KYOK 1QVOB 3HE7B 5CINL 4V1DB 1N7MH 1JGVL 4JHAH 3ZYJA 2C7UB 4PJCB 1PX4A 1EERB 4GSDL 5DRXB 3LZFL 4L9LB 5DO2D 4MA7L 1O7VA 4Z7OF 5C0JA 1KG0A 3C8HA 4KV5E 2P1YA 4YGAB 2VLLB 3TJEL 3HR5B 1NC2D 4F9PC 2M26A 5JXAH 5FKPA 4LVNC 1FAKT 4JFFB 5C0JB 1PBYA 5F7WC 1UM6L 3I6GA 3G5YB 4JAMA 1ZXQA 3GSXA 1G9MH 5CJXA 4XCCL 5FKPB 3AM8C 3P11L 2FEDD 2YBRB 2XQBH 5KVEL 2W07A 1YEKH 1H3VA 3OHXB 4M5ZH 2OK0H 3KS0H 4NZUL 3GSXB 3IKCB 2R9HC 5GRVK 4HZAA 1JTOA 5DMJB 5GJTL 3P40A 2YRPA 4G6KL 1JTPA 5IT2L 1WVZA 4LLAA 1JGUL 2LTQB 5BVJA 3TP4A 5JPMB 2JJVA 3F6LA 4AENA 3NIFF 2ADIA 2HRPH 3FO1A 3ZKMD 3X3GL 2BXZA 1ZHLA 3SO5A 5BXFB 4F7PA 3FCTA 1DL7H 3FFDA 3NGBB 4NP4L 4AENB 4UDUA 3FO1B 3O6KH 2JELH 4IOFC 4ZUVB 4MA8L 4X99A 2G75A 2XA8L 2BY0A 1ZHLB 2VLJA 4F7PB 3FCTB 2HJLB 2MKWA 3BD5A 2DAVA 3QDJA 3I3BA 4UDUB 2J8UA 1REIA 4JDTL 1VACB 4PJ9A 1IEAA 3MV8E 4I8DA 1FORH 4LAQL 1RUAH 3C87A 4R8WL 1F02I 3D6GA 3ZT7A 3TH3T 3EYVA 2OJZL 3H3PH 2H32A 1LO2H 2YXFA 1ND0A 3HS0A 1KFAL 5B3NA 1A6WL 1GVIA 4PJ9B 2FO1A 1TPXB 1EAJA 3QUMH 5C0AA 1V3LA 4KKCD 2Y25A 1ETZA 2EDJA 3MQIA 3HS0B 3NIGF 2DKUA 3BP5B 1B0RA 4NUJA 4X9BA 4A6YA 5C1MB 4KK8C 2P24A 5C0AB 3NCJL 4JM4H 4KZEL 3JTTA 4LIQH 4NO2A 1ETZB 2VN7A 1G7HA 4G3YH 4LFHD 2VLKD 3CLEH 4A6YB 1OGAB 1IGML 4LMQI 2HVKA 4Y1AB 4M4RA 1MFEH 3LPGA 5FKAA 1DQLL 4AEHL 5T1DL 1N6UA 3JTTB 4CADA 1G7HB 3L3OB 5AYQA 1CF8H 3P3YA 1MHEB 1N8ZB 4N0UA 3OKMA 1MHHB 1HHIA 4Y4FC 2LFGA 3S35X 5C0RH 5KVMC 3KWWA 3QH3B 1DBAL 5JOFB 4OIIL 1KIQA 3KPSD 5F70A 1FO0H 2VKWA 5KVGH 1YMMA 4N0UB 4NQEA 3PP3H 1HHIB 5F9WC 1RZKL 1EJOL 1MI5A 4GW5A 4N5UA 4RFOL 5E6ID 2I24N 4WV1C 5CP7A 3MREA 2AK1H 4LSPH 4Q6IB 4F57L 2VDNL 2UWEA 4NQEB 4NWUH 1U91B 2BP3A 1CLZH 1U3JA 3ZYIA 1ZGLB 1MI5B 4GW5B 4OFKA 1X44A 3O8XD 2BY2A 3UBXA 3MLWL 5CP7B 4MJID 1UB6A 1I9IH 2X40A 3PDDA 1EZVX 4KVCL 4Q74A 5J12C 1NBZA 2IGFH 2OZ4L 2X9WA 3MCLL 5IQ7L 2EXWD 4KH2A 4U1GB 4YPGA 5DVNA 5IJVA 4P49A 1TFHA 1Q9LB 2PYEB 1FCCA 3QHZL 3WUWG 4U1LB 4LKCB 1X5IA 3QXAA 3HZVB 2WBJB 4P9MH 4YPGB 5IJVB 3TN0D 1L9MA 4OFVA 2XTJE 1I8KA 4PJGF 4B5EA 5INDA 2Z4QA 2K3TA 5DFVD 2FHCA 5F7HA 1KB5H 4MZ3A 4TVSa 3H6JA 1EEQA 4OCXL 4J4PD 1AH1A 3S34L 1PZUB 1MFDH 4GRWE 4R2GC 5I73C 5GS1C 3V6OE 3AMKA 2RGSA 2VZVA 5INDB 3RNQA 1FE8H 2DQJH 4GKZA 4I4WB 2V5RA 4YFLF 2X70A 4NBXB 4PLJC 4KHTL 1VGEH 4K3DH 1ES0B 3V4VH 5A3IC 2APVA 3QEGH 5L9DL 1UXWB 4GAJH 5L7XL 5TQ2H 4K23H 4MAUL 4GKZB 3U7YH 4B41A 4XPAL 5CLTA 4X7FC 2W65A 3SY0B 2Y5TA 1HHHA 5HDBE 1LE9A 5DJCA 4L8CB 3S97C 2B39A 3R1GH 4RMUA 3O0RH 3WNOA 2DQTL 3MV7E 3NFPA 5D93B 1J12A 2W65B 5DMYA 2IBBA 5C0EB 2FB4L 1FC2D 4K7PH 4PTTA 1GOFA 1LE9B 5JZ7C 3BP6B 4PRPB 1YMHB 5D71H 5ERWB 5FHBH 3NPSC 3MRFA 3NFPB 3CCHA 5HDQH 5L6YH 3NTCH 3H3BC 4E42A 3H8NA 4HJ0C 5BCAA 2J12B 3IXAA 5DQDH 3DHMA 2PUQT 3MRFB 4JO2H 1JMZA 4R4FH 1NDGB 4M5YH 4PGEA 1LO3L 4E42B 4XAWH 1J0ZA 5GS0D 4BK5A 3SGKC 3V4PL 3O2DH 2B1AH 4BSVA 5KZCD 1CXIA 4MAYB 4JQVC 1NL0H 4WRLA 4XC1L 1T1WA 5IJKA 1WFOA 2BSSA 5BRZD 1K2DA 1S3KH 5AWNL 1A7RH 3TNMA 2VWEC 4MX7A 4FABL 1NAKH 3HNTL 1JUFB 4BSVB 2ZWLT 4M1CC 3LQMA 3K1DA 1U58A 5DTFA 3WLBA 5D2LA 3CU1A 1HDMB 3VFSA 2BSSB 4CL7A 3BZ4B 4V1DE 2VZ1A 1EXUA 4TTDC 5IVXF 4OCSL 2P5EE 4PJCE 4F3FA 3WLBB 5DTFB 4G9FA 5FCUL 4KI5E 5D7JA 4DKDC 2QQLH 3GSNL 3VH8A 1ZA3A 1NCDL 5IVNA 4NKIH 2F53E 1A3QA 3BIKA 1EXUB 2AP2A 1EFXD 1MWAA 2A38A 5FHAL 5T5FH 1TIUA 1X7QA 3QQ3A 3VH8B 1ZA3B 4UTAH 2XV6B 3OB0K 3ZHKA 3C09C 3HUJF 5BVPL 1JFQH 4ODVL 2A9MH 2ZG1A 4ZFFB 3MRLB 1VEPA 2ORBL 2ILLA 4LSSL 1FGVL 2F9BT 1DFBH 2FBOJ 2PCPA 1KLGA 1D9KB 2AJVH 1A0QH 4WI8A 1TCRA 1T89A 4WEUD 4P9HH 2M8XA 4I0PD 2IF7A 4O51B 3RWHA 1RPQA 3Q5YA 1TVDA 5LG1A 1TJHH 3FHAA 3MBEB 4OZGF 4Z7NE 1NLBL 2HFEA 1GC1C 1ZT7A 3RWHB 4X6EA 2EEDA 3JV4A 3SO3C 3TIEB 4ZOAA 1QBLH 4Z6AT 2A6JA 3OJDA 4P3DA 1J11A 4TYUA 4LCIL 4L29A 1UZ8A 1ZT7B 4X6EB 4YHLL 1E4XI 4JRYA 1WEJH 3L9RA 2L0DA 4XPHL 2A6JB 3REVA 3OJDB 4FQ2L 4P3DB 4JVUA 3WDJA 1UZ8B 3GBNL 3EFDL 4JRYB 1KNOA 2WM0A 3QDMD 2D03L 4LCCB 5F1NB 2W0KA 3RVWD 5IR1A 1I3RB 4UTBL 3N1FC 4JN2A 5TJWK 1N5YL 3BKML 3RIFK 3TO4C 5IEHA 4TULH 4M7KL 4GS7C 3VWJA 1XZ0A 2R69L 1KBGL 1KNOB 1SM3L 1VB9A 4Z95H 5FYKH 5IB3A 1EEYA 5IBUG 1M4KA 5IEHB 1J1PH 2VUOA 1NGWA 2V2TB 5DZOA 2HT3D 2QHRH 3SDDD 2A73A 3VWJB 3TPKA 5IQ9A 1XZ0B 3V79C 4TSCH 4XCEB 5CILL 4YO0B 4JG0H 1CLCA 1EEYB 1NCWH 2AQ2A 3V2AR 1JK8A 5HGAA 4XMPL 1NGWB 4X6FA 3BKJL 4Y1AE 4F37K 4DQOH 3K1KC 4TSBL 4PJAB 3BIBX 2GY5A 3SDAD 3PG2A 3VWKA 1L4IA 25C8L 1JK8B 1SJVA 5HGAB 4JKLA 3VRLF 2QEJA 3CNKA 4TSAL 4QLRA 1HSAB 3BKCL 4X6FB 3QQ4B 4ZFOL 5C2UB 2Y36L 4PRHB 2HMIC 5IGXH 4YBLC 5CJQH 1MCSA 2NY1C 5ALBL 4AL8L 3D25A 4RA0C 2YUZA 4UOW1 2E7HA 1GRWA 1IKNA 2BNQD 2D4DA 4OZIB 2GJ6E 2X89D 3VXMB 3T2PA 4XCYA 3EYQC 2FYYB 1AGFB 4DAGH 4JGJA 3BPOB 4P23A 1XCTB 5DR5H 1FGNH 5DZNA 5IJKC 1EO7A 4KDTC 1H3WM 1FVCA 4KY1H 3MTRA 5J06A 1GHFH 1YEDB 2XN9B 3MRNA 3VFMB 4H20L 3HAEA 1OTTC 4Y19D 5T1LD 3LS5H 1NAMH 4PBXA 3WD5H 4GW4A 5C0IA 5MENB 3MUZ1 4K9EC 4UILH 4ZSOE 2C1PA 3EYOA 1FVCB 5F97E 3TA3D 3SQOH 4PJDE 2Z8SA 5EO9A 1IAKA 2XZCL 1G9ML 3PDGA 3MRNB 2VXQL 5C0BA 4DGYL 3V0WL 4F7CA 1XH3B 5HYSB 5C0IB 5D7JC 1Z3GH 3VFOA 4Q9BA 4LF3A 1YEKL 3EYOB 1UADC 3WIFA 3QIBA 4XWOC 4WI6A 3QUZD 4PS4L 5EO9B 1VENA 1XAUA 3DO3A 5C0BB 4PR5A 1UKQA 5DJDA 4F7CB 5HJ3A 1I1YA 4JR9H 3VFOB 4AM0B 4Y16A 1JGLL 4LF3B 1U6AH 3WIFB 3QIBB 3VXNA 4C59B 3M8OL 4OFIA 4PR5B 4YDIH 5JUEH 2ZUXA 5B38B 4ODSL 1PLGL 1FL3A 1F58H 5EOQH 3EOBB 4Y16B 1DL7L 1Z5LA 4LCWE 1T89C 3VXNB 4ETQA 3O6KL 4PGJA 3DMMA 5SWSE 2CKBB 1JPST 3MCG1 4MLSA 5D1XA 3LQAL 1IGYA 2EDTA 3ARGD 2BNUB 1QRND 4R90L 3DMMB 2NX5D 4YXLH 2WUCH 1JZ4A 5HHMD 4QRUA 4KDWA 1A9EA 3MA9L 2ED8A 3CMOH 5D1XB 2DIBA 3FFCD 5FOBA 2Q1EA 5EIIA 1IGYB 5I71B 4KROB 4PREA 2J4WH 1TZIB 4P2RA 5I66A 2I5YH 1I9RH 4IRSD 3SCMA 2KBGA 3DNKA 5HHVL 3FQXA 1MHCA 1Q1JH 2G5RA 4D9RD 4LFHG 5FOBB 5EIIB 1MVUB 2ZSVB 4NQDD 4HWEL 4PREB 4P2RB 1WT5A 1NBVL 2QLVB 5FGCB 2DN7A 3SCMB 3ARFA 2DRUA 5MP6L 1PAMA 3O9WA 4FFVD 4UT7H 2YD5A 1XF3A 2EO9A 4LRIC 4GT7A 4MVBC 5E8DL 4CVXA 2LU3A 1VSCA 3I84A 3VGBA 1GGYA 1P9MA 4LPTA 3OR6B 1D6EB 3FT4B 3NZHL 5CZXC 4H5SA 5DJYA 1CTNA 5I75B 2DJUA 2OZ4A 4XNZB 3QCTH 3VXQB 4G7YH 4ZYKB 3MRBA 1XF3B 1MCNA 2I9TA 4NHCH 2FL5A 1BQLH 2NW2B 3EBAA 4CVXB 4NWTL 5LBSL 4ZOBA 1CF8L 2WZPD 1A4JB 1ZS8A 3ISWA 4PJFE 4H5SB 3NCBB 5T33L 2D7OA 3NCFB 4CMHC 2OP4H 4MDJB 4TNWF 5KVGL 2BVYA 2VXUH 3MGAA 1I85C 1UQSA 4GAGH 1BECA 4EXPX 1FLRL 2F5AH 4NO0D 3V4UH 4FQXB 1KUMA 5J89A 3ULVC 5IB5B 5SX5H 3VWKC 3W0WA 4NWUL 5IB4A 1A7NL 3WFDL 1YEEL 15C8H 1RZ7L 4MB3A 1J1XL 3UTSD 2IGFL 2R0WH 2BXYA 4H88L 1ZOXA 2X9XA 4OLXH 4IRJB 4S1DD 2NXYD 2HVJA 3U4EA 1R3KB 4NOFA 3U7AA 3JTSB 4YBHA 1FFRA 2XWJB 5FA4A 4R3SA 4KK5D 3ILQC 3WXVH 3LB6C 1ORSA 2J8OA 4P23C 4JVWA 2K9UA 5CWSA 2CXKA 2HVJB 4ONFL 3PNWA 3QO0A 4PJEF 3U4EB 3WV0A 4O9HL 5FA4B 3T1FB 4ZO9A 1IZJA 1TNMA 1HI6A 1G7QA 2AVGA 2ZUWA 1AC6A 1U0QA 2DQJL 3PNWB 3QO0B 4KC3B 43C9A 3RWIA 1UZ6E 2X09A 3UYPA 1L7TH 4K3DL 3FQRB 3EZ8A 1HI6B 1RFDH 1D5XA 1NFDB 5FOJA 3V6FB 4R4ND 5J4MA 2VZ3A 5FYLD 4K23L 1ZMYA 4KUZL 5GS0H 5E4EC 2CUMA 2Y72A 2N7AA 1TTUA 1D5XB 3DURA 2OXGA 4KAQH 1S9WB 3QEQA 3RVUC 5DD6B 5J56B 2IANB 2H1PH 5A43C 1JGEB 3WFHA 4WUKH 2DMCA 2F54D 4K7PL 5E2TH 1ZLUH 1N4XH 2F74A 3RUGA 5ACZA 5SWZA 3WS6A 1VGKA 4NNYA 4B0MM 3FQUA 5HDQL 5L6YL 1SHMA 3WLWD 3GSNA 4JLRA 4Y5XC 5MEPB 2AABL 1F4XL 2F74B 1AO7A 2QSCL 4HKXA 5ACZB 5SWZB 4XPBH 5EFIA 3UO1L 4Z8FH 3AREC 1CDGA 4JO2L 2DQUL 2B4CH 4I48A 3FQUB 4G8GD 5DUPL 1JZ8A 1Z2KA 3GSNB 4Z78A 4JLRB 1GSMA 5ICZB 2DOCA 4MQ7B 4XVJL 4PJAE 4PJBE 4KTYA 3RI5F 4HKXB 5I1EH 4PJ5D 3F5WB 5EFIB 5I8EA 5DMGC 4RGNC 1BX2B 3V0VA 1KCUH 5CUSH 4LLUA 1EH9A 1QFPA 2HWZH 3GMQA 1RZKC 3OAYH 3WSQL 3BPLC 1Y18B 4PRHE 5LWYH 5KSAA 4DTGL 4H0GA 4G8FB 2DQHL 3GMQB 1ADQH 3O9WC 3LD8B 1NSNL 4BZYA 3PWPA 4EUPA 4XGZA 4RBPK 4OM0H 5ANME 3S35L 5CJ5A 2DLFH 4X6CA 5CMAA 5FO9B 4P48A 3LKQA 1MPAH 2C3WA 4NZDA 3VD4A 1DZBA 2XN9E 4CN6A 2ATKA 4WHYH 4N5EC 3PWPB 2R4SH 4EUPB 4S1SH 2CSPA 3O6LL 3D48R 4BZ1L 5MENE 1U8JA 4X6CB 3QZWG 4NN5C 5CMAB 3B3IB 4ZDHA 4GRMB 1MH5A 4ZS6D 3MXWL 3PWJA 1U3YA 2ATKB 3MJ9H 3IFOA 4HK0A 5A2IH 5DYOA 4BJLA 4O2EB 2X4RB 4XB7A 4P9HL 4WHYG 3PWJB 3ZDZE 3IFOB 2W91A 3BXNA 3HFMH 1E4JA 2QL1A 5DYOB 3MV8A 1TJHL 3T0WA 5GZOD 4POUB 3VW3H 2HG5A 4UBDD 3KPRB 1ZEAH 3MLXL 1GZQB 4JQXA 3RKPA 3ZE2E 5IMOA 1UH3A 3QPQC 4FS0A 3MV9A 1WWWX 4M93C 5AZEL 4R0LA 5HVFB 4KKLC 1CGSH 3UBXI 5M95B 2X4UA 5E2VH 3RDTB 4PJ8A 5IMOB 1VADA 2KZWA 3OMZA 5DQ9A 4PJIE 5D1ZD 4XPFL 3MV9B 4FTVD 4R0LB 5BMFL 3RY6A 4X7TB 2X4UB 5JNYA 3MLSH 1VADB 4L4VE 4XXCC 2AW2A 2MPAH 3E2HC 1HHGA 5J6GA 2XICA 1INDH 3SDXB 2ZCHH 1HE7A 3OJ2C 5H35A 5DD1L 3B9KD 5JNYB 5J57B 2VZOA 4OI9A 1BJ1H 2P7TB 2VQ1A 1IFHH 4MHHI 3GO1L 5FYKL 5J6GB 1MCOL 4KMTH 2E7BA 5J11C 1NGPH 2QHRL 3D0LB 2HLFD 4KK9C 3ESVF 2MTPA 1RHFA 2I60L 3GMOB 4ZTOL 4JG0L 3FN3A 4YUEH 1NCWL 5B3JF 1KENH 2AEPH 4M6AA 3GK8L 5JHLH 1XGTA 5DRWA 5JHDD 5H2BA 3TVMA 1H8SA 1A1OB 1MJUL 3R0MA 3VXOA 3RWCA 3CIQA 1Q38A 5HDOA 1A47A 4PRIB 1U95A 5IB1A 1XGTB 3F7QA 5T3ZD 5H2BB 2BVUA 1H0DB 2XXMB 4YR6A 4I9WE 3RWCB 3SBWC 4AJ0A 5EZOH 3O45A 4I2XA 2BVPA 1G7LA 1U95B 5IB1B 3CFKA 3IDXL 4JPWL 4GQ9L 4O2CA 1A5FL 3MRJA 1K9TA 4TRPL 3BZFB 1QFWH 4I2XB 2CDFB 2YC1A 3GMLA 1WISA 1KXVC 5IROC 5I19L 1WZKA 5FV1L 3GM8A 4OZHA 3DV6A 1FBIH 1P1ZA 4O2CB 4LARH 5J3HC 4E0RB 3MRJB 4KK6D 3D2UD 5E56A 1XF5A 5C0GA 3CFBB 5DK3A 2EDWA 5KSAC 4KRLB 1ZTXH 4UILL 4PRDA 4GLRH 1JZ5A 1FZJA 2YD1A 2Q7NA 3FOLA 4OZHB 1P1ZB 3DX7A 4UDTA 4HMDA 1D5ZA 4YDJA 5IK3B 5I1KL 2QSQA 2X42A 1DDHB 3TBYB 4HS3A 3H9SD 1FZJB 1MCWW 3VGAB 3L3JB 4K71C 3FOLB 3DX7B 3MLRH 4QYOB 4YAQA 4KRNA 4YDJB 2PR4H 2ESVA 3BGMB 1QSFD 3BEVA 3CLFH 2YUVA 4JR9L 5JW5A 4U6XA 4HS3B 2A1WH 3BSZH 3OKYA 3ZE1E 2Q3AA 3T0EE 1ZA6B 5AZ2H 4HG4K 2H9GA 4YAQB 4BFEA 4DN3H 2EDQA 1XT5A 2ESVB 4J12A 5JUEL 2EICA 3NFNA 3BEVB 3DVFA 4MNQE 5DVKA 5JW5B 4G42B 1B2WL 5C07A 5EBLB 5D7LA 5D5MA 3QUMB 3WIHL 1CS6A 1KTKE 1J7VR 2H9GB 3CFCH 2JIXA 4FQ1H 1QFUL 1UFUA 2AKRB 4Z0BL 4BFIB 1I4FA 3IFPA 5L2KA 3JV6A 1A3RL 4ELMA 5JW3H 2A74A 1U8IB 4KKBC 2Z92A 3RU8H 2JIXB 4PLKC 3RAJL 2WUCL 4XMKH 1HWHB 4JQXC 2F8OA 2VLRB 1YNTB 2FLRT 3GUTA 3CMOL 1HYSC 3JV6B 4ELMB 5IFJA 5IF0A 1FO0A 2A74B 2J4WL 3MNWA 4TUJB 3MCKA 1HILB 3U30C 4P2QE 1LP9A 5HYEA 4JQIL 1MAMH 1Q1JL 3CZJA 5C6PB 5C3LD 2FATH 2X9YA 4G6JH 3GUTB 5KAQF 1X5AA 1AKJB 3GMRB 3HE6B 3RTQC 5IFJB 2CLVB 1FO0B 3RY6C 3MNWB 4X4XA 4Y5YB 3KPOB 3DTXA 4PGBB 5E9DA 3WUWA 4EVNA 3MFFA 3TZVD 2XI9A 5I6XC 4QRRA 4K8RD 1BVKA 3M17A 2F53A 1X6NA 5ITFB 3LPFA 4DOHB 1CQKA 4Q2ZB 3PHQA 1NLDH 4FZEH 4QCIA 2OR8A 5E9DB 5F3BB 3IJHB 3MFFB 5HHQB 1Z6JT 1BVKB 3M17B 4NHCL 1UC6A 4RWHA 5TE6L 3AVEA 5DFTA 4Y89A 4LLMA 4QCIB 3LY6A 4JFZH 1MIMH 1V7NL 2X6MA 4WIQA 2HA1A 3PHSA 4HXAL 2C1OA 4NKDA 3PQYA 3GIZH 5FA3A 3LPWA 3PV6A 4HEPG 2Y06L 4Q58C 4POZD 3N1GC 2XT1B 4OF3A 4L3EB 3OZ9L 4KRPB 1BBJA 2MFNA 3ZHDA 1RVFL 4NKDB 3JWDL 4LPUA 3PQYB 1KB5A 3PDOA 3PV6B 5CKGA 5JA8B 1WWBX 5KSBE 1PVHA 3TVMC 3MODH 4KQ3H 3UJJH 2JB6A 1T2QL 1OP3K 3MRHA 3BMWA 1BBJB 1YEHH 2BX5A 3KLHC 3BQUA 15C8L 1KB5B 3PDOB 4DFHA 4JM2C 4WW2A 5JQHC 1NDMA 2JB6B 3MRHB 3BQUB 3LKOA 4CVZB 5FYLH 3UPAA 5LCVH 2X4OA 4WENB 1NDMB 4DCQB 3O4LD 2XTJC 3WBDA 4P4KC 3H9YA 1H3XA 3Q5TA 2IMNA 1XR9A 4KRMB 4V2CB 3TT3L 4NM8H 1EJ6A 4L4TB 4RAHA 4X0KB 3BUTA 5F6HI 2X4OB 3SJVB 2OTWA 3KPRE 3AMLA 3C5ZD 3V6OC 3SE4A 1B90A 3KYAA 2BFVL 4LLDB 4FHBD 3VFRA 3D39E 3LQAC 2OTWB 4G8EB 3HG1E 3MRCA 4K55A 2DQDH 3EYFA 1BMGA 4OF8A 1RFDL 3WL9B 5HD8C 3W39B 2O5YH 4N0CC 3HB3D 3GI8H 3MRCB 3EYFB 1Z9MA 4D8PA 3STZA 5EBWA 1EEZA 1RU9H 1VEOA 1E0OB 5T1KD 3KHQA 4W68A 4LHUD 1KEMH 5KS9E 3SDXE 4K3EL 3A0OA 2H1PL 3RHWF 4D8PB 4P2OD 4AMKH 5EBWB 1EEZB 4OLYH 4WUKL 3ZE0F 4ZUUA 4PYGA 1QFWM 2CIKB 1P4BH 5DD0L 3D85A 1N4XL 4RWYL 1SYSB 5KVFL 1Y6NR 2PW2B 2UYLA 1F6LL 4P3CL 4NN6B 4ZAKC 1PEZA 1LO0L 4J3VA 1S78C 3D85B 1MQKL 2HRLA 2B4CL 3QXDA 3ZDYF 5C0CD 4NKQB 2WP3O 4QOKD 4QXGL 5D9SB 3SQBA 1KC5L 5F3HB 4O4YL 4Q9CA 5I1IH 5I1EL 1GIGL 3GSUA 2YZ1A 5HHOD 2R23A 1P7QD 3QXDB 1KCUL 3MFGB 4WW1A 1YNLL 4WFHE 4GMTH 4YHNB 3V5KB 4UIMB 1GOHA 2WUBL 2R23B 3SKJH 1X5GA 1MHPH 1DBKH 4KI5C 4DUVA 1JPTL 1Q9OA 5C2BH 8FABB 4ZG1A 3MSPA 4YIQA 3VMNA 2YRLA 5IG7B 1OD7A 3IDYC 3T08A 3REWB 2O5ZH 1MPAL 1RQ5A 4JZNB 4YIQB 5I76B 3QXTA 4ACPA 4FZ8H 4D9LH 4IOFD 2ADFH 3ARPA 4A2LA 4E9LA 4HT1L 3QUXC 1A7PL 5GGQL 2EDFA 5SWSA 1VDGA 5D7SH 1DQJB 1ZKAA 3BESR 4Z7QE 4KTDL 1TLKA 2DQGH 1BLNA 4JO3L 3VMPA 1OM3L 4M6OL 4JFPA 4OV5B 4EDWH 5IBUB 1JGDA 3WNMA 3GNMH 3MROA 2GT9B 3BUYB 3T0XA 3TBSB 3ZKXB 5E0QA 2V9QA 4WJ5B 1QZ1A 1KN4H 3T1WA 1ZEAL 4WW2C 4DZ8A 2R0LH 4PRNB 4X7DC 3NGBC 3QWRD 4M1GH 3ARDA 1JTTA 1MRDL 3ZKND 3MROB 4QHKI 1LO5A 4KK8D 3DIFA 5FAAA 1RUML 4NQXB 2WNGA 1CD8A 1E4KA 2ED7A 1NANI 3LN4A 3UPCA 5IVZB 1AP2A 1E6JL 1N6VA 3F7YB 3WFBH 1LO5B 4JANA 4JE4B 3WN5A 1NC2A 5L8LB 4LIQE 5HI4C 3O3AA 3MLSL 2A83B 3HPLA 1AP2B 4Y4FD 2MPAL 2VLRE 3SE4C 3VFGH 3WN5B 2CR3A 1NC2B 1EHLL 2ZCHL 2IG2L 1V3JA 2NQCA 4NZTL 5HGBA 4PJHE 5T3ZH 4WU5B 5GSRA 4BUHA 1FYTD 2EDEA 5C09E 1N64L 3STBA 3NZ8A 5HGBB 4QXUL 1YC8A 1J87A 4KTEH 3R8BB 5GSRB 1YEFH 2DMKA 2GFBA 4HBQA 3AY4A 5EUKA 2XNAA 3DVGA 5I18H 2QADC 1IGCH 4DOHE 1ZLWK 1NUGA 3TIDA 2R4RL 5D7KE 4DGIH 3D69A 3HTLX 3QDGD 1NAMA 2VDKH 4PRBA 3OTTA 3X3FH 2W9DH 2R1XA 2Z93A 5EUKB 2XNAB 1Q9WA 3DVGB 4EZMA 4DEPB 3VFNB 1NJ9B 4P59H 5L88H 4URTB 3ULUE 3D69B 1OWWA 4U49A 4EI6B 1NAMB 4FQLH 1Q9WB 3GJFH 3QB7C 4XP6L 3P9LB 3TYGL 5KN5A 1JWUA 4LCUB 3RFZC 1CFVL 1LDSA 3UTQA 1AHWA 4LOUC 4F7TB 5AYUL 3QFJD 4DJMA 3CSGA 4JFED 4J3XA 1C5CH 4R2GD 1UWEL 5KN5B 4HJJL 1AJ7L 3VDAA 2XWBA 4PLJD 3UTQB 1AHWB 5CD3B 3VXRD 2J5LC 4U33A 5D2LF 4U1NA 1FH5L 3EAKA 5A3ID 5HVWA 4KHXH 4U1GC 1HINH 1IAIM 3V52L 2VMFA 4I5BA 3QRGL 3QAZC 1BREA 4LQ1A 5D2NE 4I0KA 1JIBA 1ZTXL 4XPGL 1T7VA 4U1NB 3MLTB 3LEVL 1YJDL 3MUHL 2AS5M 2AXGA 2DDQL 2WBJC 3TYFA 4I13B 1WLHA 1T0PB 5J0BA 3L3HB 1P4IH 1N6QL 1WCBA 2P43B 5HYFA 1QO3A 5DDHA 4OM1L 4L4TE 4M03A 2G9HB 5JZ7D 1AQKH 3TYFB 2VLKB 3ME0A 3SJVE 2PR4L 1ZWIB 2GIYA 3CLFL 5F9DC 4ZS7L 2G5BA 3PHOA 1WCBB 2ZUUA 1QO3B 4WY7H 3BT2L 4HJ0D 2VLJD 4XMLH 1XF4A 1C5DA 3QDJD 4K7PY 2R56L 3OSKA 1WUNT 2VR9A 5E6IA 4L9DA 5DXWA 4M48H 3KPSB 3PHOB 1I9JH 4YXHH 2PXYA 5IBTL 5DMKA 1VA9A 4CNIA 4AEIH 1CDYA 1XF4B 3QCVH 4FQ1L 1U8OB 4ZMAT 2Z91B 4K8RH 3HNVL 3LKPB 4GMSL 1J1OH 4NYLA 3RL2A 4KZDH 1TQBC 1UWGH 5E6IB 4H25A 1I3GH 3L3IB 1HIML 4MJIA 4S1QL 3I2CL 3MMEA 1MCWM 5DMKB 4CNIB 2BVTA 3U4BH 1W72H 2VLMD 3KPMA 3OAZK 4M1CD 4J3UA 3NABH 4OI7A 4NYLB 3O8XB 4BFGA 3ARDC 4H25B 3N9GL 4MJIB 4X98A 2EKSA 4GBXC 2NR6C 1EHXA 1V7MH 4TTDD 3H9ZA 3VXSD 1AY1L 3P0GB 3UC0H 5F72S 3OKLA 1DQMH 1Q94A 4YQXH 5C86A 4X98B 3AS3A 2JK5A 4TVPE 2EKSB 2ADJB 4WI4A 1HKLL 1E4XH 1OW0A 4FP8H 5LQBH 1BBDL 5B39G 2ZPKL 3ARYA 3JBG7 1OAUH 5TFSH 3QEHB 1OLLA 4XVTH 4HC1L 3TN0B 2BOCA 1NGQH 4LKXA 2JK5B 4RFNB 1MVFA 1NLDL 2AGJL 4FZEL 4GFTB 4N8VG 3RWDB 3UYRL 3NA9L 1YMMD 1BQHG 2PN5A 2BOCB 2Z8WC 4LKXB 4MB5A 3P30H 4JO1H 4JFZL 3GFUA 1IC7L 4F7EB 4OGZA 1D6VH 1FNGA 4WI2A 2C5DC 5FIEA 2I07A 3EJJX 5CEYA 2ITCB 5BZWA 5GGTL 2CRIA 4MXWH 2GHWB 4WWKC 1RIHL 1NCBH 1WBYA 2X4TA 1FNGB 3FONA 4MJ2A 4XCFH 2C4XA 2HJFA 4IHOB 3GHEL 2I07B 5F8QC 5BZWB 1FIEA 4C56E 1MF2H 4M00A 3CH8A 2ZJSH 1INQA 4OZIF 3HC4H 1NBQA 4B7IA 1WBYB 2ICWJ 2X4TB 3DRTB 5MI0B 4NZRH 2A0LC 4JREB 4YWGH 4FRWA 1EBPA 1S8DA 5T3XE 4UINH 1GGBL 5SWQA 1UG9A 1X4YA 2FEEL 2R29L 2Y5EA 3DLQR 3FN0H 5F9AC 1KLUA 3SDYH 1RUKH 3RIAK 1MUJA 1G84A 1IC5L 3TO4D 2P42B 1S8DB 5DJAB 3EYUL 3VGFA 1S7QA 5SWQB 2V2WA 3U9UB 5KZCB 1UT9A 5GRVL 3RBSA 1BFVL 3DUSB 3UP1A 3CD4A 1M7DB 3UJIL 4UU9A 5BRZB 1KXQE 4LRNL 1BIIB 2EIBA 2FJGB 4O58H 3CAFA 2DQDL 1N59A 4UU9B 5CGYC 1YPZE 4GG6E 5BOPA 3O11B 5E2WL 3VXUD 3VDBA 5LJYH 4G43A 1QSEE 4JY6B 3TNNA 1O0VA 1A2YB 3GI8L 2VXVH 4MYWB 3SE9L 2NY5C 2AK4D 4IIQB 1BZ9B 4XNYL 3IJSA 5D7IE 2APBA 3QJFB 4X6DA 1EFXB 2X4NA 3BN9C 5EWIL 4G43B 2HMID 1T1XA 3TNNB 1JYXA 3ARVA 5ENWA 1K5NA 4AMKL 3OB8A 32C2A 4RRPG 1YQVH 4I0PA 5DEGA 5K9QG 3QZWA 4J3WA 1W8OA 3GEWB 4FXLA 5EU6D 2PXYC 5I1CL 3DBXA 3ESUF 1T1XB 2X4PB 1TETL 1MY5A 1T5XB 1IC1A 2VR4A 4WI9A 4NC1E 2E9IA 3EYQD 4DN4L 1K5NB 1TITA 4J1UB 1FZOA 4I0PB 4LHJB 3HMXL 1KJ2L 4PUBH 3HA0A 2BSRB 3BAEH 1OTTD 2IC2A 4XC3L 3I02B 1FZOB 5DHVA 1R3JA 2IALB 5F96H 2VERN 1T1ZA 3GMMB 3T0BA 3UEZA 3VGEA 2ZOKB 3BJLA 4ZO7A 3IRZA 4G9FD 5D7JD 1JHKH 1RIUL 2YHGA 3JWDC 2Q8BL 4X5LA 1R3JB 5DI8A 4XWOD 3W82A 1T1ZB 3P4OA 4OIAA 3VRJB 3ULUL 3QDMA 2H2PC 3OWEA 5FO7A 4OB5L 1QRKA 4UNVA 5IMLA 3ZMRA 3EOAA 5DK2A 4OQ1A 1ZHKA 3QDMB 1PY4A 1JPGA 4NDMA 1WIUA 5J1TC 4BH8A 4YGVA 5FO7B 3J8F7 5IMLB 2X41A 4OLVL 4XBPB 3C8DA 3GIVA 3EOAB 5DK2B 2P48B 2CRYA 4FZ8L 1ZHKB 3DOSA 4NDMB 2D0FA 1QEWA 4BH8B 3AS2A 2ADFL 2W0FA 4YGVB 4MJ5B 1V3KA 4N9GA 4HKZB 2P5WE 3GIVB 4G6MH 3WNKA 3SDDB 1U41A 4X80L 1DLFL 4NBZB 3GMPB 3QCUH 1QEWB 2AJ3A 4OTXL 1E6OH 4C55A 5MERA 3SDAA 1OAYH 2MHAB 4TTGA 3MRMB 3L1OH 4EDWL 3VFTA 2VLKE 3GSQA 3DI3B 4HJGB 2MMXA 1IL1A 2FIKA 3GNML 3OF6D 1NKOA 2AJ3B 5MERB 2DTML 5F7FA 5HPMB 4JFOA 3SDAB 2GAZA 2AV1B 1KN4L 2Y07L 1JF6A 4L3AA 1OQOA 3I50L 4NQVB 2R0LL 3GSQB 1KJMA 2E6QA 5GGSB 4BQBA 4QHNA 3JWNC 2BNQA 5HDLA 2R2CA 2GAZB 1KCSL 1MRCL 3IETB 4MVBD 2DD8H 2C3VA 1EMTH 3F58H 1KJMB 2QKIB 5CZXD 4QHNB 3UROR 5JORA 1OLZA 2BNQB 1FNHA 2X1PA 5MEQB 4EEEA 3IAGC 4ZXBA 4PP1C 3FB7B 4QRPD 4PJGB 1W0YT 12E8H 1MREH 4X6BA 3FB5B 3M1BA 2HT2C 4NRYB 1NFDF 4Y19A 3ROLA 3O2WL 5BW7A 4YC2B 4KU1A 1KJVB 1ACYH 4HMCA 4ELKA 2VKXA 2R8SH 2EO1A 5D8JH 5GSVA 3M07A 3P2TA 2GW5A 3C8KA 4X6BB 3MLVL 3M1BB 4LGSB 2DI8A 1N3NB 3BJ91 3LV3A 1PKQB 4Y19B 5T1LB 3ROLB 3VFPA 3QG7L 2AJSH 3INUL 1U8HB 4ELKB 4IS6B 3TA3B 3QUZA 5GSVB 3VD9A 1XR8B 5IWLC 2F58H 5KTEH 1CGYA 5FM5M 3C8KB 3ULVD 2QR0B 4OQTL 3VWKD 1ITBB 1WBXA 3VFPB 1XGQA 4K3JL 5IV2B 3ECBA 4KTEL 3D9AH 5F9OH 4N0FB 2DQEH 1MJ8L 1JV5A 4F15B 3Q6GH 3K46A 3QUZB 2CRMA 4XNZC 5KSBA 4HUMB 3PXHA 4P4RA 2WW8A 3UPRA 5KSVA 4NC0B 4DGIL 3AB0B 5I9QB 3TJHC 1GGCL 1GAFL 1WBXB 3A67H 3ECBB 5IFAH 3RHWK 3EJZC 1AXTH 2MCG1 2WBWB 3S36X 4E41E 3V7MA 5GZNC 3U79A 4P4RB 2NYYC 5KSVB 4P59L 3TWCL 1QBMH 3GSVA 3BPNC 4LPVA 3NN8B 5FO8B 1P53A 4FQLL 1GCFA 1CFBA 5FYJL 5BS0A 4P23D 2ZOLA 4LEOA 2NX5A 4U6VL 2MWCA 3MX0A 2FHBA 3C6SA 5FUCE 1RZJC 3O6FA 4Z77A 4FQXC 1H3UA 5FK9A 1H3GA 4PD4K 4F8TA 4UAOB 3DUHA 4KI1A 1GH7A 1FDLH 3TCXA 3ES6A 1OAXH 3ARGB 3VI3E 1QRNB 2ZOLB 3QUYA 4LEOB 1BFOA 5HYJD 2NX5B 4OF7A 4XNXH 4YHOL 3V7AG 2KH2B 5HHMB 4RBPH 5TPWL 2W92A 4PLNC 5JMRA 3FFCB 3ES6B 4NQDA 5F1IB 4PG9A 1A6UH 4LVHC 4HCRL 1BFOB 4F7MA 4IRSB 3PF2A 1C12A 2NXZC 3ROOA 1A9BA 4MA1C 3MJ6A 3MNZA 5IVXB 4NQDB 3BKYH 4OBSA 4PG9B 4X6CF 5D1QA 1MCEA 2H32H 4MJ6A 3WHE0 4F7MB 5E8PB 1MJJA 1MJ7H 4M3KB 2Q86B 3RVUD 3B9AA 5T3XL 1C12B 3IFNH 3VE0A 1VPOH 4YHZL 4Z7OE 5LXGH 4RDQF 1IM3B 1FNSH 5DA0B 5K9KB 5C08D 5JTWA 4LDEB 3CVHL 2DM3A 1AQKL 5ICXA 3T0EC 5KS9A 4U7SA 1MJJB 3E3QE 3LN9A 1DBJH 4XP5L 3RWFA 3IU3A 4RZCB 3QNXA 3HUJB 4WY7L 4ZUSB 4JJHA 3O41A 4WFFD 5ICXB 2DQCL 5F88A 3ARED 2WANA 4P5TA 3PE9A 4K07A 3V5HA 1KLFA 3IF1A 3RWEB 4OCRH 1IT9H 4HC1A 4HW6A 2FX7H 1JVKA 3OKKA 3QCVL 4LHQB 4K8RL 4OLWL 1YECL 1J1OL 5DMGD 4RGND 4KZDL 3BH8A 4NO0B 3V5HB 1J8HE 3IF1B 1BD2A 1I3GL 4BSWA 3MBXL 3DETD 3NIFE 3QWOA 4F33A 3OKKB 3UTSA 3H7BA 2KQMA 3CDGB 5EORL 3BH8B 3ARFD 3G6JA 3GSOA 1EFQA 3O9WD 3B5TA 4ODHH 4HUXA 3UC0L 3UTSB 5GGTA 3KR3H 2YK1H 1DQML 4QTHB 1UH4A 4YQXL 1GC1H 3GSOB 4RISH 3SOBH 2NXYB 4ZXBC 2WP3T 1LK2A 3G5ZA 2LQRA 1QACA 2OJEB 5LQBL 4N5ED 2FJFB 3G6DH 2VUYA 2Q7YA 3HHRB 5AG9A 5TFSL 4XVTL 1H9VA 4LSVH 1NGQL 3V6ZA 7FABH 1NCTA 5K9OB 4M7JH 4UUJA 4Z7WA 1LK2B 3H7LA 1XF2B 4MS8C 5HI5C 2DLHA 3BRDA 4ODTL 2DBLH 1OP9A 2Q7YB 4TPRL 3QIUC 4KJWC 1CE6A 4QWWC 3V6ZB 2W60A 5TQ0H 3WHE1 5HVHC 1R3HA 2PYFB 2YMXL 1L0XA 3P30L 2NZ9C 5C6TH 2R39A 3NIGE 5IMKA 4K2UL 5IKCA 3W0WD 1Y0LA 4YHPA 5DMIH 2H26A 5C71A 1JHLH 2W60B 4CRPA 1R3HB 2QQKH 1IVLA 5DC9B 1FG2A 1R6VA 1JHTA 4MXWL 5DGRA 5IMKB 4HIXH 5IKCB 3D18A 3QPQD 1Y0LB 2F54A 4JY5H 4HIHB 4KKLD 4LSUL 4WEBL 2B2XL 1S7SA 1FG2B 2ZJSL 1JHTB 3S37H 4LNRA 1YJDC 2OI9B 3D18B 4WCYL 5KG9B 4PY7A 1ZGLP 2F54B 3ZL4L 4RGOH 2UUDK 2EIZA 1S7SB 4OCYH 2HN7A 4G8GA 3O6FC 2NY0C 3SPVB 4L3CA 1RUKL 1QNZL 3CH1B 4H1LH 3VRIB 4MWFA 4PJ5A 3WXWH 4E5XA 5MEOA 2EH7H 3DO7A 4OZHF 1WFTA 3QUYC 2DLEA 2OCFD 4G8GB 2YPLE 4XI5C 4L3CB 1E28A 4L4JA 4EIZC 4ZFZA 4PJ5B 2FJHA 5MEOB 3DO7B 5GGVL 5IW3A 3IDJB 3FB8B 2HT4C 4KJQC 1CE1H 4KK9D 5B22A 3UDWA 2X05A 4PJHA 1HQRB 1FNEB 2ENYA 2EEAA 2EZ0C 2NY6D 3RDTC 1E28B 4H1LG 5ID0B 3KLDA 4HAGA 1HNGA 3RGVA 5C09A 2FJHB 3BDYH 5HDBF 4JFXA 5T1MA 4FFZH 1FP5A 3QEQD 2VQUA 3MPCA 3L3KA 3MRIA 1WWCA 4PJGE 5FDWB 1U8PB 4O2FA 4PLOB 1F97A 1FG9C 1GZPA 4OAWA 2G60H 3DECA 4K9EH 1WQVT 2BNRA 4YH6A 2O93L 4TNVK 3NVQA 3L3KB 3MRIB 3FHQA 1I7TB 1PSKL 5D5MF 4DUXA 2OS7A 4OAWB 4D0BA 1I8IB 1AO7D 5F6IC 2DQIL 4ZUWA 4P5TC 2Y1VA 1YQVL 1SJEB 5I1GH 4GXUM 3S5LB 1MWAH 4ELMF 2W9LA 3L5XH 5I8CA 3QDHA 2AQ3A 4ZUWB 3NH7H 2YOCA 5EZIH 4PUBL 2PKDA 4YDLB 1MFBH 4LVOB 1FSKB 4N0YL 5KSAD 1LP9F 3K80A 4HV8B 1KPRB 1KV3A 5I74B 5D96B 1NCAL 1NEZG 4ZTPH 3B4NA 1RIVH 5E2JA 4PG2C 5D2NA 1QKZH 1JHKL 1YEIH 3RVVC 1AQDA 5EZLA 5DHYA 3T2OA 4YHKH 5EBGA 4YK4B 5K33A 3OX8B 3THMH 3E8UL 3EDKA 5D1ZB 5FECA 4LP5A 2HLAA 4FTVB 3NCYP 4NHUA 3ZO0A 3E0GA 4XAKE 5JIIA 5I30H 5EZLB 5DHYB 2VZTA 3N85H 1QRNE 5GIRA 1GGTA 3FB6A 3VG9B 1N2RB 4IBLT 4GQPH 1HCVA 5FECB 2HLAB 4NHUB 4EI5A 4YDVA 3FFCE 1J0YA 2DWDA 3FAXA 2CKNA 5C9JA 3PJSA 3FB6B 5GIRB 1OP3H 3CPLB 4W4NA 5IBLC 3B9KB 4LAJH 2D9CA 1A7OH 3ZTNH 2P8MA 3D3VE 4J8RB 3VGGA 4D9RE 4YDVB 4XPTH 4U2ZA 3MV8D 5IVXE 4CU6A 4PJ7A 3FZUC 2DWDB 3IGAB 5ISZE 3PJSB 4JN1H 1TXKA 2VH5H 4QHUA 4WFGD 1J9CT 2I26N 5B8CB 3VGAC 4PLKD 4NQCE 5C0FA 1YEGL 3EOTH 1OTUC 3B43A 5CINH 3C6LA 3PWVB 1HYSD 1BP3B 4QHUB 4WW2F 4GSDH 1IAOA 2A6IA 5I8OH 3DVIA 3MGOB 3LZFH 3O3EB 4PJ8D 5JHDB 4MA7H 1I7ZA 5JO5A 1F6AA 3HUJE 1EDQA 3TJEH 1U2HA 1QBBA 2XY1A 2A6IB 3EO0A 1QBAA 1QLRA 3EOYG 5LGKA 3ZSSA 1I7ZB 1CXHA 4GKSA 1SBSL 1MCIA 1F6AB 1KXTB 5F7NC 5JO5B 3ULVH 1UM6H 3LDBC 3KJ4C 5IW1B 4LLVB 1EMTL 3F58L 5DVLA 2NLJA 1T0NA 3OJVC 2O61B 2EDDA 2D2OA 1T20A 1A6AB 2JJSA 4OZGE 1MSPA 3P11H 1FL6B 5AAWA 3MRKB 4MCYA 1UEYA 4IJ3C 1ORQA 2J88H 2LU7A 4NZUH 4BQ9A 1UJ3C 3ZDXF 1KPVA 1EIBA 3G9AB 4MNGE 5C8JA 1DUZB 1T20B 5GJTH 4JKMA 4ENEC 1IEBA 4G6KH 1Z9OA 3CZFB 4RAVB 2R8SL 5D8JL 5IT2H 3HZKB 3HZYB 4MCYB 1Q8MA 3D2UB 1ORQB 1N0LA 1J0JA 3RGVC 1WICA 4X7CC 1KPVB 1QYGL 2DL9A 2ATPB 2YD4A 3IDGB 1WTGT 1NMCB 2CUHA 3NA4A 1IEBB 3X3GH 2YXMA 1QSVA 1CG9A 1VEMA 2F58L 3GJFB 3TVMD 4M7LT 2SEBA 4ODXA 1QSFA 3MGTB 3HAEH 5A1AA 1B9ZA 4UNTA 1S7WA 5F9OL 2IJ0C 3H9SB 2XA8H 5GGRB 2NY3C 3KLHD 4Z7VA 2WINB 3KPQB 4JM2D 3TO2A 3BPCB 3KPLA 4HCRA 3MOAL 2AEQL 1QSFB 4ODXB 4JDTH 3QI9A 3OKEA 1M1SA 5TDOA 3U82B 4LAQH 3ULUC 1QA9A 1B6DA 4WUUA 4R8WH 4HGWA 2XKUA 1RZGA 2OJZH 3TO2B 3KPLB 3OGCA 5ETUA 3R06B 2XTJD 2IFFL 3OKEB 1KFAH 1ZT1A 4P4KD 1O5DT 5TDOB 3GGWA 2BRRH 3F7RA 4LLWA 5JA9A 1RZGB 1TVHA 3CVHA 5FYLE 1CXFA 1H3TA 2NY2C 2P8PA 1JZ6A 3E6HB 5GJSH 3V8OA 1UCBH 3GSWA 3NCJH 5CHNA 1M6OB 2FZ3B 1F4WL 4LLWB 4KZEH 4XNXL 3VRLE 5HGHA 3GRWL 2HTLC 1IGMH 1MNUL 5D2NC 4OD2A 4NCDA 5HD8D 5T1DH 1NFIA 1EUTA 4N0CD 1JBJA 4MSWA 3TZVA 5HGHB 5ID1A 5TDPB 3C60C 1DR9A 5LAXB 3S4SG 4GG6A 4XHQA 2N1KA 3MV7D 1DBAH 3G08A 4MLIA 4OIIH 4R96A 3MOBL 3W9EB 3ILPB 1QSEA 1W72A 1F11A 4KJYA 3TZVB 1K85A 4Q6YA 5B39A 1VPOL 1T7XA 1OP5H 3PGFL 1RZKH 1NCCL 1EJOH 4RFOH 3G08B 3PUCA 4ISVA 4EI5C 5C07D 5D7LD 4N8VA 1W72B 1X5JA 4R97B 1T7WA 4KJYB 5DD3L 4F57H 1DBJL 1DTUA 3UMTA 2OMNA 2IQ9L 4ZAKD 3VU2A 1BQHA 4ISVB 4OUUA 2W1NA 3MLWH 1S78D 3HZMA 3RJDA 3OKNA 1KIUA 4MQXC 5L2KD 4D0DA 2OR7A 4KVCH 3OKOA 4QRSB 3MCLH 1BQHB 2VE6B 4OGXH 2HFTA 3BEWB 3C6LC 4XBGB 1UM5H 4DVRL 3FO0L 4D0DB 2XQYK 3LEYL 3OKOB 3IYLW 4PB9L 3TLRA 3CC5A 2UZYB 3MRPA 2E7LA 1U93A 1OSZA 2P5ED 4N1EA 1FVDA 4KI5D 4NNPH 4QRRD 1P7HL 2VZUA 4OCXH 4HGMA 4QHMB 3MRPB 5DS8A 3S34H 1U93B 3O4LA 3UTTE 2F53D 1LD9B 2YK1L 1F3DH 1XFPA 5EUOA 3NOIA 3IU4L 3PABB 3RY5A 5KW9L 3O4LB 3PP4L 5L9DH 5LGJA 5L7XH 4H8WL 2JF1A 2WK2A 5F6HJ 3GM0A 4U1MA 1IE5A 1PKOA 1OGTA 4M7JL 1ZLWH 3KXFE 3C5ZB 2V2XA 1S5IL 3U2SA 3CVIL 3NAAL 5LGJB 3QUXD 2DQTH 4QY8A 3I6LE 2BJML 4U1MB 2HFFB 1OGTB 2FB4H 1C1EL 3U2SB 3JXAA 3EZJB 3W81A 4FTVE 2Q76A 4Y4HA 5EULV 3MNVA 4LDLB 4JZJC 3O6MH 3PIQA 1DP0A 2X1QA 5I0DA 2APTA 3S36L 2VDML 1UYWL 1S7VA 4XWGL 3B2UC 3QI9C 2QQNL 1UVQA 5T1KB 2FSEB 1M7XA 3MNVB 3OAUL 4LHUB 3PIQB 1LO3H 1JE6A 3MC0A 4F2MB 3LN5B 3P9MA 4HBCL 3V4PH 3S37L 3W11C 1S7VB 2WIIB 4Y2DA 5EO1A 4P2OB 5CIPH 3R4DA 2V6HA 5EU4A 2GEEA 1C08B 2VC2L 1U3ZA 1MCFA 3KAAA 4RRPA 4FABH 3P9MB 4X4YA 4F9PA 1KACB 3FQTA 4MXVE 4FQQA 2NY4C 5HI4D 5GRJH 2X1XR 5EO1B 3RPIB 2IMMA 3U7WL 4X4MA 5C0CA 4LU5H 1U8LA 2XFXA 5BJTA 4X4YB 5L2JA 3FQTB 4JPVL 2EH7L 5HHOA 1P7QA 1ITCA 4LVNB 3S6CA 2V17L 2VXTL 5EPMB 5C0CB 4MZ2A 4QOKB 5JHDE 2KPNA 5CJBA 1NCDH 2DIAA 5BJTB 1RY7B 1CVSC 5F9JB 1PQZA 5HHOB 4CU8A 5ABDE 3K4ZA 1P7QB 1IGIL 1CE1L 5FHAH 1R0AL 3Q6FA 3G04A 3RA7L 4Q97A 1QQDA 3TEUA 3MJGX 1ZVYA 1PQZB 2QADD 3PWUB 4ODVH 4GUPB 6CGTA 2ORBH 3WDHA 4LSSH 1FGVH 4ORGB 3Q6FB 3RKDC 5KOMC 3RVTC 5EA0L 1QQDB 1CBVL 3KPNA 4WVRA 5DEFA 5L8JB 3HC0A 4PJEE 1WBZB 4JDVB 1UKSA 4MDIA 3P9WB 5HGDB 4K94L 1WCQA 1BPVA 1HH9A 4OF0A 1UWXK 4K7FA 4W4OC 3I75B 4XNQA 1RJLA 3LS4H 1NLBH 2FD6L 2K7PA 5DURD 3VXPA 3KPNB 5HHPA 1XMWA 4U1JB 3QNYA 4HD9A 4MDIB 2GJ6D 2V7HA 4LOUD 3TBTA 4NC1C 4K7FB 4XNQB 1HQ4A 3JVGC 1G6RH 5J13C 5I1GL 1R3IL 2BSTA 3VXPB 3MJ8A 4MMZC 1OL0A 5HHPB 4LCIH 3CK0H 3VD3A 2Q8AL 1ZHBB 2D7QA 3QNYB 1QHOA 2IFGA 4HF5L 1FPTL 4YHLH 6FABL 4XBEL 3TBTB 2Q3ZA 4XPHH 1OAQL 4GAYB 4WI3A 5ESVA 4GJTB 4NNXA 1MCRA 4FQ2H 4M43H 2XKNA 1SVCP 3P0YH 5GGRY 4HDIA 3GBNH 2E8YA 2HJKB 2G2RA 3EFDH 4XVUC 4JG1L 1H5BC 5ESVB 3T0DA 2D03H 1D5BA 4NNXB 2V9TA 2GUOA 3JSSA 4UTBH 3CXDL 1N5YH 3BKMH 4J2XA 2G2RB 4M7KH 4P0DA 2GK0A 2R69H 3KPTA 4LVEA 1SM3H 5DQJA 1D5BB 5DRZA 3EHBC 1GPOL 3THML 2GTZB 4Y4FA 2VDLH 5CJOH 2GK0B 1T03H 1EEUA 4Q7DA 3K2UL 5DQJB 4U7KA 5CILH 4IMKC 2ZUSA 3CFDA 3VFUA 5I1HL 2PTTA 4LCWD 4Y4FB 3ZLQC 4XMPH 2D4FA 3KGRA 2YD2A 4OCNC 5SWSD 1H8NA 4WV1A 4NO5A 3BKJH 3WEXA 4PRAB 3VFUB 3CFDB 25C8H 2DF3A 1QD0A 4KGLA 3PWNA 5F9WB 1HZHL 2VIRA 5AD0A 1FYTB 5D4QA 4RIRB 4XPTL 1DN0A 4WV1B 3WEXB 3FQWA 4Y4HC 4NBYB 1WIOA 2Y36H 2VH5L 3U83A 4R7NA 5FYKD 3QDGA 5ALBH 4AL8H 3MLYL 5BV7L 2FGZA 3EOTL 3MV11 1CGXA 5EB9A 3ZE2F 1AGBB 3BGFB 3ARDD 5GISL 3FQWB 4W6XB 2FDBP 3P4MA 4FMKA 5D6CB 1MCPH 4GBXD 2NR6D 3CSYB 5F7UA 3DROB 1ONQA 2EDKA 3QDGB 5J12B 5I2IB 3DXAE 5JDSB 1K8DA 4P46C 5AAMA 5I8OL 4Y2DC 3DV4B 1ED3A 1IAIL 1QOKA 1GYAA 3P4MB 3WKML 4OZFH 1WZ1L 4ZFGL 4LBEA 2DICA 4DWHA 2VOTA 4H20H 3VCLA 2D31A 4YHIA 3QFJA 3QT2A 3MLUL 3KPPA 1ED3B 4JFEA 4QHLA 3ULVL 4MA3A 1KG0B 1MAJA 2D0HA 3GI9H 5GS1A 3L5HA 3CFJA 1A3LL 1FIGH 1PYWA 4CU7A 2J8HA 4EBQH 2XZCH 3DUUA 4PV9A 3VXRA 2VXQH 4NJAL 4OKVA 3VCLB 4DGYH 1BFSA 1FYHB 2D31B 3QFJB 3P77A 3V0WH 3KPPB 4JFEB 4M9OA 1BGXL 4MA3B 3RZCC 3I6GB 4R2GB 2NZIA 4OZFG 5DJ8A 5I73B 3CFJB 4JAMB 1K4CA 2J88L 4PS4H 3VXRB 4YX2L 3P77B 4UMGA 4WTZG 1UB5A 4NKOA 2EXWC 1JGLH 4JFDE 1CT8A 4ZNEE 3M8OH 3DX6A 4QGTA 4WWKD 35C8H 1JPSL 3X12A 1KCRL 4ODSH 1PLGH 4MD5A 3ARXA 3MA7A 4X6DF 5BVJB 4R4BA 4GRWH 4KPHL 3SKMA 3TN0C 1CT8B 2ADIB 5A2LH 5AG8A 3Q1SL 4Y4KA 2J7LA 2BVEA 1TTGA 2HKHH 3LQAH 1QHPA 4MD5B 3MA7B 1P5VA 3FFDB 5FDYA 3SKMB 3BH9A 2A0LD 5IHZA 4R90H 1EA9C 3NPSB 3B9EA 4HQQL 3SN6N 2DIJA 2P47B 4X99B 2G75B 3MA9H 4GXUN 3O2VL 2VLJB 1U36A 3SGKA 1I1AA 1RK1A 4GH7B 3P0VL 2YEZA 3QDJB 1K3ZA 4JQVA 5E6YA 2J8UB 5IHZB 5FUCC 2IAMC 1IEAB 3BO8A 5HHVH 2NPLX 5K59F 2BRRL 4OJFH 4KKAD 1NCUA 4FNLH 5B3JE 3EYVB 2KL6A 2YEZB 4HWEH 5JW4M 4UQ3A 2H32B 1ND0B 4Z9KB 5HSFA 1NBVH 1RURH 2PTUA 4Z76A 3BO8B 3S96A 4FQIH 3LH2H 5GJSL 5MP6H 1UCBL 3VXSA 5E8DH 1MOEA 5JPNA 4UQ3B 3IDNA 5FM5O 2IPUK 4HWBL 5C9KA 1B0RB 3NZHH 4NUJB 1INEL 4Z76B 5CGYD 1TDQA 3ARWA 2P24B 1WZLA 2F5BH 3RRQA 3VXSB 5DJ6A 4NWTH 5LBSH 4NO2B 4OGYL 1DVFA 5JPNB 4JRXE 5DUBA 5M94B 3LMJH 5T33H 2HVKB 2XA3A 3FOMA 3MLZL 5E5MA 5FKAB 5CZKA 5DJ6B 3CX2A 4CADB 2HH0L 3U6RA 5DUBB 3OKMB 4G6AC 4X5WA 2XZAH 3E3QC 3KWWB 1FLRH 3C09B 5E5MB 1KIQB 1IQDA 1TJGL 2PXYD 2R1WA 4BK4A 3U6RB 1YMMB 2IADA 4X5WB 2OMBA 1PW3A 3R0NA 1A7NH 2ZUVA 5CKAA 3CX5J 3WFDH 1YEEH 1RZ7H 4M7ZB 2IQAA 3MREB 4WDIA 1ULVA 1J1XH 4CMMA 4NFDA 5F1SA 3B9VA 1A7BA 2PTVA 2UWEB 3S7GA 4H88H 3F65A 1UM4L 4OGXL 3UBXB 4WDIB 1IILE 1T4KA 1UB6B 3QWQB 5FUZH 3HMWH 1UM5L 3VMOA 4KDVA 5E08L 1CIUA 3SO3B 1NBZB 3F7VA 3RWJA 4WU7A 4XX1E 4V2BA 4JHBA 2A6KA 3L7EA 3A6BL 4ONFH 2H2PD 3F7VB 4LLYA 2GJZA 2A6DA 4O9HH 5ACMA 4FFYH 3QXAB 4NNPL 5I17A 3T3PF 2APWA 1MIEL 1E27A 5FV2A 3TO4A 1AGDA 2A6KB 4LGPB 1I8KB 2XWTA 4CVWA 4ERSL 3L7EB 1WAAE 2Z4QB 1BF2A 1OAZL 2GJZB 5IHUL 3IS0X 2VL5A 3KS0J 2Q20A 1SBBA 4TQEH 1BJ8A 1E27B 3TO4B 1AGDB 1CLOH 4FXGA 3RNQB 3GHBL 2X70B 4KUZH 2VL5B 1HHKA 3ZKQD 4UIKL 4CVUA 1GGUA 5H37G 2UVFA 1T7YA 4FXGB 5I15L 2E27H 4M1DH 3D3VA 3VXUA 5EBMA 3T04D 1I9EA 2Y5TB 3B8YA 1HHHB 4YLQT 4H1LA 5EIQA 1NUDA 1ZANH 5DJCB 1F90L 4J3OC 3ULSA 2AK4A 5KSBF 1M05A 5ADOL 4NQCA 3QQ9C 3O3BA 1QFOA 3VXUB 2W0LA 4PY8J 4Y4KC 3O6ML 5IM7A 3HKFA 5EN2A 3R8QA 4H1LB 1W2KT 4PTTB 4RGMC 2AABH 1F4XH 4QO1A 2QSCH 3ULSB 1F2QA 2AK4B 1M05B 3UO1H 4NO3A 3CCHB 5DUPH 2DQUH 1R3LA 3FJTA 3MLPA 5EU6A 1NPUA 5EN2B 4XVJH 2DKSA 1R5WA 3IXAB 1I1AC 1R24A 1FN4A 3WFEH 5DT1H 1R3LB 1FYTE 2DM7A 4KDTA 1V5JA 5EU6B 4PGEB 4L4VD 3PL6A 3I6KA 4PP1D 1C7TA 3WSQH 1S7XA 2HT2D 5GRJL 1TJIH 2EKJA 1FN4B 1JYVA 4LU5L 4DTGH 2AJYL 1T1WB 1KB9J 1FFOA 3CSPA 5HYIA 1K2DB 2DQHH 3TNMB 4U3HA 4MX7B 1G7MA 2BY3A 2FIRT 1NSNH 2YD8A 1BEYL 2LU4A 1U58B 1C8PA 5D2LB 5DUML 3EFFA 3HI5L 3VFSB 3S35H 2B0SL 2AJZA 1A6ZA 4G8IA 4F3FB 1AE6L 3QBTB 1DVFC 1NEZA 1RJZA 3EKCA 4G9FB 4NQSA 5D7JB 1QLFA 1AGEA 1FFQA 2BVOA 3O6LH 4BZ1H 3EFFB 3TT1L 4JFFE 3RWGA 3BIKB 5JIKA 1MWAB 4G8IB 3MXWH 3TJHD 1AGEB 1AIFA 3T4YA 1X7QB 3QQ3B 3EJZD 4YC2C 1BM3L 1UA6L 3FT2A 3T77A 4KXZI 3RWGB 1A6TA 3U0TA 4KJPC 1JRHL 2RJMA 5GZND 1DBBL 4I9WD 5MHSE 1KLGB 2PCPB 1AIFB 1T22A 1KIPA 1BHGA 1LK3L 3T77B 1TCRB 3LS4L 2ZUTA 1A6TB 5GRUH 4CKVX 4M6MH 3OXSA 3TA3C 2X4QA 3MLXH 2OL3H 4FA8A 4OT1L 4H8WC 1P7KA 3QXWA 7CGTA 1KIPB 5AZEH 1G6RL 5E5RB 2HFEB 2AEIT 3CK0L 3OF6A 2C4FU 5GRZA 4ONGL 5EIVA 3JV4B 1OQXA 4XPFH 1KT2A 1SYVA 1KTDA 4M43L 4MQSB 4HKJA 5BMFH 3P0YL 3G6JF 5INCA 4JKPH 4L29B 1RD6A 1U3HA 3L9RB 4P5MA 2N4IA 5CSZA 2NXZD 3ZE0E 1X5KA 3QA3A 2ZG2A 4LRIA 3P73A 3REVB 1KTDB 2VL4A 1J0HA 2VLJE 4HKJB 4N8CL 4M8VA 4DKFL 3QDJE 1ZLVK 2F8VA 5DD1H 1XIWC 4P5MB 5CSZB 3KYKL 5CBAA 2I9LA 4QRPA 1TZGL 4LQFL 3GO1H 1MCOH 5IR1B 5GHWL 3T0ED 4JN2B 3B2VL 2VDLL 5CJOL 4Z7WF 5F44A 3ZDYE 3ARRA 1OT1A 1T03L 4Q0XL 2I60H 5CBAB 1BQSA 4QRPB 4ZTOH 4FG6C 5C0AE 4MNQD 5GS3A 5IB3B 2VLME 1I85A 2IPKA 2VNCA 1WFUA 2A73B 3GK8H 3KYOA 4Z7UA 5IQ9B 1OGAE 2UZIL 4IRSC 1F2XK 1MJUH 2QSTA 4K3GA 3SGDH 4BYHA 4Z7UB 2ZUQB 4I18A 4IM8A 2UUDH 1FNAA 1F6FB 9CGTA 1NMAL 3VWKB 4M61A 3F62A 3RJQB 3BRGC 4N0UE 4WO4A 3FKUS 4P2QD 3K81A 3IDXH 3ZHLA 1MCPL 4JPWH 1BFTA 4GQ9H 1S9VA 2E7CA 1A5FH 5E5UB 4TRPH 4HX1A 2CH8A 4UV4L 3CGTA 3IJYA 3D25B 3U36A 3UAJC 4NQEE 5KSUA 5I19H 1MI5E 1OB1A 2JCCA 1YZZA 3PL6C 1S9VB 4ZXBD 4UT9L 3UTTA 3MZTA 2GQHA 1G6VK 1PG7X 4HX1B 3IJYB 4LASL 3OL2A 4XCYB 4AG4L 3U36B 4HIIA 4P23B 4K94C 5E8EA 1OB1B 3GI9L 5HYJA 5K93A 1FIGL 4WHDA 2FX9L 4EBQL 5K9QI 2R2EA 2PYEE 5HY9A 2C4FT 2ENSA 3HAEB 5I1KH 3B8SA 4HIIB 5GGUA 4GW4B 3QIUD 4KJWD 2C1PB 4HFUL 4QWWD 3QIWC 5HYJB 5ILTH 2NZ9D 2R2EB 1IAKB 5GGUB 3LKRA 3MYZA 1IC4L 1L6XA 3VXTA 2XIDA 1OPGH 1VHPA 4L5FL 5LGHL 3K0WA 3IT8D 5DJDB 35C8L 5E4EB 5EU3A 5HJ3B 5C08A 1ZLSL 3LKRB 1JNLL 1I1YB 3NFSL 4HS6A 1B2WH 3S4SA 1ZVSA 3WIHH 3VXTB 2CPCA 4OLUL 1QFUH 4XT1C 5EU3B 5C08B 2ITDA 3GBML 2CRZA 2HKHL 4HS6B 3BE1H 4Y5XA 4Z0BH 1FL3B 2P46B 1A3RH 1Z5LB 3FAWA 3JZ7A 5BS0D 1S7UA 4ETQB 3AREA 5HI3C 3CFIC 3KG5A 3RAJH 3O6FD 2GSIA 2NY0D 4NOBA 4Y5XB 1MFCH 2RR3A 1S7UB 3AREB 2NY5H 3QUYD 4PRPE 2AV7A 1RULL 1ACZA 4QRUB 4JQIH 1A9EB 2D7NA 4WHCA 2VRAA 4XI5D 1T0MA 4OJFL 4APQC 5F7DA 4FNLL 2FBJL 4Q9RL 4BQ6A 3DSFL 5TE4L 4RGNB 5I66B 2AV7B 1RURL 2HT4D 3D39D 3HG1D 4FQIL 1U3HC 3LH2L 3FQXB 1MHCB 2DB8A 1T0MB 1T66C 2OI9C 5EC1A 4C83A 5IFHH 3BPLB 2CQVA 5IESH 5D1QD 4CBPA 3L5IA 1IM9A 5AEAA 1IQWH 5ESAA 3ARFB 2X7LA 1HEZA 2EYRA 1OVZA 5BV7C 1IGTA 3O9WB 2F5BL 4AH2A 3LSOA 4XCNA 4JEGB 5TE6H 4DK6A 3HPJA 2AXFA 4MD0A 3BVNA 5ALCH 4WFEE 1V7NH 3LMJL 5DJYB 1CDIA 4HXAH 2X7LB 1IGTB 4AH2B 2AJUL 3MRBB 3WJJA 4OSUH 4XCNB 3X11A 2FL5B 2I9TB 1RZIA 2Y06H 4KVNH 3ARBC 1B4JL 3OZ9H 1ZS8B 2XZAL 1RVFH 4NN5B 5D2LE 3JWDH 4P5TD 3DX8A 4L8DA 1YY9D 4R26L 3ARZA 3Q0HA 4Z5RA 2VDQL 3GBLA 4PJ7F 3WHXA 4P57A 3JWOL 1T2QH 1UQSB 2P4AB 2EE9A 4X9IA 4G9FE 2LAAA 5DK0A 1B0WA 4I18C 1BD2D 3MXVL 5DA4A 1MCJA 4Z5RB 3WHXB 4P57B 4AEFA 5FCSH 3W0WB 4MGXA 5IB4B 2GK2A 4WO4C 5FGRA 4XHJC 5DK0B 4HWZA 1NBYA 2DWEA 5C0DA 5FUZL 3HMWL 2XTLA 2FRGP 1A6VL 1JJUA 4WFHD 4FQHA 4JPKL 2FX8H 2XOTA 4M93B 3TT3H 4HWZB 3OXRA 3RVVD 1NBYB 2DWEB 4M9PA 5C0DB 2Z0BA 3FRUA 1UACL 4FQHB 4LPXA 2IPTL 4XXCA 4M6NL 2VDPL 4NJ9L 3ELAT 2EDYA 4YBQC 3B5GA 4FFYL 4R3SB 4DFIA 3CFEA 1ORSB 2BFVH 3MRQA 1QR4A 3FRUB 5CWSB 4B7LA 3E2HB 3KDMA 1MEXL 3T2QA 5HYSG 4LVOC 1FSKC 1LEGA 4LEXH 1G7QB 4TQEL 3MRQB 1JWMA 5HBBA 3LKSA 1CLOL 1DQDH 5HXMA 4XP9H 43C9B 4JRYE 5CIPA 3RWIB 1CYGA 3BGAA 3F12A 4X7EC 1LEGB 5CP3H 2V9RA 3FZUD 4PJXA 5C6WH 5J11B 3LKSB 4K3EH 2CK0L 1JI1A 2E27L 4M1DL 1CFSA 2NY6B 2AXHA 5E99L 1XGUA 5B38G 2ZSWA 1OTUD 3QHFL 1AXIB 2CK2A 4PJXB 5DD0H 1T5WA 1ZANL 3DURB 4Z7VF 2GCYA 4RWYH 1CFSB 4G6FD 5KVFH 3QEQB 4QTIL 4P3CH 1RK0A 4FFWC 3U0PA 2HP4A 1JNNH 4HPOL 2ZSWB 3WFHB 2YSSA 2WV3A 1LO0H 3SBWA 1YN6A 4U3CA 3RUGB 3U9PH 1MQKH 4UQ2A 4B53A 4JFHD 1VGKB 2VAAA 3QXUA 4NNYB 3TFKC 5CLWA 1RK0B 3U0PB 4XP1L 2W9EL 4CJ1A 4QXGH 4LSQL 4YE4H 1KC5H 1YN6B 1EBAA 2JJUA 4O4YH 1AO7B 1GIGH 3WFEL 4XP4L 4JPIA 5DT1L 5IROA 2V5YA 4A6YL 2VAAB 5ELIA 4I48B 5B8CC 1OSPH 2IEPA 4Z78B 1YNLH 5JW4N 4PP2A 4Y88A 3C08L 3H3KA 3KYMA 4Y8DC 2YS4A 3W2DL 1TJIL 4MMXC 5ADPH 5I8EB 2WUBH 2MQ0A 3V0VB 2OLDA 4ENED 4LLUB 1H3PH 4CDHA 1JPTH 2Y7QA 4AY0A 1K6QL 1KCVH 3NACL 3KYMB 3RGVD 1EGJL 3U0WL 3S88L 4OZIE 1BQUA 3VXME 2PW1A 5C09D 5KSAB 2V5MA 1CD9B 3T09A 1YYMH 3WO4C 2B1HH 2NY7L 2DQFA 1G6RA 1S7TA 5TF0A 4J23A 3JUYA 4ZNEA 2PW1B 1ZK9A 3H0TA 4S1RL 4XGZB 1IBGH 5D7KD 4X5XA 3ALPA 4I77L 2NY3D 2BNRD 4HPYH 1V8HA 4K71B 4YDKL 5DHVH 4NT6A 1G6RB 3LKQB 3WJJC 3MUY1 4HT1H 1LHZA 5SV3A 1A7PH 4RSVA 3H0TB 5FXCH 1TQCC 2ERJB 5GGQH 3RIFF 2X4SA 1U8JB 3ULUD 4KTDH 4PTUA 4NT6B 4ZDHB 4JO3H 2ARWA 2DL2A 2EH8L 1MH5B 1OM3H 4M6OH 2Z35A 1YC7A 4AQOA 2MOVA 4HK0B 1NMBL 5C0BE 2X44D 3HC3H 4GKNA 4XNUL 5GRUL 4PTUB 4RX4A 4M6ML 2YKLL 1MCLA 2OL3L 2NY2D 3BXNB 1T80A 5A16A 1CK0L 4YFLI 1MRDH 3MV8B 3U48A 3QYCA 5ICYA 4F37F 3SE8L 1RUMH 2HG5B 3T4AA 4G7VL 5F7EH 1EVTC 2YZ8A 2XQYG 5DZLA 2FHFA 4D3CL 5IW6A 4DKEH 1E6JH 5DJZA 3ZTJH 3RTQA 2BZDA 4JKPL 3T65A 3U30B 2FR4A 3VA2C 5JR1H 4PJ8B 5IW6B 3DSNA 3C60D 5L8KB 5DQ9B 4RMTA 5EUOF 5DJZB 2VDRH 1I1CA 1YA5A 4ZFOA 1EHLH 3T65B 2IG2H 2B7DT 2DS4A 2FR4B 1HXYA 1S5HA 2DYPA 1A4KA 4NZTH 5I6XB 4PGDA 3MUGA 3ZTJG 4ZUTA 4C57C 1HHGB 3SE3C 4EI5D 3VJ6A 5K9JH 1JF1A 3RP1A 2OQJA 4RAUA 4ZFOB 5DWUH 3SKOA 2E7MA 4GRLA 4G5ZL 1N64H 5CEZE 2EIDA 1R5IA 4P2RE 4GKOA 4Z0XA 5H35B 1A4KB 2ZCLL 4QXUH 3IFLL 2XYCA 5FGCE 2B5IC 2VQ1B 1G9NC 2VDOL 4ZUTB 4IMLA 5E6ZA 4EN3A 2DTSA 3VJ6B 2Z31A 4OZFA 1YYLL 1BZ7A 1R5IB 4MQXD 1BWMA 1URLA 4Z0XB 5I8KL 2R4RH 3CMGA 4BZ2L 3JV0A 2H41A 4J7RA 3AROA 5J1AA 3C2AL 4IMLB 4WTZA 3GKWH 5DD5L 1ZSDA 2HTKC 4OZFB 3C6LD 1P69B 4YHYC 3ZSTA 4FQCH 4BSJA 4JM2A 5DRWB 4KWUA 3TVMB 1A8JH 1ZSDB 3VXOB 2CO7B 4XP6H 3TYGH 2BHUA 2H8PA 1KJ3L 4NGHL 1CFVH 4R97C 4HHAA 4DKAA 2J6EL 3DRQA 5AYUH 1YN7A 3Q3GA 4JM2B 1HOCA 1BF8A 4YR6B 3GJEA 1T6VN 1UWEH 4TVPD 4P4KA 2E5EA 4HJJH 3O45B 1AJ7H 2BVPB 1G7LB 1DEDA 2V7NA 4HHAB 3CFKB 1IGFH 3DRQB 3VGDA 1YEJL 3LEXA 1W0VA 2VN4A 1FH5H 4FQJH 2RB8A 2XTJB 3GJEB 3V6OA 4POZC 1T1YA 4P4KB 3V52H 1WAAA 3QRGH 3W0WE 5TE7L 3FT3A 2YC1B 3GMLB 2V7NB 1BAFH 4XPGH 5HYQA 4ZPVA 1W0VB 3MRGA 2KUTA 2WBKA 3LEVH 3DV6B 1YJDH 4QGYA 5DEZA 4GRWB 2DDQH 5FYJD 1KULA 1A7QL 1XF5B 5C0GB 3P4NA 4L8BA 1I3UA 4RFEA 5ITBL 3FT3B 2UV3A 1N6QH 1FJ1A 4PRDB 4ZPVB 4NN7C 3MRGB 5ILTL 1FRGL 1HHJA 1JN6A 4OM1H 3L95A 4UDTB 2ARJQ 1D5ZB 1RV6X 4L8BB 4N1HB 3MV7A 1N0XL 1PJ9A 4ZS7H 1FJ1B 4ODUA 3A6CL 3BT2H 5FUOH 1G7JA 1JN6B 5IP4A 3TC9A 1OPGL 1PDKA 4QNPF 4C56D 2BVQA 4ZQKA 2YWYA 2R56H 3MV7B 3B2UD 3QI9D 4U6XB 2ZCKL 4Z18A 5KANG 5IBTH 4WUUD 1G7JB 1NFDE 5EZJA 5CFHA 3W11D 3C5ZC 2BVQB 4ZQKB 3HNVH 3NFNB 4GMSH 4ZAKA 3BE1L 5C07B 1HIMH 4S1QH 5D5MB 3H2WA 5D7LB 5T3XD 3I2CH 5C7XL 1CTOA 3D87B 1HKFA 2YD9A 3KHOA 2BMKA 2NY4D 5EU7E 3GB7A 3DX9A 4ZAKB 2IANE 3HR6A 3N9GH 1KCLA 3L6FA 1I4FB 1MFCL 4HKBA 3IFPB 1MQ8A 5L2KB 2B20A 2Z92B 1AY1H 1LO4L 2NY5L 3AU1A 4OLZL 5H94A 2BMKB 3QEQE 1V3MA 4OD3L 5IMMA 2AAVA 1QVOA 2IBZY 4V1DA 5IF0B 3T0VA 1HKLH 3MCKB 3BYYA 2P5EA 4PJCA 5EOCL 5SWZE 1BBDH 1LP9B 3A6OA 2ZPKH 3H42L 5DRXA 5IFHL 5DF0A 4HC1H 4OCWL 5IESL 3L7FA 2VLLA 2F15A 2M1KA 2AGJH 5SV4A 3UYRH