2QHRL

Crystal structure of the 13f6-1-2 fab fragment bound to its ebola virus glycoprotein peptide epitope.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
218
structure length
218
Chain Sequence
QLVLTQSSSASFSLGASAKLTCTLSRQHSTYTIEWYQQQPLKPPRYVMELKKDGSHSTGDGIPDRFSGSSSGADRYLSISNIQPEDEAIYICGVGDTIKEQFVYVFGGGTKVTVLGQPKSTPTLTVFPPSSEELKENKATLVCLISNFSPSGVTVAWKANGTPITQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFTCQVTHEGDTVEKSLSPAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords 13F6-1-2 Fab fragment heavy chain
publication title Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
pubmed doi rcsb
total genus 47
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2007-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qhrL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qhrL01
1S9WB 1YMMA 5SWQB 1U8QA 5SWSA 4PJXA 4OD3L 4OCRL 4MA1B 3MRHB 2RJMA 1H3PL 2N1KA 3RX8A 3IJSA 1WC7A 1FCGA 1T0MA 5HDBE 2KPNA 1L0QA 2YKLH 4YHZL 3QUML 4XTRC 3MZTA 2UZIL 4CDGC 1T7VA 8FABA 4FOMA 5EUOE 3HE7C 5M7QA 3DSNA 4PJDE 4K71C 4OSUL 1O7VA 2V17L 5HPMA 2R4RH 5JW4R 3WIFB 5AUMB 4PJFE 4L8CA 1G7MB 4HUMB 1D9KA 4PJ7B 2QEJA 1MCJA 5A1AA 1SBBA 1QYGL 4ZTOH 2P8LA 1MHCA 1NFKA 4TPRL 3S35H 4XAWH 3EYOA 3U1SL 4KKLD 3W2DH 3CUPA 1I1AA 1RUAL 4MNQD 4PY8I 2G75B 5E6YA 2VOTA 1U8LB 2F53D 3E3QE 3TN0C 3QPQD 5FM8A 5F6HI 2UVEA 4P2RD 4HZLA 4N5UA 4V2CB 5LQBL 4NPYB 1FSKC 4LDEB 2G9HB 4UZGA 4OM0H 3TBYB 3NZHH 3SKMB 4ZSOE 4CBPA 4QRRA 3MRLB 1JWMB 1I3VA 4J1UB 3MRFA 2N7BA 3MRKA 3MUJA 4LSUH 4TN9A 2XZAH 1A7OH 4DGVL 4F8TA 4YXHL 4NBZB 1WWWX 2WUBH 4B7LA 4JCMA 3ARZA 1YECH 1CICA 2DTSA 3PWUB 1ZTXL 3LQZB 4WV1B 4Z0BL 5D6DC 4M7JL 1B2WL 2P8MA 4MAYC 1LE9B 1ZHLA 3ZKND 3OKOA 4P4KD 2HA1A 1KB5H 4L8BA 4I2XB 5IMKB 3SGDI 4M48H 1MFEL 2PO6A 4L4JA 4HCRL 2E6JA 2P5EE 1I7RB 4YAQA 3DYMA 5D7KD 2B1HH 4C56E 1GCFA 1TPXB 2AV7B 3ZDXF 4GKOA 2K7QA 2CGRL 5GS3A 5JXAH 4N9GA 5C08A 3RRQA 2X70B 4Y19D 4FQIL 4JRYA 4WFGE 4K2UH 3UC0L 4NIKB 4N0FA 1VKXB 1AHWA 3QP3A 1LEIB 5CEYA 2Z92A 3MYZA 4U6HB 5KSBF 3AB0B 4FG6C 3UZEA 3MRPA 4RGNB 4S1DC 6CGTA 1ACYH 3PGDA 4K55A 2VLKD 2HKHL 3S36X 4DQOH 5L9DH 3SDYH 3MQIA 1I7ZB 4DAGH 3RL2B 1NMAL 1V3KA 3QNZB 4GW4B 5HHOA 5D2NB 2IH3B 3VG9C 4L8DB 2F15A 2BNRD 1ZAGA 4JKLA 3UJIH 3FB8B 3N0PB 3C87A 5IVOA 4N8VA 4YHKL 3CFJB 4UINH 5FCUL 3BPNB 2AJXH 1ZLUK 4PGZA 4DTGH 1FZOA 4QOKE 3SDDA 4EXPX 4ZD3H 3BUTA 1OGAD 2O5ZH 3DIFA 2BX5A 5I1IH 5DGRA 3RKDC 1JPST 2HN7A 3E2HB 4M3JA 3IFPB 1DSFH 3GI8H 3QNXA 5GIRB 4TULL 2GTWB 3HUJF 3Q3GB 3RVUD 5TDNB 1IKFL 1J8HA 2W0FB 3K80A 5GZND 3QUKB 1XGPA 4KJQC 4NDMB 3T2QA 4PJAB 2BSTB 4PJEA 3O3DB 1TETL 3U4AA 1W0VA 1I9IH 1KN2L 2BOCA 4G6MH 1HKFA 1K4CB 4XAKE 4RDQF 4NC1E 3WUWB 4WJ5B 1ODAA 3W82A 2A9ML 5IHZB 5IGXL 3EYQD 3QEHA 3MRRA 2VDQH 5ANMB 3DBXB 1INQB 1DANT 2A6KB 2GCYA 3ZE0F 2KKQA 3ARFA 3VXSA 1V7NH 5D93B 3VDAA 2HFGH 3O6FC 4BKLB 1AO7B 3HZVB 2CKBA 4V2BA 4G6KL 4DOHE 4PR5A 3ULUL 3OGOE 4NT6B 3FQRA 2FLRT 1M6OA 3P40A 5M95B 1DBJH 1FC2D 1OSPL 3F65A 4PJGE 5HGHA 5C1MB 4PRPE 1D6VL 2FJGB 4HUUA 3GI9H 4IOFC 1LO2H 3ZYZA 1BZ7A 2VXVH 4YC2B 1OTUC 2BVPB 2Z9TA 1BOGA 3HS0A 3DWTA 2HRPH 3V6OE 1ZHKA 4U2ZA 1XF5B 3GK8L 3WLBA 1YJDC 3ARSA 2GK0A 4LQFL 5BW7C 5IR1B 5MEQA 3W9DB 3I85A 5I1LB 3KPLA 1UWGL 4U1GC 3WHE1 4ZFFA 4BFIB 5DR5H 3D2UD 2R0KL 4BA8A 4PRAA 2VN4A 4X5WB 3RTQB 4IRSA 1DQJB 4YDLC 2HRLA 2WBJD 3LPFA 3G5YA 4HKXB 4DEPC 3UZVB 1P7HL 2J8UF 4KK5D 4XPAH 1G6RA 3RWFB 1NAML 3NCJL 4DKAA 2HJLA 3VXMD 1ZA6B 1LO3H 5DRWB 4XCFL 2PW1A 1A7QH 5F7EH 1GIGH 5CJXA 1MCSA 1NC2D 1F3JB 4ELKA 4M62L 3Q5OA 4P2QB 1TIUA 4HGWA 3GO1H 3U4EB 3MRBB 2VABB 4UOW1 2EEBA 2XFXB 3BESR 4GT7A 2FRGP 5HGBA 1IQWL 2YEZA 3QUMA 5C6WH 3QIWD 1KPUA 1F11B 1R3JA 5C71A 5KVGL 5I74B 1IAIM 3NN8B 3QWOA 5DD0L 2IALB 3D0LA 3GSNB 3M17B 2OTWB 3HRZA 4TUOA 1DBBH 3LVEA 2YD5A 2DQHL 3JUZA 4NP4L 2EEAA 3QR2A 4GXVL 4JPIB 5FHBL 3RY6A 1NBQA 3Q48A 2EDOA 4HMCA 2Q87A 2ZOKB 4LSTL 1CDJA 2Q1EA 3UTZA 1RZFL 4L8SA 2B8OT 3F12B 4BZ2H 1GHFL 4ZAKB 4J3XA 3E6FA 4ZXBD 1J1OL 1F02I 4Y5VB 2VR5A 2ICWA 3LKRB 4OKDA 4UMGA 4Y7MA 3VGBA 3BHBB 5TE4H 5D71H 4P5MB 3VD3A 5LGHL 4KK9C 3WNOA 43CAB 3S4SA 2Z4QB 3DRQB 3RWEA 1A5FL 3K1DA 4KHXL 1KJ2L 4JM2A 1ETZA 3AMLA 1HYRC 2HT2D 4QXGH 4LIQH 3MNZA 5JHLL 3K4AA 1EFQA 1S3KH 4HPYH 3G6JB 1R3HA 5IMLB 3H0TA 2EYSA 1FZKB 2AJ3A 2CLRB 3QUXD 3CZFB 5I66B 3X14A 1B3JA 1MCPL 1MFAL 4HBCL 3UTSD 1QSFD 3S88L 3EOAA 2XNAB 3LRHA 4XBPA 2EDJA 4P57B 4HUXA 4YR6B 3RA7H 4HCRA 2E27H 3ARGD 4L4TE 5D70L 2VITA 5IHBA 3Q6FA 3M07A 2F54A 3B5TA 2DLIA 1FO0H 4MQXC 4UQ2A 4AIZA 4OLWL 3HFML 3RGVC 4EI5C 1RUPL 3RP1A 3H42H 4XP5H 2YD3A 4G80B 4BFGA 1MJ7H 3P4LA 5DJ6A 3U36A 4UUJB 1U8OA 4JB9L 2MCPH 4LASL 5GGRY 3SGDH 2V7NA 1F42A 4NO3B 5DJ0A 3M1BB 5IB3A 3WDIA 2DWDB 2AXFB 4WI2A 2E9WA 5MERB 3I75A 2ATPB 3AVEA 2UVFA 1AC6A 3B2UD 4NNPH 4OZFH 1J12A 3EZJB 1JGDA 3SE4A 1YEJL 3WE6A 1NUNB 3THML 1HXMB 3AU1B 1MCLA 4M7KL 2VDLH 3O8XC 5GS1A 1QSED 1FFOB 1KOAA 1PG7X 1KCUL 1FJ1B 1QZ1A 1FIEA 2VLLA 4UT6H 4BFBD 2HT4D 2CRIA 1MCRA 5HYJA 5I75B 2YN5A 1IZJA 5BJTB 5BRZD 3X3GH 2LVCA 3IS1X 3HZKB 1HQRB 2IG2L 1JF5A 3BEVB 2KH2B 1GAFH 2ZJSH 4QHMB 3FT2A 5DJZB 3QH3B 4IS6B 1BEYH 1CK0L 1CL7L 3PV6B 3WD5H 1IGCH 4WW2C 4KTEL 3BAEH 4WHDA 1HIML 5F1IB 1UEMA 5D2LE 4Z78A 5I8OH 2GJ6A 5AD0B 2QADD 4UDTA 1T83A 4RFNC 3P4OA 1KJVA 1H5BC 4YUEL 3BKCH 4F9LC 4OGXH 4PP2A 1A4KA 3QCVH 5CJOL 2NY7L 4ODUB 5HI4D 3RNKB 4NGHH 4UV4L 4PJHA 1AI1H 4U6XA 1KJ3H 2AK1H 2JJTA 2YD1A 5ELIA 1JFQH 3KPSA 1T1YA 4EBQH 3MNVB 4NQCD 1CWVA 2IMMA 2WZPD 1NSNL 1KJMB 2WANA 2WM0A 2NW2A 5D8JL 3MYJB 1H15A 5EU5A 3TO4D 3C5ZB 3AUVA 1LDPH 2EXYC 4JCLA 3ZTNH 1QD0A 2A1WL 2EDLA 5MENE 4LEXH 5CLWA 3RVWD 5FKPA 5DMKB 2B1AH 4JO4L 5F1SA 3TWCL 5GXBB 3IS0X 3HHRB 1BREA 4OZIB 5DQ9A 3UBXG 3QG7H 4Z6AT 1HSBA 3JTTB 3FHQA 1NCBH 2XA8H 3U2SA 4W4OC 1T6VN 2BVQA 5L6YH 3VWKD 1A2YA 1I7UB 3CCHB 1F4XH 1DN2A 4EJ1C 4KZDH 1A1MA 3LRSA 2VXQL 3QUZD 1MAJA 2ADGA 3N1FC 3UTPD 3SKJL 5DJXB 5T3XD 4YO0B 3V0WL 1KYOK 2HFFB 4P4KB 1CFTB 1YJDL 3BD5A 1NFDA 4XNMA 4OGYH 2JLLA 1VHPA 2F19H 3AGVA 1N7ML 1NAMA 2BC4A 3GJFH 4OCWH 3JWDC 3KS0J 4ETQA 4XP1L 4E0RB 1WITA 4U1HA 5EORL 3KPQA 1PQZB 3C6LD 3CLEL 5A16B 3QO1B 1OAUH 4WWKD 3FO0H 3X13B 1KPRA 3S9DB 1R5WA 4LEOB 3BGAA 1ZLWK 2YXMA 5F9AC 3ZKXC 1ZOXA 4D3CH 2XQYK 5LAXA 2X1PA 4UOJA 5JDSB 4UQ3A 5T3ZE 2X4OB 5FM5M 4MD4A 4AEIL 4G43B 3ILPB 4NM8H 3WN5C 1HK6A 3MUHL 1CZ8H 2J2ZA 3D39D 4GAGL 5E2WL 1F4WH 1RHHA 3GMLB 1PZ5B 1Y6KR 2BNRB 5TQ2L 4KMLB 5JW3L 1EH9A 3OKEB 4KKAD 1FAKT 4NWTH 1H3XA 4DVRL 1EFXB 1WAAF 4XNZB 5C0BE 1P2CB 3BGFB 1I1FB 1D5ZA 4LLDA 2Q7YA 3O11B 1OGAB 3LZFH 2EDBA 1QNZH 5I1AA 3KWWA 3N85L 5D7LE 3BKML 5IK3B 4RBPH 1VPOL 5IOPB 25C8L 3MV8B 5EUKB 5C09A 3QULB 2GJZB 1PG7W 1MLCA 5I1JL 2OXHA 3AAZB 3BIAX 4LVHC 5L8LB 4H8WH 3WFZA 3LH2L 1NC4B 5HYIA 4ODWA 3DO7A 1J0ZA 1FRGL 3EJZD 5K33A 2X2YA 3DX7A 5E8NB 4GS7C 2OMBA 1KJ2A 4L4VB 1WUNT 1CDHA 4PJ9C 2Y1VA 1ZKAA 1YEDA 3D18A 1UZ6E 1U6AH 2EC9U 1FGNL 5FUZH 2UV3A 1HOCA 3CXDH 4R26H 2HG5B 4JHWH 4JM4H 3U7YL 4NFDA 3U9PH 5JXED 3KPNB 5LVEA 3TBTB 4JFPA 3BGMA 4JFEB 4L3AA 3SOBL 1I75A 2XI9A 5D7JD 3S4SG 2G60L 1A4JB 5ENWB 5EO1A 4XZUB 1KELH 1JPTH 1WBZA 4NQSA 5DI8B 3MLSL 3RUGA 5E8DH 4MQ7A 3S7GA 5FYJE 1X5IA 5HI3D 3NFPB 1UA6L 2PTTA 3KXFD 5EU7C 3FKUS 3HTLX 3FHAA 1OT1A 3ZE1E 3IGAB 4CGTA 4JQVA 3EO0B 3O3EB 1AD0B 1QTYT 4EN3C 1SYSA 2Z93A 3PGCA 3I02B 2MSPA 1IARB 2XN9D 2UUDH 1N8ZB 1QHOA 4NQXB 2J6EH 2QQLH 4Y5XA 3ARWA 3TPKA 2YPLA 4CMHC 4OI9A 5DEFB 2HTLC 2P8PB 1QR4A 1ROWA 1CQYA 1FG9C 4PJBE 4OTXL 1EXUB 5IB2A 3FO1B 3FB6B 3OXRA 5EZOH 3C5JA 1BVZA 4JDVB 3VXPA 5BV7B 3QEGL 5CIPH 3D6GA 3I50H 3N50A 2VAJA 1X5KA 2YUVA 1U95A 2CDGA 4JKPL 4LMQI 1NGQH 4ZUTB 3TNMB 4Q58C 3WNMA 5DJ8A 5IROC 4FFWC 3S3JA 5BQ7A 3SDXB 4K7FB 2WBJB 5DQDH 4M9OA 3K4ZA 1MCNA 5I1GL 5EC2B 4P2OB 5I1DA 2EZ0D 4N0CC 5DFTA 4DUVA 1G7JB 4I3SH 4BQ9A 5IV2A 5ID1A 5I30H 1S7VA 4OD2B 3BPOC 3C5SA 3QXUA 2NYYD 3MA7A 4OAWA 3BKJL 3IKCA 5EUOA 4WY7H 3T1FA 4Z95H 5J57B 4PJDA 3QIWB 5EH1A 3KGRA 5H2BB 5J7CC 4OZGB 4OLYL 5MI0C 4ZS6C 2P5WE 2MCG1 3VFMA 4MCYA 1RIUL 3DSFL 4PJFA 1IGJA 2ADFH 2OL3H 2EIEA 1BQLL 1DVFC 3BMWA 2X4PA 2DM4A 2V2TA 5TF0A 5J11B 35C8L 2IMNA 3WEXA 1XT5A 2LVEA 3W11C 1LD9B 3ARVA 1NBVL 2BY2A 5HGAA 2IPTL 1BVKB 1RZKC 1IBGL 5T3XH 3MJGX 5H94A 3LKQB 5D9SA 2GQHA 1DBKH 3WLWD 4PGBA 1DUZA 4H26B 4XNUL 3WSQH 1U8HA 2EH8L 2NX5E 4LOUD 4K8RH 4ZXBB 1AR1C 2WNGA 3GMMA 4YHMH 4AM0B 1JYXA 4LARL 4MJIE 4LLMA 2HH0H 1S7QA 2FBJH 1KNOA 1NMCB 3CVHB 4GKNA 1SJVA 4ZSOA 5LWYH 3HI6H 4X80H 5IBUB 3L3GA 1M05B 5ISZD 2IC2A 1QBLL 1DUYA 5JO5B 1WEJL 3VFWB 4R2GC 4UIMA 1TJHL 3UPRB 5IMOB 2DBLL 5BO1L 2Z91A 4NN5B 2IPUK 2G5BB 3BEWA 1BM3H 3MJ6A 2E7MA 3QUXB 5MHSD 3D25A 4DVBB 2YWZA 3AM8C 1I8MA 3F58H 1FVDA 3VWJA 3FFDB 3VI4E 2P5EA 5T33L 4FXGB 4POUB 4ONGL 3BZFA 1DQQA 4D9LL 3L5XH 3HKFA 3VFOA 4H1LB 4A6YB 2DTML 4JG1H 4PTTB 3EOBB 3NPSB 3TIEA 1X5GA 3H3KA 2Z31C 3V52H 4OUUB 5T1DH 1KTDA 3H7BA 3B5HA 1KCVL 5JQHC 4JO3L 4OFKA 4I3GA 5IB4B 3SPVB 4Z77B 4M93C 3IDUA 1RPQA 2OYPA 7FABL 3CPLB 1HHIA 2HT3C 1UJ3C 1KIRA 1OT2A 2KZWA 3JWDL 3GSRB 4DZBB 4N8PA 3KYNA 3C6SA 1KT2A 1NMBH 2MKLC 4YH6A 1ITCA 1HHKB 4XWGL 4QRQB 2C1OA 3G6DL 12E8H 1MHHA 2ICWI 5E8OB 3OTTA 4NUGH 5T1LD 4QOKA 4QTIH 3K8KA 3KJ6H 3MUGA 3VI3E 3PWVB 1VFUA 2IAMA 4HPOL 1MCWW 3TCXA 3MLRL 2WIIA 4KJPC 4TNVK 3ARUA 4G8GD 4JANB 4UTAL 3MBED 2DMBA 3BZEA 3HLAB 5CMAB 1CU4H 3HPJB 2EH7H 1A1NA 1U93A 4EIZC 5HHNB 2W07A 4IMKC 4C58B 3OQ3B 3VFSA 5KS9A 1J05A 1WZKA 1JYNA 3P2TA 5TF1H 5DJAB 3OZ9L 2BSSA 5DLML 3S37X 4ZUWA 4G7YH 1MIML 1RAMA 3U7AA 4PJXF 2DIJA 1U8NB 3MRCB 3UTTD 5HBBA 2UWEF 1F90H 3NA9H 5D1XD 4L3EE 1CN4A 4OLZL 5F1NA 1UB6A 5C07D 5GJSL 5E0QA 1JGEB 5K9KA 3CZJA 3VFVA 3C2AH 4JDZB 4RMWA 5HDOA 3STLB 1FDLH 4KKBC 1AQDA 1DBMH 1RK0B 4AIXA 4X6FA 1RVFL 1AE6L 4L29B 1FNSL 4HV8B 4Z7UB 3TBVA 5EFIB 2ED7A 2X4RA 4X9HA 2ZUWA 3T77A 4IHOB 4DN3L 5IW6A 2IGFH 3MMEA 4UB0H 4AT6A 5ACZA 1JPFA 1S9YB 2MJWA 5CZVL 1DQLL 1G9NC 4YE4H 5GJTL 3T1WA 2HFEB 4O2EB 4S2SA 3TJHD 3QEQE 4LLQB 3U46B 2APBA 1G7LA 4JQIH 1CR9H 4WDIB 4MS8D 1IGIL 4MQSB 4YXKL 1H3UA 4V1DE 1HCFX 5B38A 4LCCA 4PJGA 3O45A 3OKNA 4PRPA 4Z5RA 3T0AA 3BP7A 1HN1A 3L3IA 5FF6A 4XCNA 4P9HH 1Z3GH 2R29L 5GGTA 5KAQG 1OD9A 5ICYA 1A47A 3RWGB 1AC0A 2JKXA 4X7TA 1QVOA 4ZPTB 5GGVL 1IQDA 3OKMA 2AJVH 1CGVA 2BNQE 3AREA 1FV1A 4HMDA 4F15C 4PV9A 5IHUL 4X6BB 1UB5A 3GKWH 1CVRA 5I6XC 4FFYH 5KVFH 1F97A 2ZSWA 1AGDA 4LGRB 4OJFH 2JB5H 2DQGL 1YMHB 3NGBB 4YX2L 1INDH 4O51A 4XP6H 1OAKL 2V2WA 1MY7A 2PN5A 3ARDA 2Y72A 1C5CL 2RIKA 1QPXA 4G8EB 2W9DL 5BVPH 3TZVC 4JN1H 5JTWA 3HE6D 2AERT 4Q9QH 4HW6A 4M1DL 2VNCA 2ICCA 3BPCB 4QHLA 4FFVD 5DMIH 1IEAB 2QJDA 2A6IA 1A1OB 1F6AA 5F96H 4YHLL 4JFDB 1RJYA 5AZEL 3T0WA 1WCBA 5FCSH 4U33A 4Y4KD 1XH3A 3G04B 5DVNA 2HYMA 2YD2A 2XICA 3C6LB 3ROOB 1HHGA 5D1ZC 4WWKB 5B4MD 5I1EL 5C2BH 4U0RC 4KRPB 4WFFE 5T3ZL 5CP3A 3IT8D 3SO5A 2QR0A 3V0VB 3VMOA 2Q8BH 4I9WE 4LVEA 4Z7QF 4F33B 1MRDH 3HAEB 1I8IA 4LPCA 4MJ4A 3T8XB 3X11B 1ZGLA 4RMQA 3VD5A 3S96A 1TQCC 4LNVA 4Y2DC 4KK8D 5I71B 1EAJA 4YHOH 5EIVA 4NKMB 4EQ3A 4HJJH 1R6VA 4GUPB 1K2DA 4MB3A 4Q6IC 4BSVB 4HWUA 4P3DB 5JHDE 3AC0A 1CD1A 4PJIB 4S1SH 3BIBX 1S7TA 4AEHH 4CNIA 2APFA 1KTKE 1UC6A 1UM5H 5HGDA 3MRJA 1OWRM 2BFVL 4NN6C 4PJCE 4DKEL 4PRHD 2EDEA 2ESVE 3WIIL 2GT9A 3ARBB 2CRYA 4N1CA 5FYLE 2CKBH 2HFTA 2XZZA 2X4TB 1MIEL 5DD1L 2OR8A 1RZKL 5KW9L 4OCXL 3EJYC 1SEBB 4GKZA 4I48A 2NLJA 3RZCB 3T0ED 4JY6A 4AENB 2QSVA 1A14H 1REIA 5IW1B 5DMGD 4PJEF 3IAQA 4EKXA 3TA3D 1JZ8A 3MOBH 3ET9F 4Y16C 4UV7H 5FUOH 2OS7A 3D0VB 5TPWL 1K8DB 5L2JB 1UH2A 5DZNA 3V4PH 1KCSL 2R8SL 3AS0A 4JRXD 5MEOB 3VXQB 5TFSH 4QNPE 5KSAA 5J1AA 3SKOB 1IVLA 1S7XB 2I9LA 4AK1A 1MCOH 15C8H 4HKJA 4NKDB 1QG3A 4P3CL 5CINL 3SGEH 5BCAA 3TFKD 3IDYC 1RUKL 3R1GL 4CMMA 5FGCE 4GRLC 1DTUA 3BO8B 2BDNL 2MHAA 1MCBA 3QDHA 4NWUH 3TV3L 1VEOA 2R0ZL 4OT1H 3ULUD 1XIWA 3NH7H 4MA1C 2AI0L 4P9ML 3WIHA 3QIBB 5HXMA 3FZUD 2V5RA 1EMTL 4D0CA 3GJFK 3RVXD 4OZ4B 5EOCJ 1G6RH 2FD6L 1CFNB 5IQ9B 4OD3H 3KXFB 4OCRH 4C59B 3W5MA 3F7RA 1IL1A 1IGTB 1H3PH 2PKDA 5IVXB 4HXBL 2IAND 4HHAA 5F3HA 2X4UA 5EU6D 1CDUA 1PKOA 3WMSA 4NQTA 4FQXB 3RY5A 2A0LD 4YHZH 1BLNA 3MJ8A 4NO0A 1NLDL 3S36L 3QUMH 2UZIH 4OF3A 5FHAL 2NR6D 2HTKD 4N1EA 4OSUH 2V17H 2VAAA 2V5SA 1HEZA 3KYOB 1T3FB 4RMVA 3D5OF 4YHPA 2K1MA 3DRTA 2NCMA 2E6QA 3HR5A 5GGUB 5EU4A 3ME0A 2JCCB 1AJ7L 2R2EA 4TPRH 1S78C 3U1SH 1G0XA 2VDKL 4FQQA 3IRPX 4QWWC 1EAPA 5FEBA 3N9GL 1ZK9A 1FP5A 3S8WA 1RUAH 2GY7B 5D2LA 4ENEC 4D8PA 2DQFA 1XF1A 1I85A 2D31B 5FKAA 5I1CL 3DUUA 2D7QA 5LQBH 1Q94B 1IEHA 2P49B 1Q72L 1ZA3A 4ONHA 4WV1C 2OSLA 1FNEB 5LXGL 1H0DB 3TCLB 1T21A 4NZDA 2AP2A 3G5XB 4KDVA 3RKPA 1DBAL 4DGVH 1DFBH 3PIQB 4YXHH 2GSGA 2I5YL 4WFED 1S9XA 1WLHA 5C0GB 1HHJB 3HE7D 4E41E 1ZTXH 2YD8A 4RAUA 3GIVB 4Z0BH 4M7JH 1B2WH 1JUFA 1TPXC 2EDYA 5LGJA 3B9KB 1UFUA 3MNWA 1EX0A 5IBLC 3QDGE 1MFEH 5L8JB 4NQDD 4HCRH 1IAOB 5E6ZA 5MENA 2ID5A 4G6AC 4YXLL 3JWOC 3LIZL 4MSWB 4UT7L 3KPRE 4XNXL 3AB0C 2CGRH 4RGNC 1MAML 1YNTB 4LSPL 4M6ML 3MCKA 5FIEA 1ULVA 5DEZA 5KSBE 4FQIH 1A6TB 3UC0H 1L4IA 5D1QB 1JNHA 3RJDA 3MV9D 2RCSL 4DN4L 3BFOA 3H9SB 1RZJL 1DQTA 1G9NL 3TN0D 5D2NC 3RVTD 1CDYA 2XRAL 4OZHF 4Y4HD 1T7XA 2HKHH 1PX3A 3UTOA 3GSUB 4GRMA 1VACB 5DD3L 3BPNC 2LV4A 1NMAH 3AS2A 5FFLA 4D9QD 1FAIL 2HJFB 1INEL 4HIIB 2XPGA 2X89A 3EO1B 3OR7A 4HIEA 1RSFA 3OL2A 1E6OL 5DWUH 1FFNA 5FYKE 1NCDL 3EGSA 1Z2KA 4YHKH 5D5MA 4MNGE 5FCUH 3E2HC 5I2IA 2H8PB 5L0QB 2R1XA 2JB6B 1YUHB 4APQA 2DQEL 1Q9KB 5A2FA 1JRHL 5DJYA 1NDMA 5BMFL 2O61A 3DX6B 3CC5A 1EEYA 3EAKA 1J0IA 4P5KB 4HFWA 1A9EB 3V5KB 3HUJE 4WUUE 1Q9OA 3CH8A 4S1QL 5FDYA 3C2SA 3WS3B 2P48B 4LP4A 3FB5A 2BHYA 1T1ZA 5JW4N 5IROA 1K5NB 1CGWA 5K9QG 4TULH 1IKFH 4F7MB 1SY6A 3CD4A 4KK6C 3UYRH 1XCTB 3QZWG 2VISB 1PGRB 1TETH 3UP1A 3NFNA 1KLGB 1R3LA 4S1DD 2C1PB 3MRGA 3GMOB 4HJ0C 1KG0A 2QKIA 1KN2H 3HG1B 5C0IB 2H2PC 2CO6B 2ITDA 1CTOA 3B9VA 4KH2A 4H88L 3QDJD 5D93C 3DROB 3CXHK 5IGXH 3IDJB 4X5XA 5C0BA 3ZE0E 3JV6B 5IT2L 3E6HB 4K3EL 5ICZA 1BFOA 2NZ9D 1R5IA 4R3SA 4ZFOB 5D7LA 4YFDB 2LTQB 3MBEB 4C83B 4X7DC 1FZMA 3VFNA 3I2CL 4R4BB 2UZYB 4L1DA 3DMMA 3ULUH 4YQXL 3MZGB 3PL6D 4YC2C 3PWPE 1Q8MA 2AK4D 3FJTA 4NQED 3KPMA 4LCWE 1OSPH 2VWEC 2CLVA 5F8QC 1OP3H 4CKVX 1D6VH 3MLZL 5LKNA 4KJQD 4YPJA 3SY0A 3FCTA 1B0RB 3MRNB 1MI5B 4XXCA 5KVEL 5D1XB 4YPGB 3FT4B 5C07B 1QEWA 1GH7A 3P73B 5ESAA 3VGGA 4LQFH 3W0WD 4HULB 3SDCB 3PQYB 3Q1SL 3RTQC 2XTLA 1FFPA 4I0PB 1UWGH 4ZUUA 1KCLA 3U30B 2R0KH 2BVOB 4NNYA 1NL0H 2LAGB 4M03A 5GRYA 1WBXB 2FEDD 2J8UE 1KB5B 4WHTA 3BDXA 4KQ3H 3L95B 1B88A 1OAQL 1FYTD 3VXRB 1FVEB 3CFEB 5EULV 1N5AB 4NRYA 3O6FD 4ORGB 3U6RB 4I4WA 5F89B 1NAMH 3FT3A 3NCJH 4P5TB 3WHE0 3ULUF 4P4RB 2MOVA 4PRID 4XCFH 1T4KB 1F13A 2DLFL 4KY1L 1OF2A 2H9GA 5I74C 1R5VB 4M62H 4ZO8A 3T3MF 4HWZA 5EA0L 1HH9A 1J8KA 3RDTD 1KIPB 2DLEA 2XKNB 5EU3A 1IQWH 2Q86B 3OMZA 4IDJL 4IOFD 4I77L 2RFXA 3QI9C 1OTUD 5T1KA 5KVGH 2PXYD 4YIQA 5DD0H 4Z0XB 5H35A 2VR4A 1FNLA 4XX1E 5CZXC 4MB5A 3T04D 5CP7A 1QRND 1AIFB 4XI5C 1OSZA 4M43L 3L3DA 3QUYD 1V8HA 4BQ8A 4ZYKB 1XGUA 2CDFB 1U8KA 5ESQB 3DVGA 5ETUA 2JIXA 4UOW0 4NP4H 4GG8B 2IBBA 2EIBA 4ZAKC 4GXVH 5FHBH 4Y5VC 1DANU 2BHUA 2F9BT 1NLBL 5ITBL 4LSTH 4XMLL 3QDME 4Y5YB 3HE6B 1RZFH 5F9JA 1M7IB 3T4AA 1FVCA 1GHFH 1NFDF 5CCKL 4Z76A 5E8EB 4JN2B 1J1OH 1Q9LA 4XT1C 1G0YR 2HLFC 4FZEL 4MNQE 4LNRA 5LGHH 3GRWL 3GGWA 1MCFA 2F53E 1JPGA 2YK1L 1A5FH 3V4UH 4L5FL 4DW2L 4KHXH 1HSAB 1KJ2H 1SM3L 1UQSA 5E1HB 1RK1A 4OCSL 3WKML 1PJ9A 4OCMC 1UWEL 5IB1B 2JE8A 3WDHA 1TZIA 1U8JA 1MCPH 1MFAH 2UYLA 1WZLA 4G42A 3S88H 4HXAL 3E0GA 4X4XB 1AH1A 2VJXA 5C0AA 4NHCL 4JZOB 4LRNL 4DGYL 3MBXL 3TBWB 5D70H 1ND0A 2GTZB 1KB9J 4M4PA 2XY2A 3FFCA 1YEIL 4U1NA 4PTUA 4QRPD 5EBLB 4XCCL 2NX5A 5B8CA 4OLWH 3HFMH 3IKKA 4KDTC 2BSRB 1CDIA 1RUPH 5D7KE 5AWNL 5EG6C 4RMUA 4MJIA 2HAZA 2CXGA 4ONOA 5K9QI 1X4XA 3JWOL 1B0GA 4JHAL 4MA7L 4Y19E 4QHUA 3K8MA 2DL2A 1NBYB 1LQSR 4WENB 5EZJA 3V95A 4KK9D 4JB9H 4LASH 3T0EB 1CG9A 1RZ7L 3BRGC 2C9AA 3DV6A 3K2MC 2VLKE 2PYED 4YK4B 2VKWA 4LRIC 4IRJA 4KROB 3TA3B 1V3MA 1YEJH 5I75C 3RWIA 3THMH 4CVZA 3AMKA 4HEPG 3K74B 4M7KH 4PREB 4PUBL 4JRXB 2OMNA 1QA9A 2BJML 3AS1A 3NIFF 2Z0BA 3H9YA 1KCUH 4G9FE 2R1WB 4ERSL 1LO5A 1ZLVK 3STZA 4N0UA 4CAGA 2EYRA 4F3FA 1AGEA 3HMWL 3NACH 5KAQF 1ZHNB 3G9VA 1TJGL 4YWGH 5CS7A 2VZ3A 2IG2H 1G9MC 4MQXD 2I60L 3RBGA 3GSWA 2Q3AA 3QDMB 3RGVD 1CL7H 1CK0H 4EI5D 3QA3A 1II4E 4GKSA 4KTEH 1ZT7B 1HIMH 2BZDA 1EIBA 3DUHA 3DTXA 4ZFZB 2DM7A 2IANB 2A83B 3U9UA 1AGCB 3HC3L 3LS4L 5CJOH 2NY7H 4WUKL 1RJZB 2E7BA 4LU5L 3U82B 3C5ZC 4UV4H 1L9MA 1JV5A 2IH1B 5ESVB 5DVMA 1IJ9A 2DQCL 4ACPA 3A0OA 4K3DL 3QQ3B 4CVXB 2WP3T 1QBAA 5IFAL 1C7SA 1A22B 1NSNH 2QQKH 3O8XD 2VC2H 4KKLC 4RAVB 5D8JH 4BSWA 3P9MB 1NBZA 3MV7B 2ARJB 4M6OL 2W60B 1P4LB 4BH8B 4H20L 4U1SB 1GC1C 1I9JL 2A1WH 2P1YA 3OHXB 2ATKA 4TTGA 4JO4H 2Q3ZA 2XWTA 2FR4A 3TWCH 5CKAA 4R4FL 1I3GL 4ZO7A 1KFAL 2P46B 5DUML 3V6FA 3QFDA 2K7PA 4L3EA 5E2JA 3DETC 4K3GA 1W0WA 2FGWH 3O6ML 1HDMB 3GBMH 1CLYL 5TGBA 1R24A 3VA2C 5IF0B 4OI8A 1C5DB 4P4KC 2FHCA 3Q6GL 2VXQH 3B4NA 2GFBA 3SKJH 1FORL 1TCRB 2D03L 4NC2B 1JVKA 3V0WH 4I18B 1YJDH 4QHKJ 1BD2D 1Z5LA 5I17B 3QEQA 4NQDB 4JHBA 1DZBA 4ZPVA 5A43C 1J86A 2EXYD 3EFFB 1N7MH 4V1DA 2CDEA 5IB5A 5SWQA 4Q0XL 4OFIA 4IM8A 3CSYB 1EGJL 3LEYL 1Y18A 2BVEA 4XP1H 3NCYS 4CN4A 4Y4FD 4K94C 5L7XL 1XFPA 3VXME 5IMMB 3IYLW 1ACZA 5I1KL 3DVNA 2BMKA 5ICXA 1TVDA 1U58A 4NJ9L 1N6VA 2BNQA 3FB7B 4Y4HB 4EUPG 4KJWD 1MVUA 1BMGA 4AEIH 2KL6A 5ERWA 1UVQA 5B22A 5I8EA 4GAGH 4XNZC 5E2WH 3BGFC 1A6VL 2AV1A 3AY4A 5IFJB 4CADB 2VXUL 1Q1JL 3QG6A 5JW3H 5TQ2H 1G7MA 3JV4B 2FX7L 3OR6B 4KAQL 4DVRH 5JMOC 5E56A 1U2HA 3RWDA 5I1HL 1IC4L 1BWWA 3IF1A 1OD7A 2ZPKL 1FNFA 4FXKA 3N85H 4QXTB 1WZMA 5GZNC 3BKMH 3OX8B 1KC5L 1VPOH 25C8H 2X41A 5I1JH 1G1YA 3GRWA 4PG9B 3LH2H 1HH6B 4NPYA 1EUTA 1FRGH 2AVGA 2G9HA 3P4MA 4K9EH 2X9YA 3GB7B 4LHUB 4R97B 3ZKMC 3ZDZF 2NY4D 1NAKL 3KPPB 4A2LA 1EZVY 4MZ2A 2WIMA 4LGSB 4E42A 1FGNH 3EYQC 1AP2A 5AG8A 4P46A 1G7HA 4XVTL 1GZPA 4U49A 1TCMA 5FXCH 3U7YH 3VFGH 2WINB 4HX1A 4JHZA 3V6ZA 1LE9A 3I6GB 3LPWA 5CILL 3UTSE 3M8OL 1QSFE 2EKSA 1VADB 1JWUB 4PJCA 3TC9A 2G60H 2V9TA 3GUTA 1CFVL 1EO8L 4XBEL 1IM9D 2PO6D 3FOLB 4QXUL 1A0QL 4KC3B 1AXSB 1C12B 3MLSH 5CEZL 1NANH 3FN3A 5HY9B 5KN5B 3VXUB 1RQ5A 1UA6H 3DYPA 5DHVH 3CFDA 3VG0L 2F58L 2VLRD 4UTBL 4NBXB 2Z8RA 3UPAA 4TUKL 4LVNB 1YN7A 3PL6B 5KS9F 1LEIA 1T22B 3SGJC 2A73B 2F74B 2Y23A 3S3PA 3TH2T 4Z7OF 5CBEA 3H8NA 4YDKL 3MLWL 1J1PL 2WBWB 3KHQA 2CIKB 4YGVB 5BZDB 3AS3A 5BV7C 4AH2B 5SX5K 3C09B 2H45A 4LLUB 4PJ9D 5D2NA 3V5HA 2IH3A 2B20A 3WFHA 1P7QD 4GAYA 2VDML 3DXAD 1QRKA 4OTXH 4F7PA 5JQ6H 3MXVL 3S3SA 3L7EB 3QJHB 2DWEB 2Y4SA 3A6CL 5J56B 1MFNA 3T08A 3WBDA 4RQQB 4CJ1A 3OWEA 4KK5C 3HZMB 4P2OC 4ZS7L 4JKPH 3GMQA 5E9DB 5DQJA 3RL1A 3VCLB 4RNRA 3SDDD 1D5BA 1SMOA 4CU6A 2E9JA 3CDYA 1TNNA 2P45B 5FB8A 2VZSA 1S7WA 4WWID 5CHNB 3AXLB 1FFRA 2A6DB 2AQ2A 5BRZE 5K9OA 1FYHB 2IQAA 3IDNA 1SEQL 2H26B 1MCKA 1T7YA 3Q3GA 3GJFB 1LEKB 5BXFA 1A9BA 2YRZA 3QIWC 3V5DB 3ZKQD 2AJZB 3UMTA 1G9ML 3T2NL 1A02N 2J88L 2VL5B 3RDTB 1U3HA 3BKJH 3LKOB 1H8SA 1M7DB 5CP3H 2VLJB 1TDQA 4MVBC 4JJ5A 5J11C 4QF1B 2W65B 1K4CA 1VFOA 4X6CB 2C3WA 4OLYH 2PXYB 3G6AB 2H1PL 3QNYB 4LKCB 1RIUH 2XKSA 4OFDA 4QYOA 3SCMB 2DRUA 1YPZB 3QUYB 4TSCL 3WS6A 3FQWB 5A2IH 3LMJL 4QT5A 35C8H 1T2JA 2X4QB 4NQCE 5INDB 1X4ZA 4KRMB 4PG2C 4ZXBC 5E2TL 5ID0A 1IKNA 1NBVH 2IPTH 1UJTA 1NMCC 5DMYA 4JFFB 3TVMD 3IJYB 4KGJA 4XNUH 1OW0C 2EH8H 2BY3A 1EERB 3IAGC 3KYAA 1UG9A 4DEPB 4YHYB 1DQMH 5DK2A 4CRPA 3PWNB 1N0XL 4UU9A 2HT2C 3E8UH 1IEBA 3O9WA 4IBLT 4LARH 1GC1L 4N0CD 3RU8L 2XTJD 4OFVA 3S37L 5C6PB 1CXKA 4H0HB 4NN5C 4CW1B 1QBML 3SJVD 1Z9SA 1NUGA 3LN4B 1PW3A 2C4FT 3QUXC 2CLZB 3TO2A 3TNNA 1MWAL 2I27N 1QBLH 5DUBA 4J3WA 1ZANL 5J6GB 1JL8A 2ZSVB 1I8KB 2DM3A 1IGFL 5IR1A 5I76B 4UDUB 2DBLH 3W9DA 1CIDA 4NQUA 3T4YA 5BO1H 3IXTB 1LGVA 5C0CB 4PLKD 3HMXL 3NPSC 4XCYB 2YZ1A 4BFIA 2L0DA 3BQUA 3QDGA 1KEML 1DN0B 4X5WA 4NKIH 3T65A 5T33H 4GG6B 3VE0B 3UTPE 1DVFD 4ONGH 4PGCB 4D9LH 3RTQA 4KKCC 4TNWF 2VDRL 5T3XE 5E4IA 5E5RB 4D0DB 3KPRA 2DTMH 2C3GA 3MLTB 3ULVC 2P7TB 1YN6B 1C1EL 4KI1A 1GL4B 3QIUA 3S6CA 4FNLL 4LSVL 4Q9CA 5KSBA 4QRPB 2HJKB 5DRWA 1KCVH 2ZG1A 1C5BL 4JO3H 2VDOL 3FRUA 4FTVE 3H3PL 2BY0A 4P2QA 5JZ7C 3PWLB 7FABH 5IJKA 3MRBA 1FE8L 3VGHA 3RNQB 1U8MA 3DECA 4DK3A 3VXNB 2YSSB 4PRNB 3JWDH 1BIHA 3UAJC 1OAZL 1LEGB 5C86A 3QYCA 4XRCB 3VXTB 4K94L 1LK2B 2A9NL 1UM4L 3FTGB 1UXSB 5CSZA 3OKDB 4XWGH 3ESUF 2EDQA 4LDLB 2JK5B 2PYEB 4R2GD 3H6JA 2UY6A 4KU1A 4I0KA 4RGOL 4MNGA 3HCVA 1MHEA 1IT9L 4BZ1L 1F4HA 2ERJB 3A6BL 3JVGC 3LQAC 4JPIA 4HPOH 4XBGA 1ZLSL 3MLRH 2FATL 1KCKA 2R15A 4JZJB 5FK9A 4UTAH 1S8DA 3MFFA 3HUJA 3F12A 4WUUA 3VRIA 5GRVL 4NO2A 4Y5VA 2Z31D 5JPNB 4WCYL 3BHBA 1FHGA 3OZ9H 2WWKT 1QFOA 5DLMH 2VXTL 2UWEE 2Z4QA 1MIMH 4Q6YA 4GRWB 2YUXA 1F3RB 4GH7B 2HT3D 3QAZB 3L3KB 2DJUA 4M3KB 3LHPL 3O4LE 5GJSH 1IAIL 3MGTB 1LVEA 2RQ8A 5CKGA 1J0JA 5J89A 5E7BA 4JZNB 2YRPA 4JPVL 3OJMB 5F88A 5E5UB 1PYWB 4P57A 5CBAB 3EYFB 2A6JA 1EEZB 4KMQA 1RVFH 1AE6H 2OL3B 1FNSH 2OR9L 3MRQA 3W39B 4DN3H 4KJPD 3GSOA 5FDWB 5CZVH 1DQLH 5GJTH 5B39A 2OTUB 5F7UA 2NXYB 3JTSA 5DS8B 1CI5A 1U8IA 5F8RC 2FSEA 1RIHH 43C9B 1IGIH 5EPMA 4LCWA 1T1XA 4I5BB 4H5SB 5JPMA 5D2LF 4UUJA 1NGWB 3WJLC 2FO4A 2R29H 1EHAA 3KHOA 4WW2B 3ZHKA 3IDIB 4U0QB 4WI9A 3FL7A 4YFEA 2EO1A 3L7FA 3MSPA 2YRLA 3NGBC 1I4FB 1PSKL 2EDWA 3EHBD 4PV8A 4LSRH 5GGVH 2XN9E 4ORZC 2M8XA 4OKVB 1AKJA 1ORQB 4YHNA 5IHUH 2HVJA 1I1YB 4HKBA 2CJUL 2EICA 2H32H 5DRZB 2DQGH 4YX2H 5BV7L 1KTRL 4QHKI 1OAKH 4F57L 4KKBD 1C5CH 1VA9A 4PGDA 4WU7A 2W9DH 4LHQB 5CJ5A 3ZYIA 4Z7NE 3ES6A 3SBWC 1P53A 1CQKA 2B0SL 1BD2B 1JMXA 1SJEA 4M1DH 4HWEL 3CSGA 2GUOB 3C6LC 4WWKC 2A74A 3P4NA 4KRPC 4U1MB 4YHLH 5BS0D 3LAFA 5I8CB 3LKSB 5AZEH 3TH3T 4MCZA 5D4QA 4OV5B 4Y4FB 2DN7A 1YMMB 4IEFB 5I71C 3TH4T 5I1EH 1U8QB 4Z7QE 1RIVL 5SWSB 4PJXB 2NXZB 4YBHA 2PCPA 5T3ZH 3VFRA 3MLPA 2IBZX 3IJSB 4ODUA 5A3ID 1WWCA 4XGZA 1WC7B 4ELMF 1T0MB 4XPHL 1O7SA 1RURL 1T04B 3D9AL 5F71A 3NCYP 4KKAC 3NIDF 2I9TA 3VJ6B 1YEGL 4PS4L 8FABB 3OB0K 2VZVA 4KKNA 3ARBC 2QBWA 1BBDL 3HPLA 4MNHB 4AG4L 4R4NC 5HPMB 4YEFA 2VQUA 5D5MF 3DV4A 3OKYA 4WTZA 1UWXK 3TZVD 2BFVH 3F7VA 4DKEH 4GBXD 4LL9A 3WIIH 1E27A 1F4AA 5HDLA 3RZCC 4W6WB 4UNVA 4JG0H 1DQDL 2P8LB 1MHCB 4MNQA 1VFAA 3WUWG 2D7NA 3EYOB 2F53A 1MIEH 5DD1H 3S97C 1W0YT 3CUPB 1G7IB 1LP9A 1RZKH 4OCXH 5KW9H 1X5YA 3IFOA 1I1AB 4MXQD 1FZJA 3CVHL 4P2RA 3JTTA 4LMQE 3RWCA 2B4CL 3NAAH 1T2QL 1QLFA 1MWAA 5D1ZD 1XGYL 1CCZA 1NCCL 4HZLB 1XAUA 4OCNC 2NY4B 3IU3A 5ISZE 3QFJD 4OIAA 2FEEL 1S7SB 2FX8L 1NCTA 5DD6A 1MCCA 3I3DA 3HMXA 4PJ5E 4QRRB 5TPWH 2R8SH 5I9QB 1KCSH 3VFPA 3MRFB 1BZQK 3L1OL 3QCUL 1EJOL 3QIBC 3QEUA 2ZUVA 3PDGA 4P3CH 5CINH 4P4KA 1CFTA 5MHSE 3R1GH 1RUKH 2NY5C 2BDNH 3TV3H 4GQPH 3JWNC 2R0ZH 4A6YL 2P8MB 3TPUB 1ZHLB 2CK0L 2KZ1B 4JFHD 3OKOB 4L8BB 3H9HB 1KGCD 4MB4A 4EUPH 2AI0H 2PO6B 2FB4L 3GM0A 4P9MH 1JYWA 3VA6A 1EMTH 4L9LA 4KWUA 3RJQB 4YAQB 4DCQA 4FQXC 4HS8L 1PQZA 4Y19A 4HUWA 2P47B 2FD6H 4M9PA 4X99A 1OL0A 3HA0A 1LDSA 4HD9A 1KIUA 5D7IB 4LEOA 2AW2A 1Z0MA 4N9GB 5C08B 4FHBD 4HXBH 1HKLL 4HS6A 1N6QL 4JRYB 5JDSA 1KIQA 3S34L 4N0FB 2X4OA 1AHWB 4IJ3B 2VLKA 3D3VD 5CEYB 4G43A 3EZ8A 3ILPA 2V2XA 2VZTA 1NLDH 2EDDA 3S36H 3MRPB 5FHAH 5CD3A 3V8CA 2WLZA 4LBEA 4LCUA 4Y16D 1YQVL 5HHOB 5J6HA 1JZ7A 1H3GA 1YA5A 1V5JA 4ODSL 1FO0A 1P2CA 1FCCA 5KBNC 1I1FA 5D72H 5B3JF 3DI3B 4N8VB 5C6TL 32C2A 4GRLD 1JNNL 4X6DF 3DLQR 1FZOB 4G8GE 2G2RB 5IK3A 3SDDB 4XWOC 3LQAL 2VDKH 3B43A 3HI1A 3DIFB 1WTLA 3K3QA 3N9GH 4JEGB 1OQXA 5I19L 2NYYC 4IMLB 1RULL 3OG6B 2HN7B 5E8NA 5I1CH 5HGGS 3UPCA 3QNXB 1UM6L 2R2BA 4OZFA 2I26N 4OFYA 1J8HB 3WO3B 1ZS8A 5KOMC 5LXGH 4B53A 1XGPB 3UTTE 4ALAL 3B9KC 2V9RA 3MC0A 4PJEB 4WU5B 1DBAH 1JNJA 3FOMA 3L9RA 1HQ4B 2I5YH 1W0VB 4JPKL 4F2MA 3TBTA 5JLZA 4M4RA 1IRAY 1QKZL 4JFZL 3JV5A 5EZLA 3WLWC 1OOAA 1UKQA 5ENWA 2W59A 5DDHA 1JTOA 2ILLA 5D1QC 3TT1L 2XOTA 3QEHB 3MRRB 4LOUC 4YXLH 2VE6A 1W2KT 3GNML 3LIZH 2GCYB 4LPTA 4XNXH 3ARFB 1AY1L 3VXSB 1MAMH 1S78D 3KLSA 3TVMB 4M6MH 3MLVL 4PY8J 4QWWD 3IGAA 4N1HB 3O3EA 4OZHE 4DN4H 2RCSH 4PR5B 1RZJH 4H25A 2FYYA 2XTJB 3FQRB 3X12A 2XRAH 5IIEA 1M6OB 4KUCD 1VGEH 5DD3H 2G5RA 4HUUB 4LK4A 5L0QC 3OKKA 1BZ7B 1FAIH 3A67L 1INEH 3FO1A 5TQ0L 5HYSA 2QQNL 3KYKL 1OY3B 4MMXC 1BOGB 4J6RL 3HS0B 1E6OH 1JZ5A 1HXYA 1ZHKB 2OJEB 3WLBB 1AGFA 1NCDH 2VO5A 3O3AA 2GK0B 1C7TA 1EPFA 4NQVA 3G5VA 5MEQB 3D2UA 2AXHA 2JELL 3DGGA 3KPLB 2DQEH 5IBLD 3TIDA 4PRBA 4ZFFB 5BMFH 3CMGA 4PRAB 2WBJA 3EDEA 1GZQA 1BQHA 3ZKSD 4NNXA 1A7NL 1F6FB 4IRSB 4S1QH 3VXMA 4RGND 2I25N 5F7LB 2D7MA 5DTFA 1KXTB 1NC2A 1G6RB 3D69A 3O3BA 4Y89A 2HJLB 5EN2A 2H2SC 2FNBA 2PW1B 3BZ4A 4ELKB 3WFCL 4HGWB 3QIWA 4HKZB 2NY0D 2DQJL 4ONFL 5HGBB 4G9DA 5DGQA 3SKUD 2YEZB 3QUMB 2BOBA 4F7CA 1KPUB 1R3JB 1A3LH 4H88H 4LLWA 4R2GB 3BUYA 2Y06L 3QWOB 2LTQC 3MREA 3MJ9L 3D0LB 2IPKA 4ZNEE 4J4PA 5IT2H 3HRZB 4TUOB 5TE7L 4K3EH 1S5IL 3WJJC 1K6QL 5HYJE 4TNWK 4NCC1 4O00A 2MQ3A 1L0XA 1MQ8A 4NC0B 4XX1G 5ADPL 4PRHE 1BWMA 4R9HA 4YQXH 4ZXBA 1RMFL 1G9EA 5H37G 5CD5D 1MSPA 4L8SB 5F6IB 4F7EA 2RAMA 1MFDL 3IDXL 2GI7A 5D1XC 2VXSL 1CLOL 1NDGA 1OW0A 1M05A 2ICWB 4Y1AE 3SDCC 3MLZH 4I1NB 2FJFA 4OIBA 4I0PC 4WI4A 3ISWA 4WTZG 1UJ3B 4EVNA 3U30C 3UPRA 5KVEH 3RWEB 5EC1B 3TM6A 3FO9B 1ETZB 2G5BA 4JM2B 4RWYL 4R7NA 1TTUA 2H2PD 2IFGA 3MNZB 1J10A 2YA2A 3Q1SH 3UTSA 3MFGB 1R3HB 1QSFA 3FFDA 4GMTL 1FNGA 2EYSB 4TOYL 4FXGA 4MXVF 4RCAA 2NY6B 3P3YA 2IQ9L 1U91B 4A6YA 2C3VA 4P5TC 3ARGA 1YEEL 3EOAB 4XBPB 5J4MA 1OAQH 4HUXB 4C56D 5HVWA 3ULUE 4PLJC 1T1WA 4FQLL 1D6EA 2NY5L 3Q6FB 1NGXA 5EZIL 2F54B 1BAFL 3T3ME 4WFGD 1CXIA 4UQ2B 4AIZB 2DLFH 4KY1H 2CUIA 2XA3A 4N0YL 5DRXA 4NZRL 5EA0H 3V79C 4BUHA 2NMSA 3P11L 3K46A 2P24A 5DHYA 2ZUTA 4IDJH 4I77H 5EU6E 3U36B 4QRQA 1U8OB 1DEEA 2V7NB 2N7AA 4P23A 1EJ6A 2R69L 2APVA 2AXJA 1KXQE 4M43H 4Y5YC 3HE6C 1QSEA 3UJTL 1JGDB 4FZ8L 4RX4A 1DL7L 1MY5A 2M1KA 4QOKD 4A2MA 3HLAA 4NKQB 5GS1B 1NLBH 3CIQA 5ITBH 4XMLH 4M1CC 3BKYH 4R7DA 5DUPL 5BRZA 2VLLB 3R0NA 5C70A 1E4XL 4LP5A 4Z7WE 2XWJA 2O5XL 1ZGLP 5CCKH 5B4MC 5DJAA 4NRZA 4M8VA 2W1NA 1B4JL 2C26A 2J6EA 4FZEH 3IFLL 3LN9A 3O6LL 1CFQA 3GRWH 4P2YA 3FT2B 3CFBA 1ZHBA 3RY4A 5GS0D 2YK1H 1BGXL 4KK8C 4L5FH 4DW2H 5FUCC 1SM3H 4Z78B 2GJ6B 1F2XK 4NOFA 4UDTB 4OCSH 4MJ2A 2D3VA 1UWEH 2NNAA 3CH1B 5CIPA 3QI9D 3P4OB 1KJVB 5E24E 1ZE3C 2WMPA 4PP2B 1NEZA 2DJ4A 1SYVA 1A4KB 4HH9A 5CZXD 4NQCA 4HXAH 4XI5D 5FV1L 4WFEE 2ZKHL 4PJHB 1KBGL 1YYLL 4U6XB 4Z7UA 4NHCH 4LRNH 1JI1A 4DGYH 3MBXH 4ZAKD 2FDBP 3KPSB 1T1YB 3QXTA 4J12A 4NZTL 1SBSL 3TO4A 1S9YA 4PJ7F 5IKCA 1YEIH 2PNDA 4ETYA 2NW2B 1JHLL 4XCCH 1H15B 1FPTL 4NCC2 3U46A 2NY1B 5AYUL 1OPGH 3G08A 4GBXB 2WUCL 4OLUL 5AWNH 1MLBA 3T0EC 4LFHD 2FWOA 3K0WA 4CN6A 3JWOH 1ITBB 3MRIA 3KPTA 4MA7H 2HLFD 5FKPB 4YK4C 3NCCB 4PRPD 2M26A 5HHME 4KROC 2EDXA 3MV9E 1X6NA 3UDWC 1RZ7H 3MCG1 3SKNA 2FL5A 1YNKL 5DQ9B 1UKSA 5DYOA 1HSBB 3VWKA 3BXNA 4O2FA 4QRUA 3TFKC 3KYMA 2DKSA 3QFJB 4IIQA 3L3OA 3U2SB 1VSCA 2DQIL 1CS6A 3QUZA 4KUCF 1A2YB 4PUBH 2ZCKL 2BJMH 1F4YL 1MAKA 2CRZA 3FRPG 1A1MB 5CEZD 2EO9A 5E1AA 4U3HA 4PGEA 4ERSH 2ADGB 2OZ4L 3PV7A 4DGIL 3FAXA 3HMWH 1TJGH 1A1OA 3V4VL 4B5EA 4NHUA 4FTVA 2DDQL 2I60H 2YBRA 1NFDB 4XNMB 3GMNA 1MNUL 4W68A 1NAMB 2BC4B 4WWKA 5DVKA 2NY2B 2WWMC 4ETQB 1MCWM 4U4BA 2NR6C 4U1HB 3B83A 4CUCA 5CSGA 2JJSA 1KPRB 4IOSD 3GBLA 3LS4H 3D39A 1WIPA 4WUKH 5L2KE 3TYFA 4GUPA 4LU5H 4UQ3B 4MD4B 4HG4K 3MJ9A 5I8KL 4F37K 4P3DA 2DQCH 4K3DH 4Z7VB 3QDJE 5IFAH 4K7PL 1RHHB 1QPPA 1QQDA 3BD4A 1KUMA 5C0EA 4M6OH 4ZFOL 4WIQA 4H20H 1AXTL 1I9JH 4O02H 3T2OA 1H3VA 1G7QA 2ZNXA 4XAWL 1D5ZB 4LLDB 2Q7YB 4OGZA 3CXHJ 2UWEA 1HYSC 5I1AB 3KWWB 2Y25A 5JW5A 4NO5A 1DE4A 4R4FH 3UJJL 5IEHA 1GGIL 5C09B 1KFAH 2AK4E 1MLCB 5DUMH 1MREL 4NQEE 4P0DA 1RZIA 1UT9A 3O4LA 5IW1A 5ACMA 2DMCA 4PJAF 4ODWB 3CLFL 3BW9A 5GGRB 3DX7B 5LBSL 3OGCA 3O6MH 2VDNL 3LS5L 1CLYH 3L5WA 3PGFL 4OM1L 1KJ2B 4OF8A 3BI9X 4G8IA 5L2JA 4I18C 3UCRA 2DMKA 4FMFA 1YEDB 3D18B 5JXEA 1A7OL 1J1XL 3Q6GH 2VZUA 3EDKA 3MO1A 3C5ZD 3W0WE 4RIRA 2M2DA 4ZO9A 1FORH 5E99L 2D03H 3TYGL 1PVHA 4L4TD 5B21A 1JE6A 1OCWL 4JFXB 5D7JA 1A7BA 1X5XA 5JIIA 4JFPB 3BGMB 1ERNA 2EIDA 2BNUA 5DURB 5JOEA 3CFIC 4Q0XH 5EO1B 1FYTE 1JF6A 4HUVA 1CFNA 3ZDYF 3RVTC 1WBZB 4NQSB 1EGJH 3LEYH 4Y4HC 4WW1A 3RUGB 4MQ7B 2DAVA 4XH2A 2H3NA 5L7XH 2PYFA 2PTTB 4K2UL 3MX0A 4PRIE 4NOBA 4FN0A 5I1KH 1KB9K 4NJ9H 2XN9A 4K3HA 5CFHA 2HLAA 3OV6A 4HWBL 1KEGL 1SYSB 3DETD 2Z93B 3PGCB 1CDBA 2PUQT 3T0BA 3BPLB 3ZO0A 3MCLL 4J8RA 3RQ3A 4Y5XB 5FO8A 2YPLB 3RI5K 1ZGLM 1JTPA 1A6VH 4WEBL 5FYKH 4JFQA 2VXUH 3SE3A 3ECBB 3PXJA 1X5HA 2EDHA 1QRNE 1QP1A 3O6KL 2EEDA 2OI9B 2VZOA 4JAMA 3CX5J 3VXOA 5IB2B 2I07A 2X42A 3OXRB 1TZHA 2FX7H 4KAQH 4BELD 3VXPB 2JCCA 1T03L 3MRDA 4ODXB 5I1HH 3L5HA 2ZPKH 2YUWA 4N90D 3WL9A 2CDGB 4R97C 1KC5H 5E5MA 4KXZH 5IBTL 5DJ8B 5BQ7B 3OJDA 3RX7A 3BIKA 5JIPA 3ZDZE 4NSKA 2O93L 5I1DB 5FAAA 2YWYA 4F9PA 2YA1A 4E5XA 2GJJA 2WP3O 5IJVA 5IV2B 3PJSA 1XZ0A 3QSKB 2DLGA 5ID1B 4GFTB 3SE9L 3P77A 4S1RL 2ZUUA 1S7VB 3OPZL 1R3IL 3PIQA 1IFHL 3C5SB 3MA7B 4WNQB 2FJHA 2NY0B 3LKPA 2P43B 3IKCB 1K3IA 1HHJA 5EUOB 3T1FB 1EFXD 1VFBB 2NZ9C 4PJDB 1JJUA 2AXGA 1UZ8A 1QFUL 1P84J 4JO1L 3SGKC 1L9NA 1C16B 1S7RA 1GOFA 3VFMB 5CILH 4MCYB 5E6IA 3M8OH 3IETA 1IAOA 4PJFB 1IGJB 3MV8D 4JVUA 1CFVH 4LVNC 1EO8H 3PL6C 4XBEH 2FIKA 2X4PB 4MSWA 1KPVA 4OCLC 3L6FA 4QXUH 1A0QH 1NC4D 4MZ3A 1RU9L 5KS9E 4XNYL 3RGHA 5HGAB 1A6TA 3QXAA 3VG0H 2F58H 4L4VD 5ITFB 4Z7OE 5H94B 1NEZG 5D9SB 4TUKH 1WFUA 1T5WA 3C09C 4PGBB 1DUZB 4RFEB 1U8HB 4Q9BA 4WI8A 4R90L 4YDKH 1ZVSA 3MLWH 1J1PH 3GMMB 4HJGA 4R0LA 2PTVA 5ISZA 1F58L 1S7QB 1KNOB 1NGYA 4GKNB 4ZSOB 3ZKMD 4PJ5A 5EBWA 2N56A 2VXVL 3L3GB 4JFED 4WO4C 4M61A 5E8PA 4FQCL 2VDMH 3G6JF 3MXVH 1A7RL 3UBXA 2FEDC 3BP4A 3LEVH 1JNLL 4UIMB 1MHPL 2KBGA 2NY3B 2ZG3A 3VH8B 3LRGA 2Z91B 5IFHH 4C4KT 4M5ZL 1QFWM 2JB6A 3BEWB 1ZWIA 2FGZA 3EW3B 4K23L 2CIIA 3D25B 3PDDA 5GPRA 4ZS7H 2VUOA 1I8MB 1FVDB 3VWJB 2P5EB 4G6JL 4APQD 5DD5H 4MWFA 3BZFB 1DQQB 4JVWA 4J23A 3VFOB 4GXUM 4C56B 4Y8AA 4MD5B 1TXKA 1N64L 5J1TC 3RDTC 3W9EA 5INCA 3R06A 4MLIA 1SEQH 1KTDB 1LO3L 3H7BB 1ED3A 1PKQE 1XCTA 1A7QL 2PXYC 2YOCA 4S11A 1IC1A 4X0KA 1G9MH 3T2NH 3GMOA 2QL1A 3SCMC 3OBAA 3UZQA 5TE6L 1HHHA 3QUYC 3FO2A 4X6EA 1KIRB 4NN7B 5GSVA 1BJ8A 5C8JB 4QTHA 3SHSA 2H1PH 1D5MB 3C6SB 3KYNB 4Y0GA 1XF2A 1KT2B 2VDPL 5H37H 1JI2A 3PUCA 2C1OB 5T1LA 4K3JL 1G6VK 4TSCH 5FA4A 4L9DA 3LMJH 2AJSL 5GRXG 1MHHB 1OM3L 4U1JA 1ZV5A 4D2NA 4G8GA 4YHYC 4QOKB 3MBEA 5E2TH 4P2OD 3MUGB 3V7AE 4ODHH 2IAMB 2WIIB 5D7LD 3QJFA 1PEWA 4H8WC 4YNYA 5TDOB 3QRFM 3BZEB 1EK3A 1L6ZA 2APWA 1A1NB 1U93B 3DMMD 2D7TL 2DI7A 1UH3A 2ICEA 2A77H 3BSZL 5MP6L 1IM3A 1DJSA 5C92A 3RU8H 1J05B 1JHTA 1LILA 3S37H 1QBMH 2BSSB 3QXDA 3UTTA 4X9IA 4ZUWB 3VD4A 1MWAH 3MACL 4ZOCA 5K93A 1ZANH 5BVJA 4YPGA 5C07A 5F7DA 3P73A 1IGFH 4QXGL 4MVBD 1SVCP 1ZT4A 3QI9B 5F1NB 3ZT5A 1UB6B 3TESA 4TSBL 3HMXH 2C7UB 1KCRL 5K9KB 1KEMH 1M4KA 2PR4L 1AQDB 2VDRH 1XGRA 1CDGA 2E27L 4X6FB 1C1EH 5IQ7L 4ORGA 4FNLH 1BECA 4LSVH 3TBVB 2X4RB 3T77B 5IW6B 2V6HA 2DF3A 3MMEB 4OZHA 4P4RA 4DOHB 1T4KA 4AT6B 5ACZB 2APXA 1JPFB 1C5BH 5GGQL 4R96A 2VDOH 1R5VA 3H3PH 1X3DA 1AGBB 4S2SB 3P9LB 3H42L 1OQOA 1FE8H 5B38B 2XKNA 4LCCB 5HPOA 1LP9F 4PJGB 3O45B 4HWBA 2X1QA 4PRPB 4Z5RB 4OZIF 3JXAA 3BP7B 4NYLB 1OAZH 3L3IB 5FF6B 5E08L 3PABA 1GXEA 2ERJC 4K94H 4Z0XA 1KSRA 2A9NH 1UM4H 4G3YL 3WDJA 1ZEAL 4O5LL 4X7TB 4JZJC 1QVOB 5DK0A 1IQDB 3OKMB 4RGOH 3AREB 1FV1B 1HINL 4PV9B 1NCWL 1FLTX 1IT9H 1UB5B 3A6BH 1DLFL 2ZCLL 4DKFL 1ZLSH 5DA0B 2ZSWB 2CSPA 1AGDB 1TZGH 4N5ED 2FATH 1A6AA 1NCUA 1R0AL 4M7LL 4O51B 1M7XA 1UYWL 2V2WB 4KV5E 2L7JA 3ARDB 4KKCD 1YEFL 1NUFA 4IOIA 3ULVD 1MF2L 4JN2A 4BM7A 4EEEA 7CGTA 3QAZC 2BHZA 4WCYH 4QHLB 5FA3A 3LCYA 3PP3K 2A6IB 2YPKA 1F6AB 2VXTH 4HC1L 4LSQL 4Y4KA 2DJSA 3CSPA 2CMRL 4X5LA 2CD0A 5JZ7D 1RJYB 4HS3B 2C4FU 4XPFL 3BISA 1XH3B 2FBOJ 1T89C 4BSJA 1HHGB 4NFBA 3UAJD 1BPVA 3LHPH 5IB1A 4QKXB 1FL3B 1IAIH 2P5WD 2QR0B 1X7QA 2V5TA 3J7HA 4ZNEA 1T0NA 1I8IB 1CYGA 1ZGLB 2ICWJ 3S96B 4JPVH 1AI1L 3I9GL 5IWLC 2NXYC 1RJLA 5JMRA 5I18L 3LB6C 3GSVA 1UACL 5M94B 3CFKA 3NBNA 2OR9H 1CD0A 1MJ8L 3VGDA 5HHQA 4U1KB 5KSUA 2VL4A 4K8RC 4PRHA 3PF2A 1S7TB 4CNIB 4XHQA 5HGDB 3MRJB 2NX5D 3LSOB 2UZXB 1QSZA 1IILE 2GT9B 1EHXA 2Y9RT 4Y1AA 1NBYA 1E6JL 2VLRE 2JJUA 1DLHA 3CVIH 4LPXA 1BX2A 3T0EA 3RBSA 4GKZB 1PSKH 1V3LA 3C60A 4I48B 3IAPA 4MA3A 3LEXA 4JY6B 3NVQA 3TA3A 5C7XL 1BFVL 4LCIH 5FGBC 4J3OC 5HHPB 3UDWA 4JRXA 4QRTA 3BH8A 1I8LC 1C08B 2ZUXA 3DXAE 5BV7H 3O4OB 4F57H 3ABZA 2B2XL 5KSAB 2O5YL 2I9LB 4L4TB 1NFIA 4HKJB 1BIIA 3IXAA 1IC5L 2B0SH 4CMMB 4Y4FC 3BE1H 4HWEH 3P0VL 2MHAB 3OF6D 1XIWB 2NXZC 3V2AR 2W9LA 5C0DA 3EYSL 4HLZG 3MV01 1WBYA 4XVJL 4D0CB 4KJWC 5HJ3A 4LDOB 4B50A 1A6ZA 2IANA 4BH7A 1RIVH 3BX7C 5EU7E 2A83A 4GXUN 5EU6A 4ELME 3I6KB 4M02A 4PB0L 5DJ2A 1IL1B 3WXWL 3NIDE 4HHAB 1PEZA 2APTA 4U1LB 2X4UB 4XPHH 4FA8A 3DOSA 5SWZE 2Y6SC 5EBMA 1RURH 3D9AH 1P69B 1QACA 2ORBL 4PP1D 1OP5K 4EDXB 4PRDA 2IH1A 3MJ8B 2X9XA 2MPAL 2ZP0T 2DI9A 1QO3A 1CXFA 4XB7A 1YEGH 4PS4H 4FMKA 2J12B 5D5ME 5JORA 3MOQA 1BBDH 2VAAB 2WWKO 1HEZB 4JQXA 2XQYG 1S9KC 4YHPB 4BYHA 3DRTB 1BHGA 4Z7WA 4JFDD 4PBXA 3B2VL 4OLXL 1I1AC 5EU4B 4TRPL 4PD4J 3SDXF 5J8OA 5F7HA 1DQDH 1FQ9C 2VYRE 2R2EB 1T2XA 4KRPD 4FQQB 1CFSA 2NY4C 5D6CA 1EAPB 1NQBA 3CVHH 1CVSC 5D2LB 4H8WL 3LD8B 2B4CH 4RWHA 2DQFB 4TSAL 4D8PB 1KLUA 1T2QH 5I9QC 5HDQH 1RV6X 2Y5TA 2BRQA 5FKAB 3DUUB 1XGYH 3EFDL 4XMKL 3OXSA 3SJVE 4Z8FL 4OIIL 1RZGB 1ZA3B 4ONHB 1CICC 2FX8H 2NTFA 1BZ9A 2OSLB 2RHEA 3VFTB 4OZGF 4WVRA 1QSVA 1T21B 3HE7A 4JM4L 3L1OH 5BOZG 4X8XA 3QCUH 1EJOH 2PO6C 4ZUVA 2GSGB 4RSVA 1S9XB 1VEMA 2YN3A 1FH5L 3CX2A 3EJJX 3ARBD 3L3JA 4RAUB 2F5AL 4NQDA 4RRPA 4A6YH 1JUFB 4R4ND 5LGJB 3QHZL 3MODL 3MNWB 5E00A 3GJEA 1V3JA 2VUYA 2FB4H 4UILL 1R3KA 4PBWD 1JPTL 5MENB 1CE1L 3RZCD 4PGJA 1AHWC 4IJ3C 4V1DD 4HS8H 4U2YA 4JFYA 3MV9A 4N0RA 1I7TA 2Y7QA 3TN0A 3MCKB 1HKLH 1N6QH 1DDHA 1JNHB 4GSDL 1A7PL 1GPOL 5J13B 2DQTL 4ODTL 2BNQD 2BERA 1ORSA 5JIHA 5CJ8A 3QWRD 4GRMB 1GGTA 1YQVH 3IB4A 5B3JE 3SDDC 2XPGB 4FABL 1WCQA 3OR7B 5EZOL 4HIEB 4X6DE 4ODSH 4N8CL 3QIBD 5D6DA 3FQTB 4MAYA 3I50L 3EGSB 2H6PA 5ILTL 5C6TH 1SJHA 1JNNH 2BRRL 5I15L 5I2IB 2R1XB 4YDJA 4QHNA 4APQB 1CXLA 3LQAH 4YBQC 1L7TL 2BSED 3FMGL 5DJYB 3ARPA 2O61B 3CC5B 4PG9A 5I19H 1EEYB 3BVNA 4FQXD 4HFWB 1RULH 4U6TA 1Q9OB 6FABL 5FO9A 3FB5B 1UM6H 4HIJB 1EA9C 4URTB 2AQ1A 4OV6F 4I9WD 5L2KA 4ALAH 3KDMA 1ONQA 4DZ8A 3GFUA 4GO6B 3NFNB 5KVDH 1R3LB 3MRGB 4JPKH 3WO4B 3QDJA 1KG0B 1QKZH 2VERN 2WK2A 2ITDB 1JZ3A 5JHDD 5CGTA 3ARFC 1URLA 4JFZH 1KF9B 3CAFA 1F5WA 3TVMC 4NBYB 4X5XB 5C0BB 3TT1H 3U48A 3A6OA 3GNMH 1J18A 1T80A 2ESVD 5ICZB 1BFOB 2XTJC 1A3RL 5FYLD 4NJAL 1R5IB 2XIDA 4R3SB 5D7LB 4XWOD 4Y88A 3MLVH 4LF3A 4X7SL 5IEKA 3VFNB 3UBXI 2AK4A 3DMMB 2R9HD 4NQEA 1WWBX 4K8RL 1AR2A 1LNUA 4XCEB 4JDTH 3KPMB 4PLKC 2CLVB 3HR6A 2Y07L 3HI5L 1IC7L 4TYUA 3SDAD 1J87A 3A67H 3B9KD 3SY0B 5TQ0H 1P6AB 3KYKH 4MDIB 3W0WA 1JN6B 4J6RH 4BZYA 5DJDA 2CO7B 4JY4A 1QEWB 5C0AE 2VRAA 2IADA 3DHJA 3I3EA 3PWJB 2D7PA 5ACLA 2JELH 4JJHA 2D7OA 4IRSC 1FFPB 2K3TA 4ZUUB 1D5XA 3FFCE 4Z7UF 5KOVC 1GGCL 3CDGA 1AXIB 1FYTA 3QQ9C 5D1QD 4AMKL 4MGXA 5IM7A 2GSIB 4NNYB 4W4NA 4JG1L 3H9SD 3O6FA 5GGSY 4WHTB 2D0FA 5CJXC 1A7NH 3B3IA 3SGEI 3FQUA 2FZ3A 1LEKA 2IPUG 2W92A 4M8QB 4M6NL 3V52L 5T1DL 4X8JA 4PRIA 4NRYB 1MJJA 5BS0E 3FT3B 1NGZA 5CWSA 5C2UB 1E4WL 1OF2B 3LKOA 2H9GB 3NCEB 3DX8A 4TUJA 5DSCB 3D85D 3WFCH 2DYPA 2CUMA 1TVBA 1HI6A 3E1F1 4HWZB 1HH9B 2QHRL 4QF1A 2PXYA 2DQJH 3G6AA 3QNYA 4U6YA 3WFEH 3HC0A 5EU3B 4P2CG 4HWNA 4PJBB 1QRNA 2RFXB 5T1KB 2Y06H 5BW7A 4YIQB 5H35B 3MJ9H 3RY6C 1XCQA 4FFZH 2X4QA 5CP7B 1OSZB 3L3DB 4QCIA 5TE7H 5EO9A 1S5IH 4N0UE 1XGUB 1K6QH 4L8SC 5C0JA 5F6IC 3DVGB 5ETUB 2JJVA 5JOFB 4HIHA 1T5XA 5ADPH 3MPCA 5CJQL 1YEHL 4BQBA 2PF6A 3STBA 1RMFH 2P4AB 1FVCB 2NW3A 3R8QA 2DKUA 1MFDH 3IDXH 4RZCA 4Z76B 2VXSH 1CLOH 4JM2C 3LN4A 3O9WD 1Q9LB 2B5IB 2CLZA 3HG1D 3S5LB 4MD0B 2H2SD 5EBGA 1XF4A 4LNRB 1FL5A 1WQVT 4XC1L 3GGWB 2ZSVA 4UBDC 1JPGB 2LFGA 2NY6C 4JFOA 4RWYH 1OWWA 1RK1B 4MXVE 2P5WB 4E41D 3U7WL 5DO2D 3CU7A 2EC8A 4GMTH 1H8NA 1TZIB 4TOYH 4FQ2H 3NZ8A 1U8JB 4PGCA 2IQ9H 2UYLB 5IVNA 4G42B 4PJIF 1YEEH 4KPHL 5AEAA 2X4SB 4RA0C 2DOCA 3C8KA 1ND0B 1KGCE 3CMOL 3FFCB 2NY5H 4U1NB 4PTUB 5EZIH 1EBPA 1BAFH 2J3SA 1LE5A 5B8CB 1TVHA 2NX5B 3KLAB 3G5ZA 2LE9A 3PHOA 4HFUL 3EHBC 1MI5D 1OAYH 3O41A 4MJIB 4NZRH 1M71B 5DVOA 4KZEL 4ZUSA 4N68A 3EBAA 3P11H 3VXTA 1B0GB 4LGPB 3LN5A 4POZC 4QHUB 4RRPG 3SDCD 3PQYD 3SO3B 5EZJB 4I0PD 1JZ6A 4LSSL 3ESVF 2JK5A 1P9MC 2PYEA 4HEME 4ZO6A 5EO0A 1CG9B 3MUZ1 5GS1C 2R69H 3BYTA 3UEZA 3DV6B 3MGOA 5D7SL 4LCYA 4KJYA 3UYPA 1BF2A 2BCKA 4N9OB 1P7KA 2E7CA 4IRJB 3UJTH 1PDKA 3VXRD 3T3PE 1FN4A 3RWIB 1DL7H 4CVZB 1YY9C 3N1GC 3HB3C 1QA9B 1N5YL 5DHVA 2OK0L 3BDBA 4P5TD 2F5BL 4JN1L 1FG2A 1LO5B 3STZB 4C54A 1E4XH 1CF8L 2EYRB 2O5XH 1AGEB 4PLJD 1PX4A 5JNYA 1PKQA 3RGVA 4EI5A 1MRFL 2EYTA 3IFLH 3D1MC 3O6LH 3KAAA 1T83C 3JZ7A 5A3IC 3GSWB 5ALCL 3QA3B 5JA8B 1BGXH 4UNUA 4MJ5A 4JRWA 4OF0A 5AG9A 3RWHA 2NQCA 3DTXB 2Q8BL 4KUZL 2JJTC 1OB1A 4NKOA 2DD8H 1P4IL 2VQ1A 5ALBH 3QZWA 3ZYJA 5CBAA 4KI5C 3WHXA 5JW4M 3OKLB 2NY1C 3BH9B 2ZKHH 4GBXC 4PJ7E 1KBGH 1YYLH 3O8XA 2HVKA 2ZZUT 4BJLA 1JV5B 3W39A 4NZTH 4Z7NF 1SBSH 3TP4A 4AEHL 1F3DH 2JCCF 1UM5L 5GGSA 1JHLH 4BSWB 1FPTH 3B5GA 4TVPL 3DX9A 1NBZB 5AYUH 4M1CD 3MOAL 4MXQC 2WUCH 4LPWA 1A6UL 3FQXA 2OM5A 3RX5A 1QLRA 3PWPD 4OLUH 4J3SA 2ZNWA 2C3HA 4MDJA 4XMPL 5TJWK 1NGWA 3O0RL 4XHJC 4BK4A 4LCWD 4WW2A 1HNGA 5IESL 5CUSL 2XWTB 5GGVY 2FR4B 3GMPA 2AEQL 2BVUA 3V6FB 4R8WL 1YNKH 3QFDB 3GM8A 4L3EB 2J7LA 1H5BA 4F9LA 1P4BL 1W0WB 2ITCA 5TGBB 1FIGL 2DBJA 1R24B 2DQIH 1RFDL 2ZCKH 4I2XE 4LLVA 1F4YH 5GRJL 1JGLH 4E9LA 2GFBB 1NCAL 1TJIH 3OAYH 4LVOB 2X9WA 4AEFA 1WISA 3ARRA 3IRZA 4DGIH 1B0WA 3ROLA 2NY2C 1UCTA 3O81A 3V4VH 1U8PA 1Z5LB 2OQJA 2DDQH 1PLGL 3QEQB 5MEPA 1E0OB 4NZUL 3U4BL 4ZPVB 1MNUH 4XPTL 1CLCA 4XP4L 4Y4FA 4V1DB 2CDEB 5IB5B 5E2UL 1G6RL 4RGNE 4ZQKA 2ZCHL 1Y18B 1ZVYA 1GGUA 5ECJE 1ZLWH 1H9VA 3RPIA 5EIIA 1LWRA 4KROD 5JA9A 5D2NE 1T04A 1HILA 3DVNB 2BMKB 5ICXB 1U58B 2COQA 3GMRB 2BNQB 4W4OA 1EEUA 3LV3A 1GVIA 3VJ6A 1MVUB 5C9JA 1E28A 3MA9L 5ERWB 1UVQB 1MUJA 1DP0A 5I8KH 1J11A 5I8EB 4MNHA 3MJ7A 4Y2OA 3KPOA 1JF1A 4K7PH 2AV1B 5I73B 3KR3L 1X6LA 3QG6B 3IFNL 1KLFA 3QDMD 4JR9L 5HVGB 5FECA 1XR8A 3NCFB 1JMZA 1AXTH 1JK8A 1NJ9A 3F7PC 1XR9A 2Q20A 1E4JA 2YD7A 5C0RL 3NFSL 3RWDB 3IF1B 2Z35A 3MRMA 4OBSA 4S0TD 5DRNA 4FXKB 1G7IA 4PLOB 5D96B 4PJAE 3UJJH 1CT8A 1GGIH 3QDAA 1S9VA 2YC1A 1MREH 5JUEL 2WWMD 1BJ1H 3JSSA 2R1YA 3FONA 3CLFH 3BRDA 5LBSH 3P4MB 4XP9L 2VDNH 1S7SA 3LS5H 3DUSA 3PGFH 1WT5C 4OM1H 5HYEA 4ZFGL 4NRXA 1Y6MR 3WN5A 4P3WA 5HVFB 1TTGA 1J1XH 4E42B 1DFBL 3MV7D 1AP2B 1N3NA 4YDIL 3BYYA 2XACC 5ANME 4P46B 1EUUA 1G7HB 1N59A 4QXWA 1GZPB 5GS2D 1QYGH 1ZSDA 4HX1B 5E99H 4PJ8D 3C08L 3TYGH 3V6ZB 3L5JA 5DJCA 5JHDB 3TPUA 1OCWH 4XC3L 1VENA 2HMID 4IDLA 3H9HA 5KTEL 1AO7E 1D5IL 1IM9A 4XPBL 4MJ6B 3RWJA 3ZDYE 3CK0L 4RBPK 2EKSB 4PJCB 3GUTB 2ESVB 5GSRA 3IVKA 1BBJA 3BOVA 3LKNB 5JR1L 4JQVC 4G8FA 2VLRA 5D7IA 3BPLC 1HYSD 3CFDB 4Y5XC 4ZOAA 1YN7B 1IAKA 4HWBH 5IVZA 1KEGH 4KMTL 5CBEB 4HIXL 2OI9C 2VWEE 1YNLL 4PJ9A 3N06B 5KJRL 1MH5A 1P7QA 3MCLH 2NTSP 2XQBL 3DXAA 3SDAB 4WEBH 3SQOL 1I3RA 3V5HB 3KNBA 1Z9LA 3WFHB 4GAYB 3O6KH 1J0HA 4F7PB 4G9FD 5DWUL 1L7IL 2CH8A 1B6DA 2D4DA 1W72B 3ALPA 5FGCB 2EKJA 4HK0A 1T03H 3O2VL 2G2RA 1CGTA 2HP4A 1NGPL 3GMQB 5DQJB 3RL1B 4M1GL 2ZOLB 4RNRB 1D5BB 5IBTH 4IMLA 4W70A 2X4NB 4P2QE 5FB8B 5F3BA 4I8DA 1S7WB 5K9OB 4ELMA 2IQAB 2UUDK 3IDNB 4XXDA 3L3HA 2NY0C 2AKRA 4YFLF 5IW3A 2OX5A 5BXFB 1A9BB 4EN3A 4YEEA 3UYRL 5SWZA 1UCBL 5FOBA 4UIKL 4OFYD 4WU5A 1CL7I 2H32A 1K8IA 2PW2A 3SE9H 3D85B 4S1RH 3OPZH 2R39A 1R3IH 3MGAA 1IFHH 5AAMA 1HQ4A 4KTDL 1U3HB 5CZKA 2LABA 1OVZA 3IDGA 1BVLA 1YYML 4JJ5B 2DQDL 1CGXA 4U1IA 4W81A 4JO1H 1QFUH 4HQQL 4KVCL 1C8PA 1AD9A 1MOEA 4QYOB 3TLRA 4MX7A 3X17A 1MCHA 1JWSA 5F9WB 5CD5C 3E3QC 4QT5B 4QY8B 1JHKL 3TVMA 1RU9H 2X09A 5ID0B 4XNYH 4LHUD 2ZG2A 1NPUA 1O0VA 3UTQA 3C8HA 4U3XA 4KGLA 1F8TL 5FYJU 4JLRB 3ZL4L 3HRPA 4R90H 3OJVC 5DK2B 3SJVA 3FQNA 4G6FB 3V7AG 4NUJA 4UU9B 3O9WB 1IEBB 4GLRI 1F58H 2NY3C 3G6JE 1X5FA 3TJEL 4OBRA 3B6SB 5I0DA 3TO2B 3TNNB 4FQCH 2A9MH 5DUBB 4YHIA 1A7RH 3VWJC 2OJEA 4POYA 1JNLH 1MHPH 2CRMA 3T4YB 4E41B 2Q8AL 1JGUL 4M5ZH 1DVFA 1T20A 2AEIT 4K23H 1RD6A 1IGYA 2IBGA 1EHLL 3VXUD 3BQUB 1IZKA 3PDOB 3F62A 3QDGB 3P9WB 4G6KH 3RVVC 1PAMA 5CEZE 1UXWA 1NL0L 3T65B 4G6JH 4O2CA 1G0DA 2VB5A 4KQ3L 1WJ3A 3GSQA 3KPRB 1N64H 4AL8L 3QIUB 5KSBB 2AGJL 3WV0A 3DHMA 4NN7C 4RFOL 5FM4A 1PY9A 2ICES 3FRUB 1G84A 1DEDA 3GK8H 5E94A 4HKZA 5TE6H 1N0LA 5KG9A 3GHBL 2ADJA 2D0GA 1AQKL 1U8MB 2OJZL 4FQHA 2EDFA 1VGKA 2V5YA 4WO4D 1XGQA 1P1ZB 2IAMC 2VDPH 4X6DA 5CSZB 5E9DD 2MNUA 1LO4L 4K3JH 5CEXB 4EUPA 3AM8A 4MNGB 2AJSH 3HCVB 4J4PD 2V7HA 2EE9A 1OM3H 3TGXA 5F44A 1MHEB 2Q76A 5LCVL 4XBGB 3BN9C 5GS2H 1UADC 5C0ND 5FK9B 4HG4J 1CE6A 1S8DB 3MFFB 3QHFL 2Z31A 3HUJB 4K9EC 4WUUB 1J88A 5GS0C 3ARXA 3VRIB 2D7TH 3O2WL 3Q0HA 2ZUQB 3BSZH 2JF1A 3CX5K 4NO2B 5MP6H 1ZT1A 2VLJD 1LMKA 4HK3N 1UJ3A 4NC1C 1OTTC 1KACB 4ZDHB 3MACH 1VB9A 3QPXL 3V4UL 5EC1A 4D0BB 3AROA 3SCMD 3VRLF 3FO9A 1ZMYA 2EDTA 3NABL 4ZODA 3CDCA 4ZOEA 5IG7B 2DQHH 5BZWA 5IHLB 4W6YB 1JP5A 4TSBH 1PG7L 4GAFB 1S7UA 2SEBA 1KCRH 1WZ1L 1U91A 2ADIB 4LKXB 4JFFD 1S5HA 3Q5TA 3ALXA 5F88B 1V7ML 2PR4H 3JUYA 1OTSD 1X5AA 1A8JH 2A6JB 2Y36L 4TNVF 1J9CT 1XF3A 5IQ7H 3T0VA 3BT2L 4TVSa 4XNQA 1VCAA 4Z7WF 3MRQB 4LCCC 1YDPA 4IMKA 2R23A 2VQTA 3QQ4A 3ZTJG 3GSOB 1ES0A 1P84K 3I3BA 5GGQH 5B39B 3I84A 3PWPB