3GM0A

Anti-methamphetamine single chain fv in complex with mdma
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
242
structure length
237
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDSVTSGYWSWIRQFPGNKLDYMGYISYRGSTYYNPSLKSRISITRDTSKNQVYLQLKSVSSEDTATYYCSYFDSDDYAMEYWGQGTSVTVSGGGGSGGGGSQIVLTQSPAIMSASPGEKVTLTCSASSSVSSSHLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSFPFTFGSGTKLEIKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-methamphetamine single chain Fv
publication title Crystal structures of a therapeutic single chain antibody in complex with two drugs of abuse-Methamphetamine and 3,4-methylenedioxymethamphetamine.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 55
structure length 237
sequence length 242
ec nomenclature
pdb deposition date 2009-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gm0A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gm0A01
1KLGA 2OJZH 1A7NH 4U6HA 1MF2H 3T09A 1H5BA 4OLVH 1KNOB 4YPJA 5DQ9B 4O2FA 5CJOL 1NBVL 5DC0A 2AQ1A 1TIUA 3KPRB 1TJIH 3BEWA 4MNQE 3BZFB 4QHUB 5E8PA 1S7XB 1JFQH 5CJXC 5J6HA 3BIBX 4XP1L 4LIQH 4QOKB 1A6TA 3U7YH 5IMLA 1P1ZB 4HLJA 3NAAL 4GMSH 5DK2A 1FL6A 3OJDA 3BW9B 1H0DA 2LU4A 1OP3H 2VR4A 5C8JA 1SM3L 4WW2F 4ONFL 3HB3D 1DQML 4Z0BL 5I19H 2XRAL 4MVBC 1YPZA 1XGUB 3B3IA 3L3HA 1R6VA 1Z0MA 4BK5A 2DMCA 1YNKH 5BQ7A 1IC7H 5DJ8B 1MRDL 4HSQA 2EDDA 4UOJA 2FD6L 4NDMA 5MEQB 2GSGB 1GC1C 3KLDA 2YD9A 2E8YA 5FA3A 5I8CB 3T2PA 4HS8L 1HNGA 1VFBB 3MJ7A 3V5KA 5ALCH 3WSQL 1GL4B 4Y1AD 2W65A 2E27H 1ZHKB 1KV3A 5BRZB 1G6RL 4FP8H 4P5TC 3PQYE 1H5BC 2CRMA 5DZLA 1U8NA 5D1ZD 5ACLA 1L4IA 3FB6B 2XZAL 3O3AA 4I1NB 3EYUL 3HI6H 1NC4D 1BREA 1DLHA 2DL9A 3TEUA 5EIQA 5AYUL 1B2WH 3VFTB 5BJTA 2Q8BH 1NDGA 3U7WH 4UILL 3UC0L 2G2RA 1ADQL 4PJAA 3GMPA 4JRXE 5CJ5A 3WKNA 4WY7H 1NLBL 2DM3A 2AEPH 3C08H 3UTPD 5DYOB 4H26B 2GJ6D 2F53A 4YLQT 5FYJE 1JWMB 1P9MA 4G6AC 4R6UA 3V7AE 2BVPA 2EH7H 3OZ9L 1JN6A 2FATH 5F1NA 3ZDZF 5GGSY 4KKLC 3QEGH 3ARFA 5SWZB 5F7UA 3MXWL 1PLGL 1WBXA 3I75A 4Y2DA 4U3CA 5HVHC 5C0NC 4M7KL 5IBLC 15C8L 1MOEA 2IPTL 3NABH 1AO7D 1X4XA 4FQ1L 3QQ9C 5DURD 5EG6C 5EZIH 5ERWB 4YEFA 1TTFA 1EZVX 3BP4B 3MACH 4I3SH 4ZUSA 5J13C 1DCLA 4XMKH 2DI9A 1AGFA 6CGTA 1DQTA 3CMOL 1KIQA 3EJZC 1Z5LA 2MKWA 3NFSH 1S7SB 2UZIL 1QFWL 4BSWB 3O0RL 4NBZB 2COQA 4OD2B 3NIDF 3QA3B 4L3EA 2X2YA 4OLWH 4L4TE 1D5BB 2D7TH 3TBVB 5DQJA 3HR5A 5I1AA 5L2KE 2EEAA 4HUXA 3WXWH 1A7QL 2W07A 5BO1H 4PTTB 1BBJA 1BD2D 2VH5H 5DWUL 4XWOC 1OB1B 3DI3B 1OWRM 4X7DC 3OAYK 1EHLH 2A6KA 2BK8A 1MFBL 5IB5A 1Q9LA 1EFXD 2HFTA 5F1OB 2FIKB 3ARFC 5ETUA 5DK0A 4QLRA 2ICWB 4G43B 2MQ3A 5JR1H 5KSVA 3U6RB 3KR3L 1UVQB 4X99B 3UJIH 1RMFH 5FECA 2AERT 1RURH 2NZ9C 2XACC 2CDEB 3MV7E 3JWOL 5T5NF 3TC9A 2I07B 3IAGC 2X09A 3G5VA 4TSAH 1NKRA 3TVMC 5CS7A 2X1XR 4PRIA 4EI6A 1K9TA 3B43A 3RVVC 2BOCB 4NUGH 1J5OL 1XFPA 2P8MB 4TRPH 1D9KB 4YE4L 1MHPL 4IMLA 1HSBA 1DQJB 4K3HA 1HCFX 1RZIB 3ARRA 3JXAA 4X4MA 4NQED 4PREB 1F4YL 1YEHH 3G6AA 5I71C 3MCLH 5ITFB 3DSFH 4YR6A 5E2VH 2JCCF 2Z93B 4M4RA 4PJXB 1I7RA 5EOTA 1YYMH 3SDYL 1QPXA 5A2FA 4ZDHA 5E4IA 3FQTA 1KCVL 3QDMD 1T1XB 4JJ5B 1KJ2H 5J9PB 4QHMA 2EDYA 1ZS8B 3B9KB 3ZYZA 2YMXL 3MJ8B 3AVEA 4IRSB 4PG2C 1VKXA 1NMAL 5LWYH 1PFCA 2FLRT 2DKUA 1FLRL 2A0LC 4JM2F 2FO1A 1KCKA 1H3WM 1OSZA 4PLJC 1DVFC 2FYYB 2I9TB 1E28A 4IIQB 2QQLH 2R2HB 4V2CB 5FUZL 5IK3A 2BVQA 5CEZH 5IG7B 2VJXA 3PG2A 1V3MA 2FX8L 3QH3A 1S8DB 1NCBL 1HSAB 2PW1B 3H9SE 4LGPB 4U6XB 4WFHD 1AD9A 3UCRA 3U48A 1DBML 2DLEA 4YHLH 4FABL 4AY0A 3GMNA 3JWDL 2Y07L 4OBRA 3S35H 1F4AA 2NXZC 5IFHH 3VRIB 1GGIH 3ALPA 3F7QA 3U9PH 5T5FH 2WBJD 3VWKC 4AQOA 4R26L 4TOYL 2XN9D 2H1PH 2KKQA 4RGOL 5D2NB 3P77A 3QEHA 2NY0B 4JG0H 2CRIA 4WUUD 4DWHA 5J1SC 2CLVA 2FX7L 4HX1A 5J89A 5ADPH 3V4PH 5DJAB 1XGQB 4E5XB 2R1YA 1G9NH 4U7SA 4NJAL 4G6KL 2NY3C 3TNMA 1OAXL 1UWXH 3RI5F 5GRVL 1SBSH 4KRPC 3C5JA 1BECA 4XB8A 4JKPH 5DVLA 4ODXA 3HR6A 4XCCH 2AS5M 3ARBC 3VGAC 2ATKA 1PKQE 4PJHA 2GIYA 2YD2A 5I15H 5FUOH 2HT3D 2HKHH 3O6KL 1IKNA 2P5ED 1MWAH 2QSVA 4M43H 2R2EA 3WN5B 5LQBH 2ZSWB 5D7JC 3W2DL 5BVPH 4M62L 3SDDB 4ENEC 5IB2B 5B21A 4MAUH 1KTDB 3PGFH 3QIUB 5GS3A 5C6TL 4RMSA 25C8H 3S5LG 1C08A 2HTKC 5C71A 5IB3B 2ZCLL 4NZDA 1JHLL 4U6VH 5EC1A 5CEXA 4R4FL 5F8RC 5ID0B 3QI9A 1TJHL 5L2JA 5DT1H 1HQ4A 2CDFB 4K94H 4L8SC 4KDVA 5F6IC 3OAUL 1GZPA 1CD9B 5HYIA 1AGCA 4J1UA 2OSLA 3S96A 3DRQA 4JANA 2B2XL 1ZAGA 2WBWB 3MFGB 5C0AD 3LV3A 4LCIH 4FXLA 3QNZA 4PJ7F 2AW2A 4FFYL 1LK2A 4R4BB 3BH9B 4OZFB 1E4KC 1KCSL 3PIQA 4HXAL 3LD8C 1IC1A 2C3HA 3PP4L 1X9QA 12E8L 3BP5B 2R4RH 1KB5L 2IAND 3INUH 3QT2A 1S7UB 4HIIA 5A3IC 3VFSB 1F8TL 1NFIA 5ECJE 5F7YC 1J1XL 3O11A 1URLA 2YZ8A 2NXYB 2QSQA 1XR9A 3MRNA 3NA4A 4XC3H 3I9GL 4O2EA 3TO4B 2DQCL 5DRXA 3S36X 2JELL 3TNNA 4M8VA 1OGTB 3FQWA 4N8VA 5T3XL 1CLZH 2EIZB 5TE7H 3BQUD 1VHPA 1IFHL 3G6DL 2GUOB 1M6OB 4M8QA 3PWNB 2GFBA 4HIXH 4MNQD 3IKKA 3QI9C 4FQQA 1CE6B 3ZT6A 2QKIA 3IAPA 3T0BA 2VISB 2KH2B 4LSVL 2DYPB 1QQDB 4QTIH 3UO1L 3BKJH 4CDHA 3QUKA 3KPQB 2HJFA 4XBGA 1FO0H 1PW3A 1S7TB 4GH7B 3KLHC 5IJVA 3FCTB 3BKYL 4J4PA 1HHGB 2F8OA 5IHZB 1F4HA 4ELMB 1NAMH 1GC1L 1YQVH 4H0HB 2JJTC 3W9DB 4OD1L 4WHTB 3HNTL 1QUNA 3EHBD 4HC1L 4B41A 4JM4H 2MHAB 4U6TA 3IDYB 4M61A 1Q0XL 4TPRL 1N6QL 4HWEL 5KZCB 1EA9C 5FHBH 4JKWA 2AGJL 3DGGA 5FKAA 3MBEB 2Q8AL 1MJUH 2IPUK 4JZNA 1JPFB 3V95A 3NFPA 4Y5YB 4YGAB 5DRNB 1DBBH 3RA7L 3M1BA 1K4DA 2ATPA 2XFXB 1ZANH 3A6BL 3BE1L 3PQYD 2VDNL 4BFIB 2VITB 2PO6A 2VXSH 3WL9A 1EBAA 2V17H 3DTXA 3IT8D 3RNKB 4P23B 4DZBA 4EBQL 5I1DB 2EECA 5IW6B 4DVBB 2R0LL 3O2WL 4F7TA 1VERA 4LCCA 1IBGH 2CK2A 1UADC 3WMSA 2EDTA 5DEFA 3MOBH 4MD0B 2X4SA 2YPKA 3Q2CA 4JRXD 4U1KB 2I25N 2VQ1A 4WI7A 4TVPE 4G6FD 3MGOB 1YY8B 2J12B 3CIQA 4J4PC 1XF5A 4P5KB 3SKMA 5LAXA 2FB4L 4F58L 2A1WL 2I9LA 4ZFGH 5GISL 3JTSA 1UACH 2ITCA 1H15B 3X3FL 1KT2A 3PABA 1W72L 5ADOL 4LCWB 3X13A 2HWZL 2BHZA 4F2MB 4PS4H 2G5BA 3DUUB 1FVDA 3I3DA 5K9OB 3HNSH 1RK1B 1YNLL 5EC2B 5ITBL 2XKUA 1D7FA 5C0DA 2Y5EA 4U7MA 1PQZA 3GBNL 3V4UH 4PY7B 1EDQA 3NZHH 3OPZH 1JYWA 4Y5XB 2AK4E 4JPIA 2YUVA 3UX9B 1KTKE 4LQFL 4ODWA 1FYTA 2OR8A 3S97C 2APXA 4PYHA 1NUFA 1O0VA 1JPTH 5JLZA 2PW2A 3SQOH 1KFAH 2D0HA 4TUOB 1ZKAA 2FJGA 4OZFG 2BNRA 5JZ7C 1F4WL 4PB0H 1I8MB 4F9PA 1V3LA 3ROLA 5B8CB 4OUOA 1KSRA 5FYJL 2P5WA 2Y36H 2ZZUT 4O5LH 3CX5K 3DETC 4O02H 3L3JB 3NCCB 3FOMB 4GQ9L 4HF5H 3G9VA 2OK0L 4GBXA 1Z9SA 4FFWD 3IDMA 1HI6B 3QJHB 2XKNA 4HQQL 3QFDA 3W0WA 4HV8A 3RVUD 5JPNA 5EFIB 5HGBA 1TJGH 4XHQA 2VDRL 1YMHA 2LVCA 5AAWA 1VESA 5JUEL 3V6BR 4KJQC 1HH9A 4XI5C 4EI5C 3MV7D 3BH8A 4YFLF 3RX5A 1CLYL 4WW2A 4HUVA 1GGBH 4PGCA 4WO4A 1CTOA 2ICEA 4L8DA 4OCWH 3LEVH 2R29L 1MJJA 2QHRL 4JFEB 4E0RA 3VXMB 4WTXA 5HHOE 4N68A 1PSKL 4ZTPH 1T2QH 3RDTA 1JV5B 1U3HD 4LSSH 4DVRL 4XBEL 1ZLUK 3MUGA 3HS0A 2YXMA 1JMXA 5DC4B 5KN5A 3G5XA 3GNMH 3X12B 4CVUA 4D9RD 2AJ3B 1IAIL 3RWDB 1NGWA 5K9KB 3G6JB 4RWYL 3NCFB 1KJVB 4CNIA 2BY3A 4Z78B 5MHSE 5BZWA 3VG0L 5CSZB 1T5XB 2EH8H 3FB7B 5TGBB 4ZD3H 4LLYA 4UT9L 2KZ1B 1TZHB 3QXAB 1DE4A 1NGXA 3G9AB 2D03H 3NCEB 4KTDH 4BSVB 3N85L 1GAFL 3O2DL 3F7RA 3C5SB 4X6FA 3I6KA 5I30H 4JHWH 4KKCC 2NY7L 3O6FD 2G9HA 5B39B 2QR0A 1MCHA 1G7HB 3HZYA 3N06B 3FRUA 5F6HI 1GRWA 3ORJA 1QRNA 3BFOA 2DIAA 3ULSB 5FO7A 4HKJA 1IGJA 3IJHB 1BGXH 1UH4A 1FNSL 3WEXB 4LFHG 5FO8B 2A6DA 3R4DA 2VDPL 4R90L 3OMZA 2RJMA 4HWZA 4W68A 1TMCB 5EH1A 3EO1A 3VFVB 3HNVL 4YC2C 4P46A 3WIHL 5SX4H 1U8PA 3L7EB 4URTB 4ZUVA 1FN4A 1NEUA 2EE3A 3QG7L 4HG4K 4QRUA 1U58B 1IGCH 4NQDE 4OFVA 1V3JA 1IL1A 1YUHA 4WI8A 3CFBB 3CX2A 3VA6A 4HXBL 5ACZB 1A4KB 1AC0A 4XNZC 3IB4A 4MWFB 5A2IH 1QSED 1IAOA 4DKEH 3EZ8A 3LS4L 4N5ED 5E00B 1A6VH 5IEKB 5I18H 1IT9L 3P0GB 3JZ7A 3VRJB 1A6UL 5F1KC 3MR9B 1TDQA 4ZSOE 1G7LB 5D1QB 2W59A 2XWTA 1QKZH 2VMFA 1CD1B 3O8XD 3MRGA 2WBKA 2A6IA 2ARWA 3DVGA 4HT1L 2AAVA 4JFQB 4PB9L 5GRVK 5JIHA 4YAQA 4FG6C 5MENA 2RFXB 3TZVA 2EIEA 4UB0L 4G7VL 4QHKJ 4ALAL 3VG9C 5DD0L 4PRBB 2DQDL 2F19L 3SCMB 1LVEA 2ADGB 3MLZH 4OKDA 4ONHB 3ARED 3HAEB 4QRSA 5CD5C 3WFHB 1MPAH 2OJEB 4OZGF 4CVWA 3JV0A 4P2OC 2WQ8A 4U1MA 1RZFH 3MLSH 5F96H 1FNGA 1U8IB 3VD5A 1OGAD 2IH3B 3B9EA 4X9GA 4Y16C 2MCG1 3L3KB 4QRTA 1IM9D 4Q9QL 4JO2L 1B0WA 3Q1SH 4YXLL 4NC0B 3UTQB 2VLRA 3UPRA 4LOUD 4P2QA 5D7IE 1WJ3A 2PTTA 3C5ZB 2OTWA 1MCNA 4Z8FH 4HS3A 4NP4L 4HUKB 3HLAA 1A2YA 1N3NB 1IRAY 5IF0A 2O5YH 4IS6A 1HN1A 3ZL4L 3M8OH 5D71L 2YEZA 5D1XA 5T3ZL 3RPKA 1CFNA 3MV8B 4Z7VE 2H8PA 5CEYB 2EYTB 3HE7D 1BZQK 1CR9H 2EXWD 2DBLL 3LMJL 5IBUG 5FFLA 2JCCA 3TA3A 4TSBH 4JN1L 3DX9B 4OSUH 5GS2D 4LVEA 3OB0K 1JF6A 4M7JL 1GGYA 4P3DA 3CUPB 4TN9A 2ZUTA 5A1AA 3D85A 4OCSL 2Q87A 4EIZC 4UTAH 4UIKL 3KPOB 1EEZA 1MHEB 2RHEA 2CLRB 2D7PA 3CDFA 4H0GA 4Y88A 1BFVH 5JHDE 2OS7A 4MMXC 1TQCB 5H37H 3RPIB 5GIRA 4Y5VC 1AP2B 2AJYL 4CMMB 1BZ9B 4Q9BA 3BDYL 5F21B 1PY4A 1I4FA 3C8KA 4APQC 1NCCL 4R97C 2WUBL 4OB5H 2NNAA 2EEBA 3GIZH 5F3HA 5B39G 2FR4B 4PP2A 5GRJL 4KKNA 3SPVB 4OGYL 1AKJA 4F37F 3GSNA 3KYNA 4XBPB 2H3NB 4FQIH 1S9YA 4KI5E 4M7LL 1WWAX 3O81A 3T4AA 4L29A 3GHBH 2R0WL 1TQBB 4GXVL 4Z7UB 3EJYD 4UV4L 3KWWA 1KNOA 5TQ2H 1U91B 5DQ9A 1EJOH 1DN0B 3TA3C 4FA8A 3O41B 4POZC 1WZMA 4OAWA 4QHUA 3KDMA 3S3JA 3EGSA 3EOBB 3MRKB 4XVUD 4TQEH 1K6QH 1FO0B 1U41A 4Q2ZB 5AZEH 3R0MA 1LO2H 4WU5A 4XWGL 3B4NA 3OAYH 5DD5L 1K3IA 1UM4L 1RVFH 3MROB 3F7VB 4Z6AT 4X8JA 1YY9C 5E2TL 3GM0A 1FIGL 4PRHB 5FGCB 1R3JB 1FC1A 3L5HA 4NZTH 1KN4L 2O5XL 1QFOA 2PCPA 2VLJA 3O3EB 4HWBH 5DUBA 1Q0YL 4NQVB 3T0WA 1TENA 5MEQA 4NUJB 4WEBH 3GI8L 1WUNT 1G0DA 1SJHB 5TQ0L 4TVPD 4L3CA 4Y4KB 3RTQB 4UOW0 4U2YA 4X6BB 4BKLA 3RZCB 4OIIL 5JXEC 1JPGB 4GSDH 3ULVF 3HAEG 2Y4SA 1ZHKA 5BRZA 4X4YB 1I9JH 1FC2D 2DM7A 3O4LB 4N5UA 3PWJB 3L3IB 4CVXB 2VC2L 4JB9L 1A3LH 1PX3A 3FB6A 3OXRA 3ROOB 1U8LB 2C3XA 3AB0B 2WW8A 3FT2A 5IFAH 5I1KH 2DTMH 4JR9L 1JZ7A 3VFTA 5GSVB 4JRYB 3WS6C 3AXLA 2HH0H 2AK4D 3H3KA 3HG1E 4MJ6B 2PYEE 3BXNA 4X4XB 3SEPA 1XF2A 4I0PD 5FOBB 5DYOA 3R06A 4XTRC 1JWMA 4XP9L 1UM6L 1NCUA 4JG1L 4NKMB 4KUZL 5D6DC 4IRZL 2ZCKH 5F7FA 1T0NB 3FO1A 1OARL 5F9DC 2YPVL 1MHCB 1J0YA 1A7RH 3FN0H 1G7JB 5SWZA 5DS8B 4XC1L 1FRGL 3DMMD 2GSIA 2C4FT 3P0YL 4KMTL 2IADB 1MJ7H 4U4BA 4FFVC 1OAQH 5HGHB 3VJ6B 2HJKB 1QSZA 2C4XA 3K2UH 3TPUB 1W0YT 3GRWH 4M5YL 4JFDB 3QWRA 3T3PE 3EOYG 2Q20A 3WJJC 4HS6B 1A14H 1N26A 3CFCL 5HYJE 5F9JA 5DFTA 4FZEH 1XZ0B 5J8OA 4H8WL 2QSCL 1XAUA 3LAFA 2BSRA 3HC3L 3UTTD 4MJIA 3BJLA 1S7SA 5IT2H 4RAVA 4X6DF 3L7FA 4F7EB 1KN2L 4JFPB 3TV3H 5D7KE 5EO1A 2EKSB 3QIWD 3GMRA 1I3GH 2FHBA 5I8KL 5KSAD 4C56E 3S36H 6FABH 3EFDH 3QDHA 3FFDB 4PTTA 1C5CH 4YDLB 3OKNB 1OB1A 3QFJE 4MAYD 5FYLL 1VA9A 4GG6F 3ZHKA 1I9RH 4FTVD 4XCEB 5FF6B 3GK8L 4LVNB 2FIKA 3UMTA 1PZ5B 1WGOA 4XVTL 1PEZA 1F6LL 1MI5E 1FVEB 1QACA 2GY5A 1UCBH 4HZLB 5AYQA 4YPGB 1YEEH 2VZSA 3BZ4B 5JW3H 1UVQA 1RUKL 3FZUD 2R0KL 5CZXD 1IEHA 4PP1C 4N8CH 5CLTA 3NBNA 2CSPA 4HJGA 5E94A 2W60B 1EEUA 1A6ZA 1J1OL 2V5RA 3CVHH 5HYSG 1RIVL 2XTJE 3NIGF 1VACB 2P8MA 1N7MH 2FIRT 3ZE0E 1NEZA 3FO9A 1DQJA 1RZIA 1N5AA 1XCTB 4K3DH 4LU5L 2AJSL 3ALWA 3MV11 5DLMH 3D2UB 4JCMA 5HDQH 5KVEL 1A47A 1WBZB 1MQKH 4NFDA 4LARL 1EMTL 3GMOB 1NMBL 2VKWA 3SDCA 4G5ZH 2G5RA 2Z93A 5KG9A 4A6YL 1F45A 2YBRB 1QFWI 2ZUUA 3TFKD 1IC5H 4WGWB 1I7TA 5HHVH 5I75B 4NKDB 3VMPA 3BPLC 2BCKA 2EDHA 4IOIB 1JPST 4FXKB 4JFOB 4JJ5A 3ZKMD 2N7AA 5J9PA 1ZS8A 5L8KB 3RVWD 1GVIA 3MV9E 2IMMA 4IRSA 3DXAA 4PRAB 2DQTH 3VXUE 4DKFH 2I9TA 1Z9OA 2ZSVB 5E6IB 5D72L 3ZKNC 4LPVA 4YXHH 5D5ME 3OAZK 2UWEE 1RY7B 3HUJF 1HSAA 1AGDA 5JQHC 5GGSB 5I1CH 1JK8B 4XNUL 1R5WA 4KJYB 3I02B 1D9KC 2MQCA 1A3QA 3STZB 1LEIA 3ZZ1A 1QRKA 1A9BB 3K0WA 1H3PL 4F3FB 4JLRB 3VRIA 1FL3A 3WO4C 5FYKE 3MZGB 3KYKH 4LLQB 43CAB 5E24E 3DYMA 2F8VA 1DBJH 3GRWA 2I26N 4YXKH 1EO8L 1OAZL 4WUKH 4N0FA 1HKLH 3CX5J 3VXOA 2JB6A 2V6HA 5DI8B 1RUQH 1XGQA 4E5XA 5I1HH 3UDWA 2IAMB 1YPZE 4R96B 3ZE2F 3RU8H 3B9KC 1EUTA 5L8JB 1YQ2A 1J8HA 4L5FH 1DBAL 1MCFA 1TPXC 3MA7B 4GG8B 2VDLL 5LKNA 3O9WD 1ZA6B 1EXUB 5J11B 1T22A 2HLFC 3U4EB 2BY1A 5DJXA 4IMKA 4IIQC 1KJMB 4ORGB 2VABB 3WN5A 3A6CL 1CVSC 3F12A 4CN6A 4LMQE 3EOAB 3SDDA 5IB2A 4ODVL 2EC8A 1KTDA 3IDGB 4EJ1C 5KOVC 2J8HA 4KK8D 3QIUA 4G3YL 3LS5L 5T1DH 1CFSB 1RJYA 5DMYA 4QRPA 5IB3A 3TH3T 4IOFC 3ARDA 3WFEH 3MNWB 4S1RL 1CU4L 2HT2C 2R1WA 3D39B 4RISL 2X89D 1TNNA 5ID0A 3BO8B 3LKRB 2CKNA 1JCKA 3VW3L 2VN7A 1G7MA 1UQSA 3RVTD 5D2NC 4LCYA 1KIRB 2KBGA 5EBMB 2NY0C 4S0SD 4HGWA 2EYRA 1CLOL 1C5BL 1N59B 4PJAE 5JHDD 3CVHA 1I9IH 4M1GL 4FXGA 4RFOL 3VXNB 2OX5A 1EHAA 5B4MD 1SEBA 2F53E 3ES6A 4WJ5B 3UROR 3D3VE 4EOWL 3BP5A 3MA9L 2FJFB 4OUUA 3QP3A 4XNMB 4RSVA 2EXYD 2O61B 4IMKC 2A6JB 1WTGT 1ZHBB 4KI5D 4K2UL 2I5YH 5TDPB 3V6ZA 3TO4A 5JMRA 4N1EA 3QIUC 1WEJH 2O93L 1O7SA 1A6AB 2R39A 3WUWB 4L1DA 4E41B 1ZHLB 1EEQA 2GUOA 3QUXB 5HHXL 3OR6B 4JVPA 4K71B 1FORL 4OT1H 5J56B 5CCKL 3OKEA 2VISA 1JPSL 4GRWH 5DSCB 4JVWA 4HG4J 4G8GA 3H9HA 3KPQA 5GGTL 3GJFA 4L3EE 5F7LB 1S7TA 5DR5L 1M71B 3K3QA 4OFDA 1NC2B 2ADFL 2R8SL 1IQWH 5F7DB 4CMHB 2XZQL 1IGIL 2E3VA 3EYFA 4K9EC 3CK0H 1HHGA 2WK2A 1R0AH 3SBWC 4ZUWB 5IHZA 4OTXH 3EFFB 4JO4L 2N4IA 3HFML 4ELMA 4UV7L 3S88L 2L0DA 1A8JH 2XA8L 2R56L 4ZO8A 5E6YA 4UT7H 2MHAA 1GPOL 3H7BB 1MELA 2X5PA 4OZGA 3D0LB 1GHFL 4WI3A 3NZ8B 2BHUA 3PXHA 5INCB 2NXYC 3QIBD 5BCAA 2FEDC 4FQ2L 4LLWB 1NCAH 5HPMA 4G6JH 5DJ6A 2XFXA 2EIDA 1RUPH 2E5EA 4ZFZA 1CIUA 5KW9H 4BFIA 4DQOL 4KJPD 1U8JB 1ZLUH 4OJFL 1ITBB 5A2LH 1WICA 1J18A 2OTUA 1N8ZB 4NO2B 3TESA 4P23A 1RZ7L 5I1DA 2IEPA 3G08B 1G7QA 4LRIA 4DVBA 4X4ME 4K8RC 4HJ0D 1H8NA 2ESVA 3IFNH 4R4ND 3HG1D 4MD0A 4K7PX 3E2HB 5EU7E 4QO1A 3T0EC 3P9WB 3MRIB 4M6NH 1P4IL 4PJ9D 3MGOA 2K7PA 3DX7A 4P5KA 3PGCB 3JUZA 3CCHB 3AM8A 3EKCA 2WLYA 3I85A 2NY2D 3LN5A 3U4BH 1H15A 4KZEH 2EDOA 3HMXL 3HPLA 3UEZA 2PF6A 3V9FA 5E9DB 2ORBL 3IDYC 4F2MA 1GJIA 1KELH 5E5UB 1AFVH 5IQ7L 1RK1A 5EC2A 5D2LF 3MBEC 4D2NA 4KK5D 5C7XL 5C09B 1P2CB 2VQUA 5DA4A 3MGAA 1J7VR 4UIMB 3QCVL 4Y5YC 1YMMB 1IKFH 5JOPE 4WWKD 4S10A 1KCUH 2HT4D 4QWWC 3HI5H 3P11H 5CBAB 3EDFA 3BT2L 2ED7A 2A73B 4F33A 1FDLH 5EORL 2DQFB 4LAJH 1BIHA 4WI4A 3SE4C 4G42B 4IRJD 3FRPA 2IALB 4BZ1H 3QQNA 1WIUA 4P23C 4LRIC 1PKOA 4YWGH 3S4SB 4TYUA 3RY6C 3OV6A 3K1DA 3T8XA 1ZVSB 1I8MA 5D7KD 2YRLA 4XNXL 3B2UC 3ULUE 2NY4B 5B8CA 1MJ8L 2X7LB 3QXTA 4NKQB 3V6OA 4C56D 5JW4R 3L3JA 2F58H 4O4YH 3FOMA 4GW4A 1U8OB 1RUAH 3QFJD 2X4NB 5C0BA 1YA5A 1KJ3H 4LL9A 4QYOB 1G1YA 2VSDA 5E2WL 5F3BA 3QJHA 1AD0A 3OJVC 3QB7C 1KB9J 3RKDD 5H37G 4I8DA 2DM2A 5HD8D 3WUWG 1MI5D 1XCQA 2V5MA 5EFIA 2D3VA 4KHTH 2OZ4L 3M45A 2DQGL 4GMTH 2H2SC 4XPHH 2FJHB 3G5ZB 4MD4B 4Y5XC 1UZ6F 4JO3L 3QRGL 5ANMB 3WLWC 4JFEA 4U33A 2DQHH 3BUYB 2DQEH 4JPKL 2R69L 2XTJD 1DANT 1U92B 3GI9L 4CN4A 1C8PA 3PJSA 3RIFF 2Y5TB 3QPXL 1F02I 1RZGB 2A77L 1KENL 5TF1L 3ZE1F 4S11A 1TNMA 3X12A 1NANH 3T08A 4WFFE 1A1NB 5CJBA 3RWDA 2RCSL 1P6FA 5HHPA 3G6JA 3MLVH 4JQXA 1K4CA 1MCSA 3EO0A 4YHOL 5CSZA 1QO3A 2BY2A 4XCYB 4BQ8A 4BZ2H 2DQJL 2JLLA 2ZP0T 4QXUH 2R0ZL 4X5WB 1NSNL 3QXAA 2YPLB 5D6CB 2W0FA 4NO0D 5FGBC 4XHJC 5HVFB 5F7KC 5EOQL 3MV9D 3OB0H 3C87A 1NGZB 2B0SL 1RU9H 4OLYL 1BD2A 2X4OB 1SJEB 2DLTA 1CFVH 1G7HA 5CZVH 2X4UB 3VU2A 5HY9B 1KEML 4J3WA 3IJHA 3KNBB 5FO8A 3OXSB 4J2XA 1DL7H 2AV1B 1EERB 1A1MB 4HIJB 4P2RA 3V8CA 2HFGH 2FNBA 4U0QB 4GRLD 4YHPB 3Q5OA 3PL6A 4X4ZA 1JHTA 1FZJB 3I50L 4OGAD 5M7QA 4FMFA 4NRZB 2GCYB 2CO6B 3L7EA 3DPBA 4WFED 2YK1H 4TUJB 2X41A 5FYKD 3GMMB 1J0JA 3ET9F 1U58A 2Z8SA 3WIFA 1Q1JH 4D3CH 1NGQL 3UTZB 3CFBA 4AQ1B 4JQXC 1ED3A 1EIBA 5ACZA 5H94A 5HI4D 5CEZE 2GK0B 1K8IB 3NCMA 2E9BA 1CYGA 3MLYH 1QEWA 3QBTB 3MO1A 4W4OA 5D8JH 3UAJD 3WD5H 5E8OA 1XMWA 32C2A 3VRJA 3D1MC 1ZTXH 5GRWA 1NBZA 4WHCA 3MR9A 3RWFB 1G7LA 2HMIC 5D1QA 2X44D 4JCLA 3WS3A 3DYPA 2DKMA 4QXTB 4X6DA 4JFQA 5J6GB 2RFXA 3SGKA 5T1KB 4X6CB 1YEKL 5EU3B 1FL5B 2AXFB 4PRBA 3PWUB 3A67H 1U6AH 3WJLA 3MRQB 3WFHA 2OJEA 5IBLD 5E8DH 2HN7B 3MC0A 1DBKL 3B2VH 4Z5RB 1DQLL 1I1YB 4I0KA 4ZS6C 4R7NB 5I1EL 1KXVC 1U8IA 2IH3A 4M48H 4Y4HA 1RI8A 3HHRB 4RGNC 5KJRL 3NTCH 1BF2A 4KPHL 4LLDA 1FFNA 4OGXL 8FABB 5FOJA 4Y8DC 3CSPA 3QUZB 3IETA 3LEXA 3CPLB 3TPKA 1N3NA 4RA0C 3RL1B 4KK9C 1G6RB 2QLVB 4JREB 3MREA 4BUHA 2X1OA 1DQDH 5IJKC 5CGYC 2F53D 2VAAB 4H20H 5D1QC 3AGVA 2EYTA 2VLLB 1CBVL 1D3CA 1W0VA 2PXYA 4W6YB 2HLAB 3Q5TA 3ARFD 4ZXBC 5H35A 3B5TA 5BVJB 4Y2DD 1T03H 3SCMC 4KWUA 1Y18A 1NMCB 1VPOL 2BC4A 5L9DH 1NKOA 3CH1B 3KYMB 5DFVC 3FQUB 4TULL 1MCWM 4DGIH 1N5YL 5D7SH 1ZWIB 4JHBA 1UWGH 1HHJB 4KVCH 3KPOA 1F11A 3GB7B 2IBZX 3X11A 1QNZH 5E2UH 1FYTE 3RPIA 3W9EB 1AP2A 1D5IH 3LH2L 4TTDD 2FECI 3RVVD 3SE9H 1CDBA 1J12A 1PGRB 3VI3F 2YRZA 5FXCH 3C5ZC 3VXRA 2B1AL 3SY0A 2EDNA 3H9YA 4ONOA 9CGTA 4K9EL 3NVQA 1I7ZB 3FO0L 4HH8A 4L3ED 5IBTH 3ZKSD 4BQBA 5IV2B 1BVKB 3HCVB 3HUJA 3DO7B 4OM0H 5D1ZB 3SPVA 4GO6B 1S7WB 3IS1X 2P5WE 3KJ4B 5HJ3B 1NJ9B 4PUBL 4XBPA 1B6DA 2H3NA 2CUIA 4OD3H 1VEMA 5GGVL 4OCYL 2EC9T 4NOFA 1EGJH 4QXGL 2IBZY 3N9GH 3P4OA 5EBWB 3MLUH 1LO5B 1JNLL 2OLDA 4K94C 4GRWB 2EDFA 2Z8RA 1TCMA 1N64H 4MCZA 1OTUC 3VFGH 3EOBA 4C57C 5BS0A 1OVZA 1ND0B 1JGVL 2IANA 3LOWA 5GHWH 1H9VA 1FJ1B 2GTZA 1MFAL 4AMKH 2ZKHH 1U8KB 1BWMA 3HZMB 4D8PA 1TQCC 3SDAB 3F7VA 4DGVL 2HVJB 3LHPL 4GKZA 4PRID 4OF3A 1G0YR 1J9CT 3RGVA 4LRNL 1HYSC 4PRHA 2GY7B 5FA4B 3SO3B 3CC5B 1AO7B 3RNQA 2NXZD 4L8BA 3BQUA 5DURB 1K5NA 1QPPA 1CT8B 2OJZL 3EYQC 3HA0A 4NUJA 1Z0NA 1MF2L 2WP3O 1SJHA 4OLVL 4WGVB 3IFLL 1SJXA 1XIWA 4X6BA 3RZCA 1JPGA 2P8LB 1BIIB 1TJIL 4LASH 5E08H 4X4YA 1TQBC 1MEXH 1JFQL 3L3IA 1UM5H 1HH6B 4X7CC 4LIQL 4LSPL 3RRQA 2W38A 3U7YL 4YX2H 3TT3H 4GMSL 4KRPD 3ROOA 1B3JA 2YUZA 4KMQA 4V1DE 3EDDA 4Z76B 1S3KH 5GSVA 5I19L 4PJEF 3IGAB 2IPUG 4PGDA 2KUTA 4P49A 1QRNE 1YNKL 1IC7L 2LU3A 4MS8C 4CUCA 4P99A 3MRBB 5IWLA 4UNVA 3NCBB 3P4MB 4HUUB 4MJ6A 2HJLA 4Y4FB 2W9DH 5CZKA 5FOBA 1GOGA 4MA1B 3EO9H 2ADIB 3QDGB 1Z2KA 1QLFB 2JF1A 3T4YA 4NKMA 5INDB 4TTGA 3ZDZE 2PUQT 1T0NA 2IBGA 1NDMB 5ALCL 5ESVA 3HPJA 2A9MH 5DS8A 4CADB 2E27L 5CMAA 2BFVH 3ULUD 5DHVH 4FP8L 3IDJA 4D0BB 1K8DB 3TBWA 5DQDH 3OJ2C 2MCPH 2IADA 3OAZH 7FABH 4I2XB 4Y4KC 3RTQC 2HJKA 3O4OB 4QHLA 3RZCC 3B5GA 1U8QA 3HI6L 3OF6A 3UTOA 5KBNC 4NQEB 1B2WL 4JPVH 4P3WA 2V2XB 2Q8BL 3AAZB 3U7WL 3OGOE 5I0ZA 2H2PD 4WY7L 3AB0C 2AEPL 3C08L 4X98B 5F7NC 2ZG1A 4MA3B 5MENE 3NIDE 3QDMB 4JFPA 4MHHI 3T1FB 3RIAK 2MFNA 2E7MA 2EKSA 5IWLC 2EH7L 4YHIB 4HD9A 4FNLH 2FATL 1S78D 3QEGL 2A74B 2VUOA 3DYOA 5D7LA 4YUEH 1KUMA 3FFDA 1QHOA 4HBCH 3QPQC 1NFDF 3ZSTA 2OL3A 3NABL 4XCEA 1Q72H 3TO2B 3SGEI 1PZ5A 2L7JA 3OB8A 3QI9D 4LDOB 2VLRE 4WFFD 4P2QE 5ID1B 4HZLA 2GYSA 5EZIL 4YPGA 5KTEH 3BZ4A 4IM8A 3MACL 5KANI 4I3SL 5C3TA 4XMKL 1MLBB 2NR6C 1DUYB 1R24B 4KDTC 4OI9A 1F3DH 3NFSL 2XG4A 4FQHB 3BPCB 1I1AB 2W60A 2D0FA 1JTTA 1CVRA 4OLWL 4HFWB 2DOCA 2XN9B 2C26A 2D7TL 3NIFF 4UBDC 5IM7B 5HI5D 1VACA 5C0JB 3RZWA 4W70A 4S0TD 2C1PB 4PJGB 1ZOXA 1XCTA 3QWOA 4WUUB 5DRZB 3WXWL 3D2UA 5BO1L 2JCCE 2VH5L 4MXQD 1WBZA 3HZKB 3GMOA 1EHLL 1ZA3A 1OW0A 3TBTA 1NL0H 4G9DB 4K23H 5C07A 2YD8A 4OFKA 4KZDH 5DMGD 5SV4A 5JR1L 4IOIA 4YDLC 5KVGH 4DEPB 3UYPA 4XH2B 3UJIL 1FZKB 1RMFL 2XWBB 3I2CH 4DN4H 1RURL 3L3OB 4ZYKB 2RR3A 2RAMA 4OI8A 5I2IA 2GEEA 2OXGA 4LVNC 5D2LA 3TBYB 4AH2B 4EXKA 1OSPH 4TSAL 1UZ8B 4KQ4L 5EOCJ 4QT5B 1MCOH 4LLAA 1RK0B 5CEZD 3G5YB 3VFUB 2DQUH 4K7PH 2VQTA 4NUGL 4HPYH 4TRPL 1NGPH 2ZSVA 3FONB 4X7SH 4NQXB 1CF8H 4XPGH 2EYSB 1A22B 4JDTH 4J4PD 1YEHL 3D0VA 5TJWK 1UXWA 5GS2H 1E0OB 3CFDB 5GGSA 1I8KB 3MCLL 1JK8A 3DSFL 5D9SA 5E2VL 4KJYA 3I02A 3MJ9A 1B4JH 5FUCE 3STZA 1YYML 2E6PA 4XVJH 5C0AB 4F3FA 2XG5A 3PUCA 3IF1B 4P4KB 4LLQA 3KXFE 2R23B 1KPRA 3VFOA 4ZQKB 3OQ3B 3VXPB 4XMPH 1KJ2L 4TVSa 5E70A 3WNKA 5I75C 4UINH 5J4MA 3GIVB 4XNYH 3DVNB 5LWYL 5DI8A 2PO6D 1R5IB 3K46A 3TJEH 4HK3N 1T1ZB 5IVXB 2NW2A 4HBQA 4JKMA 2QQLL 4GXUN 2X9XA 2J8UF 5CEZL 4P5TB 4OF5A 3KPLA 2VLJE 5JTWA 1BVLB 4G8FB 1BVZA 4JKLA 1ZA6A 1R5VA 4YHLL 3U4EA 1KJMA 4ORGA 2VABA 5E6IC 3S35L 1OT1A 4MNQB 4ZFOB 3EOAA 3DETD 5IFHL 1GGIL 4NWUH 5AUMB 3IDGA 5T5FL 4GXUM 2DJUA 4BSJA 4IBLT 5BRZE 4I5BB 4OQTH 1CFSA 4LLVA 2HTLD 4ODHH 4W4NA 5TPWH 2H1PL 2OBGA 3D39A 4JG0L 3BO8A 3CJJA 3LKRA 1P7QB 5ADPL 3IDIB 3F7YB 3V4PL 2VZ1A 1S9XB 1A4JB 2VUYA 5B3NA 2PETA 1G9NL 4YNYB 5F1IB 5EBMA 3FB8A 1SBSL 4N0CC 4JKPL 1E27B 3DURB 1T21B 2X4TB 3S3PA 4NM8H 3VWJB 4WV1B 1FYTD 3S37X 1W72B 5FDWB 1G6VK 5I15L 5FUOL 5EOCH 2HKHL 4U1IA 1MWAL 2IAMC 4M43L 4NQUA 5LQBL 1LP9F 5BVPL 2E7CA 2BNRD 4MAUL 3BRFA 3PQYB 4H0IA 4MXWH 2NY1D 3PGFL 5J13B 3BHBB 3K8MA 4XNMA 25C8L 1S9VA 5DD6A 4KRNA 5J11C 2P5WD 2A6JA 4U6VL 4YBLC 3OR7B 1ZHBA 1T89C 1M05A 5TDPA 4CU6A 1VB9A 5HHQB 5DT1L 4DZ8B 5DHYB 4GBXD 4K94L 2NPLX 1A6AA 3WUWA 5EO0B 4E41A 1ZHLA 3QUXA 2IF7A 3OR6A 2J1KA 1CICA 3W0WD 5F9OH 4LCIL 4S1SH 4OCXH 1AE6H 5DSCA 3ECBA 4MJIE 1Z9LA 1IGYB 4C83A 1W8OA 5E8NB 4WO4D 4M9OA 2B5IC 1M71A 1L9MA 1ERNA 5F7DA 3MFFB 2MTPA 1T04B 1ZSDA 1FVCA 2R4RL 3INUL 5GZOC 3IVKB 3MODH 1C16B 1OTTD 4FN0A 1P5VA 1T6WA 4PV8B 2Y7QA 4CRPA 1U2CA 1UB5A 4XX1E 3RDTD 1EBPA 3QDJA 3WFBH 4XC3L 1KIPB 5ESQB 3RIAF 5IHUH 1PBYA 3H7BA 3TIEB 4RNRB 1CLZL 3GKWH 3D0LA 3R8QA 5TE7L 3GUTA 5IESH 3NZ8A 5INCA 3X17A 5KS9F 2F54E 3REWB 4HIXL 5I71B 4WI9A 1JI2A 4L9LB 4CL7A 3JTTB 3CSBA 3R8BB 1HHHA 3QEQA 1U8JA 4L4TB 4QTIL 4DW2H 3BKJL 3QUXC 1OL0A 4LCUA 1FO0L 5L2KB 5TF0A 5JW4M 2CRZA 1N8ZA 4NO2A 4Z7WF 2JJVA 1HCVA 3P73B 4OZHF 2WINB 4H1LB 5FCSH 1QRND 4PJGF 1XEDA 1NAML 1OQOA 1YQVL 4PJ8A 3KPPA 5K93A 3BEVB 4NJ9H 5CD5D 3MOAH 3MRIA 5LXGH 4JM4L 3L5WB 2HVKB 5IMOA 5HHMD 4P46D 3MV7B 4R0LB 4QRQA 3V8OA 1BJ8A 5GZNC 3OKYA 4K55A 1DBBL 3LRSA 5EZOL 4KV5F 5E9DA 3IJYB 2F8XC 1ZANL 4JO1H 4NPYA 1JGDB 3H3PH 5DVOA 5IOPB 3H3BC 2VXSL 3DXAE 1WISA 1UWEH 5C09A 1P2CA 4UIMA 2NY5H 2V17L 4D9LH 1YNTA 2EZ0C 4I48A 3VWKB 2UY6A 5CBAA 5JA9A 2A73A 5D70H 1IBGL 5DUMH 3GSVB 3U36A 3MOBL 4PGEB 4G42A 2VDQH 2VRAA 3C9NA 3PF2A 5MEND 3E3QC 3QHFH 3TZVD 4RIRB 3S4SA 1P7HL 1SY6A 1AQKH 5DHVB 2NY3B 3ISWA 1ZVSA 3AY4A 4ZFGL 4U05A 2AEQH 3IDXH 1MFCH 1UACL 2X7LA 3E2HC 4BELD 3JVGC 3MUY1 1UT9A 2X05A 3GEWB 3X14B 2BSSB 3O45A 3OKDB 4PJIF 4PS4L 1INQB 1U8OA 1JGLH 2QJDA 1T20B 1R3KB 3HNSL 5DMKB 2ARJA 4QYOA 3W11D 3ZYJA 1UA6H 5D7JB 2HFFA 2BSTB 4I0PA 4RAUB 3V4UL 4DAGH 5DHXB 5FCUH 2VLRD 3F5WB 3NZHL 2FH8A 3OPZL 4P2QD 3H9SB 4G80A 5IVXF 3RL2A 1J8HE 2FX9H 5DTFB 1YEDA 4CN1A 1JPTL 3SQOL 1KFAL 2FJHA 3G5ZA 3U83A 3V7AG 4MD4A 2AKRB 4FQLH 2R2BB 1FV1A 2CKBA 2N56A 3V0AC 4PB0L 5D1XD 1REIA 1DDHB 5EZLB 5IP4A 2DJSA 1U92A 1TZGH 3JV6A 2Y36L 4QRPE 3ZT7A 3T1WA 2Y5TA 4O5LL 1P4BH 3MPCA 4P9MH 1RZGA 2C9AA 4MMZC 4O02L 1FSKB 3TA3D 5I1IH 1JRHI 1X7QA 2DMBA 4HF5L 1A1NA 2NY4C 3BPNB 2NYYC 5CKGA 3D85D 3BWAA 1JTOA 4X6EB 5E2JA 4JHAH 3OKOA 4XCYA 4AIXA 1PKQB 4X5WA 1TJGL 1EVTC 5BW7C 3LQAC 2YPLA 5D6CA 2R15A 2BOBB 3HE6A 3DRTB 3RWIB 3PWLB 4ZFFB 1B0GB 3MRJA 4FQXA 5GGUB 5HGGS 1GGBL 1I8IB 1NGZA 3QUYA 3C6LA 5I73C 2X4OA 1IEBB 2MQ0A 4OCWL 3LEVL 4Q6IB 3NGBB 5JNYB 4WIQA 5HGAB 2D7OA 4EN3A 5HPOA 2X4UA 4DJMA 2AI0H 4NN5B 1ACZA 2V7NA 4OV5B 4ZTPL 1T2QL 1IM9B 3RWJA 1OAUH 3OXSA 4LSSL 1AKJD 2WWKT 5E99H 3BMVA 1A1MA 1QR1B 1FZOB 3B9VA 1Q38A 3NN8B 1HEZB 3GNML 4YHPA 3SGDI 1GCFA 1B6UA 1FZJA 2ARJQ 4QY8B 3PGDB 4NRZA 4FQJH 3V0VB 1F5WA 3E1F1 4PJBF 4BQCA 4PY8I 4XP5L 3GMMA 2EH8L 4OLUH 4YDJB 2J5LB 4ZD3L 2J6EH 2CR6A 3VE0B 3PDOB 5T1MB 4ISVA 4JY6B 3NPSC 3EDJA 2D03L 4G8GE 5HI3C 2GTWB 3GSOB 4Y7MA 1K8IA 5I30L 2A9NH 2FEEL 3GGWA 4JHWL 5CBEB 1AIFA 4WFGE 1NCNA 3N1PC 3QXDB 1TCRB 1J05A 4LLMB 2QSTA 3CDGB 3NFNA 4NYLB 3RWFA 4XZUA 4WI2A 1BGXL 3CZJA 1KLUB 2G60H 2ICWI 4QXTA 2V7HB 1RHFA 3DROB 4ZAKA 4ZOBA 1OY3B 4X6CA 5F44A 2YA0A 5EU3A 1FL5A 2AXFA 4OZGE 1E4JA 3MRQA 1UB6A 3RWCB 3ME0A 2HN7A 2X1PA 2AXGA 2PTUA 1IAKB 4Z5RA 1I1YA 4NIKB 4P9HH 5BRZD 2X10A 1IGCL 1NFDA 1KCRH 4KKAC 1HK6A 1Z9MA 1ORSA 1X44A 5A16B 2JKXA 3KJ6H 4DKEL 1KLFA 2NY6B 4XAKE 1S9KC 1A6VL 4U0RC 5I18L 3QUZA 4PJFF 3LRHA 3KYAA 2LAAA 4M00A 5MEPA 4Q74A 1A9EB 4I3RH 2ESVE 2C1OA 2VTFA 3CLFH 1QKZL 1G6RA 3HZVB 4BQ6A 2EIBA 4NNPH 4XP6H 2DL2A 4HKBB 1FCGA 1PG7X 3TP4A 2VAAA 4O2CB 3MLZL 2DMKA 2BRRH 2DIBA 4JFYB 4Q0XH 2VLLA 1MPAL 4YGVB 1BX2B 2OR9H 1XH3B 4PV9A 2CIKA 3HI1B 5SWZD 5D96B 1RZFL 3MLSL 5F96L 1SYVB 5I8EA 4DCQB 1MH5B 2RBLA 3CFJB 3CH1A 4Z7QF 5GS1B 4Y19A 3KYMA 3ABZA 4C58B 3FQUA 3DHJA 1YEIH 3Q1SL 1BMGA 5SWSA 1R3HB 1ZWIA 4PP1D 3LQMA 3BN9D 4LNVA 3VGHA 2PYFB 3BIKA 3QWRD 1QHPA 1GOFA 4Z8FL 5AD0B 2ENSA 1QZ1A 3C60C 1R3LA 1AHWB 1JZ6A 4XT1C 5JA8B 2O5YL 3E8UH 5C9JB 2XQBH 3M8OL 4MJID 3QUZC 3FQRB 1FBIH 2AQ2A 3LDBB 1I7ZA 2F5AH 5IV2A 2AXJA 2VWEC 4NSKA 3DO7A 4PR5A 4LSTH 1CR9L 1S7WA 5HJ3A 4JREC 3VFWA 1NJ9A 2P49B 3SJVA 3AS3A 4HMCA 3V6OE 2HP4A 5E7BA 4TSBL 4OCLC 3FJTA 4OSUL 2ZG2A 1WWBX 5IW1B 5C0BE 5CINH 1CI5A 4GW1B 3H7LA 2AK4B 3OTTA 4UTAL 2Z31B 3UTPE 2DWDA 1CZ8H 5EBWA 3MRFB 3C6SB 5K59F 1HXYB 1ZXQA 3HB3C 1NMCC 3RBSA 5IR1A 2DLFH 3FN9A 2CD0A 4PJ5A 4OLZH 2OM5A 2ZUWA 3EW3B 4RBPK 1HDMB 3HZMA 3SDAA 4JFEE 2HVJA 4CVZA 4OB5L 3GIZL 2J8UA 2ZCLH 4N1CA 5DUPH 3QRFM 3DARA 5CHNB 1A7BA 1Q9KA 5FA4A 4U6YA 4GRMB 3TN0B 4N0UE 2NX5A 4R2GD 3QHTC 3M07A 4FQIL 1BQHB 5BOZG 3MLTA 3GHBL 1YZZA 3SDCD 5EU4B 5D1ZC 1VGKA 2SEBB 3G6JE 2BNUB 3KJ4C 5CJ8A 5TQ2L 3ULVE 5I9QB 1BIIA 3TCLA 2MWCA 2I60H 5F9AC 4PJHF 1DQQB 4HKXB 4AG4H 3PNWA 1RJLA 1HH6A 4TQEL 2DRUA 1K6QL 3MLRH 1BJ1J 3QIWB 5AZEL 5ISZB 4UUJB 4NO3B 3D48R 2VDOH 5HHOB 5KSAB 1BD2E 4OQ1A 4YC2B 4IRSD 4A6YB 1RVFL 1D6EB 3DXAD 4Z76A 5FHAH 3F58H 4OF7A 5DEGA 4OCRH 4MAYB 1U8HB 1CE1H 4LSQH 2ZOKB 1YYLH 2D7QA 3MRBA 3P4MA 4HUUA 4NZTL 4Y4FA 4EDWH 3MTRA 1NUNB 4HWBL 4P2RE 5FGSA 1F3JA 3SDXF 2V2WA 4XNQB 3V5DB 1LP9A 3QDGA 3G6DH 3WDHA 4WEBL 5INDA 2RQ8A 4RX4A 5MERA 3SO3C 4IOFD 2IQAB 2C7UA 2Q86A 3A0OA 4JRWA 3MSPA 4GSDL 5C0CB 4CADA 1J0IA 1I9JL 4D0BA 1CIDA 1K8DA 2IH1A 2K1MA 4ODSH 3P0VH 5KAQF 2E6JA 2IFFL 4I2XA 1A3LL 2NY0D 5AG9A 1SYSB 4YBQD 3NMEA 3STLA 3VG9B 1DFBH 3KYOB 3OL2A 4PBVC 3RGHA 2HYMA 3MCG1 2CO7B 2XIDA 3QZWB 5IFAL 4UQ3B 5GRZA 5I1KL 1QP1A 2DTML 3S37H 3L3GA 3OGCB 3AAZA 5I1GH 3IDNB 2HH0L 1UYWH 5L7XH 1GSMA 5CILH 3AMLA 3MLWH 4XVSH 3ZHLA 4BH8B 1J8HD 4X6DE 1JP5A 4OLXH 4MA3A 3BKML 1CDIA 3CVIH 4Y16B 1TITA 2GITA 4R8WH 2ZCKL 4Y4FC 1TETH 1A7RL 3SDDD 2WM0A 3FMGH 3FN0L 5FYKH 4NQDB 1AXSB 4M5ZH 5KSBF 3QIUD 1S9WB 4L9DA 4GG6E 1RHHB 4BH7B 1MJ7L 4K3EH 4QRPD 4FFZH 3ARDD 2BJMH 4QEGA 1OAQL 1I75A 3QO1A 3F7PC 5JORA 4UQ2A 1CS6A 2VZOA 3TO2A 4GOSA 5CWSB 3K2UL 3MNZA 4K3GA 1XF3B 3IU3A 1K2DB 1CDGA 5KS9A 5T1LB 5ID1A 4ZSOB 4X5XB 1KTLB 2XTLA 1A14L 1MLBA 4FZEL 2EDKA 3ARGA 1BLNB 3VFMB 2JB5H 4JY4B 1EHNA 1R24A 1MUJB 3LPGA 5IT2L 3JWDC 3Q6FA 1I1AA 3NIGE 3TV3L 4PFEA 4TSCH 1Q94B 3U0PB 1QG3A 3CH8A 4OZHA 4ETQB 3LSOA 5C0JA 4PG9B 4MDIA 1X5ZA 1I3GL 3MRLB 4PJGA 3RAJH 1CL7H 4JY5H 3S36L 3VDCA 6FABL 3EFDL 4GJTB 3NCYS 3QO0A 1C5CL 1Q9WB 4XPAH 4QTHA 4AENB 2NXYD 1I9RL 5D7IB 1P53A 2FEDD 2HKFH 1LD9A 4R97B 3TO4D 2ZCHH 2APBA 1LE5B 3ESVF 4MJ5B 1UCBL 1XGPA 1YEEL 5JW3L 3O9WB 1AGBA 1GGCH 2QQNH 1FZKA 2VNCA 2XWBA 5H8DA 1KB5A 4R9HA 1YECH 5E5MA 4N8CL 1P6AB 4QRRA 1UZ8A 2VXVH 2DYPD 3VXRE 1JWSA 2YA1A 4Z7VB 4QT5A 4G8GD 4K8RD 4PLKD 3G5YA 3VFUA 3MMEB 3GFUA 1WCBB 4XCNB 1N7ML 3SKNB 3BWUC 3HUJE 4WFGD 2WLZA 2B1HH 1K85A 5CJXA 4EUPA 5DLML 3R1GH 5HDQL 2WBJC 3SQBA 1MQKL 1FGNL 4G5ZL 1OP5K 3LKQB 3ARPA 2P1YA 4M1CD 2EDBA 5IHLB 1IC5L 5HHVL 5KZCD 3VFPB 5GS0D 1QA9B 4PJIA 3VXPA 5JDJA 3MGTB 4PJCB 5BS0E 1RULH 4KUCF 2IANE 7CGTA 3WHE1 1XF4B 1A02N 1X4ZA 3GIVA 3EYVA 1WZKA 4HDIB 2XZCH 3ZKQD 4ZOEA 3ZE2E 1R5IA 5DJ2B 1MVUA 5KSUA 2Q3AA 4HC1A 2GT9A 5HXMA 2DQTL 3QZWG 5IMMB 5IVXA 4LF3A 4DKFL 4XAKD 5FIEA 5FGCE 2QQQA 4P23D 4P5TA 4YXHL 4N9OB 2KQNA 4S1QH 5GGRA 4G8FA 4YBHA 5I1CL 2X9YA 2ESVD 4ZPTB 3B83A 1OF2B 1MHHB 1U9KA 3LCYA 4QF1B 1DZBA 1LNUB 1W0WB 3G04B 4WNQA 2YHGA 1CXHA 1X5YA 2GJZA 3RI5K 1QFWM 2YUWA 3QHZH 4Z0XB 5I16B 4KROD 3O6LH 1MLCB 1SHMA 3KYKL 5EZJB 3OX8A 4HK0B 2CXKA 5CJQH 1LEKB 2XPGB 2VAJA 2IPKB 2VL5B 2BHYA 2JJSC 1DBJL 2JE8A 4HJJH 4TUKH 1I1CA 4M1DH 4YXKL 4WUKL 2NY7H 3LB6D 5E56A 4KXZI 4P4KC 1P7QA 1HKLL 3IDIA 4WDIA 3HKFA 3KLAB 1RUQL 1S9XA 3JV4A 5F7WC 1OOAA 1KPUA 2RB8A 1NGYB 2X9WA 4GKOA 4MNGA 2APVA 4YNYA 5I1HL 5F1IA 3RU8L 4MDJA 5JOEA 3DURA 2X4TA 2VE6B 4L5FL 3VWJA 4Z7OF 1FYHB 3GO1H 3IAQA 4NN6B 3BDXA 1W72A 1U95B 2P24B 2BNQA 2Y6SD 4D94A 1I3VA 4JE4B 2CIIA 4BUGA 4G8EB 1T7ZA 3NACH 5HHNB 3SHSA 1PG7W 5FK9B 3QJFB 4KJWD 3FQXB 4PJDF 5T1DL 1MCCA 3WFEL 1OAKH 4M3JA 3OR7A 4LAQH 1P4LB 1E6OH 3FAWA 2Y06H 1H3VA 1RIUH 4DZ8A 5DHYA 5C0BD 4LKXA 1ZT7B 4PJBA 5EO0A 5H2BA 4RDQG 2Z8VC 1OCWH 3HG1B 3HTLX 4I4WA 2PYEB 3PV7A 3DV6B 3MLPA 4RQQB 4PJ9B 4WU7B 3QNYB 1I9IL 2P7TA 4U1GB 3O2VH 1JVKA 1LK3H 1MY5A 4D9QD 4AYFA 3Q5YA 2NY2B 1FNHA 1ETZA 4YDVB 3EHBC 4ZUTB 2V2TB 3BP7B 3GKZA 1T04A 3VWJC 3WNMA 4JFED 4WV1C 3U9UA 3ULUH 5D7LE 4LPTA 5BZDA 4PV8A 1WAAF 3MRMA 2JIXA 4JO2H 2H32A 4YXLH 1WBYB 2VYRE 4NQSB 3FTGB 4WWKB 1L0QA 3TVMA 4Q58C 2I5YL 1WEJL 4B50A 3C2SA 3V6FB 4ESKA 3O3DB 3TIEA 1B9ZA 4RNRA 5HYJB 1N0XH 1ZEAH 3ULVD 1RUMH 2UY7A 2BXZA 3GJEB 1CFTB 3PWPB 5M94B 3C2AH 4OT1L 2CK0H 3HRZB 3JTTA 4MB5A 3BOVA 3FO2B 4L4TA 4RFEB 4KHXH 3MRRB 3S5LB 5TH2A 2Z92B 4AIOA 4PJFA 2C3VB 2DBLH 3BPLB 4C56B 1JE6A 1IQWL 4JFXA 3RWEA 1T1WA 1JWUB 1UJ3C 1E4XI 2C4FU 1S7VB 3CK0L 2NW3A 4PD4K 4H1LA 4OZ4A 4OTXL 4XRCA 3FFCA 1EZVY 3KS0J 1Y6KR 4PG2A 4P2RD 4KRMB 2R9HD 4UT7L 3PXJA 4ZS6D 5C07E 2HVKA 3PL6D 5I17A 1DVFA 1AXTH 2AV7B 2GK2A 4PRDB 3O2DA 4R0LA 4NNXB 3TLRA 2VR5A 2E7LA 5IMKB 3T3MF 3WLBA 1NCAL 4G6JL 4PRNB 3IJYA 5D2LE 1RUPL 4NT6B 1JGDA 1NCCH 3QQ4B 1B88A 5IOPA 2RIKA 5KW9L 4JEGB 4MXVF 2GKIA 4UOW1 1ZT1B 1LO3H 3WO4B 4OM1H 4L9LC 1LE9B 2W9LA 3VWKA 3WIHA 4XCFH 1PG7H 4D9RE 3GSQA 3QEUB 2ZUYA 3P9LA 4KVNH 4UV4H 3GSVA 4M3KB 3IFNL 1T7YA 3AU1B 4Q7DA 5D1QD 4CGTA 4Y89A 2QBWA 1N4XH 2N7BA 5AG8A 4LPYA 3D9AL 1AXIB 4M6NL 3MYJB 4RRPA 2Q76A 4NO0B 2NMSA 4QNPE 5TDNA 3U4BL 4KZEL 3ARBA 1TPXB 4XP4L 1SQ2N 1F42A 2D31A 2V9QA 1INQA 1UM4H 1KELL 4PJCF 2OR7A 1T20A 1AFVL 1R3KA 2X4QB 4ELKA 3VXUB 1MIMH 4Y4HD 4R0LC 1X5FA 5D7JA 2E7LC 2XQYK 5DXWA 3D69A 4B7LA 1O5DT 1IKFL 5D5MB 2BY0A 2UWEB 3F5WA 5F7MC 1KCUL 4UZGA 3HI5L 3P11L 4MLSA 1X5HA 4QHNB 1MQ8A 4GRLB 3VRLF 1KLGB 4U6HB 1FDLL 4M7ZC 4KGJA 4KK6D 5DTFA 4U1LB 1FIEA 3OKKA 4P57A 1TTUA 1UZ6E 1A3RH 3H0TA 5E5RB 5EPMB 3WDIA 4O58H 4O2FB 5EIIB 1UC6A 4BZ1L 2R2BA 3RKPA 4L8SA 2X4RB 4IHOA 2C3WA 3BEWB 4YWGL 2VOTA 1AQDB 4LKCA 5EUOB 5EZLA 4NQCA 5GSRA 4GAYB 1ZLSH 1A6TB 2APWA 1FFOA 5GXBB 1RFDH 1QSEE 4HWUA 2PXYD 5DK2B 4KGLA 1FL6B 3KS0H 3OJDB 4L3AA 3ZE1E 1H0DB 3D39E 2ZJSH 3MUJA 4I0CC 4O4YL 2F58L 2N1KA 5C8JB 4U1HB 1RUAL 1AI1H 1E4KA 1KJ3L 1YPZB 1OTUD 3BKCH 3L3HB 4ZODA 5BQ7B 3FHQA 3WUZA 1DR9A 3O6FC 1LGVA 2B4CH 2I27N 4NDMB 4YDIL 4KHTL 1TVHB 3SGEH 2OQJB 3BGFB 1I85C 1YC7A 2XNAA 3DRTA 4GMTL 3PWLA 1CD8A 4G9FB 1HYSD 5GGUA 4XPHL 1JIBA 3V5KB 4MA7H 2W65B 3VXRD 1VEOA 1OGAE 2DQHL 5HGAA 1U8MA 3AS1A 2DQEL 1QLEH 3RVXD 3VFRB 1LEGA 2O5ZH 4L4VB 4WW1A 1HXMB 3QUMH 3SDXA 3UTSB 1WZ1H 5DZNA 2IMNA 3TGXA 1MCPH 1WF5A 2P45B 1FZOA 5LGJB 1NCDH 1NAKH 3NN8A 3E6FB 4QY8A 4NC1E 3PGDA 1WZLA 4E41E 3GMPB 4BZ2L 1FSKC 4N5EC 4QXUL 4YDJA 2CQVA 1CG9A 2DS4A 1I3RA 2F53B 2JJTA 3BPNC 4JY6A 1OD7A 3T0DA 3HC4H 5BS0D 2BVPB 3D3VB 5E1HB 5JDSB 3O8XC 2HRPH 4MS8D 2XXMB 1JN6B 1RU9L 4ZUUB 1CFVL 3UXFA 4LLMA 5E0QA 2W0LA 4UDTB 3CDGA 4NYLA 1CFBA 3AREC 3Q6GH 3LPFA 1QBMH 3RGVD 3DNKA 4PRHD 4JHZA 1KLUA 5FM8A 3FT4A 1DL7L 1FH5H 3DROA 3GK8H 1E6JH 1MREH 1FE8H 3QDJE 2HFGL 3LN4B 3NGBC 4Q6IC 3GJFK 3VXTA 3X3GH 2FWOA 4NN5C 2YSSA 4ZUSB 1F6AB 2UYLB 4RBPH 2CLZB 5KSBA 4Y4KD 1AGFB 1C7TA 1XIWD 3RZCD 2YK1L 4LOUC 1KIQB 1IAKA 4S1DD 1Z5LB 2D0GA 3PDDA 1Q1JL 4RMQA 5T33H 3QEQE 4L3EB 3T0EB 3AC0A 3HR5B 4WTZG 5A16A 1OQXA 2J5LC 3MLYL 5D8JL 3WD5L 3FT3B 1BBJB 2DN7A 1ZTXL 3W39B 1A9EA 5CP7B 2VB5A 1MFEH 4H25A 3HZVA 2VDKH 3U1SH 5ETUB 4MSWA 5DK0B 3PHQA 4HKBA 5KSVB 1YJDH 5BXFA 3A67L 1T83C 1JYNA 1INDH 3L3DB 1U6AL 3DV4A 4O2CA 5FECB 5BV7H 4NO5B 4YGVA 3GMQA 1WFNA 4HUNB 5E8DL 1ONQA 3G5VB 2IQ9H 1I7UA 4ZFOL 5IEHB 3B2VL 3HI1A 3CLEH 5FKPA 4YH6A 1SMAA 4NCC2 1EO7A 2ADJA 5E9DE 2K9UA 3K81A 1EFQA 1D5ZA 1MH5A 4DCQA 2K3TA 4MD5B 4G6MH 3CFJA 4M48L 4EI6B 5GS1A 3P2TA 1QR4A 4WEMB 5C09E 3CSYB 4GKSB 4CJ1A 3OF6D 1IAIM 3U46A 2L7UA 2PYFA 1UH3A 5AD0A 3D25A 2AXHA 1J10A 1QSFB 3VI3E 1DEEA 4FZ8H 4LBEA 1I7RB 5L6YH 4PJXF 3QXVA 3EBAA 4RA3A 2NY6C 4ZDHB 4LHUA 3VXSB 3DVFA 1M1SA 2QV2A 4G8IB 1DQDL 4JFZH 4JPWH 3TCXA 4D0DB 5I8OH 3QUMA 5F7EH 3D18B 3EJYC 5KVDH 1GIGH 4H20L 4OZIB 4JZOA 5I66A 3ZHDA 3QNXB 4QCIA 5D7LD 4EI5A 1T03L 1P5UA 4O00A 4GW5B 1V7NH 2G75A 4XVUC 3GSWB 5L9DL 3VI4F 4NKOA 1JZ2A 1NLDH 1OSZB 1RZ8B 3RWGB 4GW1A 3L9RB 1E28B 4DGIL 1VSCA 5D7SL 5IK3B 2FSEB 2Z31A 3CZFA 3RWHA 1UWGL 2BVQB 5D96C 4KVCL 3MRFA 3QH3B 4F37K 3FB5B 4F7MB 1HXYA 4NQTA 3EYSH 4MQ7B 1QNZL 5E2UL 2NLJA 1AD9B 5GS1C 3S98A 1J1PH 4KH2A 1D5IL 3SE9L 2VXUH 3GMNB 2ZNXA 5E1AA 1EEYA 3TM6A 3KLSA 4F7PB 1HDMA 1FFPA 2BDNH 3A6OA 4AIZB 5DO2D 3PHOB 1AHWC 5IBTL 3LQZB 1CDJA 5BOPA 5CHNA 5EUOF 4OM0L 4GRMA 5EU6A 3TN0A 3CFKB 2VLKB 2Q6WA 2CLVB 5C0GB 4HX1B 3D2UD 3V52H 1BQHA 1T66D 1XGTB 5A43C 3LDBC 2R1YB 1X5JA 4JN2A 5EU4A 5B38B 1EGJL 2SEBA 3C5JB 3N9GL 5F72S 3C09C 5E8EA 4JQVC 4ODXB 5C07D 3UTTE 3MLUL 2Z4QA 4DFIA 3V5HB 2FRGP 5IB1A 1DQQA 3WFZA 1N64L 2AQ3A 1KBGH 1UXSB 2L4OA 4H8WC 3VFGL 1BQSA 1Q9OA 2Z31C 1WC7B 5GHWL 3DGCR 5ISZA 3VD9A 4NO3A 4AMKL 5HHOA 5IBUB 2ZKHL 5CIPA 4PJEE 4A6YA 4NFCA 2OYPA 4MQTB 4MJ2A 1U8HA 4FTVE 4ZMAT 2P47B 2ZOKA 1HIMH 1XT5A 5DDHA 5EC1B 1RIHH 1IGFH 2EDJA 1BP3B 4UT6H 1YC8A 4F8TA 3DI2B 2DLIA 3BP6B 5LGHH 1HQ4B 5C2BH 4XNQA 3K4AA 1GZPB 2XWJA 5J57B 4J1UB 2OSLB 2IQAA 1I1FB 3DRQB 3TN0C 4JANB 1MCEA 1NUDA 4X9HA 4F80A 4PJDA 1ZHNA 5C0CA 4LASL 2LTQB 1JPSH 3KPSA 3QNZB 5E08L 3QR2A 4UNTA 1MEXL 4KC3B 1UM5L 2Z91A 3KG5A 3I84A 1A0QH 5TFSH 4YX2L 3TT3L 5I9QC 4M7LT 1SYSA 4QHKI 4KTEH 1OP5H 3OKLB 1NFIB 3OGCA 3THMH 4JO4H 3HFMH 1DANU 4HIEB 3OHXB 3O11B 5A2JH 5C3LD 2IAMD 4P2OA 3QIWC 1XR9B 3O6MH 3WHE0 3MRNB 5HGDA 3GSNH 4BH8A 5KSAC 5DRXB 1KJ2B 4Y16A 1CDUA 4RGNB 4N8VB 3EO9L 4MAYC 1GHFH 1MCBA 4M8QB 2D9QB 2GFBB 1CD0A 5DK3A 4JGJA 3ZTNH 3ZSSA 1U0QA 2ZOLB 2EKJA 4FQQB 5KVMC 1T2JA 1WAAA 2QKIB 2A9ML 1QVOB 4NQDA 2BFVL 1QYGH 2ZNWA 1S9WA 2D2OA 5DQDL 2EDRA 1NFDE 1RHHA 2MCPL 3KPNB 4BH7A 7FABL 4OFPA 2HJFB 3FZUC 1X6NA 4XBGB 3OJMB 3B6SA 3D39D 3VGBA 4WTWA 2CDGB 1JJUA 4XB7A 1DP0A 3L6FA 4HUWA 5T1LA 3DIFA 4JPVL 3VH8B 4ELMF 4ONGH 2AJZB 3BESR 4U1NA 4ZXBB 3CAFA 2BERA 1X5LA 4RFNB 4U7KA 1IM3B 2DBJA 5FAAA 1MUJA 5GZOD 4HW6A 3QISA 3NIFE 5ICZB 5FKAB 3DGGB 1KXTB 2DDQH 1Q94A 3U0PA 5C0EA 3NFPB 2E9WA 4PG9A 1K4DB 4FNLL 3MRLA 2ATPB 4YUEL 2CR3A 4Y5VA 1SVCP 2PO6B 3TYFA 4HBCL 4PGZA 3ZKMC 3FOLB 4YHNB 4NZRH 4AENA 4PD4J 4Y19E 2VXTH 4J3TA 3RVWC 4APQA 1Q72L 5SWSE 4F9LC 4DZBB 2ZUXA 4K3JH 5B38G 1MWAB 3AUVA 3VGFA 3MCKA 3S6CA 2PR4H 4XPFH 4DKDC 4CW1B 4F7TB 5KTEL 1IC4H 3T0AA 1JRHH 4E41D 5DEFB 1VFOA 3QUXD 2X4SB 2YPKB 3IU4H 1CICD 3BVNA 2VQ1B 2H9GB 3SKMB 4KAQL 4JZJC 3K80A 5LAXB 4OBSA 2I9LB 3JTSB 3IFPA 1QD0A 1KT2B 1ZK9A 2X70B 1HHIA 3PABB 4KY1H 4XCNA 3X13B 3VXQB 4OZIF 2G5BB 1FVDB 4LP4A 3SJVE 2WANA 3DWTA 1PQZB 1KPVA 4X7TA 5CSGA 3LKQA 1G7PB 5C08B 3QDJD 1NL0L 5GJTH 5GZND 3WE6B 5JHLH 1G0XA 1WIPA 4JPIB 3P30L 1G7IA 4JFFA 3WNPA 4KZDL 5GGTA 3GSUB 2AJUH 1FYTB 5KVGL 1HQRA 4DUWA 3VFPA 4W6WB 1QA9A 1CN4A 2PW2B 3I2CL 3MGTA 4PJCA 4PJ5E 4M9PA 4B5EA 2FJGB 1XF1A 2EZ0D 1XF4A 1OSPL 1B90A 2NY1B 3QEQD 1T0MA 1MCOL 4J23A 3O9WC 3ROLB 4MCYB 2FGZA 5JXEA 2P5WB 1EUUA 2DQUL 2J8UE 1NBQA 4K7PL 4HPYL 1NGPL 4X7SL 3BDBA 4XPGL 4ZO7A 4JDTL 2NX5E 1PZUB 4KK8C 4GBXB 3BYTA 1N6UA 1HZHH 3IDMB 4ZPTA 2XKNB 4PJ8D 2W1NA 3KPRA 4QF1A 1W0WA 3G04A 1B4JL 3BZFA 4N8VG 3CU1A 4HV8B 4XVJL 1S7XA 4Z0XA 3VGDA 5HGBB 2R0ZH 3WS6A 4QOKA 5EZJA 1P1ZA 1LO4H 4HK0A 5BMFH 1LEKA 2XPGA 2IPKA 2VL5A 3RVTC 4XMPL 3BW9A 2AJXH 4WW2B 2CMRH 5HYSB 4HUVB 4PGCB 4WO4B 1MAKA 4OLYH 3Q0HA 5E9DD 2EE9A 5JQ6H 1MJJB 3HC0B 1NAMB 1XGUA 4UINL 4XNYL 5D6DA 1CDYA 2VIRB 3CFEB 3KLAA 5DJ8A 4F7CB 1NGYA 3TJEL 5C09D 3QCTH 4OF6A 3H8NA 3VH8G 1INEH 2GSGA 3HS0B 3T77B 3BAEH 3G5XB 5I8CA 3UYRH 2EC9U 1VFBA 3HMXA 2EXYC 1NGWB 5K9JH 3U0WH 1LP9E 5BV7B 3QDGE 3G6JF 2APFA 4KI5C 4G8EA 3V7MA 1X5IA 4LLYB 4NWUL 5HHNA 2PTVA 3WJJA 3BGMB 4LDLB 3IRPX 1OM3H 1DE4B 1MRFH 5FK9A 3QJFA 1MSPA 2NY4D 4OQTL 4BFBD 3RX7A 4KQ3H 4ODHL 5TPWL 1X4YA 2QQKL 3I6KB 3EUUA 3N50A 4NM4H 4P9HC 4V1DB 4X0KB 2QR0B 1H3XA 2LQRA 3ALXA 3WNNA 2J2ZA 3FRUB 3K8LA 5FEBA 1ZT7A 1QRNB 1WT5C 5FO7B 2VZUA 1IGJB 5F88B 1ZLWK 1NH6A 2PYEA 2A6DB 4H26A 2W9EH 4P4RB 4WU7A 3QNYA 4NM8L 5ILTH 4HWZB 1OPGH 3SKJH 4JQIH 5KANG 4P46B 5EOCL 1MAMH 3WHXB 1U8PB 4ZUVB 4TVPL 4WCYH 1ACYL 2WWMD 2V2TA 3BP7A 4CDGC 4Z7NF 5EBLB 4MXWL 4NN6C 4CBPA 1IL1B 4ODBD 3QIBC 1WBYA 2OZ4A 1Y6MR 5ERWA 3B5HA 3BP4A 3O3DA 5HYJA 5KS9E 1H8SA 4LPXA 2QADD 3NA9H 4KKBD 3GJEA 5DD3H 5HI3D 2R4SH 3PWPA 5LGKA 4BSWA 5MENB 5F9OL 4OD2A 4S1SL 5FM5M 4OCXL 3QA3A 1D5BA 1AE6L 2YPLD 3TBVA 4HJ0C 3HE6D 4RFEA 4R4NC 3MRRA 4QRSB 3S5LA 4I18C 1L7TH 4FQXD 1MCWW 2Z92A 4Z7WE 3QUYD 3C6LD 4PJ9C 4OZHE 1FNGB 4U1GC 4PJGE 3MODL 4EN3D 1XGRB 1DEDA 2CPCA 3WFDH 3UBXB 2NY2C 2AK1H 5DJDB 1KTRL 2ICWA 4G43A 3WFBL 2VLRB 1PEWA 3U6RA 4P2QB 1GGUA 3UPRB 5IHUL 2PTTB 4X99A 4O9HH 2CDEA 1BM3H 3GKWL 4PRDA 2I07A 5IESL 4NNXA 1A2YB 4DK6A 2DWEB 4KV5E 5IMKA 4EZMA 4WWKC 5IIEB 4IS6B 3SKOB 1F3RB 4NT6A 4PTUB 4QRRE 2BOCA 4HULB 2VZVA 3LIZH 1CFNB 1D9KA 4DW2L 3IDUA 2H8PB 1XGYH 2F5BH 1IGTB 4PREA 3SKUD 5ITFA 2JCCB 5T3XE 1JZ4A 3CDYA 3QEUA 4OCYH 4PJXA 5J0BA 4P3DB 2XI9A 5EA0H 5DA0B 5IROC 3ZO0A 4NJ9L 3D85B 3MOAL 2ZPKH 5F9WB 2DM4A 3E0GA 4ZAKD 4LPCA 5DRWB 5J06A 1T1XA 2EDXA 3MYJA 5LXGL 4X9FA 2AEIT 5AWNH 5LCVH 5K9QI 4M93C 3B9KA 5GIRB 3RKDC 5HD8C 3MJ8A 4PJIE 1WVZA 4OFIA 4JM2B 3ZKXB 3C8KB 1YEGH 4JO1L 2FYYA 3H3PL 1T7XA 3VXUA 4IIQA 2NNAB 3T04D 2R2HA 2IC2A 5F3HB 4K8RH 1UWEL 4QXWA 5IG7A 3GJFH 4PP2B 3BSZH 1S8DA 4D9LL 2DQIL 5IVXE 2PW1A 5D5MA 4U6XA 4NZJA 3GSNB 4MB3A 3QCUH 3QUZD 2H45A 2XTJC 5D70L 5DUML 1T1YB 4U1LA 5HTSA 3DX6B 4Z7UF 3KWWB 4WFEE 5EPMA 5EIIA 3IFLH 3FQNB 2VDQL 5TDOB 5ELIA 2FLBT 2W0KA 2X4RA 3QHFL 3KXFB 1AQKL 1AQDA 4OAWB 3SE3A 5EUOA 3KDMB 5D2NA 4U1JB 3EGSB 4LSPH 2AEQL 3IDXL 5GS0H 4GAYA 1MFCL 4GT7A 4HAFA 3STBA 5CUSH 4WU5B 5DJAA 1WWWX 1WITA 4U1HA 1JGLL 3BN3B 4X8JB 4N0RA 4Y19D 1UA6L 2VXQL 1KACB 5SWSD 4MNGE 4DAGL 1EPFA 4KU1A 3RIFK 5FCUL 3DBXB 1PAMA 2PCPB 2VLJB 5DUBB 1DN2A 5IUSA 2FX9L 1TVHA 2OQJA 2Z0BA 1BWWA 2ZSWA 1F4XH 4NNYB 4YBLB 5J1TC 4G9FA 1OLZA 4L3CB 2BNQE 1ZLVK 1D6VL 4FQLL 4X5LA 4BKLB 2OP4H 1I1RA 2FGWH 2EICA 4XXCC 4GRLC 1JNNH 2EDEA 1UKTA 4AEEA 3ZYOA 4OGAC 1TZGL 3VFRA 4U31A 4L4VA 1S5IH 3N1FC 1HXMA 4DN3H 3QAZB 3VDBA 3OXRB 3UTSA 2CDFA 3I6GB 1P4BL 4P9ML 3UBXG 3SJVD 3FT2B 5I1IL 3SE3C 3UJJH 2O26U 5LGJA 1HINH 2YWYA 3E6FA 3W5MA 1NCWH 2B5IB 3AXLB 4PJBE 5HI4C 5T5NG 4PJ7B 4JHAL 2XY1A 3BXNB 5DVNA 1XF2B 3SBWA 4R4BA 3UAJC 2CUHA 2Q7NA 1V7MH 3BH9A 4OZFA 1MRCH 4DUVA 3R06B 5CLWA 3T2NH 1F2XK 4EVNB 5J12B 3BZDA 4PJ5D 1P69B 5SWQB 3D3VA 4PRPB 5JDSA 3FO1B 1S7UA 3ESUF 3VFSA 2BP3A 4ZUUA 2GSIB 3KHQA 3SDAD 4IOSD 4NN7C 4HCRH 1SEQH 2AI0L 3BGFC 4UDTA 5JMOC 1PD6A 2JJUA 1IGMH 1OAUL 1FNEB 2V5SA 5GGQH 1OGTA 2NX5D 5E99L 2EIZA 3LN4A 1M6OA 3PWNA 1F6AA 2UYLA 4LVOC 2CLZA 1CE6A 5F9JB 1OTSD 4FQJL 2DYPA 1QQDA 1D5MB 3TJHC 4OLUL 2BSRB 4MJIB 2J6EL 1OLLA 4RAVB 3L7FB 1RPQA 1QBLH 4WENB 4J6RH 3T0EA 2ZUSA 3FCTA 5EO1B 2PN5A 3BRGC 3GMRB 1NANI 2A9NL 4C55A 4PJFE 5C0FB 4HFUH 3FT3A 5TE4H 4OI7A 3W9DA 5J3HD 1P9MC 4WHTA 4ODTH 3BMWA 3W39A 5CP7A 4I77H 2G60L 3FFCE 4EQ2A 4Y4FD 1LILA 2YC1B 1ZVHA 3MBEA 4Y2DC 1JPFA 4FHBD 3QDGD 4DGYH 4WI6A 4Y5YA 1QOKA 3CMGA 5DRNA 3WKMH 3L3DA 4RX4D 3VCLB 2F54B 3ULVH 3TWCH 3QWQB 3K8KA 4NO5A 2VITA 5IEHA 2J3SA 4YHZH 4P9HL 3J7HA 4HJGB 2PNDA 4KQ4H 4PRIE 4Z7QE 2J88L 1KCRL 5E94B 4MD5A 3SE4A 1A6ZB 1MFDH 4TTDC 2Z35B 3RNKA 5IW6A 1NEZB 3RY6A 3CSYA 3FO9B 3KJ6L 4GKSA 4R2GB 4ZTOL 1N5AB 1G9EA 3WV0A 4U1KA 2GQHA 4KXZH 1QSFA 3SDCB 3FL7A 1NBYB 5KG9B 1YY8A 4I3RL 1JF5A 3CLFL 1F97A 5DD1L 4NNPL 4FS0A 1I7TB 3VXSA 4XP6L 3LKSB 4G8IA 2BCKB 1GZQB 4D0DA 4LCWA 3D18A 5AAMA 4OZIA 4CJ0A 1RZJH 2BRRL 4Q0XL 3WNOA 3DUUA 4EKXA 3K1KC 3LKOB 2OR9L 3QULB 5K9OA 1VFUA 5L0QB 1MNUH 3QNXA 5HYQB 2IWGA 5MI0B 3DXAB 4GW5A 4GAJH 1BEYH 1BQUA 3GSWA 4PY7A 4Y5XA 1RZ8A 3RWGA 4G7YH 1YEIL 1T6VN 3L9RA 5K59E 3EDKA 4K7PY 2WIIB 2FSEA 4M6MH 3RJQB 3FB5A 3EOTH 4F7MA 1WFUA 2EO1A 1W2KT 1AGDB 1FZMB 4MQ7A 4TUOA 4XAWH 5GPRA 1M7XA 1R5WB 1FPTH 5HSFA 5E4EB 3ARGD 1LEIB 3E8UL 4HCRA 2XQBL 4F7PA 1FL3B 4MQXC 2KQMA 1I1AD 4NHCH 1FBIL 4AIZA 4QNPF 3PHOA 1DUZB 5EU7C 3I6LE 2F5AL 3LQZA 4GKNB 3HAEH 3U82B 3BZEB 4HK3J 3HMWH 4NQCE 1F58H 4LSTL 4XPBH 4AL8H 3CFKA 2VLKA 4N0FB 1HI6A 5C0GA 3RUGB 3RJDA 5FGBA 3VXOB 2JB6B 1XGTA 3UJTH 5IGXH 2YXFA 5CINL 5I73B 1Z6JT 1Y6NR 5B38A 4K7FB 2WUCH 1CZ8L 2MSPA 1J8HB 4ZNCD 4PJHE 5T3ZE 3TH4T 3V5HA 2EE6A 3BX7C 2DLFL 5IVNA 1UXSA 4OLZL 1T22B 2DLGA 5DJXB 3P9MB 3V2AR 3VXMA 1WC7A 3F12B 1FQ9C 4QRRD 1EAPB 1BPVA 2A38A 1JV5A 4ERSH 4YJZL 1RJYB 4OF8A 4QRPB 5EDXA 3ZDYF 5DUPL 1C1EH 3ARDB 4BYHA 2R1WB 5ABDE 1BBDH 5T3XD 4XX1G 4IDJH 3SDXE 2AJ3A 5K9KA 3ULUC 3BP6A 3NPSB 3PV6B 5KVFH 1KJVA 1KEGH 4Z78A 2ZUQB 3KHOA 4B7IA 2IBBA 1E4XH 1G7MB 4EIGB 1T5XA 1UQSB 3FB7A 2MJWA 4FQCH 4LCYB 5ICXB 5TGBA 1I1FA 2M2DA 5GRUH 4HGWB 2EYRB 1TZHA 4S2SB 1T0PB 4MVBD 3MOQA 2AJVH 3CVHB 4P4KD 4FXGB 2I60L 3TYGH 4BSVA 4AG4L 2HFEB 1SEBB 3C5SA 4GUPB 2H2PC 3MLRL 5B39A 3ES6B 1C5DB 2VDOL 3OKLA 3ULSA 3WFCH 1OAYH 4OUUB 3DECA 1NEZG 3WEXA 5FHAL 3F58L 4OCRL 4ZPVB 1IKNC 4HIEA 3OHXA 1CE1L 3LEYH 4LSQL 1YYLL 1V5JA 1S78C 3MXVH 1FNLA 4HEPG 4EDWL 3VFVA 3V6ZB 4P5TD 1VADB 1KJ2A 3D6GA 2QTEA 2GAZB 3M17B 1UKQA 1RZKH 4XXDB 4U0RB 5KSBE 2ZOLA 4WHDA 3OKEB 1QVOA 5AEAA 2DI7A 1A4KA 4ODSL 3P0VL 4G8GB 3KPNA 4MWFA 2AABL 3H9HB 3GJFB 1IAII 5FDYA 3KGRA 5E00A 5IEKA 2VN4A 1WK0A 2W91A 2Z9TA 5IJKA 1DFBL 2CDGA 2LTQC 1P7QD 4MA8H 2P48B 3EYFB 4G6AD 3RY4A 1CGUA 1ZMYA 3S37L 3U4AA 1CD1A 4LLUB 3VH8A 5I1GL 2AJZA 3CXDH 5HI5C 5TE6H 1UYWL 4KKLD 2BVTA</