3GM0A

Anti-methamphetamine single chain fv in complex with mdma
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
242
structure length
237
Chain Sequence
b'EVQLQESGPSLVKPSQTLSLTCSVTGDSVTSGYWSWIRQFPGNKLDYMGYISYRGSTYYNPSLKSRISITRDTSKNQVYLQLKSVSSEDTATYYCSYFDSDDYAMEYWGQGTSVTVSGGGGSGGGGSQIVLTQSPAIMSASPGEKVTLTCSASSSVSSSHLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSFPFTFGSGTKLEIKRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-methamphetamine single chain Fv
publication title Crystal structures of a therapeutic single chain antibody in complex with two drugs of abuse-Methamphetamine and 3,4-methylenedioxymethamphetamine.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 55
structure length 237
sequence length 242
ec nomenclature
pdb deposition date 2009-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gm0A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gm0A01
3EOYG 2DI9A 1PKQE 4JB9L 5EC1A 1IGFL 4YR6B 5JMOC 3TIEA 3F58L 3GMMB 1KEGL 2GIYA 1AQDB 3VFOA 3B9KA 3RKDD 4Z8FL 2CJUH 3PGCB 5C0GB 4F57H 3MRMB 3MACH 3P9LA 1KCVH 3PP4L 3ZYIA 3V2AR 5ETUB 4KMLB 1N2RA 1JF1B 3DJ9A 2ED8A 5F3HB 4JKKA 3QRGH 4OLWL 1P7QB 1X5FA 4ZYKA 5HD8C 4X6CB 3TIDB 4PJAE 1T2JA 3S6CA 5FUZH 3QEHA 3WNOA 1FIGL 3LIZL 1A7PL 5DTFA 4KI1A 5IF0B 3GB7A 1KIRB 2VLLA 2YUVA 4U0RC 3LH2H 2Y72A 3SDXE 3R1GL 5GSRA 1JE6A 1KTRL 1BVLB 4KUZH 3P9MA 1YNTB 1OB1A 3GMNA 1EAPA 1LO4L 1ZXQA 3HI6H 4P9HC 5EOQL 3GFUA 3QFDA 4PRHB 3VD7A 3TBSB 4XNXL 4JY4A 4GRLB 2EYRA 3M45A 1QLFB 3RJQB 4OZFG 4FG6C 1S78C 2MTPA 3X3FH 3MXVH 4N5ED 3EDDA 3CDGA 4P5KA 1G9EA 3M1BB 3ARUA 3HZKA 4L5FH 5DMJB 4X6FB 5CCKH 5HVWA 1NEZA 1QYGL 1T7XA 1D5XB 1UZ8A 3Q3GA 5K9JL 1XF5B 5D2NE 4NO0A 4M1DL 5E6IB 4HPYH 1QKZH 5GGUA 3MLRL 4EQ3A 2VR9A 1AQDA 1ZT4B 1AJ7L 1OSPL 4KKNA 5EOTB 1KJMA 3GBNH 5JW3H 4EVNB 1FDLH 1IE5A 3PGCA 5C0GA 1CF8L 3ARGD 4RISL 5C09D 3MRMA 3KYAA 3O2DL 2ERJB 5ETUA 1JF1A 5F3HA 1ZV5A 4HGWB 5E00A 2B0SL 3D9AL 4GSDL 3O3DB 1P7QA 3CMGA 3TN0B 4X6CA 1CN4A 3FRPA 2EDYA 5AYUH 1BF8A 3NCYS 1MCLA 2Y07L 3IS1X 4WGWB 3DRQA 5IF0A 3RTQC 1KIRA 3BZ4B 3QUZD 1M7XA 4M43L 4FQXC 1INDL 3GMRB 1BVLA 1NMAH 3OR7B 1H3PL 1YNTA 1KJ3H 3OJ2C 4UDUB 4DGVH 3NCFB 4HIEB 4PRHA 3TBSA 4KV5F 3T2PA 1CXLA 4GRLA 5FXCH 5E8NB 2JJSA 1A6TB 1QLFA 4MQ7A 4Z0BH 3PWPE 4WTWA 4M7ZB 4B50A 1KENH 3M1BA 1HXMB 5SWSA 3FONA 4X6FA 3AFLA 1BFVH 2PXYD 2VABB 2V6HA 3JV6B 4HJJH 2FX9L 5BV7C 1QHOA 4GAGL 1FSKB 2QHRL 2XRAH 1V3KA 4LDOB 5E6IA 3AY4A 3U7WH 1OCWH 1AI1H 4MWFB 5DURB 2IJ0C 1NMCB 3WFBL 1ZT4A 3CZJA 5EOTA 5TQ0L 4EVNA 3ULUH 4CN6A 3RBGA 5I16B 4JJHA 1QSZA 4RDQG 3SO3C 5J11C 2UZXB 3IDGB 5DZOA 4HGWA 1XCQB 4NN7C 1MNUL 1J11A 3H9SE 3O3DA 2YC1B 4FTVE 3TN0A 4LMQI 1WWAX 5TF1H 2EZ0D 3UZQA 1UB5B 1R5VB 3V7AG 5DFVD 1MRDH 2UZIL 2Z4QB 5HHOB 1T7VA 1YEGL 1X5HA 3GMRA 4JO4L 3OR7A 1NCNA 4Q9QL 4KZEL 4JO1H 3GRWH 1FJ1B 4UDUA 4QRSB 4PJIF 4HIEA 1ZAGA 1HOCB 4NP4H 1N5YH 1QFOA 3CFEB 1A6TA 3HS0B 5ACLA 5DUMH 2ADIB 4JRYE 5JPNB 3U2SB 5FO9A 2P5WD 3VH8B 5C0BB 2VABA 3JV6A 1P2CB 2V5RA 2HFFB 4MGXA 4IOSD 3WXVL 4NGHL 2DJUA 4Y4FB 1PX4A 2DD8L 4NJAL 1MEXH 3U7YH 4PJBB 1YNLH 2K1MA 1UEYA 4MWFA 2QADD 4NQCE 5D96C 1IGJB 3V7AE 4L8SC 3QUXC 4PV9B 4P57B 2Q8BL 2VKWA 4X6DF 2UYLA 1A6ZB 2VDQL 2A38A 1XF4B 5I16A 5I8CB 3OSKA 5HHPB 4JKMA 3IDGA 1XCQA 4DKFL 5D7JC 5LAXB 3FKUS 5IMMB 5FCUL 1UB5A 3RRQA 2HT3D 4QTIH 4IMKA 3MV7B 1R5VA 2P8PB 4J3VA 2Z4QA 4UINH 5HHOA 5L2KB 2HMIC 4ODWB 4V1DD 3SQOH 5GRUL 3D3VB 4PJCB 4JN1L 3T0EB 3WJLA 4WFGE 4YXHH 2EDXA 1W2KT 1FJ1A 4E41B 1DBAH 1UWEH 4QRSA 1W72H 1HOCA 5FGRA 4F80A 4HSQA 4NIKB 3CFEA 4I18C 4YK4B 4FMFA 4IRSC 3MFGB 4OBSA 3LDBC 3HS0A 1MVFA 2ADIA 1LDPL 2LFGA 1OAKL 5JPNA 3U2SA 3TWCH 3VGEA 3QHFL 3D5OF 4CVWA 3MBEB 3VH8A 5C0BA 1P2CA 4Y4FA 3O11A 4ZO6A 3HE6D 4PJBA 4I5BB 4CDGC 3BT2H 4KJQD 4XPFL 3LQZB 1IGJA 1H3TA 3UTSD 4QRTB 4PV9A 4P57A 1HKLH 3OWEA 2O5YH 5KTEH 4JHWH 1A6ZA 3UROR 5C08D 1NCUA 4HEME 1QSFB 1XF4A 5E7BA 1G7JB 1T1WB 4GXUM 3UAJC 2ZUTA 4AM0B 4PJ5D 5HHPA 1WWBX 3ARED 1SBBA 5DWUL 5LAXA 1BLNB 5IMMA 4JFDE 3TV3H 3MV7A 2P8PA 4F15C 4YH6A 2EO9A 4Q6IB 2YPVH 3MCG1 1G7MB 5L2KA 4ODWA 2ICWB 3D3VA 1YECH 4PJCA 4PGEA 3TP4A 3KS0J 5EZOL 4K3JL 2AGJH 5D7SL 4JO3L 3TYGL 4E41A 1OLLA 4KQ3H 1MUJB 1G1YA 3VW3L 5CEZD 2FZ3B 4XMPH 3KHOA 4DVRH 5KVFL 5EPMB 2G5BB 2R1YB 4UT6L 3GUTB 4XNUH 5CZXD 3ARTA 3I6GB 1PSKL 1BVZA 3D69B 4JZJC 1RZ8B 3MBEA 2IQAB 4OZFH 3SKOB 4EI5A 1F90H 1JV5B 4H8WL 4AQ1B 1KYOJ 1ZVHA 3RL1B 2ZKHL 3HN3A 3W9DB 5J7CC 3LQZA 2V5TA 1I9RH 4QRTA 2CLZB 1Z9LA 4L4VB 3WUWG 5E5MB 2YEZB 5BW7C 2W0LA 5A40E 3WMSA 4YEFA 2DTSA 2DQGH 1QSFA 2EDRA 1G7JA 1T1WA 4AM0A 3O4LA 4GXVH 1MHCB 1EFXB 1IBGL 4KZDH 2X4UB 1VGKB 4JFEE 5KANG 1BLNA 5IBUB 2Z9TA 4AEEA 5JW4R 4LCYA 1G7MA 4GJTB 1UWGL 1QO3B 3PXJA 1CGSH 5T3ZE 2ICWA 3TVMC 1RUML 2QQQA 4KAQH 3S37H 3FB6A 2F19H 3WIFB 2VLKD 2PYFB 2FGWH 3F12B 2DF3A 4XAWL 3DMMB 4U4BA 4HS6B 1MUJA 5KVEH 2FZ3A 5BJTB 3G08B 4HCRA 1U41A 3VFWA 4G8GD 3M8OH 3U9PL 4FQCH 5EPMA 2G5BA 1SJEB 2MCPH 1TJIH 1W0YT 2OX5A 2R1YA 3C08L 3GUTA 2HAZA 3CCHB 4JFPA 1IAIL 4WFHD 1L9MA 3I6GA 4P49A 5K59E 5IR1B 1RZ8A 1E27B 2CUHA 4HCRL 5CJXC 2IQAA 2FHBA 4MXWH 4JAMB 3SKOA 4FA8A 3ARXA 3IFPB 3WLWD 1JV5A 4AG4H 1I3GL 3RL1A 3CFBA 5MEND 4DWHA 1QBLH 4K8RD 1TCRB 5JIIA 1WCBB 2E6QA 2IALB 3W9DA 2R2CA 1BQLL 1IKNC 4OF3A 3SGEH 1GGBL 2J8OA 4L4VA 5E5MA 4XTRD 5SX5H 2DKSA 1Z2KA 3U83A 3CMOL 3MBXL 4QY8A 4BZ1H 3FFCB 1MHCA 1EFXA 1GGCH 3CLEL 4KH2A 2X4UA 1VGKA 2OP4L 3O6FC 3WIHH 1G9ML 1NMBL 4JPWL 5GJTL 3SDYH 3MLXH 4BSVA 3ARBC 1U91B 2FEEL 5C6WH 1EHXA 1WAAF 5L6YH 1QO3A 3K2MC 4QOKE 2C4FU 3L3OB 3LEVL 5IKCB 3U0TB 1NFDE 2GJ6E 5E99L 3WIFA 4I0PD 1B0RB 2PYFA 3T77B 4QNPE 3DMMA 1OAUH 4JM4L 4LLWB 5E8PB 5IT2L 1C08B 4DQOL 1MJUL 3G08A 2D0FA 3B5TA 1RZ7L 3MUY1 1SJEA 2Y5EA 1MFEH 5BRZE 4I77H 3CCHA 2EIEA 2Y7QA 5IR1A 5DD3L 1E27A 3RUGB 3ARDD 3ZYZA 3NA9L 3QYCA 4JAMA 4C4KO 3IFPA 4KRNA 5A43C 2YUWA 4FFZH 2DQIH 3LS4L 3BQUB 1TCRA 2GY7B 1WCBA 2IALA 1T6WA 4RFNC 4Y8DC 1CLZH 1JNLL 4MA8H 3MYJB 4R7NB 2CLVB 4ORGB 4P23C 1JYVA 3B43A 2W9EL 3PQYD 1RV6X 2GK2A 4LSPH 3FFCA 3OL2A 3MOAL 3MRNB 2BX5A 1VPOL 5FKAB 2ITDB 3DX8B 3VXRD 2A0LC 32C2B 1U91A 3V7MA 1CU4L 2DMCA 2QEJA 3RGVC 3GMOB 3TA3C 2RR3A 3AS0A 4LSVL 1Q0XL 2AXJA 1G6RB 1E4XH 3MV9B 3T77A 1B0RA 5CUSH 5CLWA 1BAFL 5D1ZB 5E8PA 1C08A 43CAB 3EFDL 5C0IB 5F1KC 3UX9B 1JYNA 3BHBB 5IV2B 1LO5B 4JVUA 1P4BL 3NCBB 4KPHL 1GH7A 3KYKL 1V7MH 2FEDD 2NY4B 5EB9A 2UUDK 3ZKND 1YY9D 4RGND 3TNNB 4FQLL 1XR9B 2XTLA 1MRFH 1YEIL 1D5MA 2X1OA 2DTML 4KDWA 3BQUA 2C3HA 4XAKE 2DB8A 2I60H 1INEL 1P7HL 2H32B 5HDBE 4U6XB 1QNZL 4PJHB 1AP2B 3MYJA 4R7NA 2P8MA 2DBLH 4ORGA 5HI3D 3IXAB 4PY8I 2CGRL 3GSXB 2IG2H 2APXA 3BKMH 4MXVE 4CU8A 1ZLUK 4CVXB 4Y4KB 5FKAA 5I8OH 1CDCA 2V9RA 4XWGL 4V2CB 32C2A 4HZLB 3GMOA 1A4JB 3QAZB 2L4OA 1G6RA 3MV9A 4JKLA 3C5ZC 5AAMA 1YEFH 2B1HL 1SBSH 5D1ZA 5GHWL 1FBIH 5HPOA 43CAA 4Y4HD 1A7NH 5C0IA 3BHBA 1G6RL 3Q0HA 3JV0A 1LO5A 5IV2A 3ZTNH 3N1GC 3V8CA 4XNMB 3INUH 5IB4B 3EYSL 1JZ3A 3DBXB 4K3DL 3B2VL 4MA7L 2HTLD 2VXUL 3TNNA 1XR9A 5B22A 5T3ZH 5L7XL 1JIBA 3UTPD 3NBNA 4P3DB 3TCLB 5IVXB 4UILL 2LAAA 4ZAKD 1LE9B 3P30H 5IM7B 1IVLA 2H32A 1KEML 4LSTL 4MNQE 3LB6D 4U6XA 3W11D 4PJHA 1AP2A 4KVNH 4IRJC 2IF7A 5TQ2L 1JHLH 5C2UB 4NN6B 2F53E 3QDJB 3F6LA 4TSCL 3ULVE 3BIKB 3IXAA 1EDQA 2XT1B 1WT5C 3WJJC 3GSXA 4N8VG 3PUCA 5J56B 2R9HD 3BRGC 5DJDB 4M4PA 2APWA 4CVXA 4Y4KA 4RGOL 4PJ7B 3GKWL 4HZLA 3HFMH 5T1DH 3VGFA 4QXGH 3MTRA 1BWMA 1P6FA 2UZYB 1BM3L 1ACYL 1GC1C 3HMWH 3RY6A 2EDOA 1A4JA 3GJFH 3VI4F 2VDPH 4XNYL 2YWZA 5GS0C 4K7PY 1JPTL 1LK3H 4HUXA 5ITBL 4HFWB 3ZKXB 5C09B 2EXYD 2X10A 2NY6D 2VRAA 5FYKL 4X4XB 2Z91B 1HWHB 2FD6H 1RIUH 2OZ4A 4XNMA 1NGQL 5I15L 2GFBB 1UA6L 1NCAH 3NZHH 3FMGH 5SWZD 4JZNB 1RK1A 4MA3B 3NVQA 4KKBD 3QUZB 5J3HD 5C6TL 4O51B 2OZ4L 4KK5D 2K7QA 4M61A 4X7SH 3SE9H 3MJ9A 3UJJH 3IU4L 4P3DA 3TCLA 5IVXA 5IM7A 2J12B 1WJ3A 1JRHH 3B8SA 1JFQL 2VXSL 4W6WB 1S9KC 5MEPA 3DHMA 3G6JE 1HYSC 2XKSA 2R0WH 1VFBB 3MJ9L 4DFHA 3IGAB 5BS0B 1A14H 3BIKA 3S5LB 1K6QH 4V2BA 4WNQB 4G9DB 3B3IB 4QKXB 4ZSOB 5DJDA 2JCCB 3V4VH 2R4RL 1KCUL 4PJ7A 1RJYB 5F7FA 5BZDB 3L3KA 2W9LA 3VFGH 4Z7WF 3D6GA 3BO8B 5JXED 1FZMB 4XX1G 3SE4A 1RVFH 1UYWH 1P7KB 2XICA 5B8CB 3AGVA 4KWUA 4RGMB 3BXNB 2DBJA 4IHOB 1S7WB 3T4YB 4HFWA 5C09A 3BDBA 4FQQB 2ICES 2BRQA 4M7JH 1J1OH 4X4XA 3SHSA 2GITB 3U4BL 1EEUA 2GQHA 4LVOC 1YPZB 4DFIA 2XWBB 2GFBA 2WUCH 4MNGB 4JZNA 3X13B 4MA3A 1LP9F 4OCXH 4Y5VC 2BJML 3QUZA 1T1ZB 4QHLB 3SGKA 1CVRA 4O51A 2H3NB 5EU7E 3C2SA 4POZD 1XIWD 1A7OH 3LPGA 1FGNL 2E7HA 1JF6A 2DLFL 2ENYA 1OM3L 5F6HJ 3HMXH 5EUOE 5IW3A 4DCQB 1VFBA 3A6CH 4H0GA 5DD1L 4XX1E 2AEQL 1T3FB 3IGAA 5BS0A 2VDKH 3UMTA 4WNQA 3S8WA 3PDDA 5C0FB 1B4JL 1MCWW 4ZSOA 4J6RL 5FUOL 2JCCA 3HZYB 5I1JH 3OKLB 3VXUD 25C8H 1C5BL 4HMCA 4X4YB 5IG7B 5TPWL 3SGJC 2AV1B 1OARL 1RJYA 2GUOB 1FNSH 5BZDA 3BO8A 4FFVC 4ZS6D 1FZMA 4YPJA 1IGML 4S1DD 5D7IB 1P7KA 1UG9A 4ERSH 5B8CA 2VZTA 5KSBF 3BXNA 4IHOA 3VDCA 1AH1A 1EO8H 2HVJB 2HH0H 2GITA 2I5YL 2HT2D 2ATPB 5H37G 1EHLL 4XBPB 1QR4A 5F96H 2XWBA 3ET9F 1X5YA 4LGSB 1JUFB 4JGJA 4MNGA 3WFZA 3X13A 5KG9B 2NY1C 1YC7A 4BJLA 1VGEL 3U82B 4V1DB 2V9TA 2O93L 1T1ZA 4QHLA 2HP4A 2H3NA 4MD4B 4YHYB 4YQXH 4R7DB 2ENSA 4XWOD 3MLZH 1BIHA 4D8PB 4HF5L 1T7WA 3SE8L 2UV3A 1I4FA 4YZFE 1QUNA 4DCQA 4ZODA 4PTUB 5J0BA 1A7RH 1T3FA 1XGRA 4OGYL 4F7TB 3KHQA 2ICCA 5C0FA 1FN4B 3TFKD 4PJEB 4X5WB 1KPUB 3HZYA 4P3CH 4LFHG 3MROB 4X4YA 3QQNA 5IG7A 4WU5B 2AV1A 4PGBB 4XP6L 4DEPC 2F74B 2BNRE 4O2EA 5D7IA 3UTSB 5GGTA 3QPQC 5HDLA 4X7CC 3GMLB 1RUKL 4WV1C 4WJ5B 2Y6SC 4KTEL 4J4PC 3RL2B 1R24B 1ZWIB 1HK6A 3PHOA 2HVJA 4OLXL 1RZKC 3ULVH 4PJ5B 2X40A 2CR6A 3SCMC 5GGTL 2C7UB 4OLYH 3FO0L 4XBPA 1JK8B 4KHXL 4P2RE 3A6BH 1JUFA 1L7IL 2O5ZH 3FOLA 5KG9A 5C0EB 3D0VB 5LXGL 4LCIH 4NZTH 4V1DA 1F6LL 4MD4A 4MCZB 1LO0H 4OTXL 1OT2A 4R7DA 4J2XA 4NM4H 5CJOL 4D8PA 4M6NH 1MCSA 2F5BH 1R3IH 3ZE0F 3SDDC 1NUNB 4DAGL 4PTUA 5FHAH 3VDAA 4NQDE 5GGSB 4F7TA 5INDB 2CUMA 1X6LA 4XVUD 4RWYH 2IGFH 5EG6C 1FN4A 3L3JB 5J4MA 1ZEAH 4PJEA 4X5WA 4HMDA 3ZE1E 4P9ML 1KPUA 3IU3B 2JKXA 3MROA 5D2LB 2Y25A 5ALCL 4WU5A 4PGBA 5F93C 1MWAH 4GG6B 2OTUB 3S7GA 5I30H 2F74A 4YFLF 2QQKL 3H3BC 1UJ3B 4X0KA 2A2QT 3UTSA 5LWYL 4JY6A 5DYOA 3GMLA 3I9GL 2A6DB 4WJ5A 3KXFD 3RL2A 1R24A 1CLOL 2R0ZH 3DYOA 2ZCLH 4PJ5A 4KJPD 4F8TA 3IB4A 3DOSA 3EJJX 3AREA 2FB4L 3JWOC 4X98B 3WO4B 1I7TB 3U79A 4QYOB 5E6IC 4AIZB 1JK8A 3AY4C 2H8PB 4LNRB 5I1CH 3O81A 3FT3B 3PL6D 4O5LL 5C0EA 2PO6B 5ANME 2YOCA 1HHJB 3MLWH 1PKOA 4WWKC 5F1IB 2UWEB 1KCRH 1PYWB 2PR4L 2YK1L 4MCZA 5IMOB 5F88B 3GSNB 1TQCC 1BF2A 1H8OA 4ISVA 4J3SA 4ZFGH 4ZPTB 1HZHH 4GS7B 3AUVA 3Q1SL 1FHGA 2B39A 4PRDB 2A9NH 3H7BB 4G8GB 3IDMB 4EKXA 3C2AL 2XTJE 5GGSA 5INDA 1X4ZA 3FCTB 3BSZH 4XP9H 5JORB 3WKML 1KYOK 3QUYD 4JCMA 4ODSH 2BERA 3CVHB 1CK0H 1G9NC 2P24B 1A4KB 2R69L 3L3JA 3PGDB 4Y16B 5CEZL 4MNHB 1P84J 3IU3A 2Z8SA 5D2LA 2B4CC 3G5ZB 4GG6A 2OTUA 1RZJH 5DHVA 1NGYB 1V3MA 2HTKC 1UKSA 3LEXB 1NCTA 3DRTB 4QRUB 1UJ3A 2JB6B 3RDTC 1FL3B 1UADC 1PG7H 2A6DA 1F2QA 2WUBL 3G5YB 2MHAB 3AMLA 3W82A 2VWEE 5EWIH 3HE7D 1I7TA 3IETB 2GSGB 4QYOA 3DXAE 3V8OA 3ISWA 3MV11 1QOKA 3OXSB 3JWDL 3CU7A 4AIZA 2EIZB 2H8PA 1ND0B 3JWNC 4LNRA 2NZ9C 3FT3A 2PO6A 1PDKA 1NMCC 2JIXB 3ZSSA 5HHVL 1F4WL 4L29B 1JVKA 1CIDA 3QWRD 5F1IA 2UWEA 3ZO0A 1PYWA 5D7KE 3V6OA 1ZKAA 1KXVC 3QBTB 1MCDA 5IMOA 5C07B 3BPNC 5F88A 5HHXL 3JV4B 3GSNA 4F58H 4ELME 5E9DD 4WEUD 4NHUB 3ZDYF 2WQRA 3VA6A 4ZPTA 4PRDA 4LP5A 4OB5L 4KV5E 3H7BA 4G8GA 4LRNL 1OTUD 3V5HB 5ICZB 3IDMA 4BZYA 4IMKC 2P1YA 2ZNWA 3GSNL 5D8JH 3T0VA 4JQXA 5JORA 3NN8B 1Q72L 1UCBL 3S35L 3CVHA 2P24A 1A4KA 1N6QH 3PGDA 4M7KH 1A3RL 5DGQA 1QFWM 5DQJB 3ARDB 4GH7B 4MNHA 3L7EB 3MA7A 4M5ZH 4D94A 1NAKL 1JZ2A 1BOYA 3L95B 4GAYB 5DO2C 4BQCA 1NGYA 1CFVL 3MCLH 3LEXA 3DRTA 3CVHL 5HVHB 2FO4B 2ZUQC 4K7PH 4UOJA 5DK0B 2JB6A 1FL3A 4Z7QE 1EZVX 5H94B 1AXSB 3TEUA 3JUZA 3I2CL 1IC1A 1IAIM 3HG1D 4K8RL 3G5YA 2MHAA 2VDRH 3PQYB 5C0RH 2R8SH 2CDGB 3QSKB 3RNKB 1K8DB 4KROB 1NBYB 3IETA 2GSGA 4OQTA 1H3VA 5FECB 3LSOB 1J8HE 3T8XB 2EIZA 1ERNA 3VXRB 1ND0A 1A5FL 4L9LA 2JIXA 5H37H 3O6KH 1LNUB 4L29A 3UO1H 4OQTL 1F4XH 4LIQL 4WCYH 1H3GA 1MCJA 4Q0XL 5C07A 5EBMB 3BKJL 3JV4A 3LKQB 1B88A 4NHUA 4MVBC 1QLRB 1I3RA 5JLZB 2I07B 2FIKA 3V5HA 1A1OA 5D7LE 5CIPH 2D03H 4EXPX 3KAAA 3HKFA 1EMTH 4HFUL 4PJDB 1U3HC 2R29L 1BGXL 3MZGB 3NN8A 3FB8B 1PD6A 4HGMA 1GZPB 4OZIE 5DQJA 1AGCB 3ARDA 4RGNB 1JGDB 3L7EA 3SDCC 3I3BA 3T0EC 5FDWA 5E2VL 2OI9B 4M3JA 3L95A 2EIBA 5HD8D 1ZHLB 5TE4H 5FHBL 1RIHH 1BECA 3VWJD 3SKNB 4BZ2L 4O02H 5H94A 1AXSA 1MAJA 4MD0B 2VDMH 1MPAH 4JFFE 4PJGE 4XP1H 1T1YB 4G43B 4N1EA 4X7TB 2IANB 4OF0A 3PQYA 2EEDA 2CDGA 4M6MH 4WI7A 3RNKA 4RRPA 1K8DA 1NBYA 3L9RB 5FECA 3LSOA 1RULL 4I3RH 2C9AA 3T8XA 3DPBA 1EGJA 4LSRL 3VXRA 4Z7UF 2RHEA 1NGPH 5B39A 4U1SB 1DL7H 3QWQB 2R2BB 4HZAA 1S78D 3HR5B 3H8NA 2YRZA 1EGJL 3TT1L 4AK1A 3LKQA 1QD0A 1J1PH 4U1HB 5IK3B 1QLRA 2SEBB 3WEXB 3MXWH 2I07A 4FXGB 4TTDC 4Y4HB 3MACL 5TDNB 4Z7VF 5I9QB 1T80A 1NANI 5CD3B 2JELH 4PJDA 1OTSC 4Q6IC 1BQHG 1AFVH 1JZ8A 3V5DB 1T6VN 3FB8A 4CU6A 5CHNB 3W0WB 1U0QA 1GZPA 1AGCA 1JGDA 1KPRB 5KAQG 4HUNB 4D9LL 2W0PA 4B5EA 1ZHLA 4ZAKB 1QRKA 4K71B 1XMWA 3SKNA 2BVQB 2C4XA 3MOBH 3RTQD 3OJDB 3HI6L 1PAMA 4XVSL 1RSFA 5E95B 1T1YA 2PTTB 4RZCB 3BMVA 4DN4H 4B7IA 5C92A 3L9RA 1QSEB 1G6VK 2ZCKH 2X4RB 3V6FB 3KPSD 1HHHB 3TC9A 1SEQH 2A9MH 4U1SA 1XH3B 2R2BA 1UC6A 4XBEH 1JI2A 4D9QD 2O5XH 3MUGB 4ODTL 1XGYH 2PCPB 2DL2A 4Q7DA 1MFDH 1DBBH 3E2HB 1U3JA 2J8UF 2F8XC 4G6FD 4U1HA 5KS9E 3EFFB 5IK3A 4Y4HA 4FXGA 4HUWB 5TDNA 4OD1L 3WIIL 4NQEE 4WDIB 3HRZA 1WIPA 2AKRB 1DQDL 4PRPB 3V5DA 1GC1H 5CP3A 3BKYH 5CHNA 4JHAH 3W0WA 5AYUL 4U1LB 3VDBA 1KPRA 4XPGL 1MCPH 4OAWB 1NBQA 4MQXC 3UXFA 5I1HH 5CBAB 2PTVA 1MIEL 4ZAKA 1PZUB 2BVQA 4ZD3L 5HYEA 3DV6B 4F7MB 3S88H 1KJ3L 3LAFA 4MJ4A 4GKSA 4KKLC 4NOBA 3NPSC 4BH8B 2PTTA 4PUBL 3OXRB 4RZCA 2GW5A 4UIKH 2YS4A 2MFNA 3EW3B 2CUIA 1QSEA 4JM2B 1SHMA 1TENA 4K94C 3EYOB 1EPFA 3V6FA 1HHHA 2IH1A 2BXZA 1NSNH 1X7QB 5FGCB 4LAJH 3H42H 1RUAL 1XH3A 5JZ7C 2H41A 3ESVF 5T5FH 3MUGA 4UV4L 2PCPA 3MRFB 4PLJC 4BFEA 2BFVL 2DQJL 2G9HB 4DTGH 3LQAH 1TZGH 1W8OA 4FS0A 2QSCH 1BFOB 3EFFA 4HUWA 2Q3AA 4C56B 5DMKB 4R96B 1PKQB 1JNJA 4WDIA 1HILA 2R2EB 3QUXD 3RVTC 2AKRA 1T2QH 1LMKA 4PRPA 4Z95L 1DVFD 3GIVB 4U1LA 5GGVL 2E5EA 3GRWA 3RX8A 5E1AB 2FATL 1W72B 4IRZL 1D6VH 3VGDA 4OAWA 5CBAA 5D7JD 4J3XA 1M05B 4JN2B 4RCAA 5IJVA 3GRWL 4F7MA 4PJ8B 1WEJL 1QBAA 3MR9B 1LO2L 2HMID 2Q87A 4R4NC 2E9WA 1EEZB 4FZEL 5DEGB 4BH8A 2MOVA 3OXRA 3IXTB 2Y06H 2XZQL 2Q1EA 2VISB 3FZUC 4PJXB 3RBSA 4X6CF 4LSDA 3V79C 4JM2A 2EDDA 5JA8B 1G7HB 2AXFB 2NXYC 4YDIH 5EULV 1GPOH 2VC2L 1X7QA 3O4OB 4JDTH 4JY5L 4Y88A 4FQIH 2R56L 1GHFH 2HN7B 3K8MA 3UC0H 5JXEA 4P5TB 2NXZC 1EH9A 1FP5A 1S9WB 4Q58C 2JK5B 3E6HB 4N0RA 4KXZI 1DDHB 3DETC 2G9HA 4U1GC 4CMHB 1BFOA 1E0OB 4JZOB 1HNGA 1B6DA 3C6LC 4ZFOB 4C56A 5DMKA 1SMAA 5D2NB 5ACZB 1PKQA 4HBQA 2R2EA 4MA1C 3EYUL 1WITA 5BQ7B 5HDQL 2F54D 3WFCH 1IC7H 5IGXL 4NZDA 3P0YL 3VRIB 5E1AA 3UAJD 1ZA3B 1W72A 3WHXB 1I9IL 3NGBC 4AL8H 4ONOA 4X9GA 5DA0B 5EBLB 1CBVL 2XY2A 4JN2A 4YXHL 4WI2A 3V4UL 5F6IB 4H88H 3EYVB 3GHEL 1W72L 4LSUH 3MR9A 3LD8B 1OP9A 1JGUH 4PJIB 3K1DA 4PRIE 2R4SH 1EEZA 4AENB 5DEGA 2YD9A 1ZK9A 1FE8H 3IXTA 5TDPB 4QHKI 1FYTD 3VFTB 2VLRD 2VISA 4QRRD 4UU9B 3SN6N 1I1CA 4PJXA 4WI3A 5D93B 5MP6H 2YXMA 4F33B 1M7IA 5HHMD 1G7HA 4HXAL 4HG4J 3G6DL 1CT8B 1OW0A 2HN7A 5TFSH 4P5TA 1YEJL 2DQEL 1EAJA 2JK5A 3E6HA 4QRPD 1OAXH 1DDHA 3IT8D 4R8WL 3MLYH 3NACL 3NIFF 2O5YL 3QNZB 4JZOA 1AGEA 1YEEL 1NLDL 4X6DB 4ZFOA 4OM0H 1KGCE 2EYTB 1PZ5B 5ACZA 2XN9D 4HJ0D 2WWMC 1CTNA 3QFJE 5BQ7A 3OTTA 1F4AA 4ZFOL 2AQ2A 3VRIA 1L7TH 1Z9MA 1A21A 1ZA3A 3WHXA 1H3UA 1MCIA 1AHWA 2XQBH 4JG1L 5KSVB 5EBLA 3OKEB 4FTVB 1NBVH 3DYPA 3EYVA 5B3JF 4L4JA 1G7QB 4PJIA 1Q9LB 3TVMD 4AENA 4AMKL 4AJ0A 3CSGA 4YWGH 3NH7L 5TDPA 4NFCA 4ACPA 4KHTH 3VFTA 2HFTA 4UU9A 1PEWA 3BOVA 2H45A 4XP4H 1B2WH 4F33A 4H20H 5K9QI 3PHSA 1QBBA 5F7HA 1CT8A 2XA8L 4BELD 3QG6B 4LGPB 1YYMH 5IESH 1UACL 1U8MB 4G9FD 1C12B 1D6EB 3HZMB 1I9RL 3KXFB 4JRYB 1JGVH 5DGRA 2X6MA 4YDKH 5C7XL 4LHUD 3QNZA 1OGTB 4WEMB 4X6DA 3DIFB 1JPSH 1NKRA 1WVZA 1PZ5A 2EYTA 2EDNA 1OOAA 2VZSA 4MJID 1SVCP 5A3IC 3E8UL 4NQCB 5HI4C 2LAGB 3EJZC 4F2MB 2NPLX 4NFDA 2D7TH 3RWHA 5HYJE 3DLQR 3N1PC 3IJHB 1FAIH 4JE4B 5CJBA 1RFDH 5KSVA 4PJBF 3PWJB 3IS0X 3OKEA 4M62L 4DK3A 2A74B 2PKDA 4YX2H 2D7NA 1KB9J 4Z5RA 2E6JA 1F8TH 2H9GB 4FTVA 3ARBD 4R4FL 3O0RL 1OWWA 4QHNB 1G7QA 3CUPA 4G3YL 5HJ3A 2DWEB 3WCYA 4F9PA 2AQ1A 2VJXA 2CRZA 5EBWB 5DSCB 1UM6H 1DEEB 5JOPE 1SEBB 1MH5B 1O7VA 4U6YB 1BJ1J 2CO6B 2VDLL 1V7NL 1VENA 4D9RD 4YDLB 4ONGL 5I1AB 3V95A 4TULH 3QG6A 4AG4L 4LKCB 1NUGA 3KPQB 4PJCF 1U8MA 1G7IB 3OPZH 1C12A 4LPTA 1D6EA 4DN3H 3QA3B 3HZMA 3UZVB 5FUCC 3OAZK 1OGAE 2N4IA 4X7EC 3KXFA 4JRYA 5ENWA 1OGTA 3B5HA 3DIFA 4JREB 3QDAA 4JFHD 2FECI 4LF3B 4BZ1L 4JJ5B 5HGBB 1OP5H 3UJTL 2RFXA 3HNTH 5DS8A 4WFFD 5C0CD 1CL7I 4DJMA 4ONFL 2BNQD 4NQCA 3VG9B 1YDPB 4F2MA 5TJWK 5C3LD 1T03H 4QXUL 1FO0B 3PL6A 3MLXL 4P23D 2COQA 5DVLA 3IJHA 3WNPA 5L6YL 4NKIH 3SKMA 5FGBA 4XMKL 3PWJA 3LV3B 1F42A 3KNBB 3R06B 5IOPB 2A74A 5E9DB 4ZNCD 1GIGH 2DICA 1UM5L 2D7OA 2MKLC 2VZ3A 2H9GA 1LGVA 2A0LD 5I1KH 2ZPKL 4QHNA 3RGVD 2EH8H 5GISL 4Z7OE 1D5ZB 3U46B 3DHJA 3THMH 2C26A 3MNWB 5DSCA 1YJDL 5K9QG 3MLPA 1XGUB 2PYEE 1DEEA 2V17H 4YHZL 1SEBA 2VL4A 4WUKH 1MH5A 2QQNH 4ZUUA 4ZDHA 4U6YA 3FQRB 1DANU 2ESVD 3RWFB 1TVDA 1S3KH 3QDGD 1Y6KR 3SO5A 3DVGA 3FL7A 4UV7H 1AC0A 5J13C 5I1AA 2Z8WC 1UVQB 4LKCA 5F7EL 1LO3L 3GMPB 3KPQA 3ZHLA 2NY7H 1G7IA 4RBPK 3QA3A 1NCWH 4TRPH 3OGCB 1RJCA 1MAKA 4MA8L 1T83C 4K3EH 3ZYOA 4BQ6A 4LHQB 5DDHB 1JNNH 3Q6FB 1J5OL 1OAYL 4LF3A 4D0DA 4YDVA 1UXSB 2GI7A 4JJ5A 4WENB 5HGBA 1UZ6E 3CVIH 5D1QB 4CJ1A 4G7VL 1B9ZA 1UM4H 2FX7L 1CD1B 3P0VL 4NKMB 1FO0A 5I73C 1YYLH 5CGTA 2WINB 4NC1C 4YFLI 1PJ9A 4UT9L 3QWRA 3PWNB 1GL4B 5B21A 3LV3A 5E56A 3KNBA 3S4SG 5E9DA 1FO0L 1HH6B 5AAWA 3MX0A 4JFEB 4KJWC 3UP1A 2NCMA 3DWTA 4JKPH 3F7VB 3UYOD 1D5ZA 3U46A 4CBPA 4HT1H 3MNWA 5FDYA 3C5ZD 1XGUA 2KDGA 4NO5B 2B8OT 5FV2A 2B2XH 3FQRA 5J6HB 3RWFA 3IDIB 3QEGH 2AK4D 2LU7A 4GLRI 1T7ZA 4S0TD 1I1YB 3TJEH 1UVQA 2FX8H 4UTBH 2W0KA 3GMPA 1I1AC 3A67L 5JR1H 3OGCA 2PF6A 5J12C 1BJ8A 2IFFL 5H2BB 1IEBB 4K9EL 5ISZD 2FH6A 5DDHA 3Q6FA 1UB6B 2BSTB 3QNYB 2AK1L 4S1RH 4Y89A 3F8UB 5MERB 3VD9A 4F37K 3GJFB 3ZKSD 1CXHA 4NUJB 4IRJD 1CD1A 1E4KA 4NKMA 3BRFA 4D3CH 3EZJB 2WINA 5DJXA 1CI5A 1QP1A 4O9HL 4TUOA 1WAAA 3W9EB 3PWNA 4AT6B 2ZJSH 1MCRA 4EDXB 5DF0A 1TJHH 2AJVH 1HH6A 4P48A 4JFEA 4WFED 1YEFL 1RHHB 2WMPA 3BN9C 3D39D 4OJFH 3F7VA 1FPTH 2WWKT 2GTZB 2GYSA 2YKLH 1F58L 3DVNB 5I8KH 1MHPL 5GS0D 5L88H 2IPUK 3F65A 1OAZL 4NO5A 4QOKB 2NY5L 4QHUA 4Y2DC 1QZ1A 1FG2B 1JZ5A 1NFDB 3BDXA 5FK9B 5J6HA 4ZPVB 3IDIA 3X3GH 5FB8B 3KR3H 4N9GB 4F8QA 3MZTA 2ARWA 12E8L 1ZGLM 5D6CB 1I1YA 2P7TB 2D7MA 4F3FA 1E4WH 4XCNB 3U0WL 3U1SH 5HBBA 4OZGE 1NPUA 1MI5E 1UKTA 2ZG2A 5BRZB 5ADPH 3E1F1 1MFBL 4NQXB 5H2BA 1IEBA 4FQXB 5C70A 1UFUA 1UB6A 4OUOA 5FAAA 2BSTA 1CR9L 3QNYA 4R90L 2EYSB 1KOAA 1FG9C 4ZTOL 3MLTB 3GJFA 3OKNA 4NUJA 3MUJA 3VFMB 2VLJE 3RUGF 4G80B 5H8DA 2C5DC 3HFML 4DOHE 1F3DH 2NX5E 4P9HL 1I9JH 1Z9SA 4AT6A 3NFPB 5E8DL 4EDXA 1IKFH 1KIQB 3VFVB 3PIQB 3CXHJ 4RX4D 3RVUD 1DFBL 3WO4C 4YBLC 1Q9WB 1RHHA 5EDXA 3OV6A 4YHIB 1QR1B 1LVEA 2GTZA 1EO5A 2XIDA 5HHQB 1YMHA 3DVNA 3P9WB 2WANA 2D0GA 1RIUL 1QFHA 2E3VA 1FG2A 3RVXC 5FK9A 5JIPA 2G75B 4ZPVA 5FB8A 4KKAC 4N9GA 1T5XB 3UTTD 1B3JA 1CGVA 1I8LC 3HLAB 1BZ9B 4NN7B 2R0KL 3PWVB 4XCNA 2DMBA 1TJGH 1PLGL 1RAMA 2J5LC 3QEQE 3RTQA 3S36H 3HI5L 2ZUWA 4GKNB 4NQXA 4XMLL 4FQXA 3DYMA 3QI9C 4Y16C 5CD5C 3VCLA 1IAMA 1A14L 3QHZH 3K4DA 1A2YB 2WM0A 5E2TH 5DVKA 1KN2L 4O58H 3SKJH 3MLTA 2IPTH 2ZUXA 4JG0L 3GIZL 4PRBB 3RX7A 4LVHB 4FHBD 3ZDZE 5DRXB 3V4VL 3VFMA 4LEOA 4G80A 1HE7A 1ZA6B 1CZ8H 5E94B 2ORBL 3QDME 1J05B 1AKJB 1KBGH 3NFPA 1KIQA 5FM5M 3VFVA 3PIQA 5ILTH 3L5HA 4K23H 2BK8A 4L8CB 3WFDL 5F70A 4PJHF 1JGLL 1OD9A 1Q9WA 4ZUSA 1CYGA 3L5WB 4YHIA 1QRNE 4FFVD 1MJ8L 1MHEB 3KYOB 5HHQA 2VB5A 5I1LB 5D96B 4L8SB 1Q1JH 2VITB 3QUXB 1Z5LB 4HWZA 4J3WA 4LPWA 5BV7L 3LN9A 3WS3B 4OFPA 2VDOH 4X80L 5M95B 3ZL4L 2G75A 2IH3A 1T5XA 1AE6L 3QG7L 3HLAA 1BZ9A 1MCOH 5IHZB 5D7JB 3PWVA 5BMFH 1A6VL 2MWCA 4OM1L 4M8VA 1F4YL 4DKEL 3HNVL 5EORL 4GKNA 2D9CA 4PLNC 3BKCH 3TPUB 5HYIA 1JWMA 3A6CL 2W91A 1FFRA 2HG5B 3AU1B 2CRYA 4O00A 1A2YA 3VG0H 4EDWH 3MLUL 1CQKA 1IC4H 1U8JB 4HQQL 3IJSB 3O3AA 4PRBA 3L3DA 3QIWC 5GRVK 4EBQL 3BZDA 4I18B 4IRSB 4MNQB 1XGTB 3O2WH 2HFGL 1K3ZA 5FUCE 4QGYA 4U1IB 3DSNA 4QRQB 1ZA6A 5E94A 1J05A 1P9MC 5IVXF 2JJVA 2P5ED 4YIQB 2E9BA 43C9B 1JMXA 4KROC 2DI8A 5CILL 5E2UL 3FN0H 3S98A 1J1XH 1K3IA 3L5WA 1MHEA 3KYOA 5I1LA 5IVZB 4L8SA 4M48L 2VITA 3QUXA 1Z5LA 1GSMA 2BRRL 3NIGF 2AEIT 4NBZB 3T3PE 4WI9A 2F54B 1J0HA 2UUDH 4QXTB 2Y6SD 3WS3A 1J8KA 4J4PD 1FCGA 1U8OB 2CO7B 4LLVB 3OB0K 4PJ7F 1LP9B 3SCMD 4W68A 5IHZA 1L6XA 2IBGA 5D7JA 3TYFB 4NZRL 4XVJL 1HEZB 1TPXB 5DK3A 1F5WA 4F15B 1X9QA 1CGYA 1P1ZB 1VESA 1Y18A 2OXGA 3QCTH 4Y19E 3TPUA 1OY3B 4U6VL 1EHAA 1FYTB 2VLRB 5GGRB 1EBPA 2HG5A 1JN6B 3AU1A 4F37F 1MWAB 3ABZA 1ZLUH 2Q6WB 3B5GA 5HHMB 1U8JA 3IJSA 4U3CA 1P7QD 4NQTA 4I18A 3SDDD 4IRSA 4MNQA 2RCSH 1FLRL 3G6JB 5ABDE 1U95B 1IAOB 4GQPH 4PGDB 2MPAH 3OKKB 3GHBL 4BQ8A 4U1IA 4QRQA 4U7MA 1TETH 4JZJB 4QRPB 3LN4B 4YIQA 4TQEL 43C9A 3NAAH 1EV2E 1U6AL 3L5XH 4HAGA 1G7LB 1QLEH 4OCWL 4ODVL 5B4MC 1MRCH 2XN9B 3ZKQD 5IVZA 4NNXA 3S3JA 5FYLE 1FORH 3MV01 4KI5C 4UUJA 2F54A 5B3NA 4QXTA 1S7QA 1N0LA 5C0AD 1U8OA 3A6BL 2JCCF 3CJJA 4LLVA 4GKZB 4B0MM 3PDOB 1FZJB 2J7LA 1U3ZA 1VEOA 1IJ9A 1LP9A 1LDSA 1ZANL 3O2VL 5CEXB 3TYFA 5IHUL 4KQ4L 1HEZA 3QR2A 2KKQA 5E6ID 1WSST 4PBWD 5I9QC 1P1ZA 4KMTH 1MAMH 1RIVL 4GMSL 4XCCL 2E8ZA 3GSUB 1TLKA 2QR0B 2R1XB 3VMNA 3TVMB 3ES6B 4OF8A 4WWKD 4UT7L 1EJOH 4YDJB 2V2WB 1FYTA 2VLRA 5GGRA 1UH4A 2DQUL 4MZ3A 1YPZF 3EIFA 4KVCH 3REWB 1YEKL 2IGFL 2Q6WA 1GXEA 3VFSB 4P2YA 3DNKA 3U30B 1SYSB 4ZOAA 5GS1C 1U95A 1IAOA 4UQ3B 3OKKA 5AWNL 2ED9A 3Q5OA 4G9FB 5I1IL 5HI5C 3BEVB 5D5MB 3KPRE 4JZJA 4QRPA 3V9FA 5CWSB 3LN4A 1AXTL 5I76B 1DTUA 4LHUB 4BUHA 4FZ8H 1B4RA 3RJDA 1TCMA 3CH1B 5DMIH 1G7LA 2X9WA 2HTKD 4WVRA 3RA7H 2R0ZL 1TZHB 2AP2A 2A83B 1OQOA 3GI8H 2XN9A 1IT9H 4MJIB 3RDTD 3V4PL 4GW1B 5C9JA 4P2QE 3ULUC 5BW7A 5E03A 5J1AB 4NNYB 3QXAA 3HNSL 4MZ2A 4M7LL 3PDOA 4AEIL 4FOMA 5I1CL 3WYRA 2ZG3A 1W8NA 4IDJH 4HC1H 5CEXA 3EDKA 4IS6B 3O6FB 2P47B 1A22B 4HHAB 4LSSH 5D6DC 3EDFA 1DP0A 5C71A 3O3BB 3MNVB 4YXLL 2LVEA 3ARBB 2NZ9D 4I0KA 3S96B 5DURD 4TNVK 4ETYA 3W81A 3GSUA 2QR0A 2R1XA 4YXKH 3TVMA 3ES6A 2A9NL 2YD7A 2YMXL 1IZKA 4U3XA 4YDJA 2V2WA 2X2YA 5ERWB 4ZS7L 3Q6GL 3REWA 2AJSH 5E6YA 1FFNB 2P45B 3VFSA 3PABB 5HY9B 1BOGB 4H8WC 4JVWA 1SYSA 2FNBA 2VQUA 3I3DA 4UQ3A 2J88L 4G9FA 4X8JB 5KVDL 4P0DA 4PB9L 2YD5A 2FECL 3BEVA 4XPTL 5D5MA 1FVDB 5ADOL 5CWSA 2AAVA 5CJXA 2YRPA 2WSKA 5GRJL 3OZ9L 4NBXB 4ZUWB 4LHUA 1CL7L 3CH1A 5DO2D 4JM2C 1ZSDB 3K80A 1TZHA 4XP5L 1EXUB 1DBKL 2UVFA 2A83A 1AIFB 4J1UB 4MJIA 4RFNB 5D72H 1IKNA 1N64L 1Z3GH 5KJRH 1T0MB 2BNQB 2BNRB 5J1AA 1V5JA 4PJEF 1YQVH 4OCSL 4NNYA 1KFAL 4S1QL 4LDEB 1ZHBB 1KB9K 5CZVH 4ODHH 3FTGB 2DLEA 5C0BD 3MRJB 3CIQA 4IS6A 3O6FA 5IQ7H 5I74C 3VXQB 2CLRB 4EQ2A 1R5IB 3N9GH 3WNNA 3O45B 3MNVA 3PV7A 2D3VA 4F58L 3ARBA 4FNLH 3S96A 1U8QB 3RGVB 2NTFB 3DROB 4RFOH 1D9KC 1J12A 1UH2A 3NABH 3TA3B 3RP1A 4MB3A 3O9WC 2YSSB 5ERWA 1UQSB 1BJMA 5IFHL 3T3ME 5I1EL 1FFNA 4MVBD 4D0BB 3PABA 4B7LA 3QDGB 2XI9A 5DJ0A 3J7HA 2PW1B 1BOGA 1VFOA 4NZUH 4N8PA 1BBDH 2AJ3B 4FP8L 4BSJA 5KW9L 3NFSH 4PJ8C 1U3HD 4OIIH 3PGFL 1KELL 4X8JA 2AJYH 3RI5K 4NQDB 5CKGA 1FVDA 5MHSE 6FABH 2Q76B 1IC5H 3SDCD 2V5YA 2CPCA 1BD2D 3LKNB 3CSYB 3T0ED 5MEQB 4AZ8A 3MV8D 4ZUWA 4DGIL 3N06B 3UEZA 5IFAL 4E41D 4OGXH 2JB5H 3E3QE 4HUKB 2P8LB 4OD3H 3RHWK 1ZSDA 2VDRL 5F9OL 5IVNA 3G6AB 1AIFA 1KJ2B 1YUHA 5JOEA 2X5PA 2M8XA 1CFBA 1T0MA 2BNQA 3TPKA 1DBJH 1WLHA 3WD5L 1T89C 3MQIA 3NZ8B 5F1NB 4P23A 4TUJA 5D2LF 4B53A 3FTGA 3GKZA 3MBED 4YPGB 3HZVB 3MRJA 1FAKT 4CMHC 4HXBH 3VXQA 2CLRA 3K8KA 1R5IA 5C9KA 2APVA 3H0TB 5J1SC 4A6YA 5E8EB 5D2NC 1U8QA 3RGVA 1WUNT 5GGQL 1TTUA 1G0XA 4NM8H 2CIKB 5D70L 3TA3A 4NJ9L 3I50H 5ANMB 2D2OA 2YSSA 3C5ZB 1EMTL 4QWWC 1UQSA 4I2XE 4TVPD 4XH2B 5FYLH 5CJ5A 4A6YL 3LKRB 2P49B 4CADB 4E42B 4X6CE 4YO0B 3OHXB 2IBZY 2ESVA 4D0BA 4ODUB 4TTDD 5ESVB 2AK4B 3QDGA 3QXVA 2PW1A 1KN4L 3UBXG 2AJ3A 4ZUTB 15C8H 2A6IB 1OAQL 4NSKB 1ADQH 4OSUH 1OTSD 2FJHB 4PS4H 2UWEF 2V5SA 1RIHL 5L0QB 3T08A 3KJ6H 4NQDA 4BKLB 3NCJH 4HLZG 1RZFL 3ZLQC 3LKNA 5MEQA 3CSYA 5ISZB 3ARQA 3ME0A 5D93C 4HIXH 5DHXB 4PRHE 2P8LA 2O26U 3G6AA 4OD2B 1KJ2A 3RVWC 3K2UH 5SWSE 4IRJB 4X5XB 3VMPA 2X4NB 5F1NA 3NZ8A 5FIEA 4E5XB 3T0XA 1NC2D 4Q9RL 4YPGA 3HZVA 1KJ2L 5JUEL 1P69B 4YE4H 2G60H 4M7LT 1SJHB 1SM3L 2Y36H 2W9DL 3H0TA 1VEMA 5E8EA 3WNMA 4QHKJ 4HIJB 4N8CL 1Q9OB 3D39B 2B5IC 2CIKA 1DBMH 4L4VD 4Q2ZB 4WI6A 4KRLB 3P11L 3C5ZA 5JDJA 3E0GA 2JELL 4XH2A 3LKRA 4CADA 2R39A 2IAMB 5DLML 2F58L 4ODUA 1JCKA 3U4EB 5ESVA 2AK4A 2VH5L 1TMCB 5LGHH 1RUPH 2LABA 4ZUTA 5HYQB 2A6IA 4NSKA 2ID5A 1IAKB 3ZE2E 1WZKA 4TOYH 2DQDL 4BKLA 3K1KC 1DSFL 4PFEA 5ISZA 4YHMH 3QZWG 2BDNL 3DI3B 3QCVH 3DMMD 5E7FA 4MQXD 1TZIB 3K4AA 1FL6A 3U0PA 2D31B 4LU5H 1QFWI 1AO7D 2DDQH 4DN4L 2X9XA 3T0WA 1HINH 2OL3H 3KS0H 4N90E 1KXTB 3EOTL 2FCBA 1N0XL 1JTPA 4IRJA 4KKLD 3UYRL 4JPVH 4X9BA 2X4NA 2OMNA 5JQ6H 2ICWI 4WW2B 5CINH 1WT5A 2EE2A 5EO1B 1BIIB 4TPRL 3WJJA 4N0YH 3V0WL 4DZ8A 5BOPA 1IAII 1B0GB 1TXKA 4N0UA 1VDGA 2HKHL 4TNVF 2Q8AL 1DBBL 2VN4A 4M5YH 2HKFH 1J8HB 4HIJA 2NNAB 3JBG7 2OTWB 1Q9OA 3D39A 5I17B 5LBSL 4O4YL 4Q2ZA 3VH8G 1AY1H 2B1AL 4PLJD 5ALBL 3SDAB 4JB9H 1F02I 5F6HI 5J57B 1IGFH 4KKCC 1QSVA 3F58H 2C3VB 1KEGH 3UTTB 3NCMA 4I9WD 3IFOA 1IGYB 5GS0L 5HHOE 4LVOB 1CDYA 5HYQA 4GT7A 1A6WL 1MCPL 5FM5O 3RKPA 1ETZB 3RVTD 1IAKA 3PP4H 3TBYB 4S11A 3C6SB 3QUMB 4OLWH 4YBHA 4Y5VB 3TO2B 1KACB 2CRMA 2FEEI 1NFKA 1K4DB 4OZIB 3QCUL 1TZIA 3LIZH 1A7PH 3TH3T 2D31A 3MRCB 5D9SB 1HDMB 5FF6B 3R1GH 3GO1L 2DM2A 5EU5B 3SJVD 1WGOA 1A6UL 5IW1B 3STLB 1SJVA 3U48A 3MA9L 4R4ND 5IQ9B 1LO4H 3CXHK 4Y5XB 3S36X 2VNCA 3IRPX 4WW2A 5EOQH 2GTWB 4JFFB 3FZUD 4U49A 1BIIA 4PJGB 5EO1A 4XNXH 2YR3A 1YMMD 1B0GA 3QO1B 4RX4A 1OPGL 4HAFA 4JREC 2GHWB 3GZKA 2MQ3A 1L0YA 5GRXG 4ODXB 1J8HA 3TLRA 2NNAA 2OTWA 4R0LC 1QYGH 2NXZD 3QIUC 2R0LL 3WSQL 4G8EB 4XBGA 4G42B 4G6JL 4M1DH 4LCWE 4O2FB 4FABL 1E6JL 3MLRH 1KB5B 4K2UH 1AJ7H 1OSPH 4XRCB 3C6LD 3UTTA 3MC0A 3ALWA 5J9PB 1I9EA 1Z0NA 2H2PD 1IGYA 4KI5F 4J3OC 5JNYB 1CF8H 4RISH 1D6VL 3O2DH 1ETZA 4HWNA 3D3VE 3IKCB 5JIKA 4DZBB 3TBYA 2NY1B 2B0SH 3CSBA 4GSDH 3QUMA 4OV5B 1OVZA 4Y5VA 3TO2A 1NBZB 5IHLB 1K4DA 1NC4D 1MREL 4OZIA 4XNZC 3IJYB 4YNYB 3WHE0 3MRCA 5D9SA 3RWCB 1BREA 1HDMA 3HR6A 2VZVA 3QUML 3L3IB 5FF6A 5GS2H 3AMKA 1CWVA 5I1GL 1INDH 5EU5A 4EUPG 2VXQL 5IW1A 3STLA 4UI2A 1H3PH 1YN6A 4XXDB 4YDIL 4W6YB 4QXWA 2GTWA 4JFFA 4LPYA 1AGFB 3OX8B 2P5EB 3KJ4B 4CDHA 2KQMA 3QO1A 5FA4B 3SGJA 4ODXA 4U2YA 1NCBL 5D1QC 1LE5B 2YPLE 2GK0B 5JO5B 3OAYH 5FYJD 4XCFL 1QSFE 2N7BA 5KOVC 4G8EA 2FX9H 2G2RB 1DZBA 3O4LE 4G42A 3ARGC 2IMMA 2H1PL 4WV1B 3H9YA 4O2FA 3QIBC 3BW9B 2C1PB 5GJSH 1KB5A 3WFBH 3F7YB 4YHKL 4XRCA 4CW1B 5TQ0H 1ULVA 5J9PA 1NGZB 1S9YB 3LMJL 3SCMB 1JNHB 5JNYA 4U1NA 2WWMD 1V3JA 5ID0B 1MIML 3IKCA 4DZBA 5SX5K 4NQEB 5DQDH 5FYKD 5T1KD 3ZT7A 1KB5L 4AEHL 3WDJA 1MNUH 4OV5A 1NBZA 5IIEA 4LSUL 1ZHKB 3PDGA 3IJYA 4YNYA 2UZIH 2AXGB 3RWCA 3CFJB 4HLZH 1T2XA 4HPOL 5EZIL 3TH4T 1YEGH 4AYFA 5MP6L 1REIA 4ZUVB 3MREB 4JO4H 3SDDB 4HKZB 4Q9QH 4KZEH 4XXDA 4ELKB 5MI0C 4LCUB 2VZOA 3ARFC 4U1KB 5TFSL 2RAMA 3OX8A 1AGFA 1INQB 2P5EA 4D0CB 2DQTL 4I3SL 2VDNL 4PJFE 1KCSL 1N7ML 2YA1A 1KLUB 5FA4A 3AM8C 1LE5A 3ROOB 4GAJH 5LGJA 2GK0A 2OTPA 5JO5A 5GRWA 3WXVH 2G2RA 3BE1L 4NGHH 4ZNEA 4OLZL 1A7QL 2DD8H 4LCCC 3QDJD 2X1QA 1WC7A 4H1LG 4NJAH 4WV1A 3BW9A 4J4PA 4ORZC 4JM2F 5C0AB 1J0IA 2C1PA 2XZCL 5DR5L 4JRXE 3BGAA 4MYWB 3F7YA 4CW1A 1NGZA 1S9YA 3SCMA 1JNHA 2Q8BH 2A1WH 3BPLC 2VDQH 2XQBL 5ID0A 1N8ZB 2CXGA 4NQEA 1RQ5A 3EJZD 5IB5B 4YR6A 3W39B 5JW5B 5E4IA 1RZKL 3GMMA 5DJYB 1QFPA 4DKFH 1DQMH 1OT1A 3CFKB 4WWKB 5DK2B 1ZHKA 5FCUH 2K9UA 3OKYA 1LD9B 1DR9A 1JZ7A 4YWGL 2VXVL 3CFJA 1TQCB 2OJZL 3P40A 2AABL 5GRUH 5IMLB 4ZUVA 3MREA 4JN1H 3TIDA 3SDDA 4HKZA 4P2OC 1RMFL 1LWRA 4LCUA 3WE6B 4U1KA 4WUUD 3IKKA 4LQFL 3IDXL 3JXAA 1PY9A 2XKNB 3HUJE 4D0CA 1AC6A 2L7UA 3MRGB 1KLUA 2Q7YB 1LDPH 4HWBA 1RU9L 3GK8L 2QADC 4LLAA 4Y2OA 3ROOA 3WLBB 3QHFH 1RI8A 5EOCL 1BVKB 3GSOB 5JHDE 2E7CA 3STBA 3RDTB 1MQ8A 2JTDA 4PJXF 3SDXF 1CD0A 3FFCE 4WO4C 5AYQA 1FGVL 5BS0D 4HWBL 3TCXA 1ODAA 2VLME 5C0AA 2RBLA 4JGMA 8CGTA 4XPFH 4HBCL 1WFUA 4Z9KB 4ZFFB 1D5XA 2QSVA 2HFEB 5GZNC 1XF5A 1FAIL 4WTZG 3VD5A 4HIIB 2RB8A 2VXTH 3P0GB 2XOTA 4KDVA 5IB5A 4X6BB 4YX2L 3W39A 5JW5A 2YD3A 5DJYA 5DWUH 3JWOL 2AJUH 5E2WL 3WFHB 4WWKA 2I27N 3CFKA 5DK2A 1H8NA 3BPNB 1KJVB 1A9EB 1UM6L 5DD0L 4RFEB 3C09C 5EZOH 5E08L 2F9BT 4K3JH 2Y9RT 5D7SH 4JO3H 1JPGB 3C9NB 4Y7MA 1MY7A 1YY8B 3VW3H 3WE6A 3BZ4A 4PV8B 2XKNA 5KVFH 1HIML 2VSDA 3PP3K 3RFZC 3MRGA 3W2DL 4UT6H 2Q7YA 1PSKH 2JJTC 3WLBA 2XG5A 2WLYA 1BVKA 1G9NL 3GSOA 4LVHC 2ZUQB 3RDTA 1GOHA 3S3PA 5E8NA 4H8WH 1FVCB 1YQ2A 2A73B 3MRIB 4Y1AE 1XF1A 2B4CL 3UPCA 2ZKHH 4R97B 5SX4I 2HRLA 1PFCA 2WWKO 3G5VB 1HXMA 1CLYL 1ONQB 4ZO8A 4ZFFA 4MMXC 3AS1A 4GW4B 4HIIA 2AEPL 4PJ9B 3MV9E 2WIIB 4X6BA 1IBGH 4KK8C 5BO1L 2GJZB 3QFJB 4JR9L 3WFHA 4XC1L 4TSBL 4ALAL 2EH8L 3V52L 4MAYB 4S2SB 5C86A 3D87B 1IQWL 1UWGH 1A9EA 3HCVB 1LEIB 1RUMH 4KJWD 2YC1A 4RFEA 4U1JB 4FRWA 3GJFK 1JPGA 3C9NA 3SPVB 4XAWH 4D2NA 1YY8A 1U3HB 4P4KB 1MCKA 4PV8A 4EUPH 5ECJE 2NY7L 3ARYA 4HV8B 2ZOLB 3U9PH 3SDCB 4L3AA 3C08H 1BD2B 3MV8B 1TQBC 2JJWA 1IAIH 5EU6D 4PJHE 5J6GB 3X12B 2DI7A 5IROC 5JXAL 5T33L 1IRAY 2DLIA 1H0DB 4HCRH 5GRZA 1F13A 1I1AD 3O6MH 1FVCA 2A73A 3MRIA 1I3GH 3CU1A 3JTTB 4NHCL 1BQLH 3G5VA 4U05A 1ONQA 3FN9A 4WHCA 3ULVC 1GGBH 1BBJB 2HFFA 5IJKA 4GW4A 2KZWA 3CMOH 3MBXH 4MD5B 3VJ6B 3NCEB 4MB4A 4PJ9A 5T3XD 1MSPA 2WIIA 4TN9A 3CLEH 2GJZA 3QFJA 2OP4H 4P2QD 1G9MH 1NMBH 2BY3A 4JPWH 5GJTH 1RURL 5K9OB 2FJFB 4RDQF 4NWTL 3GNMH 4S2SA 3RY5A 3QH3B 3Q2CA 4LARL 5I8CA 3NTCL 3LEVH 1S7VB 3HCVA 5C0DB 1LEIA 2E7BA 1VFAB 5A2JH 4U1JA 3BN9D 5BZWB 5E8OB 1TPXC 3BZFB 2PETA 1U3HA 4JM4H 3N1MC 1IL1B 4P4KA 5IT2H 4DQOH 1MJUH 3TJEL 4Y2DD 2B20A 1RZ7H 5IVXE 4HV8A 2ZOLA 3SDCA 2HJLB 3T0EA 4LVNC 1BD2A 3MV8A 5EC2B 4LK4A 5TE7H 5J6GA 3X12A 1AGBB 1QBML 5JQHC 5DD3H 1GAFL 3SBWC 1H0DA 1VADB 3NA9H 1VKXB 2W92A 3LS4H 3JTTA 4XGZB 5HGGS 4JQIL 4XPBL 1NC2B 2X1WL 4PJ7E 1JNLH 1BBJA 1HKFA 4H1LH 4LMQE 4QGTA 1DE4B 4JVPA 4MD5A 3DSFL 2W9EH 2VAAB 4I5BA 3I6LD 5IEHB 3MOAH 1VPOH 5C09E 3KPNB 1KF9B 4MX7B 1FH5L 5K9OA 2FJFA 3N1QC 4G5ZL 1FPTL 4I0PC 1CU4H 2A6JB 3QH3A 1LK2B 3CK0L 3DX7B 1ORSB 1S7VA 4LSVH 1Q0XH 1Y6NR 1VFAA 2BNUB 1CVSC 4GG8B 2J4WL 5BZWA 5E8OA 2FBOJ 4TVPL 1NCDL 4Q6IA 3WXWL 1IL1A 2PO6D 3RVXD 5CJQL 3CLFL 1QFWL 2V7NB 1P4BH 2EE3A 2HJLA 4KPHH 4KKAD 1X44A 3KYKH 3VU2A 5EC2A 1RZJC 5ITFB 5EU7C 1AGBA 1JGEB 3PWLB 1AO7B 1DN0B 1VKXA 4RMUA 4FQLH 3U30C 1YEIH 4P59L 2PNDA 2DTMH 5JPMB 2F5AH 3MUZ1 4XGZA 4ZSOE 1INEH 8FABB 3NPSB 5CSZB 1NC2A 35C8L 3QI9D 4Y16D 3D69A 2XXMB 5CD5D 1QNZH 4OLUL 4MJ5B 1WTGT 3P4NB 1DE4A 1QA9B 2H26B 2VAAA 5EFIB 2CGRH 1IKFL 4HULB 2VQ1B 1UWXH 2AI0L 3KPNA 1CFTB 3OJVC 2CLZA 2YEZA 4KGLA 1QFUH 4PY7B 4YHNB 5ICXB 3RZCC 4XWGH 4MCYB 5F97E 3IDYC 2A6JA 2ZNXA 1FL5B 1LK2A 3DX7A 4FXKB 2BVEA 5GGSY 4GAFB 1FRGL 4XCYB 2BNUA 1A0QL 1VFMA 4GG8A 5BVPL 2DQFB 5HPMB 2B1HH 1CXIA 5GHWH 2JIXD 2J8HA 4PP2B 3K81A 3O6LL 4XCEB 2I9LB 3FAXA 1G6RH 3LS5L 5C07D 1U8KB 3S36L 3QXUA 3F12A 2IEPA 3EYSH 5ITFA 4K3DH 4HS6A 4MA7H 1JGEA 4YHLL 2VXUH 1AO7A 1DN0A 5BJTA 5EOCJ 3FB7B 4L3CB 5L7XH 5FA3B 1WZ1L 1M7DB 3SJVB 5IBLD 1TDQA 5ACMA 5JPMA 2P5WE 4UILH 5HI3C 2FL5B 8FABA 1KEMH 4LSTH 3WS6C 5JOFB 2AJXL 4X4ZA 1WF5A 4MJ5A 5TQ2H 1Y0LB 4LLUB 5GXBB 1K8IB 1YMMB 3P4NA 4TSCH 3S4SB 1QA9A 2NXYB 4L3ED 4PGCB 3QIWD 5IBTL 1X5LA 5D7IE 2H32H 5EFIA 2LTQC 2VQ1A 2V5MA 3REVB 5ELIA 1CFTA 4X83A 2Z31C 2NXZB 5K59F 4PY7A 5ICXA 4RGOH 1A6AB 4GMTL 2R2HB 3GKWH 3HRPA 4K94L 1FNGB 1FL5A 4PGJA 4FXKA 1BM3H 4U1GB 1Y6MR 4XCYA 4KROD 1C5DB 1KLGB 3C6LB 1JPTH 5HPMA 2DQFA 1UENA 2K3TA 4IOIB 3NCYP 5ITBH 3EO9H 4NNPL 2X42A 3BWUC 1SYVB 3CFIC 2XYCA 1S5IL 4MA1B 4NUGH 4PP2A 3TF7C 3L3OA 4XCEA 5IKCA 2I9LA 3U0TA 5TE6L 4LEXL 1U8KA 1NGQH 3NGBB 5CGYC 5I15H 1UA6H 1NC4B 3VGAC 4LLWA 4X9HA 1GGIL 1C1EH 3FB7A 3C8DA 4L3CA 2Z93B 4G8FB 2OZ4H 5FA3A 2WNGA 1M7DA 3SJVA 2A6KB 3IU4H 3TESA 2ZZUT 4KGJA 1NFDF 2FL5A 3GSRB 4PREB 4QNPF 5JOFA 1JFQH 2VXSH 3RUGA 5BVJB 1C5CL 5BCAA 3MODH 4XC3L 1Y0LA 2DN7A 3MJ9H 1YMMA 3AS2A 3MRBB 3AB0C 3QNXB 4GFTB 5E4EC 3S4SA 4PGCA 3VFNB 4XVTL 3UTSE 4KMQA 4OLVL 5TH2B 3REVA 1KNOB 3LKSB 4F7EB 2ZG1A 4TUKL 3DGGB 5C08E 5LCVL 5CBEB 2R4RH 1KCUH 2CLVA 1A6AA 2ZCHL 4PJ5E 4DOHB 1NGWB 1CLCA 2IAND 2NY6C 4YJZL 2NX5B 4L8DB 3MRNA 3BMWA 1C5DA 3C6LA 1ZMYA 4KY1L 3ETBF 3UTOA 3LEYL 5HGHB 4IOIA 3BH8B 2ITDA 3DX8A 1SYVA 4KI5D 1E6OL 5T1KB 5F9WB 4OKVB 3U4BH 5EA0L 4G7YL 4KRPB 4QHMB 2E27L 3B2UC 4KJYB 4KK9D 1NC4A 2AS5M 5CEZE 4HDIB 4POUB 4JHZA 4NFBA 4AQOA 2BJMH 4M9OA 1II4E 4XI5D 2Z93A 4G8FA 3JSSA 1DLFL 2A6KA 5DFWH 1FGNH 1ZT7B 3C5SB 5DMYA 2DLFH 3GSRA 5L0QC 1I8IB 2XTJC 4PREA 3W0WD 1BFSA 1OM3H 4GQ9L 3BYTA 5EO0B 2WK2A 3FO1B 5BVJA 2OXHA 4GG6E 4OGAC 3LVEA 5DD1H 5F8QC 2AEQH 3MRBA 3QNXA 4PR5B 3VFNA 4N0FB 1RUQL 5TH2A 3LKSA 4J6RH 5FUOH 2IFGA 4F7EA 3DGGA 5CBEA 2CRIA 5HI5D 4DW2L 1C5BH 5TPWH 1OARH 3OKMB 3H9HB 4FFYL 2NX5A 3K3QA 3QDMB 4L8DA 1IGMH 3TBVB 1IEAB 4UAOC 5FYJL 4GBXB 5F71A 3G9AB 1QSED 2VWEC 5HDBF 5HGHA 3BH8A 4JEGB 1CE1L 2EXWC 3FQWB 2UWEE 5DMGD 5T1KA 3ULUD 3V6OE 4OKVA 2I5YH 4LLQB 4ZTPL 4C57C 1GJIA 2VLKE 1MCQA 3BP6B 4YUEL 4PP1C 4KJYA 5L9DL 1Q94B 2J6EA 1XIWC 4MXVF 1IGCL 3IFNL 2EE6A 4HDIA 2IAMC 4FQ2L 4G8GE 5F21B 4JO2L 3R8BB 1MCBA 4PRNB 4KVCL 4PLKC 4B41A 4WFHE 1BQSA 2J6EL 3LHPL 4YGVB 1H5BC 1ZT7A 2KPNA 5C0ND 3C5SA 2EE9A 5IB4A 4FQ1L 5IB1B 4PRPD 1I8IA 3DBXA 4HF5H 3SE8H 3TH2T 4W81A 2GT9B 4WUUB 5EO0A 1ZHNB 3FO1A 4H0IA 1EK3A 3NIDF 5MENE 5DRZB 2CKBB 2EH7L 1NAMB 3CX5J 4S10A 4OGYH 4YLQT 4PR5A 1A1NB 4RIRB 3FQTB 4N0FA 1LE9A 1CD9B 2A77L 1CTOA 2E6PA 3VXMD 5CS7A 4WGVB 1BEYL 4ZS6C 4S1DC 4FZ8L 3BDYL 3QDJA 4XP6H 3H9HA 4M8QB 3LQAC 4P99A 4NRXB 4WW2C 4CN4A 3QDMA 4LIQE 1X5JA 4YBQC 3TBVA 1IEAA 3GI9L 4EOWH 4DVBB 4JM2D 3QPXL 4M03A 1RUKH 5I18L 3HAEG 4KTDL 4KTEH 5CSBA 5CJ8A 3LZFL 4IDJL 3MSPA 2YPLD 2OLDA 3FQWA 4OLXH 5D71L 2IQ9L 4LLQA 5GGTH 3BP6A 5DT1L 3FO0H 1Q94A 3ARWA 3BP4B 3SDAC 1L7IH 5LXGH 5B39G 2Z91A 3KG5A 4PG9B 2ICWJ 5JW4Q 4PRNA 4M6OL 4C56D 5SWQB 5CFHA 1FNEB 1UXWB 4OTXH 1D9KD 4YGVA 1J9CT 5CJOH 4CNIB 2GT9A 4WUUA 4Y19B 1ZHNA 4OFYA 4DAGH 2CKBA 2FBJL 1NDMB 1NAMA 3QQ9C 1A1NA 4RIRA 3FQTA 3C8KB 1JBJA 3KWWB 5J13B 4PJ8D 4GOSA 2CKBL 2O61B 1NAML 5GGVY 3PQYE 5ALCH 5E6ZA 5T1MB 4Y5XC 4M8QA 3S5LA 4NRXA 2R15A 2QQKH 1CDBA 4FFWC 5ICYB 4G9DA 2XWTB 3B3IA 1Q0YL 1U58B 5LWYH 3VXRE 4DVBA 3I84A 3G6JF 3I9GH 1J0JA 4WEBH 2AV7B 3DX6B 1CLOH 4OZHE 1NDGB 4P5TD 2VTFA 2FB4H 5I73B 2NY2B 3VA2C 5EU3B 1KCKA 1S7WA 1S7UB 3BP4A 2BY2A 3T4YA 2X4SB 4FQQA 4O5LH 4CN1A 5IB2B 2BHZA 3F7RA 4PG9A 3TT3L 1HCFX 4PJDE 1KC5L 3KPOB 2YHGA 2PR4H 5SWQA 1FNEA 2YK1H 1YPZA 4O2CB 1UXWA 3T2NL 3RU8L 1KUMA 4XVUC 2E8YA 4PYHA 4CNIA 1BBDL 5CEYB 3Q1SH 4QWWD 5F1OB 4Y19A 4GRWE 3TBTB 3N0PB 4R9HA 1NDMA 3C2AH 1R3LB 3F5WB 3PJSB 4BYHA 3MLSL 4HS8H 3WKMH 3C8KA 5EU6B 4MDJB 5D1XB 4LLYB 2R69H 5CEZH 1AR1C 1MF2L 3L1OL 2JB5L 2O61A 4XHJD 4RAUB 1I1AB 5JHLL 1X5GA 2AW2A 4MJ6B 4NN5C 1ZE3C 1WV7T 5J12B 1T83A 5F7DB 4CL7A 5ICYA 2APTA 3KPRB 3OB0H 4UTAH 1U58A 3KJ4C 5I8EB 1J86A 3OKLA 5DQ9B 2AV7A 3C87A 5DHVH 3DX6A 1EJ6A 2GUOA 2WUBH 5ESQB 4HXBL 5D5MF 1NDGA 7FABL 5JHDD 1G7PB 4MQSB 3ZDXF 2EDEA 5EU3A 1SJXA 3CDCA 1NL0L 4P2QB 3PWPD 1MJ7L 3BUYB 3JWDH 3BD3A 4OT1L 1S7UA 4JFXB 4OCYL 2X4SA 3FT4B 2CK0L 5HHVH 1F4WH 1VSCA 1H15B 2ATPA 3KPOA 2YUXA 4O2CA 5DVNA 2X70B 1UKQA 2I26N 1IFHL 5CEYA 3UTPE 5FGSA 1KTLB 1JJUA 3VFUB 4Y2DB 4OB5H 4JCLA 4LRNH 4TNWF 1LEKB 5FO7B 3F5WA 1R3LA 3L3GB 3PJSA 3GSNH 1RY7B 3CFCL 1Q72H 5EU6A 1UCBH 3S35H 1BZ7B 1JWSB 4MDJA 5D1XA 5KSAC 4LLYA 4Y0GA 1X6NA 3H9SD 4FTVD 5F7MC 1A3RH 4XPAL 4RAUA 1I1AA 2DYPB 1NAKH 1X5KA 4MJ6A 3GM8A 4Z7NE 3LKOB 1CFVH 3MJ8B 1T7YA 5F7DA 3CVHH 2FLRT 4U6HB 4JPKL 3KPRA 4W4OC 5I8EA 4CKVX 4YZFF 3V6ZB 2HJKB 3WFEL 5DQ9A 3I2CH 4K8RH 5ESQA 4Q9BA 5I75C 1WZLA 2CXKA 4LQ1A 2EDHA 2VL5B 2EEBA 2RGSA 3KLDA 4P2QA 5C2BL 1ZTXL 1KV3A 3BUYA 1S9VB 4G6ML 5C6PB 4JFXA 5DJ6B 4JRYD 3L3HB 1ZWIA 2EC9T 1A5FH 3QXWA 5T3XL 3ARZA 2DJSA 1KPVB 1B6UA 1H15A 2P48B 4OQTH 1O0VA 2X89D 4LIQH 1MCHA 3DO3A 4YBLB 1MCEA 4R26H 2C7UA 3K7UA 5SWZE 3BKJH 1X3DA 4CVUA 5KVGL 2X70A 4OCRL 4NQCD 5LGHL 4LPUA 3D0VA 1KTLA 3VFUA 4Y2DA 5GRVL 4LAQL 1LEKA 4KKCD 2QSQA 4HFUH 2R29H 1BGXH 3AAZB 4MDIB 4K9EC 4NT6B 1FC1A 1BZ7A 1JWSA 2FDBP 3VFRB 3HC4L 5B38G 1DLHB 2MMXA 5DTFB 1X4XA 5E2VH 1MQKL 2J5LB 5J8OA 3LKOA 1QHPA 3VXOB 1JYXA 5FHBH 1MVUB 2QQLL 3MUHL 2QBWA 4U6HA 4BZ2H 3P9MB 3QI9B 3S37X 3EBAA 5DC9B 5FGCE 2RJMA 4RQQB 4WFGD 2HJKA 1ITBB 5CINL 1DCLA 5DD5L 5J89A 4TSAL 1CFNB 5DUBB 5AZEL 2VL5A 1CD8A 3HAEH 1RULH 2HKFL 1ZLWK 1S9VA 4J23A 2BOCB 2EEAA 3ZE1F 4LSRH 5DJ6A 4OI7A 4UB0H 3BGFB 2QJDA 1UZ8B 3S9DB 4F9LC 3EHBC 4RMQA 5DA4A 2AXHA 1KPVA 1SQ2N 4NO0B 4X98A 5GGUB 3SGEI 1SY6A 3K8LA 1EGJH 4HUUB 2OK0L 1KJMB 3TT1H 3QIUD 1W0WB 2D7QA 4WY7L 3W5NA 4P2CG 1ZVYA 1HHJA 3GBML 1SY6L 3UJIL 4HS3B 4I2XB 5E00B 3AAZA 4MDIA 1I8LA 2DQHL 4NT6A 3EO0B 3VFRA 3VWJC 4JFZL 4JDVB 3PNWB 4PB0L 1DLHA 4JFDD 3DRQB 3C5JB 4D9LH 1ITCA 4ZO9A 4PJXE 3FCTA 3VXOA 2ARJQ 4NWUL 2V2TB 1MVUA 3BAEL 3QI9A 3I75B 2VZUA 4Y16A 1CQYA 3VXUE 5E24E 2BVPB 4RQQA 4XVSH 4U7SA 4GRWH 3T0AA 2Q7NA 3G5ZA 2VO5A 4L3EB 1CFNA 3QIWB 5I2IB 4MQ7B 1NCCL 5DUBA 2BSED 2JE8A 1L6ZA 4X7FC 1MFCL 4QRUA 1BJ1H 3IAQA 3MNZB 4I1NB 5SWSB 1EZVY 2D4FA 3FONB 2BOCA 4G6KL 3CH8A 4R97C 3SOBH 3HTLX 1YEHL 4PYGA 3ZMRA 2VN7A 3O2DA 4ODTH 3O41B 4HWEL 1CIUA 2CDFB 5D1QD 5IJKC 3OXSA 2UY7A 2NY3C 4K2UL 4HUUA 1HCVA 4PJ9C 1D5IL 3UBXB 1W0WA 2DQCH 1IGIL 1OQXA 4FQJL 4NO2B 4OD1H 3QIBD 3WIIH 4HS3A 4I2XA 4IMLB 5M7QA 4MAYC 3EO0A 1XEDA 1DQDH 1EX0A 1YNKL 1MLCB 4JFED 4PJIE 4JDVA 3PNWA 3B9VA 4XPGH 1IARB 5ICZA 3C5JA 3H3PL 2XZAL 1UT9A 2RQ8A 1DEDA 1E4XI 4P4KC 1MIEH 2V2TA 2AJZB 2F15A 5T3ZD 5IUSA 5CP3H 2M1KA 3I75A 3OAUL 4ELMF 4KDTC 4ZD3H 4YHOL 2BVPA 4GAYA 4PUBH 4L3EA 3QIWA 5I2IA 2FO4A 5DK0A 3MNZA 3G9VA 3RX5A 3LRSB 3RAJL 5FO9B 3ARFD 3IFLL 1DQLL 4X6DE 1P9MA 3OF6D 4X5LA 1RUAH 1P4IL 1KIPB 3VXPB 5AZ2L 3O41A 4UV4H 1I3UA 2CDFA 5GJSL 4Z7QF 2BFVH 1NLBL 1OL0A 2DQJH 3MLVL 2X4TB 1R0AL 4WW2F 3UBXA 5LQBL 1ZLSL 3T0DA 3KPLB 1I7UB 1QG3A 2UYLB 4FG6D 3SOBL 1LNUA 4NO2A 1BPVA 4P5MB 2XQYK 5A2LH 2AQ3A 5DQDL 5K9KB 4IMLA 5EBMA 3VGHA 1R5WB 4F7CB 2F8OA 1OP5K 2CJUL 5HYFA 2FWOB 3QZWB 4Z95H 1MLCA 4F57L 5JLZA 5GGVH 1VB9A 4OIBA 2FATH 3VXTB 1KCVL 4IRZH 4HK0B 3OKOB 1PVHA 2W59A 3QRGL 2AJZA 4QOKD 2CMRH 1M6OB 4C54A 1IM9D 1WEJH 1Z0MA 2GJ6D 5FUZL 3FRUB 1LO2H 1S7TB 5EO9B 1PY4A 3LH2L 4FZEH 5KN5B 2XZQH 3Q5YA 1XF3B 4KUZL 5GS1B 3KXFE 4P2OD 4MD0A 3LRSA 5BRZD 3SGDI 4GAJL 4OZIF 1JHTB 4HWUA 1CXKA 4LASH 2VR4A 2VC2H 2NZIA 4G43A 1CGTA 4X7TA 4FQXD 2IANA 1E28B 4JY5H 3ZT6A 3RNQB 1KIPA 2R56H 3VXPA 3O11B 3X3FL 3MXVL 3EUUA 1UJTA 4EEEA 4ZXBC 4L5FL 2EECA 1T0PB 2X4TA 5CCKL 3AVEA 3KPLA 2A1WL 4PJGF 1I7UA 1DVFC 2GJJA 4WO4D 3HR5A 3EO1B 4P5MA 4HPYL 1QKZL 5K9KA 3HC0B 4LCWB 1R5WA 3EYUH 4F7CA 3GBNL 1U42A 3T4AB 5HDQH 2NY0B 5JW3L 1DQML 1FDLL 2FWOA 3QZWA 4Z6AT 5HYSG 5IGXH 5GZND 2SEBA 3WEXA 3P0YH 1NGXB 5KANI 3VXTA 1IGTB 3FN3A 1I9IH 2P46B 4W4NA 5BOZG 4HK0A 1F45A 4RSVA 5CD3A 3OKOA 4ZOBA 5HSFA 1J88A 1EUUA 1CBVH 4PGEB 1OLZA 3H6JA 1OSZB 1M6OA 3V4UH 2XXCB 3ARRA 1ES0B 5HGDB 3GHEH 4Y8AA 3FRUA 1S7TA 5EO9A 1TFHA 4RAVB 1JZ6A 1F3JB 2M2DA 3LRGA 1CDGA 5KN5A 3VXMB 1NMAL 1XF3A 4U0QB 3CC5B 5GS1A 3WN5C 2YD1A 4DGVL 2ILLA 3OJDA 1MFAH 4HXAH 1JHTA 4XZUB 1X5ZA 2APFA 2MSPA 4EI5B 3G6DH 3B4NA 1E28A 3RNQA 3BH9B 4Z0BL 3QT2A 1JRHI 3FQNB 1YEJH 4PTTB 3ELAT 4WHTB 1HHGB 1KENL 2DQEH 4YC2C 4XAKD 5DJZB 4R8WH 2YA0A 2X4RA 1BFVL 2ZOKB 3NACH 3CAFA 2YPLB 4HJJL 2YD8A 1YEEH 1NLDH 3UYPA 2IADB 2XRAL 3EO1A 2VXTL 3QUKB 3U7WL 3O4LB 3HC0A 1OCWL 1AI1L 5E9DE 4LCWA 1AKJD 3UDWC 4DUXA 2AJUL 3T4AA 3ULUL 5I74B 1I1RA 5D6DA 1J87A 1NGXA 1IGTA 4IIQC 4LCYB 2OYPA 4WIQA 1DJSA 4GUPB 4JG1H 4KK8D 3VRJB 1D9KB 4EUPB 3CX5K 3FB6B 1OHQA 3AC0A 5TF1L 1OSZA 1H3WM 5KAQF 3O9WB 1ES0A 5HGDA 5KS9F 2I25N 1O7SA 1MRDL 1U2HA 1NFIB 1CFQB 4RAVA 3QWOB 3WDHA 3ZZ1A 5I0DA 4AMKH 3VFWB 1F3JA 3NH7H 5AG8A 1IILE 3VXMA 4H0HB 5F89B 4JO1L 3CC5A 4JFPB 2N7AA 3DV6A 3U7AA 4PJAB 3HG1E 1OP3H 3ALXA 4OFDA 4XZUA 4AIOA 3DX9B 4UOW0 4NP4L 1N5YL 1KIUA 5IW6B 3T2QA 4X4MA 5GSVB 2XA8H 3GEWB 3P2TA 3BH9A 1HNFA 3V6BR 1AR2A 4M1CC 3CFBB 3FQNA 2LQRA 1UACH 3SDXB 5DUML 4PTTA 4WHTA 1HHGA 4PJFB 2GY5A 2D9QB 4HJ0C 5DJZA 3EYOA 5I19H 2ZOKA 3H2WA 5JW4N 1M4KA 4IRSD 4MNQD 5FEBA 5C7XH 2YPLA 1HN1A 4UDTB 1WAAE 2IADA 4QY8B 4LRIC 3T09A 1MEXL 3QUKA 3U7YL 1YNLL 2F53D 3SE3C 3MRFA 3HB3C 3ULVD 2NYYC 3E8UH 2IC2A 4JRXB 4HD9A 3RIFK 4BSVB 3MRDB 2H2SC 3ARPA 4MAUH 4NBYB 2Y23A 4GUPA 7CGTA 3EOBB 4R96A 5AUMB 3VRJA 1D9KA 4EUPA 4EJ1C 4M62H 3PHQB 3GIVA 3O9WA 4R4FH 4QTIL 3O0RH 4RWHA 4UINL 1NFIA 2AEWA 1CFQA 3QWOA 3RIAK 4G3YH 3SQOL 2OS7A 4CUCA 2C3XA 1M05A 5F89A 3RWIB 2Y7QB 1U8LB 4PJ8A 1DBAL 1UWEL 1Q9KB 2VDLH 4PJAA 1V7NH 4K7FB 4XB7A 3DX9A 4ONGH 5IW6A 4JFYB 5GSVA 3O6ML 4OZFB 2FSEB 4H1LB 2X7LB 3CD4A 1WIOA 3SDXA 3HUJB 2BVOB 3PXHA 4PJFA 2GKIA 2AXFA 3TWCL 4UDTA 4YFDB 5KBNC 1T89A 5JHDB 3B9DA 2HT4C 1S9WA 2N1KA 4L4TE 5HDOA 3UJTH 3PWPB 3BT2L 3FT2B 1KTDB 2J2ZA 4LLMB 4ONFH 4JRXA 2KL6A 4QXUH 1HKLL 1VHPA 5KTEL 4JHWL 3MRDA 1PQZB 3SKUD 3GNML 4NC0B 3EOBA 5D2NA 5AUMA 4XMKH 2B5IB 1ZVSB 1ED