1CFQA

Anti-p24 (hiv-1) fab fragment cb41
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN))
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
molecule tags Polyspecificity
total genus 41
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1999-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfqA01
4Q58C 3JSSA 1JVKA 2ITDA 5JXEA 4L3AA 3QIBC 3GRWH 4L3EA 5GGSB 1UZ8A 3GMLA 4ZPVA 5I1JL 4LLWB 4KAQL 4LAQL 2EC9T 2WUCH 3CFKA 3WFEL 4PUBH 1JYXA 2E9WA 5FUZL 5C0EA 2G2RA 1QYGL 4F7TB 2X4OA 1NGXB 5IF0B 1IM9A 1FFNA 2AK4B 3GJEA 5HSFA 4NSKB 4JQIL 4KI5E 3IDJA 4PRHA 4OSUL 5BVJA 4OUUB 2A6DB 1QFWM 2VDLH 2BVQA 3CVHH 1PJ9A 3GSRA 4JHBA 1DQJB 3CFBB 1BECA 3QI9D 4JFEA 5CJOH 2VXUH 4L4TB 4Y4HB 2J8UA 4F2MA 1VADA 4UT7H 4KDTC 4FQ2L 3SKOB 4GXUN 4ZXBA 1DL7L 3NACL 1JPGA 4FXLA 4MA1C 4M7ZC 4DQOH 1QLEH 4PP2A 5EUKA 5SX5H 4KJWD 3BVNA 1FL3B 3CGTA 4HFUL 4MD5B 5HHPB 4JQXC 4GAGL 4XBPA 2CDGA 4U1MA 1FNEA 3TJHD 2E8YA 2E6JA 4TSBL 3X3FL 2P43B 1JYWA 1N6QL 5IVXF 1BVLA 1KTRL 4LCWD 4EN3B 1ZA3B 2AXFA 4C4KT 4G5ZH 2WBJC 4RBPH 4PJXF 4L9LA 3OKYA 3U2SB 1CDUA 3BKMH 3UYOD 3A0OA 4DJMA 2YPLE 1BF2A 3WIFB 3O8XB 5E4IA 1MHPH 3ZO0A 4HT1L 1KPUA 1QLRA 1Z2KA 3I84A 5FGBC 3IS1X 1BQLH 4ZOAA 1CFSB 2IG2H 4Z5RB 3BH8B 3V6OE 1NFIB 1KXQE 3VXQB 1EO7A 4X98B 1OAKL 2GK2A 2BVTA 4GRLA 1TITA 1T66C 3GSXB 4LKCB 3CSGA 4OKDA 1ZLUH 1OGAB 1AJ7H 1HH6B 3ZE2E 4OLUL 5I1LA 3KDMA 5ADPH 3NBNA 1RHHB 4OLXL 3IJSB 5D7LD 3I6KB 3VGEA 4I2XA 3IJHB 1JYVA 5C0GA 1OP5H 1M1SA 3PQYB 4XBGB 3OR6B 1BF8A 1Z5LA 2BDNH 4RA3A 1KYOK 4QCIA 4OD1L 3BJLA 2X10A 3IF1A 4JDZA 1S5HB 2DTMH 2L4OA 4R0LC 1CL7H 4OZHE 5DD1L 5E9DE 2FEEI 3OPZH 1RFDH 5DSCB 3BAEH 1CFTA 4AM0A 1RD6A 4HC1H 1JF5A 5J6HB 1D9KD 2BXYA 4KY1L 4HH8A 3GMMA 2E27H 5DUMH 3L6FB 1I3UA 3UPAA 4ZTPH 4XP4H 1LGVA 3ARWA 3T09A 4DFIA 3ZTNH 5GJSL 4OM1H 2WMPA 1UA6H 1G1CA 2Y5TA 2EC8A 1B3JA 1D5BB 3BQUA 3F6IA 4WO4A 1MQKL 1T3FA 5FHAH 3OKDA 1L7IH 5MI0C 3BZDA 3MV9D 2FX8L 5HDQH 3GKWL 5IT2L 1U2HA 4G6KL 2VL5A 4TUOB 1ZLSH 4QGYA 1RU9H 3ZE2F 4O2FB 4XPBL 1D6EB 4WW2B 3PWVA 1I1AC 1SBSH 3CUPB 5CSGA 3DIFB 3KJ4C 4Y7MA 4URTB 5MEOB 3UJTH 4N1EA 3FFCD 1G6VK 4CMHB 4D2NA 1WWBX 3H9YA 4PY7B 4GG6E 1JV5B 1FVEB 4IMKC 3RVTD 5JOFA 4MDJA 3P4MB 1G7LA 4ELMF 3LH2L 3WFZA 4OQTH 1EUTA 1KNOB 5JW4Q 2CIKA 4NQEE 5BMFH 1U2CA 2M1KA 3HE6D 5D6CB 3T0ED 3OAZK 2ZCKL 4KK6D 4S10A 4Y5YA 1G7MB 2BHUA 3ORJA 4WW2F 5GGUA 4KXZH 3GSQB 4OZFG 4RAVB 1BBDL 1DBML 4D9QD 2EC9U 5FOBA 3QI9B 4J3VA 3BWAA 5DWUL 4ZSOA 3UTSA 4KMTL 4K23H 5GHWL 1AXTH 1NMBL 2VISA 3WUWA 1XF5B 1S8DB 2V2XA 3BPLB 2BJML 1LE9B 1OPGL 1MH5B 3QDGE 3I85A 2NNAB 5E2JA 4HK0B 4OB5H 4PRNB 5JXAH 3FO0H 5FKPA 1S7TA 5C70A 1HSAA 2YUWA 3PWNA 5KSBA 2C26A 2IPUG 4JRXE 3GB7B 2CH8A 2QQQA 1S7SB 3L5JA 2IH3B 5I30H 4LCWB 1F45A 2ERJB 3MV7E 3TZVC 3ULVE 2PCPA 4M5YH 4Y2DD 3KLHC 3H9SD 4Y5VB 4PV8A 1TJHH 1RUPL 4Z95H 5HXMA 3V4UL 1DEEB 1K2DB 4G7VL 3ZKSD 4GKZA 4YGVA 3VFUB 1WBZB 4NKMA 5INDA 2CRZA 1G9NH 1NDGB 1R5WB 5J56B 1CD8A 5E8EB 5ALBL 3DROB 1A9BA 1MCOH 2CD0A 3WL9A 3QZWA 4RNRA 2GFBB 4TSCH 4V2CB 2BOBB 3BHBB 3CSYB 3LKOB 4PJ8C 4YHOH 1A3RH 4Z77A 1EHLL 1OTSC 5KBNC 2QADD 5HY9A 1KIUA 4Z7VA 4OLVH 5F1OB 4UBDD 4YFLF 3RL1B 2P45B 5GGVH 1FHGA 4QRPE 2CDFA 4Y4FA 1FBIH 4LHUA 1W0WA 5I1GL 1OF2B 1XGUB 1CZ8H 1KB9K 3CXHJ 2DQUH 1A2YA 4ZFGH 4JPWL 4TQEH 3HN3A 2XT1B 3QUMB 4J1UB 2X40A 5BOZG 1KCRH 1DFBL 3E6HB 2IJ0C 4PRIE 4L8SC 3VXRD 1JWSB 1MCRA 3H3PL 3FOMB 4OZFA 5D7IE 3AXLA 5EZIH 1U3ZA 2Z8VC 3O4OB 3MCKA 2BC4B 3HNSH 1D9KB 4RGNE 4NHUB 4P5TD 5SV4A 3LS5H 4PV9A 4X80H 1CLOH 4XWOD 2XN9E 4PGDB 1KIPB 5IB5B 4HPOH 3DYOA 1Q9OB 4CW1B 5JW3L 1P4BL 3I02A 1OOAA 1CVSC 4KJPD 4UQ3B 2M2DA 1T7XA 4PGJA 5DRZA 2YA1A 1R3HA 4LMQE 3SO3C 2Y06H 3MV01 3BT2H 3GSOA 2EKSB 5DRNB 3T3PF 1NBZB 2GT9A 4HWZB 3MV9B 5I17B 5TJWK 2OQJA 2VOTA 1SQ2N 4CVZA 4IOFC 4QOKA 5KSAC 5L2KA 2CUMA 2MCPL 3X14A 1N8ZA 1JZ8A 4XPGH 1LE5B 2H2PD 4LVHC 3PNWA 5DJ2B 2J3SA 3RGVA 3KPSA 1GIGH 4Z7OF 1NGWB 3FFCB 5BZWA 3FN0H 3MGOB 1J05B 2BRRL 4PJAF 1CD9B 5SWZD 1FC1A 2GUOA 5LJYH 1BQSA 4PJ7B 3VXUB 5C7XH 2FGWL 4ZS7L 4Q0XH 1BVZA 2D7OA 1ZVHA 4HWBL 1T04B 3HE6B 4LLVB 5HHVH 4CJ0A 2OI9C 5T5NG 1IEHA 2W0KA 4E9LA 2AGJH 3P0YL 3G04A 4HIXL 1XGYL 3QCTL 4ZUTB 2X4UB 2HTLC 3M1BB 5I2IB 3PL6D 4FFZH 3BYYA 3KGRA 2ARWA 4JRWA 4R97C 4OFPA 3T4YA 5CEYA 3OMZA 4KKLD 1P7KA 4PYGA 2ZUWA 2UZIH 2V7NB 4QO1A 1CLYL 4D9LH 1KT2B 5EBLB 4Y16B 1BOYA 2X5PA 2CLVB 3GMPA 4XVTH 2VSDA 4HQQH 4X4XA 5D2NB 1AGDA 1KGCD 5IBUG 3WKML 2XY2A 8FABB 2DQCH 3S35X 2R4SL 3HG1D 1H5BA 3V0WH 3LPGA 5DYOB 4YZFE 1HHKA 1IT9H 4MB5A 2V2WA 3MROA 4ZODA 1JN6A 2XTJE 2W9EL 4H25B 1XGTA 3UXFA 1CICC 3INUL 1JTTA 1UB5B 1UWXH 1OWRM 1YZZA 2KH2B 2VQTA 3N9GH 3RHWK 3MXVH 3CLEH 1S78C 4O9HH 2B5IC 4APQD 3TV3L 3MV8E 1KN2H 3HZYB 4IRJD 4OCYL 3BGMB 4Y2DB 3PF2A 3H9SB 2AXHA 2F5BL 4UIKL 2ZCHL 5IG7A 3NIDE 4K71C 1NGZA 1P53A 4ZAKB 2FO4A 4Z7UF 2ED9A 4Z78A 4G9DB 1K85A 4HJJL 2XIDA 4ZYKB 4OCRL 1MRDH 2ADFL 5JDJA 2ATPB 2AQ3A 1MREL 4J4PA 2E9JA 5AUMA 2ILLA 1DQQA 3O3AA 5D7JA 1GVIA 4NRZA 2Z8SA 3PWJB 3U6RB 4WHCA 2YD3A 2CJUH 1FZKB 5CBEA 3LEYL 3TC9A 1O0VA 4KQ3H 3X13B 2P44B 1A9EA 3WEXB 4Z0XB 3AVEA 1HH9A 3ARRA 4JM2C 3KJ6L 3UDWC 1F6AA 2P7TA 4WU5B 3TYGH 3WO3B 3CD4A 4XXCC 1GZQB 1R5IA 2FDBP 2HFEA 2VLJA 4I5BA 4KK5C 1BD2D 3O11A 1FJ1B 1F3RB 1WCBB 3BKJL 1CE1L 5D5MF 1ZA6B 2A73A 4LVNC 2Q7YB 4QRUA 2ADGB 4MMXC 4PLOB 1DQMH 2XXCB 4WEUD 5E6ID 1DBBH 3EDJA 3BH9A 5EOCJ 4IRSD 3VXRB 4EDXA 5LWYH 1JGDB 4R26L 4Y4KD 2MHAA 5EG6C 1BVKA 4M1DH 3UTZB 1KCUH 5TF0A 4P5TB 4P3CL 4KK8D 4DKFH 3UTTE 3AROA 5B21A 3GJFH 3EOYG 3HC4L 4CL7A 2XQBL 3RNQA 3ZKQD 1B0RB 3U9UA 2DLFL 3BEWB 3FO9B 3QQ9D 1CG9A 3ZHKA 5ACZB 1NCAL 1DBKH 1AP2A 2CXKA 4NRYA 5DRWB 1MLBB 1D6VH 1G0DA 5EO0A 1WAAE 4DGIL 1PY9A 4FQLH 3C08L 1XFPA 4AEHH 1HEZA 2OR8A 3T4AB 1NCCH 4PJBA 3EOAA 2XWJB 4G42B 4M6NH 2O5XH 1XR9B 4N8VB 5E5RB 4UINH 3NTCL 4QYOB 2O61B 1RMFH 4BZYA 2UWEA 1U8HB 5SWZB 3MRDA 3KXFB 3V4VH 1OARH 1V7ML 3K81A 5EO1A 4CNIB 2H6PB 4MA8H 2IALA 2E7MA 5IW1A 5JHLL 5I71C 3TGXA 5HHOD 4HUNB 5D7SH 2FBJH 4ACPA 1JPTH 4KI1A 1FFPA 4PS4L 1NFDE 3IXTB 1ULVA 3RVXD 1F58H 4I18C 4EI5A 3HZVA 1I8LC 4I0CC 3PL6B 4RFEA 1OT2A 3VD5A 1JHTB 2AV7B 1L0YA 4JPIB 4ODXA 1T7ZA 4KHTL 3QUKA 1KACB 1WEJL 4YHKH 3SJVE 4FZEH 2P8MA 1EVTC 3KWWB 5I1IH 4XMKH 3RIFF 3A67H 3KPNB 4RMRA 3AS2A 3ULVH 2ZUSA 5CJXA 2I5YH 2YD1A 4M93C 1MHHB 4ONHA 3RQ3A 3VGDA 3BP7B 3T1FB 1MFBL 3FCTB 1U8OB 1T5WA 1ZLVH 4RFNC 1AO7D 2CGRL 4ODWB 3FT3B 3HR5A 4PJEF 4U6YB 2J5LB 2H41A 3U7WH 1JZ2A 4F33B 3O6MH 2IANA 4APQB 1OAZL 3QIBA 2V9QA 1B90A 4UDUB 5GZOD 2BSTA 5DRXA 4IRJB 4BH7B 3B9EA 1U8PA 1FL6A 2B1HH 1NFDF 3GGWB 1BQUA 2XA3A 3QG7H 1GGUA 3THML 5D1XD 1JNNH 4O2EA 3PWUA 2FSEB 2F15A 2NZIA 5SWSD 4AG4H 4P4RB 3QPXH 4Q74A 5TE6L 1EBPA 2N7AA 3U4EA 4X6DF 3NCEB 1IGJB 4RRPG 3AAZA 1RZ7L 2YD4A 3FHQA 5C8JA 5DA0B 5GGRY 2OS7A 3DMMD 4KDTA 2BP3A 3BE1L 3ZKXB 1BBJA 2A9NH 1YEFH 3P2TA 2DM4A 2X4QB 3RVUC 1DANT 1SY6H 5J13C 1HI6A 3WDHA 1OW0C 1QLFB 2QTEA 1V3LA 3TBSB 3D25B 5ICXB 1KJVA 2NCMA 4F7PB 1CD1B 4JQXA 1BD2B 4P9HH 1LDSA 4QHMB 4WY7H 3VRJB 4XCEA 3RL2B 4ODUB 1I8KB 1FZOB 3ARFC 1FIEA 2ADIB 3RZCD 1ZVSA 3RZWA 1FO0A 3V5HB 3LS4L 5TFSL 2DBLL 5IIEB 3TWCH 4OM0H 4EUPG 3X12A 2VDKH 4FTVB 1N0LA 5E6IB 3QISA 3C8HA 3FONB 4IRSB 5D1ZD 2WBJA 5C6TL 2GJZB 3K74B 3VWKD 1PQZB 4FOMA 4Y4KB 2JB6B 4C57C 3CFDB 1NGQH 5E8NA 3CFJA 1L6XA 4L4JA 3D87B 3ZLQC 4OTXH 3KYMB 1JWMB 4MLIA 4QRSA 5TDOB 3PWPE 3TNNA 2ZJSL 1L0QA 2H9GA 4X4YA 2UUDH 3D2UD 1T0NA 3I3EA 4K7PL 1MVUB 5EFIA 4YBQC 1R5VB 1VSCA 3MQIA 3LRGA 1QPXA 3NZHH 1A7PL 5I18H 4PLKD 4PJCB 5DI8A 3IDXH 1DSFL 4UQ2A 4Y5XB 3IDGA 1JJUA 5ANMA 3ILQC 2Y07L 3OX8A 4NQCE 1B0GB 2XXMB 4LASH 5GQBA 2X70B 1AD0A 4OJFH 3RWEB 4KK9D 1DLFH 1VFAA 5EOTA 4JJ5A 1XF1A 2DWDA 2QHRH 4WCYL 1BEYH 3U30C 3HUJF 2NX5B 3V7AG 3VRIB 2AEPL 1S9VA 3SKNA 4PJGB 4ODHH 4K3DL 4U4BA 5HHOB 4DEPC 5BRZA 4L3EE 4NCC2 1EEZA 2A9MH 4POZC 5DJ0A 3TBWA 2Y23A 2NYYD 4J6RH 2B4CH 5DHVA 3ARBC 2VZUA 4RRPA 2GYSA 3ALWA 3BZEA 3OKNA 3DRQA 4YDIL 1W72H 4NWUL 5F88A 2ZOKB 1AIFB 5IHUL 1OTTC 4MXWH 4F57L 4JGMA 1EEUA 3K1KC 3GBNH 3JWDH 3T0DA 1YQVL 3E2HC 4HUVA 3O45B 4JFEE 4EOWL 4PGBA 3C5SB 1TZHB 3FQUB 2J8UE 4R8WL 1IFHL 4L8BA 2F9BT 3O6FC 3TO2A 2I26N 1C16A 4P2OC 5D71H 4PJGF 1PG7W 5ACMA 1IKNA 2IPUK 3TA3A 4UV4L 4FQXC 3O2DH 4JFPA 4EUPA 3FB5A 5GS1B 2QKIA 4WV1B 3FAXA 2DM3A 4JHAH 5IR1B 3LRSB 1YN6A 4IMKA 4O02L 4U1GB 3T3MF 4HWEL 3U46A 4HBQA 3LZFL 3DGGB 1MHCA 1HOCA 2IFFL 2XWBA 4NC1E 3X3GH 1NPUA 1DTUA 3S9DB 5DC4B 3MJGX 4P2QA 2N56A 4S1RL 5I1DA 3ZDXE 1L4IA 4M43L 1IAIL 1XCQA 4YHML 5D1XB 4M8VA 2DBJA 5SWSB 2EXWD 2MPAH 2EIZB 4KJQC 1F4WH 3AU1B 2R1WA 3HC0A 4JO1H 4JVUA 5E94B 1TVBA 3UP1A 1RZIA 2UYLB 1V3MA 4CVUA 2PO6C 3U7YL 4GKSA 4MA7L 3SE8L 4YDKL 1I1FA 4BSWA 4HS8H 1H8SA 5C2BL 3RA7L 4M6ML 5D72H 4I2XE 2AKRA 2Z93A 1OCWL 3OJVC 2YEZB 4NM8H 3HCVA 1DANU 4WI6A 3RZCB 3U4AA 3VGAC 1AI1L 5CAYB 3ESUF 3NAAL 1EFQA 2B20A 4ONGH 2GTZA 3QDJA 1ZT4A 3GI8H 1I3RB 4OBSA 3TZVA 5D1ZB 1FO0L 3D69B 1DR9A 2D4FA 3D9AL 1F11B 1FRGH 3EJYC 3VWKB 1Y18B 3L3GA 4JN2B 4K2UH 4WUUA 1YNKL 3MREA 4QRTA 4NQTA 2PR4H 2QJDA 4Y8DC 2NW2B 43CAB 4WRLA 3QBTB 2CUIA 4YHIB 3QEGH 4AENA 3QHFL 3WFHB 3D2UB 5H94B 5TQ2H 5ITFA 3GMOA 3FRUA 2NR6D 4PJ8A 4U1NB 1CIUA 5DLML 1OQOA 5IMMB 2FECL 1J8HB 5I1JH 4KAQH 4NBXB 4LAQH 4OQ1A 3WFEH 3EDFA 4ISVA 5FAAA 1IQDB 1X6NA 2BRQA 1UQSA 3B9AA 1QYGH 4OF5A 1U8LB 4CADA 1S7VB 1JGEA 4JQIH 3JWOC 2EEBA 5HHMB 1I7ZA 3REWA 2EKJA 1J9CT 3O9WC 4QRRD 4L8SA 2FO1A 3MODL 4DFHA 3BRDA 3NACH 5GZNC 5F7DA 2ESVA 1AQDB 1X5IA 4X9GA 3TVMD 4G80A 3GIVB 1I4FA 3L7EB 4NYLB 5DMYA 2OP4L 1CT8B 4GAGH 1KG0A 3RTQD 4N9GA 2HTKC 5HYSG 5DJCB 2Y36L 3CFIC 4LCYA 5BV7B 2W0LA 4CN6A 3DOSA 2CKNA 4TSBH 2W91A 3X3FH 4S1DC 4ZSOE 1N6QH 1CFBA 3UTSE 1Z9SA 2AV1B 4F37K 4QHLA 5KSAA 1IL1B 3RP1A 1FCGA 4MJIE 3EAKA 3ARSA 2DJSA 1KEGL 5GSVA 4QLRA 3N1PC 2V2TB 4HT1H 5ENWB 1HKLL 2GTWA 3VI4E 3TO4C 4TULL 4U33A 1UC6A 4IDJL 3DV4A 4U6VL 3U82B 4W6YB 5DQJB 2DQTL 3P40A 1RJLB 5CLWA 5LGKA 2HLFC 3NCJL 4XCNA 1LNUB 4H8WC 4WFFE 4XPTL 5E03A 2X1OA 1N0XL 3RBSA 1UXWB 1SJHA 4OLUH 1EVUA 1CLZL 3T0WA 3JV0A 4OLXH 4CGTA 1DQDL 4KRLB 4L29A 2DD8H 4NNXB 3DTXB 3GEWB 3MBEA 1Z9OA 4H1LH 4MA3A 2LU7A 4KDWA 1GL4B 3VG9B 3VXNA 5C08D 1QFOA 4OD1H 3ES6B 5DK0B 1G0XA 1J0KA 5HYQA 5DD1H 1YMHA 4OZGA 1K8IA 3RKDD 3IXAA 5JPMB 3MLXL 2EE3A 1I9RH 2R23B 4N0FB 1FSKC 3MRQA 4Z7VE 1F4AA 4ENED 4FQIL 4KY1H 5EB9A 4Z7NE 4HKBB 2D7MA 3UTPE 3L3IA 4DZ8B 3UPRB 2V7HB 1RUAL 2GY5A 5EUOA 2R56L 4U1KA 4X8JB 1GSMA 4IOIA 5GJSH 1LK3L 2GK0A 4M4RA 1CICA 4OFKA 3MUGB 5AWNL 2DI7A 3ARQA 5FYJU 3U48A 1MQKH 3LN5A 5KOVC 5C6PB 5EC2A 2FX8H 1LO5B 5IT2H 4G6KH 5HYSA 2WIIA 4XPBH 1T03L 3S8WA 4M03A 4ZOEA 5D96C 2FYYB 4XNZC 2X4RB 3QWOA 2CIIB 2EECA 5CSBA 3WJLC 5FFLA 1DUYB 1QR1A 1AH1A 2IQAB 4LDEB 1K3IA 2FECI 3FZUC 1ITBB 4MXVF 2EXYD 4GMTL 1UZ6E 5D2LE 2QR0A 4QTHB 4X9FA 4YXLL 2BVYA 3TIEB 4DVBB 1W0YT 2HMID 3N50A 4PRPE 3LH2H 4NQED 1R3KB 4MB4A 5F6IC 4IHOA 4WTZA 5L2KE 1C5DA 5KJRL 1PGRB 4JM2A 3SKMA 5JMOC 3PWLA 5JUEL 3M45A 4XXCA 4NRXB 2ZCKH 1DE4B 4YXHL 5F3BB 3KPSE 4JPVL 2D7PA 3A6BL 3L3JA 2LABA 3L3OB 1LP9A 1BBDH 1DBMH 4TOYH 3MUHL 2YD9A 2X4TA 4A2MA 2XKSA 4EJ1C 1JI1A 1TENA 2P1YA 3TJEL 5DWUH 4FN0A 4KMTH 5GHWH 4L3CA 1A4KA 1HIML 5AAWA 4NN7B 1NMBH 4MQ7B 2BJMH 1OPGH 2H3NB 3PDOB 4XGZB 1NBYA 3QDGD 5CSZB 2ICES 2PW2B 3O81A 1I3GL 1RURH 3TVMB 1DLHB 2BY3A 4X83A 2JK5B 4CMMA 3RTQB 2GIYA 1T5XA 1W8OA 3MRIB 4PRDB 3DI2B 4BK5A 4OKVB 3MV7D 1RIUH 2F53A 3OKKB 1XF2A 3X17A 2OR9L 1PX4A 3C6LC 2YPLB 5CZXD 1G84A 3FB8B 4G8FB 1RUPH 1H3PL 1WWAX 3D0VB 4G7VH 4E5XA 5BS0A 5DJXA 4DN4L 1HQRB 2XTLA 4YDJB 4N8PA 3BKYL 1KXTB 1CXIA 4M1CC 5ALBH 3WSQH 3V4PL 3AS3A 3MGTA 5LXGH 5L8LB 5IK3A 4RIRB 1EHLH 3CCHB 1S9WA 1FFOA 5HD8C 1UCTA 1UADC 4PLNC 1FGNL 2ZPKH 4OLYL 3U36A 1MAJA 4PTTB 1A7QL 5JMRA 1X5HA 4X5XB 4K7FA 1BFOB 4I18A 1J12A 3BZ4B 3CSBA 3WMSA 1I8LA 4XNMA 5I1GH 1B0WA 1IGCL 1XIWB 5ID1A 5LGJB 4JPWH 3BGAA 4NUJA 1EK3A 5T1MA 5E9DB 2BMKA 2FL5B 2OK0L 5SWQB 1DFBH 3SDAD 4PRID 5FM5M 5C9JB 2OXGA 1MSPA 2F58H 2HT4D 1MI5A 3H3PH 3UYPA 3V0VB 4RAUB 1HYSC 4UIMB 5CGYD 2GJ6A 3JV6A 3S88L 2VLKA 4DGVL 5HI3D 3O3BB 1M6OB 2IAMA 3IDNA 2VLJE 4LIQL 3F8UB 1P4BH 4X8XA 4P57B 4JRYD 5IHZB 1IAMA 1RHFA 5I8OL 2OLDA 3D0LA 4XH2A 3S37X 3C9NA 1J86A 3BRGC 4RMWA 1J0HA 3HE7D 1T1YA 4HUUB 2HFFA 3R0NA 5FB8A 3DRTB 1DQTA 4MD4A 4P4KD 3BZFB 2MCG1 4DCQA 1WBYB 1BZ9A 2XQYK 3GFUA 2Z4QA 4GG6B 2BRRH 2RGSA 4YEEA 3NVQA 4PJHA 3LSOB 1FAIL 5JORA 1FYTA 3MRNA 3HR6A 2F54D 2EH7H 2JLLA 2FGWH 3TN0D 4XT1C 1T1WB 4ZS7H 3QUZC 2DDQL 4UT6L 2C1OA 4NQEB 3IRZA 2PYEA 4HWBH 4U6XB 1RUQH 3UBXA 2AEQL 2FD6L 4PJBE 2X4PB 3RWCB 3EDDA 5ESAA 2Q76B 1M7IB 1INEL 1UKQA 3RVWC 2LV4A 3P0YH 4HIXH 4FNLH 2PXYD 1XGYH 5FGCB 1RJZA 3QCTH 2A6IB 3ARFA 3ZHLA 2UWEE 4GO6B 4HG4J 4G8EA 1YY8B 3MUJA 1ZLWH 4L4VA 4HIJB 7FABL 2AJVL 5T3ZD 1QPPA 4Q9CA 3MOBL 3B9KD 1CLYH 3DVIA 3MCG1 3V5KA 4O58L 4UU9B 3QDGB 3MYJB 3PGFL 4AY0A 5TDNB 2Q3ZA 3WFCL 4E41E 3OXRA 4JFQB 3B2VL 5C3TA 3T0XA 4LQFL 5L0QB 2VABB 5C2UB 1N6VA 5DD5H 2XTJD 2MQ3A 2W9EH 1UG9A 2DICA 3INUH 3QEHB 1WQVT 4L8DA 1XT5A 4PTUA 4YPJA 4NN5C 3MV7B 3G5XA 5FM5O 5I8EA 2LU4A 5IBLC 4OCYH 4PY8I 4YDVB 3VFVA 2ZCLL 3WJJC 5F9WB 4ERSL 2F5BH 4IMLB 4UIKH 2ZCHH 1KTKE 1NAMB 1NL0L 5JNYB 4FQPA 2P8PB 3RWIA 4PD4J 4E42A 5GPRA 1GZPA 4MAYC 4OCRH 2ADFH 2AI0L 3DGCR 4Y4HC 1MREH 1BZ7A 5DZLA 2OBGA 4M61A 4RFOL 1BHGA 4Q97A 4G9FD 1T7VA 2IANE 4DUWA 5IJVA 2DWEA 3B5GA 3LEYH 3FOLB 4OI8A 2ZOLA 5DJYB 3H2WA 1EFXD 3ARBA 4HKJA 2E9IA 1JF1B 3WIHA 4XPFH 5I15L 3KJ6H 1CDYA 2NY3D 2DLTA 4QRPB 5D1QD 1BAFL 1RZ8B 2AJZB 4OF6A 1GAFL 1B6DA 1R3JB 4EN3C 4B53A 3J8F7 1S7XB 3LQMA 5I8KL 3BKJH 1CE1H 4ETQB 3GBML 1YEGL 3SDAB 4PRIB 3FTGB 1F97A 4JG1L 3L5WB 3QIWD 1KSRA 1JPST 1ES0A 1MUJA 4TNWK 4N90E 1Q9WA 3IJYA 1JGLL 3CDYA 4NO5B 3B8SA 5D7IB 4NKDB 4MJ6A 1CN4A 2X41A 3O6FA 2BCKB 4Q9RL 3O8XC 4R26H 4P2OA 1HWGB 1JL8A 4AMKL 2VH5L 3NCFB 1NH6A 1P6AB 2Z35B 4PJFB 4U7KA 4QWWD 3VGHA 1NCDL 1INQA 1PY4A 4HZAA 3HC4H 4NCDA 5GS0D 2XQBH 4JRYB 3G6DL 1CDBA 3FQRA 2DLFH 2KZ1B 1NCAH 3C8DA 4K9EC 4JM4L 1PEZA 2VZ1A 1MVFA 3T08A 2E6QA 3IGAA 3KPPB 4NHCL 4Q2ZB 5DHYA 1SYSA 3HE7B 4DGIH 3C08H 3TT1H 4JFYB 4AQ1B 1WC7A 2IF7A 3IAGC 4DAGL 1GGBL 3VFNB 3VGFA 5DD0L 2X1WL 2EYSB 3F7YB 5KS9F 1DJSA 4P4KB 1ZGLB 3NTCH 5GGVY 1A1MA 3FQTB 4GH7B 4LSVL 5FK9A 1OTUC 4PJFF 4KV5E 1JWUB 1OT1A 1V7MH 3PV6B 2F54B 4X6EB 3TN0B 2YRLA 4DZBA 1ZGLM 1MOEA 3ZKND 3SDCD 4PS4H 5ANME 1BLNB 4AIXA 2C7UB 2VTFA 3IKKA 1Z0NA 2Z91A 5JA8B 1TZGL 4KROC 1UXSB 4YHPB 2QEJA 2PXYB 1G7QB 1FN4B 1QHOA 5IJKA 2AJUL 1BZQK 2J88L 2VAAB 4DKDC 4NNPL 2WQRA 3BP4B 3MLYL 5EU7C 5IV2A 3D48R 3CPLB 4KHTH 5A3IC 3EO1B 4JFOA 5A43C 1WEJH 4WW2C 5E8PA 3G5YA 3MRPB 2I07B 3BGFC 3WHE1 4I77L 2XA8L 3B9KB 5BRZE 3RWJB 2R29L 4BM7A 2Q6WA 4NQSA 3QXUA 3GUTB 5TDPA 4PYHA 3QUXC 1LEGB 1QO3A 4J3XA 3BJ91 4CMHC 1G9MC 3C60A 1NEZG 5C09A 1YJDC 5TE4L 2A0LC 2D0FA 3D1MC 5ID0B 1MFBH 1DBJL 2BNRA 4UAOC 3QO1A 2XTJB 2CGRH 3MJ8B 2PW1B 2ED8A 3L9RB 5IW3A 2K9UA 4ZFOB 5KSUA 4U3CA 3TPUA 4E0RB 5TE7L 2JCCB 1OAZH 5JPNA 3BO8A 2CK0L 2G9HA 2BVPA 3RWDA 5FCSH 1U95A 3FFDA 3QDMD 4K3JL 5HVHC 5T5FL 3THMH 4LSUL 5DVLA 3FB7B 2LTQB 3S4SG 3QI9C 3MLPA 5BJTB 4OAWB 5F96L 1BIIB 3LVEA 2EDOA 3ECBA 4CU8A 3MFFB 2IQ9L 1RZ7H 2HLAB 3LOWA 3BPLC 3O9WA 4LCUB 3MRKB 5JQHC 3S6CA 4G9FB 3O41A 1ED3A 2RHEA 5F1IA 3BE1H 4HUXA 3IKCA 3SCMD 4GRWB 4LCCB 4NC2B 1EFXB 2VDPL 1BQHB 1XCTB 2JCCF 1YEEL 3SGKC 2GY7B 2NY3B 3P30L 4YBLB 2KQMA 4RZCA 1C08B 2ITCB 3GSWA 3KYNA 5D1QB 2NY7L 5JLZA 3TJHC 5ESQA 4MDIA 1YMMA 2D9QB 4FQJL 5JW5B 3WNPA 3QFJD 5CD3B 5EBMB 5DD3L 2X9XA 2ERJC 5JO5B 5J12B 2OXHA 3LS4H 2BHZA 4D0DA 5TFSH 2DBLH 1EEQA 3QIWB 3LPFA 4Y5VC 2VLRA 3VFPB 2PTTA 3BI9X 3L3KA 3HPLB 5C6TH 3TCXA 1QA9A 2EICA 2C3VB 4FABL 1H0DA 3V7AE 4GRWF 1WZ1L 3LKQB 1K4CB 3TO4A 5E2WL 3ME0A 1MJ8L 2NY4C 4KRPD 5CWSA 2EZ0D 1NAKL 2ZJSH 4KKNA 4UUJA 2XZQL 1AE6L 4I0PC 1K8DB 4K7PH 1MFAH 3DLQR 1XAUA 4XXDA 4HJGB 5B8CB 5HJ3A 1NEZA 3QDJE 5TF1L 1A7PH 5T1KD 2VZVA 2C3WA 5SX4H 2Q86A 1DSFH 1HXMA 1X5LA 2NXZD 1QQDB 3ROOA 5E24E 5FYJL 3VD9A 1KOAA 2Y07H 3S3JA 3MMEB 1U3HD 1ND0A 4OCWL 3CFEA 4M1GL 2HVKA 1ETZB 3UJIL 3WNNA 4WCYH 2Y7QA 3D39A 3CVHA 5ICYB 1QTYT 3UBXI 1A7OL 3GI9L 3LEXA 1FV1A 3HC3L 3LKSA 3OKOA 3PIQA 1JTOA 5JXED 5DFWH 3O4OC 4K3DH 2IWGA 1D9KC 1JPFB 4CN1A 4PPTA 5DK2B 3IVKB 4NFDA 3TBYA 3SDCB 2WUBL 2NZ9D 2M26A 2UZYB 3BPOC 3NMEA 2AJYL 5C0DB 6FABL 1U8QA 2ENSA 43C9A 2VO5A 2YK1L 1J0IA 1TVHA 2R1XA 1IM9D 1UM4L 5FOJA 1S9XB 4YDIH 5J8OA 4NWUH 3NZ8A 1NGYB 4PRHD 1G0YR 3EIFA 5DUPL 5IHUH 1C5CL 5K9QG 5DEGB 4X6BB 1YQVH 3ARED 4JY6A 1SMOA 2BY0A 4B50A 4JFED 2A83B 1NUGA 4D3CL 3F5WB 4R8WH 1IFHH 4MHHI 4ZXBD 3HKFA 3QJHB 1ZXQA 4H26B 4HS6B 4I48A 3KS0H 1J1OL 2BNQA 3KYOB 4OFIA 1AGBA 3EYFA 2XWTA 1UWEL 5MERA 4UV4H 1TQBB 3WJLA 4WWKD 1IILE 1MCBA 4M62L 4KZDL 4M02A 3RVTC 1MWAA 4LARL 4AYFA 4XNQA 1ZEAL 3PHOA 3ULUF 4PG2A 4O02H 1EAPB 3RKPA 3LZFH 1L0XA 4YIQA 2IFFH 2Y4SA 3T0EC 3KPQB 3X11A 2RBLA 5EO9B 2DMCA 3VRLE 5CJQL 1MCHA 3CC5B 1ZHNB 3GO1L 3GK8L 1IMHC 1FE8L 4M43H 3QEQA 1IAIH 3L5HA 4YHMH 1D7FA 5DTFA 3SKJL 1TPXB 1T21A 2NY6D 2E7CA 1KTLA 3MO1A 3KPRA 3T04D 2KKQA 3KPMA 5CP3H 4HG4K 5BZDB 1MFCL 3JWOL 5IQ9B 4ODSH 4WJ5B 3VWJA 1C8PA 4HHAA 1A1NB 2G75A 3TIDB 1A0QL 3SCMB 5DS8A 3U7YH 4MA7H 4HC1A 3SE8H 3WDJA 1ZHBA 5D2NC 2HJKB 3V6FA 3H3KA 4YDKH 5BXFB 3QG6A 4B7LA 1WV7T 5DVOA 1JZ5A 1FVDA 5C2BH 3RA7H 4S1QL 1WZLA 3KHQA 3QFJB 1OCWH 1B9ZA 1AI1H 3QJFA 5EOCL 5F71A 4NUGH 3IDIA 3JWDC 5HYJA 4R4BA 1DVFC 1HDMB 2HJLA 4OZGE 1UCBL 4P46C 1FO0H 3D9AH 3C6LA 3ALPA 2QSCL 4MCZB 3U1SL 2FR4B 4LIQE 1W0VB 4I1NB 1QSFE 4FQHA 3EO0A 2BSSA 1YNKH 1VDGA 5DUBB 4JDVA 3LN4B 4PD4K 4WHTA 3JTSB 1MIEL 3PP4L 3R4DA 5EUOE 1X9QA 5EU5A 1IAOB 4G8IA 5C0ND 2A77L 4KRPB 2A6KA 1U8IB 2R1YA 4DW2L 4LBEB 2LFGA 3QHFH 4XMPL 3P3YA 4HGWA 4XC3L 2VYRE 3NFPA 2IBGA 2QADC 5I66B 3OAYK 5T1LD 4NDMA 4PJDA 5EZOL 1DN0A 5DLMH 5D9SA 4UBDC 2J8HA 4JZOA 4U1HB 5T1KB 2YWYA 3NIFF 2OMNA 4AT6A 4OQTA 1NDMA 1S9YB 3N06B 4H8WL 2NXZB 5GS2D 3WLBA 4OD3L 5B39G 5C0FB 1AGFB 4ZG1A 1GC1C 1FC2D 4F7MA 3WCYA 1U3HB 3ARDD 4JFFD 3WN5B 4PUBL 3WFDH 4DKEL 3HAEH 4U7MA 4Y2OA 1NC2A 1N5AA 4ZUSA 2Z0BA 4LNRB 5KW9H 2VXTH 4KRMB 2VE6A 3B83A 4HSQA 4MNQA 4M9PA 2ITDB 1RPQA 4L3EB 3CVHL 3MODH 3QAZC 1UZ8B 3GMLB 4ZPVB 3I6LD 2H26A 5C0EB 1QRNA 2G2RB 4KJPC 3QWRA 1FL5A 2X4OB 2CPCA 1IM9B 3GJEB 5DHVH 5GIRA 3IDJB 4PRHB 2OP4H 3GM0A 2OTWA 5BVJB 2BVQB 3GSRB 2Y36H 4JFEB 4JREB 2J8UB 3UTSD 1XF4A 4QNPF 4XTRD 3EDKA 3BXNB 1IRAY 4NKOA 1JZ6A 4ZXBB 2P5WA 5F8RC 1JPGB 5F6HJ 4PG9A 3RHWF 4PP2B 5EUKB 4JFZL 2HKFL 4WHDA 4AEFA 2UVFA 4XBPB 4NO2A 1HKLH 2CDGB 1N26A 4GUPA 4U1MB 4TULH 1FNEB 1S7UA 1MHPL 5IVZA 4IDJH 1I75A 5FA4B 1MWAL 1OSPL 3R8BB 4YC2B 2X7LA 3QUZA 1EMTL 4H88L 3O3EA 4WFFD 2AXFB 3NCJH 2F53E 4X4MA 4PGZA 1N0XH 4P2YA 4L9LB 1VGKA 3B3IA 3WLWD 1KJ3L 1PG7X 4LSSL 5ISZA 1NCWL 1S3KL 1KPUB 1DQDH 1FCCA 1QLRB 2OX5A 1J18A 1PEWA 1OD9A 1U92A 2NY6B 4TSAL 3VDAA 5BS0E 1M05A 5B39A 1JRHL 2HG5A 1TQCB 3G6JF 1P1ZA 4J3UA 3I75A 1IM3A 3RNKA 4XI5D 2XG4A 3MLXH 5IROC 4PREA 4QGTA 3QXDA 1WK0A 5I1LB 3KDMB 3UTPD 1X7QA 1ZS8A 4ZDHA 1MAML 1X5JA 4I2XB 4X6CF 3FKUS 4O5LL 2ZNXA 4JEGB 5C0GB 2R56H 2J5LC 2MMXA 3IFOA 3DVGA 1KV3A 1WVZA 4APQC 4QCIB 4F3FB 3IF1B 4JDZB 5AWNH 4LLWA 3T0VA 5EH1A 5IMLA 2DLIA 3ZE1F 5JIPA 5HHQA 3DUUB 1U93A 1NGXA 5IF0A 1MI5E 1ZWIA 5E8OB 2FH8A 1T03H 2GJ6E 3S5LA 4WENB 5IVXA 2VLKE 1QBAA 4FZ8L 3VD7A 3GMMB 5E95B 4OD2B 1RAMA 1A5FL 4MAYA 4GS7B 1WUNT 1FGVH 2SEBA 4W4NA 4PJXA 1GH7A 1QD0A 4GMTH 4LDLB 5DJAA 2F8OA 2B2XL 3SKOA 2Y5TB 4YXLH 4WO4B 3ZKMD 3OKDB 4MJ5A 2EDEA 3UZEA 4QOKD 1NMCB 3ULUH 5T3XE 4YHYB 1MCNA 4R4ND 5KJRH 4MD5A 1QZ1A 5HHPA 5F7UA 2F5AL 3LQZA 4JVPA 3KPSD 4YXHH 3ARDB 1KLFA 4JPVH 3BISA 1KN4L 3A6BH 1J88A 4W6XB 1A1OB 4EN3A 5E6IC 4PJHE 4IRSC 3TJEH 1FYTE 1VKXA 1F3DH 4MDJB 4J3OC 1HIMH 3W2DL 1M7XA 2CIKB 4KK8C 4FQCL 5EPMA 2PYEE 3VDBA 1RULL 1I3GH 5I1AA 5D7KE 1JCKA 3B9VA 4Z5RA 4Y5YB 3STLB 1KJMA 5GGUB 2UY7A 2GSIB 2CLRA 3GMNA 3B5HA 4OB5L 5JXAL 3DPBA 3GSUB 1A6AA 3BWAB 4PB0L 4L5FL 1OGAA 3UTSB 4HPYL 1X3DA 2VISB 3WUWB 2V2XB 2XNAA 1RHHA 1F42A 4P59L 1JE6A 3TFKD 4M4PA 3JBG7 2OR9H 2X1QA 5E56A 3PHQA 4JB9L 4R6UA 4BA8A 2BVEA 1TTGA 1PDKA 4Q9BA 1MFDL 4XBGA 2Z31D 4MQXC 3SPVA 1H3PH 1UENA 5GJTL 5FKPB 3SBWC 1S5HA 3NA9L 3QUYC 3NH7H 4YFDB 1HCVA 4DN4H 3PWNB 5KSBB 2VJXA 3BKYH 1BPVA 4KRNA 4N0UA 2E9BA 3V4PH 2CO7B 3PG2A 4ZOBA 3H7LA 5J6HA 1AQKL 2QBWA 4KGLA 1XR8A 5ABDE 1YC8A 2PCPB 2H45A 2I60H 4OZHA 4LGSB 4PV8B 4RA0C 1FGNH 5IEHA 4OLYH 4ELMA 1A7QH 2A74A 4W4OC 3WO4B 4U2YA 5SX5K 1OP3H 4N5ED 1CTOA 1PFCA 1B4JL 4GKZB 4YGVB 3FT2A 1IGCH 1CL7I 15C8L 4S0TD 4J4PD 3IDYB 1CXHA 4DKAA 4OT1L 1A9BB 2PF6A 3WL9B 3QZWB 4RNRB 2OK0H 5D7JD 5KAQG 1D6EA 4WW2A 1CZ8L 3ZE0E 2WP3O 4I0KA 3ARVA 4Z77B 1LO4L 1ORQA 1ZV5A 5KSBF 3DV6A 4WTXA 5HY9B 4LPUA 4Z7VB 1A6ZB 5MEOA 3S88H 2DLHA 3NN8A 3QUXA 5GS1C 4DGVH 2P5EA 4WV1C 2ZUTA 5C07D 1MJJA 5H37H 5JHDD 2CDFB 4LHUB 4M6OL 1W0WB 4LIQH 4U1GC 2EH8L 3P0GB 3GJFA 3HNSL 5CMAA 2NY1D 1A2YB 1EGJA 3P4MA 2FBOJ 3GMQA 5GZOC 1P7QA 4TNVK 2N1KA 1CGUA 4KTEL 4WFHE 1K4DA 5FEBA 1G7HB 1X4YA 1MLCA 3O3DA 3QR2A 4OZFB 3AXLB 1ZLUK 2Q7NA 4Q9QL 5D1XC 1N3NB 3MCKB 2VDML 4XP5H 1FNFA 1A6PA 4PV9B 3SDXB 2APVA 1V3JA 1VHPA 3REVA 5BO1L 4C83B 3I02B 3QI9A 4XPGL 4RMVA 1HILA 1RQ5A 4F15B 4RWYL 2DKMA 1ZT1B 3DMMC 5K59E 3P4OB 5DRZB 1CFNA 1U8NA 3QCVL 1R3HB 3DNKA 1GIGL 1FAIH 3GSOB 4N9OB 2XI9A 5JIIA 4DK6A 4FG6C 2GT9B 2YRZA 3WNKA 1IVLA 1JPSL 3WFBH 4CVZB 2NNAA 4QOKB 4UT6H 4EI6A 1BWWA 5FYJE 4P5MA 3CIQA 4PRNA 3X14B 1T4KA 1N8ZB 1WFUA 4JZNA 2AEQH 4P2RD 1QOKA 3PNWB 3RY6C 3SGKA 3SEPA 1RIVH 4KXZI 1O7SA 1INEH 4DN3L 3KPSB 2VXVL 3RZCC 5GRZA 5BZWB 1N59A 5HHVL 1DN2A 2DL9A 3SDXF 4N0CD 1A21A 5DDHA 1UYWL 3RRQA 3VWKC 1GGIL 4ZNEA 1DDHB 4F8TA 7FABH 3V6ZA 2AJVH 3MXWH 4H5SA 3MOBH 4JRXA 3SGJC 1DEEA 4O58H 1TFHA 4NPYA 3SE3C 5I74B 1AXIB 4Y1AE 1JZ7A 2X42A 5F7MC 3B2VH 3G04B 1V7NL 3DROA 4LQFH 2GFBA 4EXKA 4XVTL 4JKKA 4I0PA 1MFEL 3LKOA 1RZJC 3QO0A 2X4NA 4PLKC 1JYNA 3T4YB 5CEYB 1KCKA 1P7KB 2DQCL 4K9EL 2NY0B 3RL1A 1IT9L 4PJIF 2FGZA 4Z7WB 5D7LA 4ERSH 2ZCLH 3MXVL 4FMFA 3GMPB 1OF2A 2Q8BL 3T0AA 1NGPL 4KK9C 2Z31B 2DYPD 5MP6L 1AGDB 5CKGA 3QUMA 4U6HB 4J1UA 5C09E 3IFPA 2AI0H 1H5BB 3E6HA 4LKXB 5E4EC 1HHKB 2BNRE 1UEMA 3QWQB 2V2WB 3MROB 3FO1A 1JN6B 1XGTB 1P6FA 1XGQA 1ZGLP 4NQDA 5GGTA 1X5KA 4RFOH 2IAND 2NYYC 5MEPA 4PJAA 3BESR 3W5NA 5DMGD 1KIPA 4XRCA 1T89A 4CW1A 1L9MA 5IG7B 5HDBF 5IMOA 1NGZB 5I15H 2FO4B 1QBML 4WDIA 4Z78B 1HINL 3HZKA 4Z7WF 2X6MA 4YHZL 2EKSA 1EEYA 5DRNA 3LRHA 4HWZA 3WNLA 3OQ3B 4HJ0C 5AUMB 2DKUA 3UPCA 3MLZL 5IMKA 3C09B 1DQQB 5I8KH 3U0WL 3GBMH 1YEGH 4MXQD 3P9LA 5D7JB 4JG1H 4NRZB 3UAJD 2W07A 4N90D 3EHBD 1IGYB 5SV3A 1VEOA 2JJVA 1YA5A 1JGLH 3MRHA 2EE6A 3P4NA 1A9EB 2FHBA 4Q9RH 5HYIA 3FFCA 1HH9B 4TUKL 4AIOA 1F6AB 2WANA 2P7TB 4HEME 4QRQA 1J05A 4AMKH 2AAVA 4Z8FL 1R5IB 1D5ZA 2FIKA 2HFEB 5LWYL 3ZHDA 2VLJB 5J6GA 4I5BB 4P3WA 4WI5A 1NCDH 2Z92A 4RQQA 3O11B 4M1DL 3DVNA 5J7CC 1G9ML 2NY1B 1YMME 1T83C 1YJDL 3G6DH 3RI5K 3CFCL 4HUWB 3QA3A 2YD8A 4JM4H 2A73B 4XWGL 2HRLA 2V5RA 4QRUB 5EZJA 1EGJL 1WBXA 1MCDA 4WNQA 4LLVA 5F9JB 5BVPL 2EE2A 1NC4A 3T0EA 3BH9B 5J1TC 3SO5A 4EDXB 1H3GA 5IWLC 3QQ3A 1IC4L 2MHAB 1T1XA 1BVKB 2XACC 2D7NA 5JQ6L 4M8QB 4DAGH 5C0IA 3TNMA 2VDNL 2EXWC 4OZIE 1GGBH 2V6HA 5DD0H 1TTUA 4NFBA 3FQNA 3VG9C 3RNQB 1EO5A 3U9UB 1CG9B 2V7NA 4LSVH 2YHGA 5I1HH 4Z7UA 4GRMA 1AP2B 3MPCA 3LIZL 4NRYB 5CILH 3C8KA 1A6VL 3WNOA 5IBUB 3AB0B 5EO0B 3O0RH 4XHQA 4XNYL 1ERNA 2CLZB 1HEZB 2A1WL 4LSPL 5T5NF 1OARL 4P2RB 3QIUC 1M71A 5FUOL 3EOAB 5MEQB 3CAFA 3RUGE 3VXMD 5D7SL 1TZGH 1JPTL 4S11A 4U1JA 1W72A 2AJUH 2UV3A 2J88H 2UWEB 4DVRL 4NNPH 5IB4A 3MRDB 3MLYH 3D39E 5EO1B 1DVFA 2V9TA 3DSNA 5IW1B 2IALB 1EIBA 1IGTA 4P46A 5F1NB 4I77H 1P9MC 1HHHA 1JTPA 2OL3A 2XA8H 5C0JA 2FRGP 1HXYB 2R29H 5D5MA 4G9DA 5J1SC 2XICA 1FFPB 4YHKL 5EIVA 5KOMC 3MNVA 4F37F 1RJYA 1Y6MR 1YPZF 2QLVB 4XMKL 3F58L 5TE4H 3DURA 5TQ0L 3QNXA 1IGML 4LPXA 1FZJB 1DBJH 1Q8MA 4J23A 4RFEB 2EDWA 3CVIL 2NR6C 1C7TA 1FZKA 2QQNL 4ODXB 4LGPB 1C5BH 3QUKB 3QXWA 5TE7H 3VXSE 1BMGA 4ESKA 2CK0H 5CEXB 2P8MB 1LO0L 1MCSA 3ARGD 3U7WL 4K3JH 5T5FH 2BNQE 3TA3D 3RGHA 1TCRA 2DYPB 5I8CB 4LSUH 2B1HL 2YSSA 2YBRA 4V1DA 3B5TA 2Q7YA 1T5WB 2V5YA 4CU7A 3MC0A 1NLBL 3QG7L 5EORL 5F89A 5F96H 3HR5B 3QUML 8CGTA 4NN7C 2IQ9H 2D7QA 2R9HC 2OMBA 2IANB 4J3TA 5DJDA 5EBWA 2EDYA 1MCWW 1QHPA 2BSTB 5DRXB 5GGTL 1U8PB 1FL6B 1U8MA 3QXTA 4P2QD 2VDPH 5JIHA 1K9TA 1B6UA 5DJ6B 4OGYL 3P30H 4HV8A 4OFYD 1YEFL 3RTQC 3QEQE 4O2EB 3MRGA 3PWUB 5J89A 3DWTA 1C1EL 1X5ZA 1OGTB 2NY7H 3BDYL 5DRWA 2YXFA 4FQJH 3U4EB 1GGCL 3CU1A 3KPRE 3RWHB 2AK1L 3G08A 4IIQA 4JR9L 3QNZB 3AAZB 3BMWA 5C8JB 1UVQA 3P9WB 4D0BA 5CEZL 1UWXK 5C0AD 3C6SA 3K2MC 1I7RA 2EDNA 2VN4A 1BBJB 3L5XL 4OI9A 2P4AB 2XWJA 2KUTA 1XR9A 5ICZA 4NP4L 2VIRB 4P3DA 5I1EL 1Q72L 4QYOA 2RJMA 4IOSD 1VERA 5DVKA 1WZ1H 3EYSL 4NKIH 1MCIA 2KZWA 2EO9A 4XCEB 4TYUA 2WZPD 5E2WH 1H3XA 1MJ8H 1NAKH 1ZVSB 2XZQH 4DK3A 3PJSA 3ARZA 3QDJD 1FPTH 2ZG3A 3X12B 1QACA 2CRMA 5IQ7H 4L9DA 3FRPG 4OFVA 4GT7A 4PJEA 4H1LG 4MD0A 1VCAA 5F3HA 4LEOB 5E8NB 3CFJB 4WUUD 1HHIA 5FYJH 3EDEA 1JHTA 2AV7A 2FCBA 3Q6FA 4OCWH 4RISL 4M1GH 1NFDA 4TVSa 2LU3A 4QRSB 3HI5L 3T65A 3TNNB 3DETC 2H9GB 3UJIH 4X4YB 3RKDC 3KWWA 2AK4D 1T0NB 5EFIB 4NNYA 1RK0A 1A7OH 3P9MA 3GI9H 4PJ8D 3HC3H 4PJDE 5E1AA 1BEYL 3DUSA 5HGHA 2A2QT 5IROA 4X6DA 1SM3L 1SJEA 2VXQL 3S96A 4JFXB 3IDGB 4LLUA 4U6TA 5ANMB 2WUBH 4QY8A 2AJYH 6FABH 3FCTA 3HG1A 2YK1H 3OX8B 4XAKE 3VXMB 1R3LA 1UM4H 4U1IB 4J6RL 4ETYA 3BW9A 4YFEA 1VFAB 2PKDA 2YPVL 1C5CH 4GBXC 4JJ5B 5DUPH 5EOTB 2DWDB 4UDUA 2Y1VA 5FYLD 5I0ZA 3IAQA 5IOPA 1W72L 2V5SA 2GJJA 1OSZB 4G6ML 1S9VB 3SKNB 4MNQE 3JWDL 4D3CH 4ODVL 3TH3T 4HLZG 1EEZB 5DJ0B 3TBWB 1OY3B 2FX7H 2FSEA 2XZZA 2ESVD 4YX2L 1J1OH 3LDBB 1QRNE 4LVOB 3BZEB 2OL3L 3OKNB 1UWEH 3DRQB 3JVGC 5F88B 3V6BR 4M62H 4KZDH 3DX8A 3W9EA 4GAYA 3KHOA 4QKXB 1ZEAH 2HMIC 5IFHL 2YPKA 4TN9A 2NY2D 3TBSA 4OF3A 4L8BB 2LVCA 2I9TA 3TO2B 1BD2A 1C16B 4W68A 3KJ4B 5CJQH 5K33A 4R96A 3GO1H 3LB6C 3TA3B 5CFHA 1QBLL 1FE8H 4HGKC 3X3GL 1I8KA 3ALXA 4JFPB 4R9HA 4LK4A 4EUPB 3FB5B 5AAMA 4LRIC 4C4KO 3GBLA 3SKJH 2QKIB 1GC1L 4BK4A 3AM8C 4C58B 3FRPA 3CJJA 1E28A 1TIUA 1YN6B 3J7HA 5AG9A 3U46B 4IRSA 5B22A 2MKWA 3W11C 1MFCH 3JWOH 2ICWA 1MHCB 2XWBB 3ZDZE 5JTWA 1LMKA 3VXPA 3HUJA 4X4ME 3S3SA 4P2QB 5FO9B 5C0CA 3KYMA 5I1DB 1JWMA 3S35H 1XCQB 5ISZE 4CU6A 3VFTB 1CGTA 4MCYB 1UH4A 5FKAA 4S1QH 4TVPD 4X9HA 4LLMB 4ZTOL 1FNAA 1MRCH 3MBED 2JIXA 5A2JH 3TH2T 1R5VA 1KULA 1ZLVK 2NY5C 2R1WB 3HC0B 4LSRL 5EOCH 1R24A 1TVBB 3D5OF 3PGDA 3PWPA 1RZIB 3C87A 3NFSL 1D3CA 1UCBH 5CZXC 4GKSB 1JNHA 4ORGA 1G9EA 2QSCH 3OSKA 1I1FB 4BSWB 3U1SH 2E7HA 1FRGL 4FRWA 3SBWA 4XVSL 2XKNA 2AKRB 3QUYA 2Z93B 1A4JA 1D5XA 1U3YA 2A77H 4NQCA 3HCVB 4PJGA 4UDTA 1SYVA 4DW2H 4OBRA 4D8PB 4XMPH 2I25N 4NJ9L 4XC3H 5K93A 4WWID 2CKBA 2GTZB 4C56A 3QDJB 5CD5D 1ZT4B 4JY4B 5K9OA 3T1WA 3TZVB 3V0AC 5I19L 1QKZL 2XZAL 5TGBA 3L3GB 4H8WH 3AY4C 4OD3H 4WUUB 5IVXE 2XOTA 4W4OA 3MREB 1JNJA 4QRTB 2PUQT 4DKEH 4GSDL 4PJXE 5B3JF 4JQVC 1TZHA 3VFSA 3FQUA 3V9FA 3O2VL 4WI9A 4P5KA 4AENB 3AS0A 4QXUH 5ITFB 3OTTA 3GMOB 5FHBL 4PJ8B 4PLJC 5CGYC 3SGEH 1P4IL 3TLRA 4AIZA 1LILA 5DT1L 4P23A 4YUEH 1P5VA 5HI3C 3L3DA 4JM2D 4WTWA 1ZTXL 1I8MA 1UQSB 1VEPA 3ZT7A 3BN9C 1AO7A 4CADB 4KK5D 3DXAA 1JGEB 2JELL 4BQ8A 4OCMC 1FLRL 2CRYA 4KPHL 3SGDH 3REWB 2KBGA 2AXGB 3HE7C 1Z6JT 3BIBX 1CGWA 2YD6A 4JDTL 2VQ1A 4M3KB 1QR4A 4L8SB 2LAAA 4K7PY 5D1XA 2R2HA 3TP4A 4IJ3C 5H8DA 3ABZA 5F7DB 2ESVB 4K8RD 2EIZA 4G80B 3P11L 1MCWM 4JFZH 2HKFH 2BY1A 3AU1A 3O6LL 4I3GA 1S9KC 3QB7C 1KG0B 3DMMA 4N9GB 2PTVA 1FG2A 3TN0C 5HPMA 4LCYB 5IW6A 3HS0A 1QSVA 4KC3B 4ZFZA 1MWAH 1ZE3C 1OSPH 3BP5A 4JCLA 1OGAE 2NY2B 4H88H 1EMTH 1F8TL 5KSAB 4KMQA 5CP7A 4LVHB 4M6AA 3RY6A 5I76A 3Q5YA 2PXYC 1KJ3H 1OP9A 4LSSH 1NCWH 3DYPA 3RZCA 1ADQL 1S3KH 1Q94B 2JJTA 2KDGA 4GAFB 2GTWB 4TSAH 1AFVH 1KIQA 2C3XA 3DV4B 1ODAA 3P77A 2DD8L 3WUWG 1JRHH 3B9KC 4N0UE 2CK2A 4BZ1L 3OKEA 3SGJA 2R2CA 3F7PC 5GRWA 3SE3A 4BSVA 2OI9B 5KVMC 1SJHB 3P0VL 3VI3F 3MRJA 4TNWF 4ELME 2HT3C 1I9RL 1MAMH 4L29B 4O5LH 3MBEB 4MA3B 4ZPTA 2F74A 4N5UA 5EU7E 1EZVY 5JW4M 4MVBD 3WHE0 4JHZA 5HYQB 4OZGB 4Z76A 1K8IB 4L1DA 4N0RA 3IXAB 1ZHLA 2EDKA 1Z3GL 4Z7QF 3MRQB 1LK2B 3KPOA 1WTGT 4HEPG 2BXZA 2LTQC 2OTPA 4FZ8H 1AY1L 2P5EE 5CBAA 3K46A 3VCLA 1LHZA 3L3IB 2W65A 1A5FH 1ZHKA 2IAMD 1OB1A 1ACYL 3EYOA 4U1KB 3QZWG 3MLWL 2GK0B 1KLGB 1CICB 1FLTX 2B2XH 2DKSA 4K3GA 1XGPA 3LN5B 2GITA 3MNZA 3HMXL 5M95B 2KQNA 3B6SA 3H7BB 5T3XD 3TH4T 3BFOA 3GIVA 4YBLC 2CKBL 5HYSB 2WIIB 4HWBA 3VXUD 5D1QC 4LHUG 2XFXA 2F5AH 5TPWL 3QWOB 3VGBA 1A7NL 5DD6A 1QR1B 4K3HA 3UZQA 5J12C 1KN4H 3MRCA 4HH9B 4JO2L 5DJZA 5C6WH 1OHQA 1P4LB 3QIWC 5DR5L 2QR0B 1NMAL 2O5YL 4PFEA 3MNWA 3G9AB 2C1PA 1DBAL 2IH1B 3LKPB 3MA7A 4TOYL 3MACL 3W2DH 3RVUD 1AC6A 5EULV 1N7ML 1UGNA 3V52L 4IHOB 4FQCH 1HHGA 4JM2B 3SKMB 5A16A 1IBGH 4QWWC 1RULH 3ARXA 5GS0C 5ENWA 5D7KD 4KGJA 4MJIA 3LN9A 4Y16D 3L3JB 1JNLL 5DQJA 4BSJA 1T83A 1LP9B 3ARFD 1RURL 2NW3A 3SY0A 2X1XR 5GGRB 2BY2A 4F9LC 4KH2A 1YDPA 2FEDC 4PB0H 4L4VD 2XZCH 4HZLA 4L5FH 5ESVA 1E4JA 2MOVA 5DFTA 4L3CB 1A4KB 1UXWA 4HPYH 4ZNEE 1H3TA 2DF3A 5IWLA 4I4WA 1OVZA 4P59H 1NBYB 1T1ZA 4I9WD 3LPWA 4UNUA 4JB9H 1RIUL 3UTQA 1MFDH 4J3SA 3L3HA 3LHPL 4R3SA 1NBQA 5J0BA 5GJTH 3VFRA 4CMMB 3NA9H 1W2KT 1T5XB 4ZAKD 1XH3A 4CKVX 5JPMA 5F7KC 3BN3B 2X4SA 5DMIL 3MRRA 4NJAL 4WUKL 3MLSL 3ZKNC 1LP9F 3R0MA 3SDCC 1JBJA 1AQKH 4X7CC 4UT9L 1XF2B 4Y19A 4BH8A 4HKBA 5CIPA 3WSQL 3QIUA 3ULUC 2LQRA 3Q2CA 5D7LE 3M17A 3ILQD 4X8JA 1FNSL 5LXGL 2X44D 4XCYA 3T3PE 4OF0A 1CFQA 3GSNH 1ZANH 2IC2A 1B4JH 2ICCA 4LOUD 4S1SL 1MCEA 2ZPKL 2N4IA 1NCBH 4X9IA 4E5XB 2ICWI 1CQYA 15C8H 5DHXB 2DJUA 2R0WH 2ZSWA 4OT1H 4HBCL 4NQDE 4AJ0A 2PYFA 4Z7OE 4CDGC 2Y5EA 4I13B 1GHFL 1MCLA 5IK3B 2LAGB 1P9MA 4PJAE 4ZUVA 1LO4H 2X4RA 1FFOB 5IM7A 1TQBC 2W60A 2YMXL 1AGEA 2GCYA 2F58L 4KHXL 4KKCD 4GW5B 4YHNA 5FDWA 4K7FB 25C8L 1J0ZA 4M6OH 1IAKA 2EH8H 3ZT5A 5IBTL 5CEZE 1YNLL 3MV9E 4MNHA 4JE4B 3BD5A 4LCIL 4NUJB 5T1MB 2VLLA 2BMKB 1GYAA 4KTEH 1RZJL 1I1YA 2JF1A 5D2LA 4P0DA 3O6FD 2GJ6B 1U91B 3JV6B 4Q9QH 1V05A 2VLKB 4XZUA 2OTUA 2VDMH 3FFCE 1TPXC 4PRPA 3W9DA 2R0LL 5B38G 4U7SA 5BO1H 2IAMB 4L8CB 3SDDA 4RFNB 4QRRA 4WHYH 4RWYH 4QTIL 1E6OH 3QCVH 3D0LB 2EDRA 2R2EB 4XH2B 3C9NB 1UWGL 3EFFA 1JPSH 4OLZL 1FDLL 3KXFD 3T0EE 1T1YB 2HFFB 3QFDA 1VFBA 2JK5A 2EH7L 5FB8B 5GRVL 2FX9H 3RTQA 4XB8A 1X5GA 4DN3H 2VXVH 1RUQL 2ZUXA 2AJXH 4D9QE 3FAWA 1BZ9B 1E4KC 2Z4QB 1WFNA 5LCVL 2D9CA 3O3UN 4R90L 4PJHB 3LY6A 4FNLL 4Z7UE 4PR5A 3MRNB 1YEIL 2X05A 1UYWH 1GGIH 4JFDA 3RJDA 3FB8A 5JW4N 2C1OB 5J13B 4UZGA 4HIIB 5FGSA 3UBXB 1OAUL 1IZJA 5EU3A 3OBAA 3H8NA 4PJ9D 5D2NE 3VH8A 5ESAB 3HLAA 4YGAB 1J5OH 4ZS6D 4ELKA 3WHXA 4KRPC 1V7NH 4PJ7F 1RJZB 3D85D 3RY4A 1FORL 3ARFB 3BSZL 4LFHG 1MFEH 4Y89A 5FDYA 5AYQA 4G8EB 1CDGA 3UROR 4L4VB 3L95A 4K9EH 3VXTB 3K3QA 5DD5L 2YZ1A 2NXZC 2J8OA 3DVFA 2MNUA 1U9KA 4PTTA 3V5KB 4UOW1 1IJ9A 4X5XA 1U3HC 5D5ME 3IYLW 4MAUL 2H32A 3WN5C 4TTDD 5CJ5A 2Q8BH 2RFXA 3W0WA 5K9KA 1NGPH 2DL2A 3C60D 5MP6H 5C08A 3FO2A 2BNRD 5C9JA 3ZYOA 5JXEC 2DQDL 2WIMA 5EA0L 5B38A 3N1GC 4PTUB 4U0RC 3G5XB 3OZ9L 2ZG2A 4KQ4L 2ED7A 5E99L 5I8EB 1Z0MA 3UEZA 1M6OA 3VFVB 1V8HA 3KNBA 2VKWA 3N1MC 5I16A 1QBMH 3RWIB 1HINH 4HXAL 1TVDA 5IB1A 4V1DE 3AREC 4GBXA 4YHZH 4XPFL 3U30B 3BD3A 5FECA 1BZ7B 3WDIA 1MAKA 3MLZH 3VXRE 4M61B 3U0WH 4OGAD 1CXFA 3LQAC 5IJVB 2DWEB 5KVGL 1UJ3C 4TPRL 3ARBB 3FQXA 2D4DA 4WWKC 1CD0A 3MA9L 4TUKH 4FTVD 1YEHL 4M5ZL 5AZ2L 4Z8FH 2VERN 4QF1A 2BHYA 1YMMD 5FXCH 1G9MH 2MWCA 1YJDH 4YC2C 2DIJA 3CFCH 4R2GC 4LLDA 4JHWL 4S1DD 4XWGH 2QL1A 4U6XA 5K9JH 4ZO8A 1EGJH 1ES0B 1MUJB 2VLRD 5BVPH 1Q9WB 1C7SA 3IJYB 2Q76A 5GSRA 1PG7L 4MJ6B 3O6FB 5FYKD 4P2OB 1IC4H 4BFIA 5JQ6H 2VDNH 3TT1L 5L9DH 3FQWA 3AM8A 4EBQH 4XVUD 3CLFL 3FQRB 3SE9L 1M7DA 5JOEA 1RUML 3LIZH 4JLRA 5F97E 1F6FB 3IGAB 1NJ9A 5DHYB 1A6VH 1F6LL 1SYSB 1YYLH 4NGHL 4XNYH 5DK3A 2A1WH 2NX5D 4LSPH 4LSQH 2HFGL 4IBLT 4EVNA 4PJEE 1WC7B 1JGVL 5IP4A 1GCFA 5FUOH 2M8XA 4F7CA 4NT6A 3JTTA 5LAXA 3T77A 5M7QA 1A1MB 4E41A 2VWEC 2D2OA 2X1PA 4DVRH 2D7TL 4NWTL 1EHAA 3NIGF 4HKZA 5FK9B 1JZ3A 3TBTA 1BJ1J 4OIIH 3HI6L 4O4YL 4DZBB 4XCCH 4X6DE 3TPKA 3EJJX 5DC0A 3HFML 4PJ9B 4GS7C 2Z91B 3HG1E 3CX2A 2AERT 1N4XL 3IETA 3ET9F 3F58H 3D85B 2EYRA 5TQ0H 1IGMH 3VGAB 3MJ9L 3CVIH 5IV2B 2QQNH 3FOLA 1NMCC 2ARJQ 2ENYA 4YHYC 5E8PB 2DQHL 1JF1A 3G5YB 1LO0H 4ZOCA 3M8OL 3HAEG 3NGBC 4FMKA 4H0HB 3AY4A 4R7NA 1T0MA 1RZ8A 3ARDC 4NQSB 2Q6WB 4U1LA 2YR3A 2XPGA 3EYQD 5TDPB 2G60L 4JN1L 2W59A 4XAWL 1QO3B 5INCA 2Y6SD 3C60B 1XMWA 5KG9B 5KN5A 3RWGA 2BNRB 3QO1B 2W9DL 3RPKA 1NLBH 5EORH 4CVXB 3QUMH 1NBVH 5KS9A 5KSUB 4ODTL 3TPUB 5CP3A 1KPRA 1CXLA 3KLSA 3BO8B 5JPNB 4KZEL 2G9HB 2BVPB 3Q5OA 2HH0H 3C2AL 3OXSA 1MEXL 3RWDB 5GGTH 3ZT6A 3FFDB 3OR7B 4WEBH 2P46B 4JFHE 4GW1B 4Y5YC 1BD2E 3OL2A 2BVUA 4OGYH 2FZ3A 3CDCA 3RPIB 1C1EH 3K8MA 3BDYH 3LCYA 2VZ3A 1GGCH 1CU4L 2AK1H 4JR9H 3ECBB 3HB3C 2WM0A 4UILL 4UV7L 3MJ6A 5CEZH 2H1PL 3O41B 2Y72A 3VWJD 1ED3B 1UACH 5F1IB 4HUXB 3IKCB 1NCUA 3L5XH 5GISL 5GS3A 4RMQA 3F7YA 3U0TA 3HUJE 4NP4H 5I1EH 4NQVA 3C2SA 1Q72H 4MLSA 1TNNA 5C0CE 3FQTA 4FXGA 1HNGA 1REIA 4G8GD 2H8PB 3KYNB 3GSWB 1D5MA 5JLZB 3EYSH 5ESQB 4MDIB 4GKNB 1JWUA 1YMMB 1F3JA 3QDAA 2F54A 4X6FA 4J12A 5CHNA 5FGBA 3LAFA 5HYJD 4GJTB 4D0DB 4UTAH 1M4KA 1U6AL 2W0FA 2WLYA 2VLRB 2C7UA 3L3KB 4YXKL 5FIEA 3G5VB 1UXSA 1MFAL 4X0KA 4X7DC 1G7QA 5FO7A 1H0DB 1GOFA 4YK4C 5F7HA 1J8HD 1PSKL 4G7YL 4RISH 4JAMB 1ROWA 5AEAA 2V9RA 5IFJA 1CTNA 2DB8A 3CXDL 3HAEA 3HI5H 4LPWA 5CWSB 3WIIL 4PJGE 4UUJB 5HHOE 3B9KA 4XI5C 4XXDB 3Q1SL 5HJ3B 3R8QA 3AC0A 4C56E 1NEZB 2YRPA 3F6LA 5HHMD 4D9RE 1SM3H 3NPSB 5I1CH 1WLHA 2VXQH 4R0LA 3JUYA 4N0YL 3QRFM 3T3ME 1HXMB 1CDHA 3ROOB 5ADOL 2DQJL 5JOPE 1ND0B 3CFEB 2FJGB 2HVKB 3H9HA 3S37H 1NC2D 2YPVH 2L7JA 1I7TA 4PJCF 3D39B 2C9AA 3CVHB 4U2ZA 5IB3A 1OAQL 3LKRA 4G6MH 2NY5L 1FV1B 3PIQB 1ORSA 3OKOB 2JTDA 4ODVH 3S4SB 1HYSD 1FSKB 3TBYB 2ZSVA 3FB7A 2C5DC 3MRLA 1U8QB 4YX2H 1NAML 1B2WL 5F9OL 2OL3H 2R1XB 1GOGA 4LLQA 1BIIA 4F15C 1KCSL 1ZT7B 1AO7E 1EJOL 1I1AA 4ZQKA 3DXAE 3MFFA 3NZ8B 4QT5B 4LCUA 2EDQA 4NM4L 3MZTA 4G9FA 1BOGA 3ZKMC 1UM6H 2VSCA 4W81A 5CZKA 1U8KA 2C4FT 4MQTB 4JY6B 1KIRA 5IFHH 1EFXA 1BQHA 4R4NC 1XCTA 1FP5A 2P5WD 4I48B 3DX6A 4WVRA 5FF6B 5D1QA 3C5JB 5D96B 2BNQB 1I8IA 2HN7A 3VFWA 1CXEA 1AGBB 3EYFB 3RVVD 5SWSE 1Q1JL 5MERB 1QBLH 4WGVB 2WWMD 2IPTL 2P48B 4MWFA 1GC1H 2NLJA 3JV4A 4XC1L 3DX7A 4XNQB 2EYTA 3PHOB 4FFYL 2Q1EA 4JZJC 3Q3GA 3QUZD 2VZSA 4M7KL 3ZYIA 4YIQB 4YWGH 2OZ4A 3DECA 3X11B 5ERWA 4ODSL 3VJ6B 1UJTA 5F21B 3RVWD 3QEQB 4Q6IC 2P47B 1XF3A 5HI5C 1PKQA 4ZTOH 4ZFFA 1T21B 3ZDYF 4PBXA 1CS6A 1KTLB 3MO1B 3KPRB 4ZO7A 1BREA 4F9LA 2DQIL 3F7VB 1I7UB 4LSRH 4YDLC 3KPMB 3IFNL 3ARYA 1J1PL 3TFKC 1G6RA 3VWJB 4HHAB 4U49A 2G75B 5BW7C 3NFSH 2ORBL 4NUGL 3HNVL 5D93B 5DS8B 4KKAC 4TNVF 1DUZA 2Z31C 4UB0L 3ESVF 1ZHBB 5IVNA 3V6FB 3QG6B 5GRJL 2OJEA 1FVDB 1H5BC 2FJHA 4G8GB 4HWNA 5JDSB 1BWMA 5E5MB 4IM8A 4XVSH 1RK1A 5D6DC 4KFZC 3QJFB 3D3VA 3IDIB 5HYJB 5SX4I 4NJ9H 4R4BB 4ZUUA 2HJLB 4DUXA 2R69L 2ZZUT 1TTFA 1K5NA 5I19H 1QKZH 2XZAH 5E8DL 4N5EC 4LPYA 3KG5A 4FQHB 1ZOXA 2BSSB 3EO0B 3B8YA 4NO3A 4HCRA 3ROLA 4MAYD 4JDVB 4WHTB 3I6GA 1CWVA 2A83A 3W39A 4HIHA 4GSDH 5EU5B 4G8IB 1TNMA 5D7JC 2A6KB 2R1YB 3O2VH 2B1AL 2OYPA 3DARA 4HGWB 4KI5D 5DQ9A 4H26A 3NFPB 3WFDL 1F3DJ 3STZA 4NDMB 4PJDB 5FHBH 5T3ZL 1DN0B 1DEDA 5KVEL 1NCNA 4M00A 3KYOA 5H37G 4J2XA 5D9SB 5D4QA 4JZOB 5EOQL 5KW9L 3EZ8A 1P4IH 2VXTL 2E8ZA 3WXVL 5DT1H 4AT6B 4LSDA 1NDMB 5FO8B 1VPOH 3WLBB 3QEUB 2NTFA 4BJLA 1ZTXH 1PX3A 4F7MB 2NY1C 3TESA 3WE6A 1H3UA 1AXSB 2JELH 1NC2B 4YQXL 1N5AB 1YYML 4ZUSB 5MENA 1FLRH 4KPHH 2VITA 3JUZA 2VE6B 4ZFOL 4M7JL 3BWUC 4JDTH 5A2LH 3QDMA 5EO9A 5FA3A 4LPCA 2P24A 1MY5A 1KJ2A 3GMRA 3UO1L 3PDDA 1F90L 1CFVL 2H26B 4Z6AT 1QRNB 2ZP0T 1FL5B 5F1SA 3RU8L 3P11H 5GIRB 3O6LH 4FQQA 4QHNA 2OTWB 2YPLD 1I3VA 4H0IA 4PY8J 3AB0C 3RIAK 4Y0GA 4V2BA 5DFVC 3H6JA 2FIRT 4NQUA 1XF4B 3UTOA 1YEDB 4WTZG 3DBXA 1F8TH 5BXFA 1FIGH 2P5WB 4XNUL 2DTSA 1IAII 5DA4A 4PG9B 5HVWA 4MS8D 5AZEL 3NFNA 2C4FU 3SQOL 2K3TA 5H2BA 1ADQH 1HE7A 1G7PA 4NO2B 3S3PA 4OZ4A 4GUPB 3EOBA 1HDMA 1YECL 1T20A 5L88L 1TJIL 4RGMB 1HHJA 3ILPA 2X7LB 3QUZB 3O3EB 3N1QC 3O6KL 3VFMA 1XIWD 4BZ1H 4G43A 4MXVE 1UFUA 4Y19E 5DUBA 2C4XA 5E9DD 1VGKB 2FEEL 3B3IB 4P2CG 3TCLA 2OZ4L 4OCNC 3P0VH 5A2KH 2MTPA 1U58A 5CLTA 2NXYC 5GS0L 2CR6A 1H8OA 1YNTB 1U92B 3MCLL 1QSFA 3N1FC 1M05B 3MJ7A 3VA6A 5B39B 3G5ZA 3BOVA 1F4XL 1S9YA 1P1ZB 1TJGL 3I75B 1IM3B 1AGFA 4QEGA 3RI5F 1QSEA 3FMGL 5EC1A 3RNKB 4O2CA 1Z3GH 1G6RL 1U3HA 3QXDB 3QUXD 2ICEA 1X7QB 1ZS8B 3C5ZD 1AY1H 4ZDHB 1TXKA 1ACYH 4EIGB 3IFOB 1EH9A 3DVGB 5I6XB 3MLWH 5J3HD 4ORZC 1P7QD 3HZMA 1WICA 5DMGC 1FGVL 4HLZH 5L2JA 3BKCL 4NN5B 1T7WA 2E7BA 5IMLB 3HMXH 2WWKT 5HHQB 3ZSTA 1U93B 1VACA 3O4LA 1ZWIB 2CKBH 2D31A 4HAFA 2IMMA 3S5LB 3EGSA 5IVXB 4ZD3L 4MX7A 3ULUL 3MLUL 4MAYB 5TPWH 1A7NH 1JHKH 3AREA 2SEBB 1GXEA 4PJXB 4LLYA 1CBVL 3UDWA 4JO2H 1Y6KR 4MXQC 4HCRL 4QRRE 3BXNA 1EHNA 5DJAB 2YN5A 4X5WA 5DR5H 4WFGE 3UAJC 3EHBC 1NMAH 2O5YH 1IGFL 4MJ5B 1DBAH 1SEBA 3MACH 3SN6N 5EU4A 1UJ3A 1EERB 1QSZA 4C55A 1N7MH 3V52H 4WWKA 5DZNA 3HPJA 1IC1A 3G6JA 5H35A 4U31A 1BFSA 3LQZB 1PZ5B 3IAPA 4X7TA 5KSVA 3V2AR 5FA4A 1AHWC 1JNLH 4YPGA 4BFEA 5B3NA 3TBVA 1VKXB 4K3EL 4X6CA 1LEKA 4JFDE 4R7DA 5J9PA 4JRXD 5EPMB 4KI5F 5EIIB 1IC5L 3NPZB 4ZUWA 3OKMA 4XNXH 5C0BA 3S34L 3T2OA 5I1AB 1KJ2L 2YD2A 3CZFA 5AYUL 3ULVD 2DQEL 3LHPH 4XX1G 4RX4D 1KJMB 4NQXA 1EDQA 2NY4D 3MRMB 2CLRB 3GMNB 4NN6B 4LF3A 4I0PD 1T2QL 1QNZL 1A6AB 3KYAA 5DMIH 4NJAH 4WUKH 5TH2B 3MLSH 4OIBA 3NH7L 2CSPA 3UBXG 4ZNCD 4HIEA 4TUJA 2XNAB 4UT9H 3OV6A 3PHQB 1R6VA 1J8KA 1VFOA 2G5BB 1FNSH 3SPVB 3W0WE 1UEYA 3BPCA 1BX2A 2I60L 4F3FA 5C08E 1AR1C 4S1SH 3KAAA 4JANA 1A14L 3F7RA 1KB5A 1MJUL 2J6EL 4JKWA 2Y25A 3GKZA 4QRPD 5JZ7C 1NUNB 4N0UB 4NQDD 3DUUA 4HBCH 4QHKI 1E4XL 1WIOA 5E8OA 1CQKA 5IVOA 1T22A 2IBBA 1GHFH 1XR8B 4F9PC 4OD2A 3LDBC 1S7RA 3AFLA 4LVOC 4MHHG 4OZHB 3HI1A 4YEFA 2APFA 2YMXH 5IEHB 3BEVA 1BFTA 4ELMB 3TF7C 2A74B 4KROB 1WTLA 4KHXH 4PGCA 25C8H 3I50L 3AUVA 2WAHA 1T6WA 3FT2B 4RGND 2J7LA 3VU2A 5CEZD 5T1LA 4LLAA 5IBTH 4HMCA 2XN9D 1YNLH 3DO7B 2JE8A 2HT2D 4LCIH 3RDTC 4OV5A 2HYMA 1WCQA 4XPHL 3ARGC 1RZJH 4DGYL 4OLEA 5E2UL 3BGFB 3CMOH 2GAZB 3OJDB 5HGBA 5IKCA 1ORQB 1MNUL 1IKNC 3DV6B 3MR9A 3TA3C 3ARDA 1RZGB 4MZ3A 4JFFA 4BKLA 3NN8B 2BX5A 3QUXB 5BQ7A 2P5EB 3C5ZB 2APBA 2R0LH 1MJJB 1A1OA 3WD5L 2CRIA 3QP3A 4OZHF 1WGOA 3SE4C 3GJFB 4KVCH 4UAOB 4XP5L 3MRFA 2AVGA 5CMAB 5E2TL 4QTIH 3GMQB 1P7QB 5FUCC 4I3RL 5A2FA 3CDGA 1K4DB 1UWGH 5EWIL 1NC4D 1MLCB 4OLZH 1FDLH 3O3DB 1RVFL 3B2UD 5EN2A 1AKJA 5HVHB 3STLA 4K94L 5FGCE 3WFBL 2AW2A 1P84J 2AJSL 2GSIA 3REVB 1KPVB 1OW0A 3GSUA 1HILB 5KZCD 3RBGA 1RIVL 2ZKHL 5E70A 3NCMA 5LCVH 1CFNB 4R90H 1U8NB 5E2VL 5BV7H 1VESA 1YEIH 3F7QA 1KUMA 2PETA 2D3VA 1A3LL 3MV11 1P5UA 4EI6B 4WI7A 1JHLH 3MX0A 4P5MB 3LQAL 1T4KB 4JZNB 2K1MA 3K4DA 1OAUH 2H2SC 4GQ9L 4NOBA 5EZLA 4GG6F 3MXWL 3MLTA 2A6JA 3EOTH 1CR9L 4JG0L 4GG8A 1N59B 1FORH 2L0DA 3BSZH 4H20L 4YO0A 3JV5A 4NC0B 5DDHB 1DVFD 1S5IL 3V6ZB 4P46D 2EDJA 4UNTA 4H5SB 5F44A 1KBGL 2E3VA 1A7RH 4HULB 4JRXB 4QXTA 4NPYB 4P48A 2I9LA 4MAUH 1BP3B 3OB0K 3MV8D 4YE4L 4M7LT 4MSWA 2N7BA 5CGMA 3VW3L 3VD3A 1VA9A 1I1RA 1RY7B 2NY4B 3QXAA 4HDIA 5FM8A 4I0PB 3QO0B 2X4NB 5LVEA 2DQDH 1N2RB 2W0PA 5EA0H 1A6ZA 2IFGA 1HQ4A 3OZ9H 4KQ4H 5E99H 1CDJA 1CVRA 3TM6A 5D7LB 4FXKA 1KEML 2VDQL 1S7WB 2DQGL 1E4XI 5CIPH 5FV2A 3N85L 4HLJA 4V1DD 4DUVA 4HXAH 2FJFA 4HUMB 4B7IA 1E4WH 3IFPB 4ZO6A 1G7HA 4YNYA 3FO1B 3ULVF 5KAQF 1F4YH 1XGQB 2HFTA 4NQDB 3VMPA 3BUYA 2QHLA 5KS9E 1N3NA 1IGIL 2YKLL 1KB5L 5MEPB 4PJAB 5ACLA 5KVGH 2OCFD 2EE9A 3SDXA 4FFWD 3BPOB 1LEIB 3TYFB 4C83A 4J8RB 4TPRH 2V5TA 4XRCB 4PJFE 3H0TB 3KPTA 5IMOB 3MA9H 4AH2A 1YEHH 4M5ZH 1ZT1A 5AZ2H 1CE6A 4JRYE 3P4OA 4WDIB 4U1SA 3HZKB 3S36X 1EEYB 4RGNB 4FQXA 3UTTD 2XN9B 2NY2C 1UM5H 1WF5A 3CH8A 5IMKB 1N6UA 4JHWH 3FB6A 4YAQA 5DF0A 3P9LB 5GRUL 2ARJA 1C12B 3MRHB 1PG7H 2VUYA 3P4NB 3FT4A 4PP1D 4QRQB 3HHRB 3HTLX 3P73A 4PJIA 2IBZY 1D5ZB 2FIKB 3G6AA 5J6GB 3WKNA 2JJWA 3PGCA 3EYUL 1OP3K 2Z92B 4RQQB 3DVNB 3CLFH 4ONFL 2WV3A 3EYVB 1DDHA 2F54E 3K7UA 3QA3B 3SE9H 5D7IF 4JZJA 1RUMH 5EZJB 5HGDA 5J11B 1EO8L 1WBXB 4WNQB 4F58H 2GSGA 3WXWH 5HGAA 1NC4B 4P49A 3T0EB 3MSPA 4NGHH 5I1HL 1I9JL 4ALAL 3FJTA 1FFQA 3QQ3B 2HFGH 1T1XB 4XMLL 5CILL 4JO4H 1JGVH 5KANG 1RZFL 2YC1A 5C0IB 3TNMB 3O0RL 4Q6IA 1CIDA 3MBEC 2PO6A 2BVOA 2GHWB 3FQNB 1TZIA 2CDEA 5KZCB 3QQ4A 1KENL 2ADJB 1CGYA 1E27B 3QHTC 4Y1AA 1SHMA 3OF6D 2D7TH 4NWTH 4RDQG 5T3ZE 4Z7UB 4GRMB 4HAGA 1CGVA 3E0GA 4Z7WA 3C8KB 3OAUL 5BW7A 3HI6H 3I3BA 1I9IL 2J1KA 4O4YH 4WW1A 2Z31A 3ZYZA 2XYCA 2EO1A 3HFMH 4U6HA 1M71B 3SJVD 5GGSY 4LKXA 1WT5C 5BCAA 1Q0YH 2QSTA 2B7DT 1N4XH 4U1JB 1W72B 2VDRL 3EJZD 1NFKA 5D6DA 3L7FA 4P9ML 5IB4B 2EDLA 2JCCE 5CD5C 3MJ9H 4KVNL 3UX9B 3QHZH 7CGTA 2IGFL 3V7MA 5F7WC 1DVFB 3QSKB 4G3YL 2AQ2A 1IGTB 1CLCA 2DQHH 4P46B 4PRBA 1HHHB 2OL3B 5C0JB 3M8OH 2G5RA 2DMKA 1C5BL 5D5MB 1MF2L 2KPNA 1HCFX 3MNVB 4G6AD 1RJYB 2G60H 3MV8B 4JN1H 4XAWH