1CFQA

Anti-p24 (hiv-1) fab fragment cb41
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Polyspecificity
molecule keywords PROTEIN (IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN))
publication title Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity.
pubmed doi rcsb
total genus 41
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1999-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cfqA01
3LN9A 3TJHC 4NBYB 4IOFC 1RUAL 1U8PB 1IM9B 4WUUD 4WI5A 2VABB 1PEWA 1VACA 3QHZH 4B41A 3L1OL 1D5ZA 3PWPE 5T5NF 3QIWA 2NW3A 3VRLF 4YPGA 4JZJA 4U6XB 4J1UB 1JWSB 1IAOB 3MRIA 1CZ8H 4Y4HB 3KPRD 4RISL 1CU4H 5CCKL 3C5SB 3UZVB 3GIZH 1KN4L 4GH7B 2I60H 1JWMA 4QTIH 2CLRA 4HUUA 4MCZB 2AV7B 4OLYL 4X5WA 3A6BH 2I5YL 4UTAH 2PO6B 4YK4C 2WINB 1P9MA 1RZGA 2KKQA 1EEZB 1WV7T 5DQJA 1G9ML 4Z78B 1UH2A 4OB5L 1MCKA 5DJCB 1IILE 1A9BB 2VDLL 5IMOB 4KKBD 4ZS6D 5KJRH 1NCUA 3NFPB 4IOIB 1RJZA 1KACB 3FRPA 2FJHA 5C0EA 5LQBH 3IVKB 2J8UB 1X9QA 5FUOL 1C7SA 3U82B 3VFOA 5GGUB 4OLVL 3T1FB 2E8YA 5C3TA 3U79A 1E28A 4K3JH 1S7XB 1HSAA 3QUMB 4RAUB 3QCUH 4LLYB 1HQRB 1LNUB 2YD8A 4NZRL 4JO4L 4KY1H 3BWAA 4ODUB 1TVBB 3LKQA 1AGDB 4X8JB 4BYHA 2W9DH 3JWDC 2AJZB 2DL2A 3B9EA 3VWJC 2VSCA 3HAEA 4FP8L 5HHPA 5LCVL 1N0LA 4JFDB 4OF5A 4YHOH 1BQHG 2BY2A 3MV01 1JWUA 4BKLB 1H8NA 1YY9C 1CGXA 4JG1H 5F96H 1E4WL 3KXFB 3FOLA 1P6AB 3KYOB 1ZHKB 3BMVA 2FO1A 3JUZA 2R8SH 1EUUA 1OCWH 3WFCL 1P5VA 3CFEA 4PJEE 3FN0H 1SY6A 4WV1B 1KPVA 25C8H 2NMSA 3LHPL 3HUJE 5EU6A 4OUUB 3RWJA 1MCHA 5HVHC 5EUOA 5E4IA 5F1IB 3LN5A 4F8TA 2AXJA 2XWTA 4LMQE 4N0CC 2W9EL 4L3ED 2YRLA 3O2DA 4GKNA 3NPSB 3LB6C 1YNKL 2IANE 5MEOA 1DFBL 1OT2A 1CN4A 3P4OA 2P5WE 1CS6A 4B0MM 3UTSB 5B39B 2PTTB 4HK0B 3UO1H 5AG8A 2P46B 3RY5A 4ZTOH 4OCLC 4ZNEA 1F11B 1ZA3B 3LAFA 1J0IA 3WNNA 2DYPA 4X6BB 1SJEA 1NUDA 3F7VA 1OD9A 5JIIA 2MQCA 3ROOA 2IMNA 1H0DA 1MFBL 2BNUA 3OKMB 3HNTH 5C0CD 4P9HC 4OCSL 2N56A 3CIQA 3DSNA 2V9RA 3U4EA 1EX0A 2DQFB 2NZIA 3QXAB 5I1EH 3T0EA 5DURD 3VFNB 1RJLB 1X5YA 2I9LA 2NY0C 4OI9A 5IP4A 5TDNA 2WWMD 1XEDA 2Y9RT 5D1XC 5CWSA 2R69L 4YR6B 5IFHL 1KJ2A 4EEEA 1HWGB 3LEXA 1ED3A 3INUL 1I85C 1B2WL 5DQ9A 1LP9E 5D2NE 1IC4H 2YKLL 4FQXD 3C6SA 4A6YB 4I2XE 3FT4B 3VG0L 3ELAT 2DI7A 5T3XD 1UKSA 1MFCL 3ZHLA 2Y25A 4M7JL 2AV1A 4NRXB 4RCAA 4GAJL 1PX4A 5E7FA 4OZHE 5IM7A 3QEHB 4QRRE 4UILL 5EFIA 4W70A 3SDCC 1KB5H 2ORBL 3W0WE 4L3CA 3RBGA 2DJ4A 3GJFA 3WJJC 3Q6FA 1OD7A 1FFOB 4OTXH 1U8OB 1DN0A 2ESVA 3O6FA 3NIFE 3UTTD 4Y2OA 1QTYT 3DUUB 1IM3A 4U1NB 5EZLA 4MSWB 5T5NG 1G9NL 2R1XA 3SKNB 1I7UB 3BFOA 4X7DC 4KUZL 1U92A 5T1MA 4IOFD 4YHNA 1OP3K 3PIQB 1HKLH 5B8CB 2IAMB 2E6JA 4G9FD 4KUCD 3O4OB 4X9HA 3WXVH 1MHHA 3L3DB 1B6DA 3FONA 1CLYH 1F4YH 5F7WC 3OGOE 3VXPA 4MJIA 2XQYK 2AK4D 1NC4B 2NXYD 3PHOA 4U7KA 1CDYA 4OCRL 1JF5A 1A64A 1KLGA 5I30L 4P2RA 1BM3L 4WRLA 3RKDC 2NR6D 5DD1L 2P8MA 2EDBA 5EU5A 3V4PL 1PZ5B 1NEZB 1U8IB 1S5HA 1CTOA 1X4ZA 2VDRL 3B43A 3KHQA 3I75B 4HX1A 3ARDA 3QNYA 5DMGD 3BN9D 4YZFE 4FTVA 3K1KC 5GGRY 1DUYB 4GRWF 2XRAH 2HP4A 3VDCA 1QSZA 5CEXA 3RUGE 3MR9A 3P4MA 1A7PH 5C0FB 4JFFB 2OR8A 4MVBC 1FH5L 1WIPA 4KKNA 2X4TA 1OPGH 3C8KA 3ZO0A 4GBXA 3OJDB 1F4AA 4POYA 1J1PH 4PJIE 1XGTA 1FO0L 4HPOH 4Y2DD 3VFTB 1NLDH 5FF6A 2HT2C 1ZE3C 2P5EB 1LE9A 4XP5L 4PRIE 3NFNB 1JNNH 1TTGA 2H8PA 2B39A 4EBQL 2CIKA 3PQYD 4JM2C 2JE8A 4TSBH 3KYAA 3MJ7A 5EIQA 4LSUL 3UAJC 1KCRH 3EUUA 3PWNA 5LGHH 1J5OL 4NWUL 4J7RA 6CGTA 3HC4L 4O02L 4JJ5A 4JZOA 4RA0C 4K9EC 1NGQH 4ZO8A 1KFAH 2FIKB 3VGAC 3WO3B 2ZOLA 3UX9B 3I9GL 3NTCL 1F42A 4NQCE 2IBBA 4OCWL 3SO3B 1YUHB 4U1HB 3ARBC 1IZKA 1ZS8B 3RZCB 4NUGL 1JTTA 1ETZB 2HG5B 5TGBA 4OGYL 2KPNA 1C12A 1CL7L 1GHFL 3BSZH 1IJ9A 1KJMB 4WU7B 4YXHH 4LHUD 1NFDA 1XT5A 1AKJA 5ACZB 4WY7L 5CINL 4RZCB 3O9WB 4X98B 4X4YB 3SGKA 4EUPB 1K4CB 4LMQI 4Y4KB 4Y5YC 3OWEA 2HMIC 4IJ3B 3HMWL 3Q5TA 3M17A 5DS8B 2N4IA 3ZKXB 1INEH 1KTDB 1HHGB 3E6HA 4Q6IB 2BXZA 3ZTJG 3SBWA 1BWMA 3ZTJH 3LB6D 4DWHA 1HINH 4UUJA 1JUFB 2COQA 5HYIA 1ZA6A 1X6NA 3B8YA 1DQMH 3BZ4B 5D93B 5D2LE 1H5BA 3RY6C 4YHLL 1J1OH 3FO2B 4S1QL 3TYGH 5E99L 5HDBF 3ZZ1A 5GRUL 5T33H 5I9QC 1EZVX 1YECH 3CZJA 4F33B 1LO5B 3V7AG 3QRFM 3P73A 5IIEB 3M8OL 3IGAB 2CQVA 1YEKL 5T3XL 2DKSA 4M1CC 2AJUL 1D5MB 3ILQC 2NY0D 1OSPL 3CLFH 5D1XD 1S7UB 1ZLVH 3UTPD 4D8PB 4DAGL 4N0YL 3SDAA 2VXSL 4WUUE 4WEBH 3RA7H 4U1LA 3VU2A 1P4BL 2NY3C 5AAMA 1ADQH 4G5ZL 3OKKB 3WFZA 3QO0B 2UZIL 2H32A 1YEDB 4ZSOA 1A6TA 1JK8B 4UTBL 1ZK9A 1MHCA 3SDCD 5ITFB 3E6FA 4H5SA 4EOWL 1ORSB 4NYLA 4TVPH 4ZFOA 1QHPA 1FPTH 3QEQA 3EOTH 3TVMA 1RUML 4YLQT 1EHNA 2VH5H 3TIEA 5KVEH 3MOBH 2E7BA 3F7RA 3WFBL 5BZDB 1QFUL 3PP4L 1SBSH 1L7IH 5I8CB 3QWQB 4LVOB 3OXRB 5CS7A 2X09A 1AXIB 3MBXL 4PGCB 3B4NA 4BH7B 2XQBH 2DDQL 4MJ5B 2W38A 3MGOA 4Z5RA 4JPIA 1OAZL 2C4XA 4Y5VB 5D8JH 4Q9QH 2ESVD 3HE6A 5F7EH 2EIBA 5CEZH 2AJXL 1YDPA 4Y4FA 2BVUA 5MEPA 2UY6A 3HS0B 1HILB 1DBKH 5F88A 1EK3A 3WNPA 3V5HB 3MRCA 3WJLC 1JNLL 3UBXG 5IR1B 1QKZH 1UM5L 2P48B 1IZJA 5ALCL 3H2WA 4N8CH 4B50A 4OZFA 5ISZB 4HF5H 5TF1L 4GAGL 2NY7H 5HHVH 3VDAA 1KF9B 5BRZA 4BFBD 3U4BL 4NKIL 3AM8A 4WW2B 4XP4H 4JHWH 5KVMC 4JO2L 2NY4B 2GUOB 4EI5B 3MRQA 5HI5D 3GBMH 4OLZL 1ZKAA 5C09D 5AZEL 1CWVA 3C5ZA 1T5XA 5EO0B 2FB4L 5A2KH 5MEQB 3MUGA 2VR4A 3JWDL 3O45A 4J3TA 2VKXA 2HT2D 4TN9A 3WIHA 4KV5E 4PJ5D 3QAZC 1NMAL 1Q9KB 2LU4A 3S5LG 1UQSB 2GTWB 3PJSB 4JM2D 4ODBD 3MLWH 4DGYL 1P4IL 1MI5D 2I27N 5DD5H 4HIHB 3BYTA 3T0AA 4LSSL 4TUOB 4AQOA 4UQ2A 2D3VA 5DWUH 2C9AA 4R26L 3S9DB 4OZGB 3RWHB 1ZVYA 1BOGA 3ZSSA 5DJYB 4JN1H 5IVZA 3X11A 1C16A 1XF2B 4QHKJ 3ZKNC 4G7YH 1I9RH 2FATH 5D6DA 5C0CE 5HI4C 4MAYD 1EAJA 1UZ6E 1KTKE 1MAJA 3L3JA 5K59E 3GJEA 1LEKB 5CJBA 5DK0B 3QISA 3A6CL 2QTEA 3CX2A 4LLQB 3LZFH 2DLHA 4UZGA 5DJ0B 3LV3A 4WW1B 5A16A 3CDCA 1EFXB 1U42A 3DUHA 3OB8A 4HXBL 3IDNA 2E7MA 3O3EB 3QWOA 5TE6H 4Z7VE 3BT2L 2WSKA 5DD0L 2CXGA 1L0XA 2HMID 4N5EC 4PJXE 5T3XE 1YPZB 4FFYL 4N1EA 1BZ7A 4DVBA 4PJAF 2X89D 5ABDE 1C5CH 4Z7OF 4XCFH 2YEZB 2D2OA 2NLJA 4HZLB 4NSKA 1AKJD 1TMCB 4U3HA 1BP3B 5HGHA 4PLNC 4XHQA 3I84A 4DTGL 3DV6B 1G7PB 4Y16C 3QHTC 1EMTL 1BQHA 3BIKA 3ARGB 3V6OA 5CGYC 1J0HA 1JPSH 3QULB 2D31B 3V8CA 1I7TB 1O7VA 2G9HB 3F7YA 2O61B 1N6QH 4V2BA 3I02B 4YUEH 4JPVH 1J8KA 3ZDZF 3SJVA 4ETQA 5I8KH 3VXUA 3ULVF 4AM0A 3ILQD 2UUDH 4M6OL 1YMME 3PWPB 5ETUA 4IEFB 3IS1X 2DL9A 5AYQA 4OLXH 4BFEA 2NY3D 1XF5B 1VKXA 4BFIB 1U91B 2DLIA 3BPOC 3UYOD 4G8GE 1U41A 1ZT1A 2DQHH 4NT6A 3OZ9H 3V5KB 3BP5A 4ZUUB 4LSTL 2ILLA 5LAXB 4PBWD 3QCVL 3KPPB 3DO3A 1A14L 5F1NB 5GZNC 2ZUSA 4G8FB 3B5HA 2GAZB 2MKWA 4CN4A 3GSNL 1IEBA 3EYOA 4UI2A 3FFDA 5E8DL 4RQQB 1R3IL 3SE4A 3QQ3B 4I5BA 1WTLA 1ZHBB 5BO1L 5I16A 3AREA 3FB8B 3O41B 5C6WH 1B0GA 1JI1A 2F54E 3TNMA 1T0NA 1OSZB 1C1EL 1MJ7H 2GK0A 4ZQKA 3REVB 5DJ8B 2OTUB 1PVHA 3QPXH 1I1FB 2HLAB 2NTSP 3X14B 1WBZA 1MF2H 1NAML 3VGHA 2CUHA 5HHOD 2OL3H 2BNRA 4WU5A 1MHEB 3TVMD 4QHMB 3CAFA 3VMNA 1PY4A 1JHLH 3GMLA 3HMXA 4NQXB 4ZTPL 4RGOH 1UJ3A 4P9MH 2RGSA 1QOKA 2EDYA 2CK0L 1LO3H 2HKHL 4XNXH 4NO2A 3MXWH 3EOYG 2WP3O 2RCSL 3MRNA 4MD5A 5EPMB 3CCHB 4PB9L 1LO2H 4QCIB 1KENL 1JMXA 4JFPB 3SQBA 5JOPD 1UB6B 2A74A 4XCYB 2IQ9L 1X5LA 1L6ZA 3BYYA 4NPYA 2VDOL 4OT1L 2FGWH 1LGVA 3UJIL 4TSCL 1W72A 1IE5A 2P4AB 4CDGC 2FH6A 3HE6D 2R9HC 5J13B 1VPOL 1DEEA 4P3WA 4CN1A 1G0YR 1GOGA 1XF4A 4N0RA 4YWGH 3V8OA 3NFSH 2C5DC 4PJEB 1MQKL 2VL5A 2WW8A 5JW5B 2YRPA 5IEHA 3TCXA 1CICA 2A6KA 4WO4A 1QRND 1VENA 12E8H 2V2TA 2YUVA 3BGAA 3HUJB 3QXVA 3W9EA 1W0VB 5F3HB 3L5XL 3OQ3B 4MA8L 1UZ8A 4JY6B 4K9EL 3RVVC 1R3LA 5ESQA 4HKXB 3K8MA 1PSKH 4HT1L 1CL7I 3OR6B 3S3SA 3NCFB 2IANB 2AGJH 4NNYA 2G2RB 2P5WB 3TPUB 1QLFB 3RIFF 3U46B 4LKXA 3NCJH 1XGUA 1IMHC 4XGZB 3EO1A 4MQXC 2H2SC 3BAEH 1DP0A 2BC4B 5A43C 4UB0H 4ELKB 2DQJH 4R4BA 2FSEB 4PJ7F 3QDHA 2MKLC 2QKIB 2A73A 4R7NB 1F6FB 1P7QD 3MUZ1 1FV1B 3PV7A 3W9DA 4WDIB 4NC1E 2C4FU 3O6KH 3UJJL 4ACPA 2PXYA 5JQHC 5ITBH 1T1WA 4CW1A 4RRPA 2B20A 3LPWA 1IL1B 3O3DB 4ODVL 2B7DT 2J1KA 4PB0L 1U2CA 2YBRA 3S37X 3S4SG 5BVJB 4O5LH 2DLFL 5AEAA 4PJ8D 1LP9B 5CJ8A 3WO4B 5D2NB 3DBXB 4LASL 3EKCA 2P7TB 2UWEE 4GS7C 2IFFH 3DX6A 1Z0MA 4XBPB 5JXEC 4F7TB 1WFOA 3EYFB 1RIUH 1HXMA 4LLVA 2W65A 1WK0A 2CKBH 5I74B 3G5XB 4N5ED 4IRJD 3X13A 1MCWW 4OZHB 2FDBP 3SKMA 2E27L 4K23L 4QRRB 1IEAB 3L95A 3RL2B 3QUZA 2Z4QA 3W0WB 2VLKE 5ECJE 1U93A 4KVNH 5TE4H 1OLZA 1DQJA 1RZKH 5E4EB 3HZKA 1RHHA 2OBGA 4H88H 4AL8L 1ONQB 2VXUL 43CAB 1BZQK 5FM5O 5CGYD 5MI0B 1INDL 1T1ZB 3E2HB 5EO9A 5DXWA 1NH6A 3BO8A 3LRSA 4JREC 1I8MB 3LN4A 3SDXE 4QLRA 3FMGH 4XCEB 4F7PA 4YE4L 2XFXB 3LQAL 1FFPA 3NZ8A 3TH2T 2D7OA 5DA0B 2XN9A 5MENE 5JXAH 4YXLH 3M45A 2DWEB 4N68A 2CIIA 5A2IH 5ADPH 5FGBA 1ZLUH 3LKNA 4APQA 4ZAKA 5HBBA 4TUKH 1FYTD 5C3LD 2LE9A 5D1ZA 4HJ0C 2ITDB 1N4XL 2C3GA 5F6HJ 1FAIL 4XVJH 1E4XH 3WL9A 3SJVD 4DZBB 4M6MH 2WBJC 1RI8A 3GNMH 4P3CL 3MLYL 1GJIA 1QPPA 3QIUA 5GZND 4KHTH 1I8LA 2HN7B 3DRTB 3U9PL 3REWB 4N8VG 3P9WB 4XP1H 2KL6A 3PWLA 2X4UA 3VI3F 4HJGB 2OJZL 4YNYA 3RUGB 1CYGA 5DJ2A 3K8LA 4Z0XB 2EXWC 1D5XB 3B9KC 2R39A 3TO2A 2VQ1B 2JJTC 4PJIB 3QG7H 2J4WL 1T04A 3NCBB 5GJSH 1GGBL 1BJ1J 1ZLSH 3RTQA 1V7ML 5IB3A 3OX8A 4PRIB 3KPQA 4J12A 4P59L 4X4XA 4XTRC 4O4YH 1OQOA 3L3IB 1ADQA 3MACL 1OL0A 3GKWL 3GZKA 5BOZG 4DW2L 1MCSA 1OHQA 3GSQB 4XPGL 4HG4J 1FVDA 3BVNA 3ARED 1XGYH 3UZEA 4TNWF 4HWUA 1PAMA 3IFPB 4M43H 4JHAH 1AI1H 2DQCH 5L2KD 4NQCB 1D9KB 3TBWB 4J8RA 2B8OT 1U58A 2BNRD 3JV6A 2K3TA 4HIJB 4LCWB 4O2FB 4QRUB 5CSZA 1WZMA 4M93B 2R29H 1U3ZA 4I48A 2R9HD 3MOAL 4QHKI 3W2DL 1X5ZA 1MJ8H 5CJOH 1FZKB 2R1WB 5IHBA 3FQXA 1F58H 4Z8FH 5D7SL 2I9TB 3WHE1 5EU7C 1MCCA 4FQHB 4MA3B 3GSRA 4XI5C 1WUNT 1TIUA 1U8NA 2O5XL 3HI1B 3RVVD 2X44D 3BXNA 3OMZA 5FCSH 2EICA 2PYFA 3EGSA 1HE7A 4JANA 2BJMH 4L9LA 4WI7A 1JV5B 1U8QA 4LKCB 3BQUA 4FMFA 4PRAA 4HBQA 3WKNA 4IMLA 4ZUSA 5ACLA 4LF3A 5JLZB 2C1PA 4PJDF 3MRJA 1MJJA 4MQXD 1MRFL 3ZKMC 1EIBA 4DZ8B 3N0PB 1C5BH 3JTTA 5EIIA 4PJHB 2F8XC 1I1AB 2YMXH 2FBJL 1K3ZA 3V0VA 2CLZA 4M62L 3SE3C 5L7XH 2F58H 4CJ1A 3ARTA 1KEGL 4FQCH 2BZDA 2WWKO 4PRDA 1IC7H 3FT2A 4I9WD 4OAWB 3O6MH 4X4ZA 1MCPL 3IDMB 2VYRE 3WIFA 4POUB 8FABA 4WUUB 2EDRA 4FQIH 3H3KA 4W4NA 3U0WH 2J8UF 3O2WL 5JXED 1EO8H 4LFHG 2DD8H 3WE6B 3S5LA 4QXTB 4NHUB 5L88L 1DQQA 1A6PA 1Z9MA 4S1RH 5DRNB 5BS0D 1ORQB 2EC8A 5CJQL 1A7RL 4K7FA 3FQNB 3P0YL 2R0WH 5D7LD 5HHQB 5E2TL 5FCUL 3MRFB 4X6DE 4P23C 1I7RA 4BH8B 1Q9LA 4WUKL 5DMKA 1E27A 4L4VE 5C07A 1UH4A 4M7ZC 2GSIA 3LKPB 3SKJH 4BQBA 4O2CA 1JF1A 4UAOC 1AGCA 3GMQB 2ZUTA 3BW9A 4NM4H 4Z7UE 5TQ0L 1V7NH 4ZUTA 3RWIB 1A1MA 2VITA 1D6VH 2J88H 1JYXA 3GSWB 3PGCA 3MFGB 1MRCL 4JFXA 3GM8A 1QP1A 5KTEL 4M1GL 3N9GH 2ZSWB 1B4RA 4J3VA 4M5ZL 5DHVB 4NBZB 3LQZB 5HY9A 7CGTA 1MFEL 1EZVY 3CGTA 4O58L 1J1XL 1FG2B 4U0RB 1N64H 2NX5A 5FYJD 4XPBL 1I9IL 2W0FA 2XN9D 2DBLH 4R7DB 5F1OB 2W1NA 2G75A 4E0RB 3AAZB 1KJVA 5IKCB 5TPWL 1FZJA 3G5YA 5E8PB 2QQNH 1WWCA 4Q9BA 1QSFD 4XAKD 3V6ZA 5I17B 4Z0BL 1CCZA 3D25B 4JKPL 1P84J 3RDTA 3IDIB 1HH6A 3X3FH 3CJJA 1K5NB 2EXWD 3MLSL 3BRFA 5I1AB 1QRNE 3PG2A 5D1QA 4F7MA 4L4JA 1YEJH 2AERT 3PV6B 3OKEA 4AJ0A 4D0CA 1WFNA 2FJFA 32C2B 4XWOC 3BKMH 1KJ3H 1RZ7H 5C71A 4HUWA 5JPMA 2C1OB 4NQSB 4D3CH 5HYSG 1NBYA 3MYZA 4WHTB 1QG3A 5E6IC 2A6JA 2ZUQB 3HMXL 1PKQA 4I4WB 3F12B 1C08A 2ATKA 1CBVL 2HJLB 1Q72H 1JPGA 4HS8H 4XP6L 3L3GA 1JYVA 3U7YL 3Q48A 3CPLA 1HQ4B 3FN3A 2ZUYA 4R0LA 4D9LH 1EJOL 2JIXD 5IHUL 2FBOJ 1SM3L 3IFNL 6FABH 1XH3B 4I3SH 3G08B 2VAAB 1BVKB 1OAXL 4D2NA 5C0CB 4RMQA 4MD0B 2DBJA 1BZ9B 5TFSL 3PHQA 2FEEI 1IGIH 4NO3B 5DURB 4F58L 4X7SL 1FL6A 2JJSA 3STZB 1FVCB 3GHBL 2P43B 3B6SA 4ZPTB 3QIBC 1J8HD 1A2YB 5IVXE 2OL3A 5DEFB 4Z7VB 1CD8A 5KN5A 1AC0A 4GG8B 1G7HA 5IQ7H 2B0SL 1KLUB 4A2LA 1JN6B 4HUVB 2QV2A 2ZSVB 1TZHB 2ZPKH 3FHAA 3HRZA 2EYSB 4GAYB 4RAVA 3TP4A 5C92A 3WYRA 4O9HL 4KGLA 5E8OB 4Q0XL 3ZKMD 5D7JA 4H25B 5EH1A 2WIIB 1VFBA 4MAUH 3D1MC 3IDUA 2HT3C 4JRYD 1HXYA 1G6RL 2FRGP 4JG0L 3U48A 5DFVD 1TJHH 4U1MB 3L3OB 1D5IL 4MNHA 3MNZB 4P2QD 3Q5OA 3H42L 3EFDH 1F4WL 3QZWA 4P46B 2VZ3A 2VERN 3W5MA 1XR8B 4OKVA 1YMMB 1IBGL 5IQ9A 2WUCH 3BD4A 3QUMH 4GRLA 1M05A 1I3GH 1HI6B 2X42A 3P9MB 2X05A 5HDQH 2M8XA 1FVEA 4G8GB 4P4RB 5EUKB 3MRBA 5I2IA 1WTGT 5B3JE 3GHEL 1KIUA 4L29A 4P2CG 3VW3L 2A9MH 2X1OA 5F7KC 2Y36H 1F3JA 5I19L 1S7WA 3G5VA 3MV9A 1MFNA 3T4YB 4YK4B 3QNXA 4N90E 5D5ME 1AE6H 3U2SB 1J12A 1TJIL 2D03L 1UXSA 4P23D 4Y8DC 3S88L 4HS6B 1LEGB 3LY6A 1KPUA 4PV8B 1LO4L 2F54B 5FKPA 5C0BA 3FQTB 1UM4H 4M5YL 3TV3L 1LEIA 4MQTB 1HDMB 3S4SA 4HWEH 4PJAA 2RFXB 2E9BA 3I50H 5CMAA 1NBZA 1ZSDB 4JZNB 2FR4A 2VE6B 5J06A 5FYJL 2PCPB 3VFPB 4CMHC 5FUCC 5DMJB 3IU4H 3UC0H 1JGEA 4I1NB 4Z77B 4KK6C 2CKBA 3STLA 1IKNA 1CFVL 4P5TC 5C07D 4UT7L 2FO4B 3OB0K 3QDME 1I9JL 4U6VH 2CUMA 4LHQB 1A7NL 4UU9A 3VXMD 3MZGB 5FIEA 3VWJB 3V5DA 1T20B 3DETC 2YXMA 1EHXA 1RUQH 5L2KE 4LP4A 2FL5A 3BP4A 3IF1B 4L9DA 3CUPA 3QCTL 1MVUA 4GMTL 1CD1B 2OTPA 5EZJA 4AEHL 4YHYC 3EJYC 3IJYB 4NQUA 3WIIH 3MRLA 5EBMA 4YQXL 2ZCHH 1DBJH 4MXVF 3T0EC 2GK2A 2DMKA 3C9NB 1G9EA 1U8MB 5ALBH 4EIGB 5IF0A 2NX5D 5I0ZA 3MO1B 4XP9L 1JPFB 2GKIA 1EVUA 5C08D 5DO2C 2Z91B 5E1AA 1E0OB 2IGFH 4RGNC 4U49A 1MUJB 3MXVL 2HVJA 1WZ1L 4LU5H 3QUXC 3TN0C 1YC8A 4PJ9A 4XWOD 3P0VL 5DEZA 3OV6A 4LEXH 5HYJA 3QH3B 3C6LA 4KZEL 2V2XB 5E6ID 4EN3C 3EOAA 4NUJA 3N50A 4WENB 2C26A 5GZOC 4KPHH 1U8HA 2KZ1B 3CZFB 2WBWB 4OSUL 2EH8H 2A83A 2N1KA 1N3NB 4N8VA 1Z6JT 4DCQA 1X5FA 1HHJB 1KIRB 2GEEA 1EA9C 3AUVA 4OFVA 1GSMA 5DRZA 3B3IB 3GMMA 1T7XA 4GRMB 1U8KA 5F1KC 5HYEA 1B0WA 3ZDXE 4NCC2 1WWWX 1T4KA 1JMZA 4GT7A 3D0LB 3K4DA 1JP5A 2Y07H 2NY0B 4DFHA 4X6FB 2Q20A 4Q74A 4I9WE 3CFKA 2UWEB 4JDTL 5D1XB 3H8NA 3QIBD 1IT9L 4HKZA 1OARH 2Q86A 2YPVL 2C3HA 1OP3H 4NZJA 3PDOB 4HW6A 4MS8C 5ENWA 1J88A 3GKZA 1J0ZA 5EG6C 4FZEH 3D39A 1YEHL 3C8DA 1NEZG 2VLKB 3PWVA 4FFZH 4PPTA 3LKOB 2IH3B 2Y06H 1CE6B 1PX3A 2VLRA 5T1KD 3GFUA 15C8L 2I07A 3MV7D 2AQ1A 4KDTA 4HUXA 2JK5B 2GCYB 4EXPX 1MCNA 5D7LE 1HK6A 3KR3L 4AENA 2AEQH 3BZFB 3TO4D 1P7HL 2YXFA 2X6MA 5DRWB 2HT3D 5JW4M 1PG7X 1T1YA 3WN5C 4YXKH 3SDXB 4NP4L 1YJDH 1TJGL 4KZDH 1MEXH 4PP2B 2PYEA 5CJ5A 3NH7H 3NMEA 4ONHB 4WW2F 1NCBH 2HFEB 3MYJA 3PGDA 3TBTB 3ZE1E 1R5IA 3GB7A 4OZ4B 5J1SC 2D9QB 3HB3C 5D7JD 2K7PA 1U9KA 3HPJA 3C60D 3HG1D 1T3FA 1ITCA 5INCA 4PJ7A 2OXGA 4K3DH 2R4RH 5CHNA 5SX5H 4KWUA 5L6YL 1JF6A 4NRZB 4U4BA 1A8JH 2FECI 3B2VL 4F57L 1NAMB 5FYJE 3FFCA 1HHKB 1BREA 1PYWA 4N0FB 2IMMA 3DVFA 4F9LC 3BKYL 2VLJD 4G42A 4LQFH 4OZGF 1K2DB 1WEJL 5EZIL 1R3HA 1MCOL 3FB6A 3NGBC 2DQGL 3MGAA 2ADJB 4UBDC 2JF1A 1QSEA 5KSBB 1QSFE 3F58H 4QOKE 5I1LB 5C09B 4XXCA 3GGWA 1GAFL 3EYVB 5GS1A 1BFVL 4JQIL 1ZWIB 4EI6A 4IIQB 1JZ8A 4L8BA 4X83A 2NY1D 4LLUA 5SX4I 5EO1A 1N5YL 3VFVB 4JDVB 5DZOA 2Q8BH 4YIQB 2G60L 5DHXB 5CZXC 1KELH 5H35A 2HLFD 2OI9B 5BXFB 4G6FD 2C3VB 4P5TD 1MI5B 1BLNA 1YPZF 5I6XC 4P2OD 2DIBA 5DD6A 3O3BA 3IDJA 4WTWA 3MNVA 3RY4A 5IMMB 3VGAB 2QSTA 4C83B 1OWRM 2DWDA 1CLZL 1OAYL 3GBNH 3WDHA 4PG9B 1S78C 3ARBB 3MJ8B 3FO9A 1V05A 3ZLQC 4R6UA 4PJFE 1ZVSA 4HFUH 4PRHE 3NIDF 2VC2L 4QRPD 5E2VL 3X3GL 3KPMA 3OHXA 3Q2CA 4KJYA 2XZCL 5DO2D 4HWNA 3VFUB 3ULVD 3HR5B 4M48H 1J8HE 3K2MC 4GKZA 5DI8A 5JA8B 4NNPL 3PE9A 4YDLC 3X12A 1AGBA 4JFOA 4Y5YB 3VXQB 4CVUA 3QUXD 3TN0D 2VZOA 1TPXC 4GW4B 2XNAB 2ZKHH 3VGFA 2R15A 1KN2H 3O8XC 1RHFA 4BA8A 4E5XB 3U9UB 1RUKL 4AMKL 4CBPA 1CD9B 1DQLL 2OJEB 3HZVB 2X2YA 4JRXE 4KROC 1TCRB 4DGIH 3D0VA 1OTUD 2CK2A 1UCBH 2GFBB 3DYPA 4LQ1A 1IQWL 5I9QB 5AYUL 4OBRA 1RZJL 1PG7H 5FA3B 1KXVC 4KK9C 1OW0A 4MNQE 1PW3A 1MRDH 1QFPA 5ICZA 4DGVH 1A9EB 1DLHA 5HYJD 4QHUA 4GXUN 2AJ3B 4P2QE 2IPKB 5E9DD 3ZDYE 4G8EB 4FQ2L 4U6YB 3NAAH 2WUBH 3VE0B 2GJ6D 2ADIB 4KK5C 2LABA 1UWXK 4WJ5A 4TPRL 3KPSD 1BMGA 1IGFH 1A4KB 3QEUA 2VDQH 4NO0A 2XPGB 3OKOB 5HYSA 2NY3B 4MS8D 1MFAL 4R3SB 1NFIA 4Y4FC 1EDQA 4XNYL 3DV4B 3LVEA 3Q6GH 3JWOL 1JPTH 1OAQL 3P3YA 5EC1B 4U1GC 3MLRH 4OD2A 3LH2H 2J12B 1RAMA 4E41E 4G7VL 3QWRA 4X6DB 2ZUVA 5DQDL 3VXSE 4ZS7H 5DHYB 4G9DA 5LXGH 5A1AA 43C9B 4L4VB 5F7DB 4RX4D 4PTUB 2VABA 2V9QA 2AEPL 3AM8C 1JE6A 3I6GB 3PP3K 4NGHL 4ZDHB 3GRWL 3U36A 4X9BA 3NCMA 3LEYL 4YDIH 4U6XA 3VI4E 1P1ZA 3TA3A 2EDKA 4J1UA 1DBAH 1OGTB 5E5RB 1IAOA 3ARZA 4Z7UB 4PJEF 4Y4HA 5F89B 1EFQA 3TGXA 4PJDA 1LD9A 3HB3D 4OM1L 1JZ7A 1XR9B 3HUJF 2X9XA 3ECBB 1R0AL 2CRMA 4MCZA 2AV7A 4HS3B 2HVKB 3HCVB 2P45B 3GIVB 2ZJSL 5FM5M 1MREL 1EEZA 4S1SL 2XI9A 4Z78A 1K3IA 2AJSH 4L8DB 5A2LH 4MB4A 1R6VA 1V3JA 5IMOA 1A22B 1A6ZB 1DBMH 2E7LA 3VXME 1F4XL 3O3AB 2BHUA 2CRYA 4X99B 4M6NL 1ZANH 3KPLA 5DDHB 3JWNC 1NSNH 3EYSH 3IVKA 1T6VN 1RUPL 2J8UA 1DE4A 2YUWA 3KPNB 4UBDD 5DZLA 2XA8H 4C56E 1I7ZA 4L5FL 5JO5A 2RR3A 3CVHL 1QRNB 4CUCA 1S7XA 1IKFL 3LCYA 4JFED 3QUMA 4RAUA 3QJHA 1QUNA 4LLYA 1LNUA 5IBUB 1T22B 5C08E 1FIGH 4ODUA 1XZ0B 4PJGA 1LP9F 1AGDA 4XC3L 1PQZB 1HKFA 4X8JA 4D0BB 1TETH 2LVEA 2AJZA 3IJSB 1WBYB 3DXAE 5B22A 1NLBH 1QA9A 3AS3A 5CZXD 2MCPL 3QAZB 3QJFB 4LP5A 3RPIA 3SPVA 4JQXA 3H3PH 2EDEA 1AO7D 1LK3L 3R1GL 4BKLA 1VB9A 1INQB 1WAAA 2SEBB 3KXFA 1N5AB 4OZHF 1FJ1A 1F00I 1A7QH 5EU3B 1ZHKA 4F80A 3I6KB 4TNVK 4QF1B 5C0AE 5HGBB 3ULVL 2Z92B 2NTFB 5J7CC 5I8EB 3NIFF 4WV1A 3CFBA 2DTML 4GO6B 1S78D 2EIZB 4PJBE 1A0QH 4HIIB 3WFDH 3GDBA 5F1IA 4D0DA 1WCBA 4DN4L 5IVXB 4WNQB 3VDBA 4NM8H 1H3XA 4NO5B 1NMBH 4Z9KB 4HCRL 1NBVL 4FABH 2PTTA 2V17L 4ODTL 1F11A 5C2BL 3S96B 5HI3C 4Z76A 4X6BA 3C2AH 4CGTA 1E6OH 2AI0L 2R0KH 1F4HA 1ITBB 2IPUK 1S7TB 4HULB 5BW7A 3O8XD 3OKMA 3HI6L 2X4RB 3S34L 3MA9H 3QPQC 4PGZA 2DQFA 2ADGB 3QXAA 3MV7E 1I8IB 4Y16B 4Y1AD 5MP6L 1RJLA 1YNLH 2F5BH 1QVOB 4YH6A 5I1CL 1XGQB 5K33A 3MZTA 1N59B 4U2ZA 1HSBA 4YR6A 1T80A 1XCQB 3IB4A 4R97C 2R0ZH 2NW2A 3LKRB 4K7PX 2DQIH 4KK9D 4YZFF 2Q8AH 3MRHA 1JBJA 4JO3L 5GSVB 2ENYA 2X70B 3THMH 4MXWH 2CJUL 3RUGF 2JB6A 3D85B 4FMKA 5EULV 3ZL4H 1UWEH 3K3QA 2RHEA 4JO1L 4KK5D 3DYOA 3PL6C 4NRXA 3DVNB 4PIRF 2F53A 4TVSa 3QEHA 4PJIF 4PGBB 1FNEB 2D0HA 3B83A 3GMOB 2Y1VA 2DI9A 1FYTB 3QI9C 4NDMB 4IRZL 4K2UL 5IJVA 4TSAL 1UJ3C 3DWTA 3BPOB 4R4FL 1BIIA 1FFOA 4FQJL 4K3HA 4PRPA 4UIKL 4X6EB 1KYOK 2GITB 2WQ8A 1DJSA 2VB5A 1KTLB 4U1NA 2IADB 1JGUL 1AQKH 4KRPC 4K3EH 4OF8A 5D5MB 4X9FA 1I7UA 4ZD3H 4KC3B 1JFQH 5FK9B 2OZ4H 2DQDH 5FYLH 2APFA 1IAKB 1NGWB 3PIQA 3H3BC 1K8DB 2VLJE 2BRRL 3G6DL 5T1DL 5B8CA 1NGZB 1JZ3A 5L9DL 1GGIH 3OPZH 4GOSA 4NN6C 3D18B 3E3QC 1QLEL 5FM8A 1KUMA 1NC4A 4WO4C 1T89A 2XICA 4PREB 4MZ2A 1J0YA 4KK8C 4ODWB 4WTZG 2O93L 4IM8A 1PZUB 2O5ZL 1QO3B 5FYKD 3KPOB 5FUCE 4FXKA 1PZ5A 4S2SB 1IM9D 2APVA 3S35L 1HHHB 4OQ1A 3CSPA 5EU6E 3QFJE 3V0WH 4BUGA 4LVNC 1NEZA 4Z7WE 1U8IA 5CBAB 1NGYA 5CSBA 3WLWC 3UCRA 1RJYB 3I75A 2AK1H 2ADFL 3L9RB 5L2KB 5F93C 1DUYA 1J87A 4XVUD 2CMRL 3FZUC 3VXNB 2QBWA 5C0FA 4ZNEE 3LSOB 4JFFA 4PJHF 2GQHA 2A77H 4ZXBA 2PO6D 4LARH 3OJDA 3VFTA 4DFIA 2VUYA 4PTTA 5A3ID 1XIWA 2ICWI 2P5EA 4PS4L 3NFNA 3TT1H 2OR9L 3RU8L 3T0EE 5JPNB 4H1LB 4NWTL 3V52L 2XZZA 3CXHJ 3DX8B 1X5JA 3S6CA 1RUAH 4H8WC 4RGNE 1T83A 3L1OH 2FIKA 2L0DA 1NDGA 4JY5L 4UT9L 2V7NB 2N7BA 1EHLL 5IEKB 2APBA 4P4KC 3L7FB 4C55A 1YUHA 3QUZC 2MPAL 4RISH 5CCKH 1CE1L 4MHHG 3RZCA 5JNYB 1KN4H 3N1PC 1ETZA 2HG5A 5D7IE 3RJQB 3SQOL 2OLDA 4RGMC 1N6VA 2VUOA 1J05A 3FO1B 3LRGA 3S8WA 4B7LA 4U1KB 2Y23A 5ACZA 4GXVL 2APWA 4RZCA 3O9WA 4JFDD 4OB5H 3VRJB 3SEPA 4X98A 2VDLH 1K4CA 3EDKA 4Y4KA 4ZPVB 4WI4A 4XPTL 2XKUA 5E9DE 4DN3L 4RA3A 5DS8A 2GJ6E 1KTDA 3JVGA 4Q6IA 2BVQB 3MRRB 2AXGA 1KSRA 3MREB 4F7CA 1JUFA 3BZ4A 5GGVY 1KIPB 4OLVH 1UB5B 1ZOXA 5T1LD 4MJ6B 3FO2A 2PF6A 5D1ZC 3CSYB 3W11C 2ZP0T 5HI3D 3CMGA 1R24B 4MJIE 4HFWB 1L7TL 4PYHA 2IH1A 4UOJA 1LK2B 4GUPB 4F33A 1DLFL 1LO5A 4EDWL 3WUWG 4MA1C 4PLJC 4NZRH 5AWNL 3UPAA 4JO4H 5TH2B 5D7LB 3QPQD 1W0WB 3NCYS 3N1FC 3CH1A 3QIUC 3R8QA 4FP8H 4QYOB 3UTSD 1MHPL 3VJ6A 1QFWL 4D8PA 4JREB 2P8LA 1ZGLA 3J7HA 3VXRE 4AEIL 1QR1B 4KRMB 1SYVB 3OKKA 3QO0A 1P4LA 1YEDA 3WFCH 3PL6D 3DYMA 4ZOAA 2K1MA 1UXWB 1GC1H 3VD5A 4NKOB 3RTQC 2IPTL 2Y72A 5I1GL 1MCQA 4QTHA 3LHPH 1C5DB 5ITFA 5DK2B 3QI9D 4IMKC 1TTUA 1ORSA 4KV5F 3F7PC 1RIVL 2I24N 1QZ1A 2W9EH 4JDZB 1NCAL 5BZDA 2WBJB 1YNKH 1DFBH 4KRPD 4MB5A 4XMKL 5I8CA 5IGXL 4N9GB 1DBBL 3OXRA 5C86A 1K6QL 3MUY1 2XWJA 2KQNA 3OTTA 1S7VB 5F8RC 2DJUA 5DJXB 4PGCA 4YBHA 2AABL 5FYKL 3VRIB 1QSFB 3U7WL 4BH7A 4QOKB 5CJXA 4MJ5A 1AXTL 3KGRA 4UOW1 1MFBH 4J4PD 3R4DA 1SJXA 4Y5VA 1UZ6F 4CDHA 4OCSH 5K59F 3B9KB 5DC4B 3RAJL 4XBEL 2EKSB 1VEMA 2I60L 3HS0A 4KK8D 1HILA 4QTIL 4TOYL 1NFDE 3BH8B 1XGRB 2O26U 3V5HA 2R69H 2EE9A 5IFHH 3MJ6A 4XB7A 3INUH 5IR1A 4Z7VF 5JDSB 1B2WH 4RFNC 5J6HB 1HHIB 2IAMD 2YKLH 4L9LC 1TDQA 5EOTB 3VG0H 3PXJA 4ISVB 4LDEB 4FHBD 3VFWB 1MFCH 1E4KC 2Z31C 1NC4D 4WW2A 3BD3A 4UILH 5HHNB 2JIXB 4EI5A 1I8KB 2ORBH 4EZMA 5CBEB 1MWAL 4X9GA 1CLOL 1GGCL 3FZUD 3MBEA 3MV11 4PJFB 5MEQA 3O11B 4PRHB 1WIUA 2M26A 2B1HL 1ZAGA 3MRPA 4KJQC 5DYOB 1G9NH 5D6CB 5C6TL 4YJZL 1UQSA 2GTWA 1J8HB 3PJSA 5I1KL 4KUZH 1T66C 4KMTL 4Q97A 4HIHA 2O5YH 2V6HA 4TUOA 1WT5A 4KUCF 1KCKA 4JFFD 4PLKC 4YDJB 1BQSA 1UEYA 4OZGA 3IS0X 4HD9A 4LCCA 3QO1B 3MLXL 1CGSL 1XF2A 4OCRH 3KG5A 5IW1B 5I30H 1BM3H 4EKXA 1FNGB 5DD1H 2F74B 3FN0L 2E5EA 4HK3J 3V4PH 3IYLW 4X5XB 5EIVA 1LEKA 4G43A 4MNQB 5DK0A 4LLQA 3QEQE 1NJ9B 4L4TA 5DJ0A 5E94B 4P2QB 2J2ZA 4X6CE 2QSVA 1EFXA 5H94B 5K9KA 2VDRH 3EO0B 3BIBX 1ZHLB 3O3EA 1HCFX 1RK1B 4LNRB 5M7QA 3STBA 3S36L 5HVFB 3TESA 1YPZA 4KI1A 2DTSA 4FOMA 4WFHD 1F8TL 2H3NB 2X41A 2YEZA 3BE1L 3O3UN 4HZLA 1NMCC 1FH5H 1F3DJ 3BPLC 3UJTL 1AHWC 1FO0H 2WBKA 1VEOA 1AFVL 1K85A 5MERA 4OGXL 3VWKA 1BQLL 2OR7A 1QBML 3W11D 3IFLL 4LOUC 4EBQH 1A6UL 2UZYB 2ATPA 5HJ3B 3B8SA 2D31A 4LSUH 3CFIC 2G9HA 2O61A 4E41B 4IBLT 3C8HA 4N8PA 4XMPL 5ACMA 4PLJD 1J5OH 3KJ4C 4NWUH 3VXSB 3HC4H 3I02A 4O02H 4X8XA 4O2EA 5HVGB 2E8ZA 5DA4A 4P23B 4Q2ZB 3FL7A 3CK0L 1MCBA 4OF3A 3GO1L 3NTCH 3PABB 3ARGC 2EDWA 1TZIA 4OCWH 4M8QA 1B0RB 1M71A 4HWBL 4M7ZB 4HGKC 1Y6MR 3NABL 3RDTC 2CD0A 1XF5A 4BFIA 4OGYH 4A6YL 1K4DB 4UAOB 1CL7H 1GHFH 3V5KA 1KB5L 4CVXB 4ZUUA 4L3AA 2NY2C 4WY7H 5CINH 4HUNB 4WWKC 4TYUA 5FYKE 4NN5C 4OTXL 4QY8B 3RWCB 3SGDI 4G8FA 2GAZA 1MY5A 2YA2A 5SWZA 3HMWH 3VXMB 4CADA 5GJTL 1RZIB 4U1JA 5FECB 3QQ3A 2J6EL 3KPTA 1ZHBA 4KHXL 3O41A 2Z35B 1MAML 2XG4A 4TVPD 5KBNC 1OSZA 4OFDA 4R0LC 5DJ8A 4YHLH 3GSXB 1MY7A 2FJGB 1KNOA 2BSSA 1GGYA 4S1QH 3AS1A 3OKLA 5E99H 1I1FA 1J0JA 3WXVL 5GRUH 4RFEB 3UROR 4C56B 1IGCL 5C0GB 1KB9K 1CDGA 1CLYL 3F6IA 1GPOL 4OCNC 4POZD 1MHEA 4QHMA 2Y5EA 3M8OH 1RVFH 4NQXA 5KAQG 2ICWB 4KJPD 1YEKH 2HT4D 4YEEA 5T3XH 4GG6E 5C08B 4PRNB 1YMHB 5DVOA 2JJVA 4AIZA 2AJUH 2UWEF 3DXAB 1OSPH 1OAUL 3CCHA 2V5MA 4FG6D 4QCIA 4DAGH 3DX9B 4JFPA 4N0YH 1UB6A 2VXSH 4OCMC 5JUEL 2YN3A 1P4BH 5J3HC 1RIHL 4TRPL 5JHDD 3IDYC 4G5ZH 1G7LB 2UZIH 2F8OA 3EYQC 1JHTB 2LTQC 2Z31D 3GSOB 3SKUD 1IARB 4PJEA 4UTBH 1IVLA 2BP3A 1VSCA 4EOWH 1A6VL 1OPGL 2V7HB 3HUJA 5ANME 5IG7B 4H8WL 3V6OE 4LRIA 1W0VA 5F3HA 4PJCE 1RUMH 5ISZD 5FKAB 3SDXF 1JNNL 4HKXA 3WFBH 4TSBL 4KJQD 1QFUH 2H2PD 3PP4H 1Q94B 2A6IB 3OR6A 5IJKA 5LGHL 2G2RA 4WTZA 3TPUA 1QLFA 3U46A 2NY4D 1QNZH 2R2EB 3MBXH 1G7MA 4XGZA 3NA9L 2GTZA 4FFWC 4PLKD 2DDQH 4ELKA 2EIEA 2D7TL 4XBGB 3GSUB 2FSEA 1OAZH 1BFTA 1I3RA 2QKIA 2AJXH 4R7NA 5AG9A 2DLTA 5T1KB 5JOEA 3B9DA 1FV1A 4GLRH 2Q1EA 3JBG7 4WDIA 5E6ZA 1JWMB 3MV7B 2CLRB 2EDJA 2X4OA 2Q3AA 1IL1A 3O3DA 3VG9C 1YQVL 1LWRA 1FL5A 1JNLH 4OM0L 4XXDA 3G6AB 2V2WB 1UM5H 4TULL 5ALCH 5BVJA 1SHMA 2Z8VC 1LP9A 5E2WL 5TF1H 1S8DA 4NCDA 4C58B 2Z8WC 4L8CB 1NC2B 4I0PA 2L4OA 3U4BH 3M1BA 3EYFA 4NKIH 2PN5A 5KSBF 1RJZB 1NANH 4JO2H 3G5XA 2OSLB 4OZHA 4TQEL 4OLZH 1IEAA 3BEVB 4QRRA 2X4NA 3RL2A 3L7EB 4ZODA 3W0WA 3HG1B 5C0NC 5C2UB 2FB4H 3VGDA 3WO4C 5T33L 3JWDH 2HRLA 1CGYA 4HH9A 1ZGLP 1YECL 3O81A 3Q3GB 1QLRB 1CXEA 43CAA 2D7NA 2X40A 4JM2F 1T1ZA 1NMAH 4LOUD 3DVGB 2X9YA 3BWAB 1RZKC 3LKQB 2Z0BA 1XF1A 4DGYH 5BJTB 1P4IH 4ERSL 5KS9E 3OB0H 5FO7A 4LSSH 4XCEA 2GJZB 2VLJB 5IW6A 4M00A 4R26H 4LHUG 1JWUB 4Y19D 5A40E 4J2XA 3HAEG 2DWEA 4IOSD 2AVGA 4YFDB 3HAEH 3FOLB 3ARGD 3DIFB 2J7LA 1FLRL 2JCCA 2CUIA 2ITDA 3CFEB 3E3QE 2XOTA 4LIQL 1KCSL 5EN2B 3MODL 4CMHB 4S11A 1KPVB 1U3HA 3A6CH 1CQYA 3ZTNH 2NY2D 5EU6B 3QFJB 3RWJB 4TVPL 4WWKD 4Z7WB 3OF6A 1FPTL 5D7KE 3PWPD 4HXBH 3LN5B 3CVHB 1HCVA 1M7DA 2XWTB 3REWA 2OX5A 1YEFL 3BT2H 2H9GB 5KSVB 5DD0H 2PW2A 3DARA 3WUWA 1AGEA 1L7IL 4K7PY 4HJGA 3AY4C 4UNTA 4KMQA 4R4NC 2BNQA 1A1OA 3E0GA 4Z0XA 4G6KL 1D5XA 2W60A 2B4CH 2VQ1A 2J3SA 3VFMB 1KV3A 4PJIA 2VWEC 2BNUB 4YHYB 2EXYC 2OP4L 5D8JL 4XVSL 4Q9QL 5M94B 1DQDL 4PRIA 3U4EB 4XCNA 4JHZA 3T0EB 3OKYA 1A6WL 2YSSB 5TDNB 4O51B 4ZOEA 2BSTB 3ULUC 5CWSB 4RGNB 3LEXB 1ED3B 3DPBA 5GGSA 5EWIL 3DX7B 4M6OH 4DEPC 4N8CL 2E9WA 3QUXB 3TN0B 3V6FB 3AU1A 2EE3A 2NY7L 4NQCA 1D9KA 3QNZB 3TBWA 4KDVA 1FRGH 1S9VA 4G8IB 3H7BA 4EN3B 4UIMB 2Q6WB 3HE7A 4O2FA 5J3HD 4LCWA 5CGMA 3K4AA 5D7IB 4HDIB 3QDAA 4LSTH 3AC0A 2VXVL 3QCVH 3SKOA 4KKCD 1A14H 3HKFA 2I9TA 4NQTA 4X6DF 1EBAA 3OAYH 4FQHA 4ODXB 3WFHB 4MA3A 1NKOA 3GSNH 5KZCD 1IM3B 1AR1C 3GJFH 5E8DH 5E9DB 1W8OA 1R3IH 1CXIA 1EO7A 1X5XA 2GJ6B 5BO1H 3MLWL 1U92B 4LVEA 5T1MB 4LKCA 3VGEA 1NGPL 4NQDD 4YHNB 4Z7UF 3KNBB 5JLZA 2DQUL 1KXQE 2E9JA 3FT3B 1WGOA 5GGRB 3ARYA 4DZ8A 3UDWA 4OBSA 3HN3A 5JW4R 1NAMH 1W2KT 4Q9RL 4MJIB 4PJHA 1I1AA 3PHOB 4ORGA 5IHZB 4ZTPH 5ILTL 3EO9L 2CK0H 5GRJL 3GI8L 3AXLB 3ETBF 2HKHH 2P8MB 5EU5B 2IAND 2RCSH 3QG6A 2P5WD 2P42B 2EDDA 3A67L 4PB9H 3AMLA 5LVEA 1KENH 4OAWA 2XV6B 1GXEA 5FXCH 2IQ9H 3CXDL 2WQRA 1ZTXL 8CGTA 2VDOH 4R8WH 4WUUA 2DM4A 1VEPA 4OT1H 4HX1B 3VXRB 3UJIH 1FSKC 5KVGL 1VPOH 5I1IL 1FGVL 2H6PB 3T77B 3WE6A 3KPRA 4XXCC 3MR9B 3P4MB 4QXTA 1MQKH 3IXTB 1I1RA 5DRNA 3C8KB 4GBXB 1ORQA 4C4KT 1KLFA 3FQNA 3HR6A 3L5XH 4MA8H 1LE9B 5DJDB 3WD5L 3QUYC 2CIKB 4RMTA 4HT1H 5HHQA 3OG4B 5CEYA 1HH9A 3MRFA 1JJUA 1Q0XL 4BH8A 1YYML 1MFDL 5HHMD 2M1KA 2CO7B 1EH9A 1VHPA 3AROA 5I8KL 4QRRD 3LKPA 3W0WD 4TVPE 3EIFA 4PG2A 3G5ZB 4ODSH 2BVYA 2EYRB 3GMQA 4RDQG 1KCVL 3CXHK 4G80B 3NGBB 3RNKB 3RP1A 3SE9L 1CIUA 2HWZL 4JQVA 3UJJH 4DKAA 3JZ7A 1WF5A 2CDGB 3WNKA 4I18C 3RFZC 3D6GA 2ZSWA 3ET9F 4ODVH 1SBBA 4AT6B 5DHVA 3LQZA 3WS6A 5JQ6L 1NFDB 4PB0H 2UVEA 1KEML 4JFQA 2HFFB 4TNVF 3TNNB 1CR9L 1FG2A 5JORB 5IVXF 4QHLA 5C0JB 4RFOL 2BRQA 1KG0B 1BGXH 4DKFL 4LASH 1K8IB 4R7DA 2GI7A 4XWGL 1F90L 2ZUXA 3AAZA 1Z2KA 5CEZE 5IKCA 3QA3B 1OT1A 3PHSA 3NPZB 3WLBB 3WEXA 3E6HB 5E8PA 2E27H 4K23H 2EDNA 2MSPA 4FQLH 5I17A 3D25A 3IDIA 5FV1L 4K94L 3V6BR 1XGPB 1K5NA 5I1AA 4AL8H 3CVIL 4BZ1L 2VXUH 2PNDA 2EXYD 1INDH 3P73B 3WSQL 3PV6A 2QADC 4NC2B 5DFTA 32C2A 2APTA 2MNUA 4NQSA 4PRBA 4WHTA 4L3EA 5FYJU 3ARFC 3X17A 4YE4H 3LQAH 3ULUD 2LU3A 3F12A 2DOCA 1S9XB 2HJLA 1UWXH 4YDLB 4LGRB 4NN7C 3BISA 4W68A 1VFMA 4ZO9A 5B3JF 4K8RD 2EDXA 3O8XB 3G08A 1ZHNB 2VAAA 1BVKA 1ERNA 1N4XH 4YWGL 3PDGA 5C0CA 1FAIH 4MD0A 1RULL 2ED9A 4P3DA 4KROB 1MHCB 4NO3A 1Q9WB 3E8UH 4XT1C 3STZA 4JGUA 4P3CH 1FVCA 3BDXA 3MLYH 5D5MF 4M9OA 3QEQB 2DJSA 3N1GC 1EGJL 4X6CB 4ZPTA 2VJXA 3BWUC 3U9PH 1A2YA 1D9KD 3TIEB 5DEFA 1PSKL 4FQXA 4AG4L 1AR1D 4GG8A 2ZCKL 1KLUA 1BJ1H 1JN6A 4HUVA 5IHLB 2IBZX 2ZSVA 1TZHA 4YHKL 3TA3C 2OJZH 4HJJH 3CDGB 4GAYA 4V1DD 5E2JA 5E8OA 5BVPL 1GGTA 3QEGL 4UB0L 3MGOB 3T08A 4Q58C 2J4WH 1GGBH 1V7MH 4H25A 3QDGE 2WIIA 4P59H 3FQUA 4Y4FB 4KU1A 3MACH 5F7NC 3GKWH 4DW2H 3TF7C 5ITBL 5LBSL 2EEDA 3UTTA 4KJWD 4XPGH 1I3UA 4U1MA 2RIKA 3L3OA 3JV4B 3I3EA 3K74B 3MNZA 4U1GB 3B9VA 2E7LC 4ELMA 3CLEL 4P46A 3JUYA 1XR8A 4LSRL 3DRQB 3JTSA 3PDDA 1UM6L 2HAZA 3LRHA 4G9FA 2DI8A 4Y19E 1HI6A 4OZFG 4OZFH 4XX1E 4B53A 2IC2A 3P9MA 2HA1A 3MOAH 3UTZB 3W2DH 4P4RA 3MRQB 1BEYL 2B2XL 4WEMB 3SGJC 3CU1A 1IEHA 2XT1B 5D7SH 2F9BT 4UDTB 1T5XB 3VD4A 3MRMB 3NCCB 3T8XA 4ODHL 4DVRL 5B4MD 4ALAL 3QQ9C 2O5XH 5GGQL 5JIKA 3F65A 4OZIA 1PY9A 1NCWL 4OFYA 4LEOB 4NQEE 1UWGL 1II4E 1LEGA 3FQWB 2ITCB 4HS6A 4OFIA 5SWSE 1I1YA 4PV8A 3WIHH 1PKQE 1R3JB 4QWWC 5J0BA 4UQ2B 4EIZC 3FQTA 3RVWC 2DICA 1MRFH 4XPFL 1HDMA 3MMEB 4N0UE 5HPMB 5JXAL 4YXLL 2YD6A 1ZSDA 4JZNA 1CGWA 1U36A 5IVZB 4YHIA 2PCPA 4JY4A 1OLLA 5FO8A 2FBJH 4Y2DA 3U0TB 2YC1A 3ZDXF 5FHBL 4GG6B 3L3JB 3PQYA 3DO7B 2YD7A 1MWAB 1KEGH 3MLUL 3ALXA 2D7PA 3BHBB 1MCPH 5DF0A 4XZUB 4FA8A 5FOJA 1T20A 5TJWK 5K9JL 4OLUL 1S9WB 1MCLA 3MROB 1BZ7B 3UBXI 5BW7C 4LCIL 1RSFA 5L88H 2VAJA 2IPUG 4NSKB 2NYYD 5HGHB 5CJQH 1A7RH 2YD3A 3C9NA 1AP2B 3P0YH 4LHUA 4R96B 3MO1A 5ANMB 2FHFA 3ULUL 1JPFA 1RJCA 2IQAB 4PJCB 2Z91A 5FCUH 4DK3A 1F45A 1MUJA 4GFTB 2V9TA 1S5IL 4P5MB 4PBVC 4K71C 2QADD 4WUKH 4K8RL 3ZE1F 1JGDB 4R2GC 2V2XA 3ARFD 4KQ3L 5ETUB 4NQDE 3F5WB 1G1CA 5TQ0H 1KULA 1BF8A 2FWOB 5T1LB 5BV7C 1MRCH 3V2AR 5FB8A 1VKXB 4MCYA 4JVWA 3T2QA 5KTEH 1N3NA 1ZT1B 4RIRB 4NT6B 4M5ZH 3BP5B 3CMOL 1HHJA 1MFEH 4O58H 1F58L 1J1XH 3D9AL 5DUML 4GRMA 4HMDA 1JCKA 3VGGA 3S37L 4XPBH 3T0XA 1I9IH 2LU7A 1TNNA 5D71L 4X6FA 1IGTB 2XZQL 5IESL 5L0QC 5TPWH 2P44B 5D1XA 4QXGL 2BXYA 1IEBB 3DTXB 4KTEL 4R97B 2QEJA 1I85A 3MLZL 4NC1C 2NXZC 2BOCB 3PDOA 4M1DL 2ARJA 1N6UA 1NUFA 3HI5L 3MFFB 2ICEA 4Z0BH 4JKPH 5IBTL 5SX4H 4KXZI 4OFKA 1EXUB 3WDIA 3PL6B 2HJKA 2VLKA 4NZTL 5HDLA 3MLSH 1CE6A 5JDJA 1GRWA 1WBZB 4E42B 5CLTA 1Y0LA 3SDCA 1JTOA 3QI9B 4WU5B 2JK5A 1H9VA 2GCYA 3GMLB 3WJJA 1UJ3B 3BZFA 5DRWA 4G6ML 3FKUS 5KS9B 3SDXA 1KB5B 4MD5B 3SDDC 1FQ9C 4KRPB 3HMXH 3TBYB 5HHME 4ONHA 1CBVH 3O6ML 5HXMA 4KFZC 4XP6H 5BZWB 1Y18B 3TBTA 3U7YH 4OZ4A 4BM7A 3GSNA 1YJDC 3ALWA 1EJOH 4H1LG 1O7SA 5IHUH 4H1LH 1SM3H 3IFNH 3LS4H 5GHWL 1DEEB 5FDWB 5C70A 1HOCA 4PJFF 1OAXH 4NN6B 4PY7B 2G5BB 5TFSH 1W72H 2R56L 1ULVA 5TF0A 4F58H 4WO4B 3T3ME 4X7SH 4CMMB 3VFRA 3P30L 4UINL 4NRZA 4P46D 1QEWB 2C3WA 3DJ9A 3TJHD 1UZ8B 1YMMD 1NAMA 3U6RB 4ETYA 1HHKA 1NQBA 1QQDB 4LVNB 1NL0L 2A1WL 2B0SH 2EEBA 4XVTL 4OCXH 4JVPA 1K2DA 3MLVL 4HXAH 4G8GD 5E70A 3EO1B 2ADJA 3AS0A 2X4PB 5KSBA 5HTSA 3SO5A 4Q0XH 5C09A 3NIGE 1ZWIA 3CC5B 3W9DB 2OCFD 3UXFA 1G6RH 1T1WB 2VWEE 4JG0H 5I15L 1CFQB 1D5IH 3VFVA 3ILPB 4OFYD 4JDVA 3ZDYF 4UOW0 3H42H 4PJ5A 2YBRB 1F4WH 4JM2A 4FXGB 2F54D 2P24B 3H0TB 3QUKB 4RRPG 5BXFA 2C3VA 3SN6N 1MI5A 3SY0B 1IBGH 1JIBA 2XKNA 3ULUE 4FZ8L 3DX6B 4NFBA 4LPXA 4IIQC 1LO0L 4LLVB 5F21B 5IMMA 2W65B 4WWID 4C83A 4FXLA 3Q1SL 1OGAD 3X13B 4P4KB 3SKMB 1O0VA 1TNMA 4PG9A 1E4JA 4DKDC 3QUZB 3GHEH 2Z4QB 3ARBA 3MJ8A 3WNOA 3VW3H 2AEIT 2A6DB 1U93B 2OI9C 1FFNA 4MAYA 2VLRE 3DECA 4RGMB 2Z8RA 5I19H 3JXAA 1G7QB 1BD2E 4JKWA 1VGEL 3VWJD 5FGCE 1TJIH 3VFUA 5EO9B 3HR5A 5L8LB 2D03H 3CX5K 4NRYB 5FHAL 3S88H 3LN4B 4LLDB 2XTLA 3VXQA 4F7PB 1LO4H 1YY9D 4HBCL 4Z7QE 4M5YH 2X89A 3RX5A 2DIAA 4V1DE 4FFVC 4E5XA 3U9UA 3HZVA 4NKMA 5FYJH 4D9LL 1TCRA 3RY6A 3AGVA 4GXUM 2GFBA 5D1ZB 4MDIB 3D87B 1HYRC 3P11L 4XNQA 1CFVH 3WFEL 5FA3A 4MA1B 1AXSB 4UT7H 1D6EB 1X7QA 2R2HB 1I9JH 3BEWA 4N0CD 2AJ3A 1A7NH 4U3CA 1G7JA 3GMRB 3QIUB 3GBLA 3O0RH 4G8EA 4IS6A 4U6YA 1Z9SA 1ZLVK 1I4FA 2ADIA 4H0GA 3QCTH 3PWLB 5DK3A 3O6LL 1YA5A 2X4UB 3EZ8A 1FC1A 4LSDA 5CJXC 3OKOA 1CDCA 2NXZD 2XPGA 4AEHH 1IAMA 5DJ2B 1J11A 4YQXH 5C1MB 2F5AL 4R3SA 3TO2B 5C8JB 3DV4A 4AY0A 1E6JL 1FZMB 2HTLC 5EC1A 1FE8L 5IB3B 3RTQB 4YDKL 2EZ0C 3OX8B 1A3LL 2G5RA 3KPQB 5F71A 4NZDA 3UZQA 3JV5A 5IK3B 3MXVH 4F7EB 2VDNL 5DJ6B 1WZ1H 5DHYA 1X6LA 4TTDC 5FDYA 1FVDB 4BK4A 3P0VH 5C6PB 1A6AA 4U1SB 4L4VA 5F7DA 4KZEH 3SDDD 2YN5A 1IGJB 1P6FA 4HPYL 2VLKD 3O4LD 3HZMB 1MNUL 1OGTA 2GT9B 3ZYIA 4IHOA 4J8RB 4Z7UA 1I3GL 4OSUH 5C0RL 3T0VA 2Z8SA 1XR9A 4I48B 5HHOA 2NPLX 3HCVA 3GIVA 1MCDA 3HNVL 5CLWA 3FOMA 1FNAA 3MSPA 1FDLL 5I8OL 3MV8E 1KOAA 4L8DA 5MEND 4JDTH 3WJLA 1WT5C 4LRNL 3OAUH 1RZ8B 1IT9H 3BXNB 4RFNB 1M7XA 2R1YA 3K2UL 3EGSB 2YPVH 3QDJE 4L9LB 1CF8H 1U8QB 4CU8A 5JHDB 5F44A 4HV8B 1P5UA 2VIRA 4RWHA 2LV4A 2XWBA 3BH9B 1YEHH 5B3NA 1NPUA 3UBXB 2Z31B 5FA4B 1MJJB 3VI3E 5GQBA 3GUTB 15C8H 1QRNA 3RKDD 4NJAL 2WV3A 3MRDB 4GRWH 1V3MA 4CAGA 3F62A 3V0VB 1T22A 3IU3A 3KR3H 2YPKB 1XZ0A 1HYSC 1HEZB 1PQZA 4NP4H 3IJSA 1TJGH 2R0LL 4CNIB 5TQ2L 1H3GA 3OSKA 1ZT4A 1MOEA 3KJ6H 2ZNXA 1DVFC 2EO1A 3HZYA 3WIFB 8FABB 1INQA 2QHRH 5IUSA 5EU4B 2SEBA 4Z6AT 1N5AA 4KI5C 3R8BB 3VCLA 3CFDA 4MVBD 2VDPL 3I6KA 4QF1A 2ZG2A 3VWKC 3PWUB 5JR1L 1P7QA 3RWEA 1PKOA 2UVFA 3BI9X 5LGJA 3G6JE 3WIIL 2Z92A 5L6YH 1JZ5A 2ZCHL 1GZQB 5GS2D 3PUCA 3UAJD 3SCMC 4L1HA 3AMKA 3B2VH 4WI8A 4F57H 2HRPH 2P1YA 1DEDA 5IVXA 4PJ8A 1I7RB 4WNQA 3TWCL 3QRGL 1BPVA 3BKYH 4NO5A 1Q9LB 1V3LA 1WEJH 5EZIH 1MCOH 4P5KA 2DQGH 5BV7L 2GSIB 3DHJA 2J5LC 4G6AC 3ARBD 2YUXA 3S96A 4IRJA 1P7KB 1D5BB 4WGWB 1ACYL 1GAFH 3E1F1 4JQIH 4NHCL 1NMCB 4PJDE 3QDGB 4KKAC 3BPLB 2BSRB 2ADGA 4CU7A 1AHWB 3ALPA 1I8IA 4Y16A 1JTPA 4Z18A 3TBVB 1N5YH 4Z7WF 2G60H 2QR0B 3LMJL 3SGEI 4JLRA 4AYFA 1XGQA 2B5IC 4DKEL 5GGTL 1O5DT 1XCQA 4P57B 5CD3B 2W0FB 3KJ4B 5GSVA 1A1NB 4LPYA 4XHJC 4P9HL 4WHYG 4WHYH 4KVCL 2AJYL 5E7BA 2R23B 3D85A 2OK0H 3TBSA 4Y19B 1WLHA 1CLZH 1OAYH 3C87A 1TVHB 4PGBA 4BSVB 4F2MB 5F7HA 3GMOA 1FYTA 4NDMA 3RDTB 3S3JA 4FFZL 1PDKA 2FX7L 2VC2H 5E2VH 4PUBL 4X6EA 5KSUA 3U30C 3X3GH 4NFDA 4ZO6A 4M1CD 2NY2B 1KTLA 2HTLD 2XZCH 1PLGL 5HGDB 4WWKB 2EZ0D 1LDSA 1MIML 1EEYB 1AY1L 4PJGE 5D5MA 2YK1L 2BVPB 4NN5B 4NNPH 4WI9A 4HUWB 5JPMB 4NQEB 4YXKL 1SEQL 4TTDD 1MEXL 5SWSB 3WMSA 1PKQB 1K8DA 2YWZA 2EH7L 4JR9L 4XPAL 1NGZA 1C08B 4LPVA 4H0HB 1AGFB 1WAAE 5D7IF 4N0UB 3D18A 3DSFL 1RUKH 1YYLL 4AMKH 2IBZY 1DQLH 4JM4L 1ACZA 1FL3B 4R0LB 1MCFA 3RWDB 2YR3A 4PREA 4HQQH 4XH2B 1IQWH 5AYUH 1QO3A 1RZJH 3PHQB 3KPOA 2ED8A 3GMPB 2XZAH 5KW9L 3OJ2C 1HHHA 1HZHL 4L4VD 4HAFA 3FO0H 1NCDL 4FQ2H 4OF0A 5IFJA 3P2TA 4HIXL 5FV2A 1RJYA 2OL3B 3O2VL 4PY8I 4TPRH 5GGVL 3BRGC 4JFYB 5L2KA 1PFCA 3VXNA 5DUPH 3LSOA 4QRSB 3IDYB 1OGAE 4ZOBA 1MFAH 3VH8B 2EDLA 4XNYH 1F6AB 2LTQB 3JWOH 5C7XL 1OAQH 5J1AB 1LILA 3TCLB 1VADA 5INDA 5JPNA 3DURB 4G7VH 4H1LA 5FYKU 1HXYB 1XF3B 5DQDH 5KZCB 2D9CA 3DX8A 5KOVC 5DLML 2WIMA 4FQ1H 4X80L 2AEPH 4NGHH 4YHZL 3GRWH 4IRSC 2PR4L 2FNBA 1UA6L 3LEYH 4MLIA 4OCYL 4NQDB 4LDOB 5IEKA 3L7FA 1DVFD 1A7OL 4MD4B 5IROA 4GKOA 3QZWG 4GRLB 3RGHA 1MLCB 3R06A 4KI5D 4OM1H 5JNYA 4YBLC 4BQ9A 2F53E 4MWFA 1TZGL 5I2IB 4U1KA 2ZJSH 1MREH 4D9RE 1NFKA 4S1SH 4PRPE 1BAFL 4LSQH 3PNWB 3VRJA 1F5WA 5E5MB 4QXUL 3MLPA 3VG9B 4ZPVA 5KSAC 1ZEAH 1F4XH 4UQ3B 1NCCH 3L6FB 3QNXB 2C7UB 3NACL 2FEEL 1WFUA 4S0SD 4M6NH 1UXSB 5DRXB 1G6RA 3ORJA 5AZ2L 1A4JA 2BVQA 4BSWB 1CGTA 1KPUB 1RUPH 2HFTA 5E08L 4EQ3A 1BQUA 1CGUA 4W6XB 3IRPX 5JXEA 4URTB 5D72L 1T7ZA 1KIPA 2XG5A 1UB5A 2DMCA 3OJVC 4MJ6A 1T0PB 4G6AD 4L5FH 3ZKND 4YC2C 5J6GA 5FO9A 3CVHH 5HI4D 4HFWA 4Y89A 4XNUL 5BS0A 2N7AA 1IKFH 4GUPA 1U3HC 1YEGL 1S9YA 3L5JA 5E00A 2VKWA 5D7LA 2MHAA 1G6VK 4KKAD 1W0WA 4XC3H 4I2XB 3S35X 3V4UL 3RIAK 4HGWB 2DKUA 4QYOA 2NY5C 2MCPH 2AW2A 5HHMB 4DGVL 4UU9B 1LK3H 3R1GH 5I71C 5JW3L 3IKCB 1BECA 4JPKL 4Q6YA 2YPLE 1B90A 5GS3A 1QR1A 4MQ7B 3T3PE 5EOCL 2FL5B 3BP4B 1SYVA 3O4LE 3CUPB 1ZLUK 2X1WL 2EO9A 1DANT 4Y16D 1M1SA 5T3ZD 1UXWA 2AAVA 3ULVH 4NKOA 5HYQB 5SV3A 3MRLB 4G6JL 2DTMH 4I0CC 5DK2A 5EOCJ 5LGKA 2FZ3B 1SEBB 3SDYL 2P5EE 1GC1C 2X9WA 4DN4H 3EAKA 4PBXA 3MLRL 1FHGA 3D85D 4JDZA 5GISL 5LJYH 3IDXL 2VLME 2CSPA 4N9GA 3B2UC 3UMTA 4HCRH 1NBVH 4MX7B 5LXGL 2V17H 1FGNL 3C6LB 4ODTH 5BQ7B 1DDHA 5C2BH 5DJXA 3HE7C 4NUJB 5DEGA 3WS3A 1JHKL 1QSFA 4KQ4L 4QOKA 1GGUA 1A02N 1L9MA 4WHDA 1T7WA 3HI6H 3S34H 2AJVL 3QSKB 5TDOB 4OQTL 4N8VB 2A83B 5IV2B 5CIPH 2EKSA 3BRDA 2BOBB 2JJTA 5MP6H 4DCQB 4N90D 4CU6A 5J89A 2GHWB 5GIRA 5I1CH 3BH8A 4X6CF 5KG9B 3MJ9A 5EORL 3RWGB 1U8KB 2HKFL 1T03L 2CDFB 5J6HA 1HHIA 4JO3H 2NCMA 4Y7MA 5EOTA 5FEBA 2VOTA 1CFBA 2CJUH 3KLAB 2LVCA 3VFWA 4JO1H 5CFHA 1KIQB 4CVZB 5L8JB 4DEPB 4RWYL 5GSRA 1SYSB 2NZ9C 2RJMA 5HHNA 4MA7L 2JIXA 3T2OA 3EYSL 5CBEA 4L8SC 4IRZH 4K2UH 1WFTA 5DD3L 1UYWL 2W0KA 3TZVC 5K9OA 4GMSH 4TSAH 4PJFA 4R4FH 1T5WB 3O11A 4FQJH 4UIKH 5EBGA 4ZFGL 2EIDA 3QDMD 5DT1L 2I07B 3RL1B 3ZE0E 1BD2B 1JGUH 5DYOA 1CD0A 5D6CA 5FGCB 1FIGL 1J8HA 4JN2A 4Y88A 1NCNA 1QYGL 1UGNA 1PEZA 1R5WB 5A2JH 5CKAA 2BRRH 3G6DH 5T1DH 2X7LB 1G9NC 5L9DH 3PWJA 3GK8L 3OGCA 4IRSD 4V1DB 1R5IB 1A5FL 1QLEH 3GB7B 4Y0GA 4OIAA 4D9QE 3QO1A 2YRZA 2BERA 1T3FB 2O5ZH 1FNGA 2F74A 1GZPB 2IALB 5CHNB 5ID0B 1RURL 4X5XA 4JRYA 3NZHL 3S35H 4HHAB 3MC0A 4MNQA 3HTLX 2FX8L 2CXKA 3SE3A 4KKBC 4P2QA 4ZS6C 4XCCL 3SE8H 5BOPA 2YD4A 3EO0A 3QXDB 4WFEE 3VXOB 1ZHLA 5E8NB 5L8KB 4LNRA 5D2LB 5M95B 2H2SD 1G84A 2CMRH 4YHML 4X7CC 1FSKB 1BX2B 2H3NA 4ZOCA 5JIHA 4GG6F 2DM7A 3GGWB 1RZFL 4Y5XC 4PS4H 2OR9H 3RU8H 5HJ3A 4L8BB 5FOBB 3V52H 5IMKB 4BUHA 5J9PA 3G04B 3QUYB 1R3KB 1KBGL 4P23A 4Q2ZA 1MIEL 4JY5H 5T3ZL 1ZT7B 4UT9H 1EHLH 5F7MC 2VDKL 4MNGE 3RGVC 1B0RA 2MPAH 3IDJB 2H1PL 7FABL 1UWEL 3MNVB 2UYLA 1EV2E 3BDYL 3EW3B 3SQOH 3WV0A 1K4DA 3HRPA 1R5VB 3MCKA 3U1SL 4CVXA 4PJCF 5DTFB 3ZYJA 3RWFB 4GXVH 3V79C 4Z95L 1DN2A 4H26A 4C59B 4I18B 3LEVL 3DMMC 1FN4B 2MCG1 4QY8A 3MV8B 3RWCA 4I13B 3R0NA 3DGCR 4XPTH 4KJYB 1CXKA 3VXMA 1CLCA 3FB7B 1RZIA 4GKZB 3X12B 3QDJB 2OTWB 2F19L 2BHYA 1AGBB 2WANA 1KCLA 2Z35A 3B2UD 2FECL 3B5GA 1CK0L 5HVWA 4EVNA 2R2BA 1KPRA 1RMFL 4HJ0D 1L7TH 5C0GA 1S3KL 4M3KB 1IFHH 1DLFH 4EDWH 3UYPA 5D4QA 5B38B 3JSSA 2ICWA 5C08A 1YMHA 2WBJD 4AIXA 4R90L 3C08L 1DSFL 3J8F7 1UJTA 2CKNA 4JFHE 4GKSB 1MHPH 2H26B 4S10A 4FQXC 1QFWH 2QADB 4L4TE 1KYOJ 3DX9A 2XA3A 2YWYA 2WP3T 1IAIH 5AUMB 4QOKD 5DUBB 4AEIH 5E6IA 3S36X 3ARFB 5IOPB 4WJ5B 1MH5A 4LAJH 2XIDA 1G7LA 2WLYA 3B9KD 2HTKC 1FBIL 2KH2B 1JHTA 3LKSB 3LQMA 4NO0B 2VZVA 3GSOA 4NN7B 4F8QA 4KI5E 5IB4A 5HYSB 2J8HA 2IPTH 5I1GH 3G6JB 4XTRD 4UNVA 5E56A 5TE7L 1YN7B 3TZVD 5IG7A 1RIVH 2QQLL 4PGEB 1Q1JL 1U6AL 1YQ2A 2VZTA 3ZHDA 3OBAA 3FCTB 5FKAA 5KS9F 3EYUL 1EEUA 4OD2B 3OG6B 4U1IB 4LCUB 1NCAH 1ZGLM 1KT2A 1Q94A 4WI3A 2A6IA 2A9NH 4XMKH 2FIRT 5IGXH 4G9DB 4F37K 1VDGA 1DBBH 3HC3L 4PR5B 3QIBA 1K6QH 4U2YA 3D3VD 1L9NA 3WKML 2R2EA 3U36B 1FAKT 5FYKH 2AABH 2QQKL 4M02A 3U7WH 4ENEC 1WC7B 1P1ZB 3TA3B 1AXTH 4JB9L 4XBGA 3DGGA 3GSUA 3QXTA 2JTDA 2ZZUT 2NXYC 4PRHD 3WXWL 4PJDB 5T1KA 3RAJH 1LD9B 4XBEH 2NR6C 1JRHL 3ZKQD 3MV7A 5LWYL 4TOYH 1N7ML 5ICXA 3VGBA 3OAZK 3MRKA 5E1HB 4XI5D 3TO4A 3G6AA 2V2WA 1BBDL 2IBGA 1N0XL 4NKQB 3QIWC 1GYAA 2QSQA 4PJXB 4JZJC 4FNLL 1QHOA 4K7PL 2EDTA 1URLA 5DMGC 3BN9C 1VCAA 4L8CA 1NC2A 3S98A 5SWZE 2HFGL 5D70L 3BESR 5GS0C 3UTOA 4JRXD 3KPLB 2OSLA 1MWAH 3BEVA 1DE4B 3BP7B 3HLAA 4OIIL 1CLOH 1GGCH 1T21B 3C60A 3L7EA 1P9MC 3HG1A 4Y2DC 4YDVB 2YA0A 5T3ZE 3D5OF 1IGML 4HIEB 3GRWA 4MNQD 5C0IB 3ZYOA 1I7ZB 5JO5B 2B1HH 1KCUL 3Q3GA 1QLRA 5TDPA 5J56B 3LS5L 5EDXA 1BF2A 2NY5L 3QJHB 5C6TH 2P8PB 1FFRA 3DVGA 1W0YT 3TYFB 4PJGB 5I1KH 1JGVL 5BJTA 1WJ3A 2ZOKB 4KMTH 3ESVF 4M3JA 3EFFA 1QA9B 5K93A 3D69A 2GJZA 2VLJA 3RPIB 3SPVB 1T2QL 5ESAA 1RY7B 3T0BA 1FJ1B 1Z5LB 5CP7A 4GW1B 3VFSB 1CT8B 3MLXH 3RGVD 3DIFA 5IVNA 1CGSH 1NUGA 2YD1A 3CD4A 1NAKL 1CFSB 1BVLB 2KZWA 3HNSL 4E41D 1FG9C 1GC1L 5FYLE 3VXSD 5EN2A 4XC1L 4U3XA 3CFBB 3TJEL 1B9ZA 3QFJA 4Z7WA 4D0DB 1IRAY 2VXTL 1H3PL 3N85L 1WCBB 3ES6B 5DVLA 3CVHA 1F3DH 1FZOB 3DMMD 4P5TA 3OL2A 2H9GA 5KSVA 4WEUD 3S36H 2X4SB 4TUJB 4P2OA 2JELL 4GQ9L 3IETB 1F8TH 4HAGA 1X5HA 3BE1H 1QBBA 1TQBC 3ZE2E 2VXQL 1OGAB 4Z76B 3UJTH 5DC9B 4WVRA 3VFMA 1AFVH 5B39G 4OGXH 1BQLH 1U8JB 2XY1A 1QBMH 3BZDA 3IFLH 1A6UH 4QRPA 2EYTB 4XMPH 4J3UA 1X5KA 2B4CC 3H7LA 3BUYB 3TLRA 3BKJL 3D2UB 3VD9A 2YSSA 4O51A 2JKXA 4OLWL 1SVCP 2BSTA 3TFKC 1HSBB 5BMFL 5GRVK 3CK0H 2NW2B 3GO1H 3DX7A 3MRHB 4NKDB 1U95B 1HIML 4K71B 3QUXA 3TN0A 3V6FA 1DCLA 3BOVA 2ID5A 1OTTC 3MJ9L 3QNZA 4HWBH 5HD8C 4C56D 2JB6B 3NABH 4G8IA 35C8L 4R2GB 4EN3A 4UIMA 2Q6WA 1U2HA 2VISB 1UG9A 1YEEL 3KYMB 4A6YH 5D7IA 4HDIA 2FEDC 2F53B 3LDBC 5JZ7C 3K46A 2HTKD 4F9PA 3P4NB 4HCRA 5BV7B 4DQOH 5IJVB 1OM3L 3DXAD 3C09B 5K9QG 1FORL 2VDML 5IB2A 1BIIB 2BCKA 4PRPB 4ODXA 3WFHA 1FNSL 1Q0YL 4J23A 2WNGA 5GJTH 1JI2A 5E9DA 2J6EH 5CIPA 2GJ6A 4KHXH 5EBWA 1MAMH 5L0QB 3KPSA 2O5YL 5C0AD 3KNBA 1B3JA 3WNLA 1JGLL 2NXZB 3FT3A 5GGRA 1IGCH 3O6FC 3H9SE 4HKJB 3C2SA 4ENED 1GPOH 1X5IA 5E2UL 5DMIL 5IMLB 5IHZA 2JCCE 1SMAA 1BFSA 1AD9A 1C8PA 3RKPA 3AXLA 3QHFL 4FXKB 1KTRL 5EZOH 1OAUH 3QQ4A 2AP2A 4FN0A 1S7QB 3PF2A 3QIWD 1NGYB 1HNGA 5JUEH 3UTQB 3WN5A 5F7UA 2HJFA 4RX4A 3SDDB 2WWKT 2YPLB 3VXRA 1RIHH 4TRPH 1VGKB 2XQYG 3O4LB 5HI5C 2H6PA 5GS0D 4DK6A 3T77A 1IC5L 4RNRB 2BNQE 1VESA 1JYWA 1EBPA 3IXTA 2Q3ZA 1QPXA 1Z3GL 4WHCA 1A6VH 1QD0A 4ZXBB 4H20L 2YHGA 4G3YL 4PTTB 4H8WH 5SX5K 5IFAL 1XIWB 5IVOA 4XRCB 4P2YA 1P2CB 3ARDC 1GIGL 4JAMB 5DJDA 1NC2D 4N1CA 4BJLA 2MTPA 5MENB 3BZEB 3L5WB 4GSDL 2R2CA 2R4SL 2X4QB 3NA9H 4GBXC 1NDGB 1Z0NA 2LQRA 4F9LA 2DQEL 5C9JA 2D7TH 3G5ZA 1H15B 2EYRA 4G80A 3GSVB 4OV5A 3RNKA 1OP5K 4LCWE 4MAYC 4HKBB 2PUQT 2CDGA 4MDJA 1MPAL 2AQ3A 1J05B 3N1QC 1J86A 4JFEA 1YQVH 4AT6A 2OQJB 4OM0H 4QT5B 2X10A 2HFFA 3TNNA 1G7IA 5I1HL 5JORA 2NNAA 4TULH 5C0JA 1KG0A 1YY8B 5E2WH 1K8IA 1UEMA 2RQ8A 5J4MA 1WIOA 5MHSE 3AB0C 5FUZL 2VMFA 3QA3A 4IDJL 1AO7A 3BP6B 3WLBA 4EUPG 5D9SB 4EUPH 5AD0A 2AXGB 4TQEH 4F7CB 5ADOL 4HC1A 1CDIA 2PTVA 3T2NL 1DL7L 1XGPA 3SGKC 3G9AB 3QFJD 5EBLB 5EU6D 4KK6D 4PJHE 4XNZC 2IH1B 3C5JB 4QGYA 3UP1A 3V4VL 1RVFL 4S1DC 3U0PA 2GSGB 3SBWC 4ERSH 3CH1B 4X7TA 3ZKSD 3ULSA 1UKTA 2Y5TB 3IJHB 4J6RL 2CH8A 3OXSB 1H5BC 3CFCL 3VJ6B 3DETD 3TH4T 4JPWL 2ERJC 3T4AB 3TFKD 1AQDA 3D3VE 1S9XA 2P8LB 1ZGLB 2XXCB 4AEEA 1M7IB 2DYPD 4AZ8A 4O00A 1OTTD 3EJYD 5HD8D 3LQAC 4YGVB 1P4LB 4W6WB 1ND0B 1FLRH 2BVOA 3O8XA 3KPRE 1ZHNA 4KKLC 2AXFB 2ICWJ 4XPHL 3T0ED 5H2BB 3L5IA 3HPLB 4LIQH 1KCSH 4WFFD 5JZ7D 2FEDD 3MODH 4XAWL 2C3XA 4QTHB 1Q9WA 4Y1AA 2YZ1A 1YNTB 4RGND 3SDAC 1KB9J 4LLWA 3TIDB 4X6CA 4MHHI 1JRHI 4P99A 1YEFH 1T2JA 4A2MA 4U0QB 1WCQA 5E0QA 1TQCC 4EN3D 4NZUL 2FYYB 2P