5JW4M

Structure of medi8852 fab fragment in complex with h5 ha
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
227
structure length
223
Chain Sequence
QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSYNAVWNWIRQSPSRGLEWLGRTYYRSGWYNDYAESVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARSGHITVFGVNVDAFDMWGQGTMVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Hemagglutinin
publication title Structure and Function Analysis of an Antibody Recognizing All Influenza A Subtypes.
pubmed doi rcsb
source organism Influenza a virus
total genus 46
structure length 223
sequence length 227
chains with identical sequence O, S, U, W
ec nomenclature
pdb deposition date 2016-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jw4M02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jw4M01
1MFDH 2DQFA 2EE6A 2GITB 3NCYP 5SWZD 5IBTL 2DLEA 2ZUYA 3RTQA 1JNNL 5IVXE 3BQUB 5D7LD 3O3EA 5LCVH 2E6PA 3UROR 4MB4A 4O02H 1I7ZB 1KNOA 1AH1A 1D5IL 5K33A 3TVMB 4U1LB 3HC3L 1HOCA 4N0YH 1OT2A 3NVQA 1GGCL 2N4IA 2O61A 3R1GH 1NCTA 1PD6A 3LEXA 4ZPVA 1EJ6A 2VXSH 3UTPD 1IAIM 1S9WB 3ULVF 4NWTL 2F8VA 3RA7H 4I0PA 2VRAA 3OJ2C 5JIHA 4FHBD 4LARH 2UZYB 4OGXL 3O8XA 4HC1H 4TN9A 2R69L 4Z78B 4MLSA 4M1GL 2PTTA 1N6VA 4X8JA 3NACH 5JR1L 2BSTA 1HHHB 3ZYJA 1QTYT 3W9EA 2NTSP 2C7UB 4KFZC 1JHTB 3QHFH 4JFZL 4MAYD 1JNHB 2WUCH 1U8JA 1S7QB 3EJZD 5INDB 2GQHA 4CNIB 5DMKB 2NY5L 2D2OA 4PD4J 1XCTA 4XP9H 1LO5B 4HS3A 3G04A 5HYSA 1HHGA 1MCCA 3VMOA 1AD9A 2PUQT 4QGYA 2XWBA 1FJ1B 5K9QG 1UXSB 4HJ0D 5T3XD 3F12B 5DJ6A 1MY5A 3VXOA 4OLWH 4F2MB 2Q3ZA 2B20A 5DRZA 2DQUH 1G9MC 1N5YL 4LLVA 2APXA 4XPGH 5IR1B 1YEEH 1A4KB 1K2DB 2X1XR 3MLXL 4C56D 5C6TH 3LKQB 4KZDH 5CEXA 1MI5A 1JRHI 3MRCB 2EYTB 2HJFB 1C1EH 2MKWA 3GSNH 1J5OH 3GO1L 3OZ9L 4OLYL 1OSZA 1R3HA 2XYCA 5DK2B 1FNLA 4Q0XL 2NYYC 1B2WH 1B90A 4Z95H 3GHEH 1HSBA 3GB7B 5D1QB 4U7SA 1OAQH 4XVUC 5I0ZA 1FZKB 2K1MA 1KF9B 3DTXA 4LCUB 2XTJC 3HAEA 1RU9H 4PJAF 1AJ7L 2W1NA 3AMKA 3H9YA 4FNLH 1EHAA 3AXLB 3IETA 4JFED 3WSQL 4KI5E 5ENWB 4LHUD 4QHMA 5E56A 1T5WA 1N7MH 5IVZA 5JLZB 4KKLC 2KQNA 4U7KA 2LV4A 1LO2L 5IV2A 2Y5TA 5DMGD 3EUUA 5HSFA 1JUFA 4L3EE 3HR5A 2BVPB 4LSSL 5A2KH 1UWXH 1JL8A 4N90E 5HPMB 1XFPA 4AG4H 1ORSB 1JVKA 1F6AB 1NCDL 2VLRB 5FEBA 2AEIT 1AGDB 1EO5A 2NY1D 1HILA 5KSBB 4NBXB 2E9IA 2JJSA 3ETBF 1FAIL 5DEZA 1NGWB 1XGYH 3DPBA 1OY3B 1JWSB 1NFIA 3C08L 1RUQL 1ZLUK 2H26A 2MHAB 4PLKD 3V7MA 4M4RA 4NFDA 3E6FB 5IB2A 2D9QB 4LLDA 4M7KL 5SX5K 2VDQH 4NSKB 2GUOA 4WY7H 4JN2A 4HX1A 1OTTD 4ZDHB 1ES0A 4QHLB 5BOZG 3LEYH 2VLRE 4KY1L 1X5KA 5KG9A 5B21A 4HWNA 1OP3K 4DZBA 3QXWA 1R3IH 2EC9T 5K9KB 4P4KA 3TO2A 2KDGA 5CSZB 5H94B 1JWMA 1T7YA 4NNPH 2JCCE 1A14L 1NDGA 1EUUA 1N4XL 5D2NC 5FM5O 2EDWA 4EXPX 4QXGH 3D9AH 4N8VB 3W0WD 1WITA 5JDSA 1I3VA 2NZ9C 2CLVB 2VYRE 2ILLA 4YWGH 5FKPA 4RA3A 3VGAB 5JQ6H 1QR4A 5EN2A 4HUVA 4X5LA 3T3MF 1NKOA 2CLZB 3U48A 4HC1A 3L1OH 1KCKA 4AMKH 2R4RH 5D5MA 3SKJH 1B6UA 1IGYB 1BFOB 1KLFA 4PJXB 4MNHB 4CRPA 3PWJB 4U6HA 1DLHA 3BE1L 3LRGA 5FYJL 4LBEA 2YD5A 1NC2D 3SDDD 2K7QA 4YHKH 1K6QH 3ARBB 2O26U 4B0MM 3PV6A 2H2SD 3GIZL 5HBBA 3DVNB 2H1PH 2AJUL 5D2LA 2XICA 2D7MA 3IS0X 2A9NH 5IW1B 3MCLH 1GYAA 2FYYA 4GXVH 3VD7A 4LKXB 1UCBL 1YPZE 2A83B 4TSBL 2P49B 4MYWB 1T7XA 1GGTA 3SKOA 2K9UA 4KJYB 4HPOL 3ILPA 3W81A 3OR7A 2DYPA 2NY0D 3RGHA 2A0LC 4GMTH 1LO3L 4NO0A 1T03H 3FOMB 4PG9B 4KROD 1CLZH 4U1MA 5I71C 4LVNB 4NFCA 4P9HC 1QRND 3TC9A 4QKXB 2AV7A 4L8BB 3MX0A 3BUYB 3WKNA 3W39B 4KTDH 3MPCA 2COQA 3MJ9H 4X0KA 5E6ID 3C09B 4JO4L 1U58B 1HSAA 3PWUB 1BBDL 2OM5A 5IVXA 2QQLH 5E08H 3GSNA 2D4FA 1LMKA 5E5MA 2H32B 2ZSWA 4WU7A 3MLRH 1M05A 3BW9B 1W8NA 1A3RL 3NFSH 4PJAE 5IB3B 1P4BL 1Y6MR 2ADFH 3ZHLA 3D48R 3FQUA 4OGYH 3ROLB 3C2SA 3ZYOA 1FG2B 3WIHL 1JF5A 1KB5L 2AJZA 3SGDI 3IF1A 1A1OA 4F7PB 3GHBL 3GK8L 5ICYB 5B38B 5JXEA 2XZZA 4Z7UB 4HJJH 4KK6C 2GITA 2MNUA 3HPLB 1IGIH 3LRSB 4LPCA 2E7LC 2R39A 1GAFL 3MRNB 1BBJB 4R8WL 4Y19B 4RAUA 1I7ZA 3P40A 3MO1A 1KIRB 2FJGB 4KRLB 1KCVH 2B5IC 3OJVC 3TVMA 3TZVC 3T4AA 3QZWA 5HGHB 1W2KT 1C12B 4OZHF 2AXGA 1NMBH 4K9EC 4N8PA 1JZ4A 3I2CL 3QDGD 1XR9A 4Z7UE 4WFHE 3KG5A 2Z31B 2B0SH 4DVRL 3RWFB 2B4CL 1YEFL 4M43L 5K9JH 4IRSA 4Z78A 5FK9B 1J1XL 1L7IH 3RUGB 4Y19E 1MSPA 3RBGA 4P46D 1FV1A 4YEEA 5JOPE 5IKCA 1P1ZB 4JO3H 4KRPB 4P5KA 1HIML 3M1BB 1J0IA 4HUXB 5DRWB 3T77B 2VLLB 3TBWB 3G9AB 3VG9B 1JHTA 3IDXL 2PYFB 3LHPH 3D18B 5I1GH 4X7EC 5INDA 2VWEC 3A6CH 3IU4L 1I7UB 2BHYA 3RUGE 3O0RL 1A7RL 1D5MA 5IK3B 3UX9B 1MFAL 1TZGH 3JTSA 3CDFA 1BAFH 1EGJH 2WLYA 3NGBC 4U1IA 1UXSA 2F53D 1A7QH 4PP2A 5I8CB 2BVOA 1T1ZB 2VUOA 4WW1B 4LSVH 4ZQKB 2DICA 2RB8A 3M07A 3NABH 5JW3L 3F58H 1CWVA 1G7IB 1A0QL 3BYTA 3EYFB 3LKOB 4S1RL 2A9ML 1KT2A 1YNLL 3I3DA 4D0DA 3IFNH 1VGEL 1M6OA 5M94B 5SX5H 4OIIH 3NTCH 4FMFA 1CR9H 5F7WC 3WLWD 2J1KA 4WUKH 1HHKA 1AGFA 3LKQA 1DQQB 1NL0H 1MIEL 2V5YA 5DD1H 3MRCA 4HF5H 1FLTX 2HJFA 4CMMA 1OAYH 5DK2A 4XVSH 2Q76B 4XNUL 5IEHB 3SKUD 3MTRA 3HZMA 4GG6F 3CPLB 4L3EA 1DSFL 3GB7A 5TQ0H 2V7HB 3OG6B 3GZKA 3MCG1 4HZLB 3BVNA 4Q9RH 2C3VB 4ZTOL 4LCUA 3X3GH 3PWPD 2ESVD 1H9VA 1KCSH 4NZRL 1FIGH 2HMID 1MFCH 4RFNC 5F8QC 5MEOA 1CD1B 3MJ8B 4M7LH 4N0CD 4IRJD 2EYSB 3UYRH 3TWCH 4NQXB 1KG0A 3RZCC 3TN0D 4AT6B 5ENWA 5GS0C 1CXKA 3KPRD 4G7VH 4MGXA 5L0QB 4EKXA 4X6BB 5LBSH 5E99L 1DVFC 2YD6A 3BDYL 5D9SA 2W0FA 1Q9OA 5TF0A 5ERWB 4NC1C 2G2RB 4GXUM 4KKAC 1V7ML 2VLRA 3MJ9A 3STLA 1BOGA 1T1WB 4XXCC 5T1DL 5FO9B 1FL6B 1NGWA 4APQA 4GAJH 2UYLA 4QRSB 4C83B 1QHPA 1IQWL 1WCQA 4M48H 5ICZB 3HMXH 2JCCA 4MZ2A 2MHAA 1ZE3C 5FUOH 3RVWD 3MGOB 5FHAL 3REWB 3UBXB 1RJLB 5JHDD 4PR5B 3MLYH 3WFCH 1CS6A 3RY5A 2Z35B 2EO9A 4MJ5A 5L88H 4LLQB 4F9LC 4CVUA 4FP8H 2VISA 1ZEAL 3P9WB 1IAKA 1C5BH 5BV7B 4OCSH 1A2YB 3JZ7A 3PQYD 5I1DA 5CSZA 1QSZA 1U3JA 1UADC 3D1MC 3U7WL 3BH9B 3S97C 3W5NA 5GGQH 4QWWC 4N8VA 4GMSL 4FOMA 4Y88A 3WD5H 4BZ1L 1EO8L 2W0LA 1DBKH 1RJYB 3O2VH 4JRXD 4Y8AA 2FZ3B 2CLVA 3G6JB 1J10A 5J6GA 4KTEL 4JPKL 5D7IB 1BIIA 1YPZA 2XIDA 2AGJH 2APVA 1BD2E 5F1SA 2AEQL 4PJFF 2VR5A 1IGYA 1BFOA 4MNHA 3PWJA 5E8EA 1Z9LA 1GL4B 3EZJB 4MZ3A 3N9GL 4YXKL 2AABH 5D7JD 5J9PB 1AE6L 5MEQA 5SV3A 3MLPA 1LNUA 3ZKMD 4WHTA 5EUKB 1QQDA 3LKPA 4JZNB 2LU4A 3LIZH 1LEKA 1BLNB 3TV3L 3IJYB 25C8H 4RGNC 3VI3E 1PFCA 1ZLVK 5IW1A 3G6JE 1ZLSL 2IADB 4XPBL 4LKXA 5D7IE 3H9SE 3RL1B 1U8NB 1ZWIA 4DUXA 1T04B 3MRRA 1YN7B 2BJML 2DKSA 2AJYH 2V17L 5I2IB 4NGHH 2HLFD 2J8OA 2OR7A 5JZ7C 1D6VL 3EFFA 1D5BB 3T4YA 3SGKA 4XX1G 1EGJA 2VLKD 2X4NA 4J4PD 1FNAA 3U9UB 5AAMA 3TA3B 4PJAA 2HH0H 2HN7B 5BJTB 3QDMB 5ESAB 3LKSB 4I77H 3AMLA 2VXUH 3V8OA 2JB6B 3QIBD 1TQCC 3EKCA 4L4TD 3BUYA 1RZKL 4A6YH 4ONGL 5KJRL 3RPIB 4NRZB 2B1AH 4I2XB 2E9WA 4WUUB 5BZDA 1PZUB 1U58A 2EE3A 2GK2A 3PWUA 3NZ8A 2AI0H 4R97C 2F58H 1G7JA 1DLFL 2YUVA 4X6DB 3RP1A 3BW9A 4PJ7F 1ZGLB 5IB3A 4K8RD 1MCJA 2OLDA 3MV7B 3JV0A 4BQ9A 3QDME 3BPLB 2DLGA 1J1OH 5D6DC 3Q0HA 4PB0H 3TF7C 5D93B 3PIQB 4K3EH 5ICYA 3D0VB 4Z7UA 4ZS7L 1EMTL 1K3ZA 4I3GA 3WNOA 1I9JL 4I2XE 4W4OA 3C60A 1ZANL 3HPLA 4J3WA 4PJDB 4RDQF 2RFXB 4HEPG 2ARJA 2ZSVA 3ZTJG 1GC1C 1KJMB 3DXAD 4Y19A 4X6DE 1XIWC 3MROB 2FJGA 2XPGB 3SDCD 1MCOH 3MV7E 4P23C 1WAAE 1IARB 4G9FD 3KLHD 1UYWL 1C12A 4OCLC 5D1ZB 1YYLL 2W9EL 3RWGB 1VFAB 1UWEL 1QNZL 3DX8A 3OAUL 3HMXA 2Z31A 1H3PL 4MJ4A 3KPQA 3OB0K 4PJDE 4R4ND 5IGXL 5IB5B 3S88L 2MQCA 3HI6L 2R15A 3TO4D 4NQSA 3RUGA 3ZKXC 4LCYB 3HPJA 2HWZH 3K0WA 1KC5H 1ZT7B 4JN1H 1W8OA 1U8HB 1VFOA 1HKFA 4WEUD 4OKVA 3UC0L 4JVPA 4XPFL 4K3DH 4F7CB 4HIIB 4J6RL 4RDQG 3OXRA 4HUXA 1I1AB 2VLLA 3QUXC 4K7PH 4UI2A 3TBWA 4ODVL 5CS7A 5K59E 2HLAA 1MFEL 2L7UA 5E2JA 3IFLL 4PGCB 4U6VH 3GSXA 4R0LC 3VD9A 4HAGA 3D18A 2ADGB 3GJFB 3LV3B 1ZV5A 4HKBB 3AROA 4X80H 3SE3C 2GSIA 5D6CA 2UWEB 5F9WB 3C6LB 4A2LA 2W9DH 1YJDC 4NQED 4DN3H 5D72L 1A7OL 4NHCH 4ZFZB 2LQRA 2M8XA 4TTGA 3C5ZD 4DQOL 1T1ZA 4WW1A 2VLME 4JO2H 3G5VB 1LDPH 1YNTB 4YUEH 5D1XC 4KJQD 2KKQA 5GHWH 4OM0H 1DQLH 1OSPH 3U6RB 4TVPL 4ZFGH 3BISA 5FOBA 3CLEL 1XMWA 4GOSA 1HI6B 3QIWB 1U3HD 4X9IA 5TE4L 4LRNH 3B4NA 3N06B 4XNYH 4V1DB 2X89A 4YDKH 5C0BB 3WFBL 3CPLA 1VENA 3SGJC 3TBTB 1L6ZA 3E8UL 2XFXB 2HG5A 3BN9D 4HZLA 2CXGA 5L9DH 4JPWL 2HRPL 3DROA 1F4XH 3V52H 1HCVA 1N3NB 1BQHB 4YR6A 1A5FH 5I18H 5DWUL 2XWTA 4BKLB 3MJ8A 4NHUA 5DDHB 1FFNA 2EYSA 5BQ7A 1UACL 5C0AD 4AT6A 2EH7H 3CFCL 2XKSA 1CGVA 4UV4L 2WMPA 4YHYC 1JGDB 4FTVB 4OFKA 4P5TC 5C0BE 3OKOB 4A6YA 5SWQB 4YHLL 1MHHA 2G2RA 3QXVA 3WN5B 3OWEA 1CXLA 4MD5B 4RX4A 4JY6B 5FO9A 1FL6A 2WK2A 5GGTH 5E6YA 1JPST 2C1PA 2JE8A 2NMSA 3QFJD 5HGDB 5T1LD 1NFDF 1NGQL 5JTWA 5L7XL 3T1FB 4U33A 3FRPA 4IS6B 3BMWA 1RJLA 4PR5A 2DBLH 1KYOK 2FB4H 2EXYD 4GW5B 4QO1A 5E94A 5GS2D 1FGNH 1FRGL 1V8HA 2V9TA 2Z35A 4FQXB 1DBML 4XVTL 5ID1B 4X6CE 2PYEB 5H2BA 3ZT7A 1OWRM 5L6YL 5GRUH 3SY0B 1JGLL 3GI9L 1EDQA 5BO1L 1BD2A 1DEEA 5IIEB 4OF3A 3PL6B 4KKCC 5CAYB 15C8L 3S37L 4P2OD 2HJLB 1E4XI 3QYCA 4P2QE 1RFDL 3GGWB 1U2HA 2C3WA 3I6LD 4GRLA 2VC2L 3MBEB 1WGOA 1XAUA 3UYPA 3EAKA 3U30B 3V6BR 5GGSY 4WW2B 3ZZ1A 5ADOL 5BZWA 3BH8B 4WU5B 1I8LA 1XZ0A 2VL5B 4Q9BA 2PYEE 3AC0A 3ZHDA 5IFHH 2FZ3A 1UKSA 3G6JA 3GMOB 1KJ2B 3H9SA 5D7IA 5C0RH 3RWIA 5EA0L 5HDBE 4Z7QF 5EU3B 3QEUA 1OGAB 3O4LB 1QYGH 3HMWL 3WDJA 4UNTA 5CJQH 1BX2A 3Q6GH 2XA3A 2AJSH 3ARGA 1WT5C 1JMXA 5E8NB 3H9HB 2IAMC 2MQ3A 2JB5H 5I1IL 1N64H 3ZE0E 3LPGA 1QA9B 1JYXA 1YEKL 4J12A 3JVGA 5JIPA 3KYKL 3HLAB 3QULB 3S35X 4R9HA 5KS9B 2A77H 2IADA 2NY5C 5FXCH 4I3SH 5EO9A 2VH5L 4NO3B 3RL1A 1FP5A 1XEDA 4CU7A 1G0YR 1T04A 4KV5F 1WLHA 1SVZA 1OGAE 5GRVK 4YFEA 4JQXA 3O8XD 3O6FA 4PJCF 5CZVL 3HRPA 2O5XL 3EOBB 4MXQC 3ECBB 2LTQC 4H1LG 1HINL 1D5BA 3QCTL 5HI4D 2JJUA 5A2FA 5KVGH 4OKDA 4YDIL 5ALBL 2IH3B 3LH2H 5JHLH 3IFPA 1CE6B 4XCCL 1VCAA 1OTSC 3NZHH 2HN7A 5DEGB 2D7OA 4ZAKC 5C09D 3TEUA 3WFHB 5BJTA 8FABA 2WAHA 4R2GC 1KIQB 3VXMD 4G7YH 3OB0H 4NQTA 4MDIB 4ZG1A 3QG7H 2GYSA 3S6CA 2JIXB 1D5ZB 1DQMH 1WZKA 1YYML 4KPHL 4M5YL 5ISZB 3ULUF 4NRZA 2QADB 1H8NA 4I2XA 1EFQA 2FBJH 4P2CG 3L5XH 1ZHBA 3KJ6L 1TJGL 1BJ1H 5JORA 1IM3B 4OTXL 2FGWH 3QUYC 5EZJB 3QXAB 4FQHB 4X6DA 5CD5D 1HCFX 2N7BA 4M93C 5B39G 1GZQB 3ZE1F 4UIKH 1A4JB 4LSQL 3MV7A 3O45A 1WAAA 3PP3H 4Z5RB 1UH4A 1NGPH 5KVMC 3MOBH 4XZUB 1QFOA 3DHJA 4PPTA 4RA0C 5JUEL 3VH8A 1IGTB 1ZA6B 4QRRE 3D0VA 5JPMB 5C07E 4KMTH 1P4LA 5GZNC 3S3PA 3GMRA 4PJDA 4NO2B 1A7BA 1FGVL 3IT8D 4PJ8A 5BVPL 2RFXA 4PFEA 2AXFB 1BHGA 4OD3H 3B2VH 1JZ5A 4JHAL 1MI5D 5IBUB 2CK0L 4PG2C 3FB5B 4LSPL 1QFWL 1MNUL 3TJHD 4WFFE 2DL9A 2VNCA 4KC3B 2NCMA 1DBJH 4QTIL 3VXUD 5GS3A 4AH2B 5GGTA 3L3IB 3NCFB 3CFBA 1KBGH 3TBVB 5DJ2B 3F7YB 3LQAL 1WCBA 4Q58C 5MEPA 4ZPTA 1S5IH 1KJ2H 3EYOA 4JGMA 5GSVA 3O6KL 3OMZA 4YHIB 4K8RL 5A2LH 4OT1H 3BWAA 3HG1E 4HGMA 4NM4H 2IGFH 1MF2L 3ZDYE 4GO6B 4LCYA 3ULSB 1U8OB 3B5TA 2PETA 2H2PD 1MAJA 3VGHA 2YD8A 4GS7C 3QQ4B 1WC7B 4NO5A 4ONFH 3BKML 1XGRB 1MCLA 3BIAX 3OKMA 4HLZG 4ISVB 3SE8H 5E8OB 2CMRL 5MI0C 1I75A 3CH8A 4GBXD 4UOJA 3LPFA 5E6ZA 1INEL 1V3MA 2FX7L 1KSRA 2ADGA 3U2SA 2NY7H 4LRIA 4I3RL 3H2WA 4NZTL 1FN4A 1NLBL 1QLFB 1P9MA 4PTTB 1TNNA 1G7LA 2OTWB 1HHIB 5C08E 4LASL 1DJSA 1D9KA 5DMIL 4GW4A 4QRPD 3FTGA 4F15C 4YXLL 4E0RB 1RUMH 4B41A 1A6ZB 1CFQB 4P4KD 5J3HD 4OBSA 2GSGA 3P4LA 4G6FD 5F97E 1E6JH 3OKYA 2DI7A 4PGDA 4K3HA 5DQ9A 2GTWB 4WI3A 4O2CB 1NSNH 1BVKA 4WTZA 3QIWA 1QBLL 3IKCA 5FKAA 3HI5L 3PGCB 3VWKC 2I26N 1IRAY 5C0BA 1TZHA 3NN8B 5D70L 3O9WA 1OHQA 1OAUL 2VZ1A 3BDXA 3CZJA 1XGUB 4Q6IB 1T0MB 4JPIB 1DN0A 4PIRF 2KPNA 3UDWA 1TTUA 4E5XA 1UEMA 3FKUS 4BKLA 1DTUA 4Y5XA 2BOCB 2L0DA 1GGBL 3TT1L 1HXYB 3EDFA 4K71C 4EI5D 4KHTH 1B0RB 1G9NL 1JGDA 3WS3B 4L8SB 4K94H 2R1WA 4X6CA 5IW6B 1MLCA 4S1QH 1I85C 4FQ1H 4YHOL 5I1KL 3ZDXE 2PO6D 3H7LA 4EN3C 1CL7I 2DTMH 3Q6FA 2DYPD 1F02I 1MREL 5CFHA 2F19L 2R0LH 4P2QA 2YA1A 5I1HH 4XGZB 4MWFB 3U4EA 3FO0H 5HGDA 4NO0D 5ETUA 3T1FA 3BEWB 4NQDE 5HHPB 3U4AA 3NPSB 4LLYB 1JGUH 3WO4C 4XI5D 4Z7OF 3KYOB 4YBQC 3VWJA 3AUVA 4P9MH 2ITCA 2PYEA 1KUMA 4FXGB 2O5ZH 2F54E 1ZLWH 1CVRA 2R2HB 4FXLA 5IIEA 2ADJB 3UJJL 4JPVH 1MCWM 2HKHH 2PCPB 2MPAH 4EIGB 1KENL 4IMKA 1JHLL 1WBZB 1RZ7L 4E42A 2Y06L 1RULH 1DL7L 1BM3L 4M3JA 3UTSB 1F3RB 4RGMB 3BH8A 1KPVA 1HKLH 5EWIL 4WU5A 2VL5A 4RRPA 5E9DE 1ZHLB 4LPUA 3RX8A 2B4CC 1VGKB 2Q3AA 1JYVA 1KJ2A 3OXSB 4AL8H 2V5TA 5EU3A 5IW3A 1OGAA 4HKJB 1T2QL 4QEGA 3BZEB 3MUZ1 1F3DJ 3BQUD 1YEDB 1T1YA 5I17A 5J8OA 5E8NA 1FG9C 4M8QB 1G0DA 1K5NA 4OIBA 1CXIA 4X5XA 3IKKA 3UTSE 1QA9A 5EIQA 1QR1A 4M6NL 3TVMD 2YWZA 1T20B 1HNGA 1X4XA 5HY9B 3KPOB 1JPGB 3HLAA 3QULA 1R3KB 3QJFB 2R8SL 3W9DB 2IWGA 5F7MC 3BKJL 4JG0L 4HD9A 1X6LA 3ARDC 2XKNB 4JHZA 3OJDA 2XQYK 4BUGA 2JF1A 3IJSA 2A1WL 3GMMA 4FQQB 1UM5H 3MRPA 4HIHA 2DIJA 5MP6H 1CE6A 3U0PB 3BAEL 1RHHB 4GAFB 1CZ8L 1RIVH 5BS0B 12E8L 3OTTA 1FH5H 1NBVH 1IQDA 2XQYG 4KUZH 1K4CB 3WUWB 1YEJL 4H8WL 2X1OA 1KJ3L 4BQ8A 4Z8FH 1JNJA 3V6FA 1T1XB 4MDIA 5DFTA 2JIXA 1X5GA 3O2WL 4ZUTA 4QRRA 4I4WB 1EFXA 4RFOL 5JW4M 5C07A 2PXYB 3P73B 3DARA 1IM3A 2HT4D 2LAAA 2ARWA 3P4OB 3UPAA 4UT7L 4GLRH 4L3AA 1AXSB 3EJZC 3HZVA 2YZ1A 5BS0E 4WJ5A 1QPPA 1JRHH 3EYUL 4HPYH 4TSAH 4R90H 4PGBB 3DO7A 2MTPA 4DAGL 1YEHH 4XZUA 1HQRA 5ABDE 5GGUA 1IGTA 2DQTL 3GJEA 2H9GB 4JFHE 3QP3A 2PR4L 1S7UB 5JPMA 3IXAB 5IESL 5I75C 3GSWA 1Q9LB 2VXVL 1EEYB 1MQ8A 4XMPL 3ARSA 4NO2A 4NCC2 2H6PB 2AXFA 3O2DH 4KI5D 1JGVH 1V3KA 3ET9F 3HG1A 2BSSA 2Z91B 4FFYH 1NDMA 5JPNB 3RJDA 1MLBB 5CEZL 3ARUA 2WWKO 2P44B 4NJAL 4L5FL 5D1QD 4N90D 3TFKC 3LAFA 3SE9L 3TPUB 1ZVYA 3OKLA 4ONHA 3L3IA 4EUPH 4WTWA 4GG8B 3MRMB 2SEBA 2NY3C 3F7YA 4HBQA 1IFHL 5C0ND 4PREA 2FHBA 4NBZB 4AENB 2HKFL 1AO7B 5L8LB 3QEHA 2DQGL 1JTPA 3AREC 4J1UB 5T5FH 4L9LC 3VXQA 3TBYB 3QRGH 5TDPB 2WM0A 3KPLB 4P5MB 1EO7A 1YEIH 1U8OA 3TBSA 1EK3A 5C08A 5LGJA 3SHSA 3KXFE 1WC7A 5TPWH 2VLRD 2P43B 5E8OA 2BVQB 4UUJA 3OKDB 4FFVD 4PBWD 4QOKB 5HJ3B 4DGIL 1FQ9C 4H0HB 2YN3A 3B43A 1QBMH 3LS4H 5DR5L 4LLWB 4HGKC 1Q0XH 2LU7A 4ODTH 1QLFA 2OL3H 4PTTA 3ARPA 3K7UA 4YHZL 3DURA 4PLKC 2OTWA 2DS4A 2VZVA 3D25A 1MEXL 1MJ8H 1HWGB 3RFZC 5J7CC 2IQAA 4HBCL 2EEBA 4NRYA 1KN2H 4PYHA 5DJAB 4QOKE 1FLRH 1A6ZA 2GFBB 1OTTC 4YQXL 1IMHC 4KKBD 1I9RL 4DGVL 1GZPB 3Q1SH 3KAAA 2EDEA 1CICB 2J4WL 4EVNB 1LQSR 1N0XH 4YGAB 1OTUD 1V5JA 2FIKB 3LB6D 2GTWA 3SKNB 3U0WH 2OXGA 3PGCA 4PJBF 3B3IB 1ETZB 3QIUC 3VFMB 3OX8B 1LE9B 4NN6C 1A3QA 1FBIH 3WL9B 1MQKL 1XH3B 3BMVA 4XTRD 1P4IL 4NN5B 3WJJA 2YXMA 2EDHA 2G75B 1RIHH 1XGUA 3CZFA 4OLXL 3KLAB 4JPIA 3EFDH 3K2UL 4JRWA 5C0DA 4LVHC 4QHUA 4Q97A 4FXKB 4UT9H 4AEIH 3QCUL 3RU8H 2Y36H 5F88A 5EUOE 3ARBD 3FHAA 2Y25A 1ZVSB 1HXYA 3MRFB 4CMHC 1BF2A 5I19L 3SQBA 4NQDA 3EW3B 1MCBA 1MFDL 1RZKC 5I15H 3FN9A 2BHUA 5F44A 2Q8BH 3SDDC 3T0WA 2FH6A 4PV9A 1BIHA 4Y4KA 3WE6A 1I7RA 5F9DC 5LCVL 4LEOB 2JJVA 4O02L 2F54A 3OAZH 4GKNA 4YBHA 5D7KD 4N0YL 3SQOH 2IMNA 1ZHNB 3R1GL 2FR4B 4OZIF 3UZQA 3T3PE 2VXSL 4XGZA 5KN5B 1RK1B 2GEEA 3LDBC 3RA7L 4QT5B 3BEWA 4LLYA 4LARL 4HC1L 5E9DA 4YXHH 4FXGA 5EOCH 2FNBA 1XF2B 4MQXD 3SGDH 2R2HA 4WEMB 3O2DA 3PNWA 4WFGE 3IJHB 3CX2A 1OAZH 1WBZA 4NJ9H 5L2KE 3QHFL 4ZMAT 2KZ1B 1K85A 2WUCL 1VKXA 5EORH 3HC0B 3VRIB 4LK4A 3EO1A 4I8DA 4EOWL 4EUPA 1Z0MA 4I9WE 4N8CH 4U4BA 1LEGB 1VGKA 3FAXA 5FECB 4XP9L 1IAIL 1Q9WB 3OPZH 4KVNH 1J7VR 2D0FA 1SJVA 4WFHD 1R6VA 4MD0B 4PLNC 4D8PA 4MVBD 5DQDH 3P30H 4OLWL 4LCCA 1HEZA 4Y19D 5I6XC 1U8QB 3ILQD 3ES6B 1NQBA 2DQUL 5JOPD 4ZUVB 2VZTA 4Z7NF 4XPGL 2YK1H 1YEEL 1QP1A 5T3ZD 5HY9A 3ARVA 1X5FA 1B3JA 32C2A 1JPGA 4HMEA 3SBWA 3RVXC 4PUBH 3QJFA 5CWSB 5C6TL 5DVLA 3W9DA 4MHHI 3GSNL 3Q3GB 1J5OL 2Z31D 3IU3A 2XKNA 4OM1H 4KQ4H 1UKQA 1QD0A 5EOTA 1B2WL 3GHEL 1EHXA 1OAQL 1UH3A 1ZHKB 2Z93A 4AIOA 2OL3A 5E4EC 2DF3A 5BW7C 2XTJB 2VDPH 2VABB 1YQVL 3CH1A 4JANB 2VZUA 4YDJA 1RU9L 4KRPD 5BS0A 4WWKB 1AP2A 3WNLA 4NZUH 4FNLL 5KSAA 1K4CA 3G5ZA 3WUWA 5FAAA 4OZHB 1FFQA 3A0OA 1S7RB 1AGBB 1N7ML 3L5HA 4I48B 1MCDA 4OV5A 2YD1A 4PJBE 4KDVA 4JLRB 5JNYB 3BPCB 1DR9A 1WICA 2E8YA 1GPOH 2PW1B 4AG4L 5EIIA 1GH7A 3BRDA 1IGMH 3L3KA 3P4OA 4JY4B 5E95B 4G8GB 1MJ7H 1QEWB 2DLFL 4OZFH 5H37G 1M1SA 1XGYL 4LHUG 1X9QA 2BVYA 6CGTA 1UEYA 3BFOA 3U7YH 2Z8WC 1FPTH 4Z0XA 4RMQA 4JM2C 4FG6C 3MYZA 4QHNA 4NKOA 1NJ9B 3UTPE 4U2ZA 4C4KO 2X9YA 3FQWA 3IXAA 2VDQL 1J8HA 1TZIB 1Q9LA 4WY7L 4MD4B 1OP5K 3LEYL 1G6RH 1CDHA 5HDQH 4M7ZC 4G8GE 2VQTA 4TVSa 3D2UB 1R3IL 3VGEA 3QDAA 4LU5H 2ZCKH 4L8DA 2AK4B 5JPNA 1MLBA 4M03A 4NNPL 3WLWC 1NCCL 5C0EA 1SHMA 1XF5A 3NPZB 3KXFA 1CDBA 4G80B 3D9AL 4R96A 2EC9U 4J3TA 4W6YB 4U3HA 1OOAA 5CJXA 3ARTA 1U91B 1Q8MA 3K4DA 4HV8B 4Q9QH 4YWGL 4B7LA 2WBJC 5MHSD 5FO7A 3L1OL 1ULVA 3FOLA 1IT9H 2R4RL 3SKJL 3TBYA 1UVQA 3S5LG 4C55A 4IRJC 3KPLA 2AK4E 2A6DB 4GG6B 4TUJB 1J12A 4YHKL 1WZLA 1K6QL 3CFJB 2F9BT 4OGAD 4FABH 1E6OH 4O2EB 2BVQA 2H1PL 3TLRA 4QOKA 3KWWA 4MNQB 2A9NL 2IQ9L 3RVTD 1G7PB 2X41A 3MCLL 1MJJB 2R0ZH 4GXVL 4TNWK 4JKWA 1K4DA 4OFYD 1P53A 2HJKA 3IS1X 1IGCL 4C56E 2XKUA 2W65A 4TULL 4POZC 2ERJB 1MJUL 3IVKB 1KULA 2B7DT 4IDJH 1LD9B 3QDJB 4GMTL 1T03L 1BD2D 3ALXA 3EBAA 4YDVB 5FYKU 5I71B 5IOPA 1W72L 5I73B 4U1NB 1YEGH 1CLZL 4MNQE 1ZTXH 3DLQR 3KYNB 3L7EB 3BJLA 5T1MA 2DMKA 5TGBB 3MBXH 4EVNA 1SM3H 1KCRH 5EUOA 2OJZH 2E6JA 2XACC 3HNVH 2FIKA 4R3SB 3ZLQC 1A1MA 4KTDL 1DE4B 1XR8B 3VXSB 4UINL 3PDGA 1FL3A 5C0CB 3QDJE 3MGAA 4JY5H 1M4KA 3MRDB 3VI4E 3GSQA 3QWRD 3WL9A 5DRXA 5ELIA 3WHXB 1NBQA 5IG7A 3L5WA 3MLRL 4K2UH 3NFSL 4ESKA 1KTLA 2ADFL 2CUMA 2FATH 1AQKH 1OP9A 1U0QA 4OGYL 4WO4A 2EDFA 1SEBB 2Y72A 3MV9B 4TNVF 2P8LB 4MJIB 4KH2A 3ARGD 1OVZA 4OSUH 5B3JF 1G6VK 3S7GA 2ZG1A 3AB0C 2RR3A 4Y1AB 3VXSE 1NBYB 5IMKB 4R4BB 1IGIL 1R24B 3DMMC 4W6WB 5C0CE 4KZEL 3ZKMC 2QQKH 1N26A 4D0BB 2EE9A 4EDXA 3V5HB 2YPLB 1FZOA 2F5BL 3IFOA 1CIDA 1PYWB 2AV1A 3TZVB 2LVCA 2WLZA 4XB7A 4C58B 2DB8A 2OJEB 2CLRB 1U8PA 1KTRL 3B5GA 2XG5A 4TNVK 1FL5B 5CILH 4RWHA 4OZFA 4OD1L 3LD8C 2VZOA 5L2KA 4LNRA 4OQTH 3DX7A 3TA3D 4Y1AE 4UQ3B 4BZ2H 4DVBB 2B0SL 5DZLA 1JFQH 1EEZA 3QDMD 5K9JL 5CGMA 1EHLH 2YXFA 5IEKA 2AEPH 1L7IL 4JAMA 4UDUB 1HXMB 4JHWL 2BY2A 2W07A 2FX8H 1Y6KR 3RKDD 1TENA 4HZAA 1GGYA 2DRUA 2R56H 3LN4A 4QF1B 2CDFB 3V79C 4JO3L 1G6RA 5JDJA 5HI3D 2EECA 5DI8A 4WUUD 3S98A 5EBWB 4ELMF 4X5WB 5DTFA 2BXYA 3VXRB 2X70B 3QG6B 4CBPA 3JV6B 3LHPL 1SMOA 4KDWA 2VOTA 5I1GL 3LQAC 3AY4C 3MV7D 2A6KA 3HC0A 3VRIA 2D03H 5JO5A 2V2TA 1EA9C 5FECA 4BH7A 2AQ3A 4K8RC 3NFNB 4BFIA 1TZGL 3T0EC 2ICEB 3GI8H 4GXUN 1EGJL 4JFYB 1KGCD 3HRZB 1A7QL 4EJ1C 1MCPL 4ZO7A 3HN3A 4MXVE 5I76B 3ES6A 3NABL 2WQRA 4PJ7B 4L1DA 3DUUB 4P48A 1S7WB 3CVHH 3IFNL 1BFTA 1EHNA 4OIIL 2C5DC 3NTCL 3TYFA 5D1ZD 4WUKL 3V4UH 5IJVB 1QRNE 1NL0L 1S9XB 5DD1L 4HF5L 5DHVH 4PJBA 1OAYL 4PJ9C 4XVSL 3L7FB 2YHGA 3MC0A 2Y07L 1I3GH 3C9NB 5F96H 3QPQC 5TQ0L 1PQZA 3X3GL 4JANA 1KCSL 1FZJB 1FIGL 1YUHB 4WV1C 4KXZI 3C8KB 4ODHH 2P24B 3VE0B 4M7LL 1SQ2N 3TO4C 4WWKA 3RZCB 3UYRL 2CK2A 1I1FA 2EDXA 5IHUH 3TWCL 1I1AD 4JZJA 4PJIE 3JWNC 3GNMH 1CTOA 1DVFB 4G7VL 5LBSL 3RVVD 2KZWA 2O5YL 5E2TH 5JNYA 1DUZB 2ZUXA 2PW1A 5IUSA 3UTTB 4NBYB 4TRPH 3NBNA 4GKSA 2DD8H 1WFTA 4G8GA 3C6LD 3F7RA 3MLUH 4GAJL 4HCRL 4Y5VA 3VDCA 5FUOL 3QSKB 1YC8A 4O4YH 3MMEB 2D7NA 1WBXB 5ALCH 5CKGA 4UU9B 3MLYL 4YDLC 2YPVH 1O7SA 3EOTH 1C7SA 3U46B 3QCVH 3MLZH 5L88L 4XP1L 3V5DA 3QDGE 1TZIA 1JN6A 1G9NC 2IG2H 4FP8L 4MD4A 4XAKD 5JQHC 3E2HC 3UTTE 3ARXA 4MA3B 1C5BL 3QIWD 3REVB 3B9VA 1OM3H 1OT1A 4OCSL 3D2UA 1CE1L 4U1GC 2DM4A 3MXVL 1C08A 1I8IB 3BD3A 4V1DD 5IVOA 2AK4A 3EJJX 4GAYB 2BCKA 5C0BD 5C2UB 5I1LB 1NMAH 1H3XA 5GGQL 4OCWL 1IBGH 1FVEA 3EZ8A 1T89A 2EH8H 3WD5L 5KW9L 3G6AB 4PRBB 4DOHE 4CDHA 1DBKL 3O2VL 1U91A 2C4FT 4HUMB 3BN9C 3CSGA 4LSDA 3BP5A 4OQTA 4HV8A 5ID0A 1P5VA 1UJ3A 3E6HA 2AGJL 5FA4B 1ORQB 4BH8B 5I1AA 2IPTH 2V5RA 2YWYA 3D69A 4C56A 1IM9B 2FECL 4FTVD 4UIMB 3T09A 2JJTA 3AM8C 3O4OC 4EQ3A 4LLUB 5B8CC 2YKLH 2AABL 3HFMH 3AAZB 5EC1B 3CFJA 2CIIB 5F93C 2F53E 3FQNB 4TUOB 5F71A 5IBLD 4RGNB 1JWUB 3LIZL 4EI6B 3PGDB 2D7QA 2I27N 1IEAA 25C8L 4MNQA 2ZJSH 1KEMH 2BSRB 1U8IB 5E2UH 3QUKB 3FT4A 5GSRB 3SOBH 2I60H 2QHLA 1E4XH 4JFXA 3RDTB 1I1CA 4FQXD 5DT1H 2AJYL 2HRLA 3IVKA 4NGHL 1YZZA 2CRZA 2V2XA 4OI7A 2PYED 4DCQB 3QDJA 5INCB 2EXYC 2HFFB 1F58H 3MLSH 3HCVB 3PL6D 4YDVA 3P77B 2ICWJ 3QR2A 5KSVB 2HH0L 2CKBB 3BYYA 3KYNA 3L7EA 3RRQA 4S10A 3MRLB 3PWPE 4MSWB 1GOGA 4I77L 1LE5B 1AGEB 1TQCB 2VXUL 3ARZA 4EQ2A 4HSQA 3MBED 1NFDB 4JZOA 3CD4A 2ZKHH 3CVHA 1Z2KA 2DQCH 1CBVH 4A6YL 1WWCA 2FJFB 3FB8A 4P2OC 4IHOB 3HE6B 1DE4A 1XR8A 3KPRE 1IGFL 4JFPA 5C0CA 4R97B 3QHTC 4OF6A 4QY8B 2AI0L 5DHVA 4U31A 3O6LL 4G8FB 4JDVB 3WHXA 3NCBB 2X4OB 2GY5A 4V2CB 4UAOB 3NIFE 5IB4B 1OGAD 3O4LD 4XBEL 5ITFB 1SEBA 2R2BB 3WFEH 3UO1H 1C5DB 1FVDB 3ARWA 3KDMB 4H26B 4PB0L 4PY7B 4K3EL 4BQCA 4H8WC 4X4YA 4YZFF 4LPWA 4HH8A 5E03A 1EPFA 3I84A 1FNSH 3MQIA 1BJ1J 3DX6B 3RTQC 3UYOD 4Y1AA 5JHDE 1NBYA 4Y4FB 1RZJH 2E7LA 4R4BA 4PJHB 4LF3A 5SX4I 4H1LB 4K7FB 2DWDA 4NUGH 1XIWB 4YHPB 1MWAH 1AR1D 4IBLT 3RWHB 4LPTA 1ND0B 4P23B 1FNGB 1MCOL 1RD6A 2VIRA 2CLRA 5CHNB 4I0PC 1FL5A 3FT3A 1LP9F 3O8XC 4F80A 3HE7C 4N5UA 3D39B 2G9HB 1RZGA 4JGUA 3KJ4C 4UQ3A 2BMKB 5IROA 5IFJB 1BVZA 5JOFA 4PJHE 5HI4C 2Z4QB 4R26H 3ZKXB 1Q9KA 2YPKB 2E27H 4UDUA 1HXMA 1NAMH 2JIXD 1YECL 5ISZD 2HWZL 1KC5L 5CSGA 4JN1L 4QF1A 2CDFA 2QADD 4LSRL 1JI2A 4YBLC 4DGYH 1HH9B 1K3IA 1OAXH 5EBWA 3WDIA 4L3CA 4K7PL 2VXTH 3N1MC 3V9FA 3LRHA 2LABA 3LN5A 4R0LB 3HR6A 2X70A 3H3PH 3QG6A 3RWEA 4U6VL 4P0DA 4WRLA 3GIVB 1I7TA 4IRZH 1A1NB 1HQ4B 4RISL 5DF0A 4RMWA 2BRRH 1QPXA 3DO3A 1QRNA 3NFNA 2EIDA 1CDUA 1MHPH 4LQFH 4ODXB 4QXTB 5FGCB 2W9DL 4JGJA 2FJHB 4DN3L 3HC4H 5C3TA 2FO4B 5EBLB 5E6IA 4HIXH 2I9LB 2D0HA 4UDTA 1LDPL 5D1XB 5I76A 4YUEL 4LPYA 2XZQH 5GHWL 1VFUA 1OSPL 4OUUB 2GY7B 2IJ0C 3FRUA 5A16A 4NYLA 1J0ZA 8CGTA 4I0CC 4PJIA 4LRNL 4XNYL 3UTZB 4RWYL 1L0YA 4L4TE 3L7FA 2ZUSA 3N0PB 3S35H 5ECJE 2FRGP 5L8KB 4RCAA 3CMOH 5K9OB 3EOAB 1ZAGA 1KYOJ 3ELAT 3DIFB 1F4XL 4C59B 4PP1D 1QFWI 3V52L 5B3NA 4FQJH 4GUPB 1YUHA 1A5FL 1RZ8B 2P24A 3VE0A 5FFLA 5I18L 1KLGB 3QPXH 2VE6B 4DZ8A 1WWBX 1IE5A 1YY9C 1WBYB 2X1QA 35C8H 5I1EH 2Y6SD 1S7XA 2EH7L 1XF4A 2XY2A 4YHYB 2MSPA 1YN6B 4P5TB 1ZT4B 4NZDA 3Q48A 3QDGA 4LVOC 1FNFA 1DUZA 2IC2A 2JJSC 3EDJA 3HUJF 1JPSH 4OQ1A 1RV6X 4WNQB 1NCWH 3PF2A 4GRWB 3QXDB 3BGMA 4UT6H 4YH6A 3TT3H 5GGTL 4HS6B 1QFWM 1RUAH 4P46A 1N59A 4PLJC 1I9EA 4JRYB 3SE4C 4TPRH 5DEFB 3SO3C 4HUWB 5DUPH 4F7EA 2B1HL 5KANI 2FB4L 1FGNL 4YC2C 3FN0H 4D0CB 2OTUB 3L9RB 5GRUL 4H20H 2GAZB 4P4KC 5J3HC 4KVCH 4GRWE 5CJOL 3MNZB 4MA3A 3OGOE 4PTUA 4OAWB 4L8CB 3LQZB 1I8IA 4JFQB 2OI9C 3AFLA 4GAYA 1MWAA 3GSOB 1QG3A 2CDEA 1EXUB 5FYLE 2F53A 1XGPB 4JG1L 1P84K 3ZE2E 5IMLA 3RL2A 2BNRB 3E3QC 2VKXA 3G6AA 3V6ZB 4URTB 5IFHL 3EYVB 3OKNA 3QFDB 3GSRA 2FO1A 4BH8A 2AAVA 1T21B 2CJUH 3GSUB 1IM9A 1QYGL 4UIMA 2LU3A 1NAMA 1BWMA 3Q6GL 5DC4B 2E9BA 2AJSL 2IAMB 4RNRA 4Z18A 2HTKD 3AAZA 4NQEE 2VQUA 1N64L 2X1WL 3O11A 4X7SH 1CGTA 1FE8H 4P3DB 1RZIB 1JGEB 3MFFB 2VDMH 2BNRE 1JWUA 4O9HH 4EI6A 1OW0A 2QSCL 4GFTB 2BDNH 3HI1B 1JV5B 3P11H 3PWPA 1Z5LA 1U8IA 3QUKA 5GSRA 2A77L 1S9KC 4I3SL 1ZSDA 2X4QB 4F3FA 1HZHH 4HMDA 3RDTA 3VFNB 4YK4B 4LSUH 3TN0A 4F8TA 1O5DT 2R4SH 4NKDB 2LTQB 1K8IB 1H3WM 3KPRA 4DCQA 2GT9B 2OP4H 5INCA 2HFFA 5KVGL 4WENB 1LK2B 5JHLL 3LH2L 3LKNB 3HCVA 4ZAKB 4N1EA 2E8ZA 3P77A 4XCYA 1QLRB 3NZHL 4R2GB 1FFOB 2A74B 3MRLA 2R2CA 4MSWA 3W82A 1T5XB 1LE5A 4G7YL 4XCNA 4L29A 1DQML 1TCRA 3UTSD 2FJFA 5KOMC 1PG7H 4JR9H 5KVDH 2ADIB 5C0AE 3HE6A 5JHDA 2QHRH 2FBJL 3L5XL 4GRWH 1Y18A 4J3SA 1N2RA 1Q38A 3H6JA 5GGVY 4FQPA 2ZNXA 4QY8A 5IF0B 4CUCA 3QUYB 5LAXB 3O81A 3WLBB 1R5VB 2FGWL 4JDVA 4M93B 2Y4SA 4RAVB 2X4OA 1I3UA 4YFLI 2F74A 5IB4A 1KCLA 5FYLH 3OKEB 2DQIH 1D5XB 5JXEC 1YY8A 1NGPL 1PVHA 3EO0A 1P7QA 3MOBL 4PY7A 2X5PA 4OD2B 3BDBA 1SYVB 5C0IB 2R1XB 1A7NH 4X6EA 4KMTL 4U1HA 4Y4FA 5HYSG 4PJHA 4D9LL 1SEQH 1TQBB 4GQPH 2BP3A 4OD3L 3B2VL 3TVMC 5I1JH 4Y5YB 5IQ9B 1ND0A 3H8NA 4GRMB 4M8VA 3DUSA 2W59A 3VDAA 3KPNB 5DJCA 3V5KA 1KBGL 3I6LE 3OGCA 2G9HA 3O3DA 4WDIA 5D7JA 4IRSC 5ITBH 2BMKA 5BS0D 4B50A 4JB9L 1EAPB 5IFJA 4RGOL 4F7TA 2Z4QA 3CU7A 2DMCA 3ULVD 2H3NA 4OT1L 5F8RC 1FC1A 4NM4L 2IGFL 2IPUK 4IMLB 4UILL 4FFWC 4MMZC 2BNQB 4GS7B 2DLHA 3FQTB 4L9DA 5MI0B 1F2QA 2PXYD 4Q2ZA 3HAEG 4ONFL 5HDLA 3SE8L 1J1PH 3CSPA 1MCKA 4X83A 3VRLF 1KXQE 4O5LH 2FDBP 5KZCB 5LGHL 4J4PA 2V7NA 2HT4C 43C9A 1FO0B 1A1NA 2PNDA 5TE7H 2CDGA 3IDIA 3RNKA 4QYOA 3GSVB 2XN9E 2R1YB 3FFCB 3QIBA 4NN7B 4QXTA 2BNQE 3VFPA 3SDXB 4L4TA 1KXVC 3GMLA 4XHJD 5E00A 2FO4A 5F7KC 1F42A 5EBLA 1DBAH 4KK9D 3S9DB 2CUIA 5DZOA 1FVCB 3CK0H 2YEZB 5B4MD 1RUML 1AGCB 1CG9A 1RURH 3RWDA 5F1KC 3VFVB 5HI5D 3MLXH 1EBAA 5LXGH 3DVGB 3BPNC 4LDEB 4KI5C 4OV6F 5D5MF 1W0WB 1E6JL 5C09E 1GCFA 1NSNL 3IDYC 1C16A 3VXME 2P5WB 3VWKB 4F7MB 5GS2H 1J9CT 2APBA 3FFCE 2OMBA 5IJKA 3GMNA 2R2EA 3SDXE 2KH2B 3V0AC 1AO7D 5F1NB 2XA8H 5D2LF 1H3UA 3T04D 1HH6A 5JW4R 1CDYA 3K8KA 3Q5YA 3L3DA 2HT2C 3WSQH 3CFDA 2NTFB 4RIRA 1KLGA 2GK0B 1S78D 3ZKSD 3SDCA 1KJVA 2VE6A 3M17B 2QEJA 1WZ1L 1UZ6F 3ZSTA 4QOKD 5GGSA 4KHTL 3VJ6A 2OQJB 1YN6A 3PXHA 3QAZC 1A22B 4CADB 3CDGA 1FAIH 1OARH 3BKYH 4S1QL 3W11D 5FDWA 1I4FA 1R3JB 4PB9L 3CCHB 2WNGA 4FS0A 4APQC 2V6HA 4FQ1L 2XTLA 4RZCA 2ATKA 4NM8H 3U4BH 4EN3B 2I5YH 2P8MB 5GISH 4HS6A 1KPUB 2DTML 1KB5B 4R7DA 2R0LL 5I1HL 1CGUA 1AKJB 1IGJA 1T22B 3FO0L 2XNAB 1QSFB 5DEFA 2EDJA 4F37F 1BZ9A 3WO4B 2Q87A 3VXUE 5IVXF 3FMGL 4M00A 3OHXA 5GRJH 4Y16B 3ARFB 4KWUA 1JYNA 1CICD 3F8UB 5GRVL 2OTUA 1CGWA 3L9RA 1RJZA 1X4ZA 1SBBA 2O5ZL 2GAZA 1M7IB 3V0VB 1FIEA 2DQHH 2N7AA 5MERB 5HPOA 2HKHL 1JTTA 5J1TC 4X7FC 5DO2D 3WS6A 4G9DA 1TVDA 3S4SB 4U2YA 1BWWA 3EO9H 4F9PA 4KUCF 1MH5A 1W0YT 2FWOB 1RULL 3CU1A 1EXUA 4FQIH 4NQEA 1PY4A 4F37K 1X7QB 4KK5D 1QSVA 1XGPA 5D7SH 1FO0H 3PWNB 2WANA 3C5ZA 1HKLL 2BNRA 3VGAC 2EDRA 2EZ0C 3V6ZA 3GMQA 3IDMB 4R6UA 4BELD 3PWLB 3EYVA 3OKKA 4GKZB 1E28A 1N6QL 1REIA 2GJJA 4Z7VE 1GSMA 4ALAH 5JW4N 1PBYA 1MY7A 4AL8L 1CDIA 1UGNA 2AQ2A 5FF6B 1CFBA 3GIZH 1U3HA 4NT6A 2AJUH 1IL1B 1FYTE 3RHWK 4KJPD 4M62H 4NQVA 1IC4H 4QRPE 1ITCA 3H0TA 5F72S 4M6AA 4P3DA 5EC2B 5TJWK 1HYSD 1RZIA 2FHCA 1JGEA 1T3FB 2EDTA 4TSBH 4XVJH 3U82B 4IIQA 5AYQA 3VFGH 3HI1A 1JV5A 3ULUL 4WEBH 2JTDA 4PJGB 4HEME 3B9DA 5EPMB 4WI5A 4HWUA 5EULV 3DRQA 2X4QA 3ARDB 2EDYA 2C3GA 3VFNA 4MNGE 2B2XH 5GGRB 5C0AA 5AD0A 1LO3H 4MXWH 4NPYB 4HT1L 3SGKC 1T7WA 4WI7A 2W60A 4NKDA 1YDPB 3NCJH 4I9WD 2GT9A 1UM5L 5MP6L 3QZWG 1LK2A 2VSCA 4XWGL 3LKNA 4DUVA 1RIVL 1GRWA 1FH5L 1NBVL 1QFUH 1FFOA 4AYFA 4KUZL 4QGTA 2BVEA 4PJGE 3UPCA 4MQXC 4QRTB 1T5XA 2AJ3A 4Z8FL 3WJLA 4LLMB 2ATPB 2DIAA 3FFDA 1KIPA 2FSEB 3C09C 3IDGB 4OIAA 5T1LA 1VSCA 1KOAA 1YNKH 2XG4A 1F97A 5KVEL 3MUJA 2NY4C 1T2JA 3G08B 2NXYB 4YIQB 3BX7C 5FIEA 2ZG2A 3UEZA 5IF0A 2CGRH 5LAXA 1T4KA 1U92A 1J0YA 3WLBA 5HHOB 3VFOA 2ENSA 2FL5B 4G6JH 4KI5F 4D3CH 2WBWB 3MXWH 1JRHL 3QEGH 4HPYL 4TSAL 4MDJA 4R90L 2F15A 4HKXB 3WIFB 3WNPA 4CDGC 3FQRB 1YEHL 4OD2A 3U1SH 4OZGE 4I5BA 4W4OC 1S7SA 3C60C 1R3LB 4MVBC 5C0IA 5I75B 3NCEB 2IPKA 1XGQA 2I25N 5IVNA 4KJWC 2WW8A 2Z8VC 1KEGH 3ZDZE 2OBGA 3K2MC 4LAJH 5FYKD 4P59L 4Y4HB 1IAII 3OR6A 1P2CA 4X7DC 4FFYL 4HDIB 3I75B 4Y5YA 5IQ9A 2NYYD 1ADQH 1VACB 5EZIH 3GMPA 4XVUD 1RI8A 1IZJA 2DQJH 2Z31C 2XTJD 2NY3B 4LP5A 3TH2T 4WIQA 5C8JB 4OI8A 1HHJA 3I9GH 2WIIB 4WWKD 4X9HA 3MA7A 2VITA 1EAPA 4DKFH 3AREB 1I1RA 1Z9OA 1T7VA 3BPOC 4KKLD 4CVXA 1TFHA 3BGFC 5T5FL 4KRPC 1P5UA 2JCCF 3QRGL 2XN9A 1YEIL 2WZPD 4LHUB 4ZXBB 1DUYB 1C7TA 3C5JB 2BNQA 2ZCLH 5IT2H 5TPWL 1XCQB 2IALB 3ARRA 5FUZL 1Y6NR 1L4IA 1JPTH 4HIJB 1A8JH 4G8GD 1UB5B 4XXDA 4NNXA 1A7RH 1QBML 1FO0A 2UVFA 5C09A 2A73A 5BXFB 1Q0XL 1AIFB 2NQCA 3VXMA 3GSVA 2OL3L 2Z8SA 5I30H 3FFCA 1L7TH 1NUNB 4N68A 1MJ8L 1UM4H 4GKOA 3F7VB 4OJFH 5JW3H 4WI6A 1MHCB 4X7TA 1KN2L 1YNLH 1AGCA 1FLRL 3D2UD 3ZSSA 1ZKAA 2KL6A 5F6IC 4I18A 3CUPB 1YPZF 5K93A 5CBEB 2JK5A 3O3BB 2AK4D 3DVGA 3SCMC 1RY7B 3K4AA 2A38A 5DQJB 1A6AB 4YAQB 4B5EA 3GRWL 1WEJH 1HN1A 4FZEH 2OR9H 3T8XB 3OQ3B 4H0GA 2WINA 3S5LB 3U0WL 4HFUH 2IMMA 3QIUB 4Y2OA 2CO6B 4NN6B 2Q7YA 4K3JH 4PGZA 5F1NA 1FBIL 1L0QA 4LFHD 3K74B 4NZRH 5F3HB 1G9EA 1H5BB 3VCLA 3WFDH 5DJXB 4WVRA 1RIHL 2Y1VA 3MRJA 3EFDL 1F3JB 3QQ9C 2NTFA 5CIPB 1ZS8B 4N8VG 3RI5K 4AEIL 2B8OT 3JV4A 2Y36L 3RU8L 5IFAH 3R8BB 2GK0A 4Z77B 4CMHB 1V3JA 2VR4A 4O51B 5L0QC 2KUTA 4LGPB 3VXUA 3J7HA 5I15L 4G42B 4MNQD 2Q8BL 2V5SA 5ICXA 4FN0A 2VDRH 4JQVA 1E4KA 3MGTB 3G5XA 1G7HB 4LOUD 3CCHA 1FDLH 3BP4B 4FFZH 2I07B 5GIRB 2E5EA 3RVTC 3LCYA 2P8MA 3SQOL 5I66A 1KPUA 4P2RB 1CD9B 2QSQA 2A0LD 3MRQB 3QDJD 3LDBB 3NFPB 4QCIA 1T22A 3L3HB 4NC2B 3WDHA 2BXZA 4ZTPH 1ZEAH 4X9GA 1U2CA 5HGBA 4Y16A 3ARFA 4GBXA 1OAKH 1MRFH 1ZMYA 1CI5A 1NKRA 2Q7NA 4RMVA 1CTNA 4UTBH 4YXHL 2ENYA 2GW5A 3MOAH 1TVHB 5EOCL 3HS0A 5F89B 4Z7VA 3QXTA 2Q86A 2FLRT 1M7IA 1CDGA 4HFWA 2E7MA 1WIPA 3C8DA 3VXSD 4G8EB 4YPJA 4GRLC 7FABH 1OAZL 3S4SA 5C0CD 4Z7UF 2AP2A 2OYPA 4JDTL 4NJ9L 1FYTA 4Y8DC 1ADQA 2FWOA 1I8LC 1UXWB 4QRPA 1M7DB 1X7QA 2YD7A 1HNFA 1UZ8B 3PWNA 5EORL 5FB8A 3QO0A 3ZT6A 5KSBE 4X6FB 2EDKA 2AEQH 3MV9D 4N8CL 3V7AE 3RKPA 3T08A 3F7QA 3JV5A 3OPZL 4KVNL 4YXKH 4Y1AD 4MNGA 4Z0BH 2EIBA 4MQTB 4WCYH 3ARGC 5CGYD 3JUYA 4X98B 1QFPA 3P30L 4POYA 5I6XB 5E4IA 1I3RB 1BZ7A 1F2XK 3JVGC 4ZUUA 2YPLD 3TZVD 4XPBH 5TQ2H 2M1KA 1I8KB 1VB9A 1T3FA 3RUGF 5DRNB 5EO1B 4D9QD 3QI9B 4PJGA 4PUBL 5EPMA 2YUZA 2BJMH 2V17H 4TQEL 2ITDB 4NKMA 5K9QI 4JQXC 3O6FC 2VSDA 3WEXB 4OM1L 3BIKB 4KQ4L 4EI5A 4NPYA 3U7AA 5E4EB 5F7HA 2AQ1A 3V0WL 2V9RA 4MCZB 5CIPH 5C9JB 2VDPL 4DTGH 3MRGB 5TH2B 1DQDL 2VAAB 3B9KB 3FQXA 5H8DA 4PJXE 5KJRH 2PO6A 5DMJB 4QRTA 2J7LA 4LLMA 5DD3H 4ZFOA 1J0HA 3VXRD 2AK1H 4OZGA 1L0XA 5HHXH 1DBBL 4XPHH 3EJYC 1MVUB 2ORBH 2DQEH 1GPOL 1FC2D 4QXWA 3V2AR 4YIQA 1DDHB 1PG7W 3DGGA 2HFGH 3BPLC 5D93C 3FO1A 5DUMH 2AJXH 3D85B 4TVPE 4JM2B 3U7YL 5D7KE 1GHFH 3WO3B 3WIFA 5DD0H 1FNEB 3L95B 4ELMB 1YMMB 1WF5A 5AG9A 1H8OA 5F7LB 1LILA 4PJ8C 5TFSH 1VERA 2AW2A 1IILE 4QRQB 1UG9A 4UTAL 1F6LL 2D31B 5E1AA 4M7ZB 3QA3B 3DRTB 1CF8H 1G6RL 1A64A 3BT2H 3MYJB 1U41A 5HDQL 1NMCC 1NEZB 4Y4HA 4IOSD 1BQLH 5DURB 3B5HA 4HDIA 1VFBB 3I75A 4N0RA 1BECA 1T2XA 4LU5L 4RSVA 2ZCKL 2W9EH 2GJZA 1VACA 1H8SA 3CSYB 3BQUA 2DWEB 3S88H 4HQQH 3KHOA 5C8JA 2D7TH 2YRPA 1RUPH 2WIIA 2WBJB 1C5CH 3RZCD 2X1PA 4U1LA 5JW5B 1TPXB 2YZ8A 5GS0D 3MA9H 1IT9L 2NW3B 1QBAA 1S9WA 4DKEL 1DVFD 5C9KA 4ODVH 4ZXBA 3RWCB 4FABL 1XCQA 3UTTD 5GJSL 1E6OL 1ZOXA 4UB0L 1DZBA 4HIJA 5E2VH 4LRIC 3K8MA 1BJ8A 3FO2B 2R0ZL 2VTFA 1CGXA 3VA2C 1P9MC 3MV11 5T3ZE 4FQ2H 1JNLH 5F9WC 1HHHA 5JOEA 5M7QA 3VFUB 1D9KC 3GBMH 4M1CC 5DJ8B 5F7DB 4CVZB 2C7UA 1BP3B 4UBDC 1SVCP 3TYGH 1JNHA 4IDJL 2BNUB 3P4MB 1G7QB 3ARYA 1S7QA 3WNNA 1MHCA 3VI3F 4HUNB 5DMKA 4CNIA 2ID5A 3G6JF 4TVPH 3CX5K 3X13B 1YEGL 5D7IF 4PS4H 1ZTXL 4KK8D 4ZD3H 5CBEA 1LO5A 3FRPG 4M5ZH 5SWSB 3MBXL 3QIWC 1A6AA 1SM3L 5CMAB 1KCRL 2OJZL 3HNVL 4UQ2B 1FJ1A 4ENEC 4YAQA 3F12A 3MRKB 3RBSA 4PY8J 1CQKA 4F2MA 1A47A 3O9WC 3CXDH 4JPWH 4JY5L 3VXTB 5IR1A 1H5BA 1X5YA 5HVHC 1A4KA 1K2DA 3UDWC 4K2UL 4Y0GA 4FA8A 4CJ1A 1AFVL 2FATL 1AQKL 4Y5XC 1IM9D 4QRUB 5DJ0B 1QOKA 5CIPA 5FGRA 2EYTA 1IZKA 5SWSE 3AB0B 2H32H 4OSUL 2DKMA 4O51A 5EZLB 4PBXA 3AU1B 4XNZB 5D1QA 1JCKA 5CEYB 4RGND 3MACH 4YHLH 1FZKA 4LCWB 3DMMB 3FB6B 5F1OB 2VERN 3LVEA 1RZFH 2DL2A 5D71H 4YPGB 3K81A 3CFKB 1CU4H 1KELL 4AM0B 5IBLC 4XC3H 1NANH 2UV3A 2X09A 3EHBC 5F1IB 3RDTD 2WWKT 4N0FB 3AXLA 2J5LC 2FECI 2FEDC 5L7XH 5T3XL 2MCG1 3DSNA 5JLZA 2WUBL 5JZ7D 5L2JB 5IHZB 3LD8B 3EGSB 3MRQA 5CILL 5CZXD 2GKIA 5L8JB 5FDYA 1Q0YH 3VWJC 2BVPA 5HPMA 4OQTL 1ORSA 5L6YH 1F6AA 4BZ2L 1AGDA 5T3ZH 1PZ5B 5KSBA 4J23A 2NXZB 4X6DF 2X7LB 3BESR 3EYQD 2AEPL 3SKMB 15C8H 5F9JB 1JWSA 1WAAF 5ESVB 2FX8L 2YRZA 4IMKC 4MCYB 5MHSE 2BFVH 2R56L 3HE6D 1IKFL 2Y7QB 4G8EA 1NAKH 3E6FA 3S96B 2VXQH 5BCAA 2I9TB 5ADOH 3U30C 3N1QC 3OG4B 3INUH 2LFGA 4NSKA 1WTGT 4BSJA 4PJDF 1EAJA 4ZDHA 4QHLA 3TH3T 1UZ8A 3L3OB 1G7MB 2D03L 3X3FH 4G43B 5K9KA 1P7QD 3I6GB 4S2SB 4DW2L 5J13C 4OB5H 5H94A 4U6YB 3T0EB 3T2PA 3DV6B 1UWGH 3KYMB 2ZPKL 4Y4FD 5J1AB 5I1IH 5K59F 5HHMB 2QLVB 1UT9A 2Z0BA 2CXKA 2YN5A 2H8PB 1IEBB 4JVUA 3QJHB 2CLZA 5DRNA 3VH8G 3CVHL 2IF7A 5EO1A 2A6IB 4PJXA 3RY6C 4TOYH 3QI9A 5CZVH 3V4UL 3MRBB 2ITDA 4P4RB 1PKOA 5DD5H 4HJGB 4PJ9B 3D39D 3ARBA 1A6VH 5IQ7H 1X5JA 3DVNA 5JXAL 3NCYS 5HHME 4XCCH 1I3GL 4XMKH 1TETH 2R9HD 1J0JA 3F6LA 4PRAB 4DK3A 4WV1B 1NPUA 1UJTA 2A83A 3MRGA 4AIXA 4ODHL 3B9KA 3IXTB 3QHZH 3I6KB 4A2MA 5IHUL 4N9GB 3JWDL 4KJYA 3QNYB 3GM8A 4QNPE 4WHCA 1LP9B 1G0XA 3VMPA 1CT8B 3BJ91 1A7PL 3GNML 1JYWA 3FOMA 5E2TL 5EZOH 4PG9A 3GKZA 3GJFK 1F6FB 2W92A 2KQMA 3T2NH 2DD8L 4L8BA 3MLUL 2XV6B 1X5AA 1U8LB 2J3SA 3P3YA 3W39A 3D85A 2WQ8A 1HDMB 5ACZB 3L95A 3QQ3B 4YDLB 1QUNA 4OCYH 4O4YL 5ALCL 5D1XD 5KVFH 1NUGA 1WTLA 3EOTL 2H32A 3QCVL 4Z6AT 2FCBA 3E2HB 4XAWL 1WFUA 5C0GB 4K94C 3QA3A 3ROLA 1FG2A 2EXWC 1NEZA 4U1GB 4PJEB 1KFAL 4YGVB 1OM3L 2J8UB 1VEOA 4F7PA 2CKNA 2JKXA 5B38A 4HWBH 3P9MB 3U36B 2C9AA 3OL2A 1NMAL 4WUUE 3LRSA 4GT7A 5BV7H 1INDH 1IBGL 3CSYA 5T1KB 3O6KH 4X6CF 3QH3B 3MRNA 1BBJA 5AWNL 1WFNA 2EH8L 3P0YH 4O00A 2A6JB 2Y9RT 4WTZG 3K1KC 1KIRA 2WBJA 3IDNB 3WXVH 2XQBL 3PWVB 2AVGA 2CIKB 4PP1C 5HGHA 1X5LA 4PJEE 2IPTL 2NW3A 2J8UE 2CMRH 3RZWA 3O4OB 4EXKA 2X9XA 3VW3H 2C4FU 2Y6SC 5J12B 4G8IB 2FX7H 3HFML 4LIQE 3RWFA 1KGCE 1X6NA 4PRDB 1CFVH 5CINH 5FK9A 2OCFD 2ZJSL 1KEML 4NQCB 5HDBF 3SOBL 5E2UL 4AJ0A 4JRYD 5HYQB 1P1ZA 1KACB 5J0BA 3JSSA 2I60L 3QUZB 1I9IH 1ZGLP 3M1BA 5FYLD 5DMIH 3D5OF 5DRWA 3T77A 3UTOA 5DT1L 1OPGH 3ZE0F 2PYFA 1CFTB 3I02B 3PV7A 1K8DB 3PP3K 2BNUA 1RK0B 1RMFH 4KKCD 1F58L 3SJVB 3MLSL 1I7UA 4BYHA 5HTSA 4JKKA 4XRCB 3X13A 5FUCE 2V2WB 5IK3A 2AS5M 3BEVB 5SWSA 3ULUC 5ESQB 5CMAA 4UQ2A 2ZKHL 2DQCL 1CBVL 5EOQH 5I8CA 1LEIB 4XB8A 2BNRD 1S7VB 2PTUA 4M6OH 4ZQKA 3VMNA 3FAWA 3WJJC 1G7IA 3GM0A 3TNMB 3EYFA 3CJJA 3LKOA 4Y2DB 3SJVE 2XZCH 1D3CA 2EKSB 5KS9F 2GHWB 3BP7B 1DQQA 4QRUA 5DJ0A 3UO1L 3WFEL 4WFED 2UWEE 2HVJB 1MAMH 4C4KT 2IAMD 1P6AB 2Q76A 4RRPG 5IEHA 5M95B 3RTQB 1FNSL 1WK0A 3DYOA 3STZB 2P45B 3O3EB 1OD7A 2V7HA 4Y4KC 3DMMA 1RZJL 2C3VA 2K3TA 2Q8AH 1U36A 4YPGA 1HOCB 1RHFA 4NUGL 2O61B 1CD1A 4U1SB 1MWAL 4XAKE 3RAJL 4NQXA 3VFTB 3VGBA 2X4PB 5LKNA 1FORH 1MCFA 4LIQH 2EKJA 4MXQD 4NNYB 4I0PB 1PGRB 5L2JA 4U49A 5AZ2H 4V1DE 4X6BA 3GBNH 3O8XB 3HE7B 4RQQB 1AD0B 5FHBH 3KJ4B 5ERWA 1A3LH 4OCRH 4HXBH 4ZAKD 1T1WA 4X9FA 2AERT 2PTTB 3A6BH 2Q6WB 4DWHA 3NIDF 1A6TB 4R26L 4X8JB 2ICWI 3SKMA 1EIBA 3NA9L 2MWCA 1KENH 2BSTB 2E27L 1NAML 4QRSA 4C83A 1CQYA 5ICZA 5F7YC 4MCYA 2Y06H 2G5RA 3MGOA 4FZ8L 4H88L 1DL7H 1A9BB 4OFYA 3REWA 4MA1B 3UBXA 4DGYL 4W68A 1OAXL 4FTVE 2DJUA 5LG1A 5CJBA 1U8JB 4P2YA 3QUYD 2VXTL 5EWIH 4LLQA 4RGMC 2E6QA 2WSKA 4HWBA 4KRMB 1EVTC 2BY1A 3H3PL 2C1OB 2RCSH 1CK0L 4IJ3C 3UAJC 3V4VH 2YA0A 1UKTA 4JKMA 3V95A 4HS3B 3G04B 5E5RB 4ELKB 5HYSB 3ZDYF 1AD9B 4IRZL 1A2YA 3I6GA 2XWBB 4S2SA 4P3CH 2BRRL 4U6YA 4H25B 5DJ6B 1MHPL 4LQFL 3GJFH 2OMNA 3BH9A 3SGEI 4AQOA 3KYMA 4LCCC 5CEZE 1KB9K 2OXHA 3LPWA 4K55A 1WJ3A 1F90H 4LLVB 3VA6A 5I74C 4J3OC 4HIXL 1RJYA 5A43C 2XRAH 3QWRA 2R8SH 3SBWC 2XZQL 3QJHA 1B88A 3RIAK 4JG0H 1IAMA 4W6XB 3BOVA 4IOFC 2A6IA 1R3HB 2VDKH 1DQJB 5I8KH 2FLBT 1CYGA 1HSBB 3UJTH 3KYAA 2DIBA 5J9PA 1GGUA 1MVFA 5EU7E 3DTXB 3X14B 5EUKA 3S35L 3HAEB 3NH7H 1VEMA 4JZNA 4X4XB 1BLNA 4U3CA 3IJYA 3MLWH 4WHYH 1GJIA 4YX2H 3IETB 2XN9D 5KSAC 4RMTA 1BGXL 4FQJL 3KGRA 4S0SD 1U8NA 4QHMB 1DFBL 2BNQD 1T5WB 3IXTA 5MENB 3QPXL 3I6KA 5IV2B 2Y5TB 3O4LE 4N9GA 1YN7A 2EDLA 3PG2A 5I2IA 1JUFB 35C8L 4MQSB 3HR5B 5HD8D 1ZLWK 1WIUA 1CT8A 4R4FL 3BD5A 4CW1B 1HILB 5KZCD 1J0KA 2QKIB 3U9UA 3TA3A 3CC5B 1JPSL 1QBBA 1S5HB 1NFIB 3QDMA 1ACYH 1NCWL 1P84J 5ESAA 5KS9E 3LKSA 3MJGX 3FFCD 2JB6A 2UZIH 4YE4H 2IBBA 1RUAL 5MENE 1U8LA 2DQTH 3RPIA 1NCBH 5FO8B 2RAMA 3D3VB 4TPRL 1HDMA 2NR6D 5ACZA 3QQ3A 4WUUA 4HX1B 5DUPL 5A3IC 4YC2B 1ES0B 1RVFH 4K23H 5KG9B 3FN0L 5D8JL 4ZFFB 5J6HB 1EZVX 4DZBB 1ZGLA 5B4MC 3ZDXF 3TO2B 4J3UA 2EICA 5HI5C 5CEZH 4KVCL 4X8XA 4XP5H 2P5WD 3VWKD 4PJEA 2DMBA 4MS8D 2J8UA 2OI9B 2V5MA 3PIQA 3S36X 3KS0H 5ISZE 4JCMA 2CR6A 5JDSB 3D3VE 4M6MH 5IMOB 5CJXC 4OLVH 3QH3A 1WWAX 5CLTA 3ZL4H 4HUVB 1KJMA 3NIDE 4XT1C 4CU8A 4LSTH 3MROA 4FMKA 2XPGA 2CRMA 1ZA3B 4U6HB 1DLHB 3PWVA 4LBEB 2CIKA 1M71B 5E5UB 1MRCH 2DI8A 3OSKA 2CJUL 3PHOB 1J87A 5D1ZA 3RWGA 3PV6B 1S78C 4EBQL 1VFAA 5D2LB 3AS1A 2FYYB 43CAB 5IB5A 4EN3D 1FE8L 3CNKA 2VDML 4O9HL 4XNXH 5DA0B 2BDNL 5GRXG 3ZKNC 3P11L 1A6WH 1ZT7A 1AKJD 4DFHA 1U8HA 5HYQA 1OL0A 4ZODA 3UCRA 3ILPB 2NNAB 1QSFD 3QUZA 1HZHL 3JUZA 4F7CA 4HIIA 4YBQD 4LSUL 1I1AA 5CD3B 4XP4L 1SYSB 4Y16D 3ARFD 2R4SL 4PGCA 3I02A 3LOWA 1I8MB 3VD5A 1I9RH 2OP4L 3FN3A 3GJFA 4P57B 3LV3A 4HKBA 3SJVA 2J4WH 3QNXB 4OLZH 4S0TD 2AV7B 1OF2B 1MCRA 3QDHA 4HIEB 1AXTH 4AEEA 3PHQB 2UWEA 1FYTD 4OUOA 3IAGC 3C6LA 4CGTA 4HG4K 5ESQA 1U6AH 4P3WA 1HSAB 1MRDL 1L9MA 5HGGS 5IVXB 1MHEB 4ZFZA 4LHJB 2EDBA 1PG7L 3GSNB 4JR9L 1G1YA 2DKUA 4WU7B 2ZSWB 3BHBB 2QHRL 1M05B 3G5VA 5IB1B 1YNTA 5DFVC 4KK5C 3TNMA 1Y0LB 4WO4C 2FD6H 2AJZB 4Y2DA 3IF1B 3U6RA 1A1OB 1CXEA 2EKSA 1RIUH 4XPAH 1HI6A 1IVLA 2QSVA 1LGVA 2DQIL 1ONQB 2NX5B 4V1DA 4Z7WB 3KPMB 4CKVX 4EUPG 3TBTA 3STZA 1A7NL 1T83A 2XFXA 1AI1H 4RAUB 3MO1B 4KJPC 3LZFH 2E7CA 1SEQL 1N3NA 2DN7A 1BQHA 1VPOH 3ZYZA 5I1JL 3T4AB 3ARDD 3QZWB 3NOIA 4DKDC 5DDHA 1HYSC 4U1SA 5HHQB 4NOBA 2J8HA 2AXGB 3VFTA 2X4PA 4UOW0 4NNYA 1XR9B 3RX7A 3ESVF 3AS2A 2NX5E 4FTVA 4Z7WE 3HE7A 4RQQA 3OKOA 4ZO6A 5CBAB 4IRSB 1AD0A 5SWQA 5ITBL 3J8F7 3WN5A 4ZNCD 1FV1B 4MD5A 2Q6WA 3WKMH 4JY6A 5IKCB 1A6TA 4U05A 4P5KB 4G6AC 2BERA 3RJQB 3DETC 3P2TA 1FFRA 2NY6C 1ZVHA 2X44D 5GGVH 1A9BA 4IS6A 4POUB 5E1HB 2D9CA 4GW5A 1F3DH 4FQXA 2NXYD 4JREB 5I9QB 3KPTA 1J1PL 2BY3A 5ID1A 4EOWH 2W0PA 5HHOD 4WI8A 3WUWG 2C1OA 3B9EA 3SY0A 5EH1A 4O5LL 3WNMA 3OB8A 1D5MB 1IAIH 3PL6A 4ELKA 1A6UH 5HYFA 2UUDK 5DUBB 1SMAA 3JTSB 5DSCB 5TE7L 2O93L 2HJLA 4LNVA 4U1IB 2QQNL 2CR3A 4H25A 2DTSA 4LCIH 3GGWA 4PP2B 3ZKQD 3MBEA 2BVOB 3I50L 4S1SL 2ZCHL 4WW2A 3PDOB 4LL9A 1LO0H 5CLWA 1DBAL 4Y4HD 1KT2B 3ZTNH 3FT2B 3CK0L 4D0DB 5FOJA 1M6OB 1RURL 4GLRI 2J88L 1U9KA 3GMOA 3BPNB 1HHKB 1AGFB 2BVTA 4RAHA 5LXGL 3TFKD 3D0LB 1F5WA 3P4NB 4CMMB 4EDWH 3IDYB 3O4LA 1DQJA 3HZMB 2NY3D 3I85A 4L3EB 5DA4A 3OAZK 3KR3H 1UQSB 1FCCA 4BSWB 1IC7H 3H9HA 3BVNB 1S3KL 4TTDD 2YS4A 1AHWB 1YQVH 1B0WA 2XA8L 3X14A 3ARED 1ED3B 4FQLH 4X4XA 5MEOB 5FGBA 2AXJA 2QR0B 4X4ZA 5HHVL 3ZMRA 5F9OL 5KS9A 1W72B 1CDJA 4WWKC 4ERSL 1KG0B 3B83A 3ALWA 4NO3A 4PJ5B 4ZXBD 4KU1A 4JZJC 1FSKC 3V6OE 5MENA 5EBGA 2AJVH 5D9SB 2W0FB 1Q9OB 3EOBA 3ECBA 3QAZB 4N5ED 3V8CA 3STLB 1BOGB 1NFKA 1PX4A 4CW1A 2IH3A 2QKIA 3FZUD 4OF0A 2DLFH 2MMXA 3CC5A 1OARL 3BKYL 4APQB 5DEGA 2UYLB 3WFHA 1S5HA 3OF6D 1FNHA 4MB3A 3U4BL 1KIQA 4NM8L 2JCCB 1N6UA 5JIIA 2I5YL 4Y5VC 5EUOF 4PJ5E 1NCAH 5GISL 1D5ZA 5ISZA 3SE4A 4KDTA 5FO8A 5CCKH 4MJ5B 3D3VA 5I1CL 2NY2B 2VISB 4MAYC 4U6XB 5EBMB 1IAKB 5F3BB 5GRJL 3CVIH 1Z3GH 4ZFFA 5J6HA 5EZJA 5EU4B 3QXAA 3CXHK 4FQHA 3BN3B 1GZQA 5I1DB 1V7NH 4CL7A 5EG6C 1A4JA 1CLYH 5HXMA 5A2IH 4G5ZH 1NCCH 4Z5RA 5CKAA 3ULVE 2DQHL 3T3PF 3JWOH 3QIUD 2G5BB 1NC4B 2YA2A 4X4ME 1SJEB 1ZA6A 4M1DH 5GGRY 4HJ0C 3EO9L 5TE6H 1T89C 5IMOA 5JA8B 4ETQB 4FQIL 5GS1B 5J6GB 5D7SL 1FO0L 1BIIB 1YPZB 5FGSA 1UJ3C 3S34H 3FB5A 4LKCB 4BA8A 5FCUH 1ZA3A 5E8EB 5F6HJ 4ALAL 2JJTC 1M71A 1MFNA 4FQCH 5MEQB 4AH2A 3QUMB 2EYRB 3PHOA 1LNUB 3SPVB 4WHTB 5JA9A 3EDDA 1QQDB 3TBVA 3LKPB 5DJ2A 5F21B 5EDXA 3PXJA 1R0AH 1LEKB 2IQ9H 3MR9B 4M62L 3SDAB 1IC4L 3EYSL 4YHIA 43CAA 3C2AL 1ZWIB 4XVJL 1X3DA 1T6VN 4P2RD 5DD6B 3VFGL 4WEBL 4LOUC 3MRRB 1IGCH 3ULSA 4TULH 2ICCA 3NAAL 1MJUH 2NNAA 3MODH 2ERJC 3QQ4A 3KLDA 3O6MH 1B4JH 2B2XL 1XGRA 2MJWA 3EFFB 4ISVA 3T4YB 5CD3A 5DMGC 1SYSA 3H3KA 4MXWL 2X4NB 3NCJL 4PJAB 1CLCA 1W72H 1I8MA 3CFIC 3KHQA 1AO7E 5I73C 4P57A 2NY1C 3BRGC 4P99A 3TPKA 3I3BA 3QNXA 3RGVB 1OF2A 4OZFG 1BZQK 2C3XA 1H3VA 1QFUL 4HIEA 2IBGA 5DHYB 4BFEA 3PHQA 1HHIA 4UINH 3DX9B 5TF1H 5BZDB 4ZO9A 3NZ8B 3T2OA 1MHEA 3ABZA 2MQ0A 4U1KB 2FHFA 4NOFA 1G7JB 1YNKL 2XY1A 3BHBA 3U9PH 4E0RA 2NY4B 3BXNB 1JHKH 5IB1A 1CFQA 3ULVH 2VB5A 4G6MH 1XGTB 2CGRL 1Y0LA 3AS3A 2ZUQC 1GVIA 4CU6A 4G6JL 1INQB 4O2CA 5EIVA 2X40A 4D3CL 3MXWL 4LQ1A 3QEGL 4GAGH 3LMJH 3C60B 1ONQA 2NX5A 4Z7WA 2GCYB 3U1SL 3JWDC 2UUDH 1UH2A 3KPMA 4R7NB 5CGYC 4KZEH 3NN8A 2ARJB 2ZSVB 2Q20A 1K9TA 3B2UD 1A02N 4HS8L 3RVXD 2F5BH 1T0MA 4Q6IA 5BOPA 3QI9D 1KEGL 1CXFA 3HKFA 2ZUTA 2BOCA 5HHQA 4OD1H 1F45A 1ADQL 4XC1H 5EZIL 3QWOB 1Q1JH 4LAQH 3DX8B 3TCXA 5HVGB 2DQJL 1B0RA 1QO3B 2WP3O 1YMHB 3WS3A 3KPQB 4L8SA 5IROC 2VDOH 3IDUA 2H2SC 5CBAA 1RPQA 5IW6A 4NQSB 3DVIA 4JHWH 3B9KD 3I9GL 2MCPH 4MB5A 3HPJB 3BPOB 4DKFL 4TVPD 4IEFB 4KAQH 3BGFB 1U8KB 3QUMH 3DSFH 4OKVB 4MAUH 1CLOH 2D0GA 3TGXA 4MWFA 4E41B 3OXRB 4QTHB 3BSZH 5C86A 2HLAB 2ZCLL 5HHPA 5HYIA 3GSXB 5IT2L 4IDLA 2NY0C 3KYOA 1KIUA 4Z9KB 1X4YA 2APWA 3P0VH 1JPTL 4KROC 5DK0B 3T3ME 3MRIB 3BO8B 4K3GA 4OCMC 3C6SB 4PYGA 1FFPB 3D85D 2GSIB 2ADJA 3NACL 4FG6D 4JM2D 1B0GB 5D6CB 5DUBA 1NGZB 2PCPA 5DSCA 1TITA 1YMMD 2EEDA 2DOCA 4E41E 1MCPH 3DBXB 5I30L 1ZLUH 2G60H 2YOCA 1L7TL 5E6IC 4DEPC 1UM4L 3UTSA 4OJFL 3PDOA 5FV1L 1ZHLA 3GDBA 3FT2A 5F6IB 3WUZA 3KPSB 5DURD 5AZEH 3SCMB 5FOBB 4ZFOL 2YUXA 3OXSA 4Z76B 3MFGB 2VLJB 3D0LA 3WMSA 3V6OA 3P4NA 4G3YH 1GIGH 2VZ3A 1OP3H 4HKJA 3LS5H 1WEJL 4FZEL 2OR9L 3BZEA 2Y07H 3W2DH 4QXUH 1YEDA 4BSWA 1UQSA 4HFUL 2HG5B 4M8QA 2RHEA 2WBJD 4K3JL 1AHWA 3L3GB 3DROB 3UJIH 2HT3D 3LQMA 5DVNA 4PV8B 1ED3A 4YR6B 1T20A 5I0DA 1A21A 3WFDL 2XWTB 3KPOA 4NHUB 2QR0A 1FFNB 2N56A 3KPSE 5BQ7B 1R3KA 1W72A 3RX5A 4KZDL 1CVSC 4PJ5A 3BIBX 5DJDB 2VLJE 1C1EL 1U42A 5IFAL 2NZIA 1QLEH 2O5YH 4Z95L 3V4PH 3H7BB 2BSED 4A6YB 1MHHB 2VDLH 3MREB 4LFHG 3VI4F 4FQQA 2XI9A 3P0GB 2VDRL 3U0PA 1RHHA 4HCRH 1FDLL 2C1PB 4FFZL 3SDYH 4P46C 4POZD 5FYKE 1KPRB 1T66D 4PRHB 1T1XA 5LQBH 4X4MA 4NIKB 2C4XA 5E94B 3MV8B 4NP4H 2AXHA 4I4WA 5E8PB