2DQEH

Crystal structure of hyhel-10 fv mutant (hy53a) complexed with hen egg lysozyme
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSASGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqeH00
1IAOA 2VLJA 3GIVB 1EEQA 4M62L 5FKPA 1AXSB 1X5HA 3FRUA 1ZLWK 1NSNL 4FNLL 4NNPL 3WBDA 1JIBA 1MVUA 3BVNB 2JE8A 5KZCD 4LSQL 1W0VB 1PY4A 3OR7B 3DETC 3MNVA 3OKLB 1E4JA 2XXCB 1E6OH 4QTIH 5F7LB 5CIPH 4E42A 4HIXL 1AGEA 1VGEH 2AXFA 5TFSL 1XGUB 4M7LL 4PJ5B 4LSSL 3BYYA 5D7LA 2NY2D 3A0OA 1INEH 4WCYH 4MJ5A 5ITBL 5I16A 1RUAH 1WGOA 3B9DA 3HMWH 3UTSB 2C1PB 2EYRB 3LD8B 5IT2H 1XF4B 3O3EB 4Q58C 3P4OB 2R2BA 5E0QA 3TN0A 5CGMA 1FBIL 3PWJB 5DD6B 1ADQA 1T1ZB 1CIUA 1LE5B 1HQRA 2DOCA 5C0EA 5C0CE 3LRGA 3STLA 3KPOA 1N5AA 5HI4C 2ID5A 5CINL 4TTGA 4WTWA 1XCTB 3DBXB 5IVNA 4QWWC 4L3CB 2A77L 3BT2L 2N7AA 4KJQD 3L3OB 1KTDB 4LGSB 1VESA 5FB8A 2NY4C 5JLZA 2BJMH 4FA8A 5DYOA 4M3KB 4JM2C 4I0PB 3QEQA 5D71L 4TUOA 4UIKH 1X7QA 2FO1A 4WO4A 1UB5B 4OAWA 4JQVA 5A3ID 3RWIA 1T7VA 4BFGA 5I8KH 3D2UD 1G7PA 2YZ8A 3T2OA 1W8NA 3R0NA 4D8PA 2Z35B 5EZJA 4PD4J 3LDBB 2HAZA 4HFUL 4KTEL 3S6CA 2IC2A 1GZPA 3S34L 3KR3L 4OZGF 5KAQG 2H3NB 1KB5H 4KJWD 3S4SB 1A0QH 1DEEB 2DTSA 4FZ8H 2EIZA 3ZT5A 5LJYH 1GGBH 1OAUH 1QLEH 4E5XB 4PG9A 5GIRB 4QRQA 5LBSL 1I8MA 3BD5A 4GBXD 4NQCB 3H0TA 2XG5A 5E4EB 3B9KA 1MREH 4I3SL 2FH6A 2UYLA 1RZKH 3LQZA 3SDXB 2IPTH 3OAZK 1N5YH 3LHPL 1NDMB 2NZIA 5C2UB 4L1DA 1JL8A 2XXMB 2EDNA 3M1BB 5DHVA 3OG6B 3SJVD 3SHSA 5ETUA 5FKAB 3FB8A 3C8DA 4ZTOL 1MH5A 3KXFA 1NLDH 4CADA 5GHWH 2DWEB 3MRKA 2ED7A 2DBLH 5MENA 2G9HB 2I9LB 4UDUA 4NRZA 1JNNH 4QNPF 5DI8B 4WDIB 2VO5A 3ARDC 5HHQB 4LCCB 4YHNA 1NBZA 1E4XL 1JZ2A 1RK1A 5CUSH 1P4BL 1FFPB 1IGYB 3H9YA 1MAKA 5DVKA 3L3IA 3MNZB 2R56L 1MF2L 5E9DA 3OXSB 3JXAA 3OPZL 2R0ZH 3IS0X 1Q72L 1UZ6E 3CPLA 1ZA6A 4BUHA 4RX4D 4PTTA 1LK2B 4CVZA 2OI9C 4EI5C 1JE6A 3NGBC 4CL7A 4Y1AD 5DQ9A 4P9HH 1J0HA 1F97A 2VITB 1YN6A 2Q3ZA 5JOEA 2RIKA 4RMWA 4LLWA 2YPKA 4WW1A 3QUML 2EIEA 3FCTB 2Y6SD 4DVRL 2PW1B 3BWAB 5T5NF 2FEDC 4ODTL 4UOW0 3QUZC 4KDTC 3JVGC 3VFVB 2YPLE 4EUPA 1KTKE 2QLVB 1YMMD 4J3XA 3T08A 5ISZA 1QYGH 1HZHL 2IAND 4ODWB 4URTB 4M6OH 4N90D 5J57B 1CXIA 5EOCH 3G5YA 4XNZC 4Y8AA 5J06A 5LQBL 1FFOA 5ITFA 2O93L 1MI5B 4GAYA 4MA3B 1LP9E 3P3YA 3JTTB 3L3GA 4XTRD 4EDWL 1AY1H 3NABL 5CEYA 1VFOA 3ULVD 3BD3A 3TYFB 3QH3B 1XIWC 2HT4C 4PJBB 2XOTA 2H6PB 3C6LC 4PRHE 4APQB 5HHPA 1IVLA 2J6EH 2IH3B 3CIQA 5JZ7D 3MA9L 1UENA 2R23A 1CL7I 3DX9B 5DMIH 4DZBB 4PGBB 2X9YA 2DQJH 1D5MA 1QKZH 1B4JH 3D0VA 4MZ2A 2A0LC 4PRAA 4HKZB 4DAGH 1QSEA 1FYTE 2CDFB 1PLGH 3AAZA 1PFCA 3U9UB 4YC2C 4R4ND 4PV9B 3E8UL 1T83C 4PTUB 2X4UB 3WFCL 2GT9A 5H37G 1F4YH 2W91A 1FIEA 5IB3A 4NZJA 4QHLA 5SWQA 3UPAA 2J5LB 3OGCB 4XCYA 5AAWA 3DROB 4OSUL 3G6JB 3VXUA 1TQBC 2F54D 5SWZD 1G9MC 2EO9A 3WNLA 2FLBT 3JTSB 4UV4L 5CWSA 1YMHA 3TCXA 3GDBA 4L9DA 2GKIA 5JO5A 4L3EA 5CEXB 1IKNC 4HCRA 1WICA 1FZJA 5ERWB 3UP1A 5HYJB 4G6FD 4G3YL 1F2QA 1EAPA 3U0WL 3U7AA 4AM0A 3PGDB 3VE0B 3TZVA 1XF5A 5I1GH 2AEIT 2FATL 1NUNB 3LV3B 3QUYA 1HEZA 1Y6KR 2WWKT 4PRPE 1N8ZB 4PJ9D 3VGDA 5D7IA 3F7YA 4GRLA 5BO1H 2G2RA 2NX5B 3BPCA 3FO2B 4YGAB 1S5HA 5KSUA 3SGDH 3JV6B 3S36L 1U8IA 1G7JB 3IKKA 3X12B 1CK0H 2ARJA 4LCYB 3ALPA 3ARXA 3PWVB 5KSBB 2VE6B 4KKCD 3QRGL 1A6AA 4Q6IA 1RIUL 3RIAF 4UTBH 4YHZL 4OGYH 3ZKMC 4CNIA 4MCYB 2Y7QB 2AJYL 3EGSB 4OD3H 2X7LA 1RUPH 5KVGL 2VLRE 3L7FA 4AMKH 1I7TB 3QPQC 35C8L 4YNYB 3I3DA 2WM0A 3UAJC 3D25B 4PREB 4MXVF 1OF2B 3X13B 4NWTL 5HI5D 3Q3GA 5DT1H 5IKCB 3C60C 3O11B 5MEPA 1LE9A 4N8CH 1J1PL 2CIKA 3IKCA 4Y5VB 4XP1H 4BUGA 5CJ5A 4JHAH 3DVGA 5CSZB 3V5DB 2VLMD 4IM8A 3IAPA 4L9LA 1OP3K 3GJFB 1GGIL 2VDQH 1SMAA 2RR3A 5F21B 5HYIA 5IBUB 5K33A 3VGAB 5BVJA 2IQ9H 1ZHKA 3DX7B 3W2DL 3B5GA 1B2WH 5F88B 1T22A 5CBEB 4EN3B 2W38A 3MLYL 4BELD 3DRQB 5HYEA 4TVPL 4G9FE 3WKML 4IMKC 4PJDA 2FRGP 4KKLD 3UMTA 3QAZB 4JGUA 4F37F 2DIJA 1QEWB 3CAFA 4PGDB 5EBLA 1QSZA 1UZ8B 3P4MA 4JRXB 4MS8D 3RAJL 1ULVA 4JVUA 3V8CA 2JIXA 5FM5M 4HXAL 3K2UH 4OZFA 1FVEB 4HF5L 1BM3L 1CLCA 1LD9B 4LPXA 2IADB 4Y4KD 3U0PA 1WZKA 3OKDB 1UJTA 1Z9SA 3QWRD 3UTQB 1A8JH 1I3RB 3ZE2E 4I0KA 5AYUL 4ELMF 4U0RB 5SWSB 3E2HB 3MV7B 5MEOB 2FIRT 3RVTC 4WW2B 5ICXA 1A6UL 1BZ9A 4ZFZB 1JWMA 4S10A 3RIFF 4F7PA 5C0JB 4YGVA 4S1QH 4PGZA 4ZOCA 3RJDA 4EI6A 5IMKA 3CMOL 4R0LC 1T21B 43CAB 2NQCA 1EEZA 3VXRD 4LSVL 3WEXA 5E9DE 2EXYC 2GEEA 4YQXH 4YFLI 3CVHB 4IOFC 4OI7A 2AXGB 2CKBL 4LL9A 4MXQD 4K94C 2XA8L 5D7JC 1X44A 1MCPH 2NY7H 2NY3D 3D69B 1FN4A 4OIAA 2ZG3A 1F5WA 4JB9L 1E4WH 4MAUL 1YEGH 1EHAA 3GJFH 3KLAA 4KZDH 2BK8A 1VFBB 3JBG7 4EDXB 1XCQB 4QO1A 1UYWH 2ITDA 3WUWB 3H42H 4C4KT 1A1MB 2DMBA 3SGKA 5LVEA 3ARTA 2CPCA 1G7IB 4GRWF 3C9NA 2OK0H 5K9OA 2J1KA 3O8XA 1F90H 2VLKD 2VDNL 1QHOA 3MUJA 4XBPB 2OP4L 3ZKNC 4ZPVB 3O2DA 2F8XC 4YJZL 4XPAL 3CUPB 4G7YL 3P9LA 2H8PB 4MCZA 1JZ5A 3CSYB 3O9WD 3QWQB 1C5BL 3VXSE 3O6FB 2VDPH 2EEBA 2LU3A 3S3JA 4FQ1L 1K8DA 5IMOA 5T3XL 4F37K 4O4YL 1I1RA 1OOAA 2PO6A 1M7XA 4LFHD 4Y4HA 3QFJB 4NZTH 4RFOL 4H25B 3B3IB 1XR8B 3MSPA 2VZ1A 2CLZA 1C1EL 1R3IL 2ORBH 3GSUB 3HTLX 1QFHA 2Z9TA 4JY5L 5DD3L 2E7HA 5I1LA 2VAJA 5EFIA 2A9NL 4ZO6A 3RX8A 4GG8B 3TESA 2BVPB 1NMBL 2EE6A 2VH5H 5F7DB 1U2CA 2ESVA 3PGCB 4JLRB 1FNSL 4LLYB 2RJMA 3NTCH 5DJXA 4NBYB 1HXMB 3IGAA 3LKRA 3QO0B 4V2CB 4Z76B 4ZO8A 3KPLB 4JFYA 3RIFK 3KPSD 1BOGA 2ZOKB 2E8YA 3BPNC 1A7BA 1FHGA 4JDVA 5KVFH 2ILLA 5DRZB 4MYWB 4ZSOB 5FA3A 3QI9B 1F3RB 3MRRB 3CVHH 4MNHB 5EBMA 1BD2E 1FORH 3VXTB 3ARQA 4GKZA 5EZOH 4MNQD 4QTIL 3DVFA 1IGJB 3STZB 1ZHBB 4YX2H 2Q7NA 2BNUB 1VGEL 2BERA 5KZCB 3I3BA 3U1SH 4MQXD 2XWTB 1INEL 4WCYL 4N5UA 1NDGA 2H41A 4G8FA 4ZAKD 5LG1A 1VFAA 1RUAL 1FO0B 1RZKC 1A9EB 3N0PB 4MMXC 1UXWB 2H1PH 3GMNB 3QEHB 5C0DA 3WN5A 5EIIA 5EO9A 1FJ1B 2FH8A 2NY2B 3D85A 1PBYA 4F80A 4ENED 3W39A 5F96H 3SBWA 1I85A 1NANH 2B8OT 1CFTA 2ZWLT 4OLWH 5GRVL 2YA0A 3PL6A 5CJXA 1LK3H 3QCTH 1EEYB 1Q9LB 2WANA 1S7UB 2OBGA 1BVZA 5IV2B 3K1KC 4X83A 3TBSA 5DJAA 1KGCE 3W11D 4QHUB 1HDMA 4A2LA 4PGEB 4X98B 3TT3H 1FFNA 3LD8C 4PJGA 1KPRA 2BJML 4Y2DA 3B9VA 1JHKH 3DVIA 2BOCA 4IRJA 3MGTB 4NQEA 5IWLC 1P7KA 4D0CB 3KNBB 1LO2L 3GRWL 4WJ5B 3IETB 5IJKC 1XGYH 2DI8A 2I26N 5F7FA 3VXMD 3HR6A 3L3HA 4NO3B 5FIEA 5GJTH 5TF1H 2E9WA 3ZT7A 2SEBA 1DQJB 1YDPB 5EZLA 4XAWH 4MWFA 3DHMA 4CJ0A 1A0QL 5E56A 3D2UB 3NAAH 4L1HA 3T0BA 3W0WD 3HKFA 3QEGH 1IC7H 2RAMA 1YEEL 3FQRB 4S2SB 4NBZB 4P9HC 3VGGA 1OAUL 4U6HA 3DYMA 2EDKA 4AG4H 1ZKAA 4KUCF 3WE6B 4HWNA 1UACH 2HFEB 3GMOA 4XXCC 5GS2H 3TH3T 2HP4A 3T04D 1X6NA 4M5YH 1OT1A 2EEDA 5D5MB 1MREL 3MRGA 4NCDA 4LVNB 4PGCA 1KYOK 1ND0A 4FQLH 2IPTL 1N5YL 2DL9A 3LDBC 4GBXB 3RNKB 1JGLH 4RAVA 1HE7A 4QHNB 4E41E 2EDYA 2EYSB 4OF6A 2D31A 4KHTH 2EDLA 4N0CC 1CT8A 4O9HH 1I3VA 3BP6A 2DLHA 3IXAB 5C8JA 3RZCA 4XWGH 3MFFB 1NLDL 2OJZH 1VA9A 4PUBH 1NAML 4G80B 4NWUL 4PRIA 4FFYL 1JNNL 3SJVB 5C0CD 4U1SA 5JHDE 3OZ9H 2X05A 3UPRA 3TA3D 3DX8A 5KN5B 1FO0H 3QIWC 1QSFA 4HUKB 5BCAA 3SDAD 3MLTB 4RFEB 2ZUWA 4RIRB 5CUSL 1DLHA 3NOIA 2DI7A 5E08L 2DQGL 4ZUTB 1FYHB 5I1IH 3MBEC 2VJXA 3C08L 4NKQB 1MCWW 2PTTA 3BGMA 3NN8B 5GZOD 2CLRA 5EO0A 3SPVA 4KAQH 4Y19A 3MCLL 1RIVH 5M94B 1KLGA 1CLOL 1U92A 3KYMA 1CXLA 2HT3D 3BP7B 3MJ9H 5I17B 2E6QA 5IB1B 2ZCHL 1TIUA 4XX1E 4Y1AB 1SEBB 1KTRL 4P2OD 4JAMA 1A4JB 4G8EA 4HKXA 3KYNA 1IMHC 2BSSA 4ZO9A 3TVMC 3H9ZA 5F1NA 3IJSA 5IHLB 4CMMA 3DRTA 3QIBD 3MBXH 4TNVF 5KSVB 1FAKT 5GXBB 4M6OL 1NL0H 5DJYB 2BOBA 3BGFB 3I2CH 5FK9B 4OD1H 4JANB 1YMMB 1FP5A 1N2RA 3QDHA 1YYMH 4ZUSB 2IANB 1MQKH 3IDGA 1AY1L 3OKYA 4X6DA 2CSPA 4ZNEA 1MFCL 3PQYD 2CIIB 3FO0H 4HUUA 1YNTA 1E4KA 3BIKA 4C57C 4M61A 3V52L 2X1XR 5IJVB 1KPUB 3O3BB 2FJFA 1T6VN 1FL3A 2J6EL 4KUZH 4PP1C 5JNYA 3MOBH 4Z5RA 1XAUA 5I19H 3L3KB 1KOAA 5HGBB 4WEUD 4HIIB 4NQDA 4CDHA 2DQJL 2NY1D 1IT9L 4ETYA 3RWHA 1QKZL 1B4JL 1H3VA 3SKUD 4DAGL 4P23D 4HIEB 5IW3A 4OZHA 4CVUA 1PLGL 2V6HA 2VIRB 2YPVL 4I2XE 3BW9B 5INDA 4D0DB 4UBDD 3V5KB 4WWKA 4ODSH 1G1YA 5F9OH 2XY1A 4Y5YB 1ITCA 4PRDA 2ZNXA 1F4YL 3GKZA 4DN3H 3QHZH 1WV7T 1X5FA 3KYAA 3BYTA 4JFQA 5KS9B 4P9MH 5C0BA 1QFWH 1F3DJ 4ONHB 3VD3A 1IC4H 1S7WB 4Y2OA 4K3DH 5DK2A 4JY6B 1MCBA 3Q6FA 1P2CB 3FQXB 5B8CA 2F54B 5SWZB 1KCSL 1NCBH 5ID0A 1L7IH 2F58H 2FJHA 2AQ1A 4X6BA 1O0VA 2A1WH 5J11C 1SYVB 5D7KE 3OJ2C 1KTLA 4HAFA 4NO5B 1AHWB 3DVNB 4J4PC 4KK8C 2AERT 5FGCE 3Q5TA 4X6FA 1OL0A 3UZQA 5D2LF 4CW1A 5D2NB 1OB1B 5I1GL 1A6VL 5JXEA 2O5YH 3EO0B 2X1OA 4G6FB 3JV4A 5DJDA 3V6FB 4K8RC 4PJEA 4UUJB 4I77H 4TSAH 1CYGA 4R3SA 5E6YA 4OZIF 5I1CH 3WNMA 2DLEA 1QR1A 4CVWA 5GSVA 2ZUUA 1LO4H 1WTLA 3BE1H 1CK0L 3T65B 4OM0H 1VFUA 4UTBL 2ZSVA 1T20B 4N0UB 4OGYL 3HE6A 3ARVA 4LDOB 4Y8DC 1W72A 3ARGD 2VZVA 4NKIH 4QHKI 3DX6B 4TSBL 5ID1B 2X1WL 4AMKL 3ULVH 2BVUA 1NBVH 2R2EB 1QRKA 2NTSP 3LKPB 4GG6A 1WBXA 5FO9A 1AR1D 4XC1H 1D5BB 5DT1L 4G43A 5I1EH 4N8CL 2P42B 4WI3A 3MRLB 4XP1L 4JHAL 4Z0BH 2HTKD 3SKNA 4PJGE 1MELA 4MA1B 5F7UA 4GXVL 3BWUC 2VDQL 3F7VB 1VKXA 4K2UH 4O2FA 3ARWA 1FVCB 3DNKA 2B20A 1H3PL 3DTXB 1I1AD 2IQ9L 2XZCH 1B2WL 1EV2E 4OQTA 5F3BB 3OKEB 4IMLA 3QQ4A 3IFPB 4PY7A 1JNJA 4MD5B 4Y5VC 5JXAH 4OFIA 1U8MA 1G7MB 1S7XB 1MAJA 3JWNC 1H8OA 2VLJD 3L95B 4HPOH 1R24B 2WWMC 1B90A 5HDQL 3VGAC 1OWWA 5GS1B 3MJ6A 5EA0L 1MNUH 1OAXH 4ELKA 4JKPH 2Q7YA 4JFOB 3K2UL 2GK2A 4EN3C 1NBYA 3HNVH 4FG6D 2B7DT 1OW0C 4GRWE 2F15A 1L6XA 2COQA 3CFCH 3KAAA 4PRNB 3LEVH 5C0IA 4KGJA 4LMQI 4Z7VA 3TN0D 1CDYA 4G7VH 3QAZC 2UZIH 4Y4KB 3O3UN 3G6AB 4QCIB 7FABL 1XGPA 5D4QA 2VLRD 4OFKA 1RHFA 1JV5B 3L5WA 4S1QL 4G9DB 3U36B 1LEIB 1OWRM 1I1FA 4JDZB 4NQSA 1ZTXL 1ZVSB 1KF9B 1SHMA 2ITCA 4WFHD 4K3GA 5H94B 4J7RA 5DMJB 2LAAA 1WT5C 2IG2H 1DP0A 3CLFH 3GSQA 1OHQA 4GW4A 3WNOA 3KPQB 3WNNA 4PJXB 1JYWA 4U0RC 1U8OB 1UM4L 3E2HC 3VXRB 4WO4D 1ORQA 4WW2C 5B39B 5IIEB 2F19L 1MCPL 2IBZX 4K3EH 3QG7H 4Y19E 3GM8A 1EHLL 4BJLA 1S7QA 4LP5A 2OTPA 2A6JB 2W9EH 4FFVD 2YKLL 5KBNC 5JQHC 4XCNB 1UYWL 1B0GB 2KQNA 3BGAA 3SOBH 3IS1X 3H42L 1AFVH 4FQCL 3WFHB 2YWZA 1JNHB 3QXTA 1YEDB 4WFGE 3OQ3B 3C87A 1D6EB 5J1AB 3PIQB 4TUKH 4GKNA 2OK0L 1DSFH 4RGMB 1F90L 3B9KD 1JRHH 3RI5F 1J18A 1NGZA 2Z31A 3AGVA 4GUPA 3CFJA 4Q2ZB 4NNXA 3RVUD 4YBQC 3C09B 2Z0BA 2VLKB 3C8KA 3UJTH 5FECA 2VSCA 5EC2B 2VDPL 1L4IA 5FUOH 3H9HB 4PJHE 1IGTB 3H9SA 3KXFD 4JJHA 4OCRL 5FYJD 3O9WB 5CLWA 3CX2A 3EO1A 3MV11 4NZTL 2HN7A 1A6WH 2BNRA 3ZKXB 1ACYH 5FOBA 3CDGB 4UIMA 1SJXA 2MQ0A 4X8JA 2ED8A 1S9VB 5F8QC 4J3UA 4PLKC 1MSPA 4K7FA 5DQJB 4OZHE 4Z18A 1KLUA 3O6FC 1TZGH 5E9DD 2VH5L 2XNAB 3EYVB 2H26B 3MJ7A 4NHUA 3NTCL 2EH8L 4F9LC 4WIQA 1GOHA 5GRUL 2EICA 5I8OL 2VB5A 2G60H 2V9QA 3UPCA 3FHAA 3L3JA 1ZS8A 3T4YB 2Z93A 1I8KA 3KPSB 4QGYA 3CVHL 3BKJL 1X4YA 4JRWA 2BHYA 5EZOL 3MV8A 3NACH 2RCSH 4YX2L 3WHXB 4XPFL 3LIZH 1PSKH 3WIHA 3TBWB 3F12B 2O5ZH 4KMLB 3GMMA 4MNQB 5EU6A 3CCHA 1T0NB 3HR5B 3QNZA 2IALB 3NIFE 3OTTA 1EBPA 2EDJA 1MCRA 1CFQA 3LPWA 5EZIH 1FZOA 4EUPG 2OSLA 5F96L 4KK6D 3MR9B 2EKSA 3RX5A 3VFUA 4U1JA 5SX4I 1IAIM 1MHCA 1C8PA 3QCTL 4YHLH 4POZC 2E9BA 2EZ0D 1G9NH 2ARWA 1CGWA 4EVNB 2PR4H 3NH7H 1BQHB 1AXTH 1HILA 3RI5K 3RL2B 3DXAA 3NPZB 3TT3L 5CZVH 5BQ7B 3V4UH 1DUZB 2GSGA 1NFDA 1JHKL 1A7RH 1T5WB 4LKXA 5LGHH 1Z9MA 3CZFA 1MLCA 4QOKE 1TXKA 3EAKA 1XGYL 2C3VB 4LLUA 1QSED 4NQXA 1WSST 3CFBB 5GJTL 5TF1L 5HD8D 2R0WH 5TDOA 3UYRH 4XAWL 4BH7A 3VXMB 3V2AR 2D7NA 2JJSA 1EJOH 2A6IA 4YAQA 3QEGL 1IC7L 4Z77B 1P7QD 1U8PB 1AGDA 5JQ6H 1AGBB 3OKOA 5ECJE 4ZOEA 4R90H 3CH1B 4AG4L 2E9JA 1UACL 3VXUD 2HH0H 2XWJB 3GMPA 3W0WB 1ZVYA 1NCCH 4HIHA 4F15B 4M5YL 1JTTA 3NCEB 1K4DB 4X99A 4P5KB 4QRRE 4X4XB 1CGSH 1HHKB 1TVBB 25C8H 3TF7C 2X4SA 1MCKA 1DJSA 2W9LA 5K9QG 1JGLL 4RBPK 3GEWB 3VG0H 5IW1B 5A3IC 2OL3A 1NAKL 1AC6A 3V7AG 1XR9A 4KHTL 3S37H 4O9HL 1YQ2A 4XWGL 4HKJB 5DVMA 4PUBL 4ALAL 3VD7A 5CD3A 4HGKC 4M43H 4QHKJ 4WHDA 4KJWC 3TZVD 4QF1A 5JOPD 1ZGLA 3VRLE 3OZ9L 3RHWF 4NFDA 4LVNC 1YQVH 3H3PL 2AJXH 4IDJH 5CHNA 5C0CB 3HRZA 3SDXF 1KGCD 2DWDB 3TA3B 5I1IL 1OY3B 1DBKH 2M26A 2G75B 3NCFB 2QEJA 3SDAB 4QYOA 1R3JB 1GC1C 1YPZA 1B9ZA 2MOVA 5KG9B 3ARBD 1M6OA 5DC0A 3FQNB 2AJUH 4KAQL 1UH2A 5DFTA 7CGTA 4FQPA 1JF6A 3QEUB 4LQ1A 1T03L 3I75A 3MJ9L 5L0QC 4Y16A 3P4NA 4Y7MA 1D5XB 4X5XB 1U95B 3I6KB 4F7MB 1A3LH 1IM9A 1A47A 3FQUB 2VC2H 4WTXA 5FGRA 1I1YA 1H15A 5E4IA 2AJ3B 4P2OB 5IFAH 1KC5H 3L1OH 3MBXL 4X7TA 3C8HA 5LGJA 3QWOB 4J8RB 4XC3H 4WENB 3NCJL 3I2CL 3T0EE 1AO7A 4P2RE 3O2WL 3TFKD 3DSFL 3QIBB 1YYML 4E41D 1MQKL 4JFDE 4UNTA 1TQCB 4PJCA 5F6HI 1Q0YH 1N7MH 3QHTC 4HHAB 5D70H 5GRZA 1IC5H 1CL7H 3R8QA 3QNYA 4KC3B 3MV9E 5HHNA 1JN6A 5D2LE 1I9RH 4KUZL 5DK3A 3MOBL 3MO1A 2CRZA 2VZOA 1DBJH 1WUNT 1VSCA 5I19L 3CC5B 3KPMB 4HG4K 1LEKB 3PQYB 1LILA 3T4AB 5JHDD 2JLLA 3LCYA 3TBYB 4ZD3H 4LLMB 2JIXD 3UTTA 4B53A 3BGFC 2C3WA 1Q38A 2I60H 5TDNA 3NFNB 4OCLC 1H3TA 1BFVH 4YDVB 5EU7C 2FR4B 3EDKA 2GJJA 4S1DD 4OZIE 4DTGH 3U0TA 1U8HB 4RWYH 5ESAB 1CD1A 3BDYH 3SY0B 2NY1B 2A6KB 4ODSL 4XHJD 2H2PD 5F9OL 4LCUB 3FB7A 4P23B 2X70B 1J0KA 4POYA 2GK0A 4XTRC 5LCVH 5K93A 5EUOA 3QHZL 3ULVC 2GITA 3IFLH 3ULUE 4BQ8A 4P9ML 3TC9A 5EWIH 2YD3A 3O0RH 4U1LB 4XP4H 1WQVT 5MERA 4WUKH 1I9JH 1QFWL 2VERN 1P7HL 1LEGB 4HUXA 1WK0A 4K3DL 2H45A 1MHHA 1JPGA 1V7MH 3GM0A 4WRLA 4BFEA 2VN4A 3FFCE 4Z95H 1FG2B 4YHIA 3VI3F 2QQKH 5IF0A 4YXLH 1NCBL 1L7IL 4OZGA 12E8H 2A1WL 1TETH 2ZUQB 4R4NC 2DIAA 5ICZB 5INCA 3C6SB 3EOBB 5L2JA 3BEVA 1EFQA 3ARRA 2O5YL 3DUSB 3G6JF 1A1OB 2AP2A 4M7LT 1TPXB 3MRBB 4JFXA 4JPIB 1VPOH 4UAOB 3UYPA 2FECI 4I77L 4JZOA 4TSAL 1JZ7A 4H1LA 3ECBB 5I1CL 3DUUA 4M1GH 2AK1L 1RVFL 3KDMA 3PXJA 4WV1B 3VFTA 1ZWIB 3BE1L 4NC1E 4DGYL 1N64H 2R15A 3EZ8A 1XF2B 4Z9KB 5D2NC 2NMSA 2HWZL 3HE7A 4O5LL 3BXNB 1U3HC 2Z8SA 1L0QA 2FL5A 3P9MA 5CSGA 3P77A 2BVQB 3ULVL 1XGRA 3P0VL 3V6OA 2RFXB 5M95B 2ICEA 5ESQA 4KK9D 2ZCLL 3ARGB 1MJUH 1U3ZA 3ZE1F 4XC1L 5E1AA 4Y4HD 2Y9RT 3B5HA 5DJ6A 1DTUA 1IILE 2H9GB 4JG0H 2HVJA 5GGVH 5GPRA 3HNTH 2JELH 3FOMA 4K2UL 2APFA 4I4WB 1UB6A 5T3XE 2Z91B 4LPYA 5KSBF 4CVXA 2C9AA 5F7EL 1OAKH 2H32A 1EO8H 3W5NA 4XGZB 1AP2A 1RZIA 3PWNA 5HHXH 4PJIA 4RDQF 1YY9D 1XGTB 1EH9A 2ESVD 1AC0A 1DANU 1HXYB 1BVKB 4H0IA 3CFDB 4HJJH 1I1AB 1T1WA 4ZFFB 1U8QB 4YZFF 3DSNA 4M93C 4MA1C 3D3VE 3FONB 1A6PA 4A6YB 4HPOL 5EU3B 1KEMH 1XGQB 3R06B 4XWOC 3IVKA 4MJ6B 1O7SA 5C6WH 1IAOB 1OAXL 4JJ5B 1V7NH 1JZ3A 4JKPL 2VLJB 3HZYB 3FRUB 2CLVA 3L7EB 3HI5L 1MVUB 1YYLL 1EUTA 4OGAC 3HNVL 1AD9A 1A7QH 1HKLL 2ZUYA 3MNVB 3CFCL 3LEVL 3MLRH 4HWBH 4P4KA 4E42B 3EYUL 1MHEA 4R7NA 2VLLB 1AGEB 1T4KB 5DMKA 2AXFB 1WFUA 4G7VL 2WP3O 2UZIL 3ARZA 3D85D 3UTPD 5I16B 3GI9H 4YR6A 3MZGB 5DDHA 3U2SB 3PL6D 2B0SH 3TN0B 3GHBL 3G9AB 4NN6B 3P30H 4KKLC 5L8KB 1X5XA 3RQ3A 2XN9E 3TGXA 4MS8C 3UO1H 3QP3A 1YZZA 2Q76B 4G8GA 4ODUA 4MVBD 4UOJA 4RGNC 2VLRB 1N5AB 2OZ4A 1OD9A 4GT7A 1AH1A 1MFBH 2IG2L 3CLFL 3VFNA 4Y2DD 3ESVF 4IRJD 4Y4KC 5DGQA 1X5YA 3IDJA 3MRJA 4O51A 4HEME 4PLJD 5CILH 1I9IH 3LKNB 3S36X 2XQYG 4JZJA 5JLZB 1ZA3B 1NQBA 3QG7L 4TUOB 4CN4A 4WW2F 5B4MD 4G5ZH 4WO4B 1J11A 1PZ5A 5JW3H 3LS4L 1P84K 2GJZB 3SOBL 1G7PB 5E2UH 4D8PB 2FX9H 1AFVL 5EZJB 1S5IH 1GZPB 4HUVA 4HBQA 3CXHJ 4TUKL 3JSSA 5GISH 4D9RE 4MXWH 1DSFL 3MUHL 3RY6C 4HMCA 1HINL 2EIZB 3VFOB 3ZKQD 1NC2A 3F8UB 5GGRA 1JRHL 4XBEL 2HG5B 3BRFA 1MUJA 1MWAL 1HIMH 1WTGT 4KPHH 5DJ0B 1I8MB 3H0TB 4RZCA 4A6YH 3B9KB 2ZUVA 3T3ME 5C71A 4WNQA 3UJTL 4XBGA 3MQIA 4MNGA 1LDPH 3C5ZD 3HNSL 3NFPA 3RX7A 3LQZB 1X4XA 3KS0J 4NQVA 5HVHB 3MUGB 3RZCD 3EOTL 2EDTA 1F6AB 1BQSA 4KFZC 4H5SA 2D7PA 4PRID 1B0RA 3KJ6H 2R29L 4EOWL 5DHVB 3D87B 1OQOA 4RGMC 4NUJA 1MCJA 5ETUB 3FB8B 3QJHA 1G9NC 3WS6A 1MH5B 3KXFB 2HA1A 4IS6A 1ACYL 4CADB 5HJ3A 4KK5C 3MRKB 3KLSA 5F89A 2FIKA 4NCC1 4WU5A 3PF2A 3QCUH 3C09C 3VFGH 1P69B 5FM4A 2EH7L 2YK1L 3B2UC 1NBZB 1QFUL 3VWJA 2R1XA 3VJ6A 4PJ5E 4OB5H 3TIEA 3O9WC 3X11A 1ADQH 2L0DA 5F9WB 1QLFB 2Z8WC 3UTSE 3L3IB 2ZOLA 5E9DB 4DVBA 3U7WH 3PNWA 4FQ2H 5HGDA 4NSKA 3NCBB 4HH8A 3UXFA 4Y19D 1BX2A 5DJ2B 3CPLB 3T2NH 1ZA6B 3AY4C 2V2XB 5IEHB 5F6HJ 4BSWB 1GGYA 1Z0NA 4X7FC 5IM7A 4I13B 3RUGA 1FNGA 4YEFA 4YHYC 4CVZB 3C2SA 3AU1A 3EYFB 1U36A 4JZNA 1MFEH 3ZTJH 2DKUA 5DQ9B 2RCSL 4L4TA 3LIZL 1KIPA 3UYOD 1P5UA 4X9GA 1KN4H 1YN6B 1SBSH 1PSKL 5E8OA 3HAEG 2O5ZL 5F6IB 4WW1B 1FIGH 5D96B 2NXZD 4TULH 4MSWA 3IDYC 2ZNWA 1T89A 1PKOA 2IH1A 1JWSA 4FABL 2GAZA 1V3LA 4U1IA 4C59B 1FVDA 4HGWA 4MA7L 4YHLL 2WLZA 4KZEL 4JFPA 3RGVA 4P48A 4AQOA 1AJ7H 1FFOB 1GAFH 2QL1A 4GAYB 2NZ9D 5I1KH 2PR4L 3NH7L 3BD4A 2W0PA 3L3GB 1QOKA 3CD4A 4LNRA 5CZVL 3QCVL 1IGFH 4NQDD 4NQCE 5LGHL 4ELMA 5HHPB 4RNRA 4UZGA 3S35H 5CCKH 3PJSA 4NPYA 4U6XA 2M1KA 3SDXE 2R0WL 2NW3B 5DHVH 1D5MB 2WLYA 4WWKD 3UYRL 5DHXB 5HTSA 2VSDA 3D0VB 1ZMYA 3ULSA 1QSEB 4EBQH 2BSTA 5C08A 2OS7A 3AAZB 3CK0H 3VH8A 1EJOL 1MRDH 4ONGH 5DUPH 3ZO0A 1T7YA 2B2XH 4MB5A 1NGXA 4HUWA 3HB3D 1ZEAH 5JMOC 4R90L 2GT9B 1T7ZA 2HH0L 2J8UF 5C0BD 1NCCL 4JDTH 4PP2A 4LBEA 5IB3B 5SWQB 4QHLB 4N68A 1P7QB 2DF3A 3WIIL 2DKSA 1CGSL 3QDJA 3VXUB 2JJVA 1EGJL 2BMKA 5E8DH 3FAXA 3VG0L 3TNNA 4HT1L 2YRPA 3MRNA 4TRPL 3LKSA 3KGRA 3I02A 4MZ3A 1YEKH 1D9KA 2W65B 3QXWA 1OLLA 1TJGH 4POUB 2YMXH 3V6BR 1B88A 2IPUK 4TPRL 2AJZA 2I9TA 2WUBH 4M43L 1XZ0B 1FZKB 1FZJB 2FJGA 2FO4A 2JCCA 4ZS6C 3X3FL 4F15C 1QRNA 3TO4A 1EAPB 4G6MH 5D6CA 2YHGA 5E2TH 3PG2A 1GGCH 4WHCA 1Q9OA 2AJXL 3TZVB 1JFQH 1XF5B 5D5MF 2C3XA 4IDJL 4R8WL 4M6NH 3LMJH 4KY1H 4PG2C 1HEZB 1UCBH 4AEEA 2ATPA 1BREA 5A16A 2Y23A 1DBKL 4KU1A 3F7YB 2G2RB 3Q5OA 5KSUB 4QOKD 1Q94A 1U8IB 3DMMA 4NO0A 4O2EA 2QSQA 2FZ3A 2X5PA 3HE6D 3RVXC 4BQBA 1KG0B 1NUFA 5DA0B 2AJUL 4Z0XB 1N26A 1A6AB 1MI5E 3ROOA 5D1QA 3DV4A 4BYHA 3ARBB 5DZOA 1CI5A 4LSRH 4CNIB 1MCWM 1ZK9A 3PP3H 1S9WA 3HMXA 3TA3C 2HYMA 1FL5A 2CMRH 3L7FB 4XXDA 5FA4A 4PJ7A 1NFKA 1C08A 3ZKSD 1T66D 1A3LL 3SDAC 4PJBE 1I7RA 4ZUVA 4HJGA 4D94A 3Q3GB 1LE9B 1NGPL 3IB4A 1MIEH 3IKCB 5IFAL 1KC5L 5IK3A 3CFKA 3L1OL 4U1MA 1ZT1A 3DVGB 4ZDHA 4OCMC 3S96A 4QXGH 4XC3L 5GZOC 2LTQB 5LAXA 1RD6A 4NC2B 4R97C 4X9FA 4UILH 1FPTH 3OKNB 5I15L 4CN1A 3NCYP 3SE9H 1ZHKB 1N7ML 3QQ3A 5D70L 1CL7L 43C9A 2HT3C 3QDMA 1T22B 2NY6C 4E41B 3FT3A 2D0GA 3Q6GL 1I9RL 3DGCR 4XCEB 4M1CC 5TQ0H 2HTLD 1DBJL 1MVFA 1YEIH 2HT2D 2R1WA 2WUCL 3BZFB 5KJRH 4I18A 1MFAH 4JO1H 4M02A 2I60L 5IR1B 1F3JA 2P8LB 3GO1H 4HCRH 1KIRA 4AH2B 1UVQB 5EBLB 3C5JA 3P4MB 3UC0L 3K2MC 3QIBC 4YDJA 5JHDB 4KMTH 2VXQH 4DTGL 1TQCC 2NXYC 2X4NA 2JIXB 2ADGA 2ATKA 3TCLA 1M05A 3QDGA 3TBVA 1ZHNA 2GCYB 5M7QA 5C0RH 4OZFB 3IDXL 1J5OH 2FGWH 1Y0LA 4LCWA 1TENA 2NW2A 3IFLL 5BOZG 5EWIL 4KXZI 3O0RL 4XP4L 4WUKL 3ULVF 1I9JL 1CFNA 4OGZA 4F7TB 4JM2A 1V7ML 3MGAA 5ICXB 1BZ9B 5ELIA 4Z95L 4N5EC 2DTMH 2NX5E 2QQKL 3WL9A 2BVTA 3KHQA 4YGVB 1CFSA 4YXLL 2ZCKH 3OKKA 4P23C 5C3LD 12E8L 3GSWA 1TETL 4EI6B 3U6RA 3BAEL 4E0RA 3PDOA 4UBDC 1EEZB 3QRFM 3WEXB 5DA4A 2WQ8A 1R3HA 1A3QA 1M4KA 5BZDA 2DRUA 3HRPA 5LXGH 5KS9F 3D0LA 1YY8A 4N1CA 3EFFA 3GIZL 4NN5B 4HBCH 2HVKA 4JFDD 3SCMD 4M8QA 3V0AC 3GMLA 3N50A 1VPOL 1AR2A 1JI2A 4X4MA 4GAJH 4MX7B 1CTOA 3KLAB 5L9DH 5IQ9A 1G0XA 1RURH 4OLXH 2FCBA 3U30C 1IE5A 1N64L 1A4KB 2Q87A 4OCSH 3C9NB 1P4IH 3FZUD 5K9OB 2AXHA 1NJ9A 1AGFA 2D7TL 2DQUH 3K4AA 3RKPA 4HLZH 4UAOC 2EDRA 3AROA 3ARDA 4YFEA 3KHOA 4MCZB 1MJUL 3H9SD 1HH9A 4H26A 4PRBA 5CZKA 2XKNA 2WINA 2HFGL 4LOUD 4I2XB 3SDDD 1BZQK 1OM3H 5T1KA 1HWGB 1EIBA 4JG0L 3ULUD 3MRIB 5GGVL 2BNRD 3ILQD 4X5WA 2PYEA 3HNTL 2JELL 5T33H 4XMKH 3RP1A 1JMZA 2F5BH 2GJ6A 5C0NC 4OZFH 4X4ZA 3EJYC 1EO8L 3FFCD 1QHPA 2HLAA 5CLTA 4HV8A 4EZMA 2FDBP 1K6QH 4EI5A 1CDGA 4NHCH 4JN1L 5I1LB 3V0WH 4OD2B 3WXVH 4WI4A 2FX7L 1NFIB 2P43B 2D4DA 1RZJC 2ESVB 1FRGH 4M9PA 3INUH 4TQEH 5SWSE 1CQKA 3BZ4A 3MV7E 3IGAB 3LKRB 4YEEA 4BZ2H 1KEML 1BOGB 3HLAA 3JVGA 2HTKC 1I7UA 5FUZL 5CFHA 1V7NL 4AK1A 3GSOA 3MV8D 4JDVB 1W8OA 3V4PH 4U31A 3PWUA 5FO8A 1A7QL 4HC1A 3T3PF 4YXHH 5EBMB 1MRFH 3G5ZA 5HDLA 2EIBA 3MLRL 4HWBL 2GTZA 2DQEH 5DJZA 5J3HD 4P5MB 4JQIL 5DJ8A 2PXYD 1XIWA 5ILTH 1GIGH 1NDGB 4G8FB 1VFAB 2KZ1B 3GI9L 1KT2A 1KIUA 4KTYA 4I3GA 2B0SL 5C0DB 3WN5B 5EIIB 5IB2A 4LASH 3P30L 4P99A 2PW2B 2P8PA 4LVHB 3DI2B 3W39B 3UO1L 1CFTB 1PX4A 3PL6B 2VXTH 4MA8H 4OFYA 5I74C 1BPVA 3DXAD 1DCLA 1IRAY 4FXLA 2YS4A 1G6RA 1MFBL 1YNLH 2BZDA 3T0AA 3O2DH 1CGUA 4FG6C 5C07A 4CU8A 1ODAA 2YEZA 5DJAB 2BVOB 2ICWA 3WD5H 1T83A 8FABA 1I9IL 3GHEH 1QR4A 5CGYD 1FFNB 3QISA 4PJGB 4BQ9A 5K9JH 1KPRB 4AIZA 4Y2DB 4NN6C 4OCXH 4HJ0D 5E2VL 4IRJB 3GBMH 1P7KB 5KANG 2GI7A 2R2HA 3L3HB 2DQIH 1QP1A 4BSJA 4L8DA 2SEBB 5E2UL 2FX9L 3TWCH 2YWYA 3BZEA 4FP8H 4LHUA 5EZLB 2JB5H 1F4XH 2MCPH 5GISL 3BO8A 1IKNA 4L5FH 3MCKA 1YN7A 4M00A 2VKWA 1PW3A 4MAYD 4PJXF 3DGGA 6CGTA 1HIML 5E2JA 1D6VH 2Y06L 1ONQB 3UTZA 4A6YL 4WHYG 2FBOJ 3MRGB 1LDPL 1AQDA 1BFTA 1HHGA 1QG3A 3VD9A 1SJVA 1MHPL 2ZUXA 4JRYA 2EECA 1BZ7A 3KJ6L 3ZDXF 4FTVA 5FOJA 2D31B 3C5ZB 4AYFA 1JGDB 1CE1H 1CT8B 1YA5A 3BP6B 2MSPA 3RZCB 1RZ8A 3TO2B 3SQBA 2C3GA 2CJUL 1TNNA 4PRIB 2XN9D 1L6ZA 4DWHA 3QCUL 3T0XA 1C16A 1IM3A 3V6ZA 1DQQA 3B9KC 4R26L 5E94B 2MTPA 3MOAH 5FM5O 3DX8B 5HVHC 5FF6A 4OB5L 4OLVH 2EC9T 5I8CA 3RVUC 1ADQL 3BP5B 2B1HL 1XH3A 3DOSA 4LLVA 2R4RH 4GAGH 4FMFA 3MXVL 4X7SL 5C0AE 5J13B 4TN9A 4FQ2L 3C60A 5EORH 1ZT4A 3O41A 2VDLH 4K23H 4U6TA 3BGMB 3T2NL 4PV8A 2CLRB 5I1DA 5F71A 4GQPH 3M07A 1OGAA 4Y16D 4YHOH 3D39A 1MFEL 3QUKA 4QT5B 4Y19B 5L88L 2XKSA 2APBA 1KN4L 5DS8A 3KPRA 1F8TH 1HNFA 1FIGL 5FM8A 4AENB 3OR6A 3KLDA 3O6LL 3RPKA 1DVFC 1U3JA 4W4OA 4IMKA 3LEYH 5SX4H 3MJ8A 1AO7D 5F1NB 3IJSB 1ZT7A 4CMMB 3C2AH 3KYKH 2WBJD 3DRTB 3HZKB 2C4FT 1VADA 1BIIA 2G5RA 2NXZB 3EO9H 3N85H 2A83A 5TE4H 4HKBA 2EKJA 1AJ7L 3CSPA 3T2PA 1GAFL 1IQDA 2P5EA 4ZOBA 3TLRA 5I1KL 1OTUC 1N2RB 4MJ2A 4PLNC 1ORSA 4X6DB 5F6IC 5J6GA 4LRNL 1BGXH 4PJHB 5JPNB 4YPGA 1IGFL 4HUUB 4JKMA 1YNTB 1SM3H 1V05A 1WEJL 5BW7C 1UJ3A 3UTTD 2X40A 5I9QB 4XMLH 1FL3B 5JNYB 5D5ME 4Z5RB 5CCKL 4NQDB 4YHPA 3CMGA 3QXDA 2C5DC 3RWHB 5FYJL 3VA2C 1K3ZA 3KPPA 3MREA 4OZHB 4EBQL 2YXMA 4DCQA 4KQ3H 4X4YA 5H2BA 1MRDL 5INDB 4HIXH 3MLXL 3OJVC 4ONGL 1JVKA 5TFSH 5IEKA 4WWKB 2EZ0C 4R0LA 2B2XL 3K3QA 2Q8BH 5IMLB 1LDSA 1ZEAL 1U93A 1KCKA 3MRDA 4PRDB 4QRUB 5ITBH 3SJVE 4JDTL 4P0DA 3TPUA 4MB3A 1ZAGA 1KEGL 1RU9H 2YA1A 2HJKA 3ABZA 2MHAA 3AXLA 4RA0C 5D8JH 1WFOA 3KPTA 4FXGA 4U0QB 5C0BB 2EC9U 3WO4B 5E8DL 3RDTC 4RMUA 5DK2B 3TJHD 1JTOA 3Q6FB 5HD8C 3RRQA 2OMNA 1YEKL 5B8CB 1TJGL 2YMXL 3BT2H 5ID0B 2FJHB 4X6BB 4KJPC 1MAMH 1KTLB 2VUOA 5CBAA 2DJUA 5D71H 2YC1A 2WSKA 2UZXB 3STBA 1K9TA 5JIKA 5E2TL 4X6FB 5ENWA 1GGCL 4CW1B 2X4PB 4NNYB 5ACZA 5CD5D 1BFOA 4W6WB 1U91A 5KSAA 2BSRA 3LMJL 4KY1L 4Y1AE 4LHJB 1UCBL 2B4CL 4WGWB 3QYCA 5DJDB 2HJFA 2ADJA 4Q9CA 3KS0H 1U8NA 3S34H 4C58B 1UXSA 3DURB 3KR3H 4PJEB 3B43A 4ZUWA 2NY0C 4JEGB 1JGVH 1QR1B 1HYSD 3HE7D 3BPLB 2C4FU 3TBTA 3TNMA 4OJFH 4B7IA 1UQSB 4ZYKA 5F97E 1JJUA 1YMME 2DKMA 5IOPA 4QOKB 3Q1SH 3T0VA 5A43C 1KBGH 3HE6B 4LSRL 1W72B 5B3JF 2CMRL 1WWAX 5JORB 2HFFB 3LHPH 3T09A 2P44B 4GG6B 1WBXB 2JK5A 5FO9B 2BY0A 5J6HB 1N3NA 4G43B 4UMGA 4ZTOH 1MIEL 5CJQH 3IRPX 3SKNB 3MLPA 3BEWA 4HLJA 4QXGL 3HS0B 4MLSA 4C4KO 3ARBC 4UILL 1FPTL 4W4NA 1KB5A 1QD0A 3SE9L 1FH5H 4B5EA 4GAFB 2ADFH 3NCYS 3KWWB 1SBBA 4QY8B 1WBZA 3ROLA 4V1DE 2X89D 2R56H 1MF2H 4PY7B 3KPNA 5TQ0L 2AV1A 3ETBF 4HS3B 3OPZH 4OTXH 1YEIL 4U4BA 1U8MB 5T5NG 1V5JA 2ZKHL 5KJRL 5I66A 4P5TD 1MFAL 2LTQC 3MOQA 4M6MH 4E9LA 4P2QE 3GO1L 4HCRL 2YRZA 5IW6A 1AXSA 1OTTC 1KNOB 3MNWA 4AEIH 4Y89A 4CU6A 1UC6A 3RWFA 2F54E 4TYUA 4ELKB 4Z7UA 3UJIH 2Q7YB 3OR7A 1UWXK 4R9HA 4I0CC 3OKLA 5C0RL 5CGTA 5F9JA 3RA7H 1H5BC 3TFKC 1J5OL 2FGWL 4HXBH 3WV0A 4XNQB 1NBYB 3QIUA 4OV6F 4CU7A 2W0LA 4FZEH 2PKDA 1XGUA 4FTVE 4DVRH 2OTUA 1KCUH 5C0IB 5TDPA 4YBLB 2FEEL 5HYQA 5BJTB 2AK4A 4HWZB 1XF3A 2C1PA 2EYRA 1G7QB 1XF4A 2AGJH 3O3EA 3ZDZE 4XVUD 2DD8H 5DD6A 1T1ZA 5IWLA 4G8GD 4EXPX 1XGPB 5FHAL 5IJKA 2DTML 5LQBH 1RV6X 2ZCKL 1DQLH 4NQSB 3QXAA 3NABH 4S1DC 4P57B 1XCTA 1G9EA 5IB5A 5HVWA 1W72H 2ITCB 4XHJC 3R8BB 2H2PC 1CD9B 4D0BA 4UI2A 3GSQB 4N0UE 3MA9H 4GW4B 3UBXB 2VYRE 5SX5H 4G8IB 5LXGL 1TCRB 1HHJB 2PYFB 3JUZA 4HBCL 5HDBF 5J12B 1OD7A 3BQUC 3EYSH 4XXCA 1G6VK 2H2SC 4WTZG 5I71B 5HBBA 1CZ8H 1XT5A 1NEZG 1KV3A 4I5BB 1S7QB 2VTFA 4KHXH 1R5WA 2V17H 4MQ7B 2Z35A 5L9DL 4JFDB 3SCMB 3E8UH 2Q8AH 1RURL 2JB6B 4OLXL 2H3NA 1WIPA 3S4SA 1T80A 2GSIB 5TE7H 3L5JA 4OCSL 3O45B 4OQTH 4YO0A 1P4IL 4K7PX 2X4RA 2FHCA 2DQUL 2VLME 3F7PC 4E5XA 4NN5C 4OF7A 3T3PE 4RGOH 5DFVC 3THMH 5IFJA 4OF5A 3NZ8A 4K9EC 3EBAA 4GUPB 3BUTA 2YN3A 3MGOA 4ERSH 4Z7WE 3QIWA 3OWEA 3KG5A 3QZWB 3C8KB 2A38A 3FAWA 1NDMA 1OM3L 4L8CB 5FUCE 4LSPL 2C7UA 5AD0A 3H9SB 3MBEA 5AYQA 3ZE0F 5T33L 5C0FB 3EO1B 4XMKL 2F5BL 3SDDB 4MD4A 4JM4L 2HN7B 2HJLA 4N8VA 2G9HA 1EO7A 1U42A 5DI8A 1RUKH 5FV1L 5FOBB 3VWJD 2FATH 4NHCL 3REWA 1G0YR 2R2CA 3V0WL 4MHHG 3WXVL 3GSVA 2GUOA 1KLUB 3I50H 3SDCD 3FFCB 5C92A 4JVPA 2VDKL 1WLHA 1FFPA 5EIQA 1RZGB 2XY2A 1FZMA 4KK9C 1FRGL 3MJ7B 3INUL 4TQEL 4NHUB 1INQA 3PHOA 3SGJC 2NY5C 5JW4Q 4ZFGL 1I9EA 2BHZA 5GZNC 1JUFA 3IRZA 5E70A 4HX1A 4U6VH 4O2CB 3TVMA 4TNWF 4DKFH 4KI5E 1ZS8B 5GS0D 1IAKB 4PGJA 1YJDC 4D3CH 2Z93B 2X4TA 2QADD 1K2DA 3MLSH 2EIDA 2GTWA 2OMBA 2I25N 4YXHL 4KMQA 5IROC 1MRFL 4LEOA 2VITA 3MV8B 4OI8A 1YY9C 2DQEL 2W60A 4OBSA 4ORZC 2ICWI 4NWTH 4PJXE 1VEPA 3B9EA 2NR6D 3VXRE 4KROD 1MY7A 1YEJL 1WWCA 1MFDL 3BUYB 1G7HA 3F7RA 4IJ3B 4LASL 1CFQB 5F7MC 2PXYB 4ODWA 3RGVD 2OSLB 4JFFE 5FCUL 4JR9L 2ARJQ 3PV6B 2EKSB 1MJ7H 1CWVA 4U1JB 2EEAA 4OZ4B 3JTTA 4Z7QF 2E6PA 1YNLL 3MLYH 1BMGA 3LS5L 3O2DL 2DMCA 1MIMH 5HGHA 3WD5L 1U41A 3VRIB 4ZQKB 2H6PA 2IH3A 1BHGA 5K9JL 5JR1H 2GSGB 4ZTPH 4OCXL 4LKXB 4XCFL 1JPFB 3GBML 4HWEH 3S3SA 4LVHC 1MLCB 2VLKE 3BX7C 1OT2A 2F53A 4KGLA 3PL6C 5C08D 4PFEA 5CJXC 5TDOB 3TWCL 3ULUH 3U9UA 3LN9A 2JB5L 1F4XL 4BH7B 2HKFL 2MCPL 4MVBC 4UDTB 4FQQB 3WS3A 3D9AL 4PTUA 1A7NL 4F58L 5BXFA 2A6IB 5EBWB 3MLVH 4C56A 2FBJL 3QT2A 4XVJH 1AGDB 3T1FA 3OKOB 4IRJC 1S7RA 4J4PA 4PJAA 3OGCA 1M7IB 2Q3AA 3G6JA 3GMPB 4PLJC 1D6VL 1K4CB 3G6DH 3CXDL 4M48L 4MAYB 3HC3H 4X99B 3OF6A 2DN7A 3JTSA 1KULA 1U3YA 2X4SB 5B4MC 2E9IA 3CMOH 5A2KH 5C09E 4TNWK 1G0DA 5IFHL 5MI0B 1XR9B 4XB7A 2AJVH 4HD9A 2LU4A 5I0DA 1QRND 1KJ3L 3TO4D 5HYJA 4J3VA 4CKVX 3KPSE 4YFDB 1NC4A 4NO2A 3QUXA 3Q0HA 1EHXA 3TM6A 1NMCB 1U58B 3WIHH 5DEFB 1MCIA 3ET9F 2CUMA 4MAUH 1U8KB 2P48B 4QRPA 4JHWH 2XN9B 4OLVL 4P4RA 5CHNB 2RB8A 3OB0H 3HC0B 4MNQE 4JFEA 1CLZH 4N0FA 2R4RL 3RL1A 4GAGL 3C5ZC 3DMMD 4NO0D 4D2NA 4HK0A 5EORL 1KXQE 2VDLL 4K23L 5BRZA 1YPZB 3X12A 3EYQD 4H88H 5D1QD 1II4E 2VE6A 4RQQA 2VDNH 1P1ZA 1WAAE 3MRCA 4YHOL 4MD0A 2Y7QA 4FXKA 2EDXA 3FOLA 3EGSA 2AEPL 5F7KC 1RZFH 1C5BH 3FKUS 2VZ3A 4YNYA 4Y16B 1F8TL 4I8DA 1E0OB 3K8LA 3P4NB 4PREA 4G6KL 3FT4B 5J13C 4JGMA 3I6LD 3W9DA 2K9UA 3O11A 3SKOA 1T0PB 1RFDH 3V5HA 2HKHH 3FL7A 3Q2CA 3LEYL 1QACA 1I1YB 3C2AL 1CICC 3LRHA 1ZLWH 1H15B 3KYKL 1BECA 4XI5D 4F2MB 3N85L 3EO9L 4X7TB 4JY5H 5TE4L 3VXQA 5LGJB 2A9NH 4RSVA 3DETD 3DX7A 3VXME 5I1JH 1M71B 3QDMD 2WBJB 3HCVA 5F88A 2Y4SA 4NKOB 5CBEA 4Z78B 4PJCB 4I1NB 4EN3A 1BGXL 1OW0A 4GW5B 1KXTB 1CGYA 3QNYB 1IGMH 3BN9D 5HHNB 1JN6B 4HPYH 4OM1H 3F5WA 2AEWA 4Y5XB 4C83B 2HLFD 2NXZC 1QEWA 2APXA 4JRXA 5F1SA 3E6FA 3UTTB 5E8PA 3QDGD 4XAKD 3FMGH 3BN3B 2WIIB 4KQ3L 1Z9OA 3H3KA 1NAMB 3BIAX 3QFDA 4XVSH 1SY6A 5C0AD 3VD4A 1FQ9C 3I84A 4LCWD 4QWWD 2IADA 5GGSA 3RBGA 1OVZA 2Q8BL 3QG6A 3FB7B 2FWOA 1PYWA 2NZ9C 2MPAH 3J7HA 1WT5A 1VGKB 2XFXA 5EUOB 5FYLL 4JM2D 4OLUH 2KBGA 1JF5A 5B3JE 1INDH 1RU9L 3VI4F 1WC7B 5MEOA 1S7TB 2E7LC 5D8JL 4ZODA 5MERB 5DMGC 4ZFZA 3DPBA 1YNKH 4HUXB 3P2TA 1MHHB 4MDIB 2ZPKH 4GMTH 4YHIB 3O4OB 1XFPA 3U83A 4JPVL 5IF0B 3NIGE 2APTA 1OSPH 5JW4R 4PJFA 1ZLUK 1MAML 3JUYA 3VMNA 2AXGA 3I6GA 1QFWM 3HB3C 1LO2H 3GRWH 5L2JB 4TVSa 3BEVB 2X6MA 2AW2A 4OUOA 1D5ZA 2W9DH 3WO4C 4U1NA 4UQ2A 5JUEL 2DLFH 3OAZH 2AJSL 4KRPC 5CMAB 5EOQL 2WZPD 5JOFB 4JFXB 1IL1B 3BFOA 4JGJA 5B8CC 3DARA 4EDXA 5I2IB 5HI3C 4H1LB 1XCQA 4NRXA 4FMKA 3WUWA 3ME0A 1AQKL 1JPSL 1TFHA 1YEEH 1JGVL 3KDMB 4XPHL 1OP5K 4TUJA 1G7IA 1UEMA 5B38B 4DEPB 4OJFL 2VZSA 1A64A 3S9DB 3ARDD 2BP3A 3Q1SL 4DKDC 4XBPA 4H0GA 1KBGL 3HE7B 3H8NA 4GRMA 4Y4FC 5D1XA 3WIFA 2FL5B 3P9MB 2DMKA 5EOTB 5T1KD 3U9PH 2ICEB 3MROA 2YD9A 5ESQB 5E1AB 3PQYE 4IIQC 2GJ6D 5CJQL 5DJ6B 4OUUA 4F9LA 3BPLC 4KKBD 5A2IH 5LGKA 1NAMH 3HUJE 4NWUH 3NA9L 4FFYH 2HVJB 3B3IA 4XT1C 1XR8A 2HRLA 4EI5D 5HHOE 1UB6B 1S78D 5JW5A 1T2QH 3E6HA 2WIMA 2YUZA 2H32B 4YHML 1FH5L 2ICWJ 1AP2B 4GG8A 1RZIB 3PWNB 1NKOA 4PJIB 3V95A 4TSCL 2ADFL 2P45B 2IQAB 1NUGA 5E08H 4H20L 2DQGH 6FABL 5F7DA 5ANMA 1KENL 3PP3K 4LLYA 4OKDA 4OTXL 2FEDD 2E7MA 5BVPH 2BVYA 3C08H 3CLEH 4Z76A 4ZS7H 5HDBE 2QV2A 3KPLA 2OCFD 3JWDH 2ZOKA 4M6ML 1A7OL 5GGQH 4PJAE 3RBSA 3PV7A 5L2KA 1QZ1A 2DAVA 3K46A 5DK0B 4AEIL 4ZSOA 3MCLH 3AMLA 3ESUF 3MCG1 4P5TB 4EIGB 1CLOH 4MNHA 4ZOAA 3UJIL 3RA7L 1UEYA 4HXBL 2ZCHH 1RJLA 1AD9B 1ZHBA 3FQWA 2BNUA 4FZEL 1XIWD 4KXZH 1KCUL 2XWTA 3S37X 4OIBA 1FO0A 1A9EA 4XNYH 3H7BB 2P5WA 2AGJL 5JIIA 3QEHA 2HTLC 2RGSA 4H1LH 2DD8L 1FJ1A 3LY6A 2HT2C 4YR6B 4NZUL 4NT6B 2A0LD 5JA8B 4OFYD 4BM7A 3O3DA 5EPMB 1DQLL 5D9SB 2VWEE 5J89A 2VZUA 1Q9LA 4G8GB 4ODUB 3ZE0E 1MFCH 3QHFH 3M17B 4DQOH 1NCDH 1W72L 3PWPE 1XMWA 1PG7W 3V52H 5I18H 4YBLC 4RA3A 4P3WA 3VFNB 4PGEA 1WZLA 2J8UA 4EQ3A 4LLDA 5I0ZA 3IDJB 3MRJB 4XZUA 4D0CA 4LPWA 3KNBA 3EYSL 1IT9H 1DN0A 4WJ5A 3IETA 4UNVA 1L0YA 4GFTB 3W82A 1CZ8L 3I9GH 5AZEL 4NO3A 3RWCB 4KHXL 2V17L 4LHUD 2YPVH 2P8MA 4V1DD 1YDPA 2A9MH 4GH7B 3M45A 2Q8AL 1PZ5B 5CEZD 2H32H 2PF6A 4LHUG 5I1AB 3D2UA 4NQTA 5TE7L 4OQTL 1EUUA 3WJLA 4P2QD 5T1LB 1JHLL 4KDWA 4NRYA 3WE6A 1TNMA 2QTEA 2HFEA 3L9RB 1PAMA 4RGOL 2PETA 5GGRB 3THML 1F42A 2N7BA 3T0EC 1MUJB 5EUKA 2FYYA 4JRYD 1GVIA 4ERSL 4OIIL 1BOYA 3SCMC 5MEQB 4WNQB 5IHZA 4MNGB 4QHNA 1KCSH 5FXCH 4FTVD 3NFPB 5EH1A 2EYSA 4RAUB 2YUVA 5MP6H 4NFBA 1H8SA 4H5SB 3MFFA 2VOTA 2OR8A 4YDKH 1B0RB 4G80A 5J8OA 1GCFA 4XPGH 1Z9LA 4NUJB 3TYGH 2VLJE 3VXPB 3QJHB 1RUKL 1A6VH 4KV5E 2YZ1A 1E28B 2FIKB 1FFRA 3FZUC 4WU5B 4Z7QE 5JDSA 4RFNB 3I50L 4WUUA 5A2FA 2V9TA 3VWJB 2DJSA 2VKXA 2R1XB 3LQMA 1IEBA 1QLRA 3C60D 5D7LE 3TIEB 1JMXA 3X11B 3D18A 5JPMA 3SDCB 4LOUC 3SDDC 1OP3H 1Q1JH 4U6VL 2ZOLB 1UG9A 3NN8A 3HPLB 4NGHL 3PNWB 4DKFL 1OGAD 3ULUC 3D39D 4NSKB 1KACB 2C3HA 4D3CL 4M7KH 1Q9WB 4TSBH 3MLSL 5IM7B 3RUGB 5TGBB 3U46B 3KPRD 4RX4A 3X14A 2A2QT 3AU1B 3GBNH 3BP7A 4JZNB 3WDJA 5I17A 3IDMA 5IB1A 2QADB 3LRSB 1KIPB 4RMVA 3P4LA 5E8OB 1A4JA 2I24N 4WFHE 4ISVA 4GXVH 3QEQE 5D1ZA 2PNDA 4F8QA 1JI1A 4GJTB 4BH8A 4MB4A 2IH1B 1JWSB 4KROB 4HAGA 1H3PH 5E8EB 5DJYA 3R0MA 2V9RA 4U1IB 1FVDB 1MJ7L 5E99H 4JANA 2APVA 4HGWB 2J12B 2X4QB 4KDVA 2DLIA 4JFPB 1HH6B 3RGVB 4XCCH 3RWJB 2BFVL 1MIML 2CIIA 3WCYA 2ZG1A 3CSGA 4R4FH 4YH6A 5H35A 5IJVA 4ZXBC 1LGVA 4NC1C 1EVTC 5JR1L 5J3HC 4Z7OF 4X6CA 4ZTPL 1BQLL 3L3KA 4HS8H 5HDQH 2PXYC 4HWEL 3DIFA 4RNRB 3MYJA 3W9EB 5EA0H 2P24B 2LAGB 4NPYB 1VENA 1BBJB 2MKLC 3AS3A 3ULUL 3S5LB 3V5KA 4KH2A 3ULSB 1SYSB 1I3GH 2EXYD 5DR5H 2GY5A 4LPUA 4GQ9L 5F1IA 2QQLH 3VH8B 3MLVL 3KXFE 5FYJE 3VMOA 2EYTB 4XVJL 3IU4H 5MENE 4KI5D 1J8KA 1NGXB 4X0KA 5C9JA 4U1KB 7FABH 5KS9A 4PJGF 5FGBC 3G6DL 4G42A 4HWUA 4PP2B 3DO3A 4XP6H 4LBEB 1F4AA 2FSEA 4KKAD 3HC3L 3LN5A 4D9QE 1QBBA 4S0SD 4X6EB 4JY6A 5IBLC 2W1NA 2VQTA 3N06B 1ZTXH 4F7CB 4KVNH 1JCKA 3RKDD 3TNNB 3RIAK 3MRNB 3WNKA 2JJSC 1MCHA 2P4AB 3SE3A 3I02B 2AJVL 5K9KB 2UUDH 3RWGA 4NYLA 4Z8FH 2I9TB 1UM4H 5GS0H 3DVNA 4UB0L 5E7FA 4WI8A 3DYPA 4P2YA 5EG6C 4JFFD 2FJGB 2JCCB 3FHQA 2F19H 5KSAD 4MJIA 3WIHL 1OB1A 1KXVC 1QRNB 4MAYC 3TO4B 3K8MA 1U3HA 3EO0A 1EHLH 4JHWL 1Q9OB 4NFCA 2YKLH 3LQAH 3BDBA 3LKOA 1IC1A 1S7SA 5DUBB 1CLZL 3QNXA 1DQDH 5MI0C 2ATPB 4KWUA 5A16B 2CR6A 4FQCH 1X6LA 2NNAA 2VL5A 1N4XH 1TDQA 3B5TA 3L3DA 1EVUA 3OBAA 4GLRI 1FC2D 4H88L 1J87A 3ARUA 5DEGA 3PDDA 3VRJA 5ISZE 5KVEL 3OAUH 3DMMB 4NO0B 2FZ3B 4FQHA 2A74B 5BV7B 3V0VA 1OAZH 4P2CG 3DX6A 5D1QB 1KCVH 3HC4H 1RZFL 4HK3N 4N1EA 2R2EA 1MCNA 1W0WA 1S9WB 3DV6B 5HY9A 2KZWA 1WF5A 3QR2A 1FL5B 4RMQA 5FA4B 4PJ7B 4KRNA 2B1AH 5FO7A 4OCRH 1D5BA 4XNUL 4GSDH 1RFDL 2G5BB 1I7RB 3VI4E 5ALCH 3MRLA 2HKHL 5GGUB 5BS0A 4ZUVB 3P0GB 1I8LA 4HJGB 3DJ9A 3DECA 4IEFB 5T1DH 4KVCL 3F7VA 1X5AA 5IK3B 3OHXA 1R3LA 3L6FA 4M03A 1PJ9A 1ZT1B 4DGVH 4ZDHB 3S96B 1QQDB 1N0XH 4OLYH 1QSEE 5LAXB 3FB5A 5I1JL 3KLHC 3BKYL 4Y88A 5C09D 5F3BA 3OKEA 2CO7B 4LVOB 1EK3A 3IFPA 4OLEA 5BMFH 2EH8H 5DD0L 4MD5A 3D5OF 3QDMB 5GRUH 1IGML 1DDHA 5I8OH 1SJEA 1G7MA 3FT3B 1S9XA 4HPYL 4OM1L 3U82B 3HZVA 2OL3L 2D0FA 2R1WB 1R24A 3RTQD 3VXUE 4IOIA 4I18B 3K1DA 2ZZUT 3FMGL 3BKJH 2WQRA 1KIRB 2WBJC 3C5JB 4YDJB 4ORGA 1QNZH 5EOCJ 3QIUD 4XVSL 3PABA 4XPFH 1HCVA 4L3EE 5E24E 2X4NB 3K81A 2ADGB 4YUEH 2ATKB 3TCLB 3BH8A 3QDGB 4PJ8A 4Q97A 4PRNA 4X6DF 2AK4D 3QULA 2MPAL 4PJHF 1LNUA 5DLMH 4YHKH 3GB7B 5C0AB 1NMAH 4OLUL 1GGTA 4Y5XC 4Y4KA 1INDL 4QCIA 5JIPA 1OTSD 5JOPE 1U8JA 2IGFH 3CU7A 3QWRA 4WEBL 4FQIH 1YNKL 1CFNB 4ZNCD 4G9DA 3U36A 4JM2B 5ABDE 2ZPKL 3MODL 5D7IE 4GMTL 1FCCA 2YSSA 4OZHF 5BV7H 1CFSB 3LN4A 5TH2B 2CO6B 4P46A 3OKKB 1OSPL 1RJYA 2V5SA 1NANI 3I3EA 4P59H 3GSWB 5F7NC 5H94A 3CH8A 3TT1L 3U6RB 1JK8A 4E0RB 3MRPA 3KPQA 3UDWA 5I75B 1IEHA 1HKFA 1N59A 3RY6A 3N9GL 5BZDB 2W9DL 4S11A 4C54A 1EERB 1YY8B 2DLFL 3EFFB 4RCAA 4M8QB 3O4OC 3JWDC 3MMEA 1FAIH 4XCNA 1MLBA 4NQUA 4QTHA 4N0CD 1N6VA 4FFWD 3TJHC 1JNHA 5IQ9B 3FFDA 1D6EA 3DHJA 1TITA 5J1AA 4I0PC 3S4SG 5DMYA 1HI6A 3CXHK 1N6QH 3NIFF 2NCMA 8CGTA 3B6SA 3QIWD 4WVRA 2NYYC 3PGFH 5DEZA 1RAMA 1C5DA 3ARDB 3TH4T 1R5IA 3U9PL 3WLWC 2RBLA 1NAKH 1HH9B 1P5VA 3H9HA 3MBED 2XKNB 2Z4QA 3TV3H 2WINB 1IGTA 1JWUA 4PJEF 2I07A 2V7NA 4PJDE 5T1KB 4ALAH 2A6DA 4GXUM 5DRWB 3ZLQC 5E4EC 2Q6WA 4XP5L 1HYSC 2GJ6B 3CDGA 4JG1H 4N8VG 3HG1A 1T2QL 5AUMA 4R96A 3S35X 3AY4A 3BMVA 3H3PH 5DQJA 3O4LA 4EI5B 4LNVA 3NGBB 3VFRA 3OSKA 4NM8L 2XNAA 3EYVA 1J8HA 2H26A 4RISL 3VW3H 5TPWH 1LHZA 4DUWA 5BVPL 5E5UB 1YECL 5J1SC 3CLEL 4UQ3A 4ZS7L 3TVMD 1CFBA 2OX5A 3JWDL 2DM3A 3BZ4B 5GGQL 3IU3B 5F8RC 4LCCC 3VG9B 5IVXA 3HLAB 3RU8H 3OXRA 2VISA 1I7UB 4K07A 1T03H 3VWKD 5CKAA 4WU7A 3WFBH 3HAEA 1ZVHA 4NKMA 3F12A 2GTZB 2DQFA 1WCBA 4LMQE 4XNYL 1L9MA 2IALA 4YLQT 3L5XL 2DB8A 1XIWB 2C4XA 5DRNA 1FV1B 1KT2B 4P5TC 3MR9A 3NCJH 4L8SA 1D5IH 2C1OA 4B41A 3O2WH 3VRLF 3QPXH 1F4HA 3EOAA 1NGWA 1UM6H 3CDCA 3DSFH 2KPNA 2VQ1A 2UVEA 3O6KH 1CXKA 3P11H 3MLUH 3QHFL 3OKMB 3GSXA 4DQOL 1NCDL 3AM8A 5I18L 2JTDA 1G6RB 5E8NA 3SE4A 2YEZB 5I6XB 5HHOD 8FABB 2ICWB 2XQBH 5K9QI 3N1GC 3UROR 2F53D 1IBGH 2CKNA 3REVB 4AIZB 2FD6H 3I9GL 5I30H 1MFNA 3PDGA 1P84J 4XVUC 2WMPA 1TJHH 1WISA 2A9ML 1OAYH 3ES6B 5DURD 3T0WA 5CJBA 1NGYA 4C56D 4APQC 3ZTNH 4V1DB 2MJWA 3GKWH 4KK8D 3BO8B 1U8PA 4M9OA 1WJ3A 2O61A 4IRSD 4XHQA 2UWEA 3W0WA 3SO5A 5ESVA 3DGGB 3P73B 1WVZA 1A6TB 2DYPA 4HUMB 4P2QB 3MZTA 3HA0A 5GSRB 5SX5K 5IUSA 1HHKA 1MJJA 2Q1EA 4RAHA 1IZKA 5E5MB 4K8RD 4FQXA 2ESVE 1HHGB 3QA3A 5IW1A 4JQXC 1NCNA 5MP6L 2APWA 2J5LC 1NC4D 4YDKL 5B21A 3ZSSA 2V5RA 3GGWB 4FTVB 3QUXD 4XPGL 1I1CA 4HC1H 3TYGL 5MHSD 4U7MA 1RZ8B 5ICYA 3JWOH 5F44A 3IXTB 4QRPD 5HGAA 1FNFA 1CXEA 5EU5B 3V6ZB 1C16B 4DFIA 1DQQB 4P3DB 2XI9A 3ZYJA 4JFED 5C0CA 5DWUL 3PWPD 1T1XB 2DWDA 4TNVK 5I8CB 2AK1H 1RVFH 1CF8L 4M5ZH 1K5NA 2F5AL 2B39A 3FT2A 3ISWA 4PJ9B 5BRZD 1R3JA 3SDAA 4F33A 1Q1JL 4DGYH 3FTGA 5KG9A 3SKMA 4WI9A 4Z7NF 1ZT4B 1RY7B 2OZ4L 1H0DB 3O41B 2HWZH 1E6JH 4O5LH 3UTPE 4M7KL 4PV8B 1G6RH 3ULUF 1QA9A 4RFNC 5I1DB 4BK4A 4OFVA 1OGAB 3P0VH 5IQ7L 4XH2B 3QEUA 3D39B 1CG9B 3EUUA 3GBNL 3QUKB 4RDQG 3VXNA 2ZCLH 5F3HA 1D5XA 1BIHA 4X5XA 1U95A 4YDLB 4AQ1B 3I6KA 4F7MA 4Q9RH 1U8LB 5DS8B 3SDCC 3KPRB 3V79C 2BVEA 2WBKA 1AE6H 1CDBA 3P40A 4PYHA 5E6ZA 1T1YA 3OR6B 2LVEA 5E7BA 4F9PC 1HOCB 4NQEE 2BRQA 1BF8A 5F7EH 3MJ8B 3MRHA 5H37H 1ZT7B 3QWOA 3E3QE 2M8XA 2XZZA 5E99L 5IBUG 3TPKA 2A83B 5GS0C 5I8EB 3QIBA 3VXOA 5CEZH 4LAQH 3WJJC 4XCCL 1Z6JT 1BFSA 3WHE1 4Z7WB 4R4FL 2ZG2A 1TLKA 2XRAH 3QQNA 1MWAB 4GKSA 1ORSB 4R2GD 5J6GB 5C7XL 4YPGB 5J1TC 2KKQA 1MEXH 4W81A 1LEKA 4HS8L 1T89C 1UJ3B 4KROC 4UT6H 4NJ9L 3UEZA 4ZUUA 1MPAL 3BI9X 2FR4A 3HI5H 4YHPB 1YYLH 3QXDB 1NCWH 3RGVC 5ESAA 5D7LD 1HKLH 3SY0A 2A6KA 4PR5B 3MREB 1I3GL 5DR5L 2BDNH 4HIJA 4DCQB 4P23A 5H2BB 1IZJA 2QQLL 5FYJU 4HS6B 3EYUH 3IDIB 1KB9K 3IU4L 4PRIE 32C2A 3UZEA 1U93B 4ZFOB 4XP6L 2X1PA 3GHBH 4L29A 3CX5K 2MHAB 1QSFE 4FXGB 2BY1A 5FYLE 2R4SH 4KVNL 1Y6NR 5CAYB 2J7LA 2PCPA 1JYXA 2YXFA 5GS3A 3QEQD 4Z8FL 1H3GA 1CDHA 4M4RA 5GS0L 5EU4A 3F6LA 5ICZA 4ZPTA 5FDYA 2E7CA 4G6JH 5D6DC 2YPLA 3WLBB 5CBAB 2E27L 4KI1A 2YC1B 4DGIH 4HWBA 3LPFA 5ACZB 1BFOB 4JPIA 4JFFB 1AKJA 1DBMH 3LQAL 4K71B 3LS4H 5KSAB 2NY3B 2BSRB 1DQDL 4LIQH 3KJ4B 4EIZC 2D4FA 3ZHDA 2HJFB 1LP9A 4RMRA 4NCC2 5JMRA 1N4XL 4S1SH 1F4WH 1Q0XH 1ZWIA 1PEWA 1LO5A 4LKCA 3WUWG 1HINH 4ZUWB 1KIQA 1A2YA 4DK6A 3OAUL 1XF2A 4PRHA 4XBEH 3MRQA 4K3HA 5D1XD 3TBTB 3TO4C 1FLRH 1MWAH 3TNMB 1OAZL 1FFQA 4PLKD 4ZYKB 3B9AA 1OARH 5IOPB 3CDYA 1KCVL 3HC4L 1KLFA 3NMEA 4NKDB 2D9CA 2WV3A 4X6DE 3MA7A 3HNSH 4ZNEE 1JRHI 3A67L 1FYTA 1T7XA 2B1AL 3EOTH 4GSDL 5MEND 5ALCL 1Q9KA 2JK5B 2R29H 4EOWH 5J7CC 3OB0K 2EDWA 5T1DL 2KH2B 2OTWA 1N3NB 4H0HB 3DMMC 4NQDE 3FO1B 1YPZF 5BV7C 4G6AD 4D9QD 1OP9A 1IAMA 4DGVL 2CRIA 1EJ6A 1QFPA 3EYQC 2IPUG 1N0XL 4OLYL 5D1QC 1Z3GH 4XGZA 3LZFL 2VXSH 1Y6MR 2EH7H 2YK1H 1J1XH 2JJTC 1QFUH 1XGTA 5GS2D 1FNEA 4X7EC 1HXYA 2KDGA 1BVKA 3CFDA 5BMFL 1CLYL 4ZFFA 1WBZB 5C09B 3ROLB 4K94H 3KPNB 4WHTB 5L2KD 1R3KB 2F8VA 1T0MA 5EU3A 2AKRB 5C0BE 5I66B 2DJ4A 1AGCB 3RPIB 4JJ5A 1FDLL 3BSZH 4XI5C 5IW6B 3HZYA 3JV0A 3L7EA 1QNZL 3MNWB 4GS7B 4N9GB 4POZD 3RTQB 4LVOC 3RWFB 1RJZB 1KJVA 4Z7UB 4PRPA 4YUEL 4DZ8A 3T3MF 1T7WA 5DJCA 2Q20A 2E5EA 3U4BH 5F9JB 4PJCF 4X9BA 2FX8L 4AIOA 3B8SA 2P5WD 1EFXA 2VLLA 4YHKL 1ZANH 3QIUB 5DLML 2V7HB 1T4KA 1NMAL 5JW4M 5ISZD 1LO0L 3NCMA 2OTUB 5TDPB 4J2XA 1FCGA 3ILPA 5HYQB 4EKXA 3FB6A 3QI9C 4ZAKB 2AK4B 2IGFL 1K3IA 4I18C 3BN9C 5GRYA 4FABH 1XF3B 4FQIL 3U2SA 1U2HA 4FRWA 2R1YA 1JF1A 2HLFC 4MA7H 4FN0A 4KZEH 4PJEE 5AZ2H 3NIDF 2K7PA 2Q76A 1BLNA 5E1HB 5BV7L 3CFEA 2VLRA 1KELH 1KJ2A 2VMFA 4P59L 5KVDL 3QXAB 4R4BA 1KN2H 3AS2A 2VXUH 1CU4H 5IB5B 3QCVH 4LU5L 5C0GB 3VGFA 3HMXL 2NY2C 4D0BB 1FC1A 4UT9H 3LKNA 5EUOF 3SO3B 1CE6B 5FYKL 1QBAA 1ZA3A 2NPLX 3G04A 2HMID 4RBPH 3MX0A 1FAIL 1MCSA 4GG6E 4OT1H 1B6DA 1VB9A 1ZHLA 2XA3A 4X80H 5GRVK 2GJZA 1R5WB 4YBHA 3BIBX 5EDXA 2FHFA 3GMQA 2EDBA 1DUYA 5I75C 2GY7B 4G9FA 3VFOA 4KJQC 1N6QL 4YO0B 2HG5A 1PQZA 1UGNA 2X4RB 3WIIH 1YC8A 4AL8L 5DJ0A 2D03L 3PGFL 5IFJB 5ALBH 1EGJH 3NZ8B 4L3ED 4V2BA 4HT1H 3MGOB 3MXWL 3MC0A 4TRPH 3QIWB 1TCMA 3TV3L 4HMEA 3MUGA 1F6AA 5E00A 2F9BT 4TPRH 2C7UB 5AD0B 3MBEB 3X3FH 1ZSDB 3QUYD 4MD4B 4JG1L 1A1NA 2HJLB 4N8VB 3MACL 4JN2A 3CJJA 4GRLD 4GBXC 4WUUD 2GFBB 3LOWA 1CXHA 4R8WH 3CDFA 3BRDA 3REWB 4WY7H 4ZMAT 1HYRC 2VR9A 4ODHH 5IMMA 3VW3L 3IFOB 4CJ1A 3GSVB 5TPWL 2GUOB 3GSNB 5CZXD 4Z7VE 1ITBB 1QLFA 1DE4A 2IPKB 1FZMB 5J0BA 4OV5A 3SEPA 1INQB 5HPMB 3PHOB 3RWDA 1DVFA 1HSAB 2CH8A 1TZIA 1JUFB 4HX1B 4KKBC 3RU8L 5DJ2A 3BKCH 3U7YH 2V2XA 3TVMB 5IEHA 3T8XB 4BSWA 1QO3A 1CD8A 3EYFA 3GFUA 2X4TB 1S78C 3WFBL 1K2DB 2GTWB 4PJIF 3A6CH 4LEOB 2QHRH 3H6JA 2W60B 3VWKB 5D1ZD 2QQNL 1NGPH 1XEDA 2E7BA 2VR5A 3VG9C 1WZMA 2QR0A 4BK5A 5BW7A 2IMNA 1G7HB 4X7DC 1A7PH 1D5IL 4WFFD 2GIYA 3WNPA 3QPXL 5I15H 1UM6L 4XPBH 2RQ8A 3O6KL 3D6GA 3P11L 3MLUL 3NCCB 4HZLA 2FNBA 4YE4H 3TJEH 3JWOC 3VXSA 3Q6GH 2GHWB 2IFFH 3FN0L 1HNGA 1UWEL 3W5MA 2AAVA 5HGHB 2WUCH 2XQBL 2Y6SC 2ZSWB 5BZWB 3HUJB 1IBGL 3X3GH 1Z5LB 2FD6L 5I30L 5KTEH 5GRJL 1UM5L 5E6IA 2DQDL 3UC0H 5HHOB 2NW3A 1TJHL 3NPSB 4JY4B 3SQOL 1OAYL 2F53B 3A6BH 1OPGH 3KYOA 2XKUA 3RDTA 3H9SE 1NLBH 1SVZA 1DANT 3IDXH 3RHWK 3ZTNL 2AV7B 4U1HB 2VUYA 4Z7NE 1JTPA 4LPTA 2D2OA 3WS3B 3GKWL 4EQ2A 5I6XC 4PJBF 5BXFB 5DURB 2BNRE 4I48A 5J11B 1DZBA 4C56B 2F74A 3OJDB 5JZ7C 4S1RH 3GSNH 3EDJA 3T1FB 3VFWA 3CU1A 1P7QA 1S7RB 3IFNH 4PJAB 2R8SH 4K3JH 4OLZH 4QKXB 3RWEB 1JZ6A 4IRSB 3BHBA 1RK0A 1V3KA 2AABL 4GMSH 1S8DB 4Y5YC 1BD2A 3WHE0 2HRPH 4A2MA 3BAEH 2W65A 4U3XA 4X9HA 1RHHA 1I4FA 1XZ0A 1FZKA 2DI9A 4HC1L 1E27B 4MJID 3LB6D 3JWOL 1U3HD 5FGSA 1A9BA 5J9PB 3GIZH 1NC4B 1JNLH 2NLJA 4NO2B 3QUXB 1CDIA 3MV8E 3S97C 2CDGA 4ODVL 1B0WA 1F6LL 1UADC 4QRPB 5CKGA 5HPOA 2VAAB 2DS4A 5DO2D 4P4RB 4M5ZL 3LSOA 1CR9H 5EU6E 4JFEB 1AHWC 4N0FB 3RL1B 1A21A 3O8XD 3PWPB 2C26A 2CQVA 4HK0B 2ZUTA 3F6IA 5CP3A 3WXWH 1E6JL 5BRZB 3QO1A 1KG0A 2D7TH 1BEYH 1BVLA 4Z0XA 1G6RL 5EO1A 2BXYA 4RQQB 3A6OA 1P1ZB 3ARBA 5HHMD 3MRCB 4MD0B 4FXKB 1ZV5A 3FOLB 3BRGC 2PO6D 4GW1B 2XPGB 2HFGH 3BP4B 4Q9RL 4PJ9C 5BS0D 4PS4H 3DXAE 1AE6L 3VDAA 3GZKA 1NFDE 1G9ML 3PP4L 3W9DB 3SKOB 2ED9A 4OF0A 3MTRA 3V5HB 2BNQA 4XWOD 3V8OA 4UU9A 4ETQA 5C70A 5FDWB 2FHBA 1J0YA 4KKCC 5IB4B 3C5SA 1JPST 1UWGL 3OKNA 3VXQB 4JN1H 5CEZL 3Q48A 4OGAD 4LAQL 4YK4B 3FO9B 3RUGF 1W2KT 4J3OC 4YDLC 2FX7H 3HCVB 2XRAL 1UKSA 2BCKA 1H5BA 4E41A 1P4LB 3S88H 4JPKH 4XCEA 5HI5C 1JGUH 1MEXL 4W4OC 5FCSH 4ODBD 4UT6L 3BZFA 1M7DA 4R2GB 5FUZH 2R0LH 4XPTH 3F5WB 4K8RH 5IR1A 5FKPB 2P8LA 4AH2A 2K1MA 1UVQA 4FHBD 5TQ2H 1ZLVH 5JHDA 1NCWL 3E6FB 2O5XH 5IGXL 4RGND 4LVEA 5E8PB 4BQ6A 4BFIA 4PJ8D 4QLRA 1VERA 2BDNL 3EZJB 4YXKH 1DBBH 2GCYA 5AG9A 3QFDB 3O81A 5FUCC 3F58H 5GGSB 5D7LB 2R9HD 4JQIH 4U2YA 1VDGA 3QG6B 5DVNA 2FWOB 1PYWB 3WSQL 4MJ5B 1MCCA 2GW5A 1UJ3C 2AEQH 3G08A 5GS1C 3W81A 2XFXB 2R2BB 4F7TA 2X9W