2DQEH

Crystal structure of hyhel-10 fv mutant (hy53a) complexed with hen egg lysozyme
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSASGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqeH00
1CFNA 4HX1B 1HKLL 1SYSB 3CH1A 4GW4A 4S2SB 3V4UL 3B9KB 1NL0L 2HP4A 3PXHA 4KKBC 2A9ML 1OAYL 4BZ1L 5K9OA 2IH3A 4HK3J 3BW9B 4AL8L 3Q5YA 3DTXA 5E5MB 4U6YB 3CC5A 1ZK9A 2FD6L 3X11A 4DVRH 1GIGH 5A3IC 5J11C 3TEUA 5BV7B 1QFWL 4H0IA 2K7QA 4MA3A 2DLTA 2YN3A 2BK8A 3TBTA 1JGEB 4JRYD 2ZOKB 4Y1AE 5J56B 1J0IA 1IKFH 4L3EE 5SV4A 3ARGA 1NC4A 4WWKB 4M7KH 4XCCL 1WBYB 1TVHA 3GMPB 4JVPA 1UWEL 4EDWH 2ZJSL 4K3GA 1WZ1H 4HHAB 4PJHF 3TN0D 5IB3B 1ZSDA 1F6LL 3M8OL 1T21B 2ZNWA 5F7DA 5BVJB 5C0AA 3TFKC 4H88H 1ERNA 3OJMB 4J6RL 1RJZA 2YA2A 1HINL 1KBGL 3VI4F 5HI3C 3DHMA 1JN6B 1OVZA 4WI8A 1MCOL 3UTTE 5H2BB 1NFDF 4RSVA 5I1AB 3VWJD 1H8SA 4JN1L 4M9OA 3DUSA 1N0LA 4OIIL 4YXKH 5SWSD 4JKWA 1MJUH 3G6AB 4GXVL 4C83B 1P53A 2QTEA 4UUJA 2UZIL 3QEHA 3QEQD 1DQQB 1UZ6F 1MIMH 1D9KA 1IEBB 4H0GA 2HFFA 4PGBA 4NKOB 3VXQB 2BX5A 4X6EA 2E6PA 1SHMA 2EDXA 2R29L 2C4FU 2ZG3A 3SJVA 4RAVB 5C86A 3SDAC 3BYYA 1QOKA 4JDTH 3C5ZA 5BRZA 1NGXA 1UM6L 3UMTA 4JPWL 4TSBL 3OJVC 2Z4QB 4GRMB 1AKJD 1BBDH 4F9LA 4PG9B 2FL5A 3PWUA 3LRSA 4NUJB 3TJHC 3QFDA 2CK2A 2Z31B 3W82A 3HAEB 4ELKA 1ZTXH 1XIWB 3X14B 2NXZC 2XN9D 3GMMB 1EHLL 4QXUL 4NWUH 4YHKH 5HHME 5HHQB 2YUWA 3BRGC 3ESUF 3DV4A 2BSTA 3WE6B 4M5YL 3QIUB 5IG7B 1XF1A 3OR7B 3T0ED 2V2TB 4FQXD 1CFBA 5FYJD 3HB3D 3QDJE 4MNQE 5C0CB 5F71A 5KAQF 3SDYH 1Z6JT 1P4IH 1NBQA 2PYFA 3P40A 4U3CA 4ZOAA 3DO7B 4DZ8A 5L9DH 2AJZB 3V4VL 4QTHA 2FX7H 1MHCA 1OAXH 1U8QA 4JRXE 2XOTA 2VE6B 5I1DA 3F7VB 3KAAA 1I4FB 5IEKA 2VL5B 4GQ9H 4Q0XL 1I1FA 2FIRT 3WYRA 2VLRB 5E2WL 1KNOA 2XRAH 2NY6C 3QXWA 4JFHD 4X99B 1MCSA 3OQ3B 4R7NA 4GW5A 1D6VH 2ADGB 4R90H 3MNVA 1UH3A 4GAGL 4JO4H 2BNQD 3U4BL 2UVEA 2AK1L 3V8CA 1MFCH 3GNML 5J12B 4UV4L 5KW9L 4JM2D 3Q6GL 1BMGA 2ICWB 4PJCE 3FT3A 4U1GB 5GHWH 3U0WL 4PJAE 2P7TB 4DGVL 1I3UA 1OWWA 4GMTH 2OTWA 3ULVE 4PJ8C 2LAGB 4ODTL 1KC5H 2BVQA 4DAGH 3DXAD 2VDLL 3FZUD 3W0WD 3ZE0E 4DKEH 2PYEB 1OL0A 2XZQL 4M7ZB 3O9WD 3S35X 3EYQC 4MB4A 4ZUTA 3GSUB 1MCFA 3TBVA 3E3QE 2PW2B 3B2UD 4QF1B 3MODH 3ZL4L 1HNGA 4Q9RH 1KJVA 4NQCB 2GKIA 3QO0B 3D5OF 3I84A 5DMJB 5ESAA 2X7LA 5FM5O 3WDHA 4NZDA 3KVQA 4JLRA 1CXIA 5BVPH 3GMLA 3RU8H 3ZE2F 2P5WB 5LQBH 1QRKA 5I30H 4JFPB 3O6FA 1U95A 2QKIA 2VLKD 2VJXA 3VFRB 2VZTA 3OSKA 4LQ1A 3VXSE 2YPKB 4R4FH 5TFSL 1P2CB 5FYKL 1X5JA 4PR5B 5H37G 3K4ZA 4R7DB 3RX7A 1LDSA 2V5MA 1P84K 4QRQA 4EI5D 3BXNB 3BKML 5EUOE 3LEVL 4OFVA 4YEEA 3DGGA 4RWHA 1M71B 3N85H 5C0JB 5TDOA 4XP1H 1E4KA 5F7EH 1FV1A 2IALB 3BEWA 3WDIA 5DEFB 5IFHH 1JHTB 4X0KB 3MV01 4HEME 1BVZA 1FNSL 1U8KB 3QUZD 1ZLSH 2L4OA 1U8HA 5IV2B 1EHAA 3H7BA 4I8DA 4Z7WE 3CIQA 3GIVB 4PJ7E 2DLFL 4YUEH 4M61A 3MCKA 4HUXA 1XGYL 3NCBB 5IHBA 1WAAA 1EERB 3EYVB 1RIHL 1RUAL 4J8RA 4OM1H 3ZDXE 1Q9OB 2D03L 3BQUB 4YHYC 5KSBA 2MFNA 1GL4B 4N8PA 4PRNA 2HJKB 3CXDL 1KJMA 1R24B 1BP3B 2DQHH 1IKNC 3DPBA 5TPWH 1MIEL 3BGAA 5IIEA 2FO4A 2ZKHH 3FOLA 1CLYL 2DBJA 4X7EC 4ODWA 5GGUA 3H3BC 3X13B 1BFVL 3HE6A 3SKUD 1E4WL 3QUYD 4OB5H 1OGAD 1GAFL 2HFEA 1JK8B 2FEEL 4H1LH 4JY4A 3STZA 3RBSA 3QDMB 5CWSB 3SDDC 2X9WA 1OAKH 4Z5RB 2BDNH 2WIIA 1EEYA 1B4RA 5D1ZA 4PRAB 5DLMH 5BO1H 2EDJA 2QR0A 5IM7B 5EBGA 5JHDD 3OB8A 2YD8A 3GK8H 3MPCA 4KC3B 5TJWK 1C5DA 3BT2H 3FB5A 4M7LT 3SEPA 5DQ9B 1LWRA 2VXUH 1I8LC 4KMTL 3TT1L 2AI0H 2DYPB 4N0CC 4OGYL 2CDGA 3MLYH 5MEOB 1AD0A 2H3NB 2F5AL 2ATKA 4HMDA 3DXAB 5HGAA 3IETA 1PKQB 4NQSB 1P69B 5IWLC 5KBNC 4NRYB 5T1LB 2GJZA 3IT8D 3HC4H 4ZNEE 4TUJA 1FCGA 1G9ML 2GW5A 1JI2A 4IS6B 1QHOA 4KRPC 3QUKB 1R5WA 3AGVA 5IB4B 4LLQA 4PV8A 3C6LC 5C8JA 5L2JB 1KENL 2VR9A 1TQBC 1ZT1A 5LAXB 3IDNA 3QQ4A 4BZ2H 4AEEA 3O45A 4O9HL 1AI1L 5F6HJ 4PJBE 3LQAL 1DQML 3LOWA 2JJSC 3UJIH 2L7UA 1TZIA 3BGFB 1FPTL 4JFEB 4EI5B 2X44D 4CGTA 1T5XB 2R23B 5B4MD 2C7UB 4ZOBA 4OSUL 5AD0A 3SQOH 3PXJA 3D69B 4HV8B 1EGJL 5FK9A 1XGUA 1Q0YL 5E7FA 4UU9B 1S8DA 1OF2A 3VXUD 3WIFB 2D7TH 4XNZB 5FO9A 4KUCD 3IDGA 3FKUS 3BX7C 4KPHH 2VDNL 4LLVB 3MJ6A 4KRMB 4JPKH 4FNLL 4WTXA 1JZ8A 2GJ6A 4MHHI 2R69H 1YY9D 3MRQA 1BGXL 1A4JA 4KRLB 5DVOA 3WSQH 4XT1C 5C0BA 3MBEC 4PRDA 4B5EA 4ZO7A 2R0LL 4MCZB 2CSPA 1NCWL 5BZWB 4P46D 4FQHB 4RISH 4W6YB 4CAGA 3WFHA 2FZ3B 4IRJA 2RCSH 3HNVL 2CRZA 4KWUA 4GW1A 4S1RL 4MNGB 2AEQH 1T20A 4ZXBB 1J5OL 4LSPH 3O6LL 1DBJH 4DWHA 4YX2L 1UXWB 4APQB 4R4NC 1OW0A 1CFQA 1IC7L 5I17B 4AM0A 4CMMB 5GRJL 1NCTA 1RZKC 2BMKB 4MCYA 3QHFL 5I76A 1IGFL 5E1HB 1FLRH 3ZE1E 5AG9A 5HPOA 1C12A 4RBPK 2XKNB 4BH8A 3WFBH 2BY0A 4PJIF 4LGPB 5I19H 2IG2L 4ERSL 3LN4B 5FUZH 2JJUA 2VDRL 1KCLA 1D5XA 5DVKA 3AC0A 4MJ4A 2HT3C 1FDLH 3QIWC 4LDOB 4X6DA 1F5WA 4KKCD 3HFML 2L7JA 2YPLB 5HYQB 2YC1A 2W0LA 1FG2B 3LS4H 4G43B 3VGEA 3WXVL 2GSIA 3PHOA 3D39D 1WWAX 1XR9A 3KJ4C 4GUPB 3OKDB 4Q74A 3M1BB 2Y36H 1NCBH 3RUGB 5DTFB 4WENB 4HIEA 1K8IA 1KFAL 1UZ8A 5T3XD 1NGZB 4X4XB 3BOVA 5INCB 5CZXC 4PREB 5IVNA 1Q72H 2NY0B 4NPYB 1KCRL 3LPWA 3MGTB 1JF1A 3AS3A 1S7UB 3L5IA 3P0GB 5JXAH 1KPRA 1NMBL 2ESVD 2M26A 2Z91B 1OAQL 3GSWA 1MFDL 1JFQH 2AP2A 1RZGB 2Q86A 3QCUH 5IVXE 43C9A 4WUUD 4ZFOB 5EOTA 1OQXA 3VD5A 3K8MA 5HVFB 3ES6B 1OPGH 3OKLB 1JHLH 4NN7B 1EO5A 4I18C 5C08D 5DJZA 1R3LA 3R1GL 3WHE0 3NMEA 2DQEH 5JLZA 3CK0L 4NO2A 3CD4A 4O2EB 3O4LA 3GZKA 4HIXH 3I9GH 2OI9B 3P0YH 4UQ3A 5T5FL 2NY4C 3HA0A 4W70A 4JGMA 3B2VH 3TO4C 5DFVC 5E99H 4L4JA 2ZP0T 2X4TB 4P9MH 1GCFA 2C3XA 3F6LA 5I1LA 5K9QG 4HS3B 3C5JB 5DQJB 3KNBA 5FYKE 1CGYA 4P49A 4C56A 3BEVA 5IK3A 3SY0B 4RRPA 1WWWX 5DDHA 4YBHA 1ZA3A 4KI5E 4XB8A 1JPGB 1TIUA 1P4LB 3QULA 3MJ7A 2YRLA 5AYUL 4NHCH 4JO2H 1BJ8A 4J3UA 2PNDA 5J89A 3FO9A 4KK5C 4XVSH 4HKJA 1GIGL 1MNUH 2JCCB 4Y4HB 4G80B 1BFTA 1RZKH 2WP3O 1ZT4B 5JOPD 5D7JD 1OQOA 4IRZH 5IW1B 1HHJB 5CSBA 1F00I 3QUMA 4YHIA 4P2CG 1G1CA 1ZHLA 3VW3H 2APWA 2Q6WB 1VFOA 2C4FT 2A1WH 2XFXB 3U0PB 1H5BC 2XWBB 4XNUH 1ZGLP 1YMHB 4X5WA 3HZMA 4P2QE 1WZ1L 5FUCE 5IUSA 35C8H 3D3VA 3FO1A 3V4PH 3WS3A 1K4CB 5HHXH 4KAQH 4WU5B 1NMAH 1X6LA 5HJ3A 5GGRA 4OCSH 2XT1B 1FNEA 1RIUH 3ALXA 3EYSL 5FKPB 4G9FB 5BOPA 1OTUD 2VLJA 3K4DA 1HSAA 3QIBD 2FECL 4H88L 1M4KA 2ED8A 4PGDA 1L6ZA 2JF1A 1NAMB 2X1QA 3JXAA 4LCWD 3I6LE 5INDB 3SKMB 1MHPH 2DM2A 3AREB 1T1ZB 4NYLB 2H8PA 3PQYD 2EDNA 4K7FB 3N1QC 5IMOA 3AM8A 3G5ZB 1NSNH 1B9ZA 1G0XA 2LU3A 1MJUL 3MGAA 3SKNB 3C8HA 1KIPA 4H25A 2X40A 1CICB 4P2RA 1PEZA 5AZEH 1MIML 3IFPA 1ORSB 4ODSL 2MQ3A 4IIQC 1VESA 3UTSD 5ERWB 4HUVB 1F13A 4IMKA 2NY3C 4OLYH 1X4ZA 5E8EB 1MFNA 5I9QB 1S7TA 2XICA 5E4IA 3MUGA 3KLDA 3PJSA 1OP9A 2VISA 2YD9A 2XY1A 1NMCC 4TNVF 4M43H 4JDTL 3RWIA 3UCRA 1CE6A 5E6YA 1K5NB 5JW3H 5D7IE 1Q8MA 1MWAA 4D3CH 1OSZA 4GKZA 1BBDL 5GRUH 1BIHA 1KB5H 4M4RA 4QY8A 4JJHA 1VGKB 1QSED 5C08B 1ZTXL 3SKOA 3SHSA 2NX5A 3BD4A 4NWUL 2EDFA 4YHKL 2FX8H 4OCXH 4XVJH 3BPNB 4MZ3A 1HI6B 2XTJD 3DJ9A 3OG6B 1NGYA 3MRLA 2F53D 5A2KH 1SYVB 4U0QB 1LEIA 3RGHA 3LKOA 1K85A 3IJYB 3ARFD 1RZ7H 5DD5H 4IOFC 2ADIA 1RK0A 3EOBA 5DEGB 4JG1H 2DS4A 4GH7B 1I9JL 5GGTA 1XAUA 3HMXH 3ILQC 3QFJB 1IM9D 2P8LB 3D2UB 3CUPA 5EU7C 3VDBA 3DRTA 1UJ3B 1P4IL 4U4BA 3K2MC 2NXYB 2DBLH 2R0WH 1FL5A 1D6EB 3WMSA 1IT9H 1IGTA 1CLCA 4KK6C 4P2YA 1IARB 2V9QA 5L9DL 3ZDZF 2FX7L 1GZQA 4B7IA 1ZLVK 4E41E 1JJUA 1OAXL 3JV6A 4EN3B 2X89A 2HJFA 1KXQE 1MELA 1QFWM 2BFVH 3WD5H 3I50H 3STLA 3TLRA 3B9KC 4GQ9L 3FN9A 3A6BH 2VR4A 3QWOA 2H9GA 1IQDB 2XKUA 4LLDB 2OYPA 2XI9A 4U6XB 4BYHA 5FOBB 1D6VL 3VGGA 2VWEE 4R90L 4X9FA 5KSAA 3BRDA 5E4EB 3L3OB 1AGBA 4Y16A 4JO4L 5TE7H 1CXHA 3HS0B 4OZ4B 4H20H 3RVUC 2D4DA 1A1MB 5EC2B 4F7PA 3AXLA 5ANMB 1JNHB 1MFCL 3ALWA 1X5AA 4P2OA 4JFFB 3HR6A 3KLHD 1PY9A 5E6ID 4OLUH 3R8QA 1G7PA 1TDQA 5GHWL 1WWBX 3O2WH 2DIBA 3MA7A 4GMTL 1MFAH 2DQJH 4YDIL 1MI5E 1KC5L 2G5BB 4MD0B 5HDOA 4DKEL 4PJEA 1RZIB 2X4OB 2Y7QB 4OQ1A 1JGVL 4GKOA 3MODL 1J0YA 3RJDA 1Z5LA 1U8MB 3GSQB 4Q9RL 3LKQA 4H8WC 2ARJQ 5D1QD 4LVHB 4OFPA 1SEBA 2H2PC 2IBBA 5BVPL 3SPVB 4PJDF 4L4VB 3RU8L 3ZKSD 5LGJA 1S7QB 3PWJB 4JZOB 4MJ6B 5LQBL 5I30L 3H3KA 1KJ3L 3D85B 2B5IB 1A3RH 3DBXA 4UOJA 5CJOH 4HKBB 1AFVH 1TZHA 4FQIH 4R4FL 4QRRB 1QSFE 4H5SB 3CFBB 2B20A 1DE4B 1JIBA 1GXEA 5DYOA 1ITBB 2NY5C 5HVWA 5B39A 3HG1A 3RY4A 4L4TD 5EBWA 4JM2F 1IZJA 1XZ0A 5DFTA 4ZAKD 1RZJL 3N85L 5EA0H 3TH3T 4PJ9B 3OR6A 5FO8B 3CDYA 4HZLB 4XP1L 2DKMA 2BCKB 5F7EL 3ZT6A 2A6JB 4PRHE 1QSEB 4EOWL 4ZTOL 1CK0H 4F58H 5IFHL 2IADB 5ESVA 1ZLSL 1U8LA 7FABH 2EH8H 1U58A 5FGCB 2JE8A 4LNRB 5CP3H 3LY6A 5IMKA 3QBTB 1B0RA 4N8VA 4X4YA 4YUEL 3PG2A 2WW8A 2C1PB 5I1KL 1I1YB 5E24E 4GSDH 3T04D 2GJJA 1XIWC 4NQDE 3FT4A 3EJYC 4JGJA 4MA8L 4OM1L 1OCWL 3T1FB 1YPZB 5JDJA 5ALCH 4XTRC 5I16B 4PG2C 3VD7A 3ZYOA 5TF1H 3ROLA 3QIUC 1W0WB 4Q2ZB 2DQHL 5TPWL 2VERN 5EU6E 3OGOE 2ZKHL 1JZ4A 2X9XA 3KPNA 1W72A 1M7IA 3ARQA 5DRXA 25C8H 1FFOA 1CGSH 5DJ0B 4EIGB 4OB5L 4NNPH 4WDIB 3BE1H 3BP4B 4YDLB 4QCIB 1WBZA 2J4WH 4HW6A 4BFBD 4M1DH 4FQQA 2GCYA 1OAKL 1SJHA 3QEUB 4XRCA 4K94C 4C55A 2ARJA 1MREH 2GI7A 2NY7H 4NO5A 3RWFB 2EH7H 5BO1L 2X1WL 1MY7A 4L8DA 2CRMA 3GK8L 2D7MA 4HPYH 2YRZA 1HIMH 4Y4FB 1ES0B 4LKCA 2BSRA 4DVBB 3ARTA 5DD3H 4D9QE 1BQLH 3QI9B 2D9CA 3BH9B 5GS2H 4GFTB 5BOZG 4NT6B 1H3PH 2CO7B 2VXUL 2AI0L 1V3JA 5E70A 1KOAA 1A4KA 3MLYL 3BKYH 5D93C 3VJ6B 3VXTB 3GJFK 2A77H 1MHEB 4Y2DB 3TN0C 3UTZB 2DQCH 4V1DA 5J12C 5EFIA 4H8WH 2YBRB 3HE7A 4RIRB 5SX4H 4OLVH 4G7VH 1A14H 4G3YL 3AUVA 1SY6H 4U1GC 1KIQB 5K93A 3DV6B 4OFYA 4PJ8A 1S7VB 1FO0B 1XH3A 3BZ4A 3HC4L 4PLJD 3RPIA 2P24A 3RZCB 5IESH 1V3MA 2O5XH 4OLZH 5C0DA 5E5UB 4HD9A 4LRIC 1O7VA 4M7ZC 2NY5H 2ADJB 4ONGH 3X3FH 3L95B 3E8UH 4M4PA 2UWEA 4MS8D 4BZ2L 2ZSWB 5E9DE 3PDOB 4MDIB 4JPVH 4I5BB 4QHUB 4TRPH 1WCQA 1EAJA 3UJIL 5C2UB 1KT2B 1HCFX 2VABB 4JN2A 4YIQB 1BLNA 1EX0A 4LKXB 3SGKC 5JIHA 4IEFB 5E8NB 2WV3A 4N68A 3TYGH 3K2UH 3H3PH 5IQ9A 2J8UA 1NJ9A 4HFUH 2D7TL 4LMQE 2NCMA 2OR7A 2W38A 4NNYA 1QRNB 3MRJA 3VGBA 1CGXA 4JPKL 2CJUH 3FONA 1NBZB 1CU4H 1OT2A 2R69L 3U83A 43CAB 3WSQL 3BO8B 3PWLB 2DJ4A 4M1CD 4YPGA 1S9YA 3U48A 4KMQA 1N8ZA 3OWEA 1A8JH 2DWDB 4RISL 3VFTB 3KG5A 4PJ5B 2FIKA 2AK4E 2BVPB 3MZTA 5CD3A 2AEQL 2EXWD 1DQTA 5F6IB 2BRQA 1U8NB 3RGVB 2LAAA 3HB3C 3TVMD 4K94H 1BX2B 1BD2E 1Y18B 1MQKL 3O3EB 1NFIA 1FLRL 3BQUC 1QEWB 3QJFB 3C8KB 5C07E 3VXMD 3WFBL 3BAEH 3MGOB 3IGAA 1BEYH 2VLLA 5FUZL 3DETC 5D5ME 3MV9A 1T6WA 3V5HB 3MV8A 3GEWB 3BIKB 1FDLL 3QWRD 4JY5H 3BIAX 5F8QC 1T04A 3K8KA 1N26A 2IAND 4MLIA 3NBNA 4F37K 2OL3B 4PTTA 5TE4H 2EEBA 5E2TH 1J0ZA 1N3NA 8FABB 4OZGF 2EIDA 2Y36L 4JANB 1NCBL 3IJHB 3QXDA 2GK2A 1DTUA 4UTBL 4O51A 1GZPB 1HH6B 4ZOCA 3MRKA 4NHUB 4NC1E 3MV7E 4XAWH 4G8IA 2OQJA 1BAFH 3BMVA 4DUWA 4JFZL 1MAMH 4PJFB 3WJJC 2P8MA 2PUQT 2BSED 4JM2C 3MRMA 1MVUA 3MRPA 4YFEA 4MHHG 5JXAL 1IAOB 4LFHG 2DIJA 5FA4B 3RY5A 2ADFH 4NUGH 2XKSA 1DQJB 5CJQH 3MFGB 3AY4A 4MJ2A 4QT5A 4M62H 5EO1B 3T65A 1JFQL 1KG0A 3CU1A 1ZVYA 3QCUL 5IMMB 3WLBB 3FZUC 5IWLA 1G7QA 3NA9H 1A47A 4JO1H 1AQDA 1OPGL 3BPOB 2FSEB 5F89B 2GAZB 1T0MA 2DAVA 1WCBB 2DQEL 4M8VA 4XNQA 1QD0A 1K9TA 3D25A 3NTCH 3P30H 3ARGD 4HIXL 1ZHNA 3ARBD 5F72S 5GISH 2AXHA 3I9GL 4BELD 1G7LA 4LLMB 5AUMB 1EUUA 3P0YL 3VGHA 2EDDA 1A0QH 1FN4B 1QNZH 4NQVA 3B2VL 3GSOA 5E99L 4DK6A 5BXFB 2DTSA 4Y19E 1U36A 4XC1H 4P9ML 4BQ8A 3PGDB 2BSSA 2OR8A 2VXTH 5LVEA 5IBUG 4KQ3H 3EYOA 2Y5TB 2I9TB 4EI5C 1NAKL 1OB1A 1DUZB 1MRCL 1I8IA 4AK1A 5DHVH 5EN2B 4YDKH 4HKXA 1AO7A 2WBJB 1S7SB 4LRNH 1ETZA 4EJ1C 4P5TD 4WW2B 1TNNA 4JO2L 2FR4B 5FYJH 4EI6A 4XNZC 1DJSA 1F3RB 2X6MA 3DX8A 4XVSL 5HHNA 1MNUL 2XWTB 1RZKL 4PRPE 1MQ8A 5J57B 1UM4H 4IRZL 4OAWA 4AIZA 1LP9E 4O00A 4JY6B 1W8OA 5F3BA 5BS0A 4OFDA 1IAKB 4XHJC 1S9KC 3VW3L 4OQTH 2A1WL 2IAMD 4CNIB 2CGRH 4KRNA 3L1OH 3V4PL 5C09A 4XVUD 1RHHB 3CVHB 5HHXL 4KAQL 1NMAL 3WN5A 3V52H 3VXMB 4WU7B 1T7YA 1RIUL 1E6JH 3KPOA 3MQIA 4APQC 5EZJB 4M1GH 4P5KA 3RVTC 1E6OH 3L3KA 1MHPL 2COQA 5D7LE 3QUYC 4TPRH 2AV7B 4O4YH 3PABB 4GRLD 4TNWK 4QHNB 1NFKA 2A0LC 3UAJD 5C6PB 2EE9A 3CAFA 5HYJA 5GS0D 1NSNL 5DGQA 5BW7C 2FJFA 4M7JH 3QIWA 3MRIB 4HWZB 2E5EA 1MJ8H 3IDIA 4N0RA 3SDCD 2FEEI 1WJ3A 2A9NL 4A6YA 3FO0L 2IFGA 5FV1L 5GGQH 1ZE3C 1CFNB 4Z7OE 3BP6A 1E28A 2PCPB 3CH1B 2R9HC 4GW4B 1IRAY 4OLYL 4NKIL 5FGBA 3BZDA 2J5LC 4XCNA 4XPAH 2IH3B 5EBMA 4PRIE 4M43L 2NY0C 3DTXB 5JW3L 3VFVA 3TA3D 4P9HC 3CC5B 4D3CL 3X11B 4NIKB 2AGJL 4WI2A 1KB5L 4LEXH 4UB0H 3TT3H 5HDQH 4EDXA 2CKNA 4X9HA 3IDUA 3MRHA 1RULH 4MA3B 1J8HD 1NEZG 3DSNA 5E0QA 3L9RA 3QDGA 3TBTB 3TPUA 4J7RA 4WI3A 4DGIL 3WFDH 2FX8L 5L7XL 3ARGB 3GFUA 1NC4B 1TVHB 3RWCA 5L2KD 3QPQC 2HLAB 2QSQA 1MJJA 4NN7C 5DD5L 4LQFL 1ZSDB 3FB6A 3O2DA 5FECA 4JG1L 1CT8A 2QQNL 3HMXL 4DKAA 5F7DB 5C0AB 2D0FA 4S1DD 5MENA 1MCIA 2VR5A 5I6XC 1KGCE 5B39G 2R0WL 4U1SA 2OI9C 3U36A 1AC0A 3KXFA 5KVGH 1IT9L 3U4AA 1GH7A 1AGCA 3KPRE 4UT6H 5J1SC 3MYJA 4K23H 4HLJA 3DUSB 5I73B 3D18A 4EBQL 4JHBA 5E5RB 3FFCD 3QHZL 1S7XA 2BFVL 3I50L 2MKWA 4JR9H 4V2CB 3TNMA 4UUJB 3L7EA 3A6BL 4ZFGH 2ICEA 2IBGA 2JB6A 3QEHB 5DHYA 1YY9C 4PJHE 1D9KB 3EHBD 4N8VG 3EO0A 4WY7H 1JZ5A 3QH3A 1H8OA 2HFFB 4PGBB 3HZVA 3Q2CA 1CDBA 4X6EB 5TE7L 4P46C 3O8XD 4H20L 3SJVB 1J1OH 4Y4HC 5ICZA 3OXRA 1CF8H 1JWSA 4HUMB 4X8XA 3VXRA 5ITBH 3C5ZB 1A22B 1A6PA 1NGXB 1EPFA 2CLZA 4I48A 5LGHH 3BYTA 4L5FL 1H5BA 2YUZA 4ELME 3O2WL 1NFDE 2FL5B 3PWUB 3LRSB 3PP3K 1MFAL 2DQJL 1PAMA 1JRHI 2Y4SA 5GRVL 3QFDB 5K59F 4RGOH 1HYSD 5F70A 3CMGA 4ELKB 3PWPD 4XP4H 4Q9CA 2GEEA 4JHWL 2P1YA 1JCKA 3RWHA 2CUMA 3RVXD 1PG7H 3PHQA 2FJHA 1A6TA 2IF7A 3DV4B 4XCYA 3RWGA 3CDGA 5EUKA 2Z8SA 3T3ME 2ENSA 1IILE 1QUNA 4KKCC 2ITCA 3G6DH 5MEQA 1GOFA 3NZHH 1FFPA 3BKJH 2XZAL 2PYFB 4P9HH 3TH4T 1S9VA 1CWVA 1FCCA 1A3RL 4QXGH 4H1LG 5CJOL 1MRFL 3G5XA 4DZ8B 3MLXH 1AFVL 4FQIL 4QTHB 1MHCB 7CGTA 3FN0H 1U8QB 4HXBH 1BJ1H 1GGTA 5JXEA 5I1DB 1P6FA 5IEKB 2H45A 1I1FB 5EA0L 5I9QC 2O61A 2BNUA 2OTUA 1KNOB 1MAJA 4PBWD 1CK0L 1ZKAA 3IAQA 3T0VA 4F58L 4AG4H 4R7NB 4J4PD 4GW5B 3VD3A 1QTYT 4QXTA 5D2LA 3MNVB 4JJ5A 1OTTD 3UPCA 7FABL 2EDOA 2EH8L 1I3GL 3ZMRA 4XNMA 4XPTL 4U1MA 4OF5A 3QB7C 3JUYA 2LQRA 5FYLH 3HZYA 1CGWA 3QR2A 4WO4A 2ID5A 1D5MA 4PJGF 4XPFH 4GSDL 4W6WB 1ITCA 4MXVF 3BPNC 2P5EE 2OTWB 3NPSB 3N9GH 5ALCL 1U8JA 3C9NA 3FHQA 2BVQB 4F7CA 2DQUH 4QHMA 5JW4N 4WTZA 4ZUTB 4HAFA 4KGLA 3TBVB 1JHKH 4FABH 1PVHA 4G6FD 4M03A 1UJ3C 5T1DL 3V5KA 1J1PH 4JFDE 1CGSL 3LEYH 3S37H 5KSVA 4NNPL 5HPMA 1KJVB 4OI7A 3G9AB 2JLLA 5F1SA 4HCRH 2J4WL 3NGBB 5BV7L 4M1DL 5BZDA 5ESAB 5ECJE 2X7LB 3C08H 4JLRB 2GFBA 3GI8H 1ZGLA 3GBMH 3GMLB 2A6DA 1MREL 5EIIA 2NY7L 1YMMA 1G7JA 4QOKE 4EN3C 2EH7L 4FXGA 3GMQB 5DS8A 3KPPA 3O6FB 2CKBA 4K3DH 4JDVA 1U95B 2QKIB 4HPYL 1HIML 1IC5L 3KPQA 5DD3L 5EORH 1IC1A 1QFOA 1YEFL 1BQLL 3S3SA 2DOCA 5D7JC 4GAYA 5I8OH 1H3PL 4QRQB 1Z3GH 4OJFL 5ACMA 1B88A 1I1CA 5E4EC 2F54A 3DGGB 1YUHA 4YWGL 3SDXF 3BKYL 5TDOB 5D72H 1FV1B 3BEWB 1JGUH 1EAPA 2A77L 4NC2B 3PHSA 2VSDA 4HUWA 5IJKA 1GGBH 5JQHC 2LV4A 1VACA 2NY2B 4OLVL 4G7VL 1A14L 4YPJA 4OF6A 1SY6L 1OTUC 3H7BB 2GJ6D 3O3BA 3FTGA 4HHAA 5DJ2A 4NQXA 2SEBA 2ZNXA 5IESL 5I8EA 3B4NA 2O5XL 3SKJL 4M61B 4WEUD 3S35L 4OLZL 1OTSD 3MCKB 1WSST 5KJRH 3BVNA 3RKDC 4HUXB 2RBLA 5DUML 1HWGB 2FECI 2GSGA 2NY5L 4J8RB 5KSBB 3W2DL 4PRNB 3X3FL 2V2WA 3E8UL 1KJMB 4JFOA 5JOFA 2XV6B 4LDLB 4U1NA 5IIEB 4E9LA 2FO4B 3FOLB 4TRPL 2F19H 1NC2D 2M1KA 4ODWB 5GGUB 2FEDD 5F88A 1AXTH 3HE6B 4M3KB 3KS0J 5DO2C 1CL7I 2HFEB 4JY4B 3STZB 5SWZE 2BXYA 1YNLH 5JPMA 3TYGL 4PB9H 3K2UL 4XCEA 4POYA 3H3PL 1A64A 1YDPA 4HFUL 5EOCH 4AY0A 2WIIB 1EEYB 4U05A 1CDJA 5B38B 4UILH 2VYRE 5D1ZB 5HDLA 4AH2A 4R6UA 1DBMH 4N0UE 2QR0B 4PJFF 2NY1D 1AIFA 4FTVE 2CJUL 2Z8RA 1CU4L 3CH8A 1XF5A 4FG6D 4RAVA 1C5DB 3FB5B 4LSSH 4PJ9C 4LCIH 2Z8WC 4EQ3A 3SBWA 3C5SA 2BHYA 3T3PE 2CO6B 4ZO9A 2UY6A 4JHZA 1BVKB 1X9QA 4R9HA 3T0XA 4WI5A 2CDGB 3QEGH 3RY6A 8CGTA 1F2XK 1AQKH 5J8OA 1AD0B 3P73A 4R3SA 1WF5A 2B8OT 1FQ9C 2ATKB 5HGAB 3IETB 3F5WA 3MC0A 1UWGH 1X6NA 1AGEA 1HOCA 2CR6A 1Y6MR 3ZDYE 2FO1A 4K94L 2GJZB 4PG2A 1BM3H 2NLJA 3CFCH 3KS0H 1RPQA 4LBEA 3VU2A 5C9JA 3CZJA 2HLFC 4LOUD 4NQEE 1R5WB 4LLQB 4PV8B 4CJ0A 3VD4A 5C8JB 3L3DA 3EIFA 1ZT1B 4JY5L 5C1MB 5I74B 3BH8A 2RHEA 3SO5A 3IDNB 4JE4B 4XMLH 3O45B 4YDLC 1FNGA 3MJGX 4NM4H 4F2MA 4Y7MA 5E2TL 5GGRY 1TZIB 2DF3A 2EIEA 4XVTH 1DN0A 5AD0B 4XAWL 3ZHLA 2VSCA 1BAFL 3H0TA 5FK9B 1XGUB 1S8DB 1OF2B 2VDQH 1MAML 2GY5A 1P1ZA 3QI9C 3UDWA 4D94A 4YC2B 5FO9B 1IBGH 3IDGB 2DLGA 4JRYA 3FRUA 1ORQB 2GJ6B 1TJGH 2ADFL 4NUGL 3A0OA 2LVCA 3MRQB 5CJQL 4ZOEA 1A4JB 3TN0A 1WTGT 4QRPD 1CTOA 2JJVA 4Y2DC 3H9SE 5JDSA 5C0BB 4F7EA 3IDJA 1LNUA 4PRDB 2ICWA 3BD5A 3EJJX 3NA9L 4YHPA 5I1GH 4JO1L 4DEPB 2AXGA 3WFHB 1FC2D 3J8F7 3VDCA 4IRJB 1CXFA 4ZS6D 3CXHJ 4GW1B 2EEDA 5ISZD 3U7AA 1T20B 1WZKA 2MWCA 5J6GA 4WFGE 1VADA 3RZCC 5D1QC 1ULVA 2EDQA 3NTCL 3P30L 3VWJA 3KPSE 1CFQB 1MCQA 2XIDA 5GISL 4AM0B 5SWSA 3MACH 1YA5A 3TWCH 4X7TA 4MCYB 5I76B 5F1NA 1KCSH 1A0QL 4U49A 4GXUN 1C12B 1IAIH 3O6MH 4BH8B 1Q38A 4P0DA 4HUNB 3QEQA 4LSVH 2X10A 4XC1L 2VKXA 1JPSL 1B6DA 4MX7A 1D5XB 3SGJC 2VXTL 1I7TA 3QRFM 2KBGA 5E6ZA 1KV3A 1JGDA 3SGKA 5A16A 4X6DB 3HMWH 4ORZC 1Q9WA 1T7VA 2EDYA 2YC1B 3SQBA 2QSVA 4ZAKC 3SGDH 2GSIB 4DJMA 3PHOB 1XR9B 1A3LH 4G8EA 5C92A 4ZUVA 2X5PA 5FYJL 3N06B 2YRPA 2MCPH 4HIEB 1B2WH 1CZ8H 1K8IB 1AKJA 1UZ8B 1TCRA 1Z0NA 2CUIA 4HAGA 4RAUA 2I26N 3NFNA 2GTWA 3HUJE 5IMLA 3GRWA 4JVWA 5EU7E 5HHVH 1RURH 4JFXA 4PJXB 5LXGH 1JF1B 4UOW0 2XN9A 1DSFH 5FYJU 4OQTL 1KPRB 2CDFA 2HVJA 5DHVA 4U7SA 2XG5A 3RAJH 1OM3H 3GSWB 5GSVA 3T0EA 2Q86B 4FQXA 2IMNA 2Q20A 1E6JL 43C9B 2EYTA 5F6IC 1WZMA 5EOTB 4HF5H 3F6IA 1UFUA 1FNLA 2LU7A 2R15A 4M1GL 5EPMA 3MLVH 4MYWB 1UYWL 1R3LB 1YNKH 5TE6H 1OAZH 1G7MA 3AMKA 5JLZB 4TPRL 4HIHA 4NO2B 4ZPTA 3RZWA 4O4YL 3O4LB 4K7PY 4WV1A 4G8GD 3GB7A 2VQ1A 4BQBA 4M7JL 4UQ3B 1KCVH 4X7FC 3KYKL 5DSCA 1UEYA 3PL6D 4NC0B 3AS0A 4PJDA 3FRPA 2NR6D 3MJ8A 3S7GA 5GGQL 2OZ4H 5I1LB 4MLSA 3SE8L 3KNBB 4YNYA 4PRAA 4R2GB 4C56B 2HRLA 3BEVB 5IK3B 1AHWA 3TO2A 3GKZA 4WGWB 1GOHA 3LDBB 1B0WA 4Z7UA 4HC1L 3RDTD 5DDHB 4XPAL 2BNQA 4URTB 5GZOD 1ZA3B 3QULB 1FO0H 4R0LA 3MJ7B 4JM2A 2FHFA 3CFJA 1E27A 4CVUA 3KR3H 3FO9B 2ZWLT 4HKJB 4G8FA 2PF6A 2QSTA 1EVUA 1MPAH 4LEXL 4UB0L 2FGZA 5HDQL 3K7UA 1NKOA 2XACC 1C5BH 1RULL 4X9IA 2V9TA 3QUMB 4PLJC 3QYCA 4YHIB 3C60A 3W0WA 3WFDL 1ZHLB 5E94A 3O9WA 1KCUL 4JKPH 3K1DA 5C3LD 5F1IA 4X5WB 4YFDB 3TJEH 2A6KA 3HZMB 4WFFD 5JMRA 1FYTD 1U6AL 4Q6YA 1I3VA 3BPOC 3D3VB 3FO1B 3WIIH 3WS3B 4B41A 4NKMA 5HJ3B 1CVRA 3D6GA 3SCMD 5GGRB 1FNEB 4GRWF 4MS8C 5J3HC 2VLJB 1HSAB 2VZSA 4PGDB 4Y88A 3GSNA 3F58H 3ZYZA 4UT9H 3SE4C 1U8OA 3RVWD 4P5MA 1K2DA 5KVGL 1MLCA 3HTLX 2VLKA 2QADD 4M93B 4F15B 1WEJH 2H8PB 4UT6L 3GSRA 1TFHA 4K23L 5IMOB 2DI8A 3UC0H 4X8JA 1BZ7A 2WWKT 1EEUA 1KIPB 2YOCA 4H25B 4JR9L 4ZFGL 4P2RB 4M02A 1WIOA 4FFWC 3IFPB 2FX9L 2DMBA 4WY7L 2YMXL 2WBJC 1R3HA 3TZVD 4Y1AD 4RA3A 2ATPB 4L3ED 4M1CC 3QUZA 3CDCA 4I13B 3HR5A 1S7TB 1JUFA 3MUGB 3PJSB 2JK5A 1CF8L 3IS0X 4UINH 5ITBL 5C0CE 3RWIB 1CE6B 1XCQA 1F3DH 4K3HA 4LSDA 5D70L 4ZUUA 3D9AL 4Y19A 5JPNA 4J23A 5LGHL 3WEXA 1MWAB 12E8H 1OSZB 4GKZB 1HEZA 4P4KD 3HI6H 5HVHB 4QY8B 1BOGA 4RGOL 1K3IA 3U7YH 1KYOJ 1P7QD 1UCTA 5HD8D 3SKOB 1DP0A 3UTTD 4LEOA 1SBBA 3FQWA 5F6HI 3VH8A 4YH6A 4ESKA 2FGWL 1U92A 1NGYB 3MRLB 1NUFA 2FB4L 1LEIB 2VLRE 3LKOB 1F90L 2ADIB 1RK0B 3EOBB 3MYZA 4N0YH 4F7MA 2QQKH 3QUYA 1OGAA 1M7XA 1L7IH 1DEEA 2DICA 1F4XL 4X5XB 3V6OA 3G6DL 1EJ6A 4MNHA 3CUPB 3O3UN 3NZHL 5BW7A 3HRPA 1T66D 1A6ZA 3BKJL 3DRTB 4P9HL 4F57H 1X5KA 3NABH 1FL5B 5EBLA 5JHDA 1IGTB 4QXGL 1F58H 3GSVA 3MLXL 3HCVA 4OF0A 1GZQB 4DOHE 4RA0C 3BUTA 4LSUH 3JV6B 4UZGA 4HXBL 2HJFB 5A2IH 3UYOD 3MRGA 5C0GA 3STLB 5L0QB 4ZFOL 2XXCB 3QWOB 2H9GB 2X1OA 2PYEE 4Z7QE 1MFBH 4AG4L 1HE7A 4I3RL 5KSAB 4DFHA 1S7UA 5HHMD 1B4JH 3CZFA 3U46A 1AGBB 3B9VA 4Y16B 2FJGA 5J11B 1NGPH 1J05B 4NQCE 1JV5A 5E00A 4F7PB 5FYLL 2IBZY 3AXLB 1A6WH 1JI1A 4P2OB 3JWOC 4RFEA 4XPFL 3MA9L 1G7PB 6FABH 3QDJD 4MNQD 1QKZH 2P5WE 4KKAD 5CEZH 3MA7B 3ARGC 2D7PA 4WFEE 3BZEA 2Y9RT 3ARBC 2DL9A 3N9GL 1DL7L 1F6AA 5CEYB 1J0KA 2JELH 2I9LA 2CMRH 1F4YH 3HE7D 2DQUL 4PJEB 4G7YL 2I27N 4TUOA 4WI7A 3GHEH 4JRXD 5DQDH 4IMLB 4ZSOA 4FABL 5CD5D 1ZVSA 1Z5LB 1J1PL 3LEYL 5DI8B 3G04A 3LKQB 3QXAA 4YLQT 4HCRL 5CBEA 2YKLH 1Z2KA 3NAAH 2R1XA 2GY7B 3VXUA 1SEBB 3DNKA 3GI8L 1EEZA 5C0ND 3GBML 2P47B 5I73C 5LGJB 4P5TC 4FZEL 3A67H 3CLEH 5DC9B 4CL7A 2V2XA 3ZO0A 4J1UA 5J6HA 5EZOH 3DBXB 1HHKA 3SY0A 4P57A 3K80A 1TZHB 4NZJA 5FF6A 1QACA 4OZGA 5EORL 1JPGA 3MCLH 3U0TA 2N1KA 5DYOB 4AQ1B 4RFNB 3CVHH 5B39B 3HG1B 5I8OL 4EUPH 1A7BA 3ARPA 4P46A 5EBWB 1XZ0B 3ULVD 4U7KA 4P4KB 2CRYA 3OR6B 2IAMC 4PUBL 4Q6IC 3SO3B 1JGUL 1AJ7H 5AWNH 1NAML 1BQHA 2K1MA 4IRSD 1HHJA 1GGBL 2IMMA 1NGWA 5ESVB 5I18L 1U8LB 3GMOA 2XWJA 1U58B 3U0PA 4ENED 1RSFA 5TH2A 3ETBF 4XNXH 1YEDA 4F9LC 5IMKB 3QDME 1B0RB 3O0RH 4K3JH 4N8VB 4X4YB 1A7RH 3RJQB 1J87A 3MV11 3FT4B 5CEXA 5JA9A 4TOYH 2KZWA 4GRLC 4KVNH 2EIBA 3C09B 5GS0C 1WFTA 5CIPA 4PP1C 3JTTA 5F21B 3BHBA 3BN9D 3ROLB 3IJSA 3PIQA 3VXSD 3WHE1 3RIFK 5A2FA 5J1AA 4OUUA 1CDGA 3P9LA 3D39A 3KPNB 2F19L 1W72B 1M7IB 4CKVX 3P4NA 5DRXB 1AXTL 5JNYB 1FFOB 4W4NA 1R5IA 3DXAE 1YNLL 1WBZB 1PKQE 5F9JA 1WQVT 4MB5A 4FQQB 2VLME 4PB9L 2GCYB 1SJHB 4PB0H 3JWOH 4XRCB 3NIFF 2ARJB 4ISVA 1QLRA 4NO5B 4UILL 1XF4A 1DBML 4IOSD 3TA3C 3VXOA 3WNMA 4L8DB 4LIQL 4K7PX 2ESVA 4CU6A 3IDYB 4YJZL 4LKCB 2BSRB 4OZIF 1QR1A 1MFEH 4Z8FL 2VXQH 4LCIL 1J88A 5J13B 4I0PD 4N1HB 4UQ2A 1ZGLM 4WUUA 2O5ZH 1HHHA 4NN6C 1UKSA 3BKCH 4OFIA 3U2SA 4BSVA 3QEGL 1A4KB 3AROA 1AQKL 4ZD3H 3RNKA 4L8BA 4V1DB 3QNXA 5EFIB 5IT2L 3HE7B 1UWGL 4JFEE 2EICA 1G84A 4XC3L 1FE8H 1T2XA 5E1AA 4PJ8B 4CBPA 2MHAA 5DT1H 2WZPD 4YAQA 4HFWA 1XH3B 2R39A 3BZ4B 3NPSC 3CFCL 2DQTH 4JHAH 1NANI 3RPIB 2P24B 5SX5H 1AD9A 5C0DB 1IGMH 5CZVL 2MPAL 2DTML 4PPTA 2BY1A 4XMLL 4NM4L 1ZT7A 4HWBH 3P4MA 4BUGA 1C08A 5T1MA 4FFYH 2VDOH 3GBLA 4JN2B 4OGZA 4MNGE 1BLNB 4BFIB 4OGAC 3O6FC 4XH2A 2E7LA 4WUKH 5D7JA 5IQ9B 2VDQL 2J8UB 1NJ9B 5DA4A 2FYYA 4PBVC 1IBGL 1L9MA 4NNYB 5ID1A 4PJXF 3MRJB 5ACLA 3FONB 5MP6H 1TJGL 1R3IH 1KELH 5GS0H 1FL6A 3MZGB 1E4KC 1HYSC 4YPGB 5FCSH 4Y8AA 5F96L 4JFQA 1S9YB 3V7MA 4TULH 1N8ZB 5HTSA 5I1GL 4ODVH 3QIBA 4YBQC 2FIKB 2YPLE 2P46B 3BN3B 2W65A 1MCDA 5CD3B 4LCWA 5HYEA 3SE3C 1WISA 1CGVA 2AXJA 1P9MA 4J3WA 3PQYA 3RUGE 3ORJA 3FRPG 4LASH 5K9JL 3MACL 4K9EC 1Q9LA 5JORA 3TWCL 2UUDH 1KCSL 1NFIB 3UTOA 5GJTH 5GS3A 1IEAA 4N90E 5DZNA 3O6ML 4L29B 4MVBD 3IGAB 4LSVL 2VLLB 3LVEA 1II4E 3UTSA 3MV9B 4XP6H 5ICYA 3MV8B 5DC0A 3O3DA 4NQTA 3H9HA 1W8NA 1P5UA 3HMWL 4H0HB 2EC9T 1T04B 3HE6C 3EDKA 3GJEA 4HH9A 4PTTB 4EQ2A 4DN4H 1IGCH 1N3NB 1A3LL 4S10A 1DEDA 3DVGA 1F2QA 1S9XA 3QXDB 1WFNA 5D1ZC 4O51B 1FVDA 4RDQF 1B2WL 3MRKB 3ARSA 4G8IB 2OQJB 1Z9OA 2R0KH 2OXHA 2ZCLH 4JRWA 5BQ7A 1RURL 4RMQA 4LU5H 5FYLE 2HT4C 5LXGL 2P8MB 2R1WA 2P8PA 3MRMB 1DSFL 1MVUB 2B1HL 3MRPB 2BVEA 1P7KA 5TF0A 5C70A 1D5BA 5DUPH 2VQUA 2F53A 2VN4A 1UM5L 4BK5A 1EFXD 3ARFA 3VWKD 3RAJL 4QT5B 5EO9A 1OM3L 3T65B 1KG0B 1U3ZA 3TGXA 3FCTA 1G7QB 1IM9A 1EBAA 5FHBH 1LDPH 4HF5L 2LE9A 1AQDB 3W39A 1LO4L 2IPUK 1JTPA 3MLVL 5DRNA 4ZTPH 1T0MB 1YNKL 3C87A 5TE6L 1OAZL 1T89A 2UY7A 4X4MA 4OCRH 4OD1L 4XNQB 4LHQB 2IBZX 3ELAT 1CYGA 3D25B 4WVRA 1ZHNB 4E42A 2JCCE 3LV3A 1G7LB 5JZ7D 5D1XD 3NIGF 1KCVL 2FATH 4Y0GA 3B3IA 3UPRA 5I74C 4NQVB 1DQDH 3GSOB 2ZSVA 3VRLE 5HGHA 4C58B 2OZ4L 2HAZA 4Q9BA 2E9IA 3ZKMD 2BSSB 4LP4A 3JVGA 3EYOB 1OP5K 1V3LA 1OB1B 3CFIC 1I8IB 4PIRF 4G9FE 1AO7B 4POZC 1FO0L 1ETZB 1I8KA 3EGSA 5JHLH 5E6IA 2CR3A 3ZLQC 4EI6B 4YC2C 1MCEA 3KR3L 1UQSA 2P42B 1FFNA 3PDGA 5HHNB 5F9WB 4K9EH 1MPAL 4KK9C 2AABH 1TTGA 3PV6A 4Z7VF 3MLWH 1C5BL 4OAWB 4YGVA 5HHPA 4AIZB 1T0NA 3OKMA 2MNUA 4P48A 4X7DC 5F3BB 5BS0B 2YPVL 1FJ1A 1CLOL 3UBXI 5DWUH 4WHCA 4JKPL 4KZDH 3NH7L 4PJGA 5KVFH 2A83A 1NLBH 5DMIH 2FCBA 4FXLA 4IRJC 4NCDA 5C09B 3WIIL 3BWAA 4N1EA 4YHLH 3WN5B 5D1QA 3L7FA 3F8UB 4CRPA 3KPOB 1A7NH 4LL9A 3VRJA 4HJ0C 5FYKD 3UYPA 4OZHF 1F4HA 3F58L 4UT9L 5DD6A 2DB8A 4AYFA 1IMHC 4P5KB 3IDXH 4RWYH 3L3KB 1CD8A 4KI5D 2YZ1A 3SGJA 5HYJB 2BERA 2CXKA 1UA6L 2FJFB 3UC0L 2B1AH 3QIWB 2AKRA 2DWEA 4L4TA 3IDIB 5AAMA 4LKXA 4ZAKA 1INQA 4LIQE 4A6YB 4DKFL 3OBAA 4HH8A 4FG6C 3BP6B 3EO1A 1E28B 5GZNC 3HPLA 2P45B 1FVEA 4RGNB 3ZT7A 1L7TH 2YD4A 1C16A 2C3WA 3JWNC 5IF0A 4P2QD 3WBDA 4XCNB 3ZKNC 3V6ZA 3QFJE 5EBMB 5TDNA 4Z0XA 4UINL 3UPAA 3O11A 3QPXH 5EU5A 3VFVB 5JXED 2WANA 1NGQH 3LCYA 1C7TA 3SDXA 4GJTB 12E8L 4AMKH 4WHTA 1MF2H 3BPLB 1VHPA 3M45A 5DMGC 3HI6L 1O0VA 3QQ9D 4EDXB 1CDYA 4DFIA 1HXMA 3I6LD 3MRHB 2BVUA 4G9DA 2NZIA 1EJOH 2YA1A 3L9RB 3QDGB 3TPUB 1BFOA 1PQZA 3VXPA 4GBXD 4LOUC 2IQ9L 1U8PA 3KJ6H 2OL3L 2ED9A 4KDTC 3QAZB 3RWCB 1HILA 2V5TA 4PJEF 5CSZA 1YQVH 5I2IA 3WJLC 3M17A 3OAUH 4AEFA 2ZUVA 3FB6B 2QQKL 5FECB 4KY1H 3EBAA 1CT8B 1L7IL 2BY2A 2RB8A 4WEMB 2EE2A 3FQXA 1EH9A 1PSKH 4M7LL 4F57L 5ANME 4LP5A 4U1SB 1T4KA 3U36B 1JYNA 1QP1A 3KXFB 4JFFE 2BVYA 1AGCB 1F58L 4G6KH 5IROC 2QQLL 3MYJB 3ILPB 3D18B 4LSUL 5D6DA 1BQHG 3WNOA 1S7XB 3RQ3A 2FBJH 3TNMB 4NP4H 3LRHA 3L7EB 3ALPA 2ICEB 2JB6B 3LDBC 5DHYB 1TMCB 3WCYA 2X4QA 3EO0B 4PJFA 3QH3B 3HZVB 1JYWA 1B4JL 2EDLA 5DMKA 4XWOC 1HQRA 4NKQB 3U6RA 1NGPL 3ULUE 3QQ3A 5K33A 4S0SD 5ICZB 1A6WL 3OXRB 1JWSB 2P48B 3VXRB 1XGQB 4N5ED 3S5LA 1VFBA 5MEPA 3RWEA 4L4VE 4P23D 2CLZB 3ARDD 4I48B 4W6XB 6FABL 1H5BB 1QKZL 5DR5L 5CEZL 5E8OA 2XNAA 5IB5A 1S3KH 4MAYA 4D9LH 3QNZA 2JELL 3L3GA 4QRRE 3WL9A 4F8QA 1WCBA 1ZHKA 1J9CT 2CMRL 1F4YL 4J3OC 4OTXH 4E41D 4GT7A 3RWHB 3PHQB 3L5HA 3CXHK 2X4SA 2FJHB 1A6TB 4XCYB 3DX6A 3RTQD 2J8OA 3RWGB 4PY8J 3CDGB 4MMZC 5EUKB 3UBXA 2PXYD 4E0RB 2YKLL 2ITCB 5MEQB 4M93C 4F15C 5FGCE 3IF1A 4Z7NF 1CFSA 4KROD 3DURB 1FFPB 3G6JA 3DROA 5DURB 3CLEL 1S9VB 3NFSH 1MSPA 2I9TA 5EZOL 3G5XB 3D1MC 3S36X 4C54A 1FC1A 3X12A 3MCLL 3CVHL 1D5IH 1MOEA 1YPZE 2NY3B 4ACPA 1NCAH 1G9NL 1KJ2B 4IMKC 1OSPH 3STBA 2O61B 1MI5D 4LSRH 2DIAA 2BNUB 5FDWA 2OTUB 1DVFD 4NCC1 4UMGA 4MZ2A 1AJ7L 5AWNL 2E9JA 1WVZA 1CG9A 1OP3H 3VG0L 4GKNA 4QXTB 1PZUB 5D2LB 4JJ5B 4P3CH 2C1OA 4XNMB 1INDH 3C2AH 5T5NF 4U1MB 3TVMA 3RNQB 4XNXL 1M1SA 4YO0A 3HZYB 4K3JL 3O0RL 4WO4B 1A7RL 4KXZI 1GGUA 1D5MB 4EUPA 4ZDHA 1NKRA 1KIRA 1AY1H 1G6RH 1IQWH 3BMWA 1URLA 4KVNL 1YYMH 3R4DA 3VE0A 3DVIA 1TZGH 3Q48A 1U8JB 4M6OH 5I66A 4K3EH 5DC4B 3C9NB 3QWRA 4F7CB 4D9RE 5IQ7H 2IANA 1X7QA 5A40E 4MA7H 4QHMB 4HS8L 1QSFD 3PL6C 4QHNA 4JB9H 1UWXH 5D2NA 1FAKT 2OR9H 3V5KB 5KSVB 4PJCF 5HPMB 4PYHA 2UZXB 4WI9A 4PJAF 4PRHD 5F7FA 1JWUA 1NEUA 1SJXA 5BZDB 1N59B 2EDTA 4PB0L 3JWOL 2GFBB 1XCTA 1YEKH 4Z76A 3ULVF 1ZGLB 1BPVA 2PCPA 2A6DB 5EIIB 4FP8H 1YMMB 1G7JB 4OF3A 2Z35A 3RA7H 4FXGB 3MLZH 3QUMH 2J8UF 1AR1C 5DS8B 3KPPB 2CKBB 4JDVB 1BREA 3ZE0F 2DL2A 1JF5A 4JFYA 3L3JA 5L0QC 4AENA 3OKKA 3KPQB 4FQJH 3EFFA 4GAYB 4NQDD 2Y6SD 2O5ZL 5KSAC 1MCNA 2EXYD 2GITA 5D4QA 3S97C 2F54B 3BKCL 4V2BA 4Y16C 1U9KA 1YUHB 3F7PC 3QG6A 2WQ8A 1T3FA 3RWJA 4ZD3L 1EAPB 3O6KH 1P5VA 4YXHH 4HUWB 5EH1A 4P2OC 5EU6D 2Q1EA 5KTEH 1T5WA 1VACB 4TVSa 3SCMC 1ZLUH 1SEQH 3O3BB 3ARBA 4NDMA 1T22A 3FTGB 4PGZA 5DT1L 2HLAA 5DJ2B 4NQXB 1YY8A 2DQTL 2SEBB 4JHAL 4XPHH 3RVWC 1BIIA 3L3IA 5I8EB 3E1F1 4W4OA 5EUOF 5JIKA 1IGML 3BVNB 2KPNA 1QRNE 4JZNA 5EZIH 4KROB 4FN0A 2GSGB 3ISWA 4WEBH 4XAKE 3A6CH 1KTLA 2V2WB 1T83C 2X70A 3WV0A 4JFOB 5JOFB 4JQIH 3Q1SH 4U1NB 4CU8A 4D9QD 5F7UA 1DN2A 1TNMA 4P5TA 4PJ5E 5B21A 4PJ7F 4S1QH 4FFYL 2WMPA 2VDOL 5F88B 4C59B 4I3GA 4NQUA 1MWAH 1QLFA 2HJLA 4WUKL 1P6AB 5JPMB 1FSKB 5C0IA 4XCEB 3QXVA 3UZQA 5E2UL 3ZDXF 1YDPB 4U6HA 4L8SA 15C8H 2CIKA 3FB8A 3HHRB 4RFNC 4AH2B 2FRGP 2YR3A 3VFNA 3MRNA 4OFKA 4KK8D 3P9MA 4JREC 1AIFB 2HMID 5MP6L 2IAMA 4Q6IA 1X5FA 1XF5B 1DLHA 1R3IL 4KJPD 2C3HA 4P4KC 4HWBA 5MI0C 2Z9TA 1ZLWK 2XA8H 3SO3C 3C5SB 1YEEH 5HD8C 1GGYA 3RIAK 2Y1VA 5T33H 4F80A 5GGTH 4NOFA 4GXUM 3UTPE 3IYLW 4WRLA 3MNWA 3P73B 2N7BA 3S6CA 4R3SB 4W81A 2KQMA 2OX5A 5E9DD 3F5WB 4LVNB 2HTKD 3NZ8A 1AGEB 1HOCB 4GRLA 2KZ1B 5BMFH 4LASL 2IPKA 3VCLA 5M7QA 1KYOK 4FQ1H 1T66C 3C09C 4Q7DA 2V7HA 2NLJB 4ZUWA 5GJTL 3PUCA 2XXMB 2XY2A 3CX5J 4X6CE 4LBEB 5C9JB 4H26B 5FHAH 3QDHA 3SDCA 3F12A 1ZV5A 4NO3A 3FAXA 5D71H 1MCPH 3EDJA 1CXEA 3QUXD 3HN3A 3QZWA 1O5DT 3DSFH 4XCFH 4XP6L 3TPKA 1UH2A 1GPOH 3L3DB 1TITA 4HSQA 3BH8B 1EV2E 3V95A 3I85A 1Y6KR 3WS6A 1FNGB 1KTDA 4F2MB 4DN4L 1IGCL 4U6VH 3LD8B 3FMGH 3TA3A 4K7PH 5FM5M 3GMRA 3IFNL 2AAVA 4WHYH 1DN0B 1XGRA 2AK4D 4NGHH 5CJBA 2Z0BA 3H0TB 3JV4A 2R0KL 2R56H 2ZCLL 3IDYC 3KGRA 1QLEH 5F7MC 1P1ZB 1J8HA 1RI8A 2BOCA 4ZS7H 5J13C 5HYSA 4JRYB 4WFHE 3FRUB 4KKBD 2XZZA 4JG0H 1KEMH 4L9LC 4ONOA 1BD2D 4NO0D 1EVTC 5DUPL 5D93B 5EOQH 4XMKH 4XI5C 4PJBF 5CEZE 4YDJA 1ZWIA 5L2KA 3SGEI 3TN0B 5T3ZH 1NCDH 1T03H 2ITDA 2P49B 4U0RB 5C07D 2AEWA 5JDSB 4F7EB 3QA3A 1VEOA 1LNUB 3IDJB 5A3ID 3HE7C 5I1JH 5GIRA 3WLWD 4YHPB 1LDPL 1JTTA 2QEJA 2PETA 3OZ9H 2AXGB 2YK1L 1WT5A 3T0WA 3TCLA 2YXMA 2YD7A 4OCRL 3UJJH 4O2CB 4AIXA 1VADB 3C60D 5J6GB 2R4SH 5C0FB 1CQYA 3MJ9A 3VWJB 2PR4H 1NBVH 4NRZA 5SWSB 5DD1H 4X7TB 5C0NC 1BJMA 5F1NB 3FFCA 2FATL 3MV7D 4Z77A 2HWZH 2H2SC 1FIEA 4YHOH 3QEQB 3TFKD 1TQCB 1IFHH 3DO3A 1SBSH 4MX7B 2OLDA 2G75B 1WGOA 1I7TB 3BESR 4WNQA 4HKZA 1BECA 4O02L 1JGDB 3GMQA 5A16B 3O8XA 2VRAA 1DFBH 4GG6E 1Q9WB 3VXME 5AEAA 2H1PH 4G8EB 1BVLA 4ZUVB 3ZE1F 3B8SA 4O5LH 4RAUB 4DK3A 1AKJB 1TCRB 2M2DA 3NFNB 2GTWB 4K9EL 4ENEC 5IMLB 2HTLC 1PG7W 2AABL 4MDJA 5DA0B 2ZOLA 5KVEL 1F4AA 5JW5A 4I2XA 3MLWL 4JFXB 2VO5A 3T0BA 4TN9A 3PWPA 2XN9B 2AJYH 1H3XA 3GUTA 5DWUL 3RPKA 1IAIM 2CDFB 2HVJB 1H3GA 2Q76A 5DHVB 3SDAD 4KZDL 5KVFL 3HZKA 1NLBL 5DMIL 3SE3A 3D87B 1W72H 4FZ8H 1UG9A 5GSVB 3T0EB 4FQXB 5DJ8A 4RMVA 5C2BH 4ZODA 3IVKA 3DVNA 3BN9C 5KOMC 4Y19D 2EYTB 3TJHD 1BQUA 2VH5H 4NRXA 3HNSL 3HPJA 4I77L 1T1WA 5EPMB 3B83A 2NXZD 3IDXL 1G7MB 1I8MA 4HIHB 5CJXC 3T2PA 3BI9X 2D0HA 4ZPTB 4J3TA 2ZUXA 1CR9H 4WV1B 2I5YH 1LK2A 2KDGA 1F8TH 3GB7B 2VQ1B 2B1AL 4RQQA 5IVXF 2W1NA 4LSTL 5DSCB 3VFMA 4PRPD 3QNYA 4Q97A 1XGTA 3NCFB 1MCWM 2OP4H 3IB4A 4PJDB 3NCYP 3MJ8B 1LEKA 4J4PA 2E7CA 3S5LG 5B38A 2NNAA 4YNYB 2QQQA 4TTDD 1L7TL 1FHGA 4X4ZA 3TO2B 1AHWB 5MHSD 3ULSA 4RX4D 4Z7UB 1PY4A 4HGWA 1VFAA 2BNQB 5HI4D 2BVTA 1A9BA 2WP3T 4RZCA 5C0AE 4R0LB 3QPXL 5IOPA 3JWDC 4JM2B 4ODUA 1IGYA 3CFJB 1HXYA 3AVEA 1NGQL 4DZBB 2UVFA 1E27B 4AMKL 1MF2L 3PF2A 4JPIA 1BVKA 4G8FB 3DHJA 2GHWB 5LJYH 1QPPA 1IZKA 3AY4C 5D7LD 1EJOL 5I1HH 2EO9A 3C60B 3UBXG 3W0WB 4N9GA 4PFEA 3EUUA 4D0CA 5E94B 1H3VA 3IU4H 3O9WB 3KJ6L 5F1IB 1JZ6A 2A6KB 4KI5F 3QRGH 2YD2A 1YQVL 4N5UA 1I7RA 5DRZA 5DGRA 2BC4A 3MOAL 4NKMB 4KY1L 2VDKH 3K4AA 4LVOC 5SWQA 3QHTC 1PSKL 2D0GA 3S98A 3GSNB 3SJVE 4XBEH 4ZO8A 1U8OB 5F9OH 4P5MB 1K2DB 1MLCB 2VLKB 4G6KL 1IM3A 3TV3L 5BRZE 1J1XH 3WFZA 4KFZC 4PRID 3GSRB 1DBKH 4LNVA 3MLTA 2QSCH 4CVXA 3MMEA 1XFPA 4X8JB 3QCVL 4CADA 1BZ7B 4X7CC 2FBJL 4NP4L 1R6VA 3TYFA 3LIZH 3W5MA 3GI9H 2Q7YA 3C6SA 3ZTJH 5ALBH 1R3HB 3QUZB 4EUPG 3NCJL 1I75A 2C26A 3HR5B 4OZIA 4OLWH 1ORQA 1JUFB 1OGTA 2JK5B 2OJEA 5D2LF 5F9WC 5I75B 4AZ8A 3PNWA 3LZFH 1XCQB 1YEIH 4ZUUB 4U1LA 4Y19B 5JPNB 4D2NA 3WEXB 3SOBH 1UC6A 1HEZB 1S3KL 1KGCD 1V8HA 2NYYD 1A7PH 2FWOA 1LE5A 1BOGB 4Y8DC 5CGYD 5LBSH 3KPRD 4KV5F 4LEOB 4OTXL 5D8JH 1FLTX 3WN5C 3FQWB 3GIZH 3VH8B 5L8JB 1U92B 3HC3L 5ID0A 5EC1A 1NC2A 4YZFE 4YHMH 1HK6A 4NNXA 2EEAA 4F7MB 3E6HA 5D7IF 2APBA 3QUYB 3LQMA 2IGFH 1OGAB 5EU4A 3VFOA 5JQ6H 3U30B 1DEEB 4Q9QH 4MNHB 1NH6A 1A6ZB 3JWDH 3TBSA 4OM0H 5EBLB 4G6JL 3V0VA 5JHDB 3CSYA 1C5CH 3ZTNH 3GSVB 2WWMD 5FB8A 5IHZA 1V7NL 2PO6A 3HCVB 3CFDA 2X9YA 1I1AD 4LSQH 2RJMA 2ZG1A 1D5IL 1T2QL 2WWKO 3V4UH 1NCAL 4MXWH 2VAAA 4RGNC 5JUEH 3MRGB 2J5LB 3SDDD 5C0GB 2WSKA 1OSPL 2A9MH 3VFPA 3NIDE 4LSRL 5FGBC 5D7SH 4BFEA 2IH1A 2VN7A 4KJWD 3VWKC 1F02I 4PJXA 1A1OA 1S7RA 2FD6H 3CZFB 3U46B 2FJGB 4P3CL 3OAYK 5A43C 4KJQD 1INDL 1JV5B 5E00B 4DW2H 3BPLC 2CRIA 3VFWA 3P2TA 4DN3L 3B5TA 4RFEB 3V0AC 3N1MC 1XMWA 4N0CD 1AY1L 4KDTA 4LPTA 4UTAH 3BFOA 3OJ2C 4TYUA 3BZEB 3WJLA 4HJJH 1TZGL 4F3FA 3QAZC 1F6AB 4M6OL 4K3EL 5JZ7C 4PYGA 4CMHB 3KHQA 2I9LB 5IQ7L 1DQLH 4ODBD 4QNPE 4OV6F 5FGSA 2H32A 4TUOB 4MWFA 5B3JF 4JB9L 4J6RH 5I6XB 4KDWA 4ZSOB 5E8PA 1K6QL 1ZVSB 1RVFH 4HWEH 5CLWA 3G04B 2WLZA 4KRPD 1MCOH 3QXAB 5IROA 5CBEB 1G6RA 1FIGH 3C6LD 2CXGA 2R1XB 4OIIH 3U4EA 3VXUB 1YEKL 1S7WA 3DI2B 1EEZB 5J0BA 4GXVH 4S1SH 3RA7L 3MLZL 3QUML 4LHUA 2V2XB 4J1UB 5J6HB 4K2UH 3V7AG 1HHKB 4P57B 5FF6B 4OZGB 2J6EA 4FQJL 4L1HA 1OLZA 4PTUA 3U0TB 1WAAE 4BA8A 4QRPA 3RI5F 5D96B 5KSBE 2P44B 4P46B 4DVRL 2P5ED 5GRYA 2DMKA 3O6KL 5ISZA 4YXHL 1BQHB 3IU3A 2C3VA 1NGWB 3BISA 3GMOB 2XWJB 1IKFL 4UOW1 5CJ5A 5CKAA 1SEQL 1CE1H 5TH2B 4M7KL 2XQBH 1NCNA 1YEDB 3QZWG 4EDWL 4Y5VA 4JFDD 3MBED 2AJ3A 4XPHL 1EHLH 2W91A 5CEXB 4LLWA 5CUSH 5EZIL 4A6YH 5CS7A 4QOKD 1SJVA 1RUPH 3R0MA 1PG7X 5CIPB 3A6CL 2NTSP 2W9DH 3JTTB 4Y5YC 3BHBB 5ESQA 1MCLA 1AXSA 1I85A 4HLZH 1I7ZA 3IJSB 3PIQB 4JQIL 3Q1SL 4LPUA 1JZ3A 5J1AB 4NZTH 4OUUB 3P9LB 3D39B 4XX1G 1N6VA 2GK0A 2WQRA 4YXKL 3T77A 1KB9J 3DYPA 4S1QL 4QHLA 3P4NB 1MCWW 5HYSG 1R5IB 4AJ0A 1MWAL 3QXUA 3S36H 1HDMA 4DUXA 5F9JB 5ETUA 3W81A 4JQXA 1YEGH 2HT3D 4F33A 15C8L 4ISVB 1QLRB 3VGDA 2ATPA 1XF4B 4MQ7A 5EDXA 3VXOB 5JXEC 1GYAA 5HSFA 2ESVB 2Q3AA 4TVPH 2AJUH 3QQ9C 2XA8L 4CJ1A 1QR1B 1IEHA 1EO7A 1YEEL 3O2DH 4RBPH 4UQ2B 4WUUB 5T33L 1HHHB 4JZJA 5GGTL 4GBXC 1I9IH 3U2SB 3VMPA 4Z7VA 4BSVB 3KLAA 4R97C 3MUHL 3ZT5A 4UV4H 1TPXB 3RNKB 4L8BB 5I0DA 2E27H 3QNXB 4WO4C 2WM0A 3EKCA 1D5ZA 1E4JA 3BJ91 4OV5A 5DRWA 3KDMA 2XA3A 4G6AC 2B4CC 1EZVY 5E1AB 4G8GA 2D31A 4ODTH 2MHAB 4FQ1L 4YAQB 4HFWB 1RQ5A 5SWZD 5FHAL 4NBXB 1AD9B 1WC7A 2CK0H 3PL6A 4X5XA 5C6TH 4OZHA 3ZZ1A 2YZ8A 1OWRM 2B2XH 1A6VH 4QEGA 3DSFL 4XCFL 1GSMA 1GPOL 4KVCH 3SDYL 4FTVD 4KKNA 4JVUA 3OAZK 5C0BE 3S37X 3RDTA 2QJDA 1KLUA 3MNZA 4FMKA 1ZT7B 3OGCA 5C9KA 4FXKA 1J11A 1ACZA 2NY4D 3P77A 3P4MB 4U6VL 1C08B 2EYRA 3FMGL 5T1MB 1ND0A 4K7PL 3VXNA 3TO4D 5DFVD 4NGHL 4XH2B 5KZCD 2R56L 5D7JB 2XRAL 3OF6D 1QLEL 3FO2A 2FYYB 4J3VA 2FH8A 4N5EC 2DQFA 4HPOH 4ZQKA 4ZS7L 2VKWA 5ID1B 3ARDC 1KEML 4OF7A 5EOQL 1U41A 1J05A 4XMKL 1QR4A 1YN7A 2GT9A 1FYTA 1SJEA 1FL6B 5T3ZL 1E4XI 3RI5K 1NCDL 3WUZA 5C0RH 2JIXD 4OF8A 1CFVH 1FNSH 3SCMA 1PYWA 4JFQB 4KK5D 4NQED 5IJKC 4X6DE 3QIBB 5IR1A 5DK0A 3OZ9L 5IEHA 3BUYA 1KXTB 2Y5EA 5CEYA 3O4OB 2W65B 4LCWB 3LKSA 4DAGL 1X44A 4LVEA 3UJJL 1I3RA 2R4SL 2CIIA 1N5YH 3JZ7A 3PQYB 2APXA 3JUZA 3F7YA 1WIUA 5ADPH 2PR4L 4BUHA 1Q9LB 5DD1L 5JORB 3MUJA 4IMLA 4KROC 1T83A 5B38G 5DI8A 1BQSA 2HWZL 1IEAB 3PGFH 1KJ2H 4FHBD 3H6JA 1ADQA 1IFHL 1SBSL 3UTSB 1T80A 3TZVA 5ICYB 4Y1AA 2ARWA 3O3DB 4L3EA 1BFVH 3H9HB 1F45A 4MB3A 1Q9KA 4P4RA 2CUHA 3GJEB 4HH9B 5DVLA 4UNUA 4KZEH 1FSKC 1FL3A 4Z7UF 3H9SD 1V3KA 2H1PL 1DLFH 3DVGB 1S9XB 2LABA 4NZUH 2AV1A 5JOEA 3EOAA 1FVDB 4O5LL 1PX3A 4JM4H 2B4CH 4EKXA 2YEZA 5KANI 2YXFA 4P4KA 5D5MF 4LLUA 3O4LE 2WBKA 5BQ7B 5D7KE 1P7QA 1BF8A 1R5VA 4LCUA 4WFGD 1O7SA 3UTTA 3SBWC 2R1WB 1QBBA 2P8PB 2AJYL 3SN6N 3KPSD 1P7KB 2PKDA 3PP4H 1D5BB 3FOMA 2XTJB 2F53B 2AVGA 3RY6C 2NMSA 3ARFB 2AEPH 1W72L 4XBGA 5EO9B 4FZ8L 1EHNA 5C2BL 4L1DA 1WWCA 1IC4H 3FCTB 2IWGA 4C56E 1IM9B 2XTLA 4U1JA 4LVNC 4RNRA 3W39B 3KYMA 3CLFH 2HG5A 5DRNB 4IJ3C 3UZVB 2CKBH 1NUGA 3U82B 2EYSA 2V6HA 4Y4KD 1S5HA 1EUTA 1CR9L 2I5YL 4E42B 4F37F 4PBXA 4IOFD 1F8TL 3LV3B 1G0DA 4I9WE 4OCMC 4EXKA 1CDHA 5JNYA 3B3IB 3ILQD 3UPRB 3QP3A 2ZSVB 2OP4L 5HGHB 2VTFA 3TP4A 1T1XA 2BDNL 1SMOA 2J12B 5ADOH 4KK6D 3LD8C 2OSLA 5DLML 3D3VE 4KKLD 2LTQB 4HIJA 3ME0A 2EXYC 5DJYA 1G7IA 2E9BA 4HWUA 1KULA 4X6CA 3BT2L 2VLJE 5DJXA 1I8KB 2VZ1A 3R8BB 3EGSB 2YHGA 1UCBH 4GOSA 3HRZA 5E6IB 2X4UA 1H3TA 3B9KD 3UDWC 2VDNH 3QDJA 4MNQA 3I6GA 4L9LA 1HHIA 4FNLH 1UQSB 1FFNB 1KSRA 2EDRA 3PV6B 1QFWI 4YGVB 5HHPB 5I1HL 1T0NB 3OKMB 4U0RC 1U42A 2W9EH 1FJ1B 2F5BH 3IU4L 4Z6AT 1ZLVH 5IW6A 3T0DA 1MEXH 1JRHH 3VA6A 4JRXA 4P2RE 3QRGL 3HNVH 3RFZC 4PJGB 5HHOE 2A83B 5J06A 4QGYA 1HKFA 3BWAB 5GRXG 3O6LH 2UV3A 4CN4A 5D1QB 3L7FB 4KTDH 1FZOA 2VITA 4ZMAT 4UBDD 2QL1A 4WWKD 3VRJB 3VWJC 4MAYD 4OZFH 1A2YA 3QHFH 5DD6B 4XBEL 1ROWA 5F9OL 4HK0A 3RL2A 4OCNC 1QFUH 3BD3A 1J1XL 2IG2H 3CSBA 2OBGA 2VDRH 1TQCC 3ARWA 4PJCA 5ICXA 5K9QI 2AKRB 2DWEB 2OCFD 3BSZH 4PJAA 1NCCH 4L4TB 3UYRH 4BFIA 5FUOH 3GHBH 4ZAKB 1RZ8A 3GI9L 3REVA 1INQB 3SQOL 2H2PD 2NX5E 1LD9A 1ZVHA 3EO1B 4IRSA 5C7XH 2NTFA 4D8PA 3HPLB 1RJLA 4M6MH 3IXTA 1PD6A 3WIHH 1FVEB 4KPHL 3FQRA 1C16B 4OLWL 3CMOH 5IF0B 1KFAH 1A6AA 1Z9LA 4TSCH 4M6AA 1TTUA 3V6ZB 1J86A 5CINH 5TDNB 4Z0XB 1KCRH 3O11B 5EU5B 5JTWA 3HC0A 3SDXB 3SOBL 4WHTB 3TM6A 3B8YA 2ICWJ 1FGNH 1QFPA 1A7PL 4Z7OF 2RCSL 1HXMB 4G9DB 1JZ7A 5LBSL 4GG6A 1I1RA 4LSPL 1BFOB 1DBJL 1PQZB 3T0EC 5D8JL 4FQXC 3VXPB 3VXSA 3GIZL 1U8PB 4ZFFA 3NFPA 1HILB 4TNWF 4YHML 2Z31D 3C2SA 5CSZB 1K3ZA 5I2IB 1JPFA 5EUOA 3IAPA 3M17B 4HJGA 1XIWD 2IGFL 5CJXA 5JQ6L 4L29A 1GHFH 3EZJB 4Q9QL 5I19L 4RRPG 2B0SH 4Z95H 1MJ7H 3MLUH 3ECBA 4UT7H 3FQXB 3JWDL 4QO1A 2AQ2A 4WV1C 4RDQG 3CX5K 4OM0L 1U3HA 3QIUD 1T4KB 1MHHA 5DJDA 1C5CL 5CGMA 4Z7WA 4KUCF 3N0PB 3LS4L 2RQ8A 4PJ7A 5C0CD 5F9AC 4LSQL 2XQYK 2HFTA 2Q7NA 2FBOJ 4I0PA 3VMNA 4MXWL 5JUEL 2VMFA 5H35A 3ESVF 1AHWC 5D7SL 1PFCA 4R26H 1Q72L 4PJEE 3IKKA 3MTRA 2X4QB 5AYUH 2EECA 3MRDA 4HGMA 3FQNA 4R0LC 5T3ZE 5DMKB 1HQRB 3U6RB 3LB6D 3WLWC 2R2CA 1CDCA 2VLRD 5TGBA 3QQ3B 5SV3A 3QQNA 4DW2L 1EDQA 3S5LB 1BBJA 1VFBB 5MEPB 3RWEB 3C60C 4L9DA 2I24N 4UTAL 5E8OB 2XNAB 5IB5B 5LWYH 4MAYB 3O9WC 1JHLL 4HJJL 5HDBF 4GAJH 3RL1A 3QNZB 5L88H 3L3GB 1OOAA 2OTPA 1TETH 3B2UC 4KMLB 3WL9B 1ZHKB 5F8RC 4NC1C 1DQLL 3HG1E 3EYSH 2EDWA 2Z92A 1OD7A 4KU1A 2X4SB 4KTEH 3DX6B 3T4YA 3BPCA 5FV2A 1RVFL 1C8PA 4HWEL 1JMXA 5FAAA 3NCMA 3UBXB 2H26A 4ELMF 2PYED 5I1IH 1FIGL 5DUBA 3IF1B 3GJFH 3GRWH 1CFSB 3CFEA 4U33A 4HUUA 4E5XA 3VGAC 2BHUA 3G6JB 3L5WA 4S1SL 3DROB 4NKDA 5DJAA 1CL7H 2Y72A 4GG8A 2R2HB 4NQCD 3EO9H 4K2UL 2O26U 2UYLA 1L0QA 4MXQD 4ODSH 4ZNEA 1S5IH 2J2ZA 4G6MH 3X12B 4NHCL 2P5WD 1K4DA 5C0EA 2F8VA 3T3MF 1T7XA 3QUZC 4LAJH 4WFED 1FBIH 1RHFA 5FDWB 2VNCA 5I75C 1CG9B 4XGZA 4GKNB 1U8IA 1XEDA 4PJBA 3CFKA 2C1OB 2XPGA 1CE1L 4XNUL 4Z7NE 3TVMB 5B3NA 2XQBL 4YO0B 35C8L 5CILH 1U93A 2VZ3A 2F58H 4EUPB 4ZDHB 4OCSL 2BVOA 1KIRB 3I3BA 1QSZA 1RZJC 5CUSL 4A6YL 4X98B 3VE0B 1RUPL 5GRZA 3BGMA 5I66B 2W9DL 1HH9A 5KS9E 1I9JH 2DDQH 2X2YA 4F7TA 4CN1A 2IANB 2R8SH 1X7QB 3U30C 4NZTL 3V6OC 4YK4B 5D2NB 3BQUD 2DJUA 4TTDC 4V1DE 3S36L 1UKQA 2Z93A 3DETD 2LFGA 1JWUB 5AZEL 4N0FA 5I8KH 5HI4C 1YEGL 1XCTB 4Z76B 4QKXB 4NN5B 2W60A 2Z35B 3WNNA 4WHYG 3LH2H 3VFSA 4TVPL 2AJUL 4JFYB 3O3AA 3QDMD 3L3JB 3AU1A 4AENB 4F9PA 3OKKB 3S4SA 1EFXA 1W2KT 3FQUA 1QZ1A 3EFFB 2YD3A 3VWKA 1AGFA 1PZ5B 3O2DL 1OT1A 1KTRL 1QO3A 2GITB 1I9IL 3ARRA 5GRUL 2UWEE 3QG6B 3K74B 1T3FB 3RWJB 3GSNH 1J18A 1BHGA 2E27L 1Z0MA 4K71C 1AR2A 1T5WB 5E95B 1JWMA 2DYPD 4DOHB 1WFUA 4OCXL 4XVJL 3ARBB 4R96A 4YDIH 4NDMB 4XWGH 1T22B 4B53A 5D1XA 5A2JH 2K9UA 1RZ7L 1YY8B 4ZNCD 1RV6X 5C6WH 1A9EA 1K8DA 2J8UE 1BIIB 1IL1A 3L3IB 3OG4B 4CMHC 4HULB 2CK0L 2VLMD 5C6TL 3EYFA 1FZMA 4JZNB 4UV7H 1KACB 2K3TA 2B2XL 5CMAA 1A6VL 5T1LD 1N0XH 4F8TA 1JGVH 4KVCL 1KTLB 2DBLL 1X5GA 1DDHA 4WTWA 1GGIH 2X70B 1CXKA 2PTUA 3EOTH 3DVFA 5B4MC 1MCBA 1EBPA 2E9WA 3U9UA 3ILPA 4HK3N 4ZPVA 4P5TB 5IVXA 3ZYJA 1KJ3H 2W0KA 3WD5L 2W0FA 2NW3A 3ZHDA 1QLFB 2HJLB 2I07A 3VG9B 5C0IB 5E7BA 4LARH 1LILA 1CLZH 2CQVA 2GIYA 5FO7A 4U6HB 4L8SB 2CIKB 3FB8B 4JFED 4HPOL 2UZYB 4O2FA 5EZLA 5IB2A 5ACZA 3VFNB 3MRNB 5D96C 3P9MB 3FHAA 4I3SH 1RZJH 4IHOA 2IAMB 4Q6IB 5F93C 1DLHB 1YZZA 4ZTOH 4EOWH 5M94B 3V79C 2NYYC 3DYMA 3QXTA 5J9PA 5FYKU 2DN7A 5C0RL 1XGQA 1YYLH 3VI4E 1CFVL 3MV9E 5CGYC 1BJ1J 5EIQA 3MV8E 4OLUL 4PV9A 3Q6FA 2YN5A 2R1YA 3DRQA 3MX0A 2Y06H 2EKSA 3MNWB 4U1IA 4K07A 1G1YA 5I1CH 1EEQA 4PLNC 5I1KH 4XHJD 2A74A 1N5YL 3S96A 3NZ8B 1UZ6E 4DCQA 4FRWA 4GRLB 4MA8H 2IPKB 4EXPX 5ADPL 5LKNA 3VCLB 1OCWH 2N7AA 3I6KA 2V7HB 4Y5YA 4ZUWB 4GRWB 4ZXBD 3T3PF 3PGFL 1KJ2L 3SDCB 4NJ9H 3KPMB 3F12B 4APQD 2WWMC 2GUOA 4NO3B 3CDFA 4OI8A 3QZWB 1I1AC 3DURA 3RVTD 4PGCA 2DD8H 1J0JA 1YEJH 5KSUA 5TDPA 4P2QA 2A0LD 1SMAA 2A73A 3ZDYF 1KTDB 4KZEL 1DLFL 4KJWC 3TA3B 4NZUL 5T5NG 3V5DA 3GMRB 1C7SA 1KJ2A 3IFLH 3ARYA 4JM4L 2B4CL 2YPLD 2YWZA 1XGRB 3E2HB 4LDEB 4KJQC 3JV4B 1RIVH 3HI1A 2R9HD 3W9DA 3LQZA 1J8HB 2BOCB 3MO1A 1U2HA 4HIIA 5MERA 1RY7B 5HYSB 4NN6B 4GBXA 1CS6A 3PP4L 4ZFZA 5GS1C 3RNQA 3P4OA 4YDJB 1ZWIB 3RHWF 2NY0D 4ZYKA 5L2KB 2AEPL 4PY8I 1CD1A 4N90D 1TPXC 2ITDB 4MJIE 1FG9C 3QA3B 1Q0XH 3V0WH 1IC4L 5AG8A 4G3YH 5GIRB 3ARVA 1BZ9A 1CGTA 5F9DC 1UB6A 1X5IA 3CLFL 1AO7E 3TCLB 3UROR 2OMNA 1H15A 3LN5A 2AEIT 4KJYA 3H2WA 5TF1L 2ZUWA 2KKQA 1OARH 2CKBL 1B0GA 3EYUH 1JNLH 3CPLA 2QHRH 2YWYA 4BH7A 3QPQD 1N5AA 4GLRI 4NRZB 5D7IA 3G9VA 4RMRA 3FFCB 4XP5H 25C8L 4ODXA 4G5ZH 5DF0A 4Z77B 3BE1L 1XR8A 5BS0E 3UO1H 1N59A 5FYLD 3VD9A 5ADOL 4WNQB 4HKZB 3I3DA 5C09E 4MQXD 3QISA 3O8XB 1YN6A 1GJIA 2X42A 2E7LC 3MRCA 3GBNH 3MXVH 3OX8A 3ZTJG 1BVLB 1UADC 1UCBL 4P23A 3ARDA 3ZSSA 1X5HA 1Z9SA 5KANG 2DLHA 4LGRB 1ZHBA 4MDJB 5GRWA 2E7HA 2ZOLB 4YGAB 3DMMA 5JW5B 4I2XB 3EJZD 5CIPH 2ZCHH 2DQCL 5HYJE 3DX9A 3LN9A 5EOCJ 3PWPB 2MQCA 4H8WL 3CCHA 2MSPA 4QTIH 3ROOA 2W9EL 3L6FA 3PWVA 4E41A 4U3XA 2F5BL 3MREA 4JKLA 3GUTB 4Y4HD 5HGGS 3EZ8A 1EGJA 1JRHL 1MEXL 2D4FA 4L3CA 2Q76B 3QIB