2DQEH

Crystal structure of hyhel-10 fv mutant (hy53a) complexed with hen egg lysozyme
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSASGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural consequences of mutations in interfacial Tyr residues of a protein antigen-antibody complex. The case of HyHEL-10-HEL
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dqeH00
5I71B 1XEDA 3U0PA 4GOSA 4LHUG 1T7ZA 3FO1A 4ZTOL 5HYSA 5GISL 4NCC1 1J05A 3QUZB 5ALBH 5IMOB 5C0AB 1QPPA 2OM5A 4KDTA 3BKJL 3GMMB 3AU1B 3CDYA 3UJIH 1WBXB 4QHLB 3FHQA 4MNGE 3RWCA 3MNZB 3T4YB 5JNYB 4O51A 3BH9A 2M2DA 2Z4QB 2G9HA 4HIXL 4TULH 5A3IC 4LPCA 4K7PY 4QRPD 1N3NA 4QRTA 1XF3B 2X4QA 1YYML 3QUYD 4QTHA 1F6AA 4YXHL 5D2LA 4PJ9C 5C0DB 5DD5H 1UWGL 5HHQA 4WO4B 3AFLA 4XTRD 2X41A 2FJFA 2YD1A 5JHDD 2RGSA 2JJWA 5IB5B 4U1GB 2QQKH 2Y36L 1BIIB 3DUUB 5D70L 1A3QA 4RX4D 1A6UH 1IC5L 5C7XH 5T33L 5FOBB 4M7KL 5GSRA 5GGRY 4DGIL 2GSGB 5FGBA 4P49A 4Z7WA 4Z7NE 4PJFB 2XPGA 4X6FA 4E5XA 2Z8WC 3C2SA 4HF5L 3SKOB 1BM3L 1H3UA 2RIKA 3V6ZB 1J1OH 4RFOL 2YPLD 5FYJL 3TT1L 1CGWA 2R69H 3HA0A 1QSEA 1CGSH 2GFBA 2KUTA 4K94L 1OGAA 2BNQB 3GB7A 3GHEH 4XC1L 3H9SB 3HPJA 4QHNA 4RWYH 3V4VH 2WZPD 3VFPB 2LV4A 2PTVA 4BFIA 5F72S 1X5LA 4YAQB 5CLWA 4ORGB 2EH8L 5CP3A 2BP3A 2E9BA 3ARDC 2CRIA 2NW2B 4K7PH 1A21A 3OR6B 5EFIA 4U6YA 5IVZB 1I7TA 5FYKH 5IKCA 1P6FA 2VXQL 4XPAH 3SO3B 5DRXA 3V0AC 4JVUA 4APQC 1LE9A 5DK0A 1AGDB 2DLTA 3F62A 1P4LB 4ZOEA 2XN9A 5HDLA 1MFCH 1WBYB 3GSWB 3VXQA 1W0WA 2W65B 3FN0H 4KUCD 1AGEB 4HBQA 1O5DT 1AD0A 1VFAB 1BEYL 2XZQL 3SDDA 3KLAB 2DD8L 5T1MB 1KLFA 2E6QA 1UCBH 5IHUL 3NCJH 3FN9A 5DJCA 1JMZA 4AIZA 3FB5B 3IJYB 4F57H 4NQXB 5T1DL 4KZDH 3KPQA 1CIUA 4QRTB 2MCPH 3VFMA 1G1YA 1GL4B 3V8OA 1NGZA 5F8RC 2XV6B 1MHHB 4K07A 4YHNB 1BEYH 2GJZA 5MENE 3W11D 2IAMD 1YEIL 1KCRH 4PRNA 5LQBH 4J3TA 5JA9A 1FZJB 5IEKA 2D7NA 3ZO0A 3MCG1 3HMXH 1JNLH 3RUGE 1H0DA 2NY3D 5IFHH 4XNYL 3GSNL 1OM3H 4CDGC 4ZSOB 4NO0D 5JR1H 3MRFB 3QG6B 3CMOH 1RFDH 5FYLD 5I1JL 2DJSA 3WUZA 3MRKA 2NXYB 1K8DA 1NDGB 1U58B 1YUHA 4PJFE 4PLKD 4QRPA 4PD4K 5J11C 2X4OA 3LN4A 4OF0A 3QWOB 3SCMD 4CVZA 1IGMH 2HA1A 4HKJA 3GI8H 1J10A 1DANT 4NPYB 5TQ0L 1W8NA 3QEUB 4HXBH 3RGVD 1IC7L 4ZFZA 5HVWA 4HD9A 1NCWH 3RY4A 3SE8L 2D31B 4YDVB 2AJUH 1YEHH 4PS4L 3BWUC 2FYYA 2NYYD 1TZIA 3ULUE 2GAZB 4HJGA 2Z91B 1ZLVK 3TFKD 4YC2B 3BZ4B 3KS0H 3BKCH 3NTCL 4EOWL 3PF2A 4K3EH 1PG7X 1BQHB 4E0RA 1T5WB 3SKUD 4RA3A 4EI5B 5GGTL 3TESA 4MSWA 3QRGL 1T0PB 5FM5M 1KB5L 5LQBL 1A6ZA 1BQUA 1CQKA 1IBGL 3QA3A 4OIIL 4NQCB 4OLZH 2YPLA 3QEQA 4YDIL 2DAVA 2QQLH 5I1KH 4Q6IB 4LLWA 5EA0L 5DTFA 1TNNA 3O11A 1FIEA 1P2CB 1E27B 1S9YB 1NGYB 4NRXB 2VR9A 1H5BC 1VFOA 4ZUUA 5KSBA 4JKPL 1NLDH 4JM4H 4NPYA 1NLBH 1F3RB 1NJ9B 1ZHLB 3DWTA 5GS0H 5KSVA 2DI8A 1BFVH 2F54D 2QKIA 4NRZB 2HVJB 5JW3L 3S7GA 5D1ZD 4NOBA 3JV0A 1FZMB 1M7DB 2HFEA 2IALB 2YD3A 5GISH 4XH2A 5FYJD 5HHXL 5DRWB 1CVRA 1BPVA 4CN6A 4DEPB 4MX7B 2HJFA 4K3EL 5KBNC 3MBXL 4XWGL 1XZ0A 4LRNH 3MLVH 3SDDD 4F37F 3A6CL 3MOQA 4LCCC 5I0DA 3B9DA 4S0TD 3X3GH 2E9WA 3BJLA 4UTAL 1RUMH 1JGLL 1JGDB 2IFFH 2JB6A 3JTSA 5C0RH 4LF3A 2Q76B 1MAKA 2NY4C 3JV6B 3ZYIA 3ULVE 4R0LA 5J3HD 5JMRA 2ICWI 4ZPVA 1CLYL 1S9KC 1XCTA 5CHNB 3KJ4C 4HH9B 2VABA 3MRQB 2ZNXA 3QUZC 5FHBL 1TTFA 5EO1A 4XGZA 4MAYC 3ZHDA 4YQXL 4LOUC 5T33H 2V6HA 5CGYC 4NO3A 2DL9A 1C7SA 4M6AA 1BD2E 5IV2A 2R23B 1N7MH 4HMDA 3RJQB 4P5KB 5GGSY 4POUB 1IGCH 4LDLB 1FPTH 1FL3B 1KCRL 1XCQA 1J12A 4N8VG 1H0DB 2YD2A 3P4MA 1OTTC 2HN7A 1H3WM 2B7DT 1A2YB 2EYSA 5E0QA 3S37X 3TIDA 5IW3A 4YDJB 4W6XB 1A7PL 3BXNB 3HG1E 4L4VD 4WCYL 4L3CB 5GJTL 4XHQA 4K8RH 1CF8H 1CQYA 3O3EA 1KTLB 4KMTL 3MLZL 3QPXH 2E5EA 1MWAL 4ZUVB 1MUJB 2UWEB 4NN6B 3QYCA 3WFZA 1DN0B 4RA0C 4AYFA 2H2PD 1X44A 4GAJL 3AXLA 4KV5E 1KN4L 2EKJA 5J7CC 2GK0B 4MHHI 4ODWA 1LK3H 3N1PC 3WCYA 3R06A 4DVBA 1Z0MA 3D3VB 2YA1A 2JELL 5D7SH 5C9JB 1K4CA 5I18L 5D4QA 1JIBA 4NQVB 3KHOA 4UQ2A 1A7RH 4LNRA 2R0LH 3IS0X 1AY1L 4MMXC 1WQVT 5GIRB 5DYOB 5FO7B 4P2RA 3HNVL 2B1AL 4ZUWA 5T1KB 3ARGD 1NCAL 2V2XB 3OR7B 1Z9MA 4LLAA 2EYTB 5CD3B 3JSSA 1OB1B 3RZWA 4MQ7A 1LO4L 2F8VA 3ARDB 5DS8A 2EDFA 4HIIA 4LHUD 4LRIA 4PB9H 1H15B 5MEND 4KRNA 4QTIL 2YPVH 4I3SL 4OSUL 4AIXA 5EC1B 2B1AH 1RULL 3KYMA 4APQB 1T0NB 4XT1C 4U49A 3SOBH 5IMMB 3EO9H 2O26U 2EXYC 1XGTA 3ZKXB 3UEZA 5A16B 3SPVA 2NY2D 3Q2CA 5DMIH 5DR5L 1MRCH 1OTSC 2RBLA 3MGAA 3NH7H 3P0VL 4P4KA 4PP2A 1KLGA 4ODWB 1B0GA 3BZFB 3RJDA 2VLKA 3F58H 4WDIB 2P43B 5EPMA 5EO0A 5EBGA 1UYWL 3ARXA 3L3GA 3VA6A 5I16B 3DRQB 2QR0A 2EDYA 4TOYL 1CXKA 1NBQA 2UVEA 3P0VH 2VUYA 1SJXA 2ATKA 4JFFA 1R5VB 3OJDA 3DJ9A 5DFVD 3W39B 4L4TE 4NKIL 2O61A 3SOBL 3HB3D 5HGDA 4HC1L 5CHNA 3BVNB 1ZS8A 1OL0A 1IEAB 2CRYA 5GGVY 2HMIC 2BCKB 5GZOD 5I30H 4TPRH 4YFLI 4CU7A 3P11L 4HMEA 4ZUSB 1AR1D 4L8DA 5F7LB 2LU7A 3QHTC 4I1NB 5E2TH 5GRWA 3RBSA 4KZEL 3L7FA 4CDHA 3BEWA 5I8KH 1OLLA 2F53A 3IFNH 3G04A 5CILL 4OF3A 1A3LL 4J6RH 3TYGH 4AZ8A 3RY6C 3KHQA 3RVVD 1F5WA 2KBGA 2PW1A 3TJHD 5ILTH 4FMFA 4EQ3A 4OAWA 1AKJB 2CPCA 1GGIL 5INCB 3DGCR 3HUJE 2GSIB 3SJVD 5GS1B 2BRRL 1ZV5A 3D25A 2AQ2A 3BH9B 3TYFA 2KDGA 1YQVL 1MI5D 3MPCA 4KHXL 4EI5C 3SKMA 5F1SA 1YNKL 5HDBF 4ODSL 3ZE1E 4PIRF 3QB7C 4GKNA 4Z0BH 1CF8L 2P24B 5D71H 5GJTH 5CSZB 4QOKA 3T2PA 1DBKL 1HWGB 1WV7T 3ALWA 4Z7QE 5HYIA 3MXVL 4LU5H 3FTGB 5C9KA 4OLUL 5A1AA 5HPMB 3RVWD 4XPBL 4NQVA 3T08A 3G08B 3D85A 2QSCH 1GGCH 4XWOC 1Y0LA 3GBLA 4OKVB 5KOMC 1EX0A 1A7NL 1MH5B 3KYKH 4M61B 5A3ID 3QDME 3B2UD 3QCUL 4NFBA 4LEOA 4MQ7B 3QQ3A 1NCTA 1T20B 1D7FA 2B20A 1WGOA 2A38A 3K0WA 4H20L 3WEXB 1MJUL 1ZA3B 1N3NB 3OAUH 4WI5A 5DEGB 1PEZA 1MCSA 3G6JE 4EXKA 1CCZA 2V7NB 3TJHC 3DO3A 3VG0L 1U92A 1XGPB 4MB4A 3G6AB 1EDQA 2CDGA 5HI3C 5SX5H 4DUWA 3VE0A 3GSQA 4D0BA 5B39B 1U93B 4PJAB 1CU4H 4U1JA 1U8NB 3SKOA 3C60B 3MRHB 3MLYH 4HWEH 5BJTA 1S9WA 4OV6F 3LEVL 1CLYH 3BPOC 2BSRA 3KJ4B 2NY1B 3LV3B 2R23A 4R2GB 1UZ8A 2Y07H 1QQDA 3AUVA 1KFAH 3GHBH 5DC4B 4A6YL 3C9NB 4ONHB 3GKZA 4UAOB 5F7WC 4XNXH 1T1YA 2ZUXA 5D7JB 1G7JA 1N59B 1IM3A 4LVHC 4Y4KC 5AZEH 1EAJA 1M1SA 3WEXA 1IGJA 4R4FL 3SY0B 2APXA 3H9SE 4M62H 2DWDA 5HVFB 3O6KL 2H32B 2WBJD 4UTAH 3VI4F 2FIKB 4JO2H 1S78D 2CIIA 1A6TA 5J57B 2JB6B 2X09A 4B41A 3BP6B 1JNLL 5LXGH 2AEQL 4AL8H 4MNQE 5HJ3A 2O5ZH 4LSRL 4FQCH 1KJ2L 4NGHL 2WP3T 5HPMA 1YYLH 1FG2A 3U30B 2IFGA 1Z0NA 3HZVB 3HC4L 4JO1L 4NSKA 3R06B 1FE8L 3DSNA 5E99H 4AL8L 4I0CC 3WHE0 4BELD 3D0LA 1CDYA 5IUSA 3RPIA 3EKCA 4XXCA 3MJ8B 5E8EB 2WP3O 1HWHB 4KU1A 2FD6L 3QJFB 4HBCL 3VWKC 2EIZB 5HHOA 2EDNA 1AC0A 3O6LL 12E8L 2C4FT 1DBJH 1GYAA 4QOKD 5B3JE 4I48B 4JZOA 1MOEA 4LSQH 3PWVB 1EBAA 1Q9OA 3WO4C 1P4IL 5BXFA 4PR5A 4LCUB 4BFEA 5CUSL 3D18B 1IILE 4P46C 3S88H 1S5HB 4N1EA 3OAYK 3WNKA 4F8TA 5FV2A 4XWOD 1I8IB 3BDBA 3CFEB 4P3DA 4PRID 5GZNC 4KRPB 1B4JL 3RVWC 3REWB 2VLRA 3IDMB 4KKCD 4ZODA 1AXSA 3EFDH 3KYOB 1P4BH 3RU8H 2VAJA 3PV6B 1MY5A 3GKWH 5D2NE 4P5MA 3L95B 2QHRL 5D1XC 1R3IL 2UZXB 4AM0B 3VRJB 2Z91A 4IDJL 3C8KA 3TT1H 4O4YL 1P7KB 2FEDD 3LD8C 3RVUC 1L6XA 4KJPC 3F7VA 1UVQB 3UJJH 3QFJA 2ICWA 4Y5YC 5K9OB 1T20A 1U8MB 2VMFA 1FFPA 1J0JA 4CL7A 5GSVB 5FCUH 4U0QB 1AO7A 1EHLH 2AJSL 3VD5A 4I3RH 4GKSB 1DBBH 4KK6D 4MD4B 4LLMB 1T0MA 5D5ME 3H0TA 4K3DL 2N7BA 4YUEH 5GS2D 1V05A 4WGVB 5CIPB 2EE2A 4IOIA 4JANB 4NC2B 3JXAA 1I75A 2MHAB 2BSRB 3K3QA 4YGVA 4QT5A 2N4IA 5EU5B 3VH8G 3OKNB 4M5YH 2KPNA 3T2OA 4S10A 5DD5L 3D2UB 5ID0A 1MCRA 1AR1C 1RZKH 3U0TB 1TXKA 2C3VA 3CX5K 4FQQA 5IF0B 3MLWL 4Z0BL 2OJZL 4Z7VF 2HMID 2FDBP 2DLIA 3AY4A 3QIUC 3NACL 2DYPA 1YNKH 4H26B 4IMKC 1QBAA 1HQ4B 4HG4J 4JRWA 3EZ8A 2DLGA 4IMLB 3W0WE 3S37H 3LKRB 1AHWC 4W6WB 1I1CA 4ZS6D 1AGBA 3CCHA 2JIXD 4WNQA 2DBJA 2ORBL 5KAQF 1WFNA 4CW1A 1HH6A 4KQ4L 4J3XA 1ZLSH 2V17H 1CZ8L 2Z31B 5F70A 1WUNT 4DVRL 2H9GA 1HH9B 2ZCKH 5JIIA 3N50A 3QA3B 5ITBL 5LCVL 3OQ3B 1JWSB 4PJHA 2ED8A 2AXJA 2P7TA 3EYUL 2ZCHH 2X4UB 1TJGH 1DFBH 2VLKE 3L6FB 2ED7A 4GQPH 4F3FA 3B5GA 1RVFH 4XVTL 1U8JA 3DXAA 1JHLH 2WBWB 4LLVA 5JW5A 4RWHA 1JNNH 2E9IA 4GKZB 5DI8A 3BGFC 5D70H 5DK2A 2DQUH 5CJXC 1G9NL 3KXFB 3L5HA 1C08B 3NPSB 4M43H 4LAQH 1IC7H 3PABA 5HHVL 4JKLA 2Z8VC 1ZGLB 2VLJA 3CLEL 1SQ2N 3D39B 4XNQB 1R5IB 3MNVA 4H26A 4LSVL 8FABA 3DNKA 1H3TA 4WW1A 3LSOB 4O58H 4HPYH 3O2WL 3QNYB 1HYSD 2IC2A 4AEIL 3H9SD 3B9EA 1T2JA 2HT3D 3GMLA 5JIKA 4JO3H 3QZWG 1IC5H 5B38B 1UXWB 5DJ0B 4PFEA 3WMSA 4OZFB 4HUVA 2N1KA 4OCYH 1HKLL 5EU6D 4RGMC 3VXRA 2FGZA 5F7UA 1ZE3C 4KK9D 4I0PB 2VL5B 2CK0L 4MCYB 3DV4A 4H88H 2ZPKH 2NXZC 3LKPA 4EJ1C 1G7QB 5LXGL 4PPTA 3WBDA 4ODSH 2R56L 1OCWH 4ONGH 3IDJB 3HG1B 3BJ91 1CDCA 4MS8D 1XCTB 5D7KE 4JRYE 5D6CA 5DS8B 1CDIA 5E7FA 5J13C 2JB5H 2BERA 5KVGL 4UDTA 4PRHB 5F93C 1IL1B 1ZOXA 3CFJB 3MTRA 1PG7W 4NZJA 2DM2A 3PL6C 2PN5A 1PAMA 3OTTA 1RU9H 3SDDB 4NGHH 4JY6B 5BW7A 4JLRA 4J3WA 4LNRB 4P9HC 1P7HL 4FXGB 3RWGA 4H5SB 1J7VR 4CU6A 4PG9A 4JFHD 3DMMD 1T0MB 5AZ2H 1CBVH 1MJ8L 5I1HL 2VH5L 4PJHB 5CEZH 5HY9B 1T1XA 1F4WL 3WD5L 4Y4KB 1MCJA 1E4JA 3M1BB 1WZ1H 5EPMB 2Z31A 3RTQA 2UY6A 1XF3A 5DJZB 3LKSA 5IT2H 1EFXB 3H42H 4X99A 3LKNB 4K71C 4U1HA 3T4AB 4JHZA 5D2LE 4NQDE 4N0UA 2NZIA 3SPVB 5A16A 1MFEH 3C2AH 3P4NB 4BUHA 1OAUL 4RAUB 1PW3A 1Y6NR 3ZTJG 1L7TL 4NBYB 4KMTH 2LVEA 2Q86B 1ZGLA 1BM3H 4CVZB 3UTSB 1A1MA 2WIMA 3KJ6H 2E27L 3V6ZA 2J3SA 5ESQA 3BSZH 4Y19A 3WS3A 1JMXA 3GRWH 5BRZB 4TTGA 5I8KL 2BY1A 2XIDA 3TO2A 3FAXA 1KLGB 3T04D 4HK0A 4NUGH 5FO8B 3G5VA 1JK8A 3BT2L 1KACB 4GW1A 4IMKA 1Q9OB 3IDXL 1KPVB 5C0GB 2AK4A 2ADIA 2Q8BH 1Q1JH 4LCCA 3VRLF 2NY6B 5DD0L 4E42B 3F5WA 4OF7A 1JPTH 4E41D 1PZ5B 3WO4B 1IEAA 2DM4A 3LQAL 2VLJD 3CZJA 1OHQA 2CLZB 2BOCA 4L4TB 2OQJA 4O2CA 5DI8B 2V5MA 3MYJB 4JDTL 4KI5C 4K9EL 1NCUA 2F5AL 4Z5RB 2FLRT 5CJQH 2AJ3A 5H2BA 4KRPC 4IRSD 4OIBA 4GBXB 4EDXB 5HD8C 3RL2B 4PJCA 4G8GA 2RAMA 1H3XA 1JVKA 3IDJA 1TCMA 2AXGA 1LEIB 2DTMH 4QHLA 3SE3C 1KXVC 1S7UA 2YKLH 3ESVF 4X4YB 3SDXB 4G6FB 3QNXA 4JB9L 4WDIA 3TCLB 3ZSSA 5HVGB 1MRCL 2AKRB 1BVLB 4RMWA 5ISZA 1LEKB 2BRQA 5JDSB 3GM0A 3TNNA 5DJDB 4JDVA 1JF1B 2XZCL 5LGJB 5C09B 3O0RL 1UM6L 4DGYL 1I7UB 2JCCE 3OGOE 2IBZX 1DEDA 4QHUA 3H3KA 5E8OA 3TA3D 4FZEL 3FQNA 5FYJE 3QDGE 5AYUL 4OGXL 4YDJA 5DJ6A 1BFSA 4IHOA 3IU3B 3HC0B 4G9FE 5I1DB 1A7PH 2YXMA 4PJDF 3U9PH 5IVXA 2OQJB 4HC1H 2MQCA 3T2NL 5TDOA 3O4LD 4PJFA 4FA8A 3MX0A 2PW2B 3Q6FB 4ODHL 4RQQA 5DD6B 2ZSWA 1NEUA 1PYWB 1D6VH 5DJAA 3TNMB 3EYOB 5HYSG 2BMKB 3VE0B 3M45A 1NGPL 4LPVA 2FH8A 3PWLB 4HZLB 4BQCA 3RVXD 5MEQA 1AR2A 3QIUB 1FVDA 1JTTA 3MA9H 1GGBL 5CKGA 2DQGH 5GSVA 3HI5H 2FL5A 1MCKA 3W82A 1SY6H 1GZQB 4I77L 2VE6B 4YHIA 5KSAD 1NUDA 3O2WH 4ORGA 3OG4B 3EYQC 1SMOA 1NBVH 4JFDD 3RZCB 4N1HB 4GKNB 4HQQH 4YIQA 1P9MC 4YXLH 1L4IA 1RIUL 4XBGB 1T7VA 1L0QA 2AP2A 1S7WA 5TQ0H 4HAGA 4BA8A 3MRKB 1FPTL 2CRMA 1JNNL 3BGFB 3W9EB 3RNKB 1ZHKB 3RDTD 4LARL 1U6AL 5BO1H 5FGCE 3NPSC 1FIGL 2GEEA 3B5TA 4R26H 3TPUA 3WS6C 3ALPA 2H45A 1WCQA 1YNTB 3CXHJ 1FGVL 2DLFH 4JRXB 1ONQB 1ZLSL 5KSAB 5D72H 1FNFA 5HHOB 1EEZA 4U7KA 3FAWA 1MHEB 3D9AH 1BFTA 2OL3B 3HNTL 4Z5RA 1DBJL 2R1WA 1NDMA 1FORH 3GK8L 3JWDL 1DVFA 3TWCL 2FEEL 5DHYA 2R0LL 4Q6YA 1P5UA 1G9EA 4O5LH 1EEYB 2DD8H 3HG1A 2NY7H 4WV1B 1QACA 5ANME 3HI6H 3FQNB 4ALAL 1OAXL 1DBML 5F1OB 3SDAA 4MJIE 1ULVA 3LMJH 3S5LA 3KPLB 3VG9B 5HDQL 4Y1AE 5D7IB 1CFNA 3ZKNC 1FGVH 1EXUA 2G75B 4Y2OA 5IB3B 4P3DB 3J7HA 1VGKB 5DD6A 2I60H 4QKXB 4X9FA 5JOFA 2VDML 3SGJC 4MAUL 3IVKA 4GAFB 1A7OH 1MREH 1WAAA 2BZDA 3PL6B 1YZZA 3MLXL 2W91A 4GAYB 1LEKA 3MC0A 3QNYA 5E9DD 3IB4A 4H1LA 5F7MC 3EYQD 1G0DA 1M05A 1FORL 1DE4A 3GK8H 4I2XA 3NOIA 2V7HB 1ORQB 4K94H 4R97B 1IAMA 1BFOA 2XQYG 3I6GB 5KW9L 4PJXF 2K7QA 3QHZH 1D5ZA 1YY9C 4CUCA 3UPRA 4YXLL 1NFIA 2AJUL 4QNPE 4ESKA 2VR5A 1G7PB 3P30H 1D5BA 4XNUH 2ADJA 4PJIF 3EOBA 1IFHL 2XWTB 4K71B 3S34L 1A64A 4R7DA 1KGCE 1H3GA 4UNUA 1W0WB 2W65A 4WHTB 3B83A 1KG0A 1QSFD 3TNMA 2HFFA 3KYMB 3QDHA 4KVNL 1AGDA 3VXRE 1YNLL 4C57C 4K2UH 3PHQA 1LO3H 2YRZA 3HS0B 3MJ6A 3S8WA 5I8EB 4DVBB 4NOFA 4WW2B 3KPQB 3X17A 2YSSA 4RX4A 1XAUA 1G6RL 4D9LH 2XXMB 3Q5OA 4Y5VC 2IQ9H 5FK9B 3VXNB 5CZVL 1WEJH 3VWJC 3JWNC 3QO1A 4ZFGL 1OGAB 3VFVA 4CMHC 4WY7H 4ZNEE 4GG6E 3O6FC 1R3JA 2GHWB 5DEFA 3ECBA 3EUUA 4Z77A 4KKBD 3D2UA 3TIDB 3QUMH 2GY5A 5B3NA 4HHAA 3HRZA 3QXWA 1NFDA 5GJSH 1RHHB 3D5OF 3GEWB 3WYRA 4P48A 3I6KB 1EXUB 1OOAA 3CFKA 1U8NA 1S7UB 2AEWA 3W9DB 2WUBL 2XKUA 5JW4M 4KI5D 3WFBH 5CSBA 3OAZK 4N8CL 1UC6A 3ARZA 4KJYA 1F02I 2F15A 2VN4A 1Z2KA 4NBZB 2LU4A 1S9XA 4Y2DC 4M7JL 5DD1L 5EBWA 1UCBL 1KB5A 4MDJA 2CRZA 4M1GL 5ERWA 4YBQD 4NQXA 5CMAB 3N1GC 4QXTB 2GAZA 4O4YH 1JZ6A 1JPGB 2XN9D 1T4KB 1UEYA 1WFOA 4RWYL 4W6YB 3W0WB 2RJMA 1XCQB 4NWTL 3UJTL 4JFPB 3FB8A 4A6YH 3OL2A 3K2UH 3PWNA 4BYHA 4GXUN 3E3QE 3PDDA 1CIDA 4G3YH 5KVDH 5DK3A 2QSQA 2NTSP 5GGTH 3OJDB 1B6DA 5ACMA 4F3FB 4DGIH 4AG4H 3T0EC 3WL9A 1J0YA 3BW9B 5DJXA 4WEMB 4GMTL 5CD5C 1JWSA 2X4OB 3LN4B 4L9DA 5HDOA 3QDJB 4FABH 5J9PA 4H0GA 4LRIC 4FQIL 3PJSA 5EOTB 2DBLL 4PY8J 4N8VB 1HDMA 1MCWM 3VXRB 3EOBB 5FKAB 1T7YA 4Y4HD 4FFVC 2CKBH 2UWEF 1CICD 5E6IA 1RPQA 4OZIF 3O45B 4BZYA 4YHLL 3K4DA 1Z5LA 2RHEA 5HHMD 3E8UL 4NYLA 1MVUA 3NIFE 3E6FB 4D9QE 1OGAE 4GRMA 4XNQA 4JG1H 3CXDH 1JYVA 5TQ2L 1A4JB 3ARBC 2NW3A 2HH0L 3DROB 2ARWA 4NO5A 5IVXF 1IM9B 3FCTA 4JFXA 1PKQB 2GTWA 1S7RA 3KYKL 2LAAA 4PB0L 4GXVL 3CVIL 2WWMC 1NCBH 3LS4H 3BRDA 4ZS7H 2OTUB 1EO5A 3IFOA 4MQTB 5F1KC 3PWJB 4FQHA 2DJ4A 5C0AE 4MS8C 1KT2B 4U1SA 5DJAB 1E4WH 2B4CC 1SJEA 4OM1H 4OFIA 3JWOH 4KK5D 1OAYH 5I15H 5JMOC 5JXED 1SYSA 1A9BB 1ADQL 4AH2B 4U33A 1J86A 1E4XH 1IAKB 2D0GA 4RFNC 1MFBH 3HPJB 1GZQA 1MAJA 3O8XB 1FLRH 4PRPA 1T21A 1QRNA 4CBPA 1S9XB 1OTUC 3JWOL 4XC3H 3R4DA 1FN4A 1I9JL 3ZTJH 4C58B 4NT6B 4EEEA 3EIFA 4KAQH 3ULVH 3L5XH 3VXSA 5ITBH 2VZ3A 3I6KA 2E7CA 4MHHG 3GSXB 5JOEA 1RK1B 1RUAL 5DHVA 2D7TH 2YD6A 1I9JH 3MXWH 5TGBA 5CEYB 3DX8B 3LDBB 2D03L 4WV1C 4WUKL 4W68A 1EEQA 2DQHL 3QCTL 3HAEH 2AV1B 3G6JA 1TZHA 5H94B 1AGFA 1HHKB 1KYOK 3QDGA 1EH9A 4XAWH 4G6ML 4NNPH 4FQQB 3R0NA 5D1ZC 1X7QA 4N8CH 1QSFE 1T89A 4CMMB 4NZUL 2F54B 3WNNA 2F9BT 4C56A 3OKEA 3Q1SH 3RWIA 1JZ2A 3IU4H 5KS9F 3D0LB 1S7SA 5JQ6L 4F37K 4WU5A 3F12B 3GNML 1EJOH 1OARH 1RZJL 4X8XA 1KENH 3MV9A 1IGCL 2ZUYA 4LLUB 3BMWA 2H9GB 4WI2A 4GAGH 1H3PH 2YBRB 4GMTH 4XCYA 4UTBL 4XB7A 1BGXL 3AREB 1QYGH 5ABDE 1DQJA 4KPHL 1EO7A 1ZXQA 1I7RA 3H6JA 4HGWA 5L8LB 2DQIL 3R0MA 1R3LA 2CUIA 5FM5O 5JHLH 1AGFB 2YZ1A 2GI7A 1RZ7L 2DQTH 2H6PB 5F3BA 4I8DA 5TPWH 1TMCB 1KXTB 1DQQA 4F9PA 3GMQA 1AI1L 2FEEI 4J7RA 1PBYA 2HT2D 4L4VA 2EIZA 3LN9A 2HJLB 4MJ5B 5B4MC 1FL3A 2KQMA 3SE9H 4F7EB 1RZKL 5JDSA 3HTLX 4PP2B 1A9EA 1MJ8H 2BSTA 4OFYD 1T6VN 5D5MA 4BFBD 5I75C 4M5YL 5EZIL 4J2XA 1BX2B 1P4IH 5JUEL 4KJPD 4MDIA 4OZHA 2E9JA 4GKSA 4XAKE 4FNLL 2NY3C 2JCCB 3GI9H 3I75B 3KXFE 4P5TD 4GXVH 3Q6FA 4RQQB 3X12B 5EBLA 1QR1A 3MACH 1CFQB 1MWAH 5IVNA 1R3KA 1E4WL 2YEZA 4NCDA 3WFEH 1IRAY 3ZE0E 4JFFE 3DGGB 1MRFL 4N9GA 3TVMA 2HWZH 3PHQB 2PR4L 1M4KA 3PGFH 3BWAB 3VXSD 4XMPH 5HBBA 1NC4D 3MLTA 2MPAH 1CICC 1EERB 1E28A 5EBMA 2PYEB 4LHUA 1IJ9A 1YNLH 2WW8A 4HFWA 4TUKL 5GQBA 5CAYB 3L1OH 5CINL 5C0BA 2A77H 5E4EB 2IPTH 4LCWB 1OP9A 2DWDB 4ZO9A 5C0AD 4NRYA 3OKMB 2NLJB 4FABL 3HE6D 4F33B 3OF6A 4P4KD 3P30L 3P4OA 3ARDD 4G8EB 3WE6B 3T0EA 3WUWA 3FQXB 2QV2A 1OAQL 2E8YA 4ENED 5E08L 1HSBA 3VFNB 1VACA 4J8RB 4N0UB 4OB5L 2OX5A 3O41B 2YR3A 3GSOB 4R96A 3HUJA 3PP3H 5ENWB 2DKUA 1KV3A 2WSKA 3EYSH 5E2WH 1M6OA 4JR9L 1JHLL 4LHQB 3L9RA 1A7RL 2R2BA 1KIRB 3H7BB 1YEJL 1LWRA 4OCXH 35C8L 1R24B 1L0XA 1QBLH 1WZMA 2HRPH 5ADPL 5DC9B 3WNOA 5EBMB 1C5BL 3OPZL 3V9FA 3ARUA 4CVXA 3ARSA 5EU6E 4PJ7B 5BV7L 2R4SH 4BZ2H 2A9NL 3DHJA 4WENB 5EIIA 3MA9L 3QI9D 3D39A 5F96H 3PWPD 3D85B 4G9DB 1CZ8H 1ZGLP 5IVZA 4XP1L 5HGHB 5JW4N 4FS0A 4FTVA 2VYRE 3GJFA 4U3CA 3OKOB 4LLQA 3U6RA 1QVOA 3BVNA 1BVZA 1VFBB 2HFTA 1I4FB 3TZVA 1PLGL 3ABZA 4G7VL 4N0CC 5E00A 1ED3B 4YEFA 2HJKB 4Z7OF 5ID1B 4PTUB 2J2ZA 3G9VA 3UTSE 3EFFB 4S1DD 3QWOA 4M93C 1XF4B 3WJLC 4HWBL 5DZOA 1DJSA 4MNHA 4EQ2A 4GLRI 1FYTE 1TTGA 1QO3A 2LABA 2V5RA 5FHAH 3RWDA 3LIZH 2VXVL 4D8PA 3SJVB 5DQDH 2AJVH 1MCDA 4LCWE 4AQ1B 1SVCP 4E9LA 1A4JA 2BVQB 2HKHH 2C7UA 5BZDB 4F7PB 4LCIL 1QA9B 5F9JA 3T3ME 3BAEH 4JLRB 3D1MC 1KJ2A 3QO1B 3T0EE 1G7HA 3B2UC 4KHXH 1VGEH 5KJRL 3CDCA 4P23C 4U1KA 3P2TA 4IS6A 4G6AD 4DN3H 1Y6KR 2VSCA 1YMMD 4LCYA 1ODAA 4NKMA 3X3FH 2OK0L 2CH8A 2DJUA 3X12A 5B8CB 4Z95L 1KT2A 1X5YA 3DUSA 2HVKB 5F7DB 4Z7WE 4DZ8B 3TYGL 1X4XA 4KH2A 3L5IA 1TPXC 3MGOA 1ZTXH 3T3PE 3ZKMC 2BOBB 2VDKH 2AJVL 5C0AA 3TH3T 4Q0XL 3MLXH 5DD0H 5D1ZB 4L1DA 4PJ7E 2P5WD 5I16A 4JM2D 1FVCA 3VH8B 3AMKA 3C6LA 3VXUA 4NUJB 1QO3B 4J1UB 5IJVB 1HEZA 2H2SC 4CW1B 4ODUA 1D5IH 1Y6MR 2YUVA 4ODTH 3CSPA 5KW9H 1I3RA 4N0YL 4X6DB 3HE7D 2GUOA 3RWCB 3T4YA 3UPCA 5TH2A 1OVZA 4PJGF 1R3JB 5C07D 4I18B 5BS0D 4DKFH 3FO2B 5AEAA 4DOHB 4WUUD 3K74B 5ICXB 3UYRH 3WJJA 2QEJA 5CEYA 4RMQA 4HXAL 3GSNA 2OTWB 2P1YA 4X99B 3LKNA 1VFBA 3IRPX 1I8IA 4Q9RH 1MFDL 1CTOA 1D6EB 3C6SB 2BNRA 3ZE2E 3AREC 3C60A 5K93A 4MCZB 1MPAL 5KS9A 3HRZB 5FOBA 1RZJC 2CKNA 3QUXC 1MFAH 4R9HA 5EU3A 2IH1B 3U36B 4FG6D 3H9ZA 4EN3A 1BJ8A 4DTGL 3OJVC 1V7NH 4G80B 4GSDH 4FXLA 4FMKA 1RJLB 1HNFA 3O4LB 1JZ8A 4KWUA 3S4SA 4H8WC 3BZ4A 4D9QD 4XPGH 5SWSD 4HUMB 3RAJL 5IWLC 2LTQC 5CBEB 3MRCB 5IVOA 4FNLH 3VMPA 3RTQC 1NEZB 4QTHB 4BQ9A 3KPRE 4Y7MA 1T22B 4MZ2A 4X4ME 4EVNA 1J1XL 1PZ5A 3W2DL 4UQ2B 2ZUQB 2XWJB 3QHFL 3LQMA 1P1ZA 3FMGH 1GJIA 4W4OC 4XVUD 3CU1A 1OCWL 2RQ8A 5LJYH 4JZJC 1LE9B 4NO0A 2O5YH 3IDUA 3FONA 1CDGA 4Z9KB 4N8PA 3IGAA 3DMMC 4D8PB 3LH2H 5J1AB 1NUGA 3VRIB 4JY5L 4PGEB 2FLBT 4I77H 3P11H 5DVOA 1MFAL 4MD5A 1HDMB 2X5PA 3AVEA 4UINL 4AMKH 1SJHA 2XKNB 4HFWB 4JO3L 4JRXE 2HG5B 4WTXA 3DVGB 3ZYOA 4P5KA 1BQHG 5KTEL 4PLJC 3VXMB 1NBVL 1JRHI 2JF1A 2C3VB 4WTWA 2VLRD 1JPFA 1U0QA 1FAIL 5C0CE 3RX8A 5IHUH 2A2QT 4AIZB 4H20H 5E4EC 5KTEH 3B6SB 4PJHF 4UNVA 5C07B 4N0YH 5DJZA 1X5FA 2MHAA 3MLSL 4M6ML 5ETUB 3VXSB 2CDFB 4DCQB 1ZT4B 2B2XL 3MJ9H 1J8KA 5DMJB 1Q94A 3CSYA 2PUQT 3C6LD 3VXUD 3QFJD 1NSNH 2EDJA 2PXYA 4XVTH 5IROA 2O5YL 1CBVL 3TVMB 1ZWIA 3PUCA 3ULUC 3MV7D 4XCNB 3N85L 4YHOL 5EWIH 5BS0A 1Q38A 4XAWL 4KMLB 5HTSA 3N9GL 1F3JB 5CKAA 3CCHB 2LAGB 2F54A 4RGNB 2DQHH 3CVHB 1HHJA 3F6IA 4M8QB 5CEXA 5IIEA 4MJ4A 4JQXA 4UOW1 5AD0B 2BVYA 2OLDA 4DGYH 3ARFB 4L29B 5FYJH 2BNRD 4DZBA 2BRRH 3C09C 3D0VA 4PRAB 1FP5A 1KCUH 3C8DA 1W0YT 3MRMA 3VFTA 3EYUH 3PHOB 4MZ3A 3VXNA 2W0FB 1ITBB 4M6NH 4YGAB 3P77B 4JGJA 2DMBA 3MLVL 1AE6L 4RDQF 4QGTA 1UA6H 5C08B 1DCLA 1CG9B 5EH1A 1H3PL 1J18A 5CJXA 4NJAL 1O7VA 4JPKH 3IGAB 4Z77B 1MQKL 2PYFA 4ZFOA 2W60A 1LHZA 3RWEA 5KG9B 2R2EA 1RK0A 3MFFB 4K3HA 43C9A 1CFTA 1A14H 3MOBL 2I9LA 3V7MA 3B9KB 2R4RL 1UG9A 5MEQB 4YIQB 1AH1A 3QEGH 4KDWA 3WNPA 1YDPA 4HCRL 4OFVA 5KVGH 4NQCD 4QF1B 2VDNH 1WBZA 3I3DA 4OZHF 1NEZA 2V9QA 5BMFL 3O11B 1A1NA 5C0JB 4G8GE 4ZYKB 3VXOA 1RZGB 3KLAA 5D6CB 5GS2H 2EC9T 3ZTNL 4UDUB 3W81A 2GW5A 4QXTA 1EVUA 3Q3GB 3DX7A 1EEZB 2HT4D 4K23H 3BKJH 3VXPB 1A1OB 1N0XH 4HLZG 1CXLA 4FQLH 3J8F7 2V7HA 4AEFA 1IKFH 5EB9A 3VWJA 2DLHA 2VLRB 5TGBB 4M00A 4MA1B 4MXQD 4P23B 3I02A 4F7EA 4WU7B 3Q0HA 5DUPH 5LCVH 2FJHA 3RNKA 1UT9A 4PJBB 3V6BR 1GOGA 1KULA 3ZYJA 4QRQA 4KK6C 1UJTA 3QHFH 4LVOB 3O6MH 3FT3A 5AAMA 2JJSA 2VC2L 2WWMD 2ICCA 2WUCL 2ZKHL 4WHDA 5C8JB 3VGBA 1DLFL 1DSFH 3U46A 4Z78A 1UWXH 5EO1B 5IB1A 1U42A 4JCMA 3PL6A 4KC3B 2DBLH 5GS0L 5IB4A 3UC0L 3JUZA 2NY5L 2X1OA 1YN7A 5F44A 1FO0H 2PXYD 1EZVY 1I3GH 2G75A 5DD1H 1AQKL 5IB3A 2MTPA 5D2NA 4BSWA 4LVEA 4OUUA 3KS0J 1TZGL 4UUJA 5LKNA 1QRKA 4LIQL 4MJ6B 1B2WH 3EJJX 4M4RA 1ZHNA 2CIKB 4ODXB 3QXUA 4EUPH 2NYYC 4JFQB 4P2RD 4KY1L 5F6HI 1QFUH 4TUKH 3VGAC 2CK0H 4P46D 5JW3H 4FFVD 3SBWA 4BJLA 4MA7L 2Q3ZA 3RWEB 4ONFH 1IBGH 2AK4B 1IMHC 2HVKA 3LPWA 3HZYA 2DDQL 4IRZH 4OGYH 2FIKA 5AG8A 2APWA 2OI9C 3KNBA 4AJ0A 3U7WH 2VZOA 1S3KL 1GIGL 4P59L 3UTQB 4ZNCD 4KZDL 1H9VA 4HPYL 3QUXB 5DMGC 3FB7A 3VWKD 4QLRA 3MRRB 4HUXA 4DJMA 4NNXA 1ZK9A 4PS4H 2RCSL 2D7OA 2J1KA 3BKML 3U46B 4Z78B 4H0HB 5IQ9A 1SEBA 1U8IB 3OX8A 5D72L 4NQUA 3IXAA 2ADIB 4KJYB 3MJ7A 3C8HA 4WFEE 2BSTB 3QWRD 5K9KA 3G5VB 2W92A 3BKYL 1E6JL 1CDHA 2LTQB 1HINH 2ZJSL 5T5NG 2OP4H 1U2HA 5F9OL 4PJXA 3DURB 1BP3B 2P5ED 5F7EL 1FIGH 3VDBA 4YR6B 4WY7L 3RTQB 3UPAA 1TIUA 3W5MA 3KPRD 3PWUB 4GUPB 4WU7A 5D8JL 1RAMA 1WWCA 5EC2A 4NQCA 3GSNB 3QPQD 4ODBD 1GSMA 3NIDF 5DEFB 4MB5A 3R8QA 1YEKH 5MI0B 4ZO7A 3T09A 4YX2L 1CK0L 1U92B 2YA2A 1IC4H 5ID1A 4HXBL 4PTUA 1NH6A 1NC2B 3DUUA 5FDWA 1F90L 3DVFA 5JW4Q 3DGGA 4PJ8D 1J0IA 5J6HA 3BKMH 2BXZA 2BK8A 1T83A 3O4OC 3UTOA 5I1IH 1FO0B 4KRMB 3MYZA 4LPYA 2XQBH 3V5KB 1F00I 1YMHB 1FRGH 4YZFF 3RWFA 5MENB 3QUXD 3TIEB 1AFVH 3HZVA 2F53D 3P40A 2J6EA 1A7NH 1QHPA 1A7OL 1MREL 2DMKA 4NFCA 4PUBH 4ZQKB 4JFQA 4YJZL 2HAZA 4MCYA 4ZSOE 1E6JH 4MX7A 3BP6A 2VLKB 2FJFB 2WANA 5HI3D 1CGUA 4PP1C 3SJVA 1EFQA 1OF2B 4J4PC 2AQ3A 3I6LE 2C3GA 2O61B 2HTLC 3IU4L 5BVJA 5JZ7D 4RIRA 1HXMA 5CLTA 5SX4H 4M1DH 4ZOAA 4JZOB 5I74B 4K3DH 4UT9L 2EH8H 5ISZD 4PJCE 1A6VL 2HFGL 3MACL 1KJ2B 2D0HA 1A5FL 1S7WB 3LRSA 1KN2L 1KIPA 1DUZA 2CLVA 2W0KA 3EOAB 5C0NC 2AXGB 3OKYA 4M4PA 1KCUL 1OPGL 4L3CA 4JJ5B 4ZXBD 2Q8AL 2Q6WA 5JPNB 3WDIA 5A2IH 3S96B 5E8DL 5ID0B 4O9HH 3QDMA 2BVUA 4ETQB 4BZ2L 1Z3GL 5IMLB 2D3VA 3H9YA 2VXSH 1PX3A 1KCSL 4UV4H 3NFSL 2FHCA 3ULVL 1VA9A 4O5LL 4NQCE 4X7EC 2OMBA 4I3RL 4X6EB 5DJXB 2CIKA 4R90H 4XCFH 3FFDA 5CCKH 5A2LH 3MRIA 5JORB 3VWKA 4NHUA 1FFPB 4JG0L 5SWZD 2A1WL 1HIML 1T7XA 1VKXB 3OR7A 2V2XA 1NCWL 4C59B 1VFMA 4XCEA 5HGDB 3OZ9H 2XG5A 1DLFH 1DSFL 4X8JA 5J6HB 5AUMA 1NGXA 3MCKB 5JZ7C 1JI2A 4M6OH 1WWWX 5EORH 3QWRA 3WJLA 4OM1L 1QSEE 1W0VB 2Q3AA 3LN5B 3SE3A 4PP1D 3PWLA 4HZLA 5SWZB 4AEHH 3V4PH 4YHZH 2YWZA 2QSVA 3EBAA 2PTUA 1INEL 2OXGA 1I85A 3ILPB 4PJGB 3S36L 1QLRB 1JTPA 1JF5A 5CGMA 3U0TA 4S1DC 4HPOH 4JFEB 5A2KH 2YWYA 3ZKQD 2G5BA 5E5UB 3IDGA 2P49B 4LU5L 4LSQL 4JO4H 4L4VB 4MJIA 4WNQB 1U41A 2VUOA 4FP8H 1CR9H 5DC0A 5ESAA 5C0BB 4U1GC 5ICXA 2PR4H 2HLAB 1Q0YL 1QFWM 4UQ3B 5TDPB 4FZ8H 1A3RL 2MKLC 3P73A 3VCLB 1Q0XL 3KYAA 4LSSH 1J0HA 4ODHH 1M05B 5DF0A 3QULB 2C26A 4K7PX 5BOZG 3H7LA 1WITA 1MFEL 1I1AC 4EDXA 4TNWK 1RULH 5EZJA 4OSUH 2YMXL 3HZKA 2UVFA 4OQTL 2W0LA 1LEGA 5KN5B 3GI9L 4JE4B 1GGBH 1WC7B 1MQKH 1I1AA 1IGIH 3IETA 5HI4D 5F88A 1HXYB 2QL1A 4KKAD 4MA7H 3VRJA 1A7QH 4Z7UA 5J89A 4Q9QL 2HFFB 5C0IB 1NKRA 1DVFD 4XPTH 1CDUA 1LNUB 1GH7A 5EO9A 2A6DB 1YNTA 2YC1A 3S6CA 1TZGH 1IM9D 1OSPL 4UV7L 3BWAA 2YN5A 2BC4B 5FECB 4RISH 1S7SB 4G8FA 3GIZH 5HHOD 1AGBB 4OLEA 1LK3L 1GZPB 4GG8B 3HE6C 3OGCA 3VGDA 3C9NA 5AWNH 1SBSL 3BP4A 2DIJA 5CJQL 2XN9B 3MREA 5F6IB 1YPZF 2ITCB 3ARGC 5C08D 1J1OL 4RFOH 4XPFH 2XT1B 2HJKA 3X14A 3GBNH 2JK5A 4WHYG 4PRIA 3U36A 1K8DB 1NDGA 1U58A 1WFTA 5DUPL 4P2RE 1HZHL 3MV8D 4OLYL 3SDYL 3K46A 4EDWL 3S36X 4HIHA 3MJ9L 2GJ6E 4UIMB 1NCBL 3LS4L 1K4DA 2VDLH 3DBXB 3ZE1F 2FL5B 2Y9RT 1LE5B 8CGTA 4DQOL 5SWZA 1G7IA 3BT2H 1DQLL 1L7IL 1QNZH 4TVPL 4YE4H 4XPBH 3BZDA 3P9MA 3WN5B 1JNHA 4FFWC 3MV9B 4XGZB 3VFVB 1KJMA 2WWKO 3DIFB 4WCYH 2Y06L 3GRWL 3LKOA 7FABH 3FB8B 2ED9A 1WSST 1ND0A 1QSFA 5E94A 2A6KB 1CD8A 4XNZC 5MP6L 1OQOA 3K1DA 5E2VH 3DSFL 1C12B 4KHTL 1A6ZB 1CD1B 1NC2A 3B4NA 1NFKA 3MRNA 2JCCA 2YBRA 5K9JH 3FN3A 1II4E 1JZ4A 2HKFL 4PG2A 1T04B 3P0YH 4ACPA 4FQIH 3IDMA 4I4WB 2R2EB 1TETL 5FYLL 1RK0B 3G5XA 3TO4B 2JJSC 2CLRA 1D5XB 3L5WB 3Q6GL 1KJVA 4LHJB 4LOUD 1VEOA 5F9WB 3EDEA 5FXCH 3V5DB 2HFEB 4JB9H 5BJTB 3AXLB 4YC2C 1TETH 1DDHA 3MJ7B 4XVJL 1DQQB 4XRCB 15C8H 5INDA 1KN4H 2VLLA 3ULSB 3U4BH 1A1MB 2UUDH 5J0BA 3OXRB 4PTTA 2JIXA 5T3XL 3ORJA 4JHAH 4LLMA 3QH3A 5IQ7L 1QSZA 2BNQD 4RIRB 1I1FA 3OKMA 4FZ8L 4HW6A 2V7NA 3MBXH 1HKFA 4OZIB 5GGRB 1KTDB 4TVPE 4Q6IC 4V1DB 4Q6IA 1QR1B 1DQDL 4JANA 4OUOA 4ODTL 1L0YA 1A3RH 5F1NA 5CS7A 5I74C 3QDJA 2X4RA 1KUMA 3QNZB 3WKNA 3QUML 4OF8A 5BOPA 4TPRL 1X5ZA 4GW4A 1PY4A 5MERA 5FO8A 1IQWL 4U1LA 2PW2A 1R24A 2YD7A 4UDUA 3K1KC 3R8BB 5D1QC 1ZA3A 1JPGA 2IEPA 1YY8B 1E4KA 5ENWA 4LSSL 5DXWA 5D7LA 5C0JA 2GTWB 1ZT1B 2K7PA 3FT4A 4YDIH 5JW4R 2JJVA 3MO1B 1QNZL 4FFZL 1JNHB 1HIMH 4BK4A 3MV8A 3NGBB 4HKXB 5HYJA 5L7XL 2EC8A 1I8MA 1UYWH 3FFCE 4M8VA 5E5MB 1Y18B 3PGCB 2NMSA 1ZTXL 1LO4H 1VB9A 1CGXA 5EU6A 4QRQB 3BAEL 5LBSH 4FQ2L 3VFRA 3S4SG 3I2CH 5B3JF 4YHZL 1JGUL 3S34H 4PV8B 3UTSA 2ZSVA 3EO9L 2KH2B 1VACB 4X4XB 4O9HL 4MAYB 2Q1EA 4XI5C 3ZDZF 4RMVA 4OD1L 2PXYC 1LEIA 1Z3GH 3ULUF 1T0NA 1RU9L 5C6WH 1UH3A 2H2PC 1LO0H 3ULSA 4POYA 1XH3A 4ZDHA 5IFJB 3B3IB 1KCVL 1LD9B 3H9HA 1GC1H 4I0KA 2HKHL 3MRGA 1RUML 2IFFL 4G43A 3VFSB 5FO9B 3QJHA 3OKOA 3DMMA 4X4ZA 2VNCA 4JDZB 4V1DE 4Z18A 3CLFH 2X6MA 5K9QI 1Q0YH 5FA3A 5FB8B 1BIIA 5F8QC 3A6BH 4OLZL 1ZEAH 3FRUB 4NO2B 3DV4B 1CFVH 3L3OB 3FO1B 4MXQC 3NIGE 1I1AB 1NPUA 4NN6C 1QFPA 2BVTA 4GAJH 2OMNA 5L2JB 2Q8AH 4NZRL 4PJEF 1U8HA 3MUJA 4HXAH 4JQIL 3NCJL 2AJYL 4FFYL 4OCXL 3QPXL 1F2XK 2B4CL 4XMLL 3CIQA 4NDMB 5IK3A 1IGTB 4NHCL 1U3JA 2AV7B 4GQ9L 1FZKA 4WFGE 3SDXF 2VITB 5C0CB 4D0DB 1G84A 3EGSA 3ARPA 4BZ1L 4OI7A 4QRUA 5EUOE 2FECI 5LGHH 1FFOB 5MEPA 2MSPA 5JUEH 2BFVH 4PY7B 3TA3B 3C5SB 1YY8A 3QDJD 5GRXG 1QUNA 4ORZC 2J7LA 2BY2A 1R3HB 3UXFA 1BVKA 5KANG 4NUJA 5IMKB 1M7XA 1N7ML 2J8OA 3PNWB 4URTB 2W9DL 3MRPB 3QQ4A 2ZUTA 5JR1L 2ENSA 9CGTA 3HE6B 5T5FH 4D0CB 5IBUG 3I2CL 4C4KT 5ADPH 1PG7H 3ARED 3ALXA 4ZTPH 1D5MB 4JN1H 35C8H 5F6IC 2LQRA 1AD9A 1SM3L 2FHBA 2NR6D 2X4RB 4TQEH 3ULVF 4IIQA 1Q94B 4ELMB 3ZKXC 3BE1L 1JZ5A 3BQUC 4OZ4B 3VG0H 4OTXL 4O2FA 5F7DA 4OBSA 1RIHL 1W72L 2IJ0C 3PWPB 3WFCL 3CSGA 2AK1H 1KNOA 4HF5H 5LGHL 2ICWB 4MWFA 3GKWL 4GLRH 3OKEB 2YUZA 1V7ML 3HE7C 1WBZB 4HX1B 4MGXA 1UXSA 5AYQA 4YXHH 1MHEA 1F6FB 2VIRB 1MFNA 2C3HA 2R39A 3LKOB 2Y7QB 3U4EA 5FUCE 2EDEA 4PRBA 2FR4B 3I84A 2R8SL 4KGLA 1IQWH 3A0OA 3OB0K 2R4RH 3MLUL 3OJ2C 4JQXC 3QEHB 4JM2C 4YHYC 2C1PA 2X05A 1C16A 2IPTL 2XY1A 2Q8BL 2ZNWA 5DT1L 4EXPX 1QP1A 1J0KA 2VAAA 3AAZB 1C5DA 1RURH 4TSCL 3BDXA 1YEIH 1DLHA 2NY1D 4PRNB 3AROA 1OP5H 3NN8A 3V6OA 4XTRC 4PRIB 2IQAA 2NY7L 4KV5F 5ESVB 1NLDL 3F6LA 3R1GH 3RHWF 3QUYC 5BZWB 4PBVC 3SDAB 4PJCB 4R8WH 5EIVA 1K6QL 3F65A 2CQVA 4KDTC 3P9WB 2A6JB 4H1LB 4JPVH 3UC0H 5IJKC 1N5AB 3TT3L 1KNOB 1PEWA 1P6AB 3S5LG 1DBAL 4WFED 5F9WC 2DQIH 1KC5H 1HHIA 1HHGA 3HMWH 1I7ZB 2Z93A 4P5TA 1T3FA 3EDJA 4S2SA 25C8L 5CP3H 3FZUD 3VGGA 3DX6B 5GS1C 2EDQA 3KPTA 3DETC 4RSVA 4WWKC 2BHZA 5JORA 2AABH 2F58H 3SQOH 2UZIH 4E0RB 4J3OC 4EI5A 1XGPA 5D8JH 5FA3B 5A40E 2JJTC 1HH9A 1ERNA 2C9AA 2FX9L 3IDNB 2YZ8A 5ETUA 4X80L 2ESVE 1UH4A 1NC4A 1XR8B 4X8JB 4DCQA 2EIDA 1BF8A 1RZJH 5B39G 1FFQA 4Q7DA 3GUTB 4GRLB 4EBQH 5BVPH 3MRLB 4AENB 1WCBB 5TPWL 4KHTH 4X6CF 5IBTL 4JZJA 3AB0B 1T5XA 4HKJB 4YDKH 4XMLH 5FUOH 2VN7A 1HILB 32C2A 4TN9A 1OW0C 4TTDC 4NZRH 5LWYH 1IGFH 1KENL 4YE4L 2X4PA 1A47A 2IMMA 2A77L 5D1QB 1MAMH 1BVLA 4JFEE 4YHIB 1I3VA 2Z0BA 2V2TB 2PNDA 1JZ7A 2YC1B 2DL2A 2R0ZL 5T5NF 3NGBC 5ADOL 4G7YL 2XXCB 3V7AE 4XPAL 5SWSE 4RAVB 4F7TB 3BW9A 5EOCJ 5FEBA 5J56B 2ILLA 1NGXB 3SGDH 4PJIB 3C60C 1HSAB 1WT5A 3MGTB 2Q76A 2BJMH 3RPIB 4LLWB 3D39D 3PWPA 4U1KB 5F9DC 3HRPA 3BPOB 3D39E 4XBEL 4OFPA 3FQRA 4IJ3B 3VI3E 3L95A 2P47B 3VXQB 5DMKB 4K8RC 4L8BA 5IHBA 1GGIH 1B2WL 2RR3A 4KROC 2MMXA 5M7QA 1ZLWK 2DB8A 2J8HA 1AXSB 1RVFL 2W0PA 3O6ML 3KYOA 4M7JH 4OLXL 1BLNA 5IHLB 1JI1A 1AQKH 4UAOC 2ZCHL 5D7JC 4LVHB 5I8OH 4M6NL 2V2WB 4GRWF 4JCLA 2EDKA 1FYHB 4Y4FB 1BAFL 2WBKA 5IEHB 4BFIB 1IT9H 3B9AA 5I8CA 5C09D 1IKFL 3VFTB 3PWVA 4PB0H 3MODH 4H25B 2BHUA 2V9RA 2AXFB 5C71A 5HYJE 2HH0H 5EOQH 2OSLA 2P4AB 4K9EH 1YQ2A 1G6VK 4O00A 1PSKL 4Z7QF 2IGFL 1LP9F 3R1GL 4JY4B 3MRQA 4P23D 5DQ9B 1BJ1J 1QYGL 3OHXA 2VSDA 3MRLA 3O45A 4AENA 3ROOA 1SVZA 2ZPKL 4NQDA 3RVXC 4WJ5A 4PREA 3JV6A 5BMFH 5GS0D 1A1NB 4GKZA 2MKWA 2HYMA 4YGVB 3KNBB 2DQEH 3O3UN 1GGCL 2BC4A 4CADA 1YMMA 3OKLB 3LH2L 4PJDE 3WFHA 5J6GB 2AVGA 3U2SB 3GNMH 5LWYL 1BZ9B 1K4CB 2W9LA 2GJZB 3MBED 3RP1A 4YUEL 2VKXA 3G6JF 3CK0H 4Y16D 5DD3H 1AGCB 1TZIB 2UZIL 3TA3C 4UUJB 3EOTL 4OFKA 1DBBL 3DX9B 4UIKL 3DV6B 4W81A 5D2LB 1PKQA 5KVFL 2R1WB 5FGSA 2GCYB 1ND0B 2YD4A 3C6SA 3VFNA 1A22B 3T65A 3U9UB 3HZMB 2NTFA 2I26N 5BVPL 2XWBA 3RVTC 3P0GB 3O3BA 1GPOH 3Q5TA 4PGBA 5HHPA 4N0FA 3D2UD 3TT3H 5E2UL 2FX9H 4ZTOH 3QRFM 3PHSA 1X4YA 2L4OA 5EZOL 1MLBB 4HWUA 3QG6A 1LO2L 4PJ8C 5H37H 3VGFA 4KJQD 3BYTA 3HMXA 3WSQL 2VH5H 2FX8L 2FECL 3LD8B 3GGWA 3BN9D 1J1PH 3MROB 3W9EA 4Y5YB 2QADD 3QAZC 5E8NB 3S96A 5JOFB 1L6ZA 4R4BA 3HE7B 3QPQC 4DN4H 5EU7C 2CSPA 3SE4C 3MA7A 1FGNH 4JPVL 5CP7B 5EN2A 4G3YL 3N1FC 3IT8D 4H25A 5GHWH 2EICA 1NCAH 4OCRH 1ZHBB 5FDYA 4IRJB 3MUY1 4LSPH 5F7YC 1KEMH 3T8XA 3INUH 4I5BA 4KRLB 1BJ1H 2FJGB 1IC1A 3UTQA 1HSAA 3M1BA 5MHSD 4JAMB 4X98A 3WIHA 2VISB 4U4BA 4U6HA 5I17A 4ZFFA 3CSYB 1I9EA 1XGRB 1OAXH 1PYWA 3IKKA 1AHWB 3TPUB 1JRHL 4FQ1H 5ICZB 5T1LD 1XF1A 5FKPA 1IGFL 4PJ5E 5CMAA 5B38A 2Z31C 2XRAL 5E56A 4YQXH 1C16B 2JJTA 2X4TB 3B5HA 3U4AA 4DGVH 2HVJA 3HNTH 3PGCA 3MRMB 1QFWH 1S8DB 5SWQA 4XNXL 1EFXD 2IQ9L 4K2UL 4Z95H 4G9FB 4KK5C 4DWHA 2AXFA 2HLAA 4QXUL 5FYKD 4Q74A 5INCA 4U1MB 4NRYB 1HXMB 2NLJA 3PIQA 5F89B 4Q0XH 4GRLC 4PGDA 3KVQA 3MBEA 1RUQL 4N8VA 3GMRA 4LVNC 3AB0C 3PQYE 4P0DA 5GRVK 5MERB 4U1JB 2I60L 4L3EE 4UT7L 4FXGA 1X6NA 2V17L 1NJ9A 1ZHLA 4N0RA 1IGIL 4Z7UB 3KPOB 5CBAB 3VFMB 4P9HL 4O02L 4WUUE 1RI8A 4L1HA 4P2OD 4HK0B 2A83A 2VABB 4U3HA 1UB6A 3IJSB 3NFNA 5ITFB 4OQ1A 4LASH 1FC2D 1SEQH 4OKDA 1OP3H 5I66B 3FHAA 5DDHB 4RGMB 3VD3A 4R7NB 4YHKL 4F9PC 3LHPL 4I0PC 2W9EH 4ONHA 4UILH 1OP5K 4QRUB 3CH8A 3VXUE 2NXZB 3P4NA 4S0SD 4ZOCA 4L5FL 5TF1H 1U3HD 2EZ0C 2ICEA 3ETBF 2JLLA 3BRGC 1S7VA 3HI6L 1CLZL 1QFUL 4R4BB 5J13B 5GGVL 1XF5B 3T77B 4WHYH 3NCFB 4ETQA 3HR6A 1U3ZA 5IVXB 4PGCB 3SDDC 3IAGC 2D9CA 1D3CA 5D7IA 1J8HE 3JVGA 4RNRA 4IJ3C 4WFGD 3D6GA 5EU4B 4IIQC 2DF3A 4LARH 1YMME 4X4YA 5FCUL 5ANMA 2P8MA 3QEUA 3RWGB 2R2HB 4HK3N 3IDIA 4KROB 1CL7L 1E28B 2O5XL 3C87A 1JBJA 4PRBB 4AT6A 1MHHA 2VLLB 3MRBB 3PDGA 1YQVH 1T22A 2OZ4A 1WLHA 2DQCH 1ES0B 1ROWA 4EI6B 4Y4FC 2YSSB 4P57B 1RY7B 5HGHA 1BWWA 4LCWA 4LSTH 2CLZA 5ISZB 2ZG2A 1JGLH 4U31A 3LZFH 4R90L 1A6WH 5IEKB 2O5XH 4FHBD 3A6CH 4XXDA 3QEHA 3BN9C 4LRNL 5CJBA 3PQYA 5D7IE 43C9B 3CMGA 1ZHNB 3BD5A 5F1NB 2J88H 4C56E 4R7DB 4ZNEA 2NY0C 4GG6A 4X7TA 1HQRB 4PGDB 4ELME 3QIUD 3QDMB 3B9KD 3T1FA 4Q9CA 5I76A 5EUKA 3VWJD 5TDOB 3KPMA 1OY3B 1OPGH 4JFYA 3RVTD 2IBBA 3EO1A 3RI5F 3VFOB 2Z4QA 4HWZB 4CAGA 3IFPB 4QGYA 4PY7A 5IESL 1HHKA 5IB1B 3INUL 5GXBB 3T2QA 4U3XA 3U79A 4QHUB 4WI6A 4Y16C 2WM0A 4HS3B 3LIZL 3C2AL 2A73B 1WK0A 4ZAKC 4Q97A 3G6DL 4LLDA 4XH2B 4GUPA 4LMQI 4DN4L 1MI5A 1PD6A 3NIFF 2VE6A 3WIIL 3LQAC 1S7VB 5B38G 1NAML 1XF4A 4GBXC 1FYTA 3WNMA 3X14B 1F3DJ 1P7QB 2OZ4L 1X9QA 4KK8D 1S5IL 2ZCLH 4LLYB 5FYKL 1FRGL 5D71L 5J06A 2VXTH 1LNUA 2NX5B 5DO2D 4KGJA 4LQFH 4RFEA 2YKLL 3CVHA 5CEXB 5IIEB 5D6DA 4KDVA 2ENYA 2P46B 4PBWD 4PJ8B 4QCIB 1T3FB 3BRFA 1RJCA 2Y5EA 3DUSB 5DDHA 1DQJB 1GC1L 3W11C 5E70A 5TE7L 4XP5H 4O02H 2A83B 2D0FA 5E9DE 4KKCC 2ZKHH 5CIPH 3B3IA 3ESUF 3GI8L 4PGZA 5JHLL 1DL7L 3A67L 4ZO6A 1C5BH 3VA2C 4UIKH 4JQVC 4PJDA 3GMNA 3BFOA 3OKDB 4X6CB 3UDWA 2I07B 3BP7A 4D9RD 3IFNL 3UCRA 1UM4H 1TQBB 1XZ0B 1JPSH 4MNQB 1XF2A 1K5NB 2W60B 3H8NA 4IRJC 43CAA 5IKCB 3OF6D 3UYOD 1Q1JL 4S1QH 4OCWH 1CU4L 2J12B 3U7YL 1EMTH 1V3KA 3ILQD 1MWAB 5K9JL 4K8RD 5EZOH 1FSKB 5HHNA 4BH7B 3RNQB 1IAOB 1WT5C 3DO7B 5DURD 3QIWA 3CFCH 2UWEA 1HILA 32C2B 3OB0H 4PJAA 4OLYH 4NYLB 3O3EB 5FA4A 2FO1A 2XRAH 4Y8AA 2WIIA 3V5HB 4JZNA 4KXZH 1Q8MA 2VKWA 4U1NB 3ZT5A 1UQSA 4LSVH 3CFDB 5BQ7A 4JM2F 1JWUB 2FBOJ 3PQYD 3UTTE 4ELKA 3HS0A 4ONFL 4QWWD 1J5OL 2GJJA 3U83A 2V2WA 7CGTA 4RDQG 1IGYB 2F5BH 4OCWL 3RZCC 5HYFA 1EJOL 1OARL 4ZQKA 3TJEL 1OW0A 4L8SB 5C9JA 1F4WH 2BDNL 4FTVD 3MXWL 1D6VL 1T5WA 1BD2A 4EKXA 3U1SH 4UV7H 4MA3B 1I7TB 1WIPA 1I1YA 2VISA 4U6VH 4I9WE 3LQZA 5J1TC 4K7FA 1OP3K 5ALCL 3BD3A 2RB8A 5KSUA 4LP5A 4FRWA 4O2FB 1BBJA 1QG3A 4W4NA 4M02A 2DIAA 2VQUA 4OQTH 1KPUB 4OBRA 1JHKL 5KSAC 3O0RH 1E4XL 1PZUB 3SGKA 4GAYA 1A3LH 4J6RL 4Y5VA 2X4TA 4XRCA 2CD0A 3H7BA 1UZ6F 1B4RA 3GSXA 1B0GB 1KCSH 4NC1C 4ELKB 1NMCC 1AI1H 5C0CD 3NAAL 1QEWB 3CK0L 1KPRA 3EJYD 1QD0A 1G9MC 1NUFA 2EDDA 3GO1H 4AIOA 1KIQB 5DJ8B 4QXWA 3CDGA 5I30L 2X42A 1KIPB 3VG9C 3OXSA 3WL9B 3FB7B 1CXIA 2D9QB 3HKFA 2EDXA 2CIIB 5KVEL 2BVOB 2APFA 3RNQA 2LU3A 3TV3H 5C86A 2VDNL 4M3KB 5EZJB 2R56H 3LS5H 5F1IA 4GO6B 3PGDA 4AT6B 2B8OT 4IOFC 3WO3B 1X6LA 1OLZA 4AQOA 3RX5A 4JM2A 4ZS7L 3F58L 4R97C 4KQ3H 1LMKA 3BP5A 3GO1L 3MLTB 5C2BH 4PJDB 4X6CA 1LVEA 3VFWA 3WHE1 5I1GH 3RUGB 5CCKL 1AO7D 3BPLC 1JN6B 3BH8A 1QRNE 5H35B 3HE7A 2Y5TA 1FZMA 1M7DA 3JTTA 4JG1L 1JPSL 4NWUL 3GJEB 2NW3B 5C07A 2CDEA 1T4KA 3C5SA 1RIVL 25C8H 1EGJL 1E6OL 5C0FB 3KWWA 3W2DH 3QULA 4XC3L 3BUYB 4JZNB 2P48B 3ARRA 4PB9L 2VWEC 3RVVC 5F3BB 3BXNA 4X7DC 1VGEL 5KJRH 5GGQL 3WE6A 1ADQA 3BP4B 2QBWA 4RBPK 1NGYA 1EMTL 2NY0B 2HG5A 4LK4A 5DUML 5KSUB 4WW2C 1H8NA 3RX7A 4EN3D 3M17B 2ICWJ 4MNHB 3MJ8A 4Y5VB 2F53B 4IDLA 3VH8A 1BD2D 4OLXH 3S3PA 5HY9A 5IFHL 1HINL 4R3SA 4YHPA 5FIEA 4HLZH 3DLQR 4IOSD 4OLVH 3SDXA 1EAPA 5ADOH 3BP5B 2ZCKL 1TNMA 5DT1H 4CMHB 2EEAA 2X4SB 2B1HL 1ITCA 2EIBA 2MOVA 3WIIH 3QZWA 4G5ZH 4NJ9H 1U91A 3O6FB 4N68A 4Y16B 3PWNB 2ORBH 3CVIH 4IRJD 4NFDA 2NNAA 4JDZA 3T65B 4ZAKB 1B0WA 4ZFGH 1NBYA 2R1XA 4HIJA 5F3HB 4ISVB 4DW2L 3T8XB 2VXTL 1IM9A 3FCTB 4JFXB 1LEGB 5GGSA 1FHGA 3FFCD 2BVOA 4D9RE 3FOLB 3DXAD 1YDPB 3QXTA 1MHCA 2M1KA 4F7CB 4EZMA 1BZ7B 1YYLL 1N2RB 3WKMH 4OZGF 1KJ2H 3ZKSD 1RMFH 1UZ8B 2CR3A 1MIMH 4YXKH 4E41B 5K59E 3AM8C 2ITDA 5DO2C 4G9FD 4K3JL 1F11A 5C0EA 3CD4A 1JGUH 2X4PB 1INEH 3LKQA 2IG2H 5DMGD 3UMTA 3EO0B 2A73A 4PJ5B 5AZEL 3OX8B 4YEEA 2MNUA 5F9OH 3GMOA 4AG4L 5I6XB 1CDBA 5L88L 1TDQA 3C5ZD 2DQFB 4EVNB 3NCYS 4PJIE 3TF7C 5DZNA 3BUYA 4DKDC 2C1OB 4TVPD 2X89D 5E00B 3EFDL 3QUKB 4Z7UF 3IRZA 4ISVA 2NXZD 3X3GL 1U8HB 5IJKA 4M7ZC 5DK2B 1NC4B 1XR8A 1YJDC 1EV2E 1DFBL 4MD0B 4I4WA 5LBSL 1I9RH 3HAEA 1S5IH 2ZCLL 5FOJA 1FCCA 3DECA 2BY3A 4CVXB 4UT6H 4OGYL 4PJ7A 5KVDL 4WI4A 3QCVH 1CFVL 5DMKA 3TP4A 4Z7WF 2QSCL 2V5SA 3DX7B 2NY0D 1IGYA 3VD4A 5ELIA 3O9WA 3EW3B 2VZTA 4JRXD 4ODVL 4UMGA 4WUUB 4NQED 3T3PF 5DWUH 4F7MB 5I1EH 5EDXA 2EDTA 3RY6A 3ARWA 3ZTNH 2BSSB 4GG6F 1TJHH 5GGRA 2HWZL 2ATPB 1FDLL 1HOCA 1OTTD 4M5ZL 5C6PB 1KEML 3QH3B 4XX1E 3F7QA 4L8SC 1A02N 3QQ9D 2J8UE 3PP4H 5IMMA 5ESVA 1C8PA 1VDGA 4Y4FD 1PLGH 2PETA 1TZHB 4M1DL 5I1KL 3FN0L 1NMAH 4OZGA 4U1IB 5BS0E 4LQ1A 3O81A 1A14L 4C4KO 3PWUA 1DQTA 1U8OA 3B8SA 4PJGE 4YDLB 5BVJB 1CGVA 4PV8A 3I85A 1LO3L 5EU5A 4JVPA 1A8JH 3PDOA 3K4ZA 1XF5A 3T77A 3VFRB 3BE1H 3ULVD 5FYJU 3UBXG 2IWGA 4POZD 4EOWH 1N2RA 3BO8B 4M48H 1PG7L 1UJ3A 5HXMA 1TLKA 1SYVB 4X9HA 3ZE2F 1R3LB 5C09E 1EIBA 1A0QH 2AJSH 8FABB 3IFPA 1YMMB 3OKLA 3FFCA 3DI2B 4MVBC 4RZCB 4P4RA 5AD0A 2E8ZA 4D9LL 4MJ6A 5C2UB 3ME0A 1N8ZB 3BYYA 3E2HB 3DX6A 4QXGH 15C8L 1DZBA 3WFCH 4OCSH 3VD7A 1HE7A 1UVQA 2BSSA 3EYFA 4LDEB 4P9ML 2YK1L 1AGCA 1TVDA 2UUDK 3NPZB 2RFXB 1UB5A 1KBGH 3WLBA 1D9KC 4F8QA 1O7SA 4N90D 5T3XD 4KKLD 3LDBC 5MEOA 3I75A 2YN3A 4XCCH 3QXDB 7FABL 5J12C 1YEKL 5M95B 5CJOH 3BGMA 4XXDB 4NHCH 5BZWA 4LGSB 3RDTB 2B5IB 3IF1B 6FABH 1XGYL 1ACZA 5EU3B 1G7MB 3V5KA 4FQ1L 3TBWA 1CLZH 3ZZ1A 4C56B 2QJDA 4BQBA 3QQ9C 2BNRB 4ZSOA 5ESQB 3VRIA 1Q9LA 2ITDB 5JQ6H 2DRUA 3HHRB 4YNYA 2X89A 3I6LD 1FFNB 1XIWA 3MZTA 5FV1L 2RCSH 1KELH 3PL6D 2DYPB 1I1RA 5T1DH 3SKMB 2GT9A 4NQEB 4GW5A 4HCRH 5GRUH 3STZB 2J8UB 4X6DA 1MCHA 4G6FD 1DR9A 1Z9OA 2VDPH 3BPLB 3D25B 5C0FA 3CPLA 4F33A 5HYEA 5IW1B 4X5XB 1MCPH 1YEEH 3MGTA 3ARBA 1U8JB 3DXAB 3MMEA 5GGUA 3KLDA 1FZJA 1FNHA 3FONB 4JJHA 4HWBA 5CEZL 1K3ZA 4OLWL 1BQHA 3DRTA 1RJLA 3O4LA 5HSFA 3MFFA 3BOVA 4PGBB 5HHPB 5MHSE 1K9TA 1KB9J 1P84J 4XPTL 3PGDB 4F58L 2DTML 1YJDH 3QSKB 1KIRA 1JHKH 2AJ3B 5C3TA 4KZEH 1JUFB 3B8YA 4HDIA 1KCVH 4X6DE 3HUJB 3SCMC 1FLRL 4WJ5B 3LKRA 5F9AC 4NC1E 4PJ5D 3QUMB 5I75B 4PJBF 2CUMA 2G9HB 3RAJH 5ERWB 1I8KB 4RISL 3C08L 4NM8H 1I7UA 4J3SA 2NY3B 4F7PA 4ODXA 4YHMH 4BSJA 2EE6A 2P5EA 1VPOH 4HKBB 5IBUB 1IQDA 1VEPA 2CK2A 1NQBA 3HNSH 3QQ4B 4OUUB 5J1AA 1UXWA 1T2QL 4Y2DD 2IALA 3X13A 3REVA 4DFIA 4PREB 4GMSH 4U1MA 1S5HA 1ZWIB 2UV3A 2XICA 3ET9F 4JY4A 3HLAA 4MXWH 1F97A 4Z7VA 5I19H 1CICB 2QADC 1XGYH 3STLA 1W0VA 3UYRL 3V4PL 5KS9E 3E1F1 4TRPH 4NRXA 3FT4B 1PFCA 4LBEA 4NQEE 2ZSWB 3GSUA 1I7ZA 2Z93B 3O6FD 4F2MB 4MXWL 3KJ6L 5BV7B 3QUXA 1P7KA 2YPVL 1FNAA 1F8TH 3MFGB 1N0LA 3C6LB 4OZFG 3VXUB 2IANB 1L7IH 4QRSA 4OZHE 2EDBA 3IKCA 3HPLB 1F3DH 1FNGA 4L8SA 3D3VE 3VXPA 1I9IH 2BHYA 2GTZA 1KIQA 1ZLUH 3OR6A 5EORL 3HG1D 2FRGP 1HXYA 4YR6A 3U9PL 2LFGA 3CUPA 5DR5H 3REVB 1P84K 2D7MA 3LCYA 3V0VB 4GKOA 5DZLA 3JTSB 5IFJA 4ZXBA 5E8DH 3NMEA 3G5YB 4RAUA 2H2SD 3FOMB 2AGJL 3D0VB 4NNXB 4XVJH 1MJJA 2XZCH 2DM3A 1TCRA 4ODUB 2JKXA 4XBPB 1HOCB 4HZAA 3U0WL 2KL6A 3K81A 3O2DA 1T1WB 1NCCH 2R29L 4WEUD 5K9KB 1QVOB 1UKSA 1T1XB 4BSVA 4Q2ZA 3L3OA 4ZPTA 3ZDYE 5D1XA 1MCPL 1E4XI 4OCNC 4U1IA 5AG9A 5GZND 4TNVF 5L9DL 1X5JA 1BF2A 4PRHD 3EDDA 5D93C 1T5XB 4M93B 5L8KB 3BESR 3GBML 1MCOH 1YEEL 4X98B 4ZXBC 1DUYA 5CJ5A 3MV8E 3WFDL 1EEYA 3WHXB 2OR8A 3T1WA 4EI5D 4ZPVB 3F7VB 4G6JH 3KXFA 1AIFB 3FQTA 1WAAE 3CAFA 1MUJA 4YDKL 3E8UH 5DJYA 1RZFH 4I3GA 1G6RH 1OAUH 1WBXA 1G7IB 5EN2B 2NZ9C 5EU4A 4JHBA 2Y72A 4GW1B 2ARJA 1MNUH 3L3GB 4JHWL 4ZG1A 4P2CG 5C3LD 3BKCL 3NTCH 2YPKA 3GJFK 3KLHC 3GMLB 3HNSL 3TZVC 4CU8A 5TF0A 4WFHE 5F89A 3LEYL 3FO0L 1TJGL 3MR9A 3G5ZA 1D9KB 3IU3A 4IOIB 4G8IA 1DL7H 3A67H 1NCDH 4NO0B 5J12B 4LKCB 3L3JA 1O0VA 2X1XR 1U95B 5BCAA 3HB3C 1IC4L 3LRSB 3RDTC 2B5IC 4F7CA 3G5YA 4G8GB 1T1ZA 1BFVL 1BIHA 1R6VA 1VFUA 1I1AD 4HGMA 4PBXA 4XCEB 2IAMB 5EUOB 1JP5A 2VB5A 4K55A 1VERA 1UB6B 3IJSA 4ZUTB 5FKPB 3MRCA 1HQRA 4EIZC 2OL3H 1PKQE 2FATL 3RWHB 1X5GA 2XYCA 3TBVA 4M48L 4QWWC 4LPUA 3MLWH 1JRHH 2GTZB 4Y1AB 5I2IA 1GXEA 4O2EA 4MSWB 4HS8L 3IKCB 3WFHB 1KOAA 3GSVA 5IM7A 4YZFE 3MRNB 4WU5B 3MMEB 5GGUB 4Z7OE 3QJHB 3QQNA 1ZT4A 3WNLA 4YFEA 5L0QB 1TTUA 4HJJH 1IZJA 1DP0A 1FNSL 4HIEA 2A6JA 2DDQH 4IRZL 3RGHA 1MJJB 5DUMH 2AV1A 3G6JB 1EHLL 3ILQC 4Y4HA 3TH4T 1H8OA 1KGCD 3SBWC 3MLPA 5GGQH 1U8PA 3BDYL 1CGSL 1E27A 1P2CA 1S9YA 5F97E 1FFNA 4U7MA 1U3YA 2VC2H 2XKNA 4OD3H 3CFKB 3EO1B 3VFOA 3LKQB 2DQUL 2EKSA 4Z0XB 4ZOBA 1CYGA 1R3IH 1YN6B 2HJLA 2F74B 4PUBL 3WS3B 5IP4A 4JFEA 5T3ZL 1RUQH 3ARQA 3KPSD 4XNYH 1INQB 1OM3L 1WZLA 4H8WL 3QUYA 4HS3A 3BKYH 1JTOA 5HGBB 3GHEL 4XC1H 1FH5L 1CVSC 4KUZH 2VL4A 4LLUA 4UV4L 4H5SA 2X10A 5DHXB 5E1HB 3KXFD 1KBGL 4NZDA 2KKQA 2ZOLA 1IARB 3B9VA 3T4AA 3DMMB 3QXAA 2A1WH 4OCLC 3BDYH 2YUXA 4KPHH 1A6PA 1CFSA 3OSKA 1RFDL 5GSRB 2F8XC 2F54E 4GBXD 1UKQA 4FTVE 5HD8D 2E7MA 2NX5A 4LL9A 4GG6B 1OGTA 2VRAA 5D7KD 1QBMH 1Y0LB 2QADB 4UI2A 1KG0B 2OR9L 4JPWH 1I8LA 4ZAKD 4ZD3H 4WFFD 4Z76A 1A9EB 2C3XA 1ZSDB 4X5WB 3ZDXE 2P8LB 4P3CH 2V2TA 5H37G 1QRND 1T80A 3G5ZB 5BV7C 4J4PA 1T83C 2NR6C 1R0AH 4LLDB 5DRWA 1CT8B 5BQ7B 2VDRH 2FX7L 3RHWK 4YAQA 4HKBA 1HK6A 2R8SH 4GRMB 4OJFL 5J3HC 2L7JA 4WVRA 1VEMA 3NVQA 2P5WE 3CZFA 4DKEH 1DUZB 2EE3A 1BFOB 3EOAA 2ZG3A 2EO1A 3GMNB 1YUHB 3K2MC 4LKCA 4EIGB 2I9TA 4XMKH 3ZL4H 3BHBA 4PRHE 1RV6X 3UJJL 1RZ7H 2DQTL 2G5RA 3MCKA 5E99L 3CJJA 3MODL 4HS6B 5TE4H 2VXQH 5BS0B 5J1SC 1EJ6A 3ULUH 1EGJH 2D4DA 4RGNC 4OV5B 2X70B 5ALCH 2E6JA 1L9MA 5TE6L 5SV4A 2I25N 5HGAB 4C56D 1N6UA 3C09B 2Y7QA 3U4EB 3LN5A 2E6PA 2ID5A 4YHPB 1FO0L 4QRSB 3TC9A 4CN1A 3KDMB 3NZHL 1R5WB 5SWSB 3Q3GA 4P5TB 4S2SB 3EZJB 3WLBB 4QXUH 4K23L 1IAIH 2EXYD 3V4VL 1MNUL 3W0WA 3GJFB 4HKZA 4CKVX 3RKPA 1H8SA 2CMRL 4F15C 4UOJA 3OKKA 3VXTB 2QTEA 3N85H 5EWIL 4NHUB 5T1LA 4YBLC 4ZO8A 3K8LA 3O6LH 1KF9B 3CSBA 4S1RH 5TDPA 3FQXA 1XGQA 2Y25A 4QRPB 4JFED 5D93B 5J8OA 1MCQA 3QEGL 1G7LA 5DJ8A 1W72B 4NDMA 4KQ3L 2VQ1A 2DOCA 4U6XA 4ZXBB 1S7TB 1DLHB 3UTSD 3SCMA 3GMRB 1S9WB 4OT1L 5CUSH 4HUWB 5E8EA 4OLUH 1M6OB 2D03H 4DUVA 4JDVB 2CUHA 1JWUA 1KJVB 3RGVA 1BQLH 1UWEH 5JPMA 5D6DC 4R4ND 3TCLA 1DBMH 1UQSB 3RIFF 2VR4A 2W07A 1HI6B 3DTXA 1UM5H 2FR4A 4HBCH 1UM4L 1A4KB 3RL1B 5HYJB 5IB5A 4F57L 1UB5B 4MA1C 1L7TH 2IF7A 5EOQL 3X11B 1AKJA 4HFUH 1TVBB 4Q58C 3TZVB 4NM4H 3I9GL 3TLRA 4ZAKA 2O93L 4Y89A 3QIBB 4P2OA 4LVOC 1N6QH 1TQCB 1RUAH 5L9DH 3ARVA 2D4FA 4GRLD 3NA9L 3DXAE 3L5XL 1P4LA 4MXVE 3U82B 4NJAH 3OMZA 4X4XA 3V7AG 5IMOA 4G42B 5F88B 3TVMD 1UACH 1E4KC 2ADGA 4PGCA 2IH1A 4L4VE 2IAMC 4KFZC 3ZHKA 5E6ZA 1ZLVH 3E3QC 2GK0A 3QFJB 2OCFD 5C0BE 1P7QD 5E6IC 3LRGA 2R9HD 2X40A 1VENA 4JEGB 3KPSB 4F2MA 2PO6D 1KFAL 1KCKA 1ZHBA 2J8UA 2KZ1B 3F7YB 2P5EB 3BIAX 2W38A 2GFBB 4M1GH 1LQSR 4RRPA 1BX2A 3S3JA 3AC0A 4PTTB 5T1LB 4GXUM 1TFHA 5E24E 3NCEB 4ZS6C 3HAEG 4W70A 1D9KA 1NFDF 5EC2B 4X9IA 5I8CB 3VW3H 4MVBD 1QKZL 5C6TH 5HYQB 1AJ7L 4WEBL 5L0QC 3ARDA 4JO4L 3T0ED 2A9MH 3L3DA 4YPGA 4APQD 3AREA 3PP3K 1DANU 4KUCF 1J5OH 3S97C 2JK5B 3P9LA 4D0BB 5B39A 4HMCA 2DWEA 2CLRB 4DQOH 1XGQB 1C7TA 4NO2A 3TJEH 3U7YH 3SJVE 5M94B 3AY4C 2VJXA 4FQHB 4LCWD 1VESA 2HRLA 4JGUA 2UYLA 4NKOB 5DJ2A 1A6AB 5LAXB 2OJEB 3TBVB 4L3ED 5IMLA 1AP2B 1YECL 4KTDL 1QLFA 2HLFC 4OZFH 4NZUH 3SKJH 1D5IL 4XB8A 3GSUB 1MY7A 4HIXH 4TULL 4EI6A 4XP9H 3H9HB 5IQ7H 3QI9A 1TVBA 4ZFZB 4M61A 2XN9E 1HCVA 2AGJH 4QXGL 5F7FA 3UJTH 1V3LA 1EHNA 3RFZC 1HHHA 5MI0C 4BH8B 1WJ3A 3CDGB 1MIEH 1HYRC 3RVUD 4OZHB 3RKDD 1Q9WB 4KKBC 4UQ3A 5ILTL 1KLUA 1A6TB 4FXKA 3VMOA 5HHNB 1EO8H 3QO0B 5DQJB 2G2RA 2IADB 5HI5D 3UYPA 3O4OB 5DJ0A 1JCKA 5FUCC 3K8MA 2JTDA 3M8OL 5IB2B 5FUZL 4Z76B 1CFNB 1KC5L 4HLJA 4G6KL 1AKJD 1DBAH 2IPKB 3KPSE 3TFKC 1QQDB 5GRUL 2P5EE 1FYTD 5TE7H 4MA8H 2GIYA 3QT2A 4WTZA 4DKFL 3H3BC 2OS7A 4DKEL 5IESH