1F4YL

Crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
210
structure length
210
Chain Sequence
QAVVTQESALTTSPGETVTLTCRSSTGTVTTSNYANWVQEKPDHLFTGLIGATNNRAAGVPVRFSGSLIGGKAALTITGAQTEDEAIYFCALWYSGHWVFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY S-20-4, FAB FRAGMENT, LIGHT CHAIN
publication title Crystal structure of an anti-carbohydrate antibody directed against Vibrio cholerae O1 in complex with antigen: molecular basis for serotype specificity.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2000-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4yL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4yL01
3HZVB 3NCBB 1B2WH 3OJ2C 1KIRB 1BD2D 3TO2B 2YPKA 3FO0L 3TP4A 1LO4H 1XT5A 2EDWA 1AIFB 4UTAL 1MUJA 2XWBB 2F19H 3L7FB 4IRSD 1HH6A 1TNNA 5GRJL 1FYTB 1GH7A 5ANMA 5AZEH 5FUZH 2EKSA 5D7IA 3UTSB 4LPTA 2VDRL 4Q9QL 3DV6A 1NFKA 1P4BH 1IMHC 5EC2A 4C56D 1IC5H 1MCEA 2D0FA 4TOYH 2R1WA 1FC2D 1JPST 1KUMA 3EHBD 5BQ7B 4N90D 4KTDH 3N1GC 4WEBL 1XZ0B 4KJQC 1XCTB 1VFBB 5FV1L 3T0WA 3OAUL 2ZSVA 1M71B 3K4AA 3O3DB 3BKML 5MP6L 1AGFA 2D9CA 5IFJA 3RPKA 2X4RA 4PJHA 3VGAB 5I1AB 2DD8H 3EYSH 4YHLH 5H37H 2QJDA 2FSEA 4TN9A 3FOMA 3N0PB 4MB5A 4NNXB 3QZWB 1FH5H 1R3HA 4Y4FA 3VG9C 5B21A 1A5FL 4H20H 5IB5A 1F4XH 3I2CL 4DZBB 5IWLA 3O9WA 1BQUA 2BSSA 1HILA 4JM2F 4BSVB 4PJAE 4JRXB 25C8H 1OF2A 4X6EB 1NEUA 2VXQL 3D3VD 1I8MA 3MOBH 5JORB 4Q9CA 2HN7B 3HUJF 3TBTA 4E0RA 1R0AH 4H25A 2XPGB 2UZXB 4J4PA 3MLSH 1NGQH 1GGYA 3OBAA 5DMYA 4ZUUA 4DZ8B 3TYFB 1CFVH 2JCCA 1BF8A 5I8OL 1C08A 3BPNC 1Z0MA 1U8IA 2CUHA 4JQXC 4L4VD 3HMWL 1MLCA 2WWKT 4NCDA 3MBED 5D5MA 3MRPA 1TZGL 1X7QB 1FL5B 2PCPB 4NO2A 4JY5L 4LGSB 1A6PA 1I1AA 1NC4A 4KMTL 3EBAA 3MOAL 2X9WA 1E4JA 1T7WA 1YEKL 1BD2E 2H8PB 5I30H 5J57B 1CI5A 4H5SB 1U8QA 1MQKL 3FO1A 5CSZA 5GGVY 3V4UL 1MCHA 2ZG2A 4X8XA 3W0WD 1YPZF 2CQVA 1NFDE 2VQ1B 1U8JB 2ZWLT 5E8EB 3VXRD 3OB0K 3GMQA 1N2RB 3CLFH 1JZ3A 3MNWA 5DF0A 1HYSD 3PE9A 2BZDA 1LILA 3ZTJG 1IKFH 4ZAKA 4C56E 4EUPA 1W0WB 4YEEA 3LKSA 4KROD 4LLMA 2FWOA 3ULSA 4X6BB 4DTGH 1WIOA 4LSSH 1Q0XL 1A6UL 2Y5TA 2V2WA 3O2VL 4N90E 4R2GB 2D7MA 2LVEA 4LLDB 4P2YA 1Q0YL 1JMZA 1OTUD 2W65A 2OR9L 5KVFL 2N1KA 4HS3A 5L8JB 3M1BA 3ZLQC 4U0RC 5D1XA 4PJ9C 4JZJC 1R3LA 1C5DB 1NFIB 4NO0D 1WZ1H 3VRIB 3FFCD 1S78D 2B4CH 4NKMB 4JKLA 1IBGL 3GBML 5J6GA 1NDGA 4C57C 3UTQA 2WAHA 5H94A 1KELL 3VGDA 4X9IA 1IEAB 3TIDB 5JA9A 2XWJB 4I1NB 2X4PB 1TETL 4LASH 4XRCB 2GSGB 3RL1A 5CD5D 3D3VE 3Q1SL 2DQEL 3O11A 3RQ3A 4CNIA 1ZTXL 1NANI 4Z76B 1HSBA 1I75A 2FD6L 3MRQB 5FHAL 5IB2B 1G9NL 1MPAL 2NY7H 4L3CA 1IC7L 2CLVA 4NO3A 1I7UB 3X14B 2JK5B 4FMFA 4KC3B 3C09C 2OMNA 4J3SA 1KIPA 5DYOA 4AENB 2V2TB 1JPSL 3RVTD 4L4VE 2X10A 4WFGD 5DMJB 4I8DA 4ZTPH 1SMOA 3GKWH 4H8WH 2CPCA 3BP6B 3UTTA 1T0NA 2CK0H 3GMNB 5KSAB 2MPAL 3V52H 5KJRH 4S2SA 1WFOA 4KKBD 1PGRB 4JFYB 1PYWB 3HZMA 3NTCH 1JNHA 5CINL 1S7SB 3VDCA 4WO4C 3PHSA 5IHZA 5C0GA 3W0WE 1ND0B 1WVZA 2UVFA 4U6XB 3RA7L 2MKLC 1SY6A 1KCKA 1RULL 2EDQA 1PW3A 4HJJH 2R1XA 1QR1A 3VXRE 1VDGA 1NAMA 1U8NB 2D03H 2YRPA 3QCVL 5BV7L 4K9EL 4I77L 5FCSH 5TPWH 1PX3A 5GISH 2ED9A 2F9BT 3Q6FB 4WU5B 3KYOB 4PRAA 3DX9A 4UNVA 4JFFA 3SPVA 1EAJA 3QFJA 5FFLA 3NA9L 4ZUVA 5ADPH 4AT6B 2CGRH 4R4FH 5JTWA 1CLOL 4PS4L 2NY3D 5DJXA 1PQZA 3GIVA 4QRSB 3RIAK 1VSCA 5ITBL 2BXYA 3FFCE 1KTLA 4GRWB 3MQIA 3VXSB 3S3PA 5F9WB 1H0DA 3AREC 1W0VB 2Q76B 3SKJL 3L3HB 1GGUA 4EUPG 3DXAD 1PKQE 3CCHB 5FYLD 4HKZA 2BVUA 4C58B 2GJ6D 3GI8L 3T0EA 4G9FB 5CUSL 4X7TB 2X1OA 1DVFB 2YKLH 5TDOB 1O7VA 5IB3A 5T3XH 5DQ9B 5E0QA 5MERA 4G6ML 3C60C 3SGKA 4Z78B 1NCNA 3PWPA 5MI0C 3QUZB 4Z7UE 4A6YH 2AP2A 3MRIB 2Z35A 2O61A 2HFGL 2GTZB 5EO1A 3BDYH 4O5LH 4W6WB 2NY6C 3B9KB 5I1GH 5GS2H 4OLEA 1DUZA 3IGAB 3SGEH 3BEVB 5C0FA 4LLQA 2JJWA 2R0ZL 4LSUH 3WS3A 1GPOL 3WJJC 1MFDH 1H3VA 4KXZI 4M6NH 4HWUA 3AROA 1OAXL 4GQ9L 3FN9A 1XF5B 5KVDH 1OGAA 3E6FA 4PJ5D 3NZ8A 1HXMB 1FNLA 3CU1A 3O6FD 4XHQA 4G7VH 1KFAL 3AMKA 3QCUL 4JPWL 3KLHC 1UM4L 1UWXK 5F6IC 1IRAY 2PXYD 4YBLC 4U3HA 4FQPA 1EJ6A 3BHBA 4WENB 3G9AB 1B88A 4GO6B 4ODSH 4BZ2L 1T1XA 3MUZ1 2XA3A 3NCJL 5KSUA 4RAUA 3QFDA 2PO6C 3IU3A 1VEPA 4WDIB 2DQUH 3SY0A 1INEL 2AJ3A 5ILTH 1E28A 1ES0A 4PUBL 2R8SL 4P3DB 1OAYL 4JFDB 3KS0H 4GXUM 1ED3B 4WJ5B 5SWZB 3VXQA 3DGGB 1FNEA 1LDPH 3DX8B 5C9JA 5C0AB 4FTVD 4JY6A 3TWCH 3GI9H 3MO1B 4NSKB 2H2PC 4IJ3B 1FZKB 3ESVF 3OKOA 4H88H 3LPGA 4XGZB 4MD0A 2NY2D 1JF6A 1UJ3A 4KVNL 1UWGH 3B4NA 4TUJB 3P73B 5F9DC 4F7EA 2Q8BH 3BW9B 3VFRA 2L0DA 1V3KA 4XCCL 3DXAE 4GRLA 4OD2A 5TGBA 4RGMB 1T20A 4UT7H 4PJ7F 5FYLE 3UPAA 4FQQB 4FG6D 2GJ6E 3C8KA 1CK0H 1KNOB 3OR6B 2O5XH 5E6YA 1X5LA 5F9OH 3WIFA 3OXSA 4AL8L 3ALWA 3FRUB 2HLFD 2E3VA 4WWKD 3PIQA 1CFBA 3TO4A 2HVKB 5CIPH 1LE5A 2I26N 1ORQB 4HXBH 4FFZL 2PTTB 3VFPA 5DMIH 4KK8C 1W72H 1XGUA 2UWEF 3L3OA 4NHCL 4LCUB 1J87A 4ZD3L 3ISWA 5A2KH 2X9XA 4LARL 1Z9OA 2BNUB 1T1WA 1ZA3B 5IVXE 2Y9RT 3FL7A 4YGVA 4UU9A 3FHQA 2P43B 1K8DA 1WBXA 3U36A 1I9RL 4G42A 5GJTL 4G6JH 3S96A 4YFEA 3SE4A 4PJ5E 1BQHG 1MCDA 4QYOA 4NOBA 5EO9B 4Q6YA 3RHWF 4K8RC 4TYUA 2ESVB 2DRUA 3CFKA 1IKNA 4GG8A 3O6ML 4WU7A 4X6CA 3RNKB 3FT4B 2NY1C 5ECJE 4ZFZA 3T77B 4BK4A 4B50A 1HDMA 1TJGL 4P2RA 3RDTA 1MCRA 2CO7B 2Y06H 4TSAL 4N0RA 2WZPD 3GBNL 4XNZC 5EU5A 15C8L 5K93A 5IMKB 1MWAA 2VLKE 2EYRB 4MS8D 1FVEB 1I1AD 4ELMB 5HDQL 1LEKB 3D6GA 3MUJA 4ZODA 4NQVA 3OKEA 5AZ2L 1QEWB 1GIGH 1INDL 1K5NA 4LKXB 4FTVE 3RWGA 1C16A 2A73A 5T1DH 1TPXB 4WI2A 2QQKL 4CU8A 1U2HA 1YN7A 5CZKA 1JGLH 2MQCA 5DMGC 1E4XH 4UAOB 1T1ZB 3CUPA 1WBYA 3G6JE 4PLKD 4JM4L 5T33L 2F74B 5D7IE 3WFCL 2AJZB 4NFDA 4PRPB 3BEWA 2AVGA 3NGBC 3MLPA 3QNXB 1MRFH 1DANU 4XPFH 5LCVH 1RHFA 3NBNA 3PWVB 3WE6A 4TRPH 2XRAL 4KZEH 4OGZA 3SDCD 2A74B 5GXBB 3DSFH 4K7PL 1EEYA 2EE6A 5HTSA 4DN3H 3LRSB 4PV9B 4AEIH 2XZQL 1H8OA 2JELH 5IT2H 4MD4A 4QHNA 1HE7A 5I1CL 5AUMA 4PJHE 2HJFB 5DHXB 1BLNB 1S9KC 4JPKL 5CGYC 2FECL 5IHUH 1CE6A 3EO0B 1QD0A 3BX7C 1U95A 2IH3A 1KJVB 5CBEA 4OQTA 2F54D 3B9EA 3V7MA 5L2JA 1S5HB 2H6PA 5GS1B 5FM8A 2HVJA 3ARGC 2Z92B 4OBRA 5LVEA 1EVTC 1V7NL 1FE8H 2GK0B 4U1JA 1T4KA 3SE9H 2P7TA 4U1SB 5L7XL 4POYA 1VENA 3L95A 1CXIA 4HWBA 4X98B 3RZCD 1G9MC 5DR5L 4XPGL 4P0DA 4YDVB 3VA6A 1C7SA 1PEWA 2XWTB 1FSKB 1WLHA 1B90A 1V3JA 4Z8FH 4O9HH 2WUCH 4JFEA 4HH9A 5FCUH 4P5TC 1EZVY 2ZCKH 1UQSA 2KZWA 3DYOA 4HGKC 3RL2B 1RZ8B 3BVNB 3SDDD 3LIZH 1PG7W 3V0VB 2DKMA 1N3NA 1N5AB 4FXGB 1A7QL 1YN6B 1QACA 3RY6A 2A0LC 4L3AA 5DURD 5GHWL 4LK4A 1WWBX 3ARPA 5IB1A 1QO3B 3SQOH 4OZIB 5D7JD 1U8PA 2A1WL 2MNUA 1T22A 5KTEL 4V1DD 1LGVA 1VB9A 2ARJQ 4PB0L 4YHKH 4XP4L 4L1HA 1PZ5B 1HKLL 4NJAL 4FABL 4JDTL 2P8PA 3QIUD 4MB4A 1EERB 4N0CD 3FB7B 3BIBX 4ODVH 5CEXB 4QRUA 1A7OH 5JXAH 1F02I 2H1PH 4RIRA 4QRRD 2R23B 5MENB 3X13A 5JPMB 2C4FT 3NPZB 3ZHLA 1BVKA 3WUZA 3EYFA 3DHJA 4KDTA 4JFFD 4YX2H 4HS8L 2CIIA 4KJYA 2ARJB 4HF5L 4JG1L 5KSVA 4NHUA 3KPSB 2CDEA 1F3DH 3F7PC 4OIBA 2APXA 5FKPB 1M7XA 4N8PA 3L5WB 5DQJA 3DVGA 1PG7H 2QQLL 1UKQA 3KLDA 2IPTH 4GAYB 2Z93B 5IVZB 5F7EL 4APQC 5J11B 4POZC 3KYAA 4G9DB 3FCTB 4UB0L 5BCAA 4X5XA 3LS5H 3R06A 1MEXL 1P4LB 2Q20A 2M1KA 4HC1H 3C5ZA 2V7NB 4WRLA 1NQBA 1DSFL 3KPPA 4GW1A 2F54E 1M7DA 2Z8RA 1MCSA 3HKFA 2IAMA 3T0DA 3RPIB 4PP1C 3N9GH 1A3LH 2X4OB 3MRJB 1G6RL 2LU3A 5IW6B 5CZVH 1UYWH 2Z31C 2X9YA 2ZG1A 4P4KA 5JUEH 1H3WM 2QV2A 4NZDA 5IEKA 2J6EL 5C86A 5KZCD 2LVCA 3I6GA 1BFTA 2YRLA 3LQAH 3VE0A 3OKYA 4JZOB 4GAJH 4LEXH 5EORH 2BDNH 4Q6IB 3UTTE 3BH8A 5AWNL 5KW9H 5EU6B 4FQHB 5HYSB 5IVXF 3V9FA 3MV8A 4YXKH 5GGTA 3VW3L 1X5FA 1FN4A 5J3HC 1E4WH 4LQFL 1IAKB 4V1DE 1RZIB 3U7WL 4IOIB 2WLZA 2XY2A 3AMLA 1U91A 1NBYA 2NXYD 3TPKA 3WSQH 1T0MA 4NWTL 5F7MC 4X4YA 3ARUA 3HMXH 3QEUB 3HLAA 4OKDA 3V6OE 1JUFB 5KOVC 1HINH 2C7UA 1FBIH 1UJTA 1XGPB 5ITFB 1JNJA 3QAZC 1LE9B 3OPZH 4NNYA 4JB9L 4Y88A 3QIWC 4PPTA 3REVA 4DQOL 5DEGB 2WP3O 4X99B 1MNUH 4JFFE 2V9TA 3CVHH 4FP8L 5JXED 1VFAB 4P57A 1YJDH 3QXUA 1OAUH 4OD3H 3VXOA 4UOJA 2IFFH 4WUUD 2AV7B 5C0ND 3GHEH 3G6JF 2DQIH 4NZTL 2DQHH 4X80L 3UAJC 4JJ5B 4RGOH 3IDMB 3REWB 2OJEA 3QDMD 4WTXA 2LE9A 1DL7H 2H2SC 4LBEB 3FO2A 3B6SB 4KGLA 4DAGH 4XNMA 4Y5YB 4C83A 1DQTA 1G0YR 2X6MA 2CKBB 3L3KA 1ZOXA 3MFGB 1S7VB 4GKOA 5TF1L 5FUCE 5I15L 5CJXA 32C2B 2R0LH 3ARRA 3PWPE 2A83A 4LPVA 3SKMA 3TEUA 1IEBB 1S7RA 2FYYB 1EGJH 1GL4B 2B4CC 5E70A 1T83A 3QG6A 1N6VA 4FQXD 4LL9A 2OTUA 2AI0H 2CKNA 3CXDL 1T21A 3BZFB 4CU7A 4FZ8H 4W68A 3UYOD 1RUMH 1I7RA 2P48B 4U1GC 3IJHB 5C0IB 4PJXF 3ARFD 1FZJA 1MF2L 3HE6C 3R4DA 4ZS7H 3VXPA 3DBXB 3NZHL 4JZNB 4QY8A 4YHPA 3CPLA 5AAWA 1QBAA 4R8WL 3NAAH 2OXHA 2BY3A 4WHTA 3WIHH 3B9VA 1T7XA 3WDIA 1T2QH 3TNNB 1I8KA 4M8QB 3S5LA 1KJ2A 2HJLA 5DJCB 4Z7VA 1TZHA 2NX5D 4PB9L 1AXTL 4U33A 1QSFA 1HHKA 4F7TB 4NN5B 2K7QA 3L9RA 3RU8L 4HJGB 4LVOB 3T04D 1RK1B 2A6JA 4LCCB 4DKFL 3V4VL 5EOQH 2A6IB 3AS0A 3GRWL 4JPIA 4Y4HC 2V2XB 4QGTA 3AS2A 1BBDL 2YRZA 2L7JA 2YUWA 5L2KA 5D2NA 3HPJA 2NW2A 1WFTA 3BIKB 1L9MA 1C1EH 5CEZH 1NEZB 1Q1JH 4YQXH 3C9NB 3T4YB 4X0KA 2XFXB 5DRWA 4XPBL 1QPPA 43C9A 5K9OA 4HK0A 5B39A 3RFZC 4WUUE 4RSVA 1N0XL 4ERSH 4L8CB 3WO4C 5C08A 2XT1B 1Q9WB 5ALBL 4NM4L 4OCMC 1FAIL 4QKXB 3QDME 3WXWH 1V3MA 2HT4D 3OJDB 1KENL 1YUHB 5GS0H 2G60H 3VI3F 1D3CA 4U6VH 1SEQL 2AJUH 4Y2DB 3NFPA 3TM6A 5EPMA 3FQRB 3PL6C 3WKMH 5IBLD 1D6EA 3KPQA 5HVGB 4PLNC 1ZLWK 2OL3H 1MOEA 5JIPA 5C0CB 4MAYD 5CCKH 4Z0BH 4HJ0D 4G7YH 3KVQA 4IM8A 3RKDC 2EO1A 2X1PA 4AEFA 4NRYB 5D2LF 1VPOH 1X4YA 4UNTA 1MJUH 4OLWH 1EUUA 3DI2B 2YOCA 1UACH 3EOAB 5DLMH 2CIKA 4G6AC 3CDFA 3HFML 4PJFA 3MJ9H 5C0EA 5HI4D 1YY8B 1A6WH 4HULB 2ZUXA 1Q9OA 1YMMA 3RWHB 5BO1H 1N8ZB 3RVVC 2HKHH 4HW6A 3PGCB 3DTXB 5JZ7C 1D5IL 4DOHE 4L5FL 1BQLH 4ZSOE 5IR1A 4X6CE 1JNNH 1G7HB 1NGWA 4ZNEA 3QT2A 5I1KH 2ZSWB 4GMTL 4KKAD 4U31A 1QPXA 3TC9A 3L3JA 1DQLH 3FHAA 4OGAC 1YY9D 4BZYA 4OF8A 3V6BR 3UXFA 4JY4A 4X7FC 1DN0B 2O93L 3HZVA 5T1LB 1J1OL 2IQAB 2DQDH 3PDGA 4OFVA 1QLRA 1J5OL 1S8DB 3T2QA 5DS8B 4HZLA 5E1HB 5HHOB 1WT5A 4CVWA 4GG6E 3NFSH 3O3AB 5C0RH 1EIBA 2KQNA 3O2DL 4I3RH 4R26H 5ACLA 5JW5B 1FYTA 2VLMD 3FQXA 4NQDB 3HRPA 3S5LG 3CC5A 3BPCB 5F97E 4U6HB 3TN0B 4FQLH 1U6AH 1UH4A 1UA6L 1YA5A 3K4ZA 5EN2B 5ICXA 2N7AA 3F65A 1IM9A 3GJFK 5IGXL 1P2CA 3IT8D 1NANH 1NCAH 4G8IB 3EJYC 3JV6B 4NRXB 5DQDL 3IFOA 1A1OA 5IG7B 3CSBA 2IQ9L 3DVNB 4JO4L 5I19L 3I50L 3PQYD 2XN9D 5FYKU 1BQSA 1A14H 4KJWD 5FAAA 1CGUA 1YECL 3CFCH 4HCRA 5JMOC 2NYYD 3WEXA 1HHGB 4M1CD 5GGQH 1Y0LB 5B39G 4U2ZA 4WNQA 4XCEA 1U8HB 5J11C 3OKDA 5JHLL 1ZS8B 2FL5A 2G2RB 3G6AA 4KQ3H 5IJKC 4OCRL 1AC0A 2UYLB 2BJML 4ONOA 4Q9BA 2EDEA 1Q9KB 3BGMA 1XR8B 2IWGA 2BCKB 2A6KB 1GVIA 4GXUN 2YK1H 2B2XL 3GK8L 3ARXA 5D70L 5GJSL 2MHAB 1T03L 3MREB 3O2WH 4K8RL 5J1AA 4JQIL 1FHGA 3UDWA 1CLYH 4BQCA 5HYQA 3VXNB 2OYPA 3TNMA 3MMEB 4YNYB 4PY8I 4BFEA 4JREB 3TPUA 4YDIL 4FQCL 4MYWB 4OZFA 4RFEB 1JHLH 5EH1A 2CDFA 1A7BA 1OM3L 1X5KA 2VZVA 5DDHB 5C2UB 1X7QA 2VZSA 4UILL 5GRUH 1C5CL 1T2XA 1OSZB 5JOEA 3KXFB 4MNHA 1P5VA 1I9EA 2AJYH 3GM0A 3BKJL 1ZHNB 4R7DA 2GEEA 4Q7DA 3CSPA 5I17B 1YEJL 4H5SA 3JSSA 1MAMH 4PLOB 5D96B 2P47B 2XG4A 2DJSA 2OCFD 3SE8L 5LBSL 1TDQA 5BS0B 2EDBA 2CRMA 3GSVB 4M5ZH 4URTB 5C92A 1EXUB 1A2YB 1S9WA 2GITA 1OD7A 5T5NF 1CDIA 2VLME 3DX7A 4I0KA 4OM0H 9CGTA 5E2VH 4EI5D 4LAJH 3MX0A 4ZFGL 3VFWA 1XR9B 1W0WA 2X70B 3BIAX 3S98A 3P0YL 3QEQB 5DA0B 1WJ3A 4IHOB 2XV6B 2I25N 4PGZA 2BOCB 1XGYH 3P11L 3VXUB 1CQKA 1DLHA 2OR7A 3BD4A 3PWLA 1MCNA 2ZJSH 4XC1L 5E8OB 1NAKH 1G84A 4ETQA 1KB9K 2FEEI 4MWFA 3SKUD 3QH3B 3PQYE 2XN9E 1CD9B 1RIUL 2WWMD 3L3IB 1BM3L 3QUMH 3VRIA 5C7XL 2VWEE 4PJ9D 4NKMA 1WC7B 5TE7L 4KXZH 5B8CC 1WBZB 5F89A 4MJ6A 1CICA 3QUXC 4M6AA 2YPLB 5L0QC 1MIEH 2KUTA 1KEML 1T66D 4OCYL 2GSGA 1A0QL 1QFWH 3OB0H 1A6TA 3HI1B 3PHOA 1OB1B 1NKRA 3MRFB 1IL1A 5EZOH 4I0PA 4HIIB 3KPLB 4ORGA 3MRQA 3O8XC 4C59B 3BQUB 5BVJA 1G9ML 5B4MC 1JBJA 1S9VB 2CLZB 2GY5A 3X14A 4XB7A 3TLRA 4KRLB 2VDLL 2RIKA 5DT1H 3MRDA 1LO2H 1EO7A 3JTSA 5EBGA 1RZFH 1OSPL 3ETBF 2PW1B 3C2AH 4PTUB 2X4NA 3GMNA 1XMWA 4XVJL 5KSAA 5FO9B 3IFNL 3O6KH 4XP1L 4TQEH 1CBVL 4F9PC 1Y6MR 2BSED 1DN2A 5JQHC 3VWKD 4G6FD 2HT2D 3LEYH 3G6DL 4HWZA 2PR4L 5E4EC 1MFCL 2VXUL 4EVNA 4GUPB 2O26U 4S1DD 4X6DA 3D18B 4DGVH 1F2QA 5ESVB 4FFWC 3OXRA 3L7EB 3T3MF 3EO1B 3BPLB 4PR5B 3T65A 3RUGA 4LCCC 3DROB 1JNLH 4NGHH 4NQED 2GK2A 4WU5A 5FYJD 4OSUH 4DKDC 1B2WL 4I18B 4X4ZA 3H9SA 1EAPB 1LO4L 4DGIH 1F6AB 4XBGB 3MPCA 1ZGLM 5CZXD 2PUQT 3R0NA 1RZGB 2F19L 3O41B 1OAZH 4NN7C 5D1QB 3MYJB 5D2LA 2IPKA 1GSMA 3Q5YA 5E1AB 5AZEL 5FUZL 1T89A 1HXYA 2K3TA 3IDXH 4PJGE 4F3FB 3AGVA 5E9DB 1P4BL 1RZ7H 4WY7H 2VR4A 4F57H 1IC5L 3PWJB 4D0CB 4JN1H 4ZOCA 5A1AA 4TOYL 4J3TA 4DFIA 4FQ1H 3EUUA 1ZK9A 4GW5A 4JCMA 2EDFA 3Q6GH 4ODUB 5DK0B 3CCHA 2VAAB 5FXCH 4KTDL 4PJDF 5HGDB 4BJLA 3MA7B 3ARED 4GKZB 4J3XA 4Y2DC 4LLVA 5BZDA 3EYVB 1AD9B 1CXLA 1CXHA 4X6FB 4LRIA 4YWGH 3JWOH 4CN1A 2DBJA 3PV6A 5GIRA 4DVBA 1J11A 4JVPA 2BNRB 2IC2A 3ZDZE 3GFUA 2DD8L 3EYSL 3VFTB 4U6YA 4YHLL 5M94B 5MEQA 5FA3A 1JFQH 4FXKB 5EOCH 4L9DA 1FH5L 1NMAH 2BHZA 3MLYH 4H20L 1F4XL 3O3UN 4X9BA 3QXDA 4DK6A 4DUVA 3TJHD 3PWUB 1AFVH 3MC0A 3CFIC 4AIZB 3C5SA 4TVPH 4K55A 4PRIB 5INCB 2R56H 5EBMB 1ZA6A 4GRMA 4JFOB 2PYEB 3BGFB 3MOBL 4ISVB 4RGNB 2VE6A 5EFIA 2P4AB 1R0AL 3VGBA 4YBQC 1AD0B 3MLSL 1NGQL 4LSDA 1CFVL 5SWQB 3MSPA 4UT9H 1EPFA 4D9LH 4PJIE 4IS6A 1QFWM 3S3JA 1G7MB 3STBA 4JFQA 2C3VB 5JNYB 4QTIH 4YHMH 3BZ4B 4Z7VE 1RU9H 1AQDA 3VMNA 1C12B 4QCIA 3LQAC 2HFFA 4MNQB 4W4NA 4NQEE 4WFED 4PJAB 5FYJE 4WV1C 4P3DA 4MDJA 1K8IA 4WJ5A 3HI6H 5I30L 4ENEC 3FTGA 5GSRB 4J23A 1KLFA 5ISZB 4GLRI 3QIBC 5L2KE 1EBPA 4XXDB 3U7YH 5D2NE 3CFDA 4R0LA 4MSWA 4AEHH 4QXTB 5JPNA 2OQJB 4W4OA 5F70A 4OV5B 2MTPA 1FYTD 4QHLB 3CLFL 3F7VB 4TUJA 1MVFA 1NPUA 3WNMA 1IKFL 3UTSD 4WFHD 3MV7A 4O2CA 4DTGL 4LSSL 5F1NB 2VSDA 5EU7C 4MAUH 4HS6A 4PJEF 1GC1H 3QXTA 5JO5B 3T4AB 5KVGH 3OR6A 3P9MA 4KTYA 1QRKA 3FT3A 4F9LA 4KK9C 2PKDA 4U1MA 2YUZA 3FONA 4PJBB 1RVFH 4F7CB 3MRNB 5IFHH 1IGIH 1WZ1L 1YJDC 1NUNB 2B4CL 4JO1H 3WHXA 5ICZB 1NFDB 3ARBB 5I2IB 1MH5B 3OL2A 4NQXA 2VN4A 3DMMB 4BFIB 3OHXA 3ARDB 3QUMB 2I27N 1CGTA 1T7YA 2QTEA 5FYLH 1KTDB 5JDSB 2W9DH 1UFUA 4LASL 1FPTH 1G7PB 4XC3H 3ZKXB 3K1KC 4JRXD 1W8OA 3K1DA 4BSWB 3GB7A 1TCMA 1OGTA 1D5MB 1UZ8A 4M1GH 5E56A 4HAGA 3VFNB 5A3IC 4NUGH 1BGXH 1CVRA 1WEJH 5EZIH 5HDOA 2NY7L 1XF4B 1KLGB 4KU1A 3PV7A 4PJFE 1E27B 2J7LA 1WCBB 4S10A 4ZXBB 5EG6C 3HCVB 4ZTPL 3GMLB 3T77A 3GKWL 3RGHA 1CCZA 4ODWA 1WSST 5E5MB 1ZVYA 2CK0L 4HKBA 1LK2A 4KAQL 4WI8A 2X4SB 2XKNB 5D7LA 5HGHB 5I1LB 4WFEE 3B8SA 4XVUC 3V52L 2VL5A 1MJ8H 1HQ4A 3O81A 5KJRL 3LKOA 4JO3H 5FOBA 3NTCL 4GJTB 5C0DA 4LHUA 1NCTA 2HRPH 2CD0A 5I8CB 4UMGA 2VRAA 5C6WH 2Y07H 4MB3A 2VISA 3AU1B 1IZJA 3CXHK 4G8EB 2GT9A 3L3GB 2P46B 4HJJL 3CDGB 4Y4KC 1DQQB 2P5EA 2QADB 1FYTE 1NUDA 3ZTJH 1A3RH 4LAQL 2G5RA 2D03L 5CSGA 2AJZA 5DMGD 4F33B 4PRPA 4WFHE 3LKNA 5TPWL 3U0WH 2ADGB 5GISL 1JI2A 3TA3A 4Y5VA 3STLB 5AD0A 4R2GD 1SYVA 3QSKB 2SEBB 5HHNA 4EN3B 3RTQC 5ADPL 2CGRL 2O5ZH 1JHTA 4R4FL 2YXFA 5K9JH 2I07B 1H15B 5FUOH 2FIRT 4ONGH 3C5JB 4PG2A 4PV9A 3RGVB 1A7NH 4IOFC 1U8LB 3FB6B 3UPCA 2Y23A 1CDHA 2H45A 2NZ9D 4WW2C 3U48A 3RWIB 1G0XA 3ZE2E 1BLNA 1MI5B 4UQ2A 1AHWB 1RHHA 2W59A 2F8OA 3HC0B 4P3WA 3QYCA 4RMQA 3O3EA 3OX8B 2ZZUT 3QWQB 2FGZA 4NYLA 3T0AA 1QVOB 2PNDA 1JYWA 4AK1A 4LDOB 2DLGA 4UTBH 4JRXE 5GS0C 4QRPA 2E6QA 3DNKA 1K4DA 3MZTA 2Z92A 1TFHA 3L5HA 4OZ4B 3RNQA 4OI7A 2NPLX 2GK0A 4Z7OF 4A6YL 4ZS6D 3BDYL 4O5LL 4ESKA 3CD4A 5I1GL 4TNVF 2BXZA 5KN5B 1MCBA 4E41B 1INQA 1K2DB 5BRZA 5DJDB 4UBDC 4OTXH 3FOLB 1YEDB 5I66A 5IMLA 1MFDL 3RI5F 1D6VH 4MNGB 4M6NL 1G7JA 4R6UA 3N06B 3ES6A 3HZKA 4OCWH 5DRXB 5KG9B 2X7LB 3RL2A 1BIHA 3P30H 3P4MA 4P23C 2CJUH 3ZKND 5KSAD 3QI9B 4YH6A 1MRCH 1N5AA 4N8CH 1T6WA 4M02A 5J13B 3IS1X 4G7VL 4AY0A 5I9QB 5L9DH 4FMKA 4V2CB 4CADB 2A0LD 4ODSL 5IM7A 3KG5A 2B20A 3OWEA 5ERWA 5EBWB 4JN2A 3DURB 2DQUL 3I85A 4J7RA 3P0VH 5ILTL 4HXAH 4IMKC 3TCLA 2NXZC 4JKWA 4ELKB 5FV2A 5ELIA 2A9NH 2OP4H 1LDPL 1HCFX 1S7TB 3TWCL 4D0DB 3V6ZB 2I9TB 2ZUQC 3KGRA 1I7TB 1S7UB 3MGTB 4H88L 2VZUA 3TFKC 3VWJC 3KPSA 3W39A 4OFKA 4K3DH 5FKPA 3TVMA 3G5YA 1U3YA 1UWGL 2X4QA 4R96A 5I1DA 3KPRB 2Q8BL 3ABZA 2VB5A 5BJTA 4P46A 4Y5XB 5I18H 2DLTA 3VXSD 3MGOA 4G9DA 2OS7A 3FCTA 4HEME 3DPBA 4UT7L 3F62A 3HE7B 3SJVB 4NZRH 5IMOB 4ZQKB 4M4PA 1CK0L 5DMKB 2O5XL 2NNAB 4D2NA 2VTFA 5F9OL 4G9FD 3QUYC 3MRRB 3LKRA 4J12A 1DVFD 5DHYA 3BUTA 1OQXA 1RY7B 3PDDA 1FVDB 2EC9U 5DZLA 3GMPB 4QF1A 4CDGC 4M6MH 2E9IA 5HJ3A 1FVCB 3QUZD 4HXBL 3LN5A 1Q9LA 2HTKC 5DMIL 1W72L 1QFPA 3B9KD 4YAQA 2AQ3A 1S7WB 3C8DA 4PIRF 4OF3A 1TQCC 1R5WA 4K7PX 2I24N 3BGFC 4NN6B 1HI6A 1XF3B 3VD5A 2FBOJ 1RK0B 4UIMB 2Z4QB 4P2OB 2AJXH 2D31A 2DQJH 2MKWA 4UQ3B 4M62H 5HYSA 3EFFA 3QQ4B 4G6JL 2OK0H 1JZ6A 1A4JA 3BH9B 4PY8J 3ZE1F 1TVBA 2EE2A 2YBRB 4M93C 43CAB 3S35X 1QHOA 4MA7H 1RAMA 4MCZB 4HHAB 3BYYA 3W11D 3CX5K 3DRQB 1JN6A 1KXQE 4PJEA 3OV6A 4K23H 4YR6A 3DO7B 2X89A 3LEVH 2Y06L 3F58H 4RBPK 3VI4E 1MVUA 2YHGA 1U93B 3B5GA 4PJ8B 3SE3C 2JB6B 4ONFH 1F3JA 1X6LA 5A16B 5KAQF 2P24A 4JFDD 1V05A 5SWZD 4X99A 4IRJB 3MNZA 4IIQB 2XXMB 4PD4J 2X05A 5C0AD 3RVXD 5IQ9A 8FABB 1P1ZA 4HBCH 4KQ4H 1VFAA 1JGLL 1YDPA 1E4XL 3K46A 5DD0H 3U46A 3LV3B 1KXTB 1MFAH 1UH3A 2DJ4A 2YA2A 3PGFH 4O2FB 4IDJH 2AV7A 2J8OA 2KKQA 3HNSH 2B1HH 1NAMH 3G08B 5FB8B 2UZIH 3CFBB 3SGJA 4GRWE 1MRFL 1FO0B 3RBGA 4XPFL 3VXSE 5LCVL 3PGDA 3AXLB 4N0FB 2CRZA 3PP3K 3UAJD 3TCXA 4TRPL 4CMHC 2R29H 4KZEL 4K7FA 4JFXA 1Q94B 1XF1A 1YMHB 1WITA 2H2SD 2W91A 2BFVH 3DSFL 4G9FE 2JF1A 1LP9B 1T5XB 1HSAB 5JQ6H 5F21B 4DN3L 4LVHC 2YPVH 4AEIL 2JELL 2YPKB 5IT2L 3M17A 2AJVH 4EJ1C 5C3TA 1Y18A 5GRYA 1HH6B 2FYYA 4JQXA 4M4RA 2D7QA 3ILQD 5IHUL 5ANMB 4Q9RH 2J6EA 2EKSB 3ZE2F 3U9PH 3EHBC 3DV6B 4L29B 5EC2B 2J5LB 3GSRB 5DSCA 1VEOA 1HWGB 4KH2A 1FE8L 4OLVH 4XH2A 2BY0A 3FQUB 4ZUTA 3SE9L 4N1EA 35C8H 4MXWH 5JR1H 4U3XA 1KCUH 3GSUA 2ZSVB 3NPSB 2ESVD 1AGFB 1KPVB 3LQMA 2AKRA 1QLEH 5IFJB 1J0ZA 2X4RB 4PJHB 3UC0H 4WW1A 4Z8FL 4O9HL 3WFBH 3WO3B 2FSEB 1D5ZA 2WUCL 3FOMB 3UTOA 1G6VK 4Y4FB 1R3HB 5IB5B 3OQ3B 2ZCKL 4LDLB 5I74B 5BXFB 1ETZA 2UY6A 1OVZA 3LIZL 2IBBA 3O9WB 4WUKH 1WCQA 2BSSB 1DEEA 3ZE0F 1HILB 1RIVH 2X1WL 4JFDE 5HYSG 5SWZE 3E1F1 3SQOL 1I8MB 1MELA 5GGRY 4JZJA 2KZ1B 4E0RB 3TBTB 3C9NA 2VH5H 2QADC 2EICA 4H25B 3C6LB 4JCLA 4HIEB 4ZUUB 1OWRM 2FHBA 2Y6SD 4XMLH 1NBZA 4YHKL 3NIFF 3VRLE 2JCCB 5C0JB 1C08B 1U8IB 4ODVL 1XGQA 1MLCB 2W9EH 1A7OL 4LIQE 4EZMA 5JXAL 2H1PL 5D5MB 1YUHA 3MRPB 3ZHKA 2XA8H 4EN3C 3N1FC 4NO2B 4BELD 3KWWA 1NC4B 4YX2L 1WAAF 1J10A 2JJSC 3MFFA 3FQRA 3S34H 1A6AA 3PNWA 5J1SC 5CSZB 1PG7L 5C0CA 1FGNH 2IPTL 1IAOA 4MA1B 4IEFB 3ECBA 1HYSC 3F12A 4KROC 4NRYA 3ZKSD 5TH2A 3LS5L 1NCBH 3GMQB 4OCLC 1K4CA 3MNWB 4HC1L 2ZOKB 4ZAKB 1RUKH 2RB8A 4EUPB 4LLMB 5CEYB 2FWOB 3ULSB 2VLJA 1OTUC 2I60H 4LCYA 5CJOH 5E99H 2Y5TB 1A3LL 3N9GL 2V2WB 3L1OH 4OT1H 5DFVD 2W65B 4LCWA 3MRLA 3TYGH 4HS3B 3JWOC 1MCQA 2BOBA 1UYWL 3M1BB 4PY7A 1MHCA 5D1XB 5JUEL 2E9WA 1R3LB 5T3XD 4R90H 3RJQB 2ESVE 4RMWA 1F6LL 3CH8A 1NUFA 4P4RA 3J8F7 3O45B 3RVVD 3LQAL 2ZSWA 4PJCB 3VD3A 4I48A 5J6GB 2ADJB 2LFGA 2C26A 1ZLWH 3FAWA 2BK8A 4GAJL 3UTQB 4LEXL 2R2EA 5CHNA 1DR9A 3EIFA 5EORL 2BDNL 5H94B 5CD5C 5KW9L 3MCLH 2BVOA 3LZFH 1ORSA 1F11A 4BA8A 4ELME 3GRWA 4YXKL 3QNZA 1A9EA 4JRYA 5FIEA 3RVUD 1BECA 1I8IA 2CRIA 4GMSH 1E4WL 3LEXA 5JLZA 3OR7A 1HSBB 1G0DA 4WI7A 2WINB 2XG5A 5KSBA 3RVTC 4WEMB 4L3CB 5FA4B 5IOPA 4NO3B 3WSQL 4U6HA 1HQRA 3HMXL 1FL3A 3WBDA 5EN2A 1KIPB 4ZTOH 4KKNA 4PRPE 1HINL 4LPUA 1HEZB 3P3YA 1YEHH 1FBIL 1MWAH 1MY5A 1UH2A 5CP3A 1OP5K 3VI4F 2EDLA 5D1ZA 3OPZL 3BN9D 4JO2H 4G43A 4NRXA 5TJWK 2FLBT 3UTTB 1GOHA 3HI5H 4KKBC 1T0NB 5MEND 5CS7A 1MNUL 1CE1H 1EFQA 4GBXB 1HN1A 3CVHL 1GHFH 5FOJA 3C60A 1YJDL 4S2SB 1NEZG 1OAUL 2VJXA 4MA3A 4OD3L 3HZMB 2IFFL 1JNHB 5DK3A 1MLBA 3TV3H 3KPSD 5C0GB 1HHGA 1G7LA 3GHEL 1Y0LA 2DQIL 1ZS8A 2DQHL 3D9AH 4PTTA 2G2RA 4RGOL 3ZDYE 1ZKAA 3NCFB 4HWEH 3R1GH 5K9QG 1DL7L 2R1XB 3TESA 1QR1B 2UYLA 5I75C 4RCAA 3SGDH 3ULVH 1AI1H 4DAGL 2F53A 2UUDK 2A6KA 1GC1C 1GZPB 1CYGA 4HLJA 3KJ4B 4PRAB 2X1XR 2JKXA 3GJFH 2NY3C 1RZKH 3LD8B 4DEPB 3DX9B 4LQ1A 5JHDA 2R0LL 3SPVB 3UPRA 3QFJB 4ZUVB 1XH3A 3NIGE 5DHVA 4Q2ZA 5DJXB 1PQZB 4FQJH 4G6KH 5T3XE 1EGJL 3LDBB 1P9MC 3GIVB 1QFOA 2WQ8A 4RFEA 4NN6C 4XP9H 5GPRA 3JTTA 2AI0L 4MQXC 2DLIA 1P69B 2BSTA 1KTLB 4FZ8L 4J8RA 1RUML 2EDDA 2YA1A 2BERA 1OSZA 4Z7QE 3BOVA 4P2QB 3B2UD 4ZS7L 2FBJH 2CUMA 1X5JA 2FZ3A 1JF1B 3NAAL 5EU6D 3RP1A 2Z0BA 4LU5H 2LTQB 3T0EB 1DLFH 3WIHL 4K94H 4KUCF 1T2QL 5IB3B 3WJLC 3DVFA 4OZIE 4G8FA 5MERB 1BMGA 4HWBH 1JK8A 2OZ4A 2VERN 3PWPB 1K85A 2O61B 2Z35B 4UV7H 5EO1B 2VQUA 1DUZB 1MHPH 2DF3A 5EOQL 4IHOA 5SWSB 3VFUA 4O58H 5HPMA 1OY3B 4HGWA 2BOCA 5C0FB 5E6IA 1FRGH 1EFXB 4CJ0A 5T3ZD 1Z6JT 5MENE 1C1EL 5CEZL 1Q1JL 4YQXL 3O6FC 1OGAB 3E6FB 1SVCP 2V7HA 2LV4A 1R5VA 2B8OT 3NZ8B 2PXYC 2Z9TA 3KPSE 4OJFH 4HMCA 4I3SH 2Q6WA 4ERSL 2UZYB 5DWUH 1WBZA 1KV3A 5FYKH 2BRRH 3BHBB 3CSGA 3WXWL 4JDVA 1MCIA 2WIMA 5GS0L 1YNTB 1T1XB 2G60L 3STZA 5KSUB 4RAUB 1ZHLA 3SY0B 3MLRH 4QRQA 3ARTA 3FB8A 4U6VL 1E28B 1ES0B 3F8UB 3MRFA 5CD3A 1N6QH 2E6JA 3JVGC 5F44A 4JFHD 3UZVB 3WKML 3VXQB 1FNEB 1B0RB 5C9JB 2DL2A 2EO9A 2OL3L 2NY2C 4UZGA 3ULUD 5IHBA 4TNWK 5FK9A 5CCKL 4Z0BL 4G7YL 1JRHH 3OKOB 4HGMA 3HG1A 1CGSH 4Q97A 4MD0B 4JM2B 1UJ3B 5B4MD 4PGEB 1VPOL 3DJ9A 1CFTA 1MJUL 2WW8A 3KLSA 3BWUC 2R1YA 3VRJA 1IAII 4F7EB 3MRCA 4GLRH 4OLWL 4YJZL 3HUJB 2D9QB 5LXGH 4FG6C 1UACL 4OD2B 2WBJA 4GRLB 5DLML 5TGBB 4EBQH 5K59E 1T20B 2NY5H 3GSOA 5EU6E 2YUVA 3MJ9L 3C8KB 5FO7A 4WWKC 1A6WL 4KI5D 5FGSA 5BO1L 4OUUB 2HKHL 2VDNH 3WIFB 3OXSB 4X9HA 2UVEA 1HCVA 1BQLL 4MVBC 3FN3A 3MTRA 2AK4A 5CFHA 4EOWH 1JNNL 3PIQB 5ESVA 3TO4B 5I1KL 2V9QA 5KAQG 1LE5B 4HUUA 5I74C 4Z7NE 1DQLL 4BH8A 4CN4A 3VFPB 3O9WC 5EBLA 1XGUB 3L3OB 4FFWD 3BJ91 4XZUA 4HFWA 2DQDL 3PJSA 1EAPA 3EDDA 2NLJA 5T3ZE 3NFSL 1T1WB 2CSPA 5GGTH 5E4IA 4ELMF 5C0RL 5DJAA 1LK3H 4YGVB 1RZGA 4UU9B 3O41A 4I3RL 1WBXB 3U36B 4R26L 5D1QA 4G42B 1C8PA 3MRGA 4ZOAA 4QYOB 4LP5A 2VIRA 3U7AA 1A02N 2DMCA 1EJOH 1U6AL 3CFKB 4FQLL 4GG8B 2C1OA 4WU7B 4PBXA 4ZMAT 3IVKA 1NCAL 3TT3H 4ZFZB 1EZVX 1OLLA 3DYPA 5HGDA 4MS8C 1I1AC 4P2RB 3RDTB 1NCWH 5EU5B 5TDPA 1CLCA 4IOSD 1MWAB 3UJJH 1L0QA 5E95B 4X6FA 4YC2B 4Y1AA 4NQVB 1A14L 4JFHE 3OKEB 4Y2DD 3SO3C 4K71B 3WHE0 4YHYB 1K5NB 3CFCL 4IBLT 5F7KC 4MA1C 3CDYA 1C16B 4KKCD 2A73B 3RWGB 4NQCB 5GGQL 3ULUE 2E7HA 1YN7B 1I4FA 4KQ3L 5C0CD 3VFOA 1G7QA 3CUPB 2DI8A 2HLAA 3FZUD 5AAMA 1UVQA 4AIZA 2BY2A 4P5TA 5EBMA 3BEWB 2PYEA 3WFHA 2ATKA 1L7IH 2YK1L 3QCTL 5EU3A 3SDCC 3EW3B 3KYKH 4WI9A 3VA2C 1JWUA 2XIDA 3O2WL 3WE6B 3VFMA 4XCFH 1CLYL 2HAZA 3IJYA 4KI5E 2H3NB 1U0QA 4YBQD 2X09A 4NQTA 1CZ8H 3QQ3B 5EO0A 1JHLL 4D9QD 3SDXF 2ENYA 3BZ4A 2AGJH 4QHNB 2DM2A 5AUMB 5GRUL 1JHKH 2Q87A 2PTVA 2F5AH 2IADA 1VFMA 4Z5RA 2AV1A 4MNQA 4ZO7A 2AJYL 1UG9A 2ICWA 5HGGS 3WLWC 5DUBA 1GCFA 1U95B 2GHWB 1MCKA 1MAML 5T1LD 5CJ5A 5T1MA 1CDJA 2FECI 5GSRA 4Y19A 5CBEB 1QLFA 5HHOD 5L2JB 3O4LA 4M5ZL 3T3PF 3FB5A 1YEEH 2HVJB 4QXTA 4OM0L 1J0JA 3QIBD 1KJ2H 4OZIF 4U1JB 5E2VL 1T4KB 2VZ3A 4NQDD 1TMCB 2P7TB 5C6TH 4P5KB 3MJGX 3KDMA 4APQA 5I0DA 3U0TA 4YUEH 5C70A 4AM0A 4PGDA 1CLZH 3TN0D 1UWEH 1A1MA 4BUHA 1M7IA 5E2UH 1XGYL 3SDDC 2AERT 3V79C 3HAEB 4JFEB 2XY1A 2ZJSL 4HH9B 4CVUA 2LABA 1NAKL 2AEIT 1UQSB 2FX7H 3TIEA 2F58H 4L9LC 5D7JC 1B0GB 4OM1H 2EYTA 3IKCA 4F7CA 3MRNA 1N3NB 3QUML 5DVMA 2Z31A 4OGYH 2MCG1 4KK9D 5IB1B 2GTWA 5CBAA 1UM5H 4QOKB 1MH5A 1T22B 4N5ED 2DQFA 3DMMA 5C0CE 4Z7WF 3QULA 2J88H 4BUGA 2VR9A 3QIUC 4N0CC 3V6OC 1MIEL 3MRBA 4ZYKB 4RFOH 4RFNC 1QFWL 1U3HB 5HHVH 2D7TH 2P8PB 3WIIL 2VN7A 5KS9A 4R97B 1GAFH 4QRUB 5EZOL 5B3JF 3F5WA 3WYRA 3A6CH 2B39A 3X13B 3IKKA 3T2NH 1TITA 1BVKB 3EYFB 3LDBC 5C07A 4R4BA 2CIIB 4KJYB 1JIBA 1BAFH 5KSVB 4NHUB 2RQ8A 2CDEB 5DT1L 3TBSA 5F72S 3H42H 1LO2L 4LMQE 4OAWA 3DVGB 1RZFL 5DRNA 1ZGLB 3C2AL 2YSSB 4HH8A 2X4SA 2XKNA 3V95A 5ID0A 4Z0XA 1CXKA 3KXFD 3O6KL 4X5LA 4TQEL 4X5XB 3T0EC 3R06B 3QIWA 3C5ZB 3H8NA 2OSLA 5ACMA 4XVUD 3KPPB 3LEYL 5HHOE 2B0SH 2IAMB 4ODHH 1BZ9A 4OI9A 5BMFH 3C08H 3AU1A 4G8EA 5BS0D 5DD5H 5C0BA 4DGVL 3BP7B 1DQQA 4F8TA 2RCSH 4NQDE 4JAMA 1FP5A 1U41A 4F33A 4P4KB 2XQBH 1JNLL 4NGHL 5DXWA 2ADGA 5IEKB 4MJIA 1JZ4A 5GGRB 4H0IA 1JPGA 5IVNA 1H3XA 4OSUL 2MJWA 3QEQD 3I6GB 3VE0B 4DKEH 2AAVA 4DGIL 3HRZB 2VLRA 2VOTA 3VXUD 3FQWA 4LPYA 5DJ2B 1JYNA 4R3SB 2JIXA 4JHAH 2FHFA 3BH8B 4AIOA 1OAZL 3MODH 1BZ7A 1WGOA 3MV8B 5TE4H 2ICEA 3SCMB 4N1CA 2WLYA 1J8HA 1WV7T 5D9SA 3IDXL 4HUNB 1F58H 1RZ7L 1TQBB 4WY7L 4F57L 1FN4B 4JN1L 5CEZD 1VESA 3EOBA 4K3EH 2NXYC 4IOFD 4FQ1L 1MI5A 1AHWA 1QRNA 4PRHA 4PJ7B 4WI6A 1CFSA 3Q6GL 3BE1H 4WGWB 1U91B 1NBYB 2YPLD 2YZ8A 1T0MB 2XYCA 4X4YB 3MCG1 3HLAB 2F53E 5E8NA 4YWGL 3JWOL 3RAJL 4KHXH 1AC6A 4BH7A 4NNYB 5JXEC 3REVB 5LQBL 2C3GA 3VXMA 1UCBH 1JFQL 3BQUD 4HCRH 5EOCL 5FM5M 2FDBP 2UWEB 1NMAL 3MLYL 5C0NC 5KN5A 4P57B 1AFVL 3MJ7A 2EE3A 1KN4H 2E8YA 4F80A 3QDHA 4OZHF 4BQ9A 2YN5A 2R56L 4E5XA 4F15B 1T80A 4RX4A 3IETA 2OJEB 1LVEA 4XMKH 2ERJB 3KXFE 3FO2B 4PBVC 4LPWA 3SDAB 2BMKA 4UT9L 5C71A 4XNMB 4MD5A 5E5UB 1ZT1B 1IGTA 2H41A 4P23D 4C83B 5JA8B 4D9LL 3QDGB 3L3KB 1KPRA 1T1YB 4KI5F 3U82B 5BS0E 1YYLH 3B8YA 1Z2KA 5DVNA 3I75A 3G5ZB 1CL7H 4QTIL 4YHML 3X12B 3IXAA 1RU9L 4G3YH 3WS6A 2A83B 3DURA 1S7RB 5AEAA 4G8GA 2YMXH 2OTUB 3QEQE 4CN6A 3D48R 3PUCA 1T21B 3HI6L 3EAKA 1CDBA 3NA4A 1FL6A 3MCKA 1S7TA 1I7RB 3VXUE 4P48A 2D4DA 3V6ZA 3VFGH 1E0OB 2ZKHH 3U7YL 3EOTH 1FZJB 3IAGC 1TJHH 3MGTA 5IV2A 4AEHL 4QY8B 3MLVH 4YHPB 3CPLB 3EYUH 5CAYB 5D1QD 5EOTB 3KNBA 1IKNC 3L5XH 1OOAA 3RIFF 5E9DD 1I8KB 2OM5A 3S5LB 4Q9QH 1KJ2B 2HJLB 1JPTH 4Z7VB 2AEQH 4MAUL 4OFYA 4LMQI 3IDJA 1QSFB 2YPLE 3SQBA 3BRFA 1GC1L 2XTJB 4M7JH 3T8XB 5KVGL 3L9RB 5F7HA 2A6JB 1NBQA 3MRRA 5TF0A 1BJ1J 4YHYC 1ZLVK 1JYXA 5F9JA 1RVFL 4JPIB 5D93C 5J12B 4OCNC 1FVDA 5IFHL 3GMPA 1IGIL 5L2KB 3DOSA 2EE9A 5D2NB 3HPJB 3B9AA 1KB5B 4JO1L 4RRPG 1EH9A 2NW2B 5IP4A 2BNRD 5D6CA 5K9KA 2WBKA 2NY4B 4A6YA 1V8HA 4X0KB 4JFZH 3OKKA 4P9MH 43C9B 5K9OB 1S7WA 4RNRA 5B39B 3KHQA 4R4ND 1NKOA 1OP9A 4U1IB 5FYLL 4N0UA 3U83A 5HGBA 2WWKO 2W9DL 1F4YH 2HT4C 1XF3A 1FPTL 3D39A 4XC3L 5C08B 5F1KC 4PRID 3DETD 4DKAA 3ZTNH 2PYED 4HDIB 4M1GL 4I3GA 4RGND 3VCLA 3BH9A 3UTPD 1JMXA 5C8JA 1MCPH 4MJ2A 1HHIB 5ALCH 4F7PB 2VDQH 2DTSA 4NUGL 1BGXL 1WEJL 5EZIL 4D8PA 3HC3H 4HK3N 1CF8H 2BHUA 5IBLC 4MCYA 1DANT 1RZKC 4MCZA 5BOZG 3NFPB 4E42A 1JTOA 1REIA 5EPMB 4MAYC 4PRDA 4F37K 4ORZC 4HJ0C 1D6EB 3KPQB 4QRTB 3FN0H 4BFGA 1NGPH 1MJ8L 4MNQD 4A2MA 3OKMB 5F88A 5A16A 4JO3L 3SDYH 2ZUSA 3I3EA 1T5WA 2HRPL 2OI9B 4QHUB 4IIQA 4GQPH 2Y07L 1FFNA 5HI4C 5ISZD 4Z7WA 1RURH 4KK5D 3V4UH 12E8H 4K94C 2CIKB 3EDFA 7FABH 1OARH 1WZKA 1I3UA 4M9OA 5FF6A 5DO2D 5C0EB 2OLDA 3CH1A 4O2FA 1A3RL 1H3GA 5JIIA 1YMMB 5ABDE 2KBGA 5FB8A 1CD8A 4HK3J 3U0WL 4KKAC 5IJKA 5IR1B 1SM3H 1BBJB 1YY9C 5L8LB 4KK6D 1NGWB 4D3CH 4DFHA 5SV3A 4YXLH 3L3JB 2ZCLH 2O5ZL 3ORJA 1F4WH 5GQBA 5M95B 5K9JL 4JY4B 5FUOL 4ONGL 5DJ0A 3QXAA 4RBPH 1ZSDA 2WIIA 2IPUG 4P99A 1QLRB 3K7UA 1A7NL 4HZLB 3QO0B 3ZDXF 2BNRE 3P4NB 1AY1H 3OF6A 5CIPA 1UENA 4GRWH 1B0WA 2VC2H 4LSPH 1UZ6F 3ARBD 5HXMA 3FQXB 3DMMD 5SX5K 3U4AA 1W72A 4UINH 3CC5B 1F2XK 3NFNA 3ARDD 1JZ7A 4DN4H 4L29A 5J89A 4RAVA 4UTBL 4K7PY 5ICXB 4PRIE 1IM9B 1P2CB 2EIDA 3GSRA 5IF0A 1MCLA 2PYEE 4U1NB 4RGNE 3UTPE 1BVLA 1I3RA 1DBMH 1GGTA 3FQUA 4O51A 3IFOB 1ZANL 4KJWC 1A1OB 3PP3H 5HHXH 1KPUB 2A77H 2NYYC 2VWEC 3K2UH 2CDGA 4M1CC 5CKAA 4JVUA 1KPVA 3NACH 1I1FA 4OTXL 1MCWM 4ZXBD 3WEXB 4WNQB 4XCEB 1IGJA 3OKDB 2AEPH 1D6VL 2FL5B 2P8LB 4M8VA 2AABH 3G6AB 4OCWL 5J6HA 1FFQA 1YZZA 1P7QA 5BXFA 2EH8H 5A40E 3P30L 3L5JA 2CJUL 4ZDHA 1JF5A 4MNQE 2NTSP 2KH2B 3MLTA 1MRCL 4N8CL 4BKLA 1A22B 2IAMC 3BGMB 1P53A 2NY5C 5JMRA 2NR6C 5L9DL 2J8UA 3TBVA 5ISZE 4YHZH 1SJXA 3C6LA 4X7DC 5FDWA 4HIEA 3JUYA 2APTA 5J1AB 3O4OB 3KYMB 5B8CA 2QADD 5IUSA 5HYQB 5C0JA 3TNMB 1WF5A 2DMBA 1IE5A 3TPUB 2J4WH 3P0VL 4HXAL 2HFEA 3PABA 4OZFB 2J3SA 4UNUA 3ARQA 2IMMA 2CDFB 2A9NL 1NC2A 1RD6A 1QSEA 4MNHB 5AYQA 2Q8AH 4EN3D 4J3UA 3A6BH 4XNXH 2EXWD 4R7DB 1F5WA 2MSPA 4YDJA 4K3DL 3N1PC 1TZIA 3ROOB 4PJBE 3RGVD 3E3QC 2VDMH 1CT8A 1RI8A 4EI5C 1ZE3C 5HYJB 1CU4H 3T1WA 1S9WB 2NCMA 5I18L 2GITB 3DX7B 4LIQH 3X11A 5EUOA 2G9HB 3EDJA 3ZT7A 1MI5D 2VKXA 3GIZH 4NZRL 2ZOKA 3IDYB 3S4SA 3VFWB 2YD9A 5CEYA 4CRPA 4WW2F 3NCYS 4YDLB 3BPOB 4F9PA 4JKKA 4X4MA 1H3TA 2KQMA 1DLHB 1RUQL 2WWMC 3PWLB 4U0QB 4M61B 1WK0A 4M6ML 4J3OC 4ETQB 3MLUL 4MWFB 1IARB 2EXYD 5DVKA 5IBTH 1OQOA 4PYGA 3O45A 4E41D 4PJCA 2HKFH 2ADJA 4PJXB 5F89B 4MJ6B 1T66C 2AJXL 1CICB 2DQJL 5BVPH 2CLRB 4M62L 4RX4D 1CXEA 2OK0L 3QRFM 4OF0A 3OGOE 2GUOA 5F1IA 1I3VA 4TVPD 3QI9D 4B41A 1A6TB 4MA7L 3PHOB 3UO1H 1IL1B 4I0PB 2Q86B 4ORGB 5CJXC 5I73C 2WINA 2DB8A 2R2BB 4OLZH 4K23L 5BVJB 5FA4A 4HLZH 3WD5H 3LEVL 4M3KB 3F58L 4Q58C 2FGWH 2VSCA 5HI5D 1HEZA 1KCVH 4ONFL 3MRDB 1YNLH 5J9PA 3JTSB 2E9BA 2ITCA 2JJVA 2HYMA 3ME0A 1KCSH 2X4NB 3H9HA 1K6QH 4YPGA 4GBXA 1NLBH 3VWKC 3NABL 4HBCL 4KQ4L 2HT2C 3GGWB 5DD0L 1ITCA 4OZGA 1KLUA 1MFAL 3PGFL 1T2JA 4IDJL 4S1DC 1IAIH 5F1SA 5EWIH 1J8HE 2B1HL 1NAML 2QLVB 3HNSL 2PN5A 5LWYH 4HWZB 2UZIL 3KPRD 4EVNB 4M7ZC 1GXEA 1FNGA 3T1FA 4X6DB 4PYHA 4RISH 1DQDH 1MI5E 3VFSA 2B5IB 3OXRB 3T65B 3RUGB 2R29L 3HE7D 4HC1A 3SJVD 4M1DH 3V6FA 5FGRA 2BFVL 5GRZA 5J12C 1GZPA 1A64A 5JQ6L 1U3JA 2V17H 4HX1A 5E08H 5D2NC 5CZXC 3H9SB 3MJ8A 1EX0A 3MLXH 2ICWI 2NY4C 1OP5H 4HUVA 3QRGH 4U1KA 1U36A 1BJ8A 2AJVL 4XBEH 1J1XH 3FT2A 5D2LB 2BNQA 2IPKB 4Q9RL 4GAGH 4E41E 1HXYB 5T1KA 3U9PL 4WI3A 3DIFA 2Z8WC 3BMWA 1WUNT 4BQ6A 2XI9A 1ACZA 1SHMA 3E2HC 4D9RE 4Y16B 3AB0B 1TENA 2R0WH 4MQXD 4P2QA 2FB4H 3NIDE 4GW5B 4MNGE 4P2OD 4WV1A 3S4SG 1I9JH 1GJIA 1JF1A 1EHAA 5CILH 1PG7X 3BXNA 2BSRB 4OLVL 4TVPE 35C8L 4LLVB 5BZDB 4MXWL 5JR1L 1KCUL 3RWCA 3BWAA 3PV6B 5GIRB 4AH2B 4DVBB 1OP3K 1QLEL 3UC0L 5MEQB 1VACA 3TJHC 4U6YB 3WFBL 5FA3B 4EI6A 1I3GH 2IPUK 5CP7A 1JTTA 3DVIA 3H7BB 2FLRT 3QXDB 3HMXA 2GKIA 3TT1H 2R39A 5SWSA 4L8SC 4PJ8D 3J7HA 2OI9C 3C5SB 3KJ6H 1RIVL 1QOKA 1IGMH 1EFXA 1ZA6B 3ARYA 4GRMB 1CQYA 2XZZA 4PJAF 4K07A 1L6XA 2VE6B 5EFIB 4IRJD 4LNRA 2VH5L 1FV1A 4I0CC 3EGSA 3CVHA 5D71H 3H3PH 4U05A 4XMLL 4K3GA 1RV6X 5F93C 4IS6B 3KPRE 2QKIA 5CLWA 2W9EL 4XPAH 4JFQB 1B3JA 2IALA 1YNTA 2HRLA 2XA8L 1AQDB 3BUYA 3IF1B 4JDZA 1XIWA 1PVHA 3Q0HA 2CXGA 4QCIB 1MJ7H 3SJVE 4PGJA 2EDHA 2HFFB 5BV7B 2VLKD 4JHWH 2XRAH 1FIGH 3P9WB 4FHBD 1WT5C 4MDJB 1S9XA 1K8IB 3BMVA 3S34L 2IANA 1B0RA 2ZUUA 1CFQA 3FTGB 5ETUB 1FGNL 3CFDB 4OUOA 4R0LB 1LEGB 4MSWB 1AKJA 5JPNB 4L4TA 5JW4N 4JM2A 1EGJA 4PGEA 5J06A 1ITBB 1NCBL 1NFDF 4FXLA 3S35H 3A67H 4LLUA 5L8KB 1RUKL 1Y6NR 3HUJA 1AO7A 3MV7B 2I60L 4O2CB 4GW4A 3RX8A 5CJOL 5E99L 2BC4B 1Z3GH 3L1OL 4M00A 4OT1L 4HS6B 3MOQA 3OKNB 4TTDD 3TYGL 5JIKA 3P9MB 1RIHH 1NCCH 4OUUA 3FT3B 4WGVB 3R0MA 4U1MB 1OAKH 3Q5OA 4R90L 3VGAC 3FONB 2VABA 3EKCA 3FQTA 1PKOA 5CSBA 5ESAB 1D9KB 1DTUA 1JWMA 2MWCA 4RWYH 1A3QA 3G04A 5TQ2H 3IJSA 3WHXB 1KACB 3CDCA 3QWOA 4MVBD 1HNGA 4H26A 4NQXB 3KPNA 2FEEL 2DLHA 4Y4FD 3OHXB 1F42A 3MCLL 4RMVA 2B1AH 3LZFL 6FABH 3O9WD 4HIHB 1UM6H 1NDMA 4GMSL 1ZVSA 3CSYA 1YPZA 3GB7B 2VZTA 5GSVB 2XICA 1OGTB 2X4TB 1UZ8B 1KJMA 1UXWA 3O4OC 1F8TH 4I9WD 3C6LD 4YDKH 4J4PD 2VO5A 4NKDA 1N26A 4CVZA 2CRYA 3BKYH 4ZTOL 3KR3H 5GGVH 1YEHL 1MWAL 4CAGA 4JDTH 3CU7A 3D87B 5JIHA 5IESH 1X5AA 4TUKH 4JO2L 4ODWB 5T3ZH 1LQSR 4TTGA 3HI5L 1OD9A 5FM5O 2GYSA 2FJFB 4HKBB 1LK2B 1CE1L 1FFPA 5D7LB 4ZFOL 2JB5H 2DJUA 1NC4D 5C9KA 2VL5B 2YD1A 3GSNA 1HQ4B 3BAEH 1IQWH 3GSWA 3LKOB 1LP9E 5CKGA 2AXJA 2G5BA 1LWRA 3GMMA 5FOBB 1A1NA 3TV3L 5C0DB 3D2UA 4LHUB 3ZYJA 3LMJH 4NQCA 4GXVH 1TNMA 3BT2H 2OL3A 3D9AL 2VISB 2GT9B 4HWEL 3R1GL 4P3CH 3KYNA 1GOFA 5T5FH 2P5EB 1XCQA 3CIQA 4LGPB 5HSFA 5ANME 1I8LA 4DW2H 1AI1L 4UB0H 2FR4A 3LKNB 1A9BA 4YDLC 4ZAKD 4R2GC 3TA3B 2VXVH 5FGBC 1YEGH 4Y5VB 3T2PA 2YD4A 3UYPA 1G7IA 2A2QT 2CKBH 2W0FB 2CXKA 1RZKL 1FLRH 2FHCA 5AD0B 1SYVB 4KV5E 3ULUH 1S3KH 5HHNB 2ICCA 2H3NA 1JHTB 3MJ9A 4XCYB 4PRNA 4M6OH 4FQJL 4G6KL 2EYSA 3IFLH 5I8KH 5D1XD 3QQ3A 2NZ9C 5FGCB 4XP9L 1JPFA 3ZHDA 4AG4H 5ACZA 4EKXA 2YEZA 3LN4A 3G5VA 3P40A 4IMKA 4UQ2B 3IU4H 4MXQD 4K3JH 1RHHB 4KDVA 2FBJL 1B4RA 2VZOA 4GOSA 3O3EB 1MCFA 4NYLB 1KCRH 4X7EC 4TULH 1DLFL 1X5IA 4K94L 1YEIH 1EDQA 4QRPB 3WLWD 3RIAF 3VWJA 1K4DB 1SJEB 4ZS6C 2PW2A 1T0PB 4LCIH 4HWBL 2J8UE 3RNQB 1CDCA 4I9WE 2KDGA 3GUTA 1FFRA 4NOFA 4UV7L 4P5KA 2JCCE 2W60A 4Z7UF 5BZWA 2ARWA 5F7DA 1QBLH 3CMGA 3RWEA 2R15A 5IK3B 1MHPL 1INQB 1BFVH 5BRZB 5HVHB 4RA3A 3RVWD 4O58L 4QNPE 5I66B 1P84J 3MRMA 2APFA 4CUCA 3ZKNC 3HAEA 1FRGL 5KSAC 2ENSA 5D5ME 5E8DH 5IMLB 1G7JB 1UB6A 2C3HA 3QUYA 3ES6B 3HZKB 3UTTD 2AXFA 1U8OA 3P4MB 3PG2A 1B0GA 4GBXD 3CAFA 1JWSA 2QBWA 4OJFL 1FNAA 5LKNA 4I3SL 4JR9H 3LAFA 5DWUL 4QOKA 2BRRL 5EU4A 4Z77B 1E6JH 2B5IC 2R4RH 3MUGB 1X4ZA 2JE8A 1AP2A 5IM7B 5EUOE 4ZYKA 1U3HA 5ERWB 4JN2B 4XPTH 5E8PA 3MLRL 4P59H 3BRGC 2AQ2A 2P1YA 2EH7H 1N6QL 3TCLB 1KEGH 1JGDA 1RJYA 4O4YH 4ZO8A 3K74B 1NMCB 2EEAA 1M6OA 5EA0H 2VQTA 5EUKA 2AQ1A 3QFJD 1IGCH 1JRHL 2HFTA 2X40A 3U4BH 1T89C 4U6TA 1CGSL 1IT9H 3SOBH 3W39B 1PBYA 4OB5H 3TVMB 3G5YB 5I1JL 2FX8H 2X4QB 1MFEH 4RMRA 4R96B 5F9WC 5I1DB 3AB0C 4NWUH 1ZGLA 1ZT7B 2YSSA 4PJCE 4R7NA 5E2TH 3TZVB 2QQNH 5BJTB 5LXGL 4P46B 5I1HH 5LGJA 3SE3A 1DDHB 3MGOB 1YC7A 2CR3A 4EBQL 2NY5L 4P2QD 3UTZA 1DVFC 2HMID 1JE6A 4LRIC 2W07A 2D3VA 3T0ED 2VDNL 5DD1L 3LKRB 1J86A 4YHNB 5DHYB 3QUZC 4FFYH 3ZSSA 3AFLA 3BP7A 4EOWL 4MXVE 1DQMH 3B9KC 2MQ3A 4QF1B 3MACH 3PWPD 5HJ3B 1BX2B 4QXGH 3ARVA 2LAGB 3LN5B 1Q9LB 5CJQH 5GGRA 4YAQB 3LKPA 1N4XH 3IDNA 3PHQA 1R5WB 5INDB 5SWSD 4KRMB 3HRZA 1HI6B 2BVEA 5GGTL 5DJ2A 3LY6A 1EFXD 2D31B 4R3SA 1BBDH 1LK3L 2W0KA 1J0KA 1KOAA 3V7AG 4IRSA 3EFFB 1A4JB 1NLDH 4WIQA 1OGAD 2Z8VC 3RWJB 3SCMA 3W11C 1TVBB 1EA9C 5IQ7H 3BZEA 2Q7YA 3IRPX 3VFVA 2E7LA 1EJOL 4C56A 3GNMH 1H3PH 4NFBA 2QQQA 4PJ7A 1JN6B 3TT3L 2D7OA 4PJEB 4YR6B 4DGYH 1IQDA 4YHOH 1NCWL 4XCNA 1MVUB 2ORBL 1ZV5A 3C2SA 3HAEG 3UJJL 4S1SH 2VDPH 4BSJA 1KJ3H 2HT3D 1F3JB 3RVXC 4X9GA 4LVNB 1R3KA 2OJZL 1TLKA 2P24B 5HY9A 4IJ3C 4RQQA 3MNZB 1KIQA 5IQ9B 2UWEA 1FDLL 3QFJE 4W4OC 1P1ZB 4UT6L 5HHQA 1YDPB 2VDOH 4UV4H 3U46B 1XF2A 5LGHH 1BP3B 5MHSD 1OHQA 2BNQE 4WEUD 3MRKB 4JM2D 4L8DA 1E4XI 2ED8A 5F71A 1MFNA 5E5RB 5TQ0H 1L7IL 4RGMC 1VGEH 5D7IF 3PGDB 3KYKL 2P49B 5C09B 4K2UH 1PFCA 4XBPA 4YFLF 5AG8A 4P2QE 3SDAA 4GRLD 4K7FB 4JFXB 4F9LC 1ZT1A 4XCFL 1O7SA 1PAMA 3T0EE 4WTWA 3V5HB 3QDGA 4KV5F 1WWCA 1PZUB 5DUMH 1DUYA 1T1YA 1CZ8L 3WFEH 4L4VA 3G5ZA 3X12A 3ILQC 3M17B 4L5FH 2IH1A 2AGJL 3MBEA 3BPNB 5J7CC 4QHKI 3TO4D 1JHKL 1Y18B 2F5AL 1R24B 5HDLA 1KF9B 4PJHF 2QHRH 4AEEA 3SKNA 3FO9A 5SWSE 1CXFA 4DK3A 2ITDB 3ZSTA 4F8QA 4TSBH 4JQVA 2JJSA 1CGXA 5DSCB 1YEEL 5CMAA 2XZCH 4WTZA 3RZWA 5GZOD 1OGAE 5DI8B 1KJ2L 4XH2B 3QQ9C 4HBQA 2OZ4H 4LHQB 5EOTA 4ZUTB 2VITB 3VXRA 5C6TL 3BZDA 3GSUB 4YXHH 4YUEL 4OD1H 1CLZL 1UWEL 1XEDA 5FYJL 4PGCB 5GRXG 2AKRB 1B9ZA 3LQZA 4WW1B 1X5ZA 5E2UL 3NMEA 1D5ZB 4ZPTA 3T8XA 2HP4A 2Y7QA 4H8WC 1NGZA 4P2RD 3RDTD 5FECB 2FX7L 1HWHB 4OIIH 1ETZB 2F58L 1JV5A 4ALAH 5CWSA 1FQ9C 1AGBA 3FFDB 4OM1L 5H35A 1DEEB 4PG9A 1TPXC 4OGYL 1KB5A 4G80B 5HPOA 4NO0A 3U9UA 3OG4B 3Q2CA 3FFCA 4UAOC 1UM5L 4JZJB 2Y6SC 4P5MA 5ICYB 5JW4Q 1PSKH 3ZKQD 4NQCD 5E2WH 3K8MA 4OLYL 2J88L 4LSRH 1X6NA 5MHSE 3QXVA 2YWZA 4U1IA 1NBZB 1BIIA 1PKQA 2BVQA 4L4TE 4RFOL 5HHVL 2D7TL 4Y5VC 3K4DA 4PD4K 5FDYA 3O6LH 4M7LH 3WV0A 2ICWJ 1XGQB 1GAFL 3HUJE 4HDIA 3I6KA 3A6CL 3GK8H 1HHIA 3LVEA 4F7PA 5D7KD 3KWWB 3ULVD 3T2NL 4LGRB 2BVTA 1DEDA 2RR3A 4Z7UA 5DC4B 4PG2C 1YYMH 4POUB 3HR6A 1DFBH 5GRVK 2OTPA 2YA0A 1BAFL 4HIJA 3MFFB 1PJ9A 1J9CT 2E5EA 4LLAA 1A6AB 2X4UB 3PNWB 1ZLVH 3H42L 4QRTA 3V0WH 5IVOA 3DSNA 4PRBA 1S7XA 3C09B 1IAOB 3ECBB 3F12B 1FG9C 2NTFB 3H3BC 4PLJD 5TH2B 4U1HB 3OKMA 2VXTH 3FKUS 1K4CB 2UV3A 3PDOA 2YD8A 3D85B 4QHUA 3K2MC 5DFVC 3WFDH 5GS1C 1LO3H 2VLJB 2DWEA 3RY4A 5GS3A 2B0SL 4AQ1B 4LCYB 4ODHL 1KT2A 5BMFL 3C08L 1YPZE 5DD5L 3UCRA 3V4PH 2HJKA 5HHPA 3JWNC 2XQYG 4WO4B 3GMOA 4LCWB 3MRLB 2RCSL 2BOBB 3UYRH 4PY7B 3UX9B 1MHCB 4MXVF 2XQBL 4NM8H 3QPXH 1FSKC 3ZMRA 1SJHB 1BBJA 4P4RB 3VDBA 1TTGA 4O02H 4I2XA 4DKEL 3V8CA 4I48B 3F6LA 3LKQA 3HR5B 2R2EB 4P2RE 1QNZH 5CHNB 4JFED 4JHAL 1UB5A 3RVUC 3FQNA 1ZLSH 3S36H 3MODL 4O2EA 2YD2A 1WTLA 2BVOB 4OLXL 1ORSB 1F11B 2EDTA 5TE4L 3QBTB 4GSDH 3QNZB 3QO0A 1ADQA 4RZCA 5L88H 1A9EB 4JRYB 1RIUH 1I8IB 4WTZG 1F58L 4NQSA 3P4NA 1M1SA 3JBG7 3I3BA 3LEXB 4K3EL 4NQCE 1P9MA 5JLZB 3OR7B 4J1UA 4QOKD 3W9EA 2P8MA 4YEFA 3BE1L 5KSBB 3I6LD 5EDXA 5IOPB 1L7TH 4RMUA 1HQRB 2GJ6A 1FL3B 3P2TA 3BN9C 2KPNA 5FYKD 5I6XB 1U3HD 3B43A 3ZYZA 2X1QA 4U1NA 4FA8A 4X8JA 4KHXL 3UEZA 3WN5A 5D1ZB 3FMGH 4G43B 5D7KE 4LP4A 3ULVE 1UCBL 1Z9MA 4HCRL 4JLRA 4FFVD 1LNUA 1KPUA 3MXWH 1Q72H 3C60B 3TVMC 5TE6H 4D0BA 2AXHA 5MI0B 4MA3B 1IC4H 3X3FH 1NUGA 1KN4L 1MLBB 1QFUH 1G7LB 4OV6F 2NY6B 2O5YH 2P8LA 2E27H 4PTTB 3EYOA 4CW1A 2EDKA 3MRHA 5IVXA 4XMKL 1GZQA 1X5YA 2I5YH 2DBLH 4PJ5A 5SX5H 5GGSY 1VHPA 4G5ZH 2F53B 2EEBA 3H0TA 3C5ZD 3O6FA 5DA4A 1E4KC 1CGYA 3V7AE 2WMPA 2J2ZA 4LPCA 2IAMD 3DV4A 1YYLL 1CL7L 5JHDB 2NR6D 3UPRB 1S5IH 2ZOLA 3KYMA 4JGUA 1XH3B 5F6IB 4G3YL 3QNYA 5DHVB 3GHBH 3WNLA 5EC1B 4Q2ZB 3CGTA 4YBLB 2EC9T 4P4KD 5EZJA 4ODXA 2YMXL 1RJZA 3JTTB 4EDXB 3B2UC 4LSVH 2BSTB 2PO6B 3S3SA 4J8RB 4Q6IC 4B53A 3F6IA 1DBBL 3VFGL 1LEIA 4FTVA 2ZKHL 4FZEH 4JFEE 3EOTL 3JVGA 1NL0H 1TJHL 2FZ3B 2QSCH 3MLVL 3EYUL 3GMRA 1GGCH 1GGIH 3ROOA 3JUZA 3G6JA 3MV8D 3L5XL 3SCMD 4JGMA 3N1MC 4MQ7A 3RJDA 5HYJA 1N59A 1KN2H 5TFSH 4G8FB 4QOKE 3TBWA 1JK8B 1JPTL 1VA9A 1TVHA 2G9HA 4Y8DC 2AEQL 3LCYA 3OZ9H 3I6LE 4YHIA 2FIKA 1ACYH 1ZXQA 3QDJB 4M7JL 4KVCH 1DBAH 1B6DA 5FYKE 4LRNH 4LVNC 3VFUB 4OGXH 5HPMB 4HGWB 4NC1C 4N8VA 5E6IB 4WWKA 4M61A 4XTRD 4NDMA 1QA9A 3HN3A 3MNVA 5EIVA 4BFBD 4JFZL 4EQ2A 4ACPA 5DEZA 2V7HB 5BW7C 3DARA 4KWUA 3DUUA 4P9ML 1R5VB 1H3UA 3W9DB 5IB4A 1D7FA 1FORH 1F4YL 3SGJC 2Q6WB 4JE4B 4PJXA 5I1EH 2A6DB 2CLRA 3ZTNL 4JDVB 2VAJA 1ZT4B 2EZ0D 3EFDH 3UJIH 4Y5YC 1VFUA 3OKLB 1MCPL 4QTHA 1DBJH 5ALCL 2C3WA 2VDQL 3STZB 1SBSH 3HC3L 3MBXH 1CF8L 4XHJD 1ZHLB 3SDAD 4QRQB 3FB8B 1DE4A 5CD3B 3ULUC 1NCDH 2Q86A 3QDGD 3PWNA 1H5BA 2R2BA 1NGYA 5FK9B 4CMMA 4F7MA 1NBVH 3FN0L 3KPMA 3HG1B 1NGPL 2RJMA 2NY1B 5I0ZA 1CFTB 1Z9LA 3SDYL 2R1YB 3VRJB 1ZWIA 3MRCB 4XNZB 1BPVA 4JFPB 4KHTH 4YO0A 1D5BA 4D94A 1RURL 4KI5C 4LOUD 3KPTA 12E8L 2WBJB 1GGBH 4HKJA 3GGWA 7FABL 3HB3C 3GSOB 2GIYA 1OARL 1WZLA 5B38A 3DLQR 5FO7B 1K3IA 3MV8E 1X5HA 2I9LA 3R8QA 2F8VA 3RWDA 4KUZH 4Y2OA 1U2CA 2DQGH 4ZUWA 3H6JA 5FKAA 5MEPA 3WXVH 5HGAA 4GAFB 1KCLA 1SM3L 2AK4B 3E3QE 1MSPA 2JJTC 4D3CL 4NN5C 4PJ7E 4LVOC 1OW0A 2FO1A 4OZFG 3WL9A 4HUUB 4FQIH 4YXLL 4X6CF 3NGBB 3HPLA 4BH8B 1CFNA 1QSFD 4IMLA 2ZCLL 4M9PA 3SDCA 1F4WL 2XTJD 4XXCC 1J05B 5EBLB 4XZUB 4HFWB 3PJSB 1DCLA 2R69H 3UROR 2NLJB 3PXHA 5L2KD 1AY1L 4MJ4A 4HKXA 5DJAB 4K3HA 2VC2L 4GG6F 2J1KA 4LSPL 4GKNB 1F90H 2NY4D 4L3EB 3PP4H 2UWEE 3MRGB 4QT5A 3S37H 5CLTA 1AE6H 4UINL 3O3BA 3RHWK 1KC5H 1LO0H 4DN4L 4CVXA 4MQSB 2P5WB 2VIRB 1F3RB 1FGVH 2DWDA 2C1OB 2XQYK 4Y16A 4DVRH 2Y36H 5C08D 2F54A 3IVKB 1NSNH 1HZHH 3KS0J 3DX6A 5DJYA 5HHMB 2BSRA 5DJ8A 1CR9H 1DBML 1EHNA 4N8VG 5TDPB 5HHXL 4XNUH 4MDIA 1QZ1A 5DFWH 2A77L 1EEQA 3ARGB 3ULVF 1I7ZA 3K2UL 4KKCC 4Y1AB 1MAJA 4LF3A 3QDGE 4AH2A 1M05A 3RZCA 3KPOA 4JGJA 3NACL 3CZFA 4OCSH 2ATPB 1MRDH 3FZUC 2N56A 1EEZA 3WNNA 2AEPL 4PREA 2AABL 3H7BA 1I4FB 2DN7A 4JRWA 2EH8L 5ENWA 3VFOB 1G7QB 4HG4J 2HLAB 1UVQB 3SDDA 4KAQH 1MFBH 4P5TB 25C8L 5ESQA 3WFHB 2ATKB 5EU3B 4L9LA 5D7JA 4YHZL 1AQKH 2A9MH 1JWUB 3QJFA 4V1DA 5F7LB 5AYUH 4NZUH 4DUXA 3VFMB 3MV11 3P4OA 3IJYB 5KANG 2Z8SA 1QBBA 2YD3A 1YMMD 2J4WL 4LAQH 3QIUA 1OTSC 3V6OA 5EO0B 4WFFD 3F7YB 4QRRA 4GKSA 3IF1A 3OAYK 1OP3H 2AK1H 3KHOA 2IADB 1QSFE 3Q3GB 4LEOA 4Z5RB 1BOGB 2AV1B 2WUBH 2XTJE 4QWWD 3GSXA 2Q8AL 3A6BL 4XNXL 2ICWB 2XZAH 5DUBB 5E94A 1ONQB 4N9OB 1KTRL 5T1MB 3QP3A 4Y19B 1GRWA 5ETUA 4CU6A 1N7MH 1QLFB 2VDML 5B38G 1CU4L 3O4LB 1LEGA 3FB5B 1T6VN 3NCCB 3CJJA 4LIQL 2APVA 4GH7B 3AM8C 1V7MH 2H26B 2YD6A 4UUJA 3TN0C 1RFDH 2VZ1A 3GIZL 2VYRE 5I6XC 3MR9A 3V8OA 3KDMB 3I02A 4I4WA 4APQB 3U0TB 2J12B 4AM0B 4PGDB 5D1ZC 5C08E 5DD6A 3W2DH 1A1MB 1UWXH 4YIQA 2BC4A 1M7IB 4ODBD 5IKCA 1IM9D 4NIKB 5DD3H 5ADOH 3OKNA 1BQHA 3ZYIA 5IFAH 2EDJA 1I85C 5IJVA 3TIEB 2EYTB 3IKCB 4OF6A 5IBTL 1BREA 4N5EC 5EZLB 1MHHA 5ESAA 5HBBA 1D9KA 4NNPH 2Z31B 3CVIH 2GTWB 2HKFL 3U6RA 4WFGE 5CBAB 2LU7A 2DQFB 2YC1A 3G5XA 4KKLD 5BVPL 3QULB 2DDQH 3MRBB 4YLQT 4HWNA 4XPHH 4XMPH 2Q3AA 4HIHA 3VG0H 5KS9B 5LAXA 5CJ8A 3UO1L 5GSVA 4F58H 3QDAA 2X4TA 1JGVH 1QFWI 3BYTA 3F5WB 1H9VA 4PV8A 4QHKJ 2GSIA 1LO5A 2IBGA 1KXVC 3JWDH 4OLZL 4OF7A 4JREC 1UXSB 1T7ZA 3WD5L 5C07B 4R4BB 4MMXC 3OGCB 1KSRA 1O5DT 2FGWL 5HD8D 1YMME 3SKOA 3GKZA 3TBSB 1KCVL 2EIBA 5DVOA 1FAKT 5DRZA 1YNLL 4WFFE 4H8WL 4OAWB 3V0AC 4I2XE 5DRNB 4ZNEE 3NN8A 1KCSL 5DZOA 1K6QL 2FJFA 1AGEA 1XGRB 2QL1A 5ID0B 1NLBL 2DQCH 4Z0XB 3GSQA 3QAZB 5D96C 5JXEA 3QIWB 1VKXA 4MHHI 2OSLB 1VEMA 1ZMYA 1IAIL 3BO8B 1A6ZB 4WUUA 5EWIL 2QSTA 5LWYL 1BZ9B 4N0YH 1P6FA 5L6YH 4EIZC 5HYJD 5C0BB 2FATH 1FO0H 1SVZA 1XFPA 4NBZB 3QDMA 4RISL 1DQDL 1B4JH 3N1QC 4JAMB 4O00A 3OB8A 3LHPH 4M1DL 4MJIB 3QHTC 3LH2H 1JPGB 5E08L 5E6IC 2V17L 3LB6D 4X4XA 2W0FA 1J1PH 4LSTH 2V6HA 3BRDA 2DICA 3MLXL 2VLRB 1I1CA 4S1QH 3QRGL 3FQWB 1G9EA 3KAAA 4XCYA 2JIXB 4XBEL 1J1XL 1BZ7B 5F3HA 3I84A 1I9IH 2ICEB 2F15A 2UY7A 4GAGL 5E00B 1J8HB 5HYIA 5D9SB 4FQXA 1QBMH 3BISA 1QTYT 3UBXI 5F7UA 3EOBB 4PJGF 4WWID 2R0WL 1QRNB 2FB4L 4PRHB 1I9JL 3BI9X 1CFSB 3ARFA 1CICD 5GZND 3IDGA 5CILL 1XGTB 1QR4A 2FO4A 4EXPX 1PLGH 5JOFB 2C4XA 3TF7C 4U1GB