1F4YL

Crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
210
structure length
210
Chain Sequence
QAVVTQESALTTSPGETVTLTCRSSTGTVTTSNYANWVQEKPDHLFTGLIGATNNRAAGVPVRFSGSLIGGKAALTITGAQTEDEAIYFCALWYSGHWVFGGGTKLTVLGQPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY S-20-4, FAB FRAGMENT, LIGHT CHAIN
publication title Crystal structure of an anti-carbohydrate antibody directed against Vibrio cholerae O1 in complex with antigen: molecular basis for serotype specificity.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2000-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4yL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f4yL01
3WEXA 1N64H 4QT5B 5LVEA 4GRLD 1CDCA 3KLHC 5DMKB 4ZMAT 1RK1A 1WAAE 3O3BB 3VXNA 4F3FA 3MJ9A 2CUMA 4R4BA 2H1PH 1DE4A 3W0WB 3V4UH 2F9BT 1JNHB 5DI8B 5B3JE 3GKWH 3LKOB 2Y36L 4PJXB 2AI0L 4KRPB 3KJ4B 1KFAL 5IVXE 2NY0D 5B39B 1NCNA 2VH5L 4PP1C 2J6EL 5CD3A 1Z3GL 2GFBB 2PYED 3AS1A 1IAIM 1FNFA 1QP1A 5IV2A 3LD8C 1NUGA 3OXRB 1U9KA 1H3WM 2WIIA 3V6FB 1NAMB 1I9JL 3C09C 3R0MA 1DBBL 4FTVA 1BM3H 3N9GL 5HYJD 1LHZA 4G6AC 1QRND 3Q3GA 1U3YA 2DQUH 3HZVB 4ZSOA 5ALCH 4F80A 5T3XE 1S8DA 4MDIA 5D1ZD 2R29H 1X5FA 4U1IB 5CSZA 3IETB 3UO1L 1RZIA 4U05A 3CSYB 1RIHL 4R97C 5IFAH 1F3RB 2X4QB 1TIUA 4X99B 3S7GA 5I19H 4DN3H 5CLWA 1MCDA 3O3DB 3LIZL 2ZG1A 4PRPA 4L4VD 1OTUC 1ZHBB 4G80B 4W68A 5GS3A 3RIFF 3SY0A 1HHIA 4K94L 4M3JA 4P5TD 5T3XH 2QQLH 1DL7H 3K4AA 5IT2H 3L7FA 4GKNA 4KKLC 1IJ9A 4WI6A 1F3JA 4PUBL 1RAMA 1EZVY 2DBLH 3BGFC 4TQEL 4ODVL 3KPSE 5F7YC 1T03H 3HUJF 2C9AA 1J8HE 4WI3A 2D31B 4TNWF 4FFWD 5LGKA 4QRQA 1FL3A 3GEWB 2OTUA 2EE2A 1JZ6A 4NQDD 4N9GB 3ESVF 4M4PA 3LZFH 4JREC 3LQAC 4LK4A 1PBYA 3OAYH 4KHXL 3GSWA 1UWGL 1QHPA 3PWLA 1GH7A 3HE7A 5GS1A 2EDWA 5ITBL 1JRHL 3MFFB 1OGAE 1JWSA 3DX9A 1CTOA 3DO3A 4RAVB 5IBUB 1SYSB 3OSKA 1AD9B 4PG9A 4GQ9L 1O7SA 4YHKL 3E2HC 5HVHC 1G7MB 2Q7YA 1FG2A 2ZOKB 3NIFF 5I1DA 1NEZB 1KCRH 1P4LB 2DTMH 1HXYA 1UXSB 1BVLA 4LFHD 4HEPG 4FOMA 4WHYG 3CMOH 4U49A 1FSKB 5C71A 5T3ZH 1NJ9B 1BF2A 1IFHL 2P8MB 5HHNA 2RIKA 1OSZA 4UOW0 3QRGH 4EZMA 3WIHL 3UTSA 2DD8H 2XPGB 1ITBB 2AXFB 1V05A 1RFDL 3WFEH 4LOUD 1RUML 4H26B 1OM3H 3HNTH 3HZKB 3LPWA 4P23B 4LHUA 5EBWB 1ZLSH 4YDIH 5D7KE 2EZ0D 5C92A 1K2DA 3AAZB 3T77B 1ZS8A 1K8DA 4RDQG 1X5YA 1FFRA 4FTVD 5ESQA 5E8DH 3OAZK 3PUCA 3CH1B 4DW2L 1KCSL 4CNIB 4RZCA 1NDGB 2NZIA 1PG7W 4NT6B 4XPBH 1SBBA 4X7DC 4L8BB 5D7IE 4HDIB 4K7PY 2EDDA 1FNHA 2WP3T 5DQ9B 5DMJB 2XI9A 4BFIA 1HWHB 3RU8H 4UOJA 5I1HH 1N7MH 3S4SA 2FL5A 1EBAA 3DVGA 5KS9E 1CD1B 1S7QB 4PRPD 3PL6B 3VFNB 4UTAL 3GSQB 2PTVA 2XYCA 4HIJB 1OAQH 4OBSA 3UTQA 4A6YH 3LPFA 4WCYL 1HKFA 1KF9B 2EIZA 1JV5B 2B4CC 2CLVB 4HWZB 3DSFL 4L9LC 1SY6L 4YFLI 4DOHB 2CLRB 3KPMA 4JO3H 1NGZA 4WU5B 3IDIA 4RNRB 5J6HB 5IJKC 5AZ2L 1HHHA 3P9MA 3TNNA 5KSVA 2FYYB 4JFPA 3VRLF 4JPKL 4IS6A 4FQHB 2V2XB 4OLVL 1CK0L 4KAQH 1U91B 1FO0A 3NTCL 4G7VL 5HGAA 1R3HB 1H5BA 4LVOC 1AKJA 1IQDB 2FWOB 1FZKB 3B9KA 1RUQL 3GMRA 5JTWA 3N0PB 2CPCA 3FB8B 4DGYL 5CGMA 5GRXG 5IOPA 2C1PA 4R4ND 1VGEH 3D0VA 3VXMA 3DX6B 3KPRB 2O61B 4FZEL 3QUKB 1CD8A 4R7NB 2CKBA 4D0CA 1ZHLB 5IW6B 4NHUB 2G2RB 3EYVB 3BPOC 3NN8B 3T0VA 5FCUH 5F8RC 1T5XB 1RK0B 5D71L 4P2RE 5E1HB 5FM5O 2UZIL 3ZDZE 1RJLA 4YLQT 2PETA 1FZOA 3UC0H 3CLFH 3BRFA 5HD8C 4MJ5A 5EZOL 1NDMB 2BXZA 5C7XL 4RWHA 1J86A 5JDSB 4BM7A 1MUJB 1T21A 3QFDA 5J1AB 4TOYL 1H3GA 5CBEA 1CTNA 5E8EA 2X40A 3QDMA 4WI7A 4YHIA 2VYRE 1MCWM 4LU5L 3S37L 1OD9A 2G75A 1JZ4A 2ZCKL 3ZKMC 5C2BL 1I1RA 2XKNB 4AG4H 5KVFH 4MAUH 3O9WA 2AEQL 3WIFB 3JWOL 4OGAC 1KPUA 4ODHL 1CL7L 5C0GA 4PJ7A 2OZ4H 1UACL 5CGYD 4LLDB 5C9JB 1YEKL 2R8SH 3HAEB 4LHUD 4YGAB 3OPZH 1JRHI 3CC5B 3HI5L 5IBTL 1IBGL 5BZDA 3O45A 2HH0L 2X4UB 3TBWA 3IRPX 1NCAH 1ETZB 3K8MA 1VERA 2IQ9L 3OAUL 4R96B 4G8GE 1IGYA 3SE4C 3EDKA 2EEDA 5L0QC 3QUXC 3RIAF 4M62H 3RVUC 5J6GA 1D5MB 4QRTA 3X3GH 2HLFD 3OKNA 3QEQA 4P2QB 3SDAA 1IGFH 3QPXH 4HKBA 3U4BL 4PJBF 3EZ8A 1EHLH 1IGCH 2A77L 3BFOA 1G6RA 2Z35B 2VOTA 1WFUA 3ARGC 3NIDE 3VE0A 2YKLL 1Y6NR 3P73A 1KB5A 1HQ4B 4OF3A 4X5WA 4AEHL 1T1YB 3OR7B 3IDGB 3W5NA 3IDJA 4M8VA 2JIXA 3B2VH 4UQ3B 4CMMB 5E2VL 4LAJH 4X6FB 2QSTA 4HJJL 4JVPA 1F6FB 2DS4A 1RJCA 4TNVF 2FHFA 2B0SL 4G9DA 4H0GA 3VWKB 1PVHA 4CVUA 4OZIE 3BEVA 1RHHA 1UKTA 1BX2B 2ID5A 3O6KL 1L0YA 3QXDA 3Q5TA 2OMNA 5D2LA 3QDJD 4EDWL 4PGCB 2ZSVB 5SWZA 3TZVC 2BVOB 4NOBA 5LWYL 1AKJD 3B9KD 3MXVH 3RTQD 1NUDA 4BQ6A 5AG8A 4NKIH 3VI4F 2WBKA 3S6CA 4PRBA 3BDYL 2KQNA 5FGCB 4F37F 3NABL 3NIGF 1SEBA 3TYFA 5F1IA 4FQIL 3VXMD 5J57B 5GSVB 1F6LL 3WD5H 5E5MB 2H41A 1NCDL 3MV9A 2P5EE 5TH2B 1N26A 2YD2A 5BO1L 3VGBA 2PCPA 3ZDXE 4F9LC 4OI7A 1DLFH 2Z4QB 4RMSA 5D72H 4NNXA 2G9HA 4NN5C 2Y1VA 3QEUA 1W0VB 1R3JB 3TV3L 1C12A 1JJUA 5DR5H 4QHUA 5CCKL 4B5EA 2GK2A 4XCNA 1IT9L 5ADOL 5J06A 2AEIT 1DVFC 4G7YL 2YK1L 1AP2A 3T2NH 4URTB 4GXVH 5I17A 3QDMD 3BQUB 4HS6A 4QHMB 2LVEA 2YUVA 3QI9D 5SV3A 1U2HA 3O9WD 4EOWL 5L7XH 5J1SC 3EGSB 4QXTA 1UKSA 2ZUSA 1I85A 4PJEA 3WFZA 2P1YA 2AEWA 1UM5H 5EBGA 4EI5B 3KYMB 1KG0B 1OPGL 4M1DL 3VDCA 4JVUA 3V7AG 5B22A 4ZOEA 2VAAA 4WI9A 5F7NC 5E9DE 2OR7A 2V6HA 3MRJB 1U8PA 4LF3B 1FH5L 4LEXH 4WTZG 2OK0H 2FZ3A 4JRYB 3P30H 2FEDD 4KI5D 3JWDL 5JOEA 3DVNB 2R2BA 1ADQH 3QEQD 3RUGE 1FLTX 3VMOA 1I8KA 5CUSH 5DF0A 2D7OA 4WUKL 1QBBA 3CVHB 1BVKB 3O4LD 4D0BB 1CGVA 5H2BA 2I9LB 5HDBE 3VFPB 1R5IB 1T2QL 2YBRA 4N0UE 1QSFA 2XZCH 1ZLWH 1E28A 3DBXB 3TF7C 5C0BA 1DQJB 2JIXD 5DJYB 5F9OH 3HMWL 1MCBA 3VG9C 1GSMA 1CL7I 5EORL 2X4OB 5MP6H 3QQ4B 5E6IB 5L2KB 5EC2A 4EXKA 4ONHA 1VCAA 1JCKA 4P2OD 3Q0HA 3OZ9H 2HJFA 4M6MH 1R6VA 1X5IA 3HLAB 4YPJA 6FABL 1M7DA 4TUOB 1P53A 5JO5B 2R56L 3SCMC 2L7JA 4OD1H 5E6ZA 3CVIL 1YN6B 3BH9A 3AVEA 2HYMA 2X09A 2H2SC 4UUJB 2VN7A 1HYSC 4FQ2H 2LU4A 5ERWB 3H9HA 4N5UA 3BN9D 4LLMA 3RL1A 4E5XA 2CIKB 1CLOH 5HI5D 4WDIA 2RHEA 3I50H 1KIPB 5DS8A 4J3WA 4X80L 4OAWB 1WITA 3VH8G 1FHGA 4HC1H 3MV9D 1U95A 2HTKD 3HS0A 4NUJB 1ND0A 1S7WA 4S10A 5LQBL 3VFRB 5HXMA 2O5XL 3CX2A 2FBJL 1BZ9A 5JW5A 5BW7C 3KYKL 3RWFB 1CXLA 3HNVH 1RZFL 4PFEA 3H9SE 2VLJE 4FNLL 4J3OC 5DD0L 1ZLWK 2BDNL 3BSZH 4P5KB 1NSNL 1NGWA 3UTZA 4PB0L 4TYUA 4PV9B 4LQ1A 4YDKL 4YPGB 5I2IB 2LTQC 2F58L 3MUZ1 5IHZB 1TJGH 2JELL 2VR5A 3PDGA 4JDTL 3S36X 2ICWB 2JJSC 3L7EA 4KUCF 4P48A 5C0JB 4I3RH 1U8KA 3QEHA 4OZFH 5F7DB 4QRPB 2NX5A 1JF5A 2OTWB 3T65A 1ZTXL 2C3GA 4PJGA 1G7IA 1IGIL 2YN5A 1TZGL 2NTSP 4EVNB 3MCKB 4V1DB 5E00B 4JZJB 5DWUH 1I3UA 3RGHA 4ORGA 4NKOB 2PXYB 3P3YA 4I0CC 4PRIE 2RFXA 3EKCA 5DJ0B 3VGDA 3WN5C 4YUEH 3ROLB 5JLZB 1NGYB 3D9AL 4HIHB 3GJFH 5SV4A 3T0WA 4JRXA 5MEND 3KR3H 4N0YL 1WFOA 1JGUH 1FNGA 4ODWB 4KK5D 4V2BA 2MWCA 4BQ9A 1TQCB 4XPAH 3MCLH 4ELME 1BPVA 5JW4Q 3HE6D 3LCYA 5EBLB 2SEBB 1QSFD 4RFOL 2C7UB 3V6ZA 3SGEH 1NBYB 4X98B 1CFBA 1EFXA 4L9LA 2EE6A 1IC5L 3KJ6H 3NIFE 3SJVB 1JGLH 2D3VA 3LKNB 3IDXL 4KKLD 5H8DA 1NBQA 3TBVA 2XNAA 4PRHA 5HGBB 2PR4L 2WINB 3BP5A 1JPFB 1KCKA 3DWTA 25C8L 5EWIL 1DQQA 4AEEA 3L9RB 3LVEA 2F54D 3C5JB 2QSVA 1FNSH 2RCSL 5C0CB 5TGBB 3WHXB 4UTBL 4U6XB 2MKLC 1MJ8H 1IKNC 2BRRH 1VSCA 5T1LA 5ICZA 4FXKB 5C0AE 1FZJB 1TCRB 1U8OB 1Z2KA 4ZUTB 1JPST 5E5RB 1MCEA 3V79C 2GSGA 2ZOLB 3NH7H 1EVUA 4MNQA 4YBLC 3WLWC 5C0IB 3V95A 1A3RH 1QPPA 4ODBD 3D39B 4DZ8B 5EN2A 3TPKA 5DSCB 3EO0B 3Q5OA 3VXOA 1DCLA 4PRNB 4OLEA 4GRLB 2W0FA 2VDNH 4AM0A 1DFBL 3K7UA 4NFDA 1H9VA 1TJHL 4LRNL 2IG2L 1FE8H 3DROA 5FM4A 3IAQA 1KSRA 1CD0A 4U1KA 1ACYH 1F2QA 3O3EA 4XPFH 4JY6B 4EN3C 4CJ0A 8FABB 4M7JL 4WW1B 2VZVA 2NY0B 4U1NA 5EIQA 5CHNA 2F53E 3IFNL 4QHKI 5B8CB 4YXLL 5A2KH 3I6KB 4F9PC 3HI6L 2LU7A 5GSRB 2NX5D 2FATL 2IANE 2VXUH 1QBLH 2VUYA 4ZQKB 3ULSB 4WHDA 4GRWE 2IALA 5DJZB 4F33B 3T0DA 3QNZA 4OZFG 1AFVL 3HFML 4OI9A 1YEFL 3SE4A 3IGAB 4OLXL 3QUXA 5HYJB 1QRNB 5F6HJ 3OJDA 1ZEAL 3NACH 3PXJA 3KHOA 4LCWE 3IVKB 4JRXD 4N8VB 3ARWA 5D1ZB 4GRWH 1I3RB 3ARGA 3MLTA 5A3IC 4EEEA 1I4FB 4AZ8A 4Q6IC 5CP3H 3G5VB 3MMEA 1MWAA 4J2XA 5F71A 4X6CA 5D2LF 3VFVB 4L4VB 1UM4L 2WM0A 1L7IH 2FO1A 2GITA 5DFVC 3UBXG 1CF8L 1EFXD 5DZOA 4P5TB 4EKXA 3P11L 1B3JA 1MCPH 1ACZA 3G9AB 1DANT 3PGCA 3DPBA 1CDIA 3MLZH 2W92A 4NFCA 4U6VL 4PJBB 3WNLA 4OZHB 1ORSB 1KJ2B 3MGAA 5FXCH 1TETL 1IM3A 4P9HC 1BJ1J 1A7RL 4YDJA 4N90D 3T8XA 3V0VA 4JPVL 4GMSH 3HR6A 2CRIA 5FA3A 3TZVA 1PEWA 2A9ML 3QQ9D 4NQDB 3A67H 4XCEA 1I7TB 1ZV5A 4GLRI 1ORQB 5TE6L 3ZE2F 4KK8C 3QO1A 3TA3C 5ELIA 2VKWA 2A9NH 4PREB 3U6RB 4KVNL 4WTWA 2EH8H 4LLUB 3V5KA 3VD7A 3V52H 2N56A 2VZ3A 4L3CB 1P84J 2DLEA 1HCVA 2EDLA 5FYJD 5IHUH 1FBIL 5DJDA 5FYJU 3AGVA 2D03H 3NOIA 4G6KL 4K9EH 3MLWL 1A7NL 1RK1B 4M7LT 3VXNB 4F3FB 3UZEA 4R4BB 1DE4B 4JGMA 5F3BA 3SKMB 1YJDC 1KPVB 1GPOH 4PD4J 1DVFA 4PPTA 3MV8D 1B6DA 3AM8C 1X5HA 5DXWA 1V7MH 2KKQA 4ZPVA 3ZKMD 1DBKH 4LSTH 5CD3B 4K8RL 3G08A 4KZDL 3ZTNL 2YRLA 1HSAA 3IJYA 1KCUH 2QL1A 4EQ3A 5IV2B 1OAXH 4AEIH 2WIIB 2FX8L 3FFCD 4HMDA 4Y89A 1GGIL 5FDYA 1WFNA 4OCRL 4WV1C 1IC7L 5M94B 1H3TA 1WISA 4FTVB 3QG7H 2KBGA 3NVQA 3V2AR 4HMCA 3RVUD 4DVBA 3Q3GB 1OLLA 4ZSOB 1T4KB 2EYRA 4P3CL 4XNXL 5C0NC 4Z78B 1S8DB 4MDIB 4TSAH 4ZO7A 3OKEB 3ARGD 4HIEA 4PLKD 5CSZB 1RZIB 3QIBC 2AJXH 5JORB 5DHVH 4NWTL 4P2CG 1SVCP 5CMAA 3VGGA 2EDQA 1TTUA 4PRPB 2J88L 1IAKA 1I1CA 3SY0B 5KAQG 1HHIB 3F5WA 4PJHE 12E8L 5DURD 3L7FB 5JOFB 4GKNB 2P5WE 5ANME 4LLWA 2NW3A 1F3JB 5F7WC 9CGTA 2A73A 4CRPA 3PHOB 2V7NA 2H1PL 2VDOH 3S35L 3V4UL 5FM8A 1CU4L 3B5HA 3MZTA 4OIIH 4RGOH 3SCMA 3W11C 2DIJA 3GKWL 3PWUA 4QRQB 3BPNB 3OX8A 2OTUB 2DDQL 3TZVD 4BSWA 4ZD3H 3MRBB 1ZAGA 3VD5A 2KPNA 4G6FD 2CDFA 4NC0B 2EIBA 2WV3A 3DARA 3GI8H 4NQUA 5JXED 3IFLH 1QSEE 3PWLB 3MRLA 4MQXD 3HE7B 3JSSA 5GS1B 2ZUXA 4FXGB 4L9DA 1JWSB 3DX9B 1QFHA 2YD5A 1BQLH 4MQ7A 4Q97A 4PG9B 3V6OC 4WRLA 1XGQA 4Y4FC 2GI7A 3ZO0A 2Q7YB 1FG2B 3ZDYE 1YQ2A 3WMSA 2IF7A 2Q1EA 2R1YA 1QHOA 5ALCL 5I1DB 4APQC 2R29L 1HXYB 1BVLB 1TPXB 2NR6D 4JFDD 5IFAL 4JLRB 5GGQH 1DVFD 3RBSA 4HXBH 1LK2A 3CK0L 5FUZL 4FG6C 5IB5A 5HHNB 4DN3L 1JUFA 1OSZB 2JJSA 4OT1H 1F8TL 2P48B 3G6DH 3PABB 4QRUA 4XXCA 2W59A 1HNFA 2GKIA 3IAPA 2ARWA 2QQLL 3PNWA 4OFDA 4AK1A 5J12B 3LKPA 1AD0A 1DL7L 5IT2L 3HR5A 2EXWD 2JK5A 1TLKA 3QNYA 2ICEA 5DJXA 3VXUD 4LHUB 2DBLL 2FDBP 5IQ9A 1K2DB 1T03L 3MRHA 3QFJD 5CKGA 1ZS8B 1K8DB 3WN5A 3CXHJ 4Z18A 5ESQB 2HKFH 4JO4H 3MGOA 1A6ZA 4XNYH 1SM3H 3K0WA 2WSKA 4RZCB 3E6HA 2BSRA 2K7QA 4Y4KC 2YD7A 3LV3A 2BX5A 3LZFL 1FAIH 3WHE0 2XTJC 4JDZA 3KXFA 4OCMC 3M8OH 4BFIB 3S4SB 2FL5B 3DVGB 1XR9A 4Z7UF 1JIBA 4CUCA 3UTQB 1KEMH 3DURB 5KVEH 4MXWH 2Z9TA 3VXPA 3DXAD 2EEAA 5J11C 5ISZE 1XCTB 2O5ZH 2EIZB 4MMZC 2ZSWA 3KPMB 3L3DA 1NGZB 4ZFOA 3IDIB 1AJ7H 4DZBA 1KCRL 2DTML 3EYQC 1HHHB 3P9MB 3TNNB 1RZJC 5KSVB 3CMOL 4JFPB 4R4FH 5TDPA 1I3GH 1QLEH 4CN6A 3RRQA 5T3ZL 1FFQA 2BERA 2YPKA 3MGTA 3JV5A 1YPZA 1MIEL 1IM9A 1FO0B 1S9XA 5EU4B 5HGAB 3TWCL 1HYSD 1IKNA 2VXQH 1H5BB 1AKJB 2FIKA 3B9KB 3RTQB 1X4ZA 4CVXA 1CQYA 2DD8L 4CU7A 3GMRB 1NCWL 3WFEL 5C0FA 1AC0A 1AXTH 3NGBC 1OM3L 3GBNH 3HNTL 5IOPB 5IB4A 3VXQB 4FFVC 2C1PB 4ZO6A 1I9IH 1A3QA 1I7ZA 3VXMB 1ZLSL 1HH9A 3X11A 2HN7A 3MNVA 4D0CB 4HKXA 4YH6A 3TC9A 5KVMC 2VJXA 4M7KH 1RJLB 2AJYH 4MHHG 4KZEL 2N7AA 1U8NA 1H3VA 4R0LB 1FZOB 3EYFA 1J0KA 4XPBL 4MJ5B 4MYWB 1HHGA 3EO1A 2IPUG 4L4TA 1I3VA 4BUHA 4EN3A 1MI5E 1T21B 3QFDB 4I5BA 5GGTH 3RU8L 3K74B 5MI0B 5I1HL 4DTGH 5CBEB 5E8EB 3PP4L 3QDMB 4YHIB 2G75B 4HULB 1OAQL 1FFPA 1JZ5A 3U0WH 1NUNB 4A6YL 3QI9B 1DTUA 3R1GL 3WSQH 4F9PA 3O9WB 4YHYC 2YD4A 4UIKH 3HTLX 1KPUB 3G6AA 1A5FL 4HCRH 4WO4D 1JMZA 5DJ2A 5C0GB 4PJ7B 1AGBA 4JJ5B 5GPRA 2WQ8A 5DT1H 4XHQA 5EOTA 5JHDE 2E9IA 4L3AA 1MFAH 1K85A 4ZO8A 3UTTA 3ARVA 3D87B 4HF5H 4X6CF 4X6EA 4Z7QE 3O45B 1U8HA 3TBWB 1BAFL 3T0BA 5JIIA 4XC3L 1IGYB 3MLRH 1WWWX 1C5DA 1S7VA 3BO8A 5J6GB 3H7BA 4GG8A 4QRTB 3W0WE 3OKNB 3QEQB 3SDAB 2XA3A 4HKBB 3NZ8A 2VXTL 1R24A 3P77A 2NXYD 4JPWH 4HAGA 4Q6IA 4XB7A 1G6RB 3SGDH 4PJXE 3BPLC 4EI6A 3VE0B 1P4BH 5JXAH 3L3IA 3P73B 1KB5B 2BNUA 3HZYA 4JY4A 5MEOA 1UH2A 1XGYL 2QADC 4XCYA 3RWGA 4I8DA 5DC9B 1HOCA 4ZODA 3IDJB 2JIXB 2R2HB 3O3UN 5FCUL 5DMIH 3OKMA 2EDOA 2GAZA 1QNZL 4G9DB 4JO1L 3UC0L 4P2OB 3DRTA 3NCMA 3EJJX 1E6OH 5D93B 4QXGH 3BEVB 1RHHB 4OTXH 1H0DA 3F58H 3QXDB 1CIDA 1PD6A 4AIOA 3S3SA 1IM9D 3R8BB 4UNUA 1KENH 5D2LB 3WO4B 5CIPB 1KJ3L 2APFA 2R9HC 3X3FH 5JMOC 4D9QE 4AG4L 5KVFL 1NAMH 1X5LA 4MAUL 4PJIA 1T1XA 4WFHE 5EOCH 4PRBB 1YY9C 2OL3L 1W8OA 3TA3A 1FV1A 5IFJA 1SEBB 3TYFB 1C7TA 3GSNA 1MFNA 4RMWA 3OPZL 3G5ZA 4X9IA 1QG3A 2DYPA 3QB7C 5IHLB 3MV9B 4B50A 1ROWA 1N5YL 4Y4HC 1HXMA 3LS5H 3THMH 1RJYA 3BRGC 1ZWIA 1P2CA 2PCPB 3FQNA 4NNXB 2NY6C 1X5ZA 4FQXC 2GK0A 2G9HB 3GSXA 1PZ5A 3TPUB 4Q2ZA 5HDQH 4ALAH 3QEUB 2QEJA 1IGFL 1D9KC 1IGCL 3W2DH 1C12B 4C54A 4L4TD 2MSPA 1YMMD 4EN3D 2B5IC 4XCNB 1TTGA 3AM8A 5CSGA 2IADA 3NBNA 1AP2B 3M45A 1U6AH 3ZKQD 3DUUA 4DVRH 4AL8L 4O4YL 4QTHB 1MFEH 4QXTB 3B2VL 3BVNA 1N5AA 3VFWA 2R2EA 2M26A 5I1LA 4PJEB 3DI2B 1INEH 4YGVA 1MREL 3MRRA 4NHCH 2VAAB 4JFOB 3C09B 3UTTD 2QQKL 4WV1A 2ZUTA 4OD2A 2HT4D 3C5ZA 2MTPA 2VWEC 2YA0A 2FZ3B 5FHAL 3VA2C 2VR9A 1D5XB 1Q9LA 2DRUA 2D4FA 3ZE1F 3ZE2E 2BNQE 1KIQA 1FYTA 2G5BA 2R2BB 2W60A 5A3ID 1I8KB 4S1SH 3VD4A 3QIBA 2P49B 4NKIL 2XWJA 4WWID 3UYRH 4XNQA 5H2BB 1ERNA 1L9NA 1BECA 5DK3A 2YBRB 4BA8A 2DQTH 1QSFB 1A7QH 3EOAA 2PUQT 1E28B 3VD9A 1I1YA 4TRPL 3KS0H 3TH2T 1C7SA 4LKCA 5D72L 4R9HA 4YR6A 4BJLA 1MCOH 3BGFB 3NFPB 1VFOA 4HWNA 4Y5XC 3JWNC 5EC2B 4ONHB 3WDIA 5JPMA 5F9WB 2HJFB 1OAYH 1P7KA 2ADJA 4NJ9H 3QPQD 5DR5L 1M7DB 2VDRH 2F54B 4XCCH 3B6SA 3D0LA 3S34H 3ELAT 1ZHKA 3T2NL 1HE7A 3BH9B 1DEDA 3HRZA 5ICXA 1R0AH 5B39G 1K6QL 1X5AA 3C87A 2YOCA 4KK8D 5L7XL 4WEMB 2BJMH 3H9HB 2Z8RA 4LLMB 3RL1B 4E5XB 4JM4H 3W9EA 4WDIB 4IJ3B 5CEZH 4U31A 4N8PA 5DEZA 1V3LA 2UVFA 5DS8B 1U8IA 1UM5L 4MNHA 5DC0A 1J87A 4Y5YC 4YK4C 3DIFA 2NY5H 4IOIA 2NZ9C 2B1HH 1U95B 3HS0B 3E6FA 1ND0B 1S7WB 4NO0A 4DOHE 1F45A 3V6OA 3UJIH 3NCFB 3E2HB 4LEXL 3ULUC 4J1UA 2OK0L 4HK3J 4Y4FA 4AEFA 1BZ9B 5JW5B 4APQA 1ADQL 3HI1A 2VR4A 1NPUA 1HINL 2RBLA 2E7MA 3UTZB 1NGWB 3FO9A 1G9ML 4YHNB 4U6TA 5I18H 4P49A 3FMGH 1DDHA 4Z8FH 1BWWA 3VDBA 2MQ0A 4ZXBC 2XZCL 3WLBA 1AE6H 4OQTA 4X4XB 1YYMH 1U8KB 3QEHB 4MXVE 3DYOA 3EOTL 3H0TA 3TESA 5F72S 2D0FA 2NX5B 5F9OL 5GRJH 3T65B 5DD6A 2Y06L 1F4WL 4PJGB 1G7IB 4ZG1A 1AH1A 5MP6L 3PHQB 2CLZA 4HKZB 3OZ9L 4MNGA 4M6ML 4ORGB 4Y5VC 4P46C 3C5ZD 3SGKC 2RFXB 2DQHL 4CADA 4OD1L 3WIIH 5C0ND 1E4WL 1FYTD 4Y4KA 5D5MA 4HG4J 4JRXB 3WUZA 2ORBH 3QIBD 3KPOA 4FQ2L 5E7BA 5JMRA 1FNGB 1CLOL 2HA1A 5A40E 4YEFA 4GKZB 4NM4H 1Q0YH 1AO7E 2CGRL 2VKXA 4X5LA 3V6ZB 1NLBH 1EFXB 1XFPA 3MV7D 3PDDA 1N6QH 1WTGT 2EDEA 3AS3A 5GGVY 4BYHA 3MNWA 2W38A 3TBVB 4PRHB 5JQ6H 4OSUH 1A1OA 3HNVL 2FHBA 1FN4A 1T6VN 3BP5B 1Q8MA 4E42B 4OM1H 1HKLH 1NEZG 3PQYA 1YEEH 1DQQB 3S9DB 4Y1AE 3SE9H 3GM8A 1NBZA 2J2ZA 4KDVA 4YZFE 4LVOB 5TE7L 4DFIA 3UDWC 1A14L 2BZDA 1S3KL 1PSKL 1JMXA 2BCKB 3MTRA 3FB7B 3DMMD 5ICZB 1RJZA 3NCYS 2FH6A 4MNQB 1ITCA 1I1AC 2M1KA 4JKKA 1NMBH 4WEBH 2P8LA 4NO0D 2HVKA 3BPOB 2ZUVA 5EN2B 1JGDA 4YDVA 4YUEL 1CLCA 4F58H 2X9WA 2YR3A 3D3VE 5DO2C 2L4OA 3GMPA 2MPAL 2W0FB 5CJOH 4AM0B 4APQD 1M6OA 1GGCH 1R3LA 3SE3C 3KR3L 2BVYA 1MOEA 4P0DA 1JGUL 4Z7UE 4C59B 1FIEA 5BOZG 3O3EB 2OXGA 3AFLA 3FN0L 3MCLL 4XPAL 5C0RL 1CFTA 4U1NB 3MLVH 4M48H 5CHNB 2OS7A 4XC1H 3HN3A 3H2WA 4K07A 1JGLL 1EHXA 5A43C 2QTEA 4PGDA 2IALB 3I6LD 4LDLB 4LSUL 5EH1A 3QNZB 4PB9L 1G0YR 1EGJH 3QUMA 2X44D 3L3KA 3QUXB 5KOVC 4NM8H 3MUGA 3OJDB 1CE6B 1KBGH 2UZYB 1E4KC 1PJ9A 4Y4KD 1CFVH 2OXHA 1KGCD 3O41A 1MJ8L 1I9EA 1CR9H 3ARGB 3MLTB 3FOLA 1QFPA 3PWPA 2NY2C 3ARSA 3K80A 5CP7A 3MMEB 4U3XA 1MWAB 4CVZA 3NH7L 2BHZA 5DD5H 3EYOA 4X6CB 2Q87A 1NCBH 5DTFA 2I07A 1A3RL 3CH8A 2DLFL 2GITB 3U0TA 4L3EA 5DURB 3MRIA 4LAQH 4J6RL 5SWSD 3PGCB 1Z5LA 2VDNL 5J0BA 3HHRB 4IRZH 3EYQD 3KVQA 4KHTH 5JDJA 5CEXA 1LO0H 3K81A 4UDTA 3PQYD 4LSQL 1CFNA 4YDJB 1H3XA 4OV6F 4X6DB 2VZSA 1C5BL 1YY8A 3T8XB 5HYFA 3V0VB 4XPFL 1PX3A 3S36L 5L8JB 4FMFA 1RIUH 5FA3B 2FLBT 2OJZL 3TZVB 1UB5A 4G6FB 4XCEB 2GHWB 1FGNL 4ZAKC 4NCDA 1A64A 4WWKC 2ZCHH 3QO1B 5CWSA 3IT8D 3PXHA 3RWCA 2CMRL 3SKJH 1XAUA 3HAEG 5CILH 4Y4HA 1GGTA 1LNUA 2AK4A 3QDAA 4U2ZA 4KGJA 5CFHA 1V7NH 1YEIH 3CVHH 2D7QA 4FQXA 5DJDB 4BSVA 1A6AA 4BFGA 3CSBA 4GOSA 4HZAA 2PW2A 4D9RD 3DNKA 1P69B 3S3PA 2HFFA 1EO7A 2X2YA 4OCWH 1AQDA 2BVTA 3UJTH 1PX4A 3ZKNC 5F3BB 4JFDB 2XWTA 1DVFB 2EKSA 3P4LA 2Z93B 4QXWA 2VLRA 3TJEH 4ZPVB 3IDNA 3G9VA 4HBQA 4DFHA 1MHPH 3G08B 3LMJH 5I1JH 4QRRA 3IJYB 1HSAB 1CICC 1PKQA 4U1GC 1RU9H 1MCPL 5GISH 3QHFL 4HWBA 5DGQA 3MLZL 3VXUB 4OZGB 4AMKH 4ESKA 2W9DL 1EZVX 3ZTJH 1UFUA 5FOBA 1FG9C 1JP5A 4Y16C 4NWUH 4MD0A 2F5AL 4PLJD 3LEVL 2EYRB 2VC2L 3SDXA 4ETQA 3QDGD 3VFUA 2P7TA 1IC1A 5HTSA 5E2WL 3A67L 2C3VA 4U1LA 3C6LC 4HIEB 3PWPD 3L1OL 4CJ1A 3QIUD 4Y2DC 4FQJH 1YEGH 5CD5D 2ZG2A 5GGRB 4JAMB 1T89C 2EICA 4NIKB 3O2VH 5DD1L 3RDTC 1QEWA 3KDMA 4DGVH 4QRPE 2EH8L 5KOMC 2BFVH 1IAKB 3SGEI 5BCAA 3F5WB 3VG9B 4RFNB 4FFZH 2DQEH 5IQ7L 3K8KA 4Z7VB 4V1DE 4KJWC 4Y2OA 4Y5XA 5F89A 1A4JA 2NW3B 4LLWB 2D03L 4I0PD 2V7NB 4DEPB 4WHTA 2BMKA 4N5EC 3U30C 4NQTA 3SCMB 3P9WB 3Q5YA 5BRZE 3PWUB 1A6WH 1CFSA 4JQIH 3OX8B 1W72A 3V7MA 3RWDA 3QXTA 1V7ML 2YUZA 4BSWB 2GJ6A 3LHPH 1WBZB 4UQ2A 2CDFB 3UP1A 3L3JA 3BGMA 2W0PA 2W07A 2YD9A 4IRSC 3RIFK 3T0EE 3CFKB 1KCUL 3MRLB 4GW5A 4UV4H 1MRCH 1GOHA 1CGSH 4YXHL 4AEIL 1A21A 4Y4HD 1QYGL 5CLTA 2AK4D 2VDQH 1SBSH 3HMXA 3SJVE 1CIUA 4KRMB 1KNOA 4PG2C 4MQ7B 2DL2A 3HC0A 4FQXD 4TNWK 2FX9H 1BZQK 1XGQB 4GSDH 2R1YB 2Y9RT 4IRJA 4TSAL 5D9SA 4OF7A 3RKPA 3RPIA 1XGUA 4G9FA 2R1XA 1R5VA 2AJXL 2NY7H 2CR3A 1LK2B 2DQFA 1MVUA 5IB5B 2VLRD 1JUFB 1KTRL 4KJQC 1BGXH 4ZXBA 4Z0XA 5IW3A 2FJGA 1DQLH 5D5MF 1LD9A 4QRUB 3BKJL 4BZYA 3PNWB 4JFXA 4HK0B 1XEDA 3LKPB 1AD0B 4WFFE 1IC4H 2EYSA 2JK5B 3QNYB 2ICEB 5DDHA 5DJXB 3ZYOA 4GW4A 5IQ9B 3BZEA 3F7QA 1MCIA 4Y5VA 3MRHB 4G5ZH 1T5WA 2VDOL 1Q94A 3SGKA 3EZJB 3WN5B 3GB7A 4JHWL 4RGOL 3EO9H 4U6HA 2YZ1A 4JFYA 1VB9A 3LEYH 5D7LE 3MGOB 1A6ZB 2HJLA 2VRAA 3OR6A 4NNPH 1F13A 2DWEA 3GHEH 1VFBA 4DK3A 2X7LA 4ZD3L 3E6HB 2BSRB 4JO2H 5HHOD 4JFFA 1KPRA 3LV3B 3GI8L 4MQSB 2EDXA 3ZTJG 3IFLL 5BV7C 2NXYB 1JNLH 1LMKA 4JDZB 1KLFA 2CO7B 1EXUA 2NY4C 1U8JA 4WI2A 4XCFL 3NFNA 5LAXA 1XR9B 1GIGH 3HG1A 5C07A 2DLTA 2X4SA 4HK3N 4NYLA 3L3GA 2PYEE 5IM7A 2CUHA 5FUCE 5EU6A 3VXPB 1BQLL 1NC2A 2C3WA 3UROR 3L3DB 3WJLC 4ZFOB 3VXTA 4O51A 4TUKL 3QR2A 4DZBB 2NXZC 4YNYA 3MR9B 4HUNB 3EOBA 5TDPB 5EBMB 2GYSA 4KU1A 3SDCC 5E95B 2YPKB 2ESVD 1S9YA 3MGTB 1YPZB 3CU7A 4KXZI 1IM9B 3O2DL 3QULA 3UAJD 1S9XB 3UDWA 4JHBA 3ARED 1RZGA 4OT1L 4BFEA 1KELL 1EUTA 4CVXB 2X4PA 5JIHA 2AP2A 2R4RH 1G9EA 1KFAH 5C0FB 2V9TA 4Z6AT 5IB4B 2E6JA 4YBLB 3ZKXC 3I3DA 4UBDC 1I7ZB 4TTDC 1G9NH 1HH9B 3X11B 3MNVB 3V8CA 2H8PA 4HKXB 4M6AA 1MCHA 3AU1A 3ULUD 1ED3A 2HKFL 4JO4L 4XNYL 4OZHE 1U8LA 3EOYG 1U8NB 1VFAA 1SM3L 1WAAA 4ODXA 4IRJD 3SE3A 1QPXA 2P47B 4ZOBA 1XIWC 5D6CA 5KSUA 5KSAC 1FAIL 1HHGB 3EO1B 4L4TB 4K3DL 1YMMB 4EN3B 4I5BB 1XZ0B 3M8OL 5DFTA 4QLRA 4NRXA 4FFYH 4NQDE 4ZXBD 5IVXA 3TH4T 3ROOA 1B9ZA 3CX5K 3UO1H 1FFPB 1KEML 1XF3B 4MJ6A 5KTEL 1QSVA 2GTWB 4MXWL 1GHFH 3G6AB 5DJ2B 4TVPL 2IPTH 3LIZH 1AGBB 3DRQA 2MCG1 4Q9RH 5SWQA 5EOTB 5DMGC 1WTLA 2Z0BA 4WUUD 3T3PF 1AJ7L 5K9QI 1RI8A 5FYLD 3UTTB 4X6EB 3FCTA 3CSPA 2DMKA 2X4NA 1U8HB 4LVEA 1A1MA 4J3SA 3BZFA 1QLEL 4M5YH 4F7PA 1E4KA 4G42A 1C5DB 1S7VB 4PGJA 3BO8B 3H7BB 4AQ1B 4GG8B 4TVPD 1S7XA 3NZ8B 1FFNA 2UZXB 3KWWA 1R24B 1E4XL 3P77B 4Q6IB 3AS2A 4NO2A 4EI6B 1AXTL 1MH5A 3UTPE 3GBNL 3L3IB 2BNUB 4JY4B 3HZYB 5MEOB 3NCBB 1I9IL 4KK6C 35C8H 4XCYB 5C07D 3MRQA 4S11A 1IEBB 3WKML 3GBLA 1HOCB 3MJ9H 3P4MA 5EU6D 2VQUA 1NC2D 3IAGC 3HPLA 3OKMB 2J8HA 2GAZB 3VFOA 1FLRH 4RA3A 3DRTB 3KPSA 1MAML 1NFDE 4GQ9H 5I15H 1J8HA 4F8QA 1H0DB 3RGVD 3B3IA 3P4NA 4L8SC 3LQMA 4H1LA 4LPCA 4MGXA 1EO8H 2ZUQC 1PYWA 3CFJA 3GRWA 3U0WL 4BZ1H 5T1MB 4RISH 1CLZH 3WSQL 4WWKA 4PJIB 2JCCE 3C2SA 1T1XB 4UIKL 1IFHH 3WFDH 1RZ7H 3RVVC 4YXKH 1FV1B 5HHME 5IFJB 5I8EA 3TO4A 3GSNB 1OGAA 4TNVK 5EA0L 3WIHH 4OUUA 3G5ZB 1MFAL 4MHHI 3RVWC 3ULVL 5JUEH 3RPKA 3M17A 4HF5L 1HXMB 1RFDH 1RJYB 4OB5H 3CDGA 3RX8A 1ZWIB 1ZGLA 5ACLA 2V5TA 5FV1L 5KSBB 5TJWK 3FQNB 3MLRL 5DO2D 5J3HD 2GK0B 3D69A 3GSXB 1PZ5B 4K3HA 4Q2ZB 1QO3A 4ZOAA 2VZTA 3VFMA 4L8DA 4JPWL 4ZOCA 5C0DB 3TBTA 5L2JA 4DW2H 4F37K 1QBAA 3ULVD 4HS8H 5AAMA 1KCSH 1GC1H 1P4BL 5JXAL 3CLEH 4GFTB 2IADB 4Z7OF 4KRNA 5CJQL 3SDXF 5GRUL 4RRPG 1CICA 3BVNB 3VGEA 1N5AB 3VFWB 2R2EB 3KLDA 3T2PA 3VXSD 5I1LB 3A6OA 5DMIL 5IW1B 4L1DA 3JBG7 3H3KA 4DUWA 2K3TA 3B9EA 2VISA 4WV1B 1E6OL 4OD2B 2X41A 1SY6H 1G7PA 3C5ZB 4Y16A 3ARUA 3F58L 4TULH 1Q9LB 4O2EA 1B4RA 1KENL 5AZ2H 1KIQB 1FYTB 2G5BB 4G8EB 1IKFH 3HCVA 5CKAA 4JPKH 3X3FL 3O11A 4OLVH 2NY2D 1NAML 1CK0H 3QIBB 3PF2A 5D7IA 3OF6A 5I71C 2XWJB 4Y2DA 1T66C 2AAVA 2VB5A 4G7VH 3NTCH 1T89A 3FQTA 43C9A 1MHEA 1F90L 3O6FA 3RDTA 5KS9A 1UZ6F 3EOAB 4IIQC 3O8XC 1F3DH 5KG9A 3THML 1I1YB 1MJJA 3ARDC 1QR1A 4OCXL 2IQAA 4KPHH 4UDUA 4LKCB 1IMHC 4Z95H 1A9EA 4YR6B 1VESA 1WIOA 2HWZH 5HDQL 1JF6A 3PJSA 4ALAL 1JBJA 1UQSA 3KPSD 4MA3A 3W2DL 5FOJA 2ADJB 2AJZA 1J8HD 4PJCF 4LFHG 2IFFL 3B6SB 5DK0A 5C3TA 4NRZA 1OQXA 3FRPA 5FGBC 1ZHKB 1DN0A 3JXAA 4K3GA 5ENWA 1U6AL 3HRZB 1B0GA 1D5IL 1F4AA 1X5KA 3UCRA 4OCLC 4S0SD 4JRWA 1MFEL 3W9EB 3DMMB 5E2TH 1PLGL 1E4XI 2DQJL 3ISWA 1U8IB 1INEL 4N0FB 4MNHB 3TO4D 1OGAD 5C2BH 5F7MC 4QWWC 1QR4A 2XKUA 4NHCL 4MZ3A 2VDPH 3DIFB 4IOIB 4PBXA 3QYCA 4ODHH 1CL7H 4H8WH 3UJJH 3E6FB 4PG2A 1XMWA 4NO0B 1KCVH 2R1WA 2YC1A 5I1KH 2ATPB 4K55A 1YEKH 4J1UB 4Y4FB 2KUTA 4DKEH 4P2RA 1OT2A 1LQSR 4AQOA 1WT5C 4APQB 1IBGH 1A02N 4WTZA 2OZ4A 2IQ9H 2L7UA 2FSEA 4BQCA 4PJDE 3IF1A 3BWUC 1E27A 3F6IA 4GS7C 1DDHB 3QDJE 3V0WH 4LSVH 2DQTL 3WLBB 3BZ4A 5E2UH 3H0TB 2YKLH 4AEHH 5IMKA 5ILTH 3JVGC 5DD6B 4FABH 4WW2C 3CCHA 1T6WA 5DVLA 1F11A 4OGYL 1FO0H 2C4FU 5D7KD 3WV0A 5HYEA 4MNGB 4MA1C 4NJ9L 4LSDA 4Y16D 5I8OH 4XPTL 1J1XH 2VDRL 4XCCL 3TJHC 4XZUA 4G8GA 4RGNE 3S34L 4HH8A 1MCSA 4K3EH 3HZMA 5AG9A 4MVBD 4Y4KB 4S1QH 3VGAC 3KPOB 3OKOA 2XTJB 3VRIA 2R0KH 1L0QA 5CEZL 7FABL 3SGDI 1B0RA 4MZ2A 3GK8H 4Z77A 3QDME 3O6FD 2BSTA 4KMLB 3NMEA 2ENYA 1GOGA 2GW5A 2B1HL 4LCCC 5IMMA 3T4AA 2AK1L 1ZXQA 4NQCD 2X1WL 32C2A 5LKNA 4FQIH 4XT1C 1DR9A 2L0DA 4KJWD 1UEMA 1ZA3A 3WJLA 5FYKD 3ZLQC 3MNWB 5SWSB 1A1OB 5FYKU 3AUVA 4MD5A 1FN4B 2WLZA 1CLYL 2O93L 4XBGB 2PTUA 3QG6B 3PQYB 5I18L 3SDCA 3FMGL 1U0QA 2BY0A 4Q9BA 4Z8FL 4NUGL 1NBZB 5TQ2H 3RNKA 4Z7WF 4WI4A 4NN7C 3TV3H 2F8VA 3KYNB 5K93A 3RX7A 2JKXA 1WWCA 1AE6L 4TN9A 4RDQF 1WAAF 1F00I 3TBSB 3O4LE 4G7YH 3NGBB 5CEYB 1RJZB 3QJHA 2BNRD 2XICA 5I1IH 4K9EC 3BGAA 5B3JF 1OCWL 1Q9WA 4LHUG 5IVXF 4P59H 3RAJH 2P5EA 2P8LB 5ICYA 4OF8A 3CFDA 2HVKB 2HTLC 5F1OB 1JGDB 3ARTA 4YDVB 1G6RH 4GW1A 1K4DA 4OLWH 5ACZA 2CRMA 1T22A 3GMPB 1KB5H 1N0XH 1XR8A 1M6OB 5KSAA 4HD9A 1R3LB 2ORBL 5D2NE 1X44A 2VMFA 2K1MA 2EKJA 2QSQA 2MQCA 1CT8A 4TSCH 2C4XA 3VXRE 3JWDH 4JB9H 4KJQD 1DQDH 1JNNH 1CFTB 3S4SG 5AUMA 4YHYB 1BJMA 1J0HA 5JA9A 4XVJH 4ZUUA 2ZZUT 2Q76A 3NCYP 5H94A 1X4XA 1F97A 1T2QH 3ARBC 5JQ6L 4OSUL 3REWA 4D3CH 3QQNA 3V5HA 4NZJA 4OM1L 5CIPH 4NN6C 5E9DA 4YHZH 3ECBA 3HMWH 2XXMB 5K9KA 4G6JH 3QUMB 1YEEL 4LVHC 5DHYA 3L3KB 2J5LB 3D48R 4G8GD 4X5XA 1VACA 2IH1A 3DUSA 1K8IA 3SE9L 3MUGB 2AJVL 3QISA 3QDGB 4JFHE 3VG0L 3O41B 3B2UD 3I2CH 3RUGA 2PW1A 3MYJA 4K23H 3ZSSA 3PWPB 2R56H 3EAKA 1RQ5A 3BPLB 1Q38A 3CVIH 4ONOA 5IKCA 5IK3A 1R5WA 2A6KA 1BF8A 5CP7B 2QADB 4CVZB 1K5NA 3KG5A 4N0UA 3EYOB 2E7HA 3P0GB 5DTFB 1RVFH 1QFWH 1NMBL 2QJDA 4FQ1L 4WEBL 3QJFA 1OY3B 4XBEH 1OSPH 3WNMA 3WBDA 3DUHA 4L3EB 1KN2H 3U0TB 2X4RA 4XP9H 3RWJA 2X6MA 2NXZD 1Z5LB 5CJOL 5T5FL 1I1FA 1YN7A 5LQBH 1GGCL 4I0PB 2O5XH 5CEXB 4UDTB 4XP1H 1CFNB 4Y7MA 4LBEA 2DAVA 4L8SA 1RZFH 3WKNA 4HC1A 4P2QD 4NKMA 2M8XA 2BDNH 1NLDH 1NSNH 3MLVL 4M48L 5MENE 3ZSTA 3W9DA 1UB5B 4KQ3H 1QLFA 3WXWH 1F02I 2JELH 5CWSB 4UNVA 4TTDD 3RWCB 3IKCA 4XI5C 2YWYA 4Y4HB 4QGTA 4YBHA 4Z5RA 4OGXH 1AGCA 1LNUB 2AK4B 2ICCA 1LE9A 3BI9X 1ZTXH 2R4SL 4FQXB 1HHJA 4BSVB 1A6AB 5HGHA 1I8MA 1KBGL 2NPLX 3WXVL 4OZFA 2PW2B 3H9SA 4EIZC 2VLJA 1VA9A 1CFVL 2ADIA 3VFGH 2HFFB 3RKDD 1KJVA 3T4YA 3BEWA 1AQDB 3DGCR 2F54E 2B5IB 5E08H 2IBBA 4PJAB 3P9LA 2XWTB 3D9AH 2EKSB 2J3SA 2X4TA 2VLRB 4GLRH 1ZLUK 3RBGA 1NCBL 1X6LA 2DM3A 2Y4SA 1GJIA 3LY6A 4QRRB 3WE6A 1PKQB 5DMGD 1WSST 4LAQL 4RFOH 2QQNL 5DLMH 3UBXA 1HILA 4IRZL 5E99H 4KHTL 5KS9F 5E9DD 1LO0L 2XTLA 1K3IA 5FOBB 4PRIA 3LRSA 3D5OF 4MD0B 2PR4H 4ZYKA 5HHQB 3TFKC 1RIUL 3SDXB 4ETQB 3VFUB 4IBLT 3WHE1 5EWIH 5HHOB 3B9DA 4U1LB 4Y88A 1FZMA 1ODAA 2Y25A 1OTSC 1TZHA 1N2RA 3ZHDA 4KK6D 3BQUD 2AV1A 1GZPA 4ELMA 4IIQA 5F1KC 1N8ZB 1A3LH 1QEWB 3KDMB 3O8XA 5CILL 1L9MA 1A7BA 1KTLA 3ARDA 4XP5H 4OLZL 1V7NL 1F2XK 4Y5XB 4I48A 5F89B 1A4JB 3VGFA 5M7QA 1T0NB 4MXQC 1JVKA 3IFOA 4HUUB 4OCWL 4GJTB 3QCVH 2BMKB 5DD3H 3UJTL 5I1GH 4PP2A 4KTEL 1W0WA 5HDOA 5HHVH 1CFSB 4WIQA 1W72B 5I73C 1A4KA 3RWDB 1TJHH 4JQXC 3TJEL 3BIBX 3ZDZF 4LRNH 2IG2H 3IU3B 4HJGA 4ODTH 4UQ2B 4XX1E 3BGMB 1M7IA 1WZLA 3LMJL 5I1JL 3RVVD 3OMZA 5C0AA 4M7JH 3KPQA 4MWFA 5GISL 4GW5B 4KKCD 3Q6GH 3RVWD 4YK4B 4AMKL 2I25N 3FAXA 1K4CA 5CSBA 4R2GC 4M4RA 4DJMA 4MS8D 4NWUL 2Q20A 2UV3A 3MLPA 1X5JA 1ZLVH 3H9SD 2AW2A 5KW9H 2PKDA 4IRJB 1AFVH 5D9SB 3RPIB 1XGUB 4OLXH 2R1XB 3ET9F 1UKQA 1R5VB 1A2YA 4FQJL 1YEGL 5L88H 1MVUB 5T1KA 4ZXBB 3O2VL 5BS0D 2FJGB 4DGVL 4ZFFA 4HZLA 2F53A 1RUPH 1LD9B 1A7PH 3TIEA 3JVGA 5I8CB 4WFEE 4JFXB 4A2MA 2VSCA 2EYSB 5DDHB 2IBZY 4PJCE 4WUUB 1RZKL 5HVFB 1MF2H 4Y5VB 1T5WB 5JNYA 4ZNEE 1Q94B 3FO2A 4HAFA 2DN7A 2AGJL 4I2XA 4OD3H 2NY3C 4U6HB 4JFYB 1A6WL 2HJLB 3STZA 1NMCB 3OR6B 2DWEB 1VFBB 2HLAA 1BMGA 2X7LB 3LHPL 4LCWA 5JW4M 4JFFB 1KPRB 1T66D 3GUTA 3MV8E 4UIMA 4NRYA 3PIQB 4OZIF 1EXUB 5FYJH 2A9MH 3NFNB 5LAXB 1MRCL 2KZ1B 5C8JA 3HG1B 5C07B 5GZNC 1UWXK 4OFYD 2R23B 2X4SB 4NYLB 2EXYD 4LCCA 3L3GB 3ARDD 1NCUA 3GMNA 1SBSL 5IM7B 1VPOL 5EU6B 1BD2E 4JANA 3RY6A 1NC2B 1DUYA 2FX9L 3C08L 4KVNH 4LPWA 3PWNA 4XMKH 2WK2A 4E41E 5TE4H 2XA8H 1IL1A 3FFCE 4GSDL 4MB5A 5HJ3A 1UWEH 1T1ZA 2FX7L 3IDYC 4YNYB 3QHZL 3PP3H 1YNLL 4HW6A 3EOBB 2NY7L 5F7HA 1MJ7H 1WUNT 2FLRT 3MLWH 1S9YB 4XGZA 3ZDXF 1B2WH 2WQRA 3QULB 4KJPC 1JPSH 1BGXL 1DQLL 5HDLA 1N59A 4NZDA 3KNBA 5JR1L 2GY5A 1TCMA 2XWBA 1UM6H 1IC4L 1A6UH 2PO6A 4O2CA 1MNUH 1J1OH 4CMHC 1INDH 1Z6JT 4G5ZL 1RULH 1EBPA 2H8PB 3AU1B 5F97E 1BEYL 4BSJA 1GGUA 3NCCB 1WJ3A 5FO7A 3LEYL 5I75B 3EYUH 1U8LB 3ZHLA 2B20A 2UY7A 3QWOA 1VFAB 4ODXB 3J7HA 1SEQL 5D6CB 5KSUB 2WLYA 4ONGH 4X6DE 1JNLL 5C0CD 1FL5A 1VEPA 1DEEA 1TVBA 2VLKE 4P3CH 4XX1G 4NRXB 4R26L 5IVXB 3ROOB 5BZWA 3F7VA 4MJ6B 1WZKA 5CZVH 3QUYC 1A6VL 3ARBA 3DRQB 1KB9J 3Q6FA 2EDYA 2J88H 1UCBL 2GJZA 5I16A 1P5UA 3RZCC 2NQCA 1FVCA 12E8H 2P24A 3FCTB 3LKSA 2VN4A 4HFUH 4Z7WE 2NMSA 2X4NB 5D8JL 3TJHD 3BZFB 4NC1E 4F7PB 3E1F1 4JFED 4G42B 4I18C 1FRGH 4YJZL 5B4MD 4LCWD 3S35H 1CU4H 4M9PA 4CGTA 4CL7A 1S7XB 3ARYA 1FFNB 4JFDE 4Y19D 4BELD 3KWWB 2NY2B 3QA3A 4NO2B 2R4RL 5E03A 3U7AA 1MH5B 2DDQH 5GGUA 4PTTB 3QSKB 1G9NL 4GAYA 3MRQB 2P44B 1EMTH 1I75A 4QXUH 2H9GA 1NBVH 3TP4A 3HPLB 3VXUE 4OZGE 4RWYH 4PBVC 1T80A 4M5ZH 2P5WA 3CFEA 3VFOB 3QFJE 3GO1L 3KPSB 4QY8A 4NGHH 1ZKAA 2A6JA 4K7PL 1J8HB 1P84K 4OFVA 5J13C 2ICWI 3B3IB 3P4NB 4JN1L 3FQXA 4H1LB 4FFYL 2NY5C 2W9EH 3A0OA 3CFJB 2ITCA 3DX8A 2DJUA 4WWKB 1KJ2L 5DRNA 5BQ7A 1BOGA 3CK0H 5FUZH 1GHFL 5C09A 1QSEA 1LP9E 4PD4K 3WNNA 5FECA 2IPTL 3RWHA 5I8EB 4Q9RL 3RVTC 1PG7X 3TO4B 1OGAB 3PL6C 3BESR 3BJ91 2PO6D 4OUUB 1F8TH 3DXAE 3M17B 3BJLA 4M7LH 4PYGA 4LNVA 3CDGB 1ZGLB 4Z7VE 2IWGA 4M5YL 2VZOA 4GBXD 4RBPH 3D69B 5D96C 4KDWA 2O26U 1LEGA 4FQCH 2FD6L 1EK3A 1CXIA 3BIKA 2DF3A 4KKAD 1J8KA 1S9VA 3VFMB 4L8DB 4M1CC 2I9TA 3QCUL 3TBTB 5L2JB 1EH9A 1LE5A 3X14A 4XNZC 35C8L 2E9WA 3IJHA 1RUKL 2CK2A 3BUYA 4FS0A 4NKDA 3MJ9L 1CICB 3OAZH 1H3PH 4U1GB 2CK0L 2DKUA 4U4BA 1SJHA 1A9BA 3NA9L 5T3ZE 4ELMF 3T0XA 1FLRL 2VISB 5MHSD 2A6DA 1REIA 1BWMA 2H26A 1UJ3A 3KPTA 3RFZC 5I15L 1G7PB 5JPNA 4Y16B 2H45A 1A7OH 4GXUM 4POZD 4PYHA 1MSPA 4ZUVA 5CBAA 1U2CA 3LAFA 3OQ3B 2FECL 4IEFB 4O2EB 1MFCH 1Z9SA 2HJKB 1EO8L 3HCVB 1VEOA 4BZ1L 4PGEA 3O11B 4RISL 1CLZL 5CZXC 1XGTA 5D7IB 3DV4A 3BW9A 4F57L 4Y2DB 3WFDL 1MIEH 1RZ7L 2HFEB 4YXKL 2WBWB 4XRCA 3FQTB 3TWCH 1MHEB 43C9B 3BYYA 3O6FB 3RDTB 4RBPK 5I76A 1JHTA 2EECA 5CJ5A 5KS9B 1JI2A 2X1QA 1LDSA 1NCWH 2CRYA 2WWKT 3V8OA 5JUEL 4KUZH 1F5WA 3HC3L 3H9ZA 5KG9B 2E8ZA 1MJJB 3RX5A 1SYVA 4OB5L 5ISZA 2Q8AH 1QR1B 4NQCB 4UDUB 5C0EA 1A9EB 2VDLH 2P5WD 1IAII 1ZVSA 3PJSB 2ZUUA 5F1NA 5B38A 1UQSB 1JE6A 2GCYA 3P0VH 4LLQA 4MA3B 3U30B 2MCPH 1XF2A 3FT2A 4WENB 4KZEH 4OUOA 2F74A 4HS8L 4PV8B 1GC1L 3EFDH 4HLJA 4JFZH 3CLEL 4NRZB 4UB0L 4JQXA 2NNAA 4P5MA 2B2XL 2Q3ZA 3CPLA 5ENWB 3AS0A 4MLSA 2OR8A 3QH3B 2ZUYA 2VERN 1TFHA 1YDPA 5C09D 1QSED 3S97C 3PP4H 2BNRB 3I75A 4RA0C 2FR4A 1EFQA 2E7CA 4JCMA 4XI5D 3R1GH 1YNTA 3MRCA 2YD6A 1AR1C 1A5FH 5GGTA 2Y5TA 1TZIA 2R1WB 2YC1B 4LVNC 1N4XL 3VFTB 1UXWA 4TULL 4P2RB 4WW2F 4GRWF 4HCRA 1IKFL 3VWKC 4YAQA 4PRAA 5KAQF 1BAFH 1PZUB 4XC3H 3CXHK 2FSEB 4HJ0C 3IF1B 3MRFB 1YPZE 3EDEA 1E27B 1MI5A 4P57A 5I1EL 3C8KA 1DBJH 1MCRA 5ADPH 5JW4N 1XF1A 3GMQB 2VXTH 4ZS7H 2OM5A 3TIDA 5DRXB 3BZ4B 3DVIA 3DJ9A 3DO7A 4TUJA 4YBQD 3HE7D 1G7JA 4KPHL 1XGYH 5IMKB 1M7XA 4GRMA 4Z95L 1FJ1A 3CCHB 5A2IH 1F11B 2HWZL 5JHDA 1MJUH 2UYLA 2CO6B 3UPRB 2QLVB 1IVLA 3V7AE 4GAJL 3WFBH 4X4ZA 5FGRA 2APXA 3TFKD 4G8GB 1QNZH 1ZT7A 4PY7A 1F6AB 4JO1H 4UT6H 4NO3A 1OD7A 3MBEC 3N1FC 3W0WA 1S9KC 5BV7B 1YMME 3OKOB 3VRIB 1OTSD 3MJ6A 2CXKA 4AH2A 4PJFE 4PJXA 4LDEB 5E2TL 3U2SA 1B0RB 4Z77B 5F70A 2BSTB 4MDJA 1KJ3H 1AHWA 3UTSD 5EU7E 5IG7B 5JA8B 2FGWH 2VDPL 2OL3H 4H8WL 3UJJL 5IMMB 3EHBC 1KCVL 3T4AB 5I1KL 5GRYA 5IIEA 2X5PA 5DJ8B 3U0PA 32C2B 4LCIL 3MODH 1ZA3B 3IS1X 3OGCA 4DKEL 4OLYH 3LB6D 2NXZB 1N5YH 4MD5B 2DOCA 2HRLA 3GSVA 4JN2A 5IVZA 1UGNA 3OKDA 5EU5A 1CGYA 2D2OA 4KUCD 4YHML 3V0WL 3LS4L 3RNKB 4LSVL 5FDWA 1URLA 2FECI 1WIUA 1QVOA 5E2UL 1V3JA 5T1DL 1J0IA 2XXCB 1JI1A 5KVGH 5AD0A 3QJHB 5ILTL 4FABL 4Y0GA 5IBLD 1Q9WB 4OBRA 4AL8H 3EJYD 4O4YH 1A0QH 1PY9A 1FO0L 3S37X 2PNDA 2P5EB 1KYOJ 3OKLB 5EOCJ 5ICYB 3CFDB 5I8OL 4J12A 1JN6A 4BH7A 1J1XL 3ABZA 4J3XA 1M71A 1IAOA 1K4DB 1MREH 3RNQB 5ACZB 4K3EL 1T22B 2QQKH 4S1QL 3QZWB 5GRVK 1YQVL 5FHAH 2CKBL 2R0KL 4YC2B 3I02A 1LO3L 1J5OH 3MA9L 4MJIE 4F8TA 3GK8L 3OL2A 4L8CA 5F1SA 4XVUC 2FIRT 5GS0C 1CGXA 1M4KA 1EERB 1X9QA 4P9HH 3QUYA 4ZUUB 2XZAH 1T7ZA 2Q76B 2CXGA 4JGJA 4OZ4A 3N85L 3MJ8A 4W4OC 1AGFA 5GGVH 3RL2B 4PGBA 3REWB 5F6IC 5JHDD 4RAVA 1BREA 2DB8A 3RZCA 4TRPH 5D1QC 1EA9C 4Q74A 3V5HB 4CU8A 1MIML 4RQQA 3GMLA 4FMKA 1AD9A 1FDLL 1KIRA 3ECBB 4JQVC 5E9DB 5K9KB 5KSBE 2HFTA 5DHYB 4I3GA 4I18A 3CZFA 4X5XB 2KQMA 1VACB 2IH1B 3DUSB 4JFQA 4PJHF 2NLJB 5B3NA 5TQ2L 3ZYZA 4DKFL 5EPMA 4YFEA 2BNQA 3GSNH 3RUGB 2PW1B 3MYJB 3S98A 4F7TB 2GT9A 4R8WH 4WY7H 3ALWA 4NQEE 3U7WH 3D85A 5IKCB 5IK3B 1R5WB 2A6KB 3O4OB 5I1IL 3QIWC 1LO4H 1HHKA 5GZND 1K5NB 1K6QH 2N1KA 3BE1H 1NFIA 2Y6SD 4N0UB 4P59L 2ARJQ 3QJFB 2YEZA 3RAJL 4LARH 1SJEA 3ALPA 1RY7B 3LQZA 3PWJB 5DUMH 2X4RB 4IMKC 1G6RL 2DQIL 5DZNA 1OLZA 5EBWA 5EUOF 3RWJB 4OLWL 2XACC 2HT2C 1KB5L 2HT3C 4W81A 1N0XL 4JZJC 1YN7B 3STLA 2PXYC 5J8OA 2D7MA 1Y0LA 4LBEB 1YECH 3KS0J 4TSCL 4ZTOH 1QOKA 4L8SB 2ED9A 1I9RL 4JB9L 3SDAD 2VQTA 1DQDL 1JNNL 4NKMB 2ZUQB 4X7SL 1HINH 4G3YH 1G9MH 3B8YA 5L9DL 2Q3AA 3ZDYF 1FQ9C 1GL4B 4D9QD 4XVJL 1LILA 1A47A 1X3DA 3CUPA 3T0EC 1CD1A 1S7QA 4NQVA 3GSQA 4YQXH 3D2UA 2UWEE 4D3CL 3IKCB 3KYOA 3EOTH 3N1MC 4Z5RB 1P7HL 3MV7E 4YHZL 1JV5A 1LE9B 4G6JL 2Y06H 5FEBA 1F4WH 3X13A 1G1CA 3F7YA 1MRFL 2JB5L 4M7ZB 4RNRA 5HGHB 1I8MB 4JVWA 4OZFB 5I1AA 5J9PA 3H9SB 2VLJB 3I2CL 2FYYA 2R0WH 1KJVB 4PJ5E 4K23L 3BEWB 3T4YB 1UB6A 4FQHA 2DQHH 4GXUN 1KC5H 2D9QB 4JG1H 3P9LB 1E4WH 3WCYA 5SWZD 3GMOA 3G6JF 4C56E 3W5MA 5K9OA 1WZ1H 5BS0B 2P8PA 5DVKA 3D1MC 4OIAA 1JK8A 3KAAA 1RVFL 4KGLA 1QFWL 4LPYA 5JHLH 2IEPA 3QUYD 4XBEL 1OSPL 4O2FB 4WVRA 2BSED 1KN2L 4WNQA 4OF0A 3WE6B 4I9WD 4JGUA 4XP9L 5FV2A 3RA7H 4DUVA 1DSFH 3HUJB 2CGRH 2E6PA 1WWBX 3UBXB 4U0RC 3RZCD 1HILB 2HG5A 1EHAA 3ZYJA 4XP1L 5FIEA 2MNUA 3KLHD 4YDLC 4PRIB 3LRSB 4ZYKB 4GRLC 3D18A 1L6ZA 2BNQD 1NLDL 3QO0A 1NL0H 2ZNXA 3VGHA 2CD0A 5HPMA 5I71B 4KQ3L 1MCJA 1FZMB 3WXWL 3D85D 3STBA 2BHUA 2RJMA 1RPQA 1TZHB 1N2RB 2J8UE 2VXSH 3U83A 3W82A 5TE7H 1G0DA 2AV1B 4PP1D 5DRZA 1GZPB 1A14H 2X10A 1AO7A 3BX7C 1VADA 1S3KH 1GYAA 1PSKH 3O8XB 1KTLB 4OGXL 4IDJH 3ARDB 3MC0A 5FO9A 4NZRL 3CNKA 1U8MA 2H2PC 5FUCC 1UENA 1F4YL 4G43A 4PR5A 3DGGA 4I48B 5I74C 4U0QB 3IFOB 5JIKA 5ECJE 3VFGL 1JGVH 4G6AD 4OQTH 4R96A 4PP2B 5E08L 1Z0MA 3BHBB 1W0WB 5E4EB 2MPAH 4Y1AA 1ZSDA 4B7LA 1A4KB 2YZ8A 1KGCE 3CGTA 3IXTA 4F15B 4JZNA 4D9LH 1OWRM 1M7IB 5GIRA 3FN0H 5C0RH 5C0AB 3KPQB 4MWFB 2IPKA 1OTUD 4NBXB 4Q0XH 1TQBB 2IC2A 3D2UD 2P43B 5DLML 4KFZC 5C0BD 4KV5F 5E99L 1JHLH 4M9OA 5BVPH 5GJTL 4HS3B 3LQAL 1TVHB 2YN3A 5ESAA 5SWSE 2VNCA 5IJKA 3VW3H 2D0GA 3AB0B 3D3VA 4LSUH 1NGXA 2BOCB 4PB9H 3VWKA 2ED7A 3WUWB 3P4OA 4ERSL 4M1CD 3C9NA 5L6YL 3HKFA 3FQRA 4JHAH 5T33H 1F42A 4XPGL 5I0DA 5DUPL 4Z7UA 4Z7QF 4XWOC 1A2YB 4FFWC 3ESUF 4HT1L 4PGCA 1S7SA 5T1KB 4HG4K 4K94C 1EGJA 2B8OT 1A3LL 4ZFFB 4HZLB 4BH8A 1Y18A 4XP5L 1RZJH 3TIEB 1T20A 2FRGP 1DBML 1MCFA 1T0MA 3MUY1 3OKYA 1IE5A 4PJXF 2AQ3A 2O5YL 3U7YL 3H9YA 4GRWB 4HLZH 3FN3A 2DLFH 4J7RA 4MA1B 5HHXH 3QCVL 4KTDH 3TT3H 5JNYB 3FO2B 5DD3L 5I1GL 4I2XB 4J6RH 4PJ9C 1YEHH 5HHVL 4JFEB 3STZB 4D9RE 4F7CA 1W0VA 2HLAB 3EBAA 3MBEA 4LCWB 5EZLA 4LSQH 4RMTA 4ODTL 5GZOC 4RAHA 4Y19B 1J1PH 1C5BH 3GUTB 2XFXA 3S36H 4NRYB 2OJZH 4M93B 1MCQA 4QHMA 1YC7A 3Q6GL 5C8JB 1FGNH 4HQQL 3EGSA 4LCCB 4MJ4A 3T08A 1NCCL 5C9KA 2MHAA 1EVTC 3GMNB 4GKSA 3TNMA 2JB6A 1I8IA 1QFWI 2RB8A 4JANB 5FO8A 1DUYB 4EDXA 3KYMA 1KG0A 2CMRH 4LGRB 5EU3B 5C86A 3WL9B 2DQDH 2YPLE 5HJ3B 1IL1B 5KW9L 3EDDA 1JHKH 5EG6C 4LF3A 1TJIH 4ZFZA 2BSSB 1A8JH 1U3ZA 5GQBA 2B4CL 1KLGA 1EX0A 4HGWA 4KROC 3QDGE 5L88L 2V7HA 4XGZB 3GI9H 1JWUA 5D1XC 1UC6A 4M3KB 5BOPA 3CVHA 1BVKA 1RUPL 3AROA 1A7PL 1OGTA 1KIUA 1N59B 3D25A 4LIQL 4R6UA 3BDBA 1WEJH 3EJZC 4WI5A 1J7VR 3V4VH 3V4PL 2VABA 3KNBB 3VFPA 4MAYC 2XWBB 1O5DT 1FCCA 4L5FL 2PO6B 1MF2L 4O2CB 1J88A 1FPTL 4J3VA 1YMHA 4OLUH 6CGTA 4FA8A 4EXPX 3QHFH 1GC1C 4OD3L 2HAZA 3FQWA 2VQ1A 1FGVL 4PRHD 1C08A 3VFSA 5CJBA 4N1HB 5FO7B 3QQ4A 1A6PA 2EC8A 4GBXB 3WNOA 1B0WA 1J0ZA 3D3VD 2W9DH 3VRJA 3QWOB 3GHBH 1MPAL 3SKNA 3MZGB 4PY8I 1D7FA 4KXZH 4LEOA 4NJAL 4CU6A 4U6YA 4AY0A 5F21B 5JO5A 2F5AH 1FL5B 3LEVH 1DEEB 5ID1A 3BD3A 2BY1A 2VC2H 3QCTH 2VITA 4GG6E 3BPNC 2RAMA 2R15A 5FYJL 5E2WH 2GSIA 2VLME 1IGJA 4UUJA 1HSBA 15C8H 1JFQH 5FB8A 3L1OH 3F7VB 5T1LD 4DK6A 1NC4A 2YD1A 3GM0A 2E5EA 4W4OA 5IVNA 4JM2C 3ARBB 2BVQA 5TF0A 4MNQD 5DD1H 3Q6FB 4XMKL 5M95B 4R4NC 1YYLH 1EAPA 1F58H 5TE4L 3KLSA 2H6PA 2XA8L 5D1QA 2NW2A 4NNYB 1K9TA 1UWEL 1JPGA 4F9LA 4JQVA 1FVCB 1UA6H 2P24B 3LKSB 2I27N 4X8JA 5IQ7H 3WEXB 3UMTA 1MJ7L 5EOQL 3L6FA 2OQJA 5HD8D 1B2WL 4HLZG 5I6XB 3B43A 3MBED 1NGPH 1JPSL 5F7EH 1PKOA 1KXVC 1AGDA 3KPLA 4PJAE 5HHPA 1MRDH 3GGWA 4LCYA 3QA3B 3F8UB 1WK0A 4YPGA 1C1EH 3MRKA 1D6EA 3QIWA 3O2WH 2VLRE 1UM6L 1J05A 1A6UL 4OGAD 1IZJA 4GAYB 1MNUL 1J1OL 1OW0C 3BWAA 5F7DA 2BVUA 2VSDA 1INDL 3G04A 4QRPA 3N1PC 2PF6A 3EHBD 1RULL 1QRKA 2H9GB 5KVDL 3MLUH 3EYUL 4YXHH 4QCIA 1QYGH 4V1DA 1C8PA 2P5WB 3CFEB 5DVOA 1MQ8A 5T5NG 1MWAL 3HB3C 2PXYA 2CIIA 3PGFL 4ONGL 4QY8B 3QUXD 2A6JB 2IH3A 1IGTA 1RHFA 2EDHA 4Q6YA 3ROLA 4OIBA 1Z9OA 5BRZA 3C2AH 3JWOC 3FQXB 1CI5A 5HHOE 1D3CA 4HWBH 3U4AA 2XN9E 4H8WC 1H8OA 4NQSA 5MERA 2ITCB 3DX8B 4HIXH 4K2UH 5CZVL 2ICWJ 4OV5A 5DRNB 5BQ7B 5H35A 5C09B 1QSEB 2MFNA 3H7LA 3T0EA 2XQYK 5FECB 3RWHB 1WBXA 3P0YH 4NDMA 2BY2A 4WFGE 3BKJH 3KHQA 1BQSA 4HFUL 3SJVA 3L5XH 4MXVF 4X9BA 4AYFA 4G8FA 1MQKL 2VO5A 5HGBA 2D7NA 1FRGL 5D7SH 1LEGB 4PIRF 3FT3A 4JHWH 3BIKB 1S9VB 3L9RA 2I9TB 3C5JA 4M1GH 1FL3B 2EO9A 2ESVE 2E6QA 5HBBA 1BBJA 3O81A 1LE5B 2WBJC 4FQLH 3X14B 2FCBA 4I13B 1PAMA 5IEHA 5GS0D 1OAKH 3IJHB 4NCC1 1CE1H 1EPFA 1EMTL 4RCAA 3RTQC 1H8NA 5ETUA 4NKDB 1XGRA 5EUOE 4QXUL 3GSWB 4R3SA 4ZUTA 1NC4D 5AEAA 4JY5L 1NBVL 4XCFH 1SJHB 1G84A 4RWYL 5IMLA 1A9BB 4M5ZL 3WS3A 2F15A 3G5XA 5D1QD 1W72H 4RMVA 2AEPH 2BK8A 2LE9A 2A6DB 4J8RA 2H26B 1UJ3B 4NGHL 3L95A 5BW7A 5JPNB 2EDBA 3NPSB 4HUMB 1WGOA 4ZUVB 5CBAB 5D7LA 3FO1A 1DANU 4TUKH 4RGNC 2W9EL 4R0LC 2C1OA 3IKKA 2W0KA 4PGEB 2QHRL 1XGTB 4XNUL 3DV4B 3BW9B 3CSGA 4B41A 5IWLC 2BVEA 3QIWD 4K71B 3O2DH 1Z9MA 3ULUH 4XRCB 3UTSB 1JHTB 1KELH 1T3FA 4X9FA 3B8SA 3JUYA 3QI9C 5GJSH 2FHCA 4YZFF 5EO9A 1JZ7A 2PYEA 4M7LL 1SYVB 1CVSC 1G7QA 1HYRC 5ISZB 5C0EB 4WUUE 2HT2D 2HT3D 5F6HI 1VHPA 2B7DT 1ZVSB 4FQCL 4H25A 3OHXA 3GNML 3QAZB 1M1SA 5F1NB 4DCQA 5B38B 2GCYB 2A83A 1U8QA 2VIRA 3EUUA 1BFTA 3G6JE 5K9QG 5D4QA 1XF2B 2J6EA 3FT2B 3QP3A 2F74B 5I73B 4QOKE 4TVPE 4P5MB 3F7PC 3WFHA 4I4WA 4D8PA 1UZ8A 2WUCH 2YPVH 3R4DA 1DQTA 4K3DH 4M6NH 3FHAA 2IBGA 3G5VA 5ABDE 5FYLH 3MUHL 3T0ED 1H3PL 2RGSA 2JJVA 5SX4I 3I75B 5KTEH 4HX1A 3VFVA 5EO0A 4MCZA 2FR4B 1T7YA 1IQWH 4JCLA 4R2GB 4C57C 5KN5A 4TVPH 5I1CH 4DN4L 4AIXA 2Y5TB 1TZIB 3JWDC 4CN1A 1A7OL 3ARRA 1UXWB 3BH8A 3VWJC 1MFCL 2V17L 1NFKA 2IMNA 2R0ZL 4P2OC 4YAQB 4PRAB 4IS6B 3SCMD 4H20L 5D93C 2G60L 1BQHA 4CDGC 1OB1A 1QKZH 5D2NC 2APBA 3OTTA 2H2SD 4P57B 3RP1A 3C8KB 3MV11 4RGMB 1HI6A 4P9ML 5HSFA 1E4XH 4XP4H 3TIDB 1NUFA 3CXDH 3S3JA 5IEKA 4KUZL 4NZTH 4TUJB 3DO7B 4XVTH 1G7JB 5HI5C 2Q8AL 2ERJC 3D0VB 4GRMB 1FJ1B 3WKMH 2VDLL 1L7TH 1OAZL 1QQDA 2CKBB 5JHDB 3LRHA 2UYLB 1NAKH 4QNPE 2N4IA 3P0VL 2HTKC 1DJSA 4PJ9A 2MCPL 3NCJL 2JF1A 4JR9H 4F7MA 5D7LD 4KY1H 5I9QB 3EFDL 4JFZL 1ZT7B 3TEUA 4DKAA 4PY7B 3JV0A 1MAMH 4NO3B 1B6UA 1BP3B 2FJFA 4ZFGL 5C6TL 1J10A 3SKMA 1KPVA 3MJ7A 1PW3A 4AH2B 3ULVE 1PG7L 2HRPH 4KV5E 3U2SB 2Z31C 4MDJB 1AHWB 4NPYA 2BC4A 2H2PD 4DAGH 4HV8A 3VXSE 3U1SL 5IIEB 5F7FA 1I85C 3SBWC 3U0PB 3U4EA 1AXSA 4IMLA 5EA0H 2DWDA 3OGCB 3QUZC 1OP5H 2DIAA 3ULVH 4ACPA 5BZDB 3UEZA 3IDYB 5C6PB 3GSVB 4JN2B 5IVZB 3CJJA 1NFDA 3OKDB 5EU5B 4RAUA 3WIHA 4S1RL 1T4KA 3MBXH 3S5LA 5D1XA 1DBJL 5ADPL 4JDVA 4Z78A 1LO5A 1IRAY 5FDWB 4ZS7L 4GKOA 2MKWA 3OKEA 1QVOB 4ZFOL 2DIBA 3KXFD 3SGJC 5JORA 2JCCA 2A1WL 4HXAH 1KLUA 2ZG3A 1BHGA 5AD0B 3SQOH 4MAYA 4KK5C 4X5WB 1UH4A 3SDDC 4OCSL 2QHLA 5CJQH 5GRUH 3HE6C 4CMHB 4DUXA 1MJUL 3DLQR 2CKNA 3WFBL 1XT5A 1GOFA 5JOFA 1JN6B 4BH7B 3BP4A 1QFUL 2EIDA 1M71B 1IAOB 4UT6L 3PHOA 1FP5A 5F9WC 4DGIL 5TDOA 4XWOD 3I02B 4KJYA 2LFGA 4G6ML 3EDJA 3MRBA 5SWZB 1OP5K 4L8CB 1SY6A 2FGWL 2JJUA 3BDXA 5GRVL 3C60C 1U92A 3QUYB 4JM2A 2EDNA 1F90H 4IJ3C 4OZ4B 5F1IB 3WLWD 3MJ8B 4FXGA 1AGFB 3MODL 4OLYL 4GO6B 2BP3A 4PGBB 2C3HA 3RZCB 4H1LH 2HP4A 1Z9LA 4UT7L 4RQQB 3GMLB 4OCXH 1KIRB 3F12A 3GRWH 4PJ9D 5LGHH 4KQ4L 1L0XA 5HYQA 4HUVA 3MRMA 3OG6B 2BXYA 4I18B 3CZFB 1CXKA 3LKQA 4JFQB 2EEBA 5EPMB 3SE8H 2BNQB 5KANG 5GZOD 2FBOJ 4WTXA 1DBAH 4QHUB 2GT9B 4LSRL 4MB3A 4JLRA 2IFFH 5KVGL 3D85B 5E5UB 2ADFL 1CGTA 3DVFA 5FKAA 5I17B 3UTPD 1D5IH 4HS6B 1SMAA 1KJMA 1HHKB 1OW0A 1NFIB 4HWUA 1A0QL 3PABA 5A2LH 5ITFA 1PLGH 2YEZB 2DQJH 3TN0C 3LD8B 1SJEB 3LQZB 1CBVH 3T0AA 5K59E 5IJVA 1KV3A 4UU9A 2DM4A 1GGBH 1U8PB 4YEEA 3STLB 1P5VA 1F3DJ 2VAJA 3OAYK 3ORJA 5J13B 1Y0LB 4KROD 1JL8A 1J5OL 3N1GC 1QBMH 5D1XD 3V6BR 2V9QA 2H3NA 2E7BA 4R97B 1CXFA 1DQMH 3EJZD 4S0TD 4P9HL 2YSSA 2XZAL 4Q9QH 1N6VA 4MAYD 3PWVA 3CUPB 5HYSA 5HHMD 5GGVL 4BQBA 4NQVB 5DFVD 2VTFA 3DURA 3D2UB 5KJRL 5C0BB 3KYOB 5EZJA 4UI2A 2QKIA 2XZZA 1XCTA 4NQCE 3T2QA 4XTRC 3X13B 5FYKE 3F7YB 1GAFH 4CVWA 2DMBA 3BAEH 4MJ2A 4OGYH 4H5SA 5D96B 3WYRA 2H32A 5CEZE 5I1AB 5J9PB 3T1WA 3GSNL 3HRPA 3INUH 2D7TH 1RD6A 4XPTH 1UB6B 4N0CC 4R8WL 4WY7L 3U7WL 5EB9A 4HPOH 4PJDA 2WBJA 1UYWL 4JKLA 4XNZB 1P9MC 1LO4L 2XOTA 5EU4A 3QDJA 4M43L 2ZP0T 3GMOB 2GTZA 4JREB 3BE1L 5FYKH 3RTQA 5K9OB 2P8PB 3QQ9C 4R90H 1JK8B 1MLCA 3KYAA 2LV4A 5CJ8A 3TA3D 4LARL 7FABH 4JM2D 1YEJH 2BNRE 5DUML 1I7UA 3BIAX 4WNQB 5I66A 2I26N 1YJDL 3VXQA 4ISVA 2I60H 1T83C 4OGZA 3GJEA 5E0QA 2DYPD 3LOWA 3VI3E 2HG5B 3MUJA 4C58B 2AK1H 2KL6A 2ZJSL 5HVHB 2W9LA 1AQKH 2YA1A 1YECL 4D94A 4ZTOL 2NY3B 3ARPA 3RQ3A 2YRPA 3F6LA 3D18B 1CLYH 3JTTA 4R0LA 2I5YH 4G3YL 4EQ2A 4H1LG 5ALBH 3QO0B 1DUZA 2QR0A 5HPMB 5IWLA 4WU7A 4NUGH 4EUPA 5DRZB 4PBWD 4YQXL 1AO7B 4WGWB 3L7EB 1WQVT 4YFLF 4AT6A 1VADB 2X70A 3QI9A 1LO2L 4X4ME 5FO9B 3TH3T 4LDOB 1U8MB 5IESL 3KPRE 2FH8A 3I6GA 4JJ5A 4JKPL 1OCWH 4G43B 4PR5B 5DJ6A 5TDNA 3DGGB 1HN1A 1D5BA 3HB3D 3QHTC 4CBPA 1G7LA 1FL6A 2R0WL 3ME0A 1HH6A 3E3QC 1KC5L 4JG1L 4Y1AB 4K8RC 1OQOA 1ZSDB 4L29A 1FC1A 2BY3A 3IXTB 4NP4L 1WZ1L 4OZHF 4U1SA 3RJQB 3IS0X 2AXJA 4JZNB 4HEME 5JHLL 1KT2A 4PLKC 5GIRB 3O4LA 2HVJA 3RA7L 2IPKB 1DSFL 5IHBA 2IBZX 5IBUG 4L9LB 2R2HA 4LVNB 3EDFA 1YC8A 5BV7H 5ESAB 1C5CL 2XNAB 4LQFH 3VWJA 4PTUA 2NCMA 3D3VB 4P2OA 1NGXB 1BJ8A 4JG0H 4EJ1C 3W11D 3P4OB 3RWEA 1NL0L 3C9NB 3FQRB 5D2NA 2FB4H 5ESVA 4Z7UB 2WBJD 4P2QE 2AJVH 3VXRA 2VXSL 3JUZA 3VG0H 3HAEH 1S7SB 2HMIC 5CIPA 4KI1A 4C55A 5DJAA 1P6FA 4BH8B 5T1LB 5JXEC 2K7PA 1Y18B 4IDJL 4UILH 1Q9KA 4HMEA 1T20B 4U1MA 3OJ2C 2NTFA 2GSGB 1T0MB 4S2SA 4MQXC 1RZ8A 3RY4A 1X5XA 1MFBL 2AV7A 1HDMA 4FQ1H 1VEMA 1YUHA 4POYA 1JGVL 1CS6A 4Y4FD 4OQTL 3VXOB 4YIQA 3R0NA 3CMGA 4LKXA 5T5FH 4MA7H 3TPUA 4RGND 4TPRH 4NC1C 1T1WA 4F7CB 3MBEB 3FRPG 4X6BA 5EZLB 3DROB 3B9VA 4D9LL 4U1KB 3RWIA 4FG6D 3FO0H 2NR6C 2C26A 2XFXB 2Z31A 2GQHA 1NFDF 3PHSA 4KRLB 4Q0XL 1QA9A 5FGCE 4XAKE 1JHLL 1EDQA 4QTHA 5BXFA 5IB3A 5BVPL 1WC7A 2MHAB 4X8XA 4GKSB 4UZGA 2JB6B 3TNMB 3SBWA 1I8IB 2PTTA 2OYPA 4LHQB 4EDXB 2JCCF 3ZT5A 1E4JA 4X7FC 5FO8B 3QUZA 2EXWC 2WMPA 4QHKJ 3BP7A 3VW3L 1L6XA 2A74A 4JPIA 5E8PA 3P2TA 4JFOA 1K3ZA 2V5MA 1KACB 1S5IH 3U9PH 4ZFZB 2R4SH 4JHAL 5T33L 5L0QB 4UAOC 2XIDA 3WNPA 2E27H 1D5XA 3WXVH 1KLGB