1H8NA

Three-dimensional structure of anti-ampicillin single chain fv fragment from phage-displayed murine antibody libraries
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
240
structure length
217
Chain Sequence
KDIVLTQSHKFMSTSVGDRVSITCKASQDVGTAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQQYSSYPLTFGAGTKLEQVQLQESGGELVRPGASVKLSCKASGYTFTSYWINWVKQRPGQGLEWIGNIYPSDSYTNYNQKFKDKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARWGYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibody
molecule keywords MUTANT AL2 6E7S9G
publication title The Importance of Framework Residues H6, H7 and H10 in Antibody Heavy Chains: Experimental Evidence for a New Structural Subclassification of Antibody V(H) Domains
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 217
sequence length 240
ec nomenclature
pdb deposition date 2001-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h8nA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1h8nA02
2MQCA 1D3CA 5SWSD 4NFCA 1OTSC 5F7MC 1GYAA 4KHTL 3OAUH 3LN4B 5CGMA 1YN6A 1BQHA 2P7TB 1WQVT 4GKSA 4CMHB 2OZ4H 3QUZC 3KNBA 3EYOB 1YN6B 2BNUA 1C08A 4RGNC 1BQHB 3HRPA 4TVPE 4X6FB 3QBTB 4S0SD 3CFBA 1AFVH 2JCCA 4GKSB 2ZPKH 4WEBH 3KNBB 1C08B 5HHQA 4P5TD 2BOBA 5JDJA 3CFBB 2JCCB 5EU5B 5DC0A 1ADQH 5HHQB 5ICZB 4Q2ZA 5ISZA 3CH1A 2BOBB 5HDBF 1OGAE 2V5RA 4YFEA 2A9MH 3PDGA 4TQEL 4Q2ZB 3CH1B 1ZV5A 2Y25A 3WHE0 5FO9B 3GMOA 5KZCB 3CVHA 3TYGH 3FTGA 1OW0C 4WFHD 1KPVA 3GMOB 1MFAH 1I9IL 3NH7L 1U8HA 4JB9L 4QY8A 4OM0H 3TV3L 3CVHB 2IPKA 1X3DA 3FTGB 5J7CC 5ETUB 3QG6A 3RUGF 3ZT7A 1KPVB 4YC2C 1U8HB 3ULSA 2MOVA 5DVOA 4BSWA 2IPKB 1MRCH 1A5FH 4HUMB 1WCBB 4AMKH 3QG6B 1RMFH 1F8TL 3ULSB 4XPTH 4BSWB 1NGQH 2CDFA 4EQ2A 4G7YH 5C1MB 3WXVL 2AJVL 5C86A 1I8LA 1KUMA 5C0BD 2MFNA 2CDFB 4C54A 2O5ZH 1HNFA 4XNZB 5GS0H 3U0TA 1RIVL 3X14A 4KRNA 1QSFE 4OB5H 1RUQH 4R97C 5MP6L 3HI1B 2YMXH 3U0TB 3UTSD 3LY6A 3X14B 1DEDA 5AYQA 4N8CH 3FMGH 3ARFD 4QOKA 3C60D 4RX4A 3QUYA 4K9EC 4KROC 3UO1H 4WI7A 2E9IA 4QOKB 1BBDL 3T3ME 5EA0L 2BRRH 3OKOA 1X5YA 1BD2E 1BFVL 3U30B 1MY7A 1NC4D 2EEBA 3TESA 4BQ6A 5JLZB 2X9YA 5FKAB 1NCWH 4WVRA 4XI5C 5FO8A 2D4DA 3OKOB 5J89A 1ZVHA 5HI3C 3EO1A 4KK8C 2AQ3A 5IMOA 1MRFL 4JHBA 1GC1C 3K81A 5FO8B 5GS0D 2A83A 1IGIH 5CILH 3EO1B 2ZUQB 5EBWA 5IMOB 5I15H 2YUZA 3WV0A 4ZTOL 2A83B 3CZJA 2F54E 1A4KA 4QNPE 4AYFA 1MCFA 3QHFL 5EBWB 3BKJL 3GSXA 2BXYA 5BO1L 2OR9H 4H8WC 2ICWA 3T04D 1ETZA 1A4KB 4JHZA 1WAAE 4NQSB 4NQVA 1F58L 2HP4A 2Z8RA 5T5FH 2PTVA 5J1AA 3GSXB 1H3UA 3WJJC 5DVNA 1DE4A 4PJHF 1OSZB 1ETZB 2VUYA 4NQVB 1FFRA 2BK8A 5C0DA 5J1AB 1WK0A 3T0XA 2EXWC 1FH5H 4XCNA 1G7JA 1DE4B 4LASL 3TA3D 5GRZA 2GK2A 4HWUA 3SE8L 5J1TC 2XQYK 5FK9A 4NN7B 4PY8I 4XCNB 5LG1A 4APQD 1NFDA 2DQTH 4XXCA 4WW1A 5FK9B 2YWYA 4LOUC 5LQBL 3RWJB 1DTUA 4UTBH 3FKUS 4L4TA 3DSFL 4DZBA 1NFDB 3CJJA 2VR9A 1HK6A 3AM8C 2IFGA 3QUMH 4WW1B 1G7QB 4K94H 4KTYA 4D8PA 1TETL 4L4TB 2FO4A 5EB9A 2EE6A 1Q0YH 3QDMA 2VL4A 1Z6JT 1CDGA 2NX5D 3SO3B 4N8VA 4UNTA 5IVZA 5CP7A 1R3LB 1A7QH 3VXRA 1BIIA 5JZ7C 5I1AA 1MJ7H 4D8PB 3MLRL 2FO4B 1MF2H 5CEZE 3QDMB 2X40A 2RB8A 4JRXB 2DF3A 3IDYB 4N8VB 3L7FA 5CP7B 1DSFH 1PDKA 3MXWL 3VXRB 1XGPA 1GJIA 1BIIB 2Y1VA 3Q1SH 4MAUL 5I1AB 3PV7A 4Y88A 1OWWA 3L7FB 2DMCA 2EDEA 1XGRA 1XGPB 3RWFA 2NTSP 3IDIA 1ZLSL 1U8LA 2FGWL 2A77L 1N5YL 3UBXI 1C1EL 1F4WL 1XGRB 3M07A 1DQDL 4HPOH 3RWFB 3IDIB 3ULVF 5GISL 4DOHB 3SDDC 4YDLB 1RUPL 3TN0C 1DLFL 2GJ6A 3QEQE 1U8LB 1BF2A 2Q86A 4UAOC 1N3NA 2CUIA 5CD5D 2OQJA 2OSLA 3QDJA 1I3VA 3HZVA 5I75C 2GJ6B 1CIDA 2Q86B 1N3NB 3ME0A 2RHEA 3DTXA 1BAFL 1YEFH 1BECA 2OQJB 3BRFA 1X6NA 1N6QL 3QDJB 3MRHA 5HDBE 1KB5A 1YC7A 2AI0L 3HZVB 1U0QA 5HYEA 4R26H 3DTXB 2VN4A 1P6FA 2FIKB 3ZHLA 3GGWB 5BV7H 2GT9A 2X09A 2Z8WC 4XRCA 4RFNB 4ODTL 1A9BA 2BZDA 3NZHH 3V7AG 5B3JF 5FGSA 2GT9B 4F2MA 4XRCB 4MLIA 1A9BB 2D3VA 4Z9KB 3SE3A 2GJZA 4F2MB 4OGAD 3U0WL 4Y5XC 4KZEH 3GKZA 4JPKH 2GJZB 4O02H 5BVJA 2OTPA 4HKBA 1VA9A 1KELH 2WK2A 1JPST 3BZFA 9CGTA 4GG8B 2NXZB 5SWZA 1LDSA 2VJXA 5BVJB 1X9QA 4X9IA 4HKBB 3HR6A 5IJVA 3BZFB 4EOWH 3ILPB 4FTVD 4Q58C 5SWQA 5SWZB 4NQEE 5IKCA 5SWQB 2H26A 3MRMA 4YH6A 4K8RC 4N90E 2AGJL 4OLZL 5HD8C 5IKCB 1MI5A 2H26B 3MRMB 3AC0A 1GAFH 3MV8D 4LIQE 5E9DD 3ARWA 4HC1H 5JTWA 4OZGE 5MEPA 3BD4A 3ZE1E 1MI5B 4L3AA 1KCSL 1R3KA 2A73A 2OMBA 4EDXB 3E2HC 5DHXB 5I19H 4M62L 3B9KD 3QO0A 3FB7A 1UH3A 5GXBB 4MQSB 2J8UA 5MEPB 1SVZA 1UM6H 1M7IA 2NY7L 1CGTA 1KN4H 3O0RL 1R3KB 4M7LH 5FGRA 2ZSVA 2XKUA 1UJTA 3HN3A 3CFIC 5BXFA 3FB7B 1P84J 5FYKH 1V05A 2J8UB 1DQLH 1M7IB 4KUCD 3KPNA 2ZSVB 2VLLB 2VABA 4C56D 3BKYH 4PJAB 4PJBE 5TFSL 5EZIL 1HINH 2JE8A 1JHTA 2ZP0T 4KJPC 3MJ9H 3KPNB 3QIWD 1HWHB 1UKSA 1FFOA 1GGBH 2VABB 1EHLL 2OTUA 2Q8BL 1N7MH 5AZEL 4MVBD 1JHTB 2DI7A 3HC4H 1QR4A 1RURL 1A8JH 1FFOB 4DK6A 2Q6WA 5FV1L 4UI2A 4B50A 2OTUB 1FNSL 1VFBA 1PYWA 5DRNB 2CKBH 5D1XC 3SOBL 2HMID 2R4RL 5KAQF 3BN9C 1TPXC 3HFMH 1Z3GL 2PXYA 5BRZA 1VFBB 1PYWB 4YXLL 4P49A 4A6YH 5DI8A 1F5WA 1WT5C 3QWOA 4KU1A 3HE7A 4KJQC 2PXYB 4MQTB 5D2LA 5BRZB 5FYKD 4E41A 5DI8B 4JO3L 3QWOB 4QRSB 2R1YA 2A2QT 3HE7B 5D2LB 2BCKA 5JA9A 4E41B 2AEQH 4LCCA 2R1YB 1CD9B 1UYWL 3WNKA 3DXAE 1MQKL 4O9HL 2BCKB 5I1EL 4F37F 3EZ8A 4GBXA 1EBPA 1LDPL 1PBYA 2B8OT 1QBLL 2NY3B 4KZDH 3HB3C 4DEPC 3GBNH 4GBXB 2ZJSH 5ACLA 1U8OA 1LO3L 3OMZA 4OZ4B 3S5LG 2PYFA 4Z5RA 2YA1A 2F74A 3X12A 1U8OB 1HHHA 2PYFB 4Z5RB 1UWEH 3BEVA 3ALPA 5IG7A 4M6NL 1BX2A 1TJGL 5IMLA 3ARDC 2F53D 1KGCE 2F74B 3NTCL 4Y5VA 4IM8A 4H88H 5CJQL 4WI3A 1IAIL 1HHHB 3OKLA 3K2UH 3ULVE 1FPTL 3BEVB 5IG7B 7FABH 4XAWL 1BX2B 5IMLB 4XNXL 3ARBC 1EEUA 4YHPA 4Y5VB 1QQDA 3WXWH 3JTTB 1KEMH 3OKLB 5TE4L 3MBEC 1W72A 4M8VA 4YHPB 3V0AC 1DBAL 4KK9D 1QQDB 2DQHH 1ND0A 3DHJA 2ATKA 3S88H 2ZCKH 4CN6A 4FZEL 2CR6A 3C5ZC 3M8OL 1BZ9A 1MEXL 1B4JH 4WHYH 3ULVL 1LNUA 1ND0B 4LCWE 1Y6KR 2ATKB 1ZEAL 3BKCL 4BQBA 4RA0C 1X5GA 1BZ9B 5DVMA 3RWGA 4X80L 1LNUB 4OLXL 5GGSY 1D5XA 5C0CB 5T3XE 4AG4H 3IU3A 3X3FH 4HK0A 2XT1B 3VW3H 4X4ME 4RWYL 4WHTB 1D5XB 2EYTA 3H2WA 3IU3B 2XOTA 5I30L 3TH4T 4IMLA 1ZT4A 1L7IL 2Q3AA 2W59A 4HK0B 3TVMA 4QHLA 2L7UA 3ULUH 1P53A 3BE1L 1AJ7H 2EYTB 4CN4A 5MENE 5I18L 1NUFA 2XV6B 3FB5A 1GGUA 3O6FA 3WFDL 3DX6A 4IMLB 1ZT4B 1E6OL 3OKEA 5AG8A 4OD1H 1OPGH 1TMCB 4QHLB 4TSCH 3QRFM 2J5LC 5T3XL 4HH9A 2NNAB 3O6FB 3OKEB 1FNFA 5EU6B 3KPPA 4R96A 5ADOL 4HH9B 2DAVA 3VFSA 3T0EE 4P4KA 4IIQC 4OZFA 2NYYC 1UM4H 4JG0L 5DJXA 1N0LA 2VQ1B 3KPPB 4R96B 2Z0BA 5CJ8A 2ZG1A 4MB5A 4OUOA 3VFSB 3QNXA 4M5YL 4OZFB 3D1MC 3B9KB 2YPVH 4QRUB 2P5EE 5DJXB 4GXUM 3UTZA 1SYVA 2DKUA 5JQ6L 2R69H 4KDTA 5B22A 1C7TA 3ULUD 1EAJA 4JO2L 4P3CH 2FR4A 3UTZB 1SYVB 2X4TA 2XY1A 2H2PD 2F58L 1EEYA 2OXHA 5J13C 2H1PH 2FR4B 2X4TB 4DGYL 2XQBH 2J88H 3O45A 2HFGH 1EEYB 1WBZA 2C3GA 3B9EA 5H37G 2RQ8A 3OKDB 3O45B 4LVOC 3FJTA 5DFWH 4Y4KC 4I9WE 1MJ8H 1GHFL 1WV7T 1MCWM 3SCMC 5DJCB 5GRWA 4WUUE 1NAKH 1KEGL 3UJTH 4Y2DD 3MC0A 4W4OA 4RMWA 5E03A 4LU5H 4ZYKA 4LVEA 4Z8FH 4BSVB 1CDBA 1WBXA 3BHBA 4ZYKB 1KC5L 2Q3ZA 3LPWA 2XKNA 4P2RE 2F15A 1QFUL 4HS8H 4YR6B 1E4WH 2IPTL 3P4OA 1I85A 3WNMA 3TFKD 2VWEC 2D31A 3O9WD 2GFBA 3BHBB 1FVCA 3HE6A 1UEYA 2PKDA 2XKNB 1RZ8A 4LSPH 4XAKE 3P4OB 1CF8H 1EGJA 5JQHC 2D31B 4K3EH 3TCLA 5BS0D 4MNHA 2GFBB 4G7VH 1FVCB 3HE6B 1YY9D 5J11C 3STBA 4NC1E 3TYFA 1YEGH 5FUCC 3TCLB 4MNHB 3MV7E 4AIXA 1MCKA 3F6IA 2OI9B 3TYFB 3HAEA 1MFBL 2M1KA 3TM6A 1X6LA 3MLXL 2E6JA 1UZ8A 4HWEL 3IKKA 1GZPA 3HAEB 4G9FE 5F9WB 2WQ8A 4XWOD 4RGNE 3W2DL 3RIAF 1UZ8B 1XAUA 4P99A 5I71C 2P5WA 1GZPB 4UZGA 4X8XA 4XC3L 2X1QA 1IC7L 5I17A 3Q3GA 1L6XA 1YQVL 1HYRC 4M48H 5FXCH 3GIZH 4P3WA 2J8HA 3E8UH 4J12A 5LJYH 2B1AL 3Q3GB 3IFLH 3RY5A 1XF4A 1QSEE 3RTQD 5L2KD 5HHXL 3EIFA 1XF4B 4PYGA 4QGYA 3T3PF 5ERWA 3HI5L 4HS6B 3FQXA 2P46B 2OJZH 1OTUD 5EC1A 5IEHA 5K9QI 2IG2L 1NGPL 1ZE3C 1MIMH 3I6KA 3OPZL 5ERWB 2Z35A 1J5OH 5EC1B 5IEHB 2DDQH 3GI9H 3L3KA 3I6KB 3NABH 4XP1H 2Z35B 4DUVA 2PUQT 2AQ1A 5I1HH 1U92A 1H3XA 1GZQB 1S5IH 2UYLA 4UV4H 3MACH 3HG1A 5KJRL 5I74C 3L3KB 5E94A 1WF5A 3L5JA 4XP6H 2YD6A 4PJ7A 2UYLB 3KWWA 3HG1B 1RK0A 1Q8MA 2AW2A 4AEHL 3MNZA 1OP9A 2Z31D 5E2TH 2E5EA 5E94B 5F1KC 2AERT 1RUMH 3CXDH 4I3RH 2XWBB 4PJ7B 3KWWB 3OZ9H 1WFNA 5DMIH 1RK0B 1T03H 2VLRD 3MNZB 1LVEA 3LDBB 3GZKA 4BFIA 1GIGL 3VFPA 2EICA 4ZO6A 2EYSA 2IANA 3V0WH 3TJHD 5D96B 5JW3L 4F9PC 1QR1A 4BFIB 4OF8A 3VFPB 1CXLA 4JFZL 4E5XA 1D6VH 2IANB 3WE6A 4OD3H 5IR1A 1HE7A 4OF0A 1DFBH 2M26A 4Y8DC 4M7KH 1MREH 1QR1B 2AKRA 1YYLL 1CVSC 2CXGA 2QSCL 5IR1B 3A67L 4HAFA 1NJ9A 3MRQA 3EGSA 3OJVC 2IFFL 2FEDD 5F7DA 1NJ9B 3D5OF 3MRQB 3EGSB 3WFEH 3FO0H 1OSPH 5ID0A 4XBGA 5I9QB 3S3SA 1I9EA 4JFOA 1LO0L 5F7DB 4G9DA 3WUWA 5DJAA 1X4YA 4AZ8A 2APBA 5ID0B 4XBGB 1O0VA 4JFOB 2P45B 4G9DB 4PJGA 2ESVA 3WUWB 4Z7UE 5DJAB 1UM5L 2EKJA 5CWSA 4K9EL 4KKLD 4IJ3C 2JJSC 4JRYD 2XFXA 2FX9L 4MS8C 4FQJL 4NP4H 4PJGB 2ESVB 3HZMA 5CWSB 3TPUA 1U36A 2XFXB 2YEZA 5F7YC 1T1XA 1CFBA 4XCEB 4M6AA 4ELMF 5CSGA 3TPUB 1GC1L 2YEZB 3L1OL 2V2XB 2HVJA 4L4JA 4BZ1L 4JR9L 3S37L 1LP9E 1T1XB 4I0PD 1F97A 1G9NH 5DJ2A 4XMKH 2UWEF 2HVJB 1JP5A 1S7RA 3CSYA 3O9WB 4S1RL 3RIFK 4I2XA 1S7RB 1BPVA 3CSYB 3DV6A 1CXKA 4KK6C 4QHKI 4DKFH 1H3PL 2EH7H 4I2XB 4PBVC 4P9HC 4TOYH 5GGVL 3NCBB 2BJMH 3O6LL 2DI9A 4BH8A 3RGHA 4N8VG 5JUEH 4XMLL 5D6CA 2W07A 5T1LD 1HYSD 1MFCL 3A6OA 4XP4H 1L7TL 2YD4A 2A38A 3WS6A 3F58L 1FORL 3HS0A 4BH8B 3KXFD 5GSVA 1UG9A 4FFYH 3U82B 5D6CB 3FO1B 1DJSA 3H42L 3HS0B 3GMQA 5CD3A 4JPWH 4IRSA 4L3CA 5GSVB 1N64L 4L1DA 5C6PB 3MZGB 3ESVF 3BESR 4PJDF 1MCEA 2CO6B 2E3VA 1UB5A 4ENED 4IRSB 4L3CB 2Z93A 5DA0B 4KJWD 3SDXB 3UBXG 1UB5B 4PD4J 5ISZD 2L4OA 2PYEE 2Z93B 5FHBH 1H0DA 4HIJA 4LRIC 4F57H 4POUB 5T1MA 1KJ2B 3BDXA 4UT7H 3MYZA 1O7SA 2P43B 1H0DB 2XWJA 4HIJB 2ZCHH 3LQZA 5E8NA 2BHYA 4YHKL 5T1MB 3CK0L 2X4OB 2FATL 1QLEH 3O11A 2XWJB 5E8NB 4JKPL 1J0IA 1MWAL 4I48A 3WIHA 3A6BH 4PJ5A 1Y6NR 3ULUC 1RZJH 3P11L 4PJCF 4WTXA 5L6YL 2H2PC 4I48B 5HPOA 3KR3H 4PJ5B 1JWMA 1JGVH 1A3LH 3G04A 2CH8A 2NY0C 4Q9QL 4JFEE 1JWMB 5D7IF 3MMEA 3FQRA 4P2QA 7CGTA 5ABDE 3G04B 1U2HA 4YDVA 4R2GD 5D8JH 5GGUA 5BJTA 3MMEB 1G84A 3FQRB 4P2QB 4M00A 3GKWL 4Z7WF 4YHYC 2BP3A 3PXJA 1IGCL 4YDVB 4P59H 1JZ3A 5GGUB 1Q72H 3KG5A 4HX1B 4PJFF 5BJTB 4NCDA 1QFOA 4EN3D 4OBSA 5CZXC 3OL2A 1SBSH 3OHXA 1AC0A 2XI9A 2QADB 2R2BA 4YDJA 2FHBA 1UCTA 1MCDA 4K23H 3RGVD 3DSNA 3DJ9A 3OHXB 1BJMA 5F6IB 3TNNA 2AJUH 3QUYD 4RX4D 1W0YT 5HHOB 1LK3L 4YDJB 5ITBH 4LBEA 5DSCB 5DJDA 4JO4L 4NRYA 4L4VE 3VXMA 2JELL 1ED3A 3KPRA 3AU1A 4LBEB 1CD8A 4MYWB 5DJDB 5D93C 5FYJH 5JHLL 4N5ED 5GZNC 3EOBA 4B53A 4ZS6D 3VXMB 3EO0A 1T1WB 1EJ6A 3FHQA 1ED3B 3KPRB 3RY6A 1N0XH 3I02A 5IB2A 3AU1B 3TO4D 3F7QA 4LRNH 3EOBB 5HYIA 3X11A 2EE9A 3EO0B 2BVUA 4LVNB 2MKWA 4AY0A 2DQEH 1YEEH 3I02B 3HUJB 5IB2B 5DUPL 4LLUA 5EO0B 3FO9A 3RL1A 3P0YH 3X11B 4OZIA 5HHVL 4HT1H 5HI5D 3CFCL 5E00A 4XNQA 4LLUB 3FO9B 3RL1B 2BXZA 4H0HB 2RIKA 3ZTNH 3MLZH 2Q7NA 4LHJB 5B4MD 4OZIB 1DN0A 2ZOLA 3S4SB 5F88A 3N1QC 4I0PB 2HKHL 4XNQB 1YMMA 2HJFA 1EMTL 1DN0B 2ZOLB 3BPOB 5F88B 1ULVA 3QXDA 3F65A 2JB5H 4JZNA 4OLWH 4XP5L 2YPLE 5FYJD 1YMMB 1J8HD 1QEWA 2HJFB 2R0KH 2VO5A 3RTQC 4ZAKC 1PX3A 5IROC 3UROR 1QHPA 4JZNB 5L0QC 2VOTA 2UWEE 2YA0A 4DFHA 2DM3A 3CX5K 2X41A 1QEWB 4NGHL 5F21B 3GJFA 2DTSA 1JPSH 1XIWC 3CD4A 4N0YH 5DJYB 1OM3L 3F7RA 3IDUA 4QXGH 1QO3B 3GJFB 1OARH 1X5KA 5KVDH 1E4XH 4MA8L 1A7PL 5DT1H 2A6DB 3P4LA 3ARTA 1KB5H 1MNUH 4YPJA 1KENH 1VHPA 2QQNH 1D5MA 1M6OA 4HEME 4GG6E 2H3NA 3AUVA 1AKJD 1C5CH 3IDXL 1D5MB 1M6OB 1YNLL 2Z31C 3SKNB 3NFPA 1WZMA 2H3NB 3KYMA 1AQKH 1G7LA 1ZK9A 5D5MA 2APVA 5FHAH 3KYKH 5C0BE 3C6LD 4WCYL 4DWHA 3NFPB 4PRID 1XT5A 3KYMB 3O3AB 5D5MB 3ARRA 3GMLA 3QRGL 5AD0A 3PDOA 5GPRA 4Z0BH 1JGDA 3MA9H 5DMJB 3BRGC 3REWA 4U1SA 5J1SC 5AD0B 1CU4L 3PDOB 5T33H 3VWJD 4M1GH 2G9HA 2BSRB 5I6XB 1JGDB 5DD3L 4GMTL 1CLYH 3N85H 3REWB 1L9MA 3EYFA 2C3XA 2Y5EA 2G9HB 1UCBL 5E5MB 5GRXG 3EDDA 1YJDH 2J4WL 4CNIA 1TQBB 2CIIA 4WHCA 3EYFB 1PKQB 3MV9D 2B4CL 4QRPA 4NQDA 5JO5A 4LLMA 5I1CH 1MIEH 4JG1H 3VXUD 3IDNA 2EDXA 3VXNA 2X4RA 5ACZA 4QRPB 4NQDB 5JO5B 3HA0A 4LLMB 1MCHA 3GSNL 1BVKA 1KCRL 1P9MC 3IDNB 4YHZH 3VXNB 2X4RB 5ACZB 2HVKA 3M17B 5A2KH 3WIFA 2IPUK 4JKMA 4PJ8C 1K3ZA 43C9A 1BVKB 4TUJA 5CSZA 4MB4A 5D7IE 1MY5A 2HVKB 2NPLX 4NBYB 5IWLC 1FG2A 2NXYD 43C9B 2E9BA 1T7YA 3MLYH 4TUJB 5CSZB 1HKLL 1Q9LA 2ICWJ 4Q0XH 4M43L 3EYQC 4UINH 1I1AA 1FG2B 3T1FA 1Z9SA 1C8PA 1Q9LB 5L8LB 1JZ8A 1ZSDA 1I1AB 3OJMB 4PRDA 4XCCL 2WNGA 4WUKH 3T1FB 2VLKD 1YQ2A 2Y07L 2C26A 3BZEA 1MAML 3H0TA 3HR5A 1ZSDB 3PQYE 4BFEA 4U49A 4PRDB 4JM2F 4J1UB 1B2WL 2J8OA 5TPWH 2XQYG 2AP2A 3MUZ1 3BZEB 3VXSD 1TJHH 3H0TB 3HR5B 1X44A 2DYPD 4M9PA 3DMMB 3IDMA 1J1OL 4QTHA 4Y16A 4L29A 4EIGB 4L8SA 1CDIA 5EZOL 4ZFFB 3BEWA 3IGAB 3BQUD 4CMHC 1H8NA 1HYSC 4QTHB 1LHZA 1OT2A 4Y16B 2RCSH 4L8SB 4NKIL 3CFEA 3BEWB 3BP7A 1P5VA 5C07A 5DHVA 1AY1L 1G9NC 4UV7L 1K5NA 2FB4L 5CGYC 1OAXH 1ZS8B 3CFEB 3BP7B 5C07B 4NHCH 1QBML 5DHVB 1KTKE 5E7BA 1K5NB 2O5YL 4ZPTA 4M7ZB 4NM4L 2WIIA 2YA2A 4FXKA 4OF3A 1QUNA 1NGXA 5L7XL 4WY7H 5E6ID 3FQNA 1VERA 2WIIB 1G6RH 4Z78B 4FXKB 5DC4B 4PTUA 4RMRA 1NGXB 4D3CL 4DAGL 2JF1A 3FQNB 4NKDA 4KI5D 3PWPD 1NAMA 5IFHL 4I77H 3PL6D 3V6BR 3V4VL 4NKDB 4KKBD 2VWEE 3KVQA 5IIEB 5MEQA 2X1WL 1NAMB 1LK2A 4DW2L 2Y36L 1EFXA 4DJMA 1ZGLM 3K7UA 2XICA 3QQ9C 5F7EH 2NMSA 4GQ9H 1WICA 1LK2B 1EFXB 2ORBH 4NJAH 1JI1A 1QRKA 1W72H 4H20L 4JFFE 4PRPE 5EU7C 2EC9T 2R4SH 1RV6X 3BDYH 5FUCE 4NPYA 3V52H 2AEPL 2HFFA 2DQIH 3AS0A 4X9HA 5CIPA 2X6MA 4KHXL 4Z95L 3O4LE 4LGSB 3HAEG 1EERB 4NPYB 4UOJA 3VFRA 3DVIA 2EDBA 4XNZC 2HFFB 5CIPB 1E4XI 5DF0A 2HYMA 1I8LC 3UTTA 4R2GC 4KY1H 3MBXL 4S1DD 5E5UB 4DN3L 2HH0L 1A7OL 3PP4L 1R6VA 1IM3B 3TT3L 3UTTB 4GAGH 5F3BA 3RHWF 1BVLA 4X7CC 3O4OC 4LARL 5E4EB 3VG9B 4FTVE 5F3BB 2R8SL 3JV5A 2VTFA 3GRWA 1YY8B 5DURD 3U30C 3QUYC 5IHBA 4KWUA 4V1DD 5DEGB 4TPRH 4KV5E 3HCVA 3V6FA 4IDJL 2SEBA 3MJ6A 1TTGA 3SPVB 1C5DA 3LB6D 3O3EA 3P9MA 3EJZC 1L0XA 4HAGA 4N5EC 1UZ6F 3HCVB 5E9DE 3V6FB 1RZFH 1EBAA 1B90A 4N5UA 3WIIH 4X83A 1TJIL 2ZUQC 4DFIA 1VGEL 2HFTA 1C5DB 3O3EB 3TO4C 2J6EH 3P9MB 4DTGL 3QI9D 1U8JA 5INDA 5KANI 3P40A 2XRAL 2XTJB 3R06A 4S2SA 5GJSL 1FYTD 1NCTA 3VCLA 5IMMB 1U8JB 5INDB 5IESH 1UWGH 3CU7A 1WWBX 3VH8A 3R06B 3TVMD 3VRLE 4J4PD 3VMPA 4I3SH 4RCAA 4BH7A 3ISWA 4WTWA 3VCLB 4Y4HB 3U7YH 1UGNA 1W8OA 5J4MA 3GO1H 4KKAD 2EDNA 4BH7B 2G5BA 4POYA 1A02N 1H15A 4KQ3L 5C09D 3JVGA 4PYHA 1VENA 2BNQD 1WEJH 3TZVA 4LSRL 3LKRA 1K3IA 2G5BB 1UJ3A 4U0QB 4U1HA 1G9MH 4P4KD 3TZVB 2D7TL 2AS5M 3RI5K 3R1GH 4MXQD 4XXCC 3C9NA 1KB9K 2Q8AL 3RPKA 1UJ3B 4OCXH 4YK4B 4MAYD 3K74B 4U1HB 4AENA 3K4AA 1T1YA 3UYRH 3OTTA 5FYKE 3S35H 3SO3C 3C9NB 1JZ5A 3CAFA 1A6VH 2YN5A 4KFZC 4JFPA 1YYML 2IAMD 3K46A 2KQMA 4AENB 1T1YB 3IDYC 4K3JH 2XG4A 4MNGA 3SDAD 3QCVH 5FECB 3QXAA 4JFPB 1CXIA 1KNOA 3VGAB 3WUWG 1RJLA 1FNAA 4MNGB 4YQXH 2YK1H 3RPIA 2EO9A 2NY6B 4PGEA 3IJYA 3SJVB 4KH2A 4NCC1 3QXAB 1KNOB 2A74A 1MHEA 2W0FA 1F4YH 3RPIB 4PGEB 1TCMA 3IJYB 3VD5A 2LQRA 2A74B 1DBBH 1UQSA 1MHEB 2W0FB 4EZMA 1QRNA 1S5HA 3BYTA 1LGVA 4K2UH 5CINL 3GK8L 1H3WM 1NH6A 1I3UA 2ADFH 1UQSB 2ADGA 3OKKA 1QRNB 4JZJA 3WKNA 1TQCB 3X3GL 2R0WH 3OKKB 1CICD 4PJEA 4YE4H 4JZJB 3QIUA 1WJ3A 1R3IH 4P3DB 4HFWA 4R7NA 5T3ZE 1ACYH 2CDEA 4PJEB 3D3VA 2E27L 5IBLC 3QIUB 1Z2KA 4JHWH 1LO4L 2VDPL 2X9WA 5JIIA 1ROWA 4R7NB 4RFNC 1ZHNA 3F7PC 1MCNA 2CDEB 5BMFL 3ZSSA 3D3VB 4QYOA 3V6OC 4Y5YA 4G8GE 3DGCR 4NUJA 1ZHNB 1ZAGA 1GSMA 4JM4L 1CGSL 2JIXD 3UTPD 4YUEH 4QYOB 1B0WA 3D39B 5BVPL 3OB0K 4NUJB 1AP2A 1KF9B 3DYPA 4KTDL 4GRLA 3SE3C 3G6DL 3DUUA 3DYMA 1LMKA 4KGLA 1ZLVK 5GRVL 4OIIH 2OBGA 1AP2B 1FFNA 3FQUA 2AV7A 3ZYZA 2NXZC 2V17L 2ZNXA 4P9HL 3U9UB 3DUUB 4FP8H 3S36H 3LD8B 3S35X 3P2TA 5IFAL 3QCTH 3EHBD 3VGBA 2R0ZL 3T65B 1FFNB 2AV7B 2P5WD 2KH2B 3MLVH 1T22A 5FUOL 2DQDL 4MXVF 5EBMA 2XACC 2A6IB 5FYLE 1HNGA 5I8OL 3D9AH 4LHUB 2WM0A 3MJ8A 1X4ZA 1T22B 3KGRA 2VXVH 1ZMYA 5EBMB 2AJYL 4OCRL 1JE6A 1TZHA 3LMJH 5ACMA 3MJ8B 3MV01 3DYOA 4O4YL 4KVNH 4F3FB 4WI9A 5C2UB 4YDIL 5DUMH 2C1OA 4NDMA 1FZMA 3TJEH 1TZHB 2X9XA 2DWDA 4KAQH 1FE8L 3PGFH 4FQCH 5TF0A 1J18A 3G6JE 1IAKA 5CEYA 5JXED 5A2FA 2ITCA 4J6RH 2C1OB 2F5AL 5FYLL 3N50A 5CEYB 3QHZL 4RMSA 4J3VA 2ITCB 4MLSA 2NY5L 3QFJA 3SBWC 3I84A 4FNLH 3ULUE 5AWNH 3QDGD 1OP5H 5IHZA 4KKNA 2DJSA 4JPVL 4JY4A 3WHE1 3EYUL 3QFJB 1J0ZA 4Q9RH 5IHZB 3W11D 4WO4D 5KVEL 4JY4B 2H8PA 1FGNH 1SBBA 4YEEA 2DQUH 4XH2A 5DDHA 4C4KO 3HNSL 2BSED 3H8NA 3UC0H 3H9SE 2H8PB 5C09B 3CVIL 3TPKA 2B1HH 4WV1A 1QFWL 3RNQB 1T66C 1A7NL 4KHTH 3ARSA 4FQ2L 1GOGA 2DLIA 1X7QB 5E6IC 4WV1B 1A1OA 2H32A 2PXYC 4OTXL 2VDRL 4R6UA 1DZBA 4P5MA 2VSDA 1FBIL 3FAWA 2B0SL 1A1OB 2XPGA 4BFGA 2A6KA 3HE7C 3O2DH 4P5MB 3MRJA 3S36X 3OAYK 2XPGB 1GGCL 3GJEA 4WI5A 3OB0H 4GFTB 2FECI 3MRJB 3V6ZB 3BGFB 3TBSA 1MJJA 4LCCC 3GJEB 3ARQA 1L4IA 1ZLVH 4S1SL 3NOIA 4TQEH 2NY3C 1XMWA 4LQFL 4RMTA 3TBSB 4Y4FD 3BPLB 1MJJB 1BREA 4GBXC 4I1NB 4L3EA 4M6ML 2BY2A 4CVWA 5JMRA 4FQLL 5HVFB 2APXA 4LLYA 2ZKHL 1I9IH 2CRIA 4JB9H 3JXAA 4L3EB 3OF6A 2AVGA 5MI0B 1AGCA 1YEHL 4JN2B 3WD5L 3S4SG 3THML 1D5IL 2XNAA 3QZWA 1A0QH 2I07A 2X4NA 2MWCA 4MD5A 4HWBA 4HG4J 1F8TH 3MRFA 4PP2A 4Y5VC 3G5XA 3QNZA 2X4NB 5IW6A 2EZ0C 4MD5B 1U8QA 1X5LA 4S1QL 3MRFB 1T7XA 4P57A 4PP2B 1EZVY 3WXVH 2AJVH 4D9RE 3G5XB 3QNZB 2KZWA 5IW6B 3ZKND 3NIFF 3UJJH 1U8QB 4OQTL 2DRUA 3T4YA 2LTQB 1RIVH 5L2KE 1JUFA 2YZ1A 5GS3A 4X6EA 5MP6H 4EDWL 4M6OL 1DQJA 4HIIA 4UDTB 3T4YB 4PGJA 4QRRA 1ZHBB 4LSTL 4P46A 3BRDA 1JUFB 4FQQA 2NW3A 3AGVA 3MOBL 3LCYA 4X6EB 1DQJB 4QRRB 3ALXA 3UZVB 1UA6H 4CJ1A 3NFSL 4H0GA 3GMNA 3QR2A 4FQQB 4QF1A 1LE5A 2R9HD 1RZKL 4OFYA 2AK4B 1BBDH 3GMNB 1BFVH 1AGBA 4QF1B 1LE5B 3NCJL 4RBPK 4MZ3A 1FVEA 4A2LA 1CK0L 3RDTA 1XR9A 4K7PL 3TVMC 1MRFH 1CIUA 2XZCH 5SX4H 3IDJA 1FVEB 1NDGA 1KB9J 4X4XA 1CE1L 1F42A 3RDTB 1XR9B 3O6FC 2DIAA 1OL0A 2AQ2A 1I9JL 4O2CA 5KOMC 2WMPA 2VLRE 1FFQA 2ENYA 2HLAA 3IDJB 4ZTOH 1NDGB 1XGUA 4X4XB 3LKQA 1IKFH 5I2IB 5DUBA 3BT2L 4UUJA 3QHFH 4O51A 4O2CB 3GB7A 3BKJH 1OP3K 2HLAB 1T7ZA 4HUKB 2XA8L 4N0CD 1XGUB 5BO1H 2G5RA 4TNWK 1I7RB 4QRTA 1N59A 1QG3A 5DUBB 3LZFL 4O51B 4P4KC 3GB7B 4PB0L 2NLJA 4HIXH 1R3HA 1X5ZA 1JRHI 4QRTB 1N59B 3OQ3B 4FQXD 1QSFD 2BSSB 2NLJB 4GAJL 1R3HB 4LASH 1H3TA 3SE8H 2QQLL 3ZKMC 4HJJL 5D7JD 4YBQD 4BZ2L 5L9DL 2GCYA 4XCFL 4HV8A 4X6DF 1IQWH 4N68A 5LQBH 3UDWA 3SY0A 1NBVL 4JAMA 4PV8A 4YXKL 5GGRY 1BFTA 3DSFH 2ATPA 2GYSA 3Q48A 1MFEL 4HPYL 5KN5A 4PS4L 1TETH 3SY0B 4JAMB 4N8PA 4PV8B 3JV4A 4LF3A 3TWCL 4YGVA 4LCIL 1VB9A 1G9MC 4H26A 5KN5B 3BYYA 4IDLA 3MLRH 4NJ9L 4XBEL 3JV4B 4LF3B 4GRWE 4YGVB 5IBUB 1WZLA 1IE5A 3LHPL 3MXWH 1SVCP 3DHMA 5KSAD 1TZGH 1V7NL 4MAUH 2HFEA 4MJ2A 2QL1A 3U4AA 2NY1D 3FFDA 1JZ4A 4W4OC 4E42A 4FA8A 3VA6A 4OCNC 2HFEB 4X7FC 4FZ8L 2EDDA 3FFDB 1ZLSH 2FGWH 1NFDF 2A77H 1N5YH 1A22B 4E42B 4HF5L 1DQDH 4AEIL 1I85C 1RUPH 1DLFH 4PJ9D 4ZXBD 1KJ3L 5ID1B 2FD6L 2VC2L 3HE6C 4QO1A 4K3HA 1NCDL 1JTTA 4ELMA 2C9AA 1R5IA 1ZWIA 4RBPH 1YPZF 5J8OA 1BAFH 2WW8A 3V2AR 1N6QH 2AI0H 2OI9C 1D5BB 3WJLA 1R5IB 1ZWIB 3G6AA 1E27A 3MNWA 2Y5TA 3N9GL 4R4BA 4MA7L 4O2EA 2RR3A 2VQTA 5F9WC 4XHJD 2DKSA 3ZKXC 3SDYH 4KRPD 4PBWD 5E5RB 3G6AB 4YO0A 3KXFE 3MNWB 2Y5TB 3RVWC 5C71A 4R4BB 4O2EB 4ODTH 4K07A 1ONQA 4CDGC 1OP3H 5C0RL 4YO0B 1NCBL 3BIKA 1J8KA 2JCCE 4BUHA 2ZUSA 1ONQB 4NFDA 2X44D 4WI8A 4D9QE 2DBLL 3IRZA 3U0WH 3BIKB 1U8NA 4ZOAA 1FC2D 3MUJA 5ISZE 4PJIE 1JFQL 4JHAL 5HTSA 3DRQA 1WTGT 1U8NB 1ODAA 3CSPA 4YGAB 1OGAA 3NIFE 2Q76A 3F5WA 4BZYA 1A2YA 3QEQD 5I66A 5D1ZA 5EUKA 3EJYD 1OGAB 2Q76B 2WINA 3F5WB 5DVLA 1IGJA 3JUYA 3DI2B 1A2YB 1CZ8H 4Z0XA 5I66B 5D1ZB 5EUKB 5EWIL 4DVRL 2GHWB 2WINB 4I18A 3D25A 4HZLA 4N1HB 4HCRL 1IGJB 2AGJH 5E6ZA 3NIGE 3EFDL 4TUKH 4ETQA 5K9OA 5EU7E 3D25B 4HZLB 2F9BT 1KFAL 3MOAL 3CVHL 2ICES 4JY5H 1II4E 1KCSH 5K9OB 3LDBC 1I8MA 2JJTA 4M62H 4NKOA 5DLML 2QTEA 3U7AA 4YWGL 3W5MA 5CLWA 3OBAA 3F6LA 3KYOA 2NY7H 2V2TA 5D96C 3O0RH 2ZCLH 4RRPG 5GGQL 3LQAH 1I8MB 5BZDB 5CBAA 5I1DA 3FFCD 5C0AA 1MUJA 3FQTA 4JFXA 4YPGA 1KSRA 3KYOB 2V2TB 3GSVA 4GXVL 5IQ9B 3QIBA 4HUUA 5CBAB 4D0DA 1MUJB 3FQTB 5TFSH 1XF1A 5EZIH 1FSKC 4JFXB 4YPGB 2XXMB 3GSVB 1GGIL 4JLRB 5EBLA 4JVUA 3RJDA 3H9YA 3QIBB 4HUUB 1RU9H 3JSSA 4D0DB 1EHLH 1QSFB 1IZJA 1DQML 2Q8BH 3BFOA 1R5WA 4QOKE 5AZEH 3TBTA 5EBLB 1FNLA 4KRMB 1RURH 2D0HA 4JEGB 2D9CA 3CDFA 5D7JB 5I9QC 1FNSH 1NFIA 3BP4A 1R5WB 2FX8L 4Z7WA 5CFHA 1ZA3A 3TBTB 3IFOB 1Z3GH 3DO7A 1BD2A 5EFIA 4PJFA 4L5FL 4NQED 3P4MA 1N5AA 4MQXC 3BP4B 4LPTA 4YXLH 4Z7WB 1ZA3B 2HA1A 2J8UF 4LKCB 3FN0L 4RMVA 1BD2B 5EFIB 4PJFB 1IM9D 2I5YL 1N5AB 2COQA 3P4MB 4PJAF 4LNRA 5DS8A 2W9LA 1CTOA 3BUTA 1TVDA 2H41A 4LNRB 4HDIB 2F54A 4IOIA 5DS8B 4IRJD 5CLTA 2WBJA 1UYWH 1KCKA 4NIKB 2VAAB 4O9HH 1NSNL 5I1EH 4ZODA 1VFUA 4Q74A 2F54B 3NPSB 4IOIB 1QVOA 1KN2L 1LDPH 4OCSH 2WBJB 1QBLH 4JFHE 1IBGL 3V9FA 2IQ9L 1EAPA 5GRUL 1NC2D 3ARGD 4PY7A 2Q20A 4W6WB 3DNKA 1BHGA 1LO3H 1INEL 1SY6A 3MX0A 3U7WL 3KLDA 1JHKL 3JV0A 4PY7B 4DN4L 3V5KA 1TDQA 4JCMA 1TJGH 4HMDA 5D2LF 5EDXA 5A43C 1U3HD 3K8KA 5T1KA 3V5KB 4OD2A 4PRHA 1ZT1A 1IAIH 1HKFA 1FPTH 3PHSA 4LSDA 4HJ0C 1P6AB 3NZ8A 4UILL 4L4TE 4XAWH 4XNXH 4Z7NF 1EA9C 5T1KB 4OD2B 4PRHB 4ZQKA 3T0AA 1ZT1B 5TE4H 4Z77B 3VI4E 3NZ8B 1MSPA 3QDME 1DBAH 4ZQKB 4XB8A 3DBXA 3RWDB 3ECBA 3KLHC 3VXRE 1TFHA 3WS6C 3MFGB 2UZYB 4NO5A 4WFED 1ZT7A 1I4FA 3DBXB 3MGTA 1FCGA 3M8OH 5JW4N 1MEXH 3ULVH 2VH5L 3NPZB 4N0FA 4EIZC 1ZEAH 1L9NA 3BKCH 4NO5B 5FB8B 1IAOB 4XVSL 1ZT7B 1I4FB 2OX5A 3FB6A 4IRSC 4XNMA 2VZVA 4WEUD 4X80H 2WLYA 4N0FB 3DXAD 4OLXH 5KOVC 3OGCA 3IAQA 1I8IA 5DRZA 4B5EA 3FB6B 4XNMB 2GQHA 4PRNA 4U31A 4RWYH 4PRIE 1I8IB 5DRZB 1A3RL 3HI6L 5I1GL 1L7IH 2CSPA 4NNPH 1KTLA 5DRXB 4PRNB 2EECA 3QDJE 3UMTA 4CVXA 2ICEA 5DZNA 3BE1H 5I1LA 5I18H 3MLSL 1IC4L 1XCTA 3NMEA 3RKDD 3WFDH 2E8YA 1E6OH 1KTLB 4FABL 2AJXL 1IEBA 2ICEB 4LPVA 4AH2A 5T3XH 2G60L 1XCTB 3ULVD 3VRIA 3GUTA 1IEBB 1BGXH 1WFTA 4AH2B 3N1FC 5ADOH 1DUYA 3VRIB 3V6OE 2VQUA 4ZOCA 3MOQA 3LOWA 4DCQA 3GUTB 3RWEA 2B39A 2YRZA 5AAWA 1NEUA 2R0LL 1SM3L 1S9XB 4YBLB 1DUYB 3VXUE 1MCRA 2R1XB 4DCQB 3RWEB 4KUZL 5DMGD 5HGGS 5JQ6H 3LKNA 1CLOL 1VFAA 4OF6A 4YNYA 4JO2H 5B38G 2LE9A 5AAMA 2LU3A 5ENWA 5T5NG 1I3RB 4QXTA 2F58H 3GSWA 3M45A 2W38A 1VFAB 1ADQL 1BLNA 1KCVL 4H1LH 2R29L 4YNYB 1FN4A 2QADC 5T3XD 1FJ1A 4DGYH 1A4JB 2IPUG 5ENWB 4JCLA 4QXTB 1GH7A 4PLOB 3GSWB 1ZLWK 4LHUG 3P0VL 4XNUL 1BLNB 3FN9A 4UU9A 3C08L 1FN4B 2AEIT 1FJ1B 3QJHA 3MLWL 2HT2C 2A9NL 3QPXL 5F89A 5MEND 1GHFH 1SEQL 3D85D 4NO0A 1MFAL 3QJHB 4TNVK 3QH3A 4OM0L 1X5AA 4L8BA 4GW4A 4ALAL 2VLKE 1KEGH 2AABL 5F89B 5F9OL 1CTNA 4NO0B 4MQ7B 2X4UA 5DQDL 1AXSA 3QH3B 4GW4B 1QKZL 4YHOL 1MRCL 1JZ2A 4L8CA 5JHDA 3BP6A 2X4UB 4OZGA 4QRQB 4R9HA 3RY6C 2NZ9D 4XPTL 3T0ED 4ZS7L 5I76A 5DEZA 1RIUL 3ABZA 1LO5A 2IPTH 1GGYA 4L8CB 1EK3A 4U6XA 4D94A 2J8UE 5JHDB 4OZGB 4CN1A 4LEOA 5HBBA 5SV4A 2PO6A 4GW5A 1FLRL 5I76B 4O58L 5AG9A 1LO5B 1OT1A 3D2UD 2P5ED 1RK1A 4U6XB 4JM2A 3QEHA 4LEOB 2PO6B 4GW5B 5E8OB 5EUOE 4NBXB 4AEFA 1RK1B 4PJBA 1LEGA 3QEHB 4JM2B 3BPOC 2MSPA 4NQCD 1QP1A 4TRPL 4PJBB 1LEGB 4G6ML 1EVTC 1MFBH 2CLVA 5IW3A 5DRWA 5TE6L 4PGZA 2ZG3A 3PWUA 2CLVB 5DRWB 5E24E 2FJHA 5BRZE 1CXEA 4I9WD 2P24A 1K85A 3PWUB 1IC7H 4WUUD 4G6JL 1YQVH 2FJHB 2NY4B 3Q5TA 5HHNB 4GUPA 4BQ8A 4YX2L 4E41E 2P24B 1EIBA 1KG0A 4Q6IA 5CILL 1JCKA 2D4FA 2P47B 2XY2A 4PG9A 4GUPB 1D9KD 4OUUA 1KG0B 2APTA 4Q6IB 4JREB 3IJSA 4YEFA 4P2RD 3SE4A 1F6LL 4M7LT 5L8KB 1NCUA 3HI5H 1NGPH 3DV4A 3IJSB 1UB6A 1IFHH 4Y7MA 3VFUA 3LRHA 3OPZH 3VFOA 4G6FB 4OQ1A 3DV4B 1KIPB 1JNHA 1UB6B 3VFUB 3TGXA 4HGWA 4CJ0A 3GMRA 2E6QA 1FHGA 5FGCE 43CAA 1LO2L 3ZSTA 5KJRH 1KIUA 5CJOH 2MCPL 4WWKA 2QJDA 4HGWB 3GMRB 5C2BL 1BQLL 5E8PA 43CAB 4AEHH 5F1OB 4W6YB 1BZQK 1VEMA 3WKML 1U6AL 4WWKB 4JFYB 5I6XC 4HSQA 4G9FD 5E8PB 3ILQC 3UJIL 3QUZD 4LMQE 4RGND 1GIGH 2O61B 1Q0YL 1TQBC 4V1DE 5JW3H 3LEVL 4Z76A 4U1IA 4U1JA 4OCMC 1MJ7L 4JFZH 2HWZL 1A47A 1RUKL 1T5XA 5LBSH 3B8YA 5CJXA 3KJ4B 1IVLA 4F9LA 5F44A 3VWKA 4Z76B 3RL2A 4MMXC 1S7WA 1EO7A 1YYLH 4U1IB 4U1JB 1G0XA 4LCWA 1T5XB 1TVBA 4P2CG 4Y19A 3O6ML 3ZE0E 3TBWA 3A67H 5I1JH 1QPPA 3VWKB 5BW7A 3RL2B 1VPOL 1S7WB 3ZT6A 4LCWB 4UMGA 4Y19B 4PJ7F 3TBWB 2VZTA 2ED9A 1A6PA 4HJGA 1FYTE 1M71A 3L3JA 2GI7A 4X4MA 4M5ZH 4IBLT 2XZQL 3U4BL 1Q38A 1BMGA 3QEUA 4HJGB 2ARJA 4GAFB 5C9JA 1NL0L 5K59F 3MROB 1UM5H 3IVKA 4K9EH 3QEUB 1I1AC 2ARJB 1MHPL 5I1IL 2FX9H 5DEFA 5C9JB 4FFVC 4TUOA 4FQJH 4OGZA 4X7SL 3NA4A 1H5BA 3IVKB 2GSIA 3MRRA 1S3KL 3QULA 1PGRB 3OAZH 5DEFB 4TUOB 5BV7L 1H5BB 5JPMB 2GSIB 3RZCA 5HI4C 3IXTA 5ALBL 1GC1H 5GHWH 3QULB 3L1OH 3UX9B 3O8XA 3WUZA 4BZ1H 4JR9H 3S37H 3RZCB 5ITFA 3IXTB 5E08L 3EYSH 4X5LA 1RI8A 1VADA 2H32H 4XVTL 4NO2A 2JTDA 4S1RH 2C4FU 3MO1A 5ITFB 2UV3A 3FONA 4Y16C 4OI9A 4L8SC 1VADB 4H8WH 1BZ7A 4O5LL 1VGKA 5H35A 4NO2B 4PJGF 4KROD 3MO1B 1H3PH 3FONB 3NCCB 5IGXL 4O02L 5GGVH 2ZUWA 5M94B 1BZ7B 4FOMA 1KELL 1VGKB 2NR6D 2WLZA 5H35B 3O6LH 5AUMA 2PTUA 1AGEA 2X89D 5DZOA 4M7ZC 3MJ7B 4XI5D 3U9PL 2CD0A 1JYVA 3AVEA 3HMXA 5IBUG 2YD9A 4XMLH 4TSBL 5AUMB 1Z0MA 5HI3D 1AGEB 3F58H 1FORH 2K3TA 2Y06L 3LEXB 2BVOA 2GUOA 4NHUA 3DWTA 3W0WD 3H42H 4RZCA 3S5LA 1PD6A 2BVOB 1VACA 1N64H 4NHUB 4LSUL 1QTYT 4HEPG 4R7DB 5DXWA 2BVYA 3STLA 3RKDC 3S5LB 4WJ5B 3MRCA 1AD9B 1VACB 5D7LD 3SDCA 1CVRA 3PWJA 2Y6SD 1NMCB 4OLYH 3STLB 3PDDA 5D1QA 4DUWA 2DQGH 5E1HB 4F7CA 2AAVA 3MRCB 3TT1L 4P23A 3SDCB 5FM4A 3HTLX 2BSTA 3PWJB 1QLRA 2AJ3A 4Y89A 4M3KB 5D1QB 4PRAA 1G0YR 4NZRL 3BAEL 4P23B 1JV5A 1URLA 2BSTB 5J9PA 4ONHA 1QLRB 4YHKH 1M4KA 2AJ3B 4PRAB 1QACA 3CK0H 2VXQL 2WWMC 3NACL 1JV5B 4LOUD 2FATH 2VLMD 4NN6B 2PN5A 3GHEL 1MRDL 3MV7A 4LCUA 3VE0A 4JKPH 1MWAH 2X1PA 4HIHA 3P11H 3S37X 3MV7B 4LCUB 3DARA 5F3HA 2NZIA 1TITA 5DTFB 1ZLUK 3SDXF 3VE0B 4U1GB 5L6YH 1AHWA 3O6KL 4NZUL 4HIHB 4MMZC 5JZ7D 5E4EC 3JWNC 3EBAA 4PUBL 1WFOA 4DKDC 2P5WE 3VG9C 4HH8A 5D72L 5A16A 1B6DA 3ZDYF 3CFDA 1CLZL 1JNNL 2OL3A 4KK5C 6CGTA 1YDPA 3RVTC 3VI3E 4Q7DA 2WUCL 3UPCA 1QSEA 2OL3B 1DUZA 1YDPB 2BNRA 2NY2B 2W91A 1IGCH 2D7MA 5EU4A 5F1IA 1QSEB 4P46D 3TN0D 2BNRB 2QBWA 5F7WC 3L5IA 2PYED 3I50L 5EU4B 5F1IB 5D70L 3S3PA 4Y2OA 4F8QA 2XTJC 2W65A 1LK3H 3L5XH 4JO4H 4HMCA 2OYPA 1UEMA 2WBKA 3QDGE 1CLCA 5IT2H 2JELH 2W65B 2VZSA 4GJTB 4GS7B 5JHLH 4CAGA 4NZTL 4PJ7E 1JPFA 2HKFL 3BX7C 3V4PL 7FABL 3WHXA 1JPFB 5IMKA 1BF8A 1YMHA 1CXHA 2N7AA 4K8RH 3BPCA 3WFCL 2IANE 3JVGC 3TZVC 4HGMA 5HHVH 5IMKB 3X13A 5B8CA 5B21A 1UJ3C 4YK4C 3BPCB 3QQ3B 1DBMH 3X13B 5B8CB 4FG6C 5EC2A 3FZUC 3CUPA 2YUWA 3N0PB 2W1NA 1F90L 4ZUTA 1CE6B 3VFGL 4M1DH 5EC2B 1JNJA 3CUPB 2X1OA 4C59B 3D69A 3DVGA 2B2XL 1R24B 3VGAC 3AROA 1VCAA 3J7HA 3AXLA 3HUJF 2EH8L 1YEJL 2NY6C 4GSDL 3D69B 3DVGB 4RGMC 5IP4A 2DQJL 1U42A 1IC5L 4KDWA 3DLQR 1Z0NA 5E1AB 3AXLB 1L0QA 4K8RD 4EUPH 5HD8D 1OM3H 1DVFA 4PRBA 5H2BA 1DBJH 2ESVE 4OZIF 3KYNA 1RFDH 4MA8H 1HSAA 1DVFB 4PRBB 4EI5A 1FYHB 5H2BB 2I25N 1CL7L 3UPRA 4IS6A 4XP9L 4QHNA 1FO0A 1HSAB 4GXUN 4CKVX 1NLDL 4EI5B 1TQCC 2EDQA 3TH3T 5K9KA 3RX5A 4HK3J 3UPRB 3PUCA 4IS6B 1X5XA 4JZJC 4QHNB 1FO0B 3QUXA 2APWA 3IDXH 5GGRB 3EYOA 1YNLH 5K9KB 2KL6A 1AQDB 4X6FA 5BQ7A 2VZOA 3KPSA 3QIUC 3ELAT 3QUXB 1OWRM 3CXHJ 1PJ9A 4KJPD 2R69L 3VG0L 4G8IA 4U7SA 1LP9B 1NGZB 1P7QA 4M61A 3KPSB 4AQOA 5BQ7B 5D9SA 3LAFA 4U05A 5EU5A 5I16A 1I75A 4P3CL 5ICZA 1A6WL 3BP5A 4G8IB 5HVHB 1P7QB 4M61B 1N4XH 1X5FA 2YPLD 4NCC2 5D9SB 4Y5YC 1P84K 4JN1L 1FGVL 1AI1H 5D1XD 3L3DA 3E3QC 5I16B 32C2A 1FC1A 4OCLC 1ZA6A 5FO7A 3BN9D 2FCBA 3BP5B 2XQBL 4HCRA 5FO9A 5JW4R 2VAJA 2FX7H 5DD3H 3L3DB 2V5TA 32C2B 1ZA6B 4OM1L 5FO7B 5DO2C 4KJQD 1UCBH 3MYJA 4GRLC 4LSSL 3T0BA 2M2DA 3LD8C 2J4WH 4D0BA 5ETUA 25C8L 1CYGA 2VNCA 2B4CH 3MYJB 3V0VA 5DD0L 5D5MF 4D0BB 1WCBA 1RAMA 5JOFB 4LU5L 1VFOA 2J7LA 2VDLH 1K8IB 4C4KT 3V0VB 5KW9L 1A14L 3QO1B 3GSNH 4HXBL 1KCRH 4F15C 3NIDF 1FDLL 1U3JA 3HB3D 2PW2A 1ZHKA 3ZDYE 3NCMA 3IU4L 5DGRA 5ILTL 4LSPL 5IV2A 1KT2A 3EO9L 3SDDB 5GRJH 4M8QA 2PW2B 5E2JA 1ZHKB 3VA2C 1MPAL 2P1YA 1CD1A 5EO9A 4G7VL 4UAOB 4M43H 3HI1A 1NMAH 4QCIB 5IV2B 1KT2B 2M8XA 2DL9A 3ARYA 1H8OA 1ZTXL 4M8QB 3ARDD 4LHQB 3QWRA 1CD1B 5EO9B 1ES0A 1BQSA 4ZPVA 4LDOB 4OI7A 3GMPA 1PFCA 4XCCH 2KPNA 4HLZH 3ARBD 1KJ2L 3ZTJG 2Y07H 3AREA 4PJ5E 1ES0B 4ZPVB 1MAMH 3GMPB 2VB5A 3MBED 3QG7L 1HH6A 2PTTB 5JLZA 3AREB 5FKAA 1TCRA 5D7SL 4P2OA 3K2MC 2NR6C 1HH6B 3B9VA 3C5ZD 1TCRB 4JFEA 5EOQL 3F12A 4P2QE 4FN0A 2C4FT 3C87A 4P2OB 2BY1A 1FRGL 3GIZL 5EZOH 3C8DA 3WIHL 1KV3A 1IEHA 1G6VK 4WV1C 4JFEB 1AD0A 3F12B 3E0GA 4X6DA 3P3YA 1MCPL 1AIFA 5CCKH 4DUXA 4UV7H 5FCSH 2XYCA 5D2NA 1AD0B 2C5DC 4X6DB 4NQSA 5IQ7L 1AIFB 3C5SA 3HLAA 1QBMH 5D2NB 3QNYA 2O5YH 3AY4A 1OSZA 1HIML 4NM4H 4RSVA 2DIJA 5TF1L 5C0FA 3C5SB 1YUHA 4JGUA 3GBML 3HLAB 5C08A 5L7XH 2Y6SC 3QNYB 1T0NA 1Y18A 4OV6F 5I73B 3RIFF 3VGGA 3L95A 3VXME 1JWUA 4L4VA 4P9MH 5C0FB 4UV4L 1YUHB 3KPRE 3BPLC 4ZO9A 2EKSA 5C08B 4XPFH 4D3CH 5IHUL 1T0NB 1Y18B 4DAGH 4RFOL 2AEWA 4RGOH 3L95B 2DS4A 2X10A 1JWUB 4L4VB 3RNKA 2AXGB 4PREA 1XF2A 3RWJA 2EKSB 4LSVL 5IFHH 4J3TA 2NYYD 3PQYD 4M9OA 4ODHL 3V4VH 4AK1A 1RUML 4EVNB 5MI0C 1G7QA 2OS7A 3GMMB 3RNKB 4PG2A 1XF2B 4PREB 5DMIL 2Y36H 5SWSA 3T8XA 4F7EA 4XGZA 1KBGL 1R3LA 1INQA 4NRXA 2H2SC 4JRXA 5SWSB 3T8XB 1YPZA 4F7EB 4XGZB 3SQOL 1D6VL 5JIHA 3K1DA 2AEPH 1GOHA 1INQB 1DFBL 4KHXH 4NRXB 4Z95H 1LD9B 1YPZB 5F7UA 3IAGC 4RAUA 1YMME 2APFA 3OG4B 3O2VH 5LAXA 4P5TA 2LTQC 3BZDA 1PEWA 1NDMA 5F9JB 4RAUB 3MLUL 5FUZL 1KLUB 3DIFA 2HAZA 3BH9B 3MBXH 4WU5A 4DN3H 1EX0A 5LAXB 4X6CA 1A7OH 1CGUA 3KHQA 3PP4H 4P5TB 5L2JA 1NDMB 4Y4KD 3TT3H 3FO0L 5EU3B 5GZOC 3DIFB 3SCMD 4JFDD 3VRJA 4WU5B 3UBXA 4X6CB 4P46C 5L2JB 4LARH 5F8QC 2R8SH 1RVFL 5JDSA 4CVZA 3VRJB 3UBXB 3TC9A 3ZKSD 4YHML 5KG9A 5JDSB 4CVZB 1VEOA 4G42A 1WCQA 4IDJH 2FIKA 4EJ1C 3GGWA 5KG9B 2YOCA 4KI1A 4M02A 4G42B 3RDTC 5KSBA 2BDNL 4LP5A 4NKQB 1TJIH 1VGEH 3MUGA 2ITDB 1ADQA 4DTGH 5KSBB 1ZANH 4JFFD 4PRPD 4C57C 2VXUL 2XRAH 5D5ME 3MUGB 4LPUA 3RUGE 5GJSH 4Z7VA 5GRYA 5T1DL 1JIBA 5C0BA 1U95B 4DEPB 3FFCE 5CAYB 1MCIA 4JZOA 3B5TA 1NBYB 2PETA 4K55A 3O4LD 4Z7VB 5L88L 5C0BB 1CD0A 3KPOB 1JYWA 3NIDE 4JZOB 4S0TD 4MJID 3CIQA 3P9LB 1X5HA 4PFEA 3AS1A 3K80A 4GG8A 3UTSA 1XFPA 2A0LD 2HLFC 3QYCA 3W39A 5HDLA 4G5ZL 3BD3A 1DQTA 5BCAA 4KQ3H 3ARFA 3ILPA 4UT6L 3UTSB 1MH5B 3W39B 3SGJA 1HDMA 3C60A 4QXUH 5E99L 4HWNA 4LSRH 6FABL 5FEBA 1MAJA 3ARFB 1HDMB 1T2XA 2D7TH 3C60B 2WV3A 4LLVA 5JIKA 4QRPE 4NQDE 4KPHL 2Q8AH 5EN2A 3UDWC 2QQKL 1INDL 1NC4B 4DQOH 4LLVB 4GLRH 4Z7OF 5EN2B 1K9TA 4FMFA 2YC1A 4KVCH 4EDXA 2VRAA 1IGYA 1HHKA 4HULB 1V3LA 1XEDA 5DQ9A 3K4DA 2YC1B 4RDQG 2CR3A 1IGYB 1HHKB 4C58B 4ISVA 2ICCA 2W0PA 5DQ9B 1U3ZA 5KSUA 2VLLA 4PJAA 4ISVB 1HN1A 1U9KA 2LU4A 5F71A 4JKLA 2ZCHL 5KSUB 1FV1A 5LGJA 2HT4C 1ZOXA 3KJ6L 1YECL 3I3EA 4RMQA 2NCMA 5CINH 3TA3A 3GK8H 1FV1B 4OZHA 5LGJB 3VJ6A 3LRGA 3G5ZA 1ZVYA 1FIGL 5DRNA 1RZJL 3TA3B 4APQA 4H1LG 4OZHB 5EULV 4ZUSA 3VJ6B 4PJHE 3P30L 3ZYOA 3ZLQC 3G5ZB 4EXPX 5JNYB 2CJUL 1JGVL 4APQB 1MJUL 4ZUSB 5D4QA 3RBGA 4OKDA 3WJLC 1NQBA 4NQTA 2E27H 3AMKA 3O3DA 3BPNB 2VDPH 5ALCL 3UTOA 2NX5A 4QRSA 5E8DL 5C0JA 1U41A 4J8RB 5BMFH 3BSZL 4W68A 3EFFA 3O3DB 1T7VA 1UENA 2EDJA 4WFEE 4X7TB 2NX5B 2A1WH 5C0JB 4NC0B 2W0LA 1CGSH 1CS6A 3RVVC 3EFFB 2P42B 5BVPH 1SBSL 1IL1A 2F19L 5T3ZH 4EQ3A 4ZSOA 4KC3B 3B3IA 2E6PA 5JR1L 3HMWL 3G6DH 3K8LA 4K23L 3H9ZA 3L5HA 5E0QA 4OZ4A 1IL1B 4MDJA 4ZSOB 3B3IB 3MODH 1JI2A 2V17H 4Q9BA 4P9HH 4PJEF 4MS8D 5IFAH 5FV2A 3QUMA 4MDJB 1JGLH 2R0ZH 2VDQL 3V7MA 4LDLB 1MELA 5FUOH 2CQVA 3QUMB 2DQDH 4OLUH 2OTWA 1VEPA 2D7OA 5D1ZC 5I8OH 3E1F1 3S34H 4Y1AD 2UUDH 5FFLA 3JTTA 2B4CC 4JQIH 5A3IC 2AJYH 2HRPL 4OCRH 2OTWB 1PZ5A 1SJHA 4I18C 4O4YH 5T3ZD 3C2SA 2Z8VC 1PZ5B 5KS9A 3RWCA 1OQXA 1SJHB 1XR8A 3VU2A 3MLZL 1NAML 4KK6D 3U0PA 5FYLH 4JGJA 5KS9B 2VDML 2VDKL 2JJTC 4JFFB 3RWCB 5J11B 3QHZH 4G8GD 1XR8B 3FB8A 4FFZL 3DX8A 3WL9A 2NY5H 3U0PB 2VLJD 1Q9WA 1NMBL 1U8KA 1F3DJ 4C83A 3IFPA 5C0CA 4MXWL 1D6EA 4JPVH 3FB8B 3DX8B 3WL9B 3EYUH 1Q9WB 1U8KB 4WHTA 4C83B 3IFPB 3QIBC 1NUNB 1JYXA 5B3JE 2OXGA 1D6EB 5KVEH 5HYJD 3QFDA 4UBDC 1HILB 3HNSH 3FL7A 3CDGA 3AS3A 5ECJE 2ZUTA 1V8HA 4FTVA 3BZ4A 3CVIH 3QFDB 2DQCL 1QFWH 1E0OB 3CC5B 3CDGB 2NNAA 5GJTL 5BV7B 2AXJA 4FTVB 3BZ4B 1WWAX 4PB9H 5DT1L 5FYLD 5EU6A 1MNUL 2VDRH 2R23A 3ZMRA 3VDAA 1FBIH 2X1XR 1IILE 2B0SH 3WCYA 4I0KA 2VQ1A 3MV8A 1DQQA 1WFUA 4WI4A 2XTJE 2R23B 2W9EL 1C5CL 3GRWL 2AJSL 5ICYA 3B9KA 4QRUA 1GGCH 3MV8B 5E9DB 4HWZB 1DQQB 4N0RA 4YFLI 5FHAL 4YFDB 4P5KB 5ICYB 4G6AC 4Z7OE 3NPSC 4S1SH 2WBJC 4JQVC 1T0PB 4LQFH 4PD4K 3SKJL 4C56A 1RUAL 4M6MH 4Z0BL 5I74B 4BQCA 3WN5A 3QIWA 2ZKHH 4GLRI 4NQCE 4C56B 3OKDA 3N06B 3WN5B 4H25A 1RSFA 2NY0D 1PG7W 3QIWB 5JIPA 1YEHH 1N2RA 4QHMA 3WD5H 4ZNEA 3THMH 1D5IH 4HC1A 1PZUB 1P7KA 4H25B 3H9SD 5DJCA 4UIMA 4ZD3L 1SMAA 1F02I 1N2RB 4QHMB 2XN9D 1EO5A 3BI9X 1J0HA 2OP4L 1P7KB 2DB8A 4UIMB 1OGTA 4S1QH 4BSVA 1G1YA 1YN7A 5K9JL 5CZXD 1OGTB 4GH7B 4OQTH 4YR6A 4CU8A 1JTOA 1BQUA 4MNGE 1YN7B 2MHAA 2OJEA 4XPBL 4ERSL 3MJ9A 4UIKL 3WSQL 1QSZA 4EDWH 2FSEA 1G7HA 4LSTH 3KYAA 2MHAB 2OJEB 2FSEB 1G7HB 1OAUL 3NFSH 5E2WL 3MRPA 2CKBA 5GZND 2WP3T 4BFBD 2J12B 3AS2A 1T89A 5JPNA 4NC2B 4S11A 3MRPB 4TYUA 2CKBB 3G9VA 3PWVB 3NCJH 4JJHA 4A6YA 4WUKL 5GIRA 2EXYD 5JPNB 1CK0H 5D71L 3QCUL 2ED7A 1NGWA 4N0UE 3O3BA 4K7PH 1CCZA 4A6YB 5DK3A 2F53A 3BW9A 2H6PA 5GIRB 4MNQD 1CE1H 5TPWL 2BY3A 4WEMB 3LV3A 4PJEE 1NGWB 3O3BB 4R8WL 2A0LC 1I9JH 4CW1A 3G5YA 2F53B 3BW9B 2H6PB 1AO7D 5I8KL 1OTTC 3EDKA 5HJ3A 3LV3B 5KBNC 3BT2H 5EOCL 3WNOA 4LCYA 4CW1B 3G5YB 4V2CB 4OCYL 2XA8H 3I75A 1UVQB 3OWEA 4I8DA 1P2CB 5HJ3B 1ZHLB 4D9RD 3UAJC 4YBLC 3A6CL 3CLEL 4LCYB 3BKML 3E3QE 4POZC 3I75B 4N1CA 4ZAKD 4HS6A 1JHLL 1PSKL 2V7NA 2IJ0C 4M7JL 4GAJH 5C0NC 4LK4A 2CUMA 2VXTL 4NHCL 5HHMD 2QQLH 1XIWD 5A40E 2V7NB 1LILA 4BZ2H 5L9DH 1IMHC 2YKLL 1PVHA 1GZQA 2X4SB 3DO3A 3JBG7 3PE9A 3QXWA 5TDPA 1G6RL 2OCFD 1NBVH 4OSUL 4YXKH 3QP3A 1NKOA 3S6CA 4KTEL 5TDPB 4RISL 1MFEH 1X5JA 3SQBA 2PR4L 4HPYH 3IAPA 2IC2A 4PS4H 1NANH 4LCIH 5EIQA 2XWBA 3OKMB 4I77L 4R4ND 4V2BA 5AZ2L 2D2OA 4NJ9H 4XBEH 5DD5L 3MRGA 4XNYL 3LHPH 3OKNA 2YXFA 3MRGB 5F7EL 3RI5F 2FHCA 4ZUWA 4X6BA 5C3LD 3OKNB 3O3UN 3G6JA 1KIQA 1H3VA 4FZ8H 4UB0L 5H37H 4PLJC 4X7DC 3RVUD 3U4EA 2V7HA 4EBQL 1BWWA 4ZUWB 4X6BB 4AEIH 3QA3B 5C0GA 3G6JB 3ZYIA 1KIQB 4UT9L 1QFWI 2LAAA 4K7PX 5ICXA 4GRWH 5HY9A 1KJ3H 3MUHL 3U4EB 2FD6H 2V7HB 2VC2H 2PO6C 3I2CL 1NCDH 5C0GB 5MERA 3B2UC 3LIZL 5ICXB 4JM2C 5HY9B 1TTUA 3I3DA 4U0RC 5C70A 2UZIL 5MERB 3FHAA 2HN7A 3LVEA 4GMSL 4GRMA 1QNZH 1I9RH 4MA7H 2HN7B 4GRMB 3QAZC 2HTKC 3B83A 5E2UL 5B3NA 4HFUL 4TPRL 3W0WE 4PJ8D 3I3BA 5C0RH 4Y2DA 2FZ3B 4HD9A 2NY4C 4U6VL 1YNTA 4J3XA 4XCEA 4NO3A 2ZZUT 1CGVA 2V2XA 4Y2DB 1RZFL 1FIEA 2DBLH 3WIIL 1UT9A 1R0AL 5D7LE 1YNTB 5I8EA 4NN5C 4NO3B 2CLRA 4Q6IC 1T6VN 3EYQD 4JREC 4HUXA 1EUUA 4LQ1A 3O9WA 4TTDC 1JFQH 4JHAH 1OAQL 5I8EB 4E9LA 2QSVA 2CK0L 3GSRA 2CLRB 1RY7B 2GY5A 4HUXB 2RGSA 3SE4C 4H5SA 5BS0A 3GSRB 1P69B 3JWDC 4I3SL 5HGDA 1WIOA 1QFPA 1CFNB 2ZUUA 4H5SB 5BS0B 2EE3A 2VLME 4PGCB 4XX1G 5HGDB 2CK2A 4F58L 4QT5A 5EWIH 4DVRH 4F7PA 2VL5A 2FECL 4QT5B 2PW1A 5BOZG 1MFNA 2VZ1A 4WWKC 4F7PB 1HXYA 3FO1A 1CDUA 4G8EA 2VL5B 4E0RB 3MOAH 5EORH 3CVHH 2DTMH 5DK2A 4LKXA 1U8IB 2PW1B 5DLMH 1GL4B 4EUPG 4HGKC 1HXYB 1OD9A 4G8EB 4YWGH 1IJ9A 5DK2B 5GGQH 3BDBA 4LKXB 1A6UL 3CSGA 1R5VA 3BIAX 5CGYD 2FNBA 3VMNA 4KMQA 2BC4A 4MCZA 3RTQA 3SDXA 2D0GA 4GXVH 3KJ4C 4D9QD 1R5VB 5L2KA 3QCVL 4WI6A 1RZ7L 4HWBL 2BC4B 4MCZB 3RTQB 2B20A 5CJXC 3U2SA 3PABA 3H9HB 1KJ2A 1N6VA 5L2KB 2YK1L 2HTLC 1SJXA 1G7PA 2NY5C 3T2QA 1DQMH 1ZGLA 3NGBB 4U33A 5KZCD 3V79C 2QHLA 2VYRE 3U2SB 3PABB 5IOPA 2FJGA 1G7PB 1ORSA 5BW7C 2X4OA 1ZGLB 1YEKL 4HIEA 2FX8H 2N7BA 4XPAL 5IOPB 3DRTA 4U6HA 2FJGB 1ORSB 4L5FH 5TE7L 3VXPA 3T3PE 4HIEB 3LKPB 5J3HC 4I4WA 2JJVA 3DRTB 3FN0H 4U6HB 3CMOL 3V8OA 3VXPB 3QQ9D 5TQ2L 2GAZA 5F93C 2NTFA 3HKFA 4XPHL 3HC3H 4I4WB 5F9DC 4XVUD 1JMXA 2XZZA 2JLLA 5JA8B 1TENA 3LS4L 1JZ6A 2GAZB 2NTFB 2Z31B 1CFVL 3R8BB 1H5BC 3RKPA 4JHWL 3J8F7 2VLRB 2EC8A 1KLGA 4JY6A 4TULL 1KN2H 3I6GA 3RZCC 4YHLH 2BERA 5GRUH 4HX1A 3O8XC 4ZNCD 1KLGB 4JY6B 4LGPB 5LVEA 1INEH 3D6GA 2ZSWA 1NANI 3I6GB 2E8ZA 4ODSL 3T3MF 3U7WH 1JHKH 3MRBA 1PLGL 1P7HL 4PTTA 4LL9A 1G1CA 3GIVB 3WDIA 4DN4H 1QLFA 2XIDA 2HT3C 3BJLA 4FMKA 2ZSWB 5HHOA 4F33B 8CGTA 3H3PL 3MRBB 3WLWD 5DSCA 4PTTB 4QOKD 4QWWC 2CIKA 1QLFB 1AR1C 3Q5YA 3MRLA 5ADPH 1DANU 1HZHL 4UILH 2WWKT 4WENB 3TNMA 4Z7QF 2CIKB 3ESUF 3MRLB 1JRHL 4QNPF 1T1WA 4NZDA 4U1NA 3TNMB 4IOFC 2VDOL 3EJZD 3C2AL 4JRYA 2LU7A 1IGFL 1G7MA 4UNUA 4BSJA 3HUJA 1GVIA 4HLZG 4U1NB 5FDWA 5EO0A 4JRYB 3WO3B 5IWLA 1OAZH 1QFHA 1G7MB 2EXYC 3NAAL 4LGRB 1T6WA 4PJ8B 5DFTA 4A2MA 5FDWB 1EVUA 4K71B 4XVSH 8FABB 2D7PA 1FZOB 4X99A 4KAQL 4FQCL 1P5UA 3S4SA 1NMCC 2ERJB 4I0PA 4X99B 1JVKA 3SDCC 4NQXA 3WFZA 4JFHD 3QPQC 5D1QC 4FQ1H 1A3RH 1JJUA 2I26N 3HI6H 1J87A 2A6JA 4LLDA 3Q0HA 4PV9B 5I1GH 4NQXB 2O5XL 4ELME 4ZFOB 3MLSH 1IC4H 4HUVA 2A6JB 4Q9RL 4LLDB 1RZKC 2ZNWA 3LH2L 3O2WL 4NN6C 5E70A 4OGYL 3ZHDA 1ITBB 3Q6GL 2GTZB 4OF5A 2G60H 3BH8A 4HUVB 5DJYA 3Q6FA 5GS1A 1QO3A 4L4TD 1V7ML 3B5GA 4U1GC 3AB0B 3BH8B 4K3DL 2B1HL 5T1LA 4AEEA 4GKZB 3Q6FB 2IBGA 5GS1B 2FYYA 2A6DA 4ONGH 3KXFA 3RX7A 3QDMD 5KVFL 4D2NA 4JRXD 1AHWC 2R0LH 1SM3H 1QA9A 4B7IA 5T1LB 1K6QL 3VXRD 1T1ZA 2FYYB 2IH1A 4KUZH 3KXFB 1P4IL 1WWCA 1QA9B 1S78C 1YEIL 2IGFL 1CLOH 1T1ZB 4X4YA 2BNUB 3SKNA 2IH1B 3O2DL 4L8DA 2NY2C 4R4NC 2IMNA 5TDOA 5EG6C 5HYFA 4X4YB 1JPTL 1KCVH 5F7NC 5HGHA 4L8DB 2R29H 4PJIA 3VFTA 3O3AA 2VKWA 3IB4A 4TNWF 3BOVA 3PWNA 5TDOB 3HC0A 4RIRA 5M95B 3KPMA 4XVJL 3MXVL 3P0VH 4XNUH 2QR0A 5HGHB 1VDGA 5ISZB 4PJIB 2GJ6D 3C08H 4PJDE 4TVPL 3VFTB 3PWNB 2G75A 3HC0B 4RIRB 3KPMB 5F72S 3MLWH 1FNHA 2A9NH 2QR0B 3QDJD 3QPXH 5E6YA 3S9DB 3O41A 3RVUC 1SEQH 2BSRA 4WRLA 2G75B 4LAQL 4GS7C 1U8PA 4KMTH 4ALAH 3QB7C 4PIRF 2AABH 4CL7A 3O41B 5F9OH 5E5MA 3N1GC 5DQDH 1FZKA 4QY8B 4X5XA 1QKZH 5IBLD 2LVCA 1U8PB 4YHOH 1A0QL 1PKQA 3OXSA 2PCPA 4WI2A 1FZKB 4X5XB 1B0RA 4ZS7H 1RIUH 4DGIL 1NLBH 3OXSB 5CKAA 2PCPB 1CGYA 1B0RB 1OCWL 1QFWM 2EEAA 5ESVA 3DETD 1NCCH 1FLRH 1W0VA 5C0AE 4O58H 2V5MA 3M17A 3UJJL 4PJCE 2EIBA 2GJJA 4FXLA 1A21A 1I3GL 1EJOL 5ESVB 4WFFE 2Q87A 1W0VB 5B8CC 4R2GB 3FAXA 4EN3A 2NXZD 3WFBL 4XWGH 1CFSA 3K4ZA 1CG9A 2WUBL 3CLFL 4TRPH 3O4OB 4G6MH 4X5WA 3RGVA 1UA6L 4M4RA 5CBEA 4Z18A 5SWZD 4EN3B 1B4RA 5TE6H 1CFSB 4HW6A 1CG9B 3C09B 3HNTL 1F3RB 2VR5A 4NQUA 1N26A 4Z7WE 4X5WB 1KYOJ 3B43A 4JE4B 4ODBD 3RGVB 5CBEB 1RIHL 2N56A 4OZGF 3ZE1F 4CMMA 4PJFE 3QUYB 3MGOA 5MHSD 2IWGA 2IBZY 4J1UA 4CMMB 4G6JH 4HKXA 3MGOB 3MPCA 4YX2H 2XZCL 1DVFC 3TO4A 2QKIA 4G3YL 1MI5D 2ZUVA 1BEYL 4CRPA 4NSKA 3D0VA 4HKXB 3DMMA 4Z7QE 2B5IB 4PY8J 3FN3A 4G6KL 5F1SA 4EI5C 3TO4B 2QKIB 4LPCA 1IKFL 4PJBF 4FQIL 4XZUA 5I8CA 4ZFFA 4NSKB 3IGAA 3D0VB 5LCVL 2ICWI 4XZUB 5I8CB 4TN9A 3SE9L 3QUXC 4HIXL 3MRDA 2ICWB 5DVKA 4X4ZA 1ZS8A 1CGWA 1EXUA 2D03L 4OFDA 3MRDB 5F7KC 1LO2H 3CZFA 1OHQA 5HVHC 5C0DB 2MCPH 1J8HA 1EXUB 1CBVL 1G7JB 4BELD 5C2BH 1T66D 1BQLH 5MEOA 4PRHE 3CZFB 4Z78A 1DBKL 3WKMH 1U6AH 1S9KC 1FP5A 1IQWL 1J8HB 4JFDE 3NA9H 2P4AB 5ANMA 1S8DA 2EIEA 4GKOA 5MEOB 1KCLA 1QYGH 3UJIH 1RD6A 2PXYD 1SY6L 5BRZD 5ANMB 1S8DB 4DZBB 3LN9A 1T83A 3LEVH 3HE7D 5IIEA 2HWZH 4QTIL 4E41D 2X7LA 1RUKH 3MGAA 1HCFX 2KDGA 1A7RL 1X4XA 5IVZB 1IGML 4W81A 1TZGL 5EH1A 2X7LB 3SGEH 1XGYL 4N9GA 3O6MH 5DJ8A 1AKJA 3I9GL 2NY3D 1VPOH 3DGGA 4GBXD 4N9GB 4XVUC 5DJ8B 1FNEA 1AKJB 3IS1X 1WTLA 3EJJX 1IRAY 3C6LA 3DGGB 1U3YA 5CEZL 1UACH 4PRIA 1FNEB 2XZQH 4FFWC 3U4BH 5C7XL 1EEZA 3C6LB 3P4NA 1Z9LA 4RRPA 4ZDHA 1IM3A 4PRIB 3BUYA 4MJIE 2E7BA 1NL0H 1EEZB 1UKQA 4HQQH 1PG7L 5IBTL 2R56L 3P4NB 4PLKC 4YXHL 4M3JA 3W81A 2OSLB 4ZDHB 1MHPH 4U6TA 5I1IH 3BUYB 3VWJA 4X7SH 3GNML 3VMOA 1IT9L 2EZ0D 1YY8A 1S3KH 3MRHB 1KB5B 3VWJB 3AREC 2J3SA 3SDYL 3WLWC 3V6OA 5DEGA 4Y0GA 5ALBH 3MV9A 2UY6A 1I8KA 3SPVA 4ONFL 3VXUA 4P2OC 5E08H 3L7EA 3ROOA 3MV9B 4HG4K 3LPFA 4RDQF 4XVTH 1PY9A 1I8KB 4MHHI 3VXUB 3L7EB 1I1YA 3ROOB 5C0CD 4O5LH 5K9QG 1NUDA 1EO8H 1F11A 1YA5A 4FQPA 2VITA 4OZFH 5IGXH 4YDKL 1BM3H 1I1YB 2XKSA 4JDZA 5IMMA 1DANT 5E2VL 3FT4A 1XF5A 1F11B 2JJWA 5D2NC 4BM7A 2VITB 5A1AA 1C5BH 5K33A 1EDQA 3U9PH 4JDZB 4Y4HA 4UOW1 3FT4B 1XF5B 2NXYB 4TSBH 1TXKA 5I73C 3AY4C 3B6SA 1U8MA 4NOBA 4WHYG 1MCWW 2Y06H 1CZ8L 1WIPA 3O6FD 1GCFA 5GGSA 5IJVB 3B6SB 1U8MB 2VLKA 4YHNA 3EOTL 5EU6D 5B39G 2AK1L 4NN7C 3QHTC 5GGSB 3MRNA 4TUKL 4LSUH 2VLKB 4YHNB 5JHDE 3VXSA 4KQ4L 2MPAL 2DLFL 4JY5L 1QHOA 3MRNB 2MKLC 5KVGL 4XCYA 2DYPA 4LSQL 5FOBA 3VXSB 1J12A 4ODVH 3SBWA 4PG2C 3T08A 3INUL 3TT1H 2ZCLL 2A73B 3LQAL 2YPKA 1NCAH 4PP1D 4XCYB 2DYPB 2WANA 3BQUA 3QO0B 5FOBB 1MHCA 4KKCD 5FECA 4NZRH 3ZKMD 3BAEH 5FIEA 2YPKB 3U1SL 5HGBA 5EUOA 3WDHA 5A2LH 4AIZA 5BXFB 3BQUB 4OIBA 4LIQL 1P4BL 1MHCB 1AH1A 3SJVA 2VXQH 3NACH 2WAHA 1RU9L 5EUOB 5HGBB 3GHEH 4AIZB 1MRDH 5FAAA 4XT1C 1WZKA 3V5HA 5EBGA 2GSGA 5LXGL 4P5TC 3KPLA 1EGJH 2BVQA 3V5HB 3O6KH 5E6IA 5SX5K 1OAKL 1OP5K 2GSGB 4NZUH 2HRLA 4OT1H 3RAJL 4YDLC 3ARPA 4JO1H 1A9EA 3KPLB 2XXCB 3MJGX 2Q6WB 4PUBH 1OVZA 5HYSA 2BVQB 5E6IB 5D72H 4NNYA 1JNLL 1OLZA 1CLZH 1TTFA 1A9EB 3CMGA 1JNNH 3PWPA 2VISA 5HYSB 4LEXH 3HAEH 4NNYB 4Y1AE 4P3DA 3PL6A 5DR5L 2WUCH 3PWPB 3VFNA 2NQCA 2VISB 3PL6B 1Z5LA 1MCOH 3DPBA 3VFNB 5C3TA 5F8RC 4OFKA 4LCCB 3HE6D 1Z5LB 3I50H 3GI8L 4PJXA 5D70H 4MWFA 4OCSL 3ARZA 1EV2E 1F2QA 4JRWA 1T04A 4D9LL 4JPIA 3W9EA 1X5IA 1FL6A 4PJXB 3D39A 1G6RA 4MWFB 2RFXA 4JGMA 2VLJE 5C6WH 3O81A 1T04B 3V7AE 4JPIB 3W9EB 1W2KT 35C8L 3DETC 1OB1A 3M1BA 1FL6B 2VXSL 1G6RB 3JWOL 4NM8L 2RFXB 4HBCH 4NZTH 1DP0A 1GRWA 3JWDL 1NEZA 1OB1B 5FGCB 3M1BB 3U9UA 3KS0H 3X12B 4R90L 1B0GA 2HKFH 5HYJE 3OG6B 4I13B 5B38A 3RVWD 3SGEI 3T65A 2G2RA 3V4PH 3DVNA 1NEZB 3TBVA 4LMQI 5FCUL 1B0GB 3RY4A 5B38B 2A6IA 1HHGA 2G2RB 3ARFC 3WFCH 4JVPA 3DVNB 3IFNL 3H7LA 3SGJC 4LHUA 3C60C 3VD7A 3TBVB 4TNVF 4V1DA 3B2VH 1HHGB 2UVFA 4X9BA 1W72B 5DURB 1Q1JL 3SHSA 5DWUL 4F3FA 4V1DB 1T4KA 1V3JA 1R3JA 2O26U 3LSOA 2V9RA 4Y19E 1F90H 3S8WA 1T4KB