5C0AD

1e6 tcr in complex with hla-a02 carrying mvw peptide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
197
structure length
197
Chain Sequence
EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMRGDSSYKLIFGSGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 197
sequence length 197
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0aD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0aD02
3I50L 3D85A 4F9LC 1NSNL 5F9JA 8FABB 1KYOJ 5SV3A 3LIZL 5E03A 1ZSDB 4CDGC 4ENED 3GKWL 4MDIB 4M5ZL 3RUGA 4MD0A 1RIVH 3FB5B 3MFFA 1Q9LB 3PNWA 1QFOA 4U1HA 3BDXA 4FQIH 2JCCB 4JFFA 4KY1L 1KIUA 1WF5A 1GJIA 1N5YL 5HHME 1PYWB 4UOJA 1NEZA 1QG3A 5HHNB 2ILLA 3C08H 5F89A 1FFPB 1HWHB 1X5XA 3VXQA 1WBZA 1MHPH 4O00A 1X7QA 1IC4L 4OUUA 2F74A 4ODUB 3U36A 1G6VK 2X70A 3VFVB 5D8JH 2MJWA 2P46B 3FAXA 4RRPA 2LU7A 5D93B 5L8KB 1NL0L 5DWUL 1A1MB 1ZLSH 1FZJA 3D18B 2RCSH 1N64H 5DLML 4C55A 4GBXD 1QEWA 3DX8B 1AIFB 4NWUL 4IRZH 5F1IA 4UTAL 2FECI 3CIQA 1DANU 4CVZA 1YUHA 1INEL 5D1QA 3ZYOA 1ND0A 1QSFE 1KTKE 2ADFH 1A7NL 1JGVH 1XR9B 1JHLH 4HIEB 2P5ED 4I3SH 3E3QE 4DN3H 3VFOB 3AREA 5DSCA 2MCG1 1NMAH 3C5SB 5LGJB 2HRPL 3ALXA 5IBUG 1MFCH 3S6CA 3TVMD 4PLKD 2IH1A 3P73A 5GRUL 3QEQD 4OLZH 4DEPB 4LHUD 3PWPE 1E28A 4MS8C 4WWID 4BUGA 4ZS7H 2F15A 5EO1B 2FD6H 1JVKA 3CPLA 4IIQB 1DBAH 5DFWH 4JDVB 3SDCA 5DUPH 4M4PA 3GSXB 4UTBL 3ZL4H 4O2FA 1XIWB 1MCPL 2C3HA 2DLTA 5E4EB 5CD3A 2ICES 4LLWB 4RX4A 4MHHI 3H9HA 1A14H 4FQXD 3BKCH 3ARTA 3DV4B 4WU7A 5INDA 1LO5A 4X98A 5BVPH 2Z92B 3CFCH 2YPLA 4JKLA 3PWUB 4UAOB 1D5ZA 4NQDD 5FO9A 5FM5O 4NN5C 3ZO0A 5A2JH 5JW4R 3T2OA 2X1XR 3L5XL 4N0FA 4OSUL 2KQMA 4I1NB 2EH8H 5IB2A 1JTOA 2Q8BH 2B20A 3SGEH 3K4AA 5GJTH 1D5IH 5FF6B 1QYGL 3G6DL 5ETUA 4TUOA 4RDQF 3HNSL 1MJ7H 1RZJH 3JWDL 5ITBH 3CGTA 3C9NA 3NZ8B 3HC3L 1QFUL 1BBJA 4KROC 5DMKA 2NXZD 4Z76A 1JWSA 1MCRA 5TF1L 4ESKA 3PV7A 1IC1A 2HFTA 5DK3A 2L7JA 1DUYA 3FB7A 4JFDB 5BOPA 4W6YB 5IG7B 2K7PA 5TQ2H 4MWFB 2NZIA 1T7WA 5C0FB 5AZEH 5HYJE 4F2MA 9CGTA 1FVCA 4U7KA 3DHMA 4PJ5E 5B8CA 4RZCA 1Z9LA 4KHTH 3OR7A 4M1CD 5CWSA 2DJ4A 5DA4A 3MXWH 1F13A 3HNTL 3MC0A 5I18L 1J5OH 3CVHB 3VFMA 4TNWK 3WKNA 4ZPVA 2BNUB 1FO0H 4K23H 4GXUM 4LLDA 5LQBL 5EPMA 2MFNA 3SOBH 3N06B 5CP7B 5GGSY 2CIKB 1RQ5A 5IW3A 2HT4C 1KJ3H 3QIBA 4NN7C 3ILQC 2HAZA 1OGTA 1BQLL 2XG4A 3HMWH 2Z31C 3TIDB 2DTML 4PRAB 1CFBA 4U3CA 3DBXA 3CNKA 2Y06L 4K07A 4F7TB 4P99A 1WCBA 4HX1B 3B3IB 1NGWB 2ITCA 1CD8A 3MUZ1 5DJDA 4UNUA 1MWAL 3WLBB 3HZVA 3ET9F 3IDIA 1AR1C 4G6KH 4G8IB 2LVEA 2EDYA 4DUVA 3BISA 3CZFB 3MROB 4IBLT 5D1XA 2GTWB 3PWVA 5FO8A 3SO5A 1TQBB 3KDMB 3GO1L 2X1OA 5B39A 4E41B 1MRCH 5C07B 3LZFH 2YPVL 4EDWH 3O41B 4UIKL 1UB5A 2GTZA 3H0TB 1CXEA 1SM3H 1OLLA 3U4BH 4H1LH 1HI6B 2BXZA 1G7JB 1JNJA 2LQRA 2YRZA 4NQEB 1GIGH 2AXGB 3JXAA 1YEKH 4HH9A 2VNCA 4XWGH 5IVXE 5IVNA 1BX2B 3EHBC 5EUKB 5C92A 1KTDA 4NQVA 3X12B 3TZVA 3V6FA 4UILL 1CGYA 1GZQB 4KJWC 4D9LH 8FABA 1ZSDA 1FYTE 1NAMB 4MDIA 4L8SB 4RMUA 4MJIA 1DBMH 1WBXB 1UWGL 1KJMB 1A5FH 1Q9LA 3TBTB 1O7SA 3UTSA 2DBJA 3AGVA 4L4JA 3E8UH 1ZT4A 1MFDL 2Z93B 3TT1H 4JEGB 3QNZB 2EE2A 1IM9B 1B4JH 1U3ZA 1W0WA 4HZLB 3W11D 1G9NC 2FBOJ 4ODUA 1OY3B 4MZ2A 2GJ6B 4Y1AA 1VPOL 3HTLX 1MVFA 1PFCA 4NSKB 4P23D 1N7MH 1RAMA 1A1MA 5I75B 4B50A 5FKPB 1OLZA 4CGTA 5JQ6L 5L8LB 4CUCA 2UY6A 5D1ZA 4YHLL 1SVZA 4HXAH 4XBEH 3DX8A 2I25N 2ZUYA 1QLRB 3MYZA 4QXGH 5JHDD 3OSKA 4ZOBA 1IBGL 3EYOB 4IDJH 3P30H 3LB6C 5I30H 4FP8H 4JN1H 1OGAE 4MJ2A 3MRDB 3L3GB 4OF5A 3S3SA 2A9MH 1BIHA 3UBXI 3S3JA 4NIKB 2VLRD 4YK4B 1LD9B 3CXHJ 1GGCL 2XWTA 3RZWA 3BJLA 2D7TH 4HC1A 5EC1A 5I73B 1WTLA 3EBAA 1LEKB 2X40A 2DI7A 4PLOB 2R0KH 3U4EA 5LWYL 5MEND 3VMPA 4KRPB 5EO1A 4UT9L 4X6CF 3BKML 4JDVA 1RZ8B 2ZSWA 3U30B 2J6EL 2KH2B 4ZOEA 5IHZB 3GSXA 3DXAD 3OJVC 4P9MH 5ADPL 1XIWA 5C0CB 4OTXL 5JW5B 1CD1A 3KGRA 4JQIH 2VDML 1JRHH 1IKNA 3TYGH 3TEUA 5SV4A 3OKOA 4PY7B 1YDPB 3JTTB 5AD0B 3DVFA 2J4WL 3DV4A 3RGHA 4FQJL 1KLUB 4KDTC 4X6BA 3LEXA 1RJZA 2GSGB 5I8CA 1PY4A 4IHOB 4RMVA 3ALWA 5MERB 1MPAH 1GZPB 5EULV 4G7VL 4OLUL 4O51B 4AEIH 1WFNA 2F53D 4NUGH 5FF6A 3W0WA 4XPTH 1AO7E 1YMMB 4JB9H 5I1JL 4X5XA 5IMLB 1JPTL 1CF8L 3GK8H 4M61B 2P7TB 4XI5C 4NFCA 3QDMB 5DRWB 3A67L 1T3FB 2Q8AL 3QYCA 3WD5L 4MS8D 5TQ0H 4XZUB 3RNQB 3QJHB 2QKIB 2CJUH 2BRRL 3E6HA 4YDJB 4BZYA 4AL8L 3MRLB 3NVQA 5IG7A 1M4KA 5TDOA 3O4LD 2FEDD 2M26A 3B4NA 5C0FA 2ED8A 1MI5A 1EX0A 2ZCLH 5J1AB 1S7RB 3Q48A 5E8PA 3QNYB 4LSQH 4QOKE 3IKCB 3TP4A 1G9NL 1F6AA 1K8IB 3OB8A 4GXUN 4UNVA 4H0IA 4JG0H 4LIQH 4AEHL 3EYSL 3WIFA 1I3GL 3CVHA 2OZ4A 5L88L 4Z7NF 3BQUC 5B3JF 4KZDH 2K9UA 3GSOB 3E2HB 4P57A 2AS5M 1TETL 2D9CA 4GLRI 5CP7A 2VR4A 4OQTL 2DRUA 2LABA 2BVTA 4HCRL 3TIDA 2OL3H 5L8JB 4IEFB 5CZVH 3BW9A 5HGBB 4KROD 3GI8H 4QWWC 1BIIB 2YSSB 2ZSVB 2W9EL 3VXUA 4FOMA 4FXGA 5HHQB 4MNGB 2A6JA 1NGWA 2D7NA 3MLTB 3V8CA 5C0EB 3DO7A 1ED3A 2ZUVA 3EOBA 5F9OH 4LCWE 3WLBA 5E9DD 4OZFH 5J56B 1T89A 2C9AA 2DD8L 1KELL 1HINL 1WT5A 4XAKD 3CZFA 3PWLA 3MROA 2P42B 4U1SA 4ZOCA 3R8BB 4X4YB 4TPRH 4OZIF 3O6FC 4KK6D 5ANME 5E56A 2HKFH 4HUMB 5CJQH 2EC8A 1NCWH 3ARBA 2H6PA 4JVUA 3QIUC 1U8IB 3H0TA 2NY1B 4HFWB 4GSDL 1G7JA 4NQEA 2HT4D 3ZE1E 5IFHH 2AXGA 4MA3B 3IDGB 3IDUA 5FO7B 3ILQD 1WIPA 2Z31D 1BX2A 5EUKA 1OARH 5DR5L 3X12A 4BFBD 1ZHBB 1XGYH 1S9KC 3C5JA 4I2XE 3WE6B 3M17B 1ZEAH 3I6LE 4HUVA 3TO2B 3AXLA 3KWWB 1LEIB 2XQYK 4WI3A 1NAMA 3BZFA 3D25B 4L8SA 1S7TB 1JN6B 4CADB 1MHHB 4O2EB 1JPSH 1KJMA 3TBTA 2YHGA 3C5ZC 5DT1H 4K9EC 5ID1B 1AR1D 4YDLB 2FBJL 1LP9E 4QRPE 5F44A 1NGXB 2Z93A 3FO0L 2VXUH 4LKXA 4RFEA 4Z77B 3GSWB 4FNLL 4M43L 5LAXA 1IM9A 2CLVA 3ZHDA 1UJ3B 2OK0H 3HAEH 1FGVL 1BEYH 2YRPA 3GSQB 3BKYL 2ADGB 4FTVE 4QRUA 5H8DA 1BMGA 1A22B 1KCUH 3DX6A 4Y2DC 3V6ZA 3VFPA 1QO3B 4NSKA 3ROLA 2ERJC 2CRMA 4QCIB 2X4PB 3RWCB 3MOBL 4FFVC 4BZ1L 2MCPH 2WWMC 1CDGA 1MFNA 3ZT5A 5CSBA 3BH9A 2NY7H 5BS0A 3IU4L 1OTTC 4NN6B 3EHBD 4X0KB 5KJRH 1QLRA 4OF0A 5D7KD 3FO9A 1MCJA 2WQ8A 1CXFA 3RGVC 3EYOA 4GG6F 4N8VG 5KSBE 1ZGLM 2N56A 4EXKA 4U6TA 3MRDA 2G5BA 3L3GA 4KJWD 4R97C 3V5KB 2JELH 3MOAH 3CXDL 1NAKH 4F7MB 4Z8FH 1A4JB 2ICWA 3LQAH 2DJUA 4WFFD 1I1RA 1VGEL 3S9DB 2VLJE 3BIBX 5IFAL 1LEKA 3SKJL 3I3EA 4PJHB 3UTTD 5EU4A 5GHWH 1DQLH 1RHHA 3KPSE 2B1HH 4K7FB 1SYVB 1PLGH 4N9GB 1J8HE 1ZTXH 3T0EE 1U8PB 2DJSA 1DANT 3D3VB 4G6ML 1FSKB 3MQIA 3IGAB 4ODVH 5JW5A 3VD9A 1Q9WB 5EBLB 5I66B 3QHZL 2Z35B 2HLFC 4NM4L 1A3RH 3JTTA 5J6GB 5EORH 3C09B 1NUGA 1KLUA 3SDDA 2CR3A 4BH8B 3MACH 3RIFK 5F7HA 3IFPB 4Z0BL 5F93C 2NY4B 4AIXA 5MERA 5K33A 1WUNT 3LB6D 3STBA 4QYOB 3MV9E 4O51A 3VI4F 5SWQA 2VQUA 3MRNB 3DMMB 1WAAF 1YMMA 4OM1L 1DQQB 1UACH 3NOIA 1I7TB 5IMLA 5CEZD 3MLYH 3U83A 3WN5B 5GZNC 4M61A 2P7TA 3VD4A 4PGEB 1PBYA 3DTXA 2B1AL 3QDMA 1XEDA 4YDIL 4M6OH 1S7XB 3RZCC 1MJ8H 2QKIA 1AY1H 2XNAA 3VXMB 2IGFH 1U8QA 3SCMB 3BAEH 2IADA 5FYKU 2X4UA 4PJCF 4K9EL 3QEHB 4ZNCD 4R9HA 1SHMA 3E6FB 2P8LB 3MBXL 5TFSL 1M6OB 1S7RA 4YFEA 5HYFA 3QNYA 3P4NB 1K8IA 1TVDA 5C0RH 4NT6A 4X9GA 1YPZF 2JJSA 4Z7UF 4GRMA 4NC1C 1M7IB 5EOCJ 4G8FA 3GSOA 2JKXA 2E7BA 2JLLA 3V4VL 2A2QT 1FO0B 1KUMA 3ES6B 2DL2A 4GAJL 3QDJD 5IV2A 1BJ1H 5E2VH 1F3DJ 1FRGL 5E8NA 3GM8A 2R2EB 1N8ZB 4GH7B 1S9VA 3HI5L 1ERNA 4XI5D 5HGBA 3FONB 1OSZB 4M6MH 5CBEB 1BIIA 2YSSA 2ZSVA 3P4LA 5T5NG 3NCJL 4PJXA 3HE7B 4ALAH 1EPFA 1ZK9A 3MRCA 4P9HC 1H3WM 5HHQA 4MNGA 3P0VL 1YY8A 5CCKH 3A6CL 3C60A 1IILE 1OT2A 2C1PB 1X4YA 4AQOA 1A6WH 1R5IA 5JMOC 3MFGB 3WFCL 5FYLH 3PXJA 3RU8H 1LDPL 3DV6B 4X4YA 4IMKA 5A40E 1KBGH 4HWEL 4P2QD 4BQ6A 4OLYH 3CDFA 2VR9A 2WBKA 3NA9H 4QHKJ 1F3JA 1R3HB 3IRZA 1S3KH 5TE7L 4HFWA 4MJ5B 5D2LF 3O4OC 4KH2A 3GDBA 4I18A 1AGBB 4MA3A 4H1LB 3IDGA 5F6HI 5FO7A 4ZXBC 1BM3H 5K93A 3VH8A 1FLTX 4HMCA 5F3HA 4F8TA 1ZHBA 5LBSL 5GJSH 4QWWD 43CAB 4NQCD 1NGYB 5HI3C 4O02L 3BD3A 3TO2A 3KWWA 3MRRB 1LEIA 2FZ3B 5FYJH 5DD0H 5LGKA 1ZT7B 3F5WB 2J8UB 4CAGA 3D25A 3NABH 1S7TA 3S3PA 1MHHA 3QUXD 4O2EA 4Z95L 3C6SA 4LHJB 5ID1A 4PIRF 4RFNC 4U4BA 1YQVH 4WTZG 1NGXA 2NTFB 1KNOB 5JQHC 1JMZA 1Q0YL 4K71C 3O9WB 5HDBF 1SBBA 2RBLA 4MMZC 3GSWA 1UJ3A 2MKWA 3O6FD 3NIFE 3DX7A 2A9NL 5E94B 3BKJH 4JQVA 3QQ9C 2ADGA 4XX1E 1OPGL 5JXEA 3CSYA 3QIUD 3ULVE 2Q1EA 4QCIA 4C56E 1VFOA 5FV2A 3OF6A 3VXPA 1U2CA 2DAVA 2FJGB 3GZKA 1F4YH 1YEFL 1F4HA 1WZ1L 4U1KB 4EEEA 3VU2A 2EEAA 2PO6D 4ORZC 3VWKB 1JGLL 4PJ7F 4I0CC 4P5TC 5I9QB 4C83B 3F7VB 4L3EE 1UB6B 1RURL 5F7MC 1LO2L 4HLZH 2BOCA 4YXHL 4NO2B 4JFHD 4P2RE 3P0GB 3QQ3B 1X5IA 4F80A 1E4JA 1TPXB 1UWEL 3BESR 1Z5LA 3VRJA 3GHBL 1SYVA 3FB8A 3FN0H 2EE3A 3ZTNH 1IAIM 2IAMB 2I24N 2CO6B 1Q9WA 5I66A 1MHEB 1GAFL 2AKRA 4PYGA 3D2UB 3THML 5J6GA 1VGKB 3MCKB 3UC0L 2IPTL 2KQNA 3EUUA 3MV7B 3WUZA 2A1WL 4YLQT 5GGVL 3LN4B 1HXYA 3CFKB 1EO8L 4QYOA 3MRNA 2UWEE 3DMMA 1MY7A 4HHAB 1U91B 2WSKA 5FOBA 2VITB 2QQKL 2MNUA 3MLSH 1L7IH 2D7OA 1WV7T 3WN5A 1I7UB 4OZGA 3HC0B 1KACB 4PGEA 5C3TA 2P47B 1KN4L 3RVVC 4IOIB 1AFVL 1UWXK 1NCDH 3ORJA 3VXMA 2CMRH 4X5WA 1IGIH 3WUWA 4GS7B 3HRZB 3GRWA 3HHRB 3KXFB 1JGEA 1RFDL 3QEHA 4HWBH 4U49A 1KPVA 1KGCE 2P8LA 2JCCE 2HLFD 4PRIE 3IKKA 3VCLB 5IM7A 3FO2A 1PAMA 4N0RA 3QO1A 4FQ2L 1A9BA 4NQTA 2AGJL 3MLUH 1RIHH 5JR1H 3QPXL 1EMTL 5C7XH 2CKBH 4PJ8C 1UCTA 2ED7A 1CFSB 2J2ZA 7CGTA 1T4KB 4YZFF 3EKCA 5IW6A 2OR9H 1CGXA 3LPWA 4GRLA 1T20B 1X5FA 3P9WB 1H3TA 1IEHA 1FO0A 3ES6A 1QSVA 1CBVH 2VWEC 4BJLA 4FFZL 5GZND 2R2EA 1N8ZA 3H9SB 1OHQA 3WFHB 3Q5YA 3QDHA 3V8OA 4UZGA 2CIIB 2H41A 3RZCD 1OSZA 2OL3B 3UTPD 5CBEA 5AZ2L 3HE7A 1F45A 1XT5A 3KYMB 2F5BL 1T03L 2DL9A 4V2CB 1F4XL 1QRNA 1V7MH 1X3DA 3QIWC 2X9YA 2YN5A 5JDJA 4E5XB 1AR2A 4UV7H 4OZFB 3QRGL 4OFIA 5FA3A 5DRNB 2VL5B 2EZ0C 4FFYL 3PGDB 3ZKNC 3SE3C 2QADB 1SMAA 3W9EA 1IGJA 1UZ8B 4M00A 1NCBL 4PTUB 1R3HA 1XF5B 2OR8A 4MJ5A 4JFPA 2X1QA 1DQTA 4H1LA 3BWUC 4X4MA 2Y9RT 3Q5TA 4GMTH 4G9FD 1U58A 1BD2D 3LOWA 3QXWA 4Y4FD 2WMPA 4MJ6B 5CIPB 1CG9A 4JFEB 4HXBL 5CHNB 4IRJA 43CAA 1EVUA 3D48R 5IWLC 3GBML 2AI0L 2FZ3A 1NCNA 1ZT7A 4F7EB 4PG2A 1I8KB 2HT3C 2CRYA 2YD4A 4MAYC 1KC5L 1AHWA 5GSVB 5T1KB 3MJ9L 5ITFB 5ESQB 2BX5A 5J3HC 1BZ9B 4WHCA 1VDGA 2IMNA 3KPTA 1MRFH 4HS6B 1UM4L 3AC0A 4KXZI 2GJZB 3DETC 4XP6H 5E8OB 4LSSL 1KNOA 1OAUH 3FQTB 1E4XL 3GJFK 1K2DB 3O9WA 4MLIA 1I3VA 4M1GL 1QPXA 1K5NB 2X4RA 4JFDE 1CLYL 1TNMA 4YC2C 4GQ9H 4LGSB 1FFQA 5CJXA 3HAEB 2P48B 3BDYL 1JZ7A 4LLAA 4WFHE 5A2IH 4NQUA 2GFBB 1T2QH 3RDTA 5DJ2B 4KI5F 2H45A 4M5YL 4PGCA 3IYLW 2VZ1A 5HXMA 5D72H 1A3LL 3PL6C 2VKXA 3D0LA 4U1KA 2LTQC 2PXYC 5HI3D 4TUJB 4QTIH 2BNRA 3VXRD 3VWKA 5DUBA 3QJFA 1UZ6F 2R1XB 2HVKB 1SBSL 3F7VA 1QBBA 1NLDH 1T6VN 1UB6A 5IGXL 3BRDA 5EC2B 4HK3N 4Y8DC 3RKDC 5HTSA 4KRMB 2ZCKH 4XP4H 4GG8A 4J3XA 1IJ9A 4WFGE 4P2CG 2H1PH 3O11A 1O5DT 3QQ3A 1BAFH 2DIBA 1YECL 4G8GA 2EIDA 2JJVA 1IAII 5JOPE 4WW2F 3Q0HA 4RGNC 1CDYA 2VSCA 1U92B 3QQ9D 1EEYB 2HKHL 2IAMA 1YEEL 3ARPA 4LEXL 2E8YA 4OCWL 2F58L 3NH7H 1DQML 4GAYB 5IESL 1VGKA 3MCKA 2VUYA 3H9YA 4UIMB 3MV7A 2XKSA 4XCYB 4JM2B 1T6WA 5E2UH 3LN4A 1CE1H 1VERA 4E41E 4JPKH 2D0FA 2QEJA 2Z4QA 3IDYC 5GS0D 5C07E 1YYML 4HT1L 4WI7A 3MPCA 3B9AA 1U8KB 1HQRB 4I0PB 4RWYH 1OF2A 2D03H 4G9DB 4NQEE 1Q1JL 4P5TD 1UENA 3FOMB 3QB7C 1H8NA 2Z8SA 4HKZB 5F1OB 4QKXB 1OB1A 25C8H 1CL7I 1CIUA 5J11B 3WHE1 1S7WB 1BQHG 5D1QC 4IOIA 4XBPA 4MA1C 2XZCL 2DLFL 4ZNEA 3AREC 5J13B 5JORA 3BJ91 3S4SG 2ORBH 1F2QA 5I71C 3U9UB 1PY9A 3VFSB 1AC0A 5IEHA 3WO4B 1R3KB 3KXFA 1J1XL 4D94A 2NQCA 5MI0B 3VCLA 1EZVX 2GY5A 5HDOA 4QHLB 4XVUC 1I8IA 3F65A 5I0ZA 3SDCC 3QWOB 4L4VA 4OFVA 2WBJA 4KUCF 5C0NC 2GJ6E 2NMSA 4LCYA 3BUTA 4BK5A 5DTFA 5T33L 1T4KA 4X7TB 5MEPB 1A4KB 5MP6H 4OIBA 4H25B 5L9DH 3WYRA 2E6PA 3IFNL 1M1SA 4GBXB 3GSNL 3H9SA 2JB5H 3S35H 3WFHA 4N90D 3C2SA 3MRHB 3RVVD 2CIIA 2LAGB 2OL3A 1DDHB 2VLKD 5IHUH 4FQ1L 3QXDB 4U1MB 2FATH 35C8H 4HJGB 4AENB 4X6DB 5J9PB 1ES0B 4KTDH 2ESVD 3ARDA 4OCXL 1G7PA 3TVMB 4R3SB 3L95A 2WWKT 5SWZD 5BRZA 4YIQA 4NZRL 4E5XA 2A6KB 1J87A 4PTTB 5GQBA 4BFIA 4LHUB 5DRNA 1NMCB 3QULA 3RY4A 1A3QA 3G9AB 4MB3A 2YXFA 3F6LA 1I9JH 1OAYH 3QNXB 4PJ8D 5C0CE 5D5ME 4Z0XB 1UZ8A 1RULL 4PTUA 3ZDZE 4NJAL 4MNQE 4MDJA 4DKFL 2ZCHH 4ZSOB 4FQXB 1KEGH 5D7SL 3WXVL 1XGUB 5B8CC 5DHXB 1A7PL 1CGUA 1E0OB 2DQUL 1T1ZA 1FNAA 3AS0A 4JE4B 4MJ6A 1A6ZB 4TULH 3HNVL 4JFEA 2RQ8A 5CHNA 3ARSA 2XT1B 2R0WH 1NGQL 2DQIL 1VFAB 3NCCB 4NJ9H 6FABL 2AJYL 2APXA 5DC9B 4NRZA 3IU3B 1I8KA 3G6JE 3HRPA 2F19L 3QIBC 4F7EA 1WWBX 4GXVH 3QIWD 5GSVA 5T1KA 4LPUA 1TCRB 2FX7H 5ITFA 3BGFB 5ESQA 5I1DA 1BZ9A 4FQLH 1EHAA 1F58H 3QDME 4CMMB 2JB6A 3H6JA 4OCRL 2GJZA 1ZKAA 4ZD3H 5E8OA 1NMBH 4X6FB 1IAKA 2NXZB 5CBAB 3FQTA 5FHBL 1RZ7L 1YQ2A 1K2DA 2EZ0D 2ADIA 3MOQA 3LKPB 4PJAB 3STLB 3ZKND 3DUHA 2XXMB 1TXKA 5EO9B 4XAWL 4LLMB 2ATPB 5A3IC 3HAEA 3PHOB 1RIUL 5JHLH 4HIJB 4H8WL 3UTQA 3WFBH 5E5RB 1H0DA 1IGFL 5D1XC 4JRYD 4B41A 4X8JB 2V5RA 5C0IB 3SN6N 5DJ6B 4YDKH 3B2VH 3SBWC 4XCFL 1FAKT 4MQXC 4XH2B 1DQDL 3BRFA 2EYTB 1QZ1A 2CK0L 3O3BA 4M7LH 3TESA 3QA3A 5F96H 1CLOH 1KJVA 3NZHH 3IDXL 2HT3D 4MAYD 2R1XA 5JW3H 3GSVA 2BNQD 5FK9A 1MEXL 4MGXA 5ERWA 5J3HD 1PG7X 2DOCA 4LRNH 5D2NA 5DK2A 4WEUD 3DETD 4I4WB 1CZ8L 4KGLA 1W72H 3HB3D 4U05A 4D0CB 1HHKB 3JTSB 3STZB 4Q97A 2AV7B 4F9PA 3BGMB 5EZOL 3MGOB 4ZTPH 3CVIL 2EECA 2VDPL 1AKJA 2OSLB 3MLXH 1II4E 3D39A 5L6YH 2OJEB 3LCYA 4R7DB 1H8SA 1EJ6A 4Z18A 1IC7H 2I5YL 1JZ5A 3R1GL 1U3HA 3HG1D 3OX8A 1SVCP 4DKAA 3O3UN 4Y19D 4UIMA 4WO4A 4XCYA 4JM2A 1OP5H 2FGWL 5F1SA 3FRUB 5I19H 3MZTA 4FZ8H 5GISL 3SO3C 4O5LH 5TDPB 1JCKA 1KEMH 3PV6A 2XRAH 3MJ8A 3NACH 3PL6D 4ELMB 4RQQB 2FR4B 2PF6A 3KYNB 3Q1SL 3ZT6A 3PJSB 4I0PA 2MMXA 5D1ZC 3FHQA 4QF1B 4OFDA 4MX7B 4HKZA 1R3JA 4L3AA 3V0AC 3RKDD 5KW9H 2Y07H 5E4IA 1QHOA 3QCTH 5SX4H 4KK8C 2YMXL 3DRTB 2EE6A 3HUJB 4JFQA 5SX5K 3L3KA 3D85D 2G75B 4PJGA 3HC4H 3L7EB 3FMGH 2CQVA 3U9UA 1F6FB 2FYYA 3VDCA 3VFSA 5EZIH 4NKDA 1HK6A 4RGND 1R3KA 4U2YA 1JNHB 5IVXF 4A6YH 1YY9C 4OZ4B 2B5IB 4JFFD 2VMFA 1DLFH 1RMFL 4LBEA 4JRXD 4K7PL 4BM7A 3RI5K 3QUYA 4O9HH 1OAQH 3GI9H 3OKEB 4QHLA 3K8LA 4MD5B 1I9RL 5AUMB 2UZIH 2FIKB 4Y88A 1BVLA 3SE4A 1MAMH 1ZVSB 3VFGH 1XIWC 1IKNC 1OAKH 1INDH 2D0HA 2ARWA 4E9LA 1RUPL 2CKBB 4KI5C 2V2TB 4P23B 5B3NA 5MEPA 5GGTL 1JTPA 4Y89A 4H25A 4ZDHB 4UAOC 2HWZL 2QQLL 4GBXA 4KUZL 3S96B 4I3GA 4Z7WB 3K8KA 4L5FH 5JHDB 4LNRB 5D1QD 2E5EA 5C0AD 5DMGC 2NCMA 2V9RA 1KENH 1DDHA 2Y4SA 3QXDA 1J8KA 4XC1L 3O6MH 2B2XH 4L3CB 1Z0MA 1I3RB 3ARED 3SDYH 4AENA 2R69H 1ES0A 1UH4A 2VLRB 4PB0H 4XPGL 1AQDB 1EHNA 4TSAH 4NO0A 4PJHE 5MENB 2F54D 3CMOH 4XVUD 3KYOB 1C7TA 32C2A 2X4NA 3SDCD 3OHXB 7FABH 1WIUA 3LSOB 4YBLB 2AABL 3D3VE 3QNXA 4QHNB 4LVHC 3DXAB 5C0ND 3TWCL 4XMLL 1V7NL 2I9LB 4RX4D 2ZPKL 2YUVA 1EO5A 2KDGA 1BJ1J 4QXUH 4ZSOA 4FQXA 1TNNA 2YPLD 4HUNB 2XZZA 3TBWB 2GQHA 2RJMA 4PJFB 1A6ZA 1J0HA 5D6CA 2EDOA 2C1OB 3WL9A 1A2YB 2IPUK 1UA6H 1VFAA 3LH2H 1WEJL 1B0GB 3SE9L 3ZTJG 3IU3A 1NKOA 1TCRA 3AS2A 3BMWA 1D6VL 1LK3L 1JZ2A 1I9IL 4N0YL 5F7EH 4CMMA 4OV5A 4O2CB 3RA7H 4HPYL 4J12A 1HQ4B 4X6FA 4JO4H 4P5MB 4LFHD 5CBAA 4TQEL 4PJAA 4FABH 1BBDH 1YEJH 3O2WL 5EUOF 5EO9A 2VXQL 3OZ9L 1UM5H 2ATPA 3O4LB 1K3ZA 1T89C 1HHIB 5SWSE 3PHOA 2NY2B 1WT5C 4HIJA 4U7SA 3ZZ1A 1OM3L 4GW5B 2BY3A 4X8JA 2V7NB 2ZOKB 3TBYA 5C9JB 3UPRB 4G6JL 3QDAA 3RQ3A 1NC2D 4L1HA 3ARBC 4NN5B 3VWJA 5EA0L 4FQCL 5E2TH 2XZQH 2MHAB 2EYTA 5I15L 3O3EA 3MXVL 4R0LA 5E6YA 2OI9C 2R1WB 4D9QE 3QIBD 4X6EB 1UKQA 3F62A 4ODXA 4JJ5B 1FL6A 4XMPL 3JSSA 3QEGL 4ONHA 2PTTB 4IMLA 4PGBB 1BZ7B 4L4TE 3T1FB 4YHIB 5JIIA 4KROB 3WIIL 4X5LA 4YNYB 3BP5B 4Q74A 3STZA 1DBJH 3BGMA 3TJEH 3MGOA 1FG2B 4L8SC 3L5IA 4JY4B 4PJIA 4R7DA 4F58L 3ARQA 2AJXL 5E9DB 2YBRA 4RMTA 4DAGH 4S1SH 2AQ3A 4EI5A 1RUAH 4PD4K 1G7QA 5D1XD 3V6BR 2X4QB 4OGAC 1JF6A 1DSFH 4ONGH 1T7VA 4UT7H 3JVGA 3K2UL 4M3JA 3OG6B 1MCOL 4JO3H 3TIEA 2R2BB 1FNLA 5C0BA 4JKKA 1P6AB 4YXLH 4RQQA 2FR4A 3MCLL 3KYNA 3PJSA 3QWQB 2DWEB 4MCZB 5CLTA 4MX7A 4NN7B 1U6AH 1CFTB 3CVHL 2OZ4L 1MNUL 2Z31B 3VFWB 1D7FA 1YEHL 3DRTA 3HUJA 1J12A 2AJZB 1AD9A 4OCSL 2G75A 3AU1B 4NFBA 3L7EA 2DM3A 2J8UE 2WNGA 4O4YH 4MJID 4NYLA 3ZE1F 3UTSD 1QLFA 4OGXH 4UT6L 2DM4A 4G7YL 1UXSB 4OZ4A 4NNYB 1KCKA 5DO2D 1NJ9B 1RUKH 2W60A 4HWBA 4OUOA 5E08H 3REWB 4MD5A 5AUMA 2FIKA 4ZFZB 1QLEH 4S0SD 2VSDA 2VDQH 3JWNC 3RX5A 4Y1AD 3UXFA 5HI5C 2YD9A 2QR0B 4XVTH 4YHMH 1BFSA 2CKBA 3QCVL 5D1ZD 1A6PA 1FGNH 5C2UB 4ZDHA 3SDDC 1X5HA 4YHZL 1TJIL 4OFPA 4JZOB 1MFEL 3S96A 1OAXH 4Z7WA 3QUMA 5JHDA 4KK8D 1TFHA 4EBQL 2C4FU 1N6VA 3RY6A 5AG9A 2R0LL 3BGAA 4X4XA 1FVEB 2PYFB 3RP1A 4F9LA 4ISVA 3BUYB 3RWFB 3IB4A 2VLRA 1M05A 1YY9D 4JPIA 1BVZA 3P40A 4XXCA 4M62H 2E9IA 3S36X 5KSBF 1UT9A 3KPRA 5MENA 3KYOA 3UTTB 3S34H 1NAML 4WENB 3MA9H 3H42H 3LSOA 4JHBA 4XP9L 4LSUH 1XIWD 4QHNA 1UGNA 2B0SL 4LPXA 4YFLI 4HGMA 5HVGB 1WFTA 3F12B 4KI5D 1AH1A 5IMOB 5ACLA 4QXWA 2ITDB 3QSKB 5FUOH 3RWEB 3MRBB 2R56H 5JA8B 3TBWA 3KLHC 2VXTL 4ZUVB 5GS0H 3VXTA 2JJSC 4K94H 1J1OH 1LWRA 2BFVL 5DMGD 1XFPA 1P4IH 3R0MA 4J7RA 3E2HC 1FL5B 1ADQA 3FN9A 1IM3B 3W0WD 4QRTB 2VDKH 5F7WC 3WNOA 1UC6A 1B0GA 1KXQE 1PZ5A 2R29L 4NQSA 4F57L 4MQ7A 2OM5A 5FB8B 3N85L 3RY5A 5DF0A 3UTZA 4DGYH 5LCVL 2VXSL 4K55A 5IW1A 4P5MA 5C8JB 3G6AB 3C60C 2P44B 4R4FH 1U8LA 4ZAKA 4G42B 3V0VA 2IQAB 3W39B 4EQ3A 1LO3H 4AJ0A 1MI5D 3O4LA 4J3OC 1A02N 1HHIA 5ALCL 5KVEH 1G9MH 2D4DA 1BHGA 3CDGB 4Z7VB 4NP4H 1QR1B 5JUEL 4YE4L 4GW5A 1P7HL 2V7NA 5ISZE 2ZOKA 3TT3H 4IMKC 3ZE0E 2DMBA 5C9JA 5DRXB 1MFBH 1YEIH 2QHRL 3UPRA 5JDSB 3EO0B 3REVB 1TLKA 3EW3B 2VXVL 2YD2A 3U7YL 3LS5H 3QG6A 4OD1H 5IQ7L 4HUXA 3LQZA 3PP4H 2V6HA 4JN2A 5DMJB 3WDHA 2NY1C 5BMFL 3QFDB 2R1WA 5L7XL 5IP4A 4I18C 2ATKB 4X6EA 3RNKA 4LPWA 3QDJB 1EGJH 3LHPH 2PTTA 1FIGL 3F7PC 2Q3AA 4ONOA 1BZ7A 2Y36L 3HMXH 2QQNH 5IROA 4YNYA 4WW1A 3VXUD 3BP5A 2AVGA 5J6HA 1DUZB 4K8RD 1Z3GH 1W72B 1FVDA 2D31B 1A7RL 4JR9H 5EOCL 1PKQA 4JY4A 1G84A 1NDMB 3QFJA 1Q0XL 4JY5L 3FCTA 4YDLC 2XACC 1DQJB 3CC5B 1E4WH 4X83A 2R0ZH 3ETBF 4PRHA 5KBNC 5EOTA 3S37H 4BYHA 2PW2A 3ULUE 1UJ3C 3L3HB 1WISA 4JQVC 3D69B 3V4PH 4P2QB 3ARBD 5HHMD 4HKJB 5D96C 5JXEC 4ZFGH 4Z5RB 4C54A 1W0YT 1OT1A 5HBBA 1WZKA 1CDBA 3B6SB 2EDXA 1U95B 5FDWA 1QRKA 4KKLC 4WUUE 4HV8B 1NANI 2DWEA 1N26A 1IEAB 3VFWA 4I13B 2VDLL 5JPNB 2C4XA 4HJ0C 3VW3L 4K3EL 4H20H 1U8MA 5DVMA 4NQCB 2Q86B 4BSJA 3AU1A 4R26H 3N50A 4TSCL 4JQXA 3VRIB 5HGHB 5BQ7B 3L6FA 2EDLA 4HUUB 4M02A 1OSPH 2DBLH 2P5WA 3QUXB 4NNYA 5EBMB 4EOWH 2GJJA 3INUH 4EKXA 1NJ9A 1JFQH 1F97A 5I1KL 3Q6GL 5AWNH 2AEIT 3LKNA 3DURB 2DQDL 2NY3C 1IM9D 2DICA 4ZFZA 3BP7B 4LSPH 3FFDA 2HTKC 3RJDA 2YA1A 1FSKC 3SJVA 1JI2A 2QR0A 3BIKA 2W65B 4RWHA 5E8DH 5I1CL 1E4KA 3QIUB 1GGIH 3A6BH 2R2HB 5JNYA 2DKMA 5HY9A 3ZKXC 1MH5B 2NY0C 2QQQA 3HKFA 3CDYA 5BS0D 1S9WA 1LNUB 4PJEE 1MFAH 1CFNB 4J4PA 2DQHL 2ZG1A 2EIBA 4K3DH 4F8QA 3GBNL 3NIFF 2BVOB 2X5PA 2E7MA 4NZTH 5IMKB 1U2HA 5AAMA 5DLMH 5I1EH 3ARXA 1RZGA 2AEQL 1YJDC 3DMMC 4JANA 2PO6B 4JDTH 3ULVF 2MKLC 5EU6A 1IGYA 3RWFA 3UAJC 1J10A 4N8VA 4U1NB 1H3PH 1XF2A 1Z2KA 3WN5C 2VDNH 4OAWA 5DD3H 4YPJA 4RGOH 3OAZH 4RCAA 1RU9L 3FB6A 3UTTA 1NDGB 3I6GB 5HYIA 2DQJL 2AJUL 1S9YA 4PB9H 2YRLA 3F12A 3V7AE 4FQIL 1Q94A 2ERJB 3MRBA 2XFXB 3SDDD 3C08L 5D7LA 4S11A 2LFGA 4BQ9A 1A0QH 1MHPL 4ZUVA 3GMPB 5HYJD 1TMCB 5CEXA 5IVOA 1A7QH 5D8JL 4PJ5D 1C08B 4GRLC 1A7OH 1T04A 5TDNB 1IM3A 1ZLSL 4R97B 1IGTB 4QY8A 3I02A 5D7IA 4JAMB 2RCSL 5FKAB 2LE9A 1N64L 2IPKB 1DE4B 3NAAH 4LPCA 2XY2A 3W5NA 1D3CA 2WQRA 1IZKA 5FB8A 4IRZL 4OB5H 3OAZK 1CD0A 1VFUA 1UKSA 4ORGB 3L3JB 3HE7C 5IQ9A 1CD9B 1MOEA 5C8JA 4ZOAA 4LVOB 2W59A 4KFZC 2ADFL 1JGVL 1DBKH 1JHLL 2UWEF 2V7HB 4I3SL 4DN3L 4I48A 4P49A 4NNXA 3BIAX 4G42A 4JFZH 3NCMA 2IQAA 4KGJA 1GRWA 1EFXA 3O8XA 1UH2A 1URLA 4KDWA 4OCYH 1QR1A 4OLZL 4PRDB 2Y7QB 1UXWB 4ZUSB 3ZSSA 2C5DC 4ZS7L 2FD6L 5EBWA 3WFEH 3KLHD 1DBAL 3EO0A 1VFBA 3REVA 5TJWK 5DEGA 4KKAC 5DUPL 1CDHA 5ESVB 4HBQA 4ODBD 4RMSA 3ZL4L 4DGIL 3TLRA 4JM4H 5ACZB 4YHKH 3TH4T 5HPOA 1PG7W 5F7DB 4UOW0 2JCCF 4HFUH 3Q3GB 4HULB 2Y5TB 1A14L 1JF1A 1M7DB 3MR9B 5BVPL 3QDJA 3CFCL 3LEYH 5LQBH 5EZJB 5HI4D 4IRJC 2YUWA 3MODH 3PHSA 1XZ0B 3RZCB 2Q8BL 5GJTL 4IRSC 1D5IL 4H88H 2P5EE 4LRIC 2HJFB 4X6DE 4ZODA 2D31A 2IG2H 3C60D 1AHWC 2ZG2A 4S2SA 1MJ7L 1RZJL 5FYKD 1NDMA 5ITBL 1VESA 1MJJB 3EDKA 4AMKH 1GYAA 5HHVH 3CC5A 4U7MA 3QEQE 3TV3H 2MSPA 2VDRH 5CS7A 3L3HA 2W0KA 4P2QA 2AV1A 5TQ2L 5CJXC 4HKJA 4PG9B 4WFED 4ZYKA 5H37G 2E9WA 1F4WH 5AZEL 1ZA6B 2NY1D 4HLJA 2C3WA 1U95A 1NFIB 5ADOH 3BPCB 3V5DB 5B21A 2EIEA 5EG6C 3RDTC 2N7BA 1G7LA 2YPVH 5DJ0A 3LN5B 3UX9B 4NGHH 4KHTL 4NQDE 1C5BH 4G9FB 1BD2B 4Y4FB 4Y4HD 3MXWL 5HDLA 2BSSB 4IS6B 1FO0L 4NQCA 2NNAB 1MRDH 3VWKC 4F15C 3WBDA 3SOBL 3VGAC 2Q87A 5KS9B 1J0JA 3SDXE 1KJ3L 4FQHA 2ZZUT 1IGCH 2H26A 3HMWL 5F1NA 3QUXA 1OGAD 3SPVA 2VISB 4X6CB 4A6YA 2F8XC 1OAZH 1M71A 3WEXB 4TVPD 3NMEA 3DURA 3ZKSD 3BP7A 1YYLH 4F7PB 1ZVYA 2Z91B 1CDCA 4BKLB 4U6HA 3FJTA 5HGAA 2IAMC 5BVJB 4KKCC 5JXED 1T5XB 2W65A 3VDBA 1CXLA 3OKNB 1HWGB 4G6KL 3QIUA 2OCFD 2R2HA 1KIPB 5DS8A 5T5FH 4KKLD 5MEOB 1MH5A 3UJTH 3O4OB 3UCRA 3OF6D 1CFNA 3MV8E 1P6FA 4G6AD 5K9JH 3O6LH 4LU5H 2BJMH 2BVOA 1MRCL 5IMKA 5I8EA 4HJ0D 3LZFL 5C08A 4PRPB 4HD9A 1CLZH 4RMRA 1SM3L 2PO6A 3VXRB 3U4BL 2VIRA 4KAQH 1S7VA 3KPNA 1GIGL 4PBXA 1YEKL 2ARJA 4XWGL 1GOHA 4UDTA 2C3GA 4RFNB 1AO7D 5KOVC 5I17B 5I6XC 2VAAB 5FECA 4PYHA 3KPPB 1GGCH 4K71B 4D9LL 1XR8B 2NY3D 3T0XA 4GKNA 5IEKB 2A6DB 1JWUB 3I6GA 1T0PB 2HTKD 2GIYA 5L2JA 2BMKB 1EK3A 2C4FT 1CN4A 1DBML 1A5FL 5CGYD 4ETQB 3E8UL 3GMQB 1GL4B 1KIQA 2NY0D 4MA7H 2W0FB 4OTXH 3TT1L 2XTJC 3JV4B 5IF0B 1T66C 2WBJC 4KJPC 3UO1H 3NPZB 1KT2B 2W1NA 2O5YH 3UP1A 3KLAB 4YFLF 3C8KB 4ELME 2OMBA 3BHBA 1ONQB 4GKZB 2E6JA 1N7ML 3DMMD 5TDNA 3QG7H 5E1AA 1IGTA 4YHPB 3GMRB 3F58H 3UAJD 5DJZB 5FKAA 4P5TB 4HXAL 2IPKA 4BZ2H 4XBEL 2OMNA 1DE4A 4GLRH 1S7UB 4OLUH 3G9VA 1A1NB 4QXGL 2G9HA 3HUJE 2MQCA 3GIVB 4GKSB 4IDJL 3P30L 3VXMD 4JN1L 5I30L 2AJSH 4U6YA 1CF8H 2CDGB 2V7HA 3X13B 1CXHA 3OKKB 1BFVH 3ARDC 5GRXG 3QEUA 4KU1A 2GI7A 2D7TL 4L29A 5F70A 4GJTB 2R0KL 1UXWA 2CLRB 5KN5B 2V17H 4ZUSA 3PDOB 4LCWD 2LAAA 5K9OB 5EU5A 2VH5H 5ESVA 4N68A 4P9ML 3ARGC 3HI1A 5FGCB 5ACZA 5DK0A 4OI7A 1X6LA 4JQIL 1JRHL 2YOCA 4XB7A 3TYGL 3UMTA 4GRLD 5B38G 5F7KC 1OP9A 1G7IB 2NPLX 4AEHH 4Q9QH 4LCIH 3T65B 3SGKA 4LHQB 4CMHB 2X05A 4J2XA 3J8F7 2P8MB 4Z7WE 4MXVE 1MPAL 3K4DA 1IKFH 1SEQH 1XZ0A 3PWJB 1OOAA 2VLKB 4OFYA 5EU7C 2GAZB 2FL5B 1EVTC 3MLVL 4AEIL 1P2CA 4NUGL 1IARB 5DQJB 1QRND 2HJFA 4XPTL 4WUKH 4HJJH 4JB9L 3DGGA 1CQYA 1A47A 5TPWL 2ESVB 4PD4J 3I6LD 1MJJA 3GK8L 5C9KA 5SWZB 4CJ0A 1NCUA 3P0YH 3IFOA 5TQ0L 5F3BA 3CFEB 4RAUB 4V1DB 3EJYC 1A64A 5HHPA 2BERA 2IAND 4KKAD 4QRPD 3HZKB 3DXAE 4XC3H 4MVBC 4PJ8B 5DJ8A 1D5MB 4L8DB 1D5XB 2ZCLL 2ZUWA 1NFIA 1L0YA 4L8CB 1FNHA 1JRHI 3BPCA 4E0RB 3VG0H 1T83A 3ROOB 4LSQL 4XBGB 5JPMB 1NUFA 3DUSA 3T04D 1IT9H 4I77H 4ZFFA 1BF2A 4G9FA 1BD2A 3E0GA 4PJFE 5CUSH 2SEBB 4JG0L 1G1CA 4Y4FA 4LIQL 4IRJD 4BQ8A 3LQMA 5D5MF 1R3IH 5DEFB 3ZDZF 2BSSA 4IS6A 5BJTA 1OWRM 4KZDL 5DJYB 2F53E 1RK0B 3EDDA 4IRSD 3IXTA 3I75B 3X11A 1TCMA 2FX9H 1NGZB 1KFAH 3QIWB 3LQAC 4GAGH 5D2NC 2F5AH 2OL3L 4LGRB 2VISA 4X6CA 2YXMA 1AXSB 1FN4B 3GI8L 2EXWC 4F9PC 4TNVF 1ZAGA 1SJEB 3BEWB 5DYOB 2Z91A 3FQRB 3G6JF 4FG6C 1HE7A 1P5UA 3BRGC 4XPBH 3O4LE 1T5XA 3OG4B 5F9OL 4JVWA 4XPAH 1U3HC 5FCUH 5TH2B 4LCUB 3RWDB 3W2DH 5IJKC 3KPSD 3T0BA 2AXFA 5IIEB 1J8HD 1Q9OA 4JRYB 3T0ED 5MEOA 1TIUA 5E5MA 4WO4C 3RDTD 1L6ZA 4JM2C 4KDVA 3U0WH 1JPFB 4M9PA 4PP2B 5HYSB 1NH6A 1CS6A 4TPRL 1J0KA 3LN9A 5CJQL 3JBG7 1NCWL 5FHAH 2BNRD 5D70L 1HNFA 4PRPA 1JWMB 2V9QA 4I0PC 4PV8B 3VRLE 4JZNA 4W6XB 3VWKD 2OJZH 4MB5A 3MRKB 3MRPB 5AYUH 4L9LB 5IFHL 4RNRB 4R2GB 2C3VA 3WNKA 1GGBH 1T1WA 3KHOA 3VXNB 4XNXH 1MJUH 2BNQB 3D5OF 1OD7A 1OARL 5I17A 4XMKH 2VAAA 4K8RH 1XGYL 3KPPA 4PJCB 3UJJH 2GT9B 3LV3B 4G8GD 1ZEAL 5I1AB 1ZVHA 2A6DA 3QAZC 1JWUA 2YKLH 2IAMD 4KKCD 1N5AB 1S7QB 2FJFB 3MLWH 1JPSL 3AY4A 5E9DE 5DT1L 4YBQC 1EBAA 4ETQA 1K8DB 2Y25A 5M95B 4WI6A 3QUYC 3AM8A 3HG1B 1FH5H 4R90H 4Z7UB 4G6MH 2VXUL 4Y19B 4HBCH 2O61A 5ID0A 3JV4A 3S97C 5IF0A 3H7BB 2OK0L 1E27B 5C0GB 4G6FB 1BEYL 1EDQA 1KT2A 3GSNB 3CH8A 4DCQB 3DRQA 3KLAA 4UB0H 3C8KA 2IWGA 3G5XB 3PL6B 1KCUL 4GKZA 4U1JB 4RRPG 1C5CH 2LTQB 5CJOH 1QA9A 5A1AA 1LQSR 3GMRA 4M1DH 5DJZA 2MCPL 4QHMA 4P5TA 2L7UA 4GBXC 2WUBH 3BPNB 2NY7L 4KPHH 4NDMA 3U46B 1S7UA 5KJRL 4QXTB 3ISWA 1HDMB 5H94B 3IJYB 5IJVA 2AEPH 3D85B 4LDEB 5F9JB 2PW1A 1YN6B 4NHUA 2JELL 3MOAL 2CDGA 2VLMD 1BQHA 1NAKL 2Y5EA 3X13A 4Z8FL 4XNZB 4MD0B 4WDIA 2Y1VA 3W81A 3MFFB 1HEZA 4RGNB 5E8EB 3PNWB 5HHXH 1CWVA 4JFFB 4JRXB 1FJ1B 4OZIA 1R5WA 5KN5A 1NEZB 2ENYA 1KCVH 3PDOA 4L4VD 5GGRA 3VXQB 1WBZB 5GHWL 1DQLL 2XTJD 5TFSH 1X7QB 1T66D 2B1HL 1J05B 2WBJD 4OJFH 4OLXH 5K9OA 4KJPD 1PLGL 4OUUB 3GJEB 1ZTXL 3U36B 4H5SA 3VXSD 1KB5H 3T2PA 5E6IA 5DFVC 1A3RL 3BZDA 1FZJB 2JJWA 1L7TH 3LS4H 3T65A 5EORL 4OGYH 1XGRA 2ZJSH 3U7WH 3ARFC 3MACL 3CSGA 5F1IB 5D7KE 1JK8B 1YUHB 2GK0A 5D1QB 5C0AB 3PWJA 1ND0B 2VLKA 2GAZA 1NBZB 4FS0A 1JHTB 3HMXA 1AGCB 4ZTOH 5C6WH 5DQJA 3AREB 1WSST 3MZGB 4WFFE 5KVGH 1UACL 3ARDD 2R4SH 2FO1A 2ESVA 4KZEH 3MLYL 5BRZD 2IH1B 2WZPD 4PJDF 4EVNA 3TPUB 1E28B 2NXZC 4M6OL 5ICYB 1MJ8L 4KRNA 2APBA 4AEEA 1ZV5A 4RGMC 2GCYB 3UDWA 2F54B 4RAUA 3CPLB 4V1DA 5HHOA 2IGFL 4LFHG 3SDCB 3BAEL 4KKBC 5KSVA 1NEUA 4P3DB 5EIIA 1CVRA 4JHWH 2A73B 3ARGD 2VR5A 3B8YA 4L8DA 4XX1G 3NBNA 4PJ9D 2FIRT 1P7KA 4X98B 4PJHF 3CFJA 2YPLB 3ROOA 1AGDB 5JPMA 4N0UA 3L3OA 2FRGP 4LVNB 4GG6A 5FO9B 1CE6B 3T3ME 3VWJC 1JUFA 2SEBA 3ULVD 3U48A 4NM8H 2PYEA 3VFUB 2EDEA 5IB2B 1RY7B 4PJ7B 4R0LC 4LSRH 2BRQA 2YPKA 2BZDA 5DJYA 1RK0A 3I84A 4QRRA 3I75A 4W81A 4F7CA 4CKVX 4DK3A 5CEZE 1PVHA 2VRAA 4JHAH 4O58L 2NLJB 1Y6MR 3UBXB 1I8MA 4GQPH 1FN4A 5DMKB 4I8DA 4M03A 4Z76B 1JWSB 1YN7B 4M6ML 4OF6A 1TDQA 2FCBA 4TNWF 4ALAL 3BEWA 3FB7B 3QCUH 3EJYD 2IBZY 5CCKL 4MVBD 3LRSB 3TYFB 2ZWLT 4PY8J 4Z7VE 2C3XA 4NKQB 4XCNB 1A6WL 5TH2A 3OPZH 1ZLUK 4EI5C 4F2MB 3LKRB 4YDVB 5FOJA 5FYLL 3PGCA 3JVGC 5B8CB 3RU8L 3WFZA 1ZHLA 1OQXA 1OPGH 5IOPA 3GMOA 3MJ6A 1JPFA 4AG4H 4PP2A 1KBGL 4QTHB 1NC2B 3F7RA 4WI8A 4PUBH 3OGCB 4HUWA 1LO4H 4OLYL 3SGDI 2H3NB 3VFMB 2DI9A 1WAAA 1G0XA 3NA9L 4ZPVB 5EN2B 4LLDB 2V2XB 1S3KL 3QUKB 15C8H 2ICEA 4FQQA 2BCKA 3QIBB 4L9LA 3VMNA 1OGTB 4H0GA 4PGDB 3P9LA 1BM3L 3VXNA 3TNMA 5DRZB 2EH7H 2BNQA 3IDMB 5JOFA 2P24A 4LAJH 3K3QA 5DVNA 5GJSL 4PJCA 3K74B 2GT9A 1AKJD 3WLWC 3SE8H 1T0NA 1RJCA 5FYJL 5DD0L 3D39D 4HH8A 5J1SC 1R3LB 2I26N 4FG6D 3NABL 5DJDB 3FQWB 1N5AA 1S7QA 1U8NB 1V5JA 2FJFA 1R6VA 3P77B 1U3HD 1YQVL 2VJXA 2ZUXA 4HDIB 3HG1A 2P1YA 5D1XB 3PWVB 2HVJB 5FO8B 1YPZA 4WO4D 4JM2D 2BY1A 4KMLB 1KGCD 1GAFH 5D71L 3W11C 3QPQD 3O2DH 5C0GA 5B39B 1GGTA 2EDRA 3BKJL 4BSWA 1RZKH 2XN9A 3G5XA 3IF1B 2GTZB 4U1JA 4ZO7A 4I0PD 3PGFH 4J1UB 4OZHE 4XHJC 1HKLH 3TA3A 3WO3B 1LE5A 1X44A 1AXTH 1B0WA 1RJYB 5H94A 1F4YL 4NQVB 4KTEH 3RY6C 2XIDA 3IJYA 3O2VH 1UM6L 3V6FB 1KCLA 4NQCE 2NTSP 1U3YA 1DBBH 1YN6A 4X9HA 1MCSA 5CJ8A 2BOBA 1FE8H 3BZ4B 4MJIB 2BXYA 2R4RH 3UTSB 2VUOA 1WCQA 5E8EA 1ZXQA 4Y16B 1SYSB 4D0BB 4YBQD 4XXCC 3QP3A 1ZT4B 4TVPH 4JRXA 5T5NF 3QUYD 1FJ1A 1H3XA 3V5HB 3DNKA 5JXAH 1GGUA 4YBLC 1W0WB 1J05A 3V6OA 3FN0L 3GJEA 1EBPA 3ZTNL 3SO3B 2B39A 4Y1AB 5J0BA 5D2LA 2AGJH 1YNTA 1MF2H 4YBHA 5D1ZB 1J18A 3FQNB 3ME0A 5DHVH 1PQZB 3PG2A 2NY6C 4GW4B 4JFYB 1MLBA 1JK8A 5C0AA 1FZOA 1NBZA 1OW0C 1JHTA 3IJSB 1AGCA 3L7FB 4ODHH 3EGSA 3PABB 1CXKA 2DIJA 2XWTB 5BOZG 3MLSL 1L7IL 3NIGE 3P4OA 4PLNC 4JGMA 1ORSA 5EC1B 4WU5B 2CXGA 3TPUA 3U4EB 4JFHE 4NO0D 4XNMA 3DX9B 3DSNA 5ICYA 2YS4A 4U1LB 2GCYA 4BA8A 5E24E 1NCDL 3TCXA 3WIHH 2F54A 4QNPE 4S1QH 3NCYS 4WI4A 5IB4A 5FYLD 2CMRL 2OTWB 1IGIL 1FDLH 2IQ9H 2ZSWB 2AK4B 4ZAKC 1MWAA 4P3DA 3V4UL 4ZFOB 2FEDC 2A73A 1CD1B 3BPOC 4HWBL 2NY2C 4JZJA 3OKOB 1YZZA 4YWGH 3G5YB 5DFVD 4XVJH 1AJ7H 1LMKA 5GIRB 4MXWH 1AGDA 3QXTA 3MLUL 4X6BB 3LEXB 1MCQA 1RJZB 1RIHL 1U8OB 2DYPB 4PS4H 5I8CB 4EUPH 5J7CC 5JR1L 4MLSA 3VJ6B 1CE6A 2QSVA 3ARFD 3FFCA 3MGTB 4WFHD 5C7XL 1N59A 2CKBL 3O3DB 3VFUA 1YJDH 2FEEL 4PJ7A 4UU9B 4P2OA 1JGUL 5IBTH 3W0WB 1WICA 5CEYA 3MSPA 5TF0A 5FYJD 1CBVL 4X5XB 2W38A 1MQKH 2NLJA 3HI6H 4TUKH 3JV5A 3UBXA 4MJ4A 5IROC 1FNFA 3GKZA 1YN7A 2XY1A 3E6HB 3NPSC 5DVLA 3GRWH 4UINH 3D87B 4KKBD 3VFTA 3RX7A 1V7ML 1N4XH 5I8OH 5TDOB 1IAIH 3GIZH 4LVHB 2XPGB 3LRSA 3TYFA 3MRJB 3RBGA 1MI5B 4XCNA 1CLYH 1CFVH 1I7RB 5KSUB 3LKRA 4UV7L 4YDVA 5E8PB 1U8HB 3IAPA 1Q8MA 2X4SB 1F6AB 4I3RH 4EN3D 4KK6C 4QTHA 1NC2A 3RL2A 3VWJD 3OGCA 1XGTA 4WY7H 4U2ZA 3WIFB 2H3NA 4M8QA 3HS0A 5FGSA 2X1PA 4X4ZA 5EN2A 2X2YA 5D7JC 3BO8A 2V2XA 4HS3B 4M5YH 4P57B 2FEEI 3WCYA 3QUKA 4M8VA 3QHFH 3CU1A 4LMQE 3ZE0F 4PGDA 5F88A 4GMTL 4RSVA 5DRZA 1ZWIA 3IDMA 3EZJB 3BW9B 4J6RH 3PQYA 1RZIA 4ODSH 1GPOH 1CL7H 5DDHB 4HS8H 3UTPE 2IFGA 2YR3A 3U6RA 3VXUB 4JQXC 2J88H 4FXGB 4LDLB 1HSAA 2A6JB 3H9ZA 4IOFC 4UDUA 3RL1A 1NC4A 5TE6H 1HIMH 1R3LA 3DO7B 1ED3B 3EOBB 3MRIA 3FQWA 1U8NA 2NX5B 1RUMH 1NCAH 4K3JH 2E9BA 3P77A 1MRFL 4G43B 4EI5D 3TO4A 1EHXA 1GC1C 1IQWH 4HDIA 4XP6L 3PWLB 3MJ7B 4U1SB 1OAUL 2HVJA 3B9DA 2WUCL 1GHFH 1KCSH 4ETYA 4PJBE 4NKOB 4M7JH 2IBZX 3RAJH 3SBWA 5C0BD 3ARBB 4PREB 4Q58C 5HHMB 2H6PB 4GQ9L 2I60H 1I75A 4NC1E 1E4KC 4KQ4H 3IF1A 1DFBL 3PF2A 2BK8A 2OI9B 4J1UA 4J4PC 3DUUA 3QDGA 1TVBA 2V5SA 1T2QL 2BP3A 3ULUF 3PIQA 5B22A 4G9FE 4HIIA 3AVEA 4GAFB 5CGTA 1DP0A 1RJYA 5D72L 3C5JB 4Y5YC 5T3ZD 4HUVB 3AXLB 4QTIL 4R8WH 4U0RC 4UUJA 3WLWD 1N6QH 5KS9E 1HXMA 1BFOB 4OFKA 3WS6A 3BZ4A 3BZFB 2HP4A 3NGBC 1RUQH 1NLDL 2AW2A 5GSRB 2XZCH 4Y16A 3WSQH 4ELKA 1QSFB 1SYSA 2NW2B 4D0BA 1TJHL 1ODAA 5F7LB 3V5HA 2H1PL 4K2UH 1B6UA 1BAFL 1RK1B 4LKXB 4P59H 4RFEB 5LAXB 2CLVB 3BVNB 3DHJA 1MCEA 4QRUB 1HHGA 4QRQA 3QZWB 3VFPB 3DX6B 3V6ZB 1A7BA 3ROLB 3WXWH 4P3CH 3NH7L 1BECA 4XHJD 5BS0B 3BH9B 5JW4Q 3FQNA 1PQZA 2XWJB 2AK1H 5E2UL 1HSBA 3FO9B 4GW4A 1CE1L 4ODTH 4JFYA 4Y5XA 4LEOA 4JPKL 3H3KA 5GGSB 2NXYC 2BSTB 2DIAA 2G5BB 2DWDA 3VXRE 3IJSA 4BQCA 1QD0A 3L7FA 3FTGA 2ICWB 2D03L 2I27N 3JV6A 3PABA 4XCEA 1ETZA 4PJEF 2R9HC 2ZG3A 1TZIB 25C8L 3QI9A 2Q6WA 4BQBA 4WU5A 5CZXC 2I07B 3DX9A 3RIFF 3KPRD 4AK1A 1KPRB 4U1LA 3EO1B 5EU4B 4APQD 1OP3H 1RHHB 2OTWA 2WANA 4OI9A 4G80A 4DKEH 4KVNH 2AK4A 1BPVA 5EWIH 4ZFOA 3O45A 3RWJB 3PXHA 3SQOH 3O8XC 1KJ2H 2EDKA 5ICZA 3G5YA 2J8OA 4PBWD 1NLBH 3LEVH 4IM8A 5GIRA 3SDDB 1U8OA 2DYPA 4M7KH 4NJAH 1PW3A 4DKFH 2JF1A 3VJ6A 4R6UA 3MGTA 5HYJB 2NY6D 4X80H 3O3DA 4X8XA 5GGVY 4N8CH 1B0RA 5C6PB 1CIDA 3ARVA 4PJ5B 4UU9A 3CJJA 5H35A 5SWQB 2YUXA 4RIRA 5MP6L 2DKUA 1ZGLB 3VGGA 4ZQKB 5L9DL 1I1YB 3IAQA 2YEZB 4HK0A 2EDTA 5KG9B 4NFDA 5IMMA 4I9WD 2JB5L 5IK3B 3DTXB 3S35L 3MRGB 3LDBC 4M7ZC 4WW2A 3U82B 5IHUL 2XNAB 2FATL 1U8QB 2HN7B 1OP3K 2IADB 2YUZA 2DQCH 2X4UB 4ZAKD 4KTDL 4CRPA 3K8MA 2XPGA 3MRJA 2NY2D 4HKXA 3SKMA 2WIIA 2VZUA 2JK5B 1I7RA 5KSUA 1G7HB 1BLNA 1U8HA 2X4SA 4AY0A 2GW5A 1I9JL 4NT6B 1OAYL 5FGCE 5DXWA 4D9RD 2QJDA 4GRMB 5EIVA 4G8FB 4HS3A 2ZCHL 4ZUWA 5CJBA 1P4BL 1KEGL 5C09A 5IV2B 5L2KA 1U9KA 5D9SB 4DFIA 4X7DC 5E8NB 3D9AH 1S9VB 1X9QA 5DZLA 1P69B 1VEOA 1O7VA 3OR6B 4TULL 3VD3A 4N90E 2E7LA 5DDHA 2F8VA 2R0WL 4PJXB 1QSEA 4HSQA 5IVXB 3MRCB 4LASH 1P84K 4X99B 4NJ9L 1EJOH 1YY8B 3HR5B 2XYCA 3C60B 5CEZL 3QFJD 4GXVL 4Z78B 3QUXC 3BP6B 1U0QA 2NX5A 2FX7L 5ICXA 4POUB 3BZEA 3EDJA 5SWZE 1R5IB 4FQLL 5F6IB 1F58L 4G43A 4PRHD 4HF5H 1FLRH 4ZD3L 1NMBL 5IB1A 3MJ7A 4X6DF 4XXDA 4GW1A 2YD6A 4NKOA 4HGKC 1JHKH 2WW8A 4XPHH 5EO0B 5MEQB 4PREA 4YHNA 3OAUL 5FCSH 3MBEB 4C58B 1F3JB 1CICA 5D7JD 5GS1B 5JHLL 4DFHA 5FXCH 3S5LB 2EO1A 4Q7DA 4I18B 3MV11 4NBYB 2VWEE 1JYNA 3ULVH 4X7CC 3VH8B 1FBIH 1S9XA 3IDJB 5CKAA 1QBAA 4P4RB 4YDKL 3B2VL 3H3PH 3N1MC 2Z8RA 4I5BA 5F3HB 3U1SH 1ZGLP 4Y4HB 4OGZA 1SEBA 1HNGA 3HZMB 5JIPA 2PO6C 5F96L 3NFPA 1CLOL 3NZHL 4IOFD 1BFOA 3WFDH 3I6KB 4ONFH 3LRGA 4R4ND 1U41A 2P5WD 3C6SB 5JW3L 5DVOA 5GSRA 3U4AA 1F90H 4YUEH 1QSFA 1OGAB 2NW2A 2VAJA 1HH6B 4RMQA 4LRNL 4DOHB 1YEGL 4DZBB 1W72L 1RK1A 1A1OB 2H2PD 3BVNA 2CUIA 3MLXL 3DX7B 3SJVD 3SDXF 5L6YL 4NC0B 3PWPA 3QZWA 5D96B 1EEZB 3RPIB 3CSYB 3LD8C 1KB5A 5EBGA 2NW3A 1FNEA 2W0LA 3WNLA 4JRYE 4P5KA 1CT8B 4CW1B 2EICA 3MNZB 3CU7A 4J4PD 1JTTA 3VXPB 1J9CT 2XV6B 2XWJA 3M1BA 2Q7YA 5I19L 1Z9MA 4S1RH 4FZ8L 4O5LL 2DQFA 4BSVB 1KEML 5DHVB 4U0QB 2XRAL 5GGSA 4OLWH 4NKMB 3NACL 2BSTA 4HIXH 4NZDA 1AGEB 4OD3H 2QBWA 5EU6D 1T1XA 1FPTH 4JJHA 1TZIA 4JKMA 5KW9L 3LPFA 2BOCB 3CX5K 2Y07L 4RFOH 3QCTL 3BH8B 2I07A 4Y2OA 1AO7B 3X3GH 5IT2L 5EUOB 1YEDA 3DJ9A 4LVOC 1FFNB 1KPRA 3BSZH 4JRWA 3L5HA 2EXYD 3EO1A 1KN2H 4WEMB 3T2NH 1Z5LB 3VRJB 3HC4L 3NCBB 2NY3B 5LGHH 3FMGL 3ZT7A 3FB8B 5EZIL 1FZKB 5IB5A 1C12A 3RWJA 4A6YL 2AKRB 5I16A 1DLFL 2E27L 1WFOA 5GRYA 4O9HL 1OAQL 4Z7UE 5F6HJ 3ZKXB 2NY0B 5D7LD 2YA2A 3GI9L 4TOYL 4Y19E 2UZIL 2APFA 4U1GC 5SWSD 3NN8B 1MAML 3VFGL 1HXYB 5HYJA 2ICWJ 3QQ4A 3EYUL 1AQKH 4X7SH 4EUPB 1OAKL 1INDL 2NXYD 3BOVA 1CXIA 1PG7H 4QOKB 2WK2A 4NCC1 4PJ5A 1LEGB 1YNKH 4BH7B 1A21A 3LY6A 1ZGLA 4ZQKA 3SGKC 3HN3A 5EFIB 3P3YA 5FOBB 1I1YA 3F7YB 2YEZA 5IVZA 2R9HD 5BV7C 3SQBA 4OZGB 5KG9A 5IK3A 3QQNA 5CSZA 2H8PA 2AERT 3MRFA 4L5FL 3MRGA 5CZXD 4D9QD 2R8SH 4ELMF 1KENL 3O6ML 4X5WB 2B2XL 2HN7A 3WUWB 2XZAL 1A6AA 3NTCH 3SDYL 1ITCA 5ILTH 4WWKA 3RUGE 3G5ZA 3RWIA 4CVUA 1FORH 3ILPA 4RGNE 4PB0L 1JGEB 4ZO8A 1P1ZB 1AE6L 1KPVB 3AROA 4JFFE 1EFXD 3O8XD 2JJTA 2JK5A 5IM7B 4TSAL 3FO2B 1G7HA 4UQ2A 5FM4A 4JPWH 1QQDA 3QO1B 1A9BB 4OM0L 1EUTA 5DHYB 5ALBH 3CMOL 4HUKB 1NFDF 2DM2A 1BOYA 2D7MA 4LCWB 5AEAA 7FABL 2HH0H 1L6XA 5E2WH 2HFEB 1H3GA 5IW6B 2W9DH 2UYLA 4GRLB 4AYFA 1AP2B 4MA8H 1NKRA 4QXUL 3DIFB 2EDHA 3BYYA 1T83C 2C7UA 5KSAB 2DDQH 4WCYH 5D9SA 4P46A 4M4RA 1SJXA 4H1LG 3VMOA 1XGPA 3MRMA 4Y4FC 3OR6A 3GB7A 5C0AE 3QEGH 4U1IA 2VKWA 1UA6L 3RJQB 5IVXA 2CUHA 4QEGA 4X99A 3LH2L 1QRNB 2ZKHH 3HR5A 1B3JA 4NNPH 1CTNA 5DA0B 4Z78A 3BP6A 2APWA 4GRWE 4XP5H 1NCTA 4LPTA 5F7EL 1MVUA 1X5YA 4MXVF 3RA7L 2DLHA 5FA3B 4OI8A 3DSFH 4JO4L 5K59E 4FZEL 4J3UA 2VZ3A 4FABL 1QFPA 3D1MC 5GRJH 1BBDL 1YEJL 1FNGB 5DJXB 2IANB 5EO0A 3RVWD 4QRPB 1C5DB 3FN3A 4YH6A 4QGTA 5MEQA 1UM5L 4FXLA 3W9EB 1IGJB 3ZE2E 3O2DA 3MBEA 5GS1A 2XKNA 5CD5C 3S5LA 2K7QA 1DN2A 3ESVF 2XICA 4Y0GA 4JFPB 2YPLE 1I3UA 1DL7H 4RAVA 1KB9K 1U58B 4Y5VA 3IDJA 4P4RA 2CD0A 1CG9B 1J88A 1NBQA 4Y4HA 5E2TL 2XZQL 4IRJB 4YR6B 4E42A 3HZMA 5JO5B 4KQ3H 4XNUH 4RBPH 1TZGH 2O5ZL 4IRSB 3VFNA 1D9KC 1AHWB 3I6KA 3EFDH 3V95A 4TYUA 1E6OH 2Z0BA 5KSBB 4CVXA 3BWAB 1OGAA 4PJFF 4TSBH 1HH6A 3O81A 2QLVB 4J3WA 4DZBA 4NHCH 3WHE0 5GRVL 2IALA 2AJVH 1DBJL 2X4RB 3TJEL 1A1OA 2VLJB 1E6JH 4NQXA 4LCCA 3AY4C 1JE6A 1EEZA 2CH8A 3RPIA 4B7IA 2CPCA 4DAGL 3DOSA 3AM8C 4S1SL 3VG9B 3KPSB 1RUAL 5LXGH 1CT8A 4CW1A 1J8HB 3ULSB 3MNZA 3T0EB 1DSFL 4ONGL 4Y4KD 3RDTB 3PHQA 5IUSA 4UT7L 1L4IA 4PGCB 4YEEA 3QCVH 1JPGA 5GS0C 4NOFA 2NY5H 4JO3L 5DHVA 4BSVA 4K94C 4P4KD 5C08D 3D0LB 4NKMA 3X3FH 4YXLL 2BNRB 3PP3H 1ULVA 4A2LA 1AGEA 4YX2L 4LOUC 4F15B 5DUBB 3QJFB 2VB5A 3VGAB 2KKQA 3W5MA 3ZLQC 1NBYA 4LMQI 3C6LA 1U6AL 1UYWH 1YMHA 1HHJA 4GG8B 12E8H 2OTUA 1EZVY 3BH8A 1AO7A 3GMLB 3O11B 5EUOA 1FFNA 4P9HL 3VRLF 4G8GB 3O3AA 2DB8A 4O4YL 3I3DA 3WIHA 3CLFH 1FZKA 4LVEA 2A77H 4Q2ZB 3MUHL 4U6XB 4OQ1A 3EYVA 1T22A 3NIDE 1G9MC 1WBYB 1KJ2B 3BE1H 5E08L 1T5WA 4CL7A 1S5IH 1QLEL 3NN8A 3AUVA 1JGDB 2VDQL 1MSPA 4QRSB 2Z4QB 1OL0A 4W6WB 4EUPA 5E6IC 2DLIA 4XVTL 4KVCH 4YHML 4QOKA 1LEGA 1C1EH 3I2CH 4GUPA 4BH7A 3EIFA 1OF2B 4M6AA 5J12C 4CMHC 4CU7A 1FGNL 5EFIA 3F7YA 5IBLD 1OB1B 1QBLH 3EYFB 1OAXL 5T3ZH 5K9KA 4B7LA 4XBPB 2XTLA 3G5VB 5I6XB 3G04A 1EEQA 5JORB 2OP4H 4MJIE 1HILA 5IEHB 3GSRA 3UTSE 5LCVH 4RA3A 2XQYG 1P1ZA 5F7UA 2DQGH 1CDIA 3C8HA 5D6DC 4M62L 4K7PY 3UDWC 3N1FC 5DHYA 4OZFG 1I8IB 3S34L 2BC4B 4LCWA 4L4VB 3MA9L 2FNBA 2XTJB 2EDQA 2VQTA 2WBJB 2HFEA 4LSUL 2ARJQ 2VL4A 4Y1AE 4LCYB 1DZBA 5I1IH 4QT5A 3UZQA 3VXSB 5DTFB 4NBZB 2AJ3A 3VD7A 3ULUD 4R7NA 3OB0H 1AP2A 1WJ3A 3DIFA 3KPQB 3L5JA 1PKOA 5FUOL 5KSAA 5TE4H 1EHLH 2R56L 3QUMH 2ZUTA 1NANH 1QFWL 5B38A 3U0PA 2DMKA 1X5KA 1ZHNB 2PKDA 5GS0L 2X4OA 4K94L 1J1OL 2PETA 3DVIA 4OFYD 2HJLA 1P4IL 3UYRH 1QNZH 2AQ1A 1OQOA 2VDKL 2GYSA 1L0XA 2FWOA 1N3NA 3L9RA 4HWNA 2P8PA 3EJZC 4U3XA 3ARDB 1HZHH 4N1HB 4I2XA 1G7PB 4DQOH 3L95B 5BRZB 4YIQB 2O5XH 3EDFA 3TN0A 4BFIB 1DEEA 3VGFA 3S88H 4ZUUA 4DGYL 4FXKA 4ERSL 3QULB 4DVRH 1K6QH 3DO3A 1MIEH 4JPVH 1FNGA 5DJXA 1F3DH 4R4FL 2IANA 4QRPA 1C5DA 2HG5A 1T1YB 1AGFA 1LO3L 3ARGB 1MCIA 3HAEG 4MDJB 4Q0XH 4KI5E 5KVEL 3OB0K 1G9ML 4PJ9B 3ESUF 3TT3L 2WBWB 4FTVA 1MFBL 1YEIL 4YO0A 1T1ZB 3BXNB 3SKUD 2J7LA 1QP1A 1RVFH 1ADQH 3MMEB 1QHPA 1GVIA 3TFKC 3SEPA 1QFWI 3LS5L 4OD1L 4LSTH 5DZOA 4YR6A 3TGXA 2ZNXA 1G0YR 4FMFA 5JO5A 3PP4L 2QTEA 4EIGB 3W0WE 1VFMA 4HEPG 4IRSA 4NRZB 4L9LC 4LRIA 5C0DA 3S36H 1NCCH 1J0ZA 4R2GC 4JKPH 1MCKA 1EGJL 3LHPL 4HMEA 3QO0A 5I1DB 1JZ6A 5KSBA 3T3MF 1RZFH 3BWAA 1JNLH 3WNPA 1F8TH 2JB6B 1BGXH 5DMYA 3HMXL 3HB3C 1IAKB 3MV01 2HT2C 2QQNL 1WVZA 2ADIB 1ZLWH 4GKOA 5JOEA 2VLJA 1RD6A 1H15A 4JR9L 3RWGA 3B5HA 2EDDA 3OKMB 5L0QC 1IC5H 1MI5E 1FHGA 5EZLB 3MYJB 3UTQB 1N0XH 1G9EA 5CD5D 1H0DB 5GZOC 1NGPH 3KPSA 3V7AG 5KTEH 3KLSA 3RBSA 1J8HA 3ULSA 3T0EA 5ESAA 4CNIA 3GEWB 3S37L 1QSZA 4BFGA 4WJ5B 3V4PL 3ALPA 5C71A 2WM0A 1F6LL 4OLVH 3ZDYE 2G2RA 4ZFGL 4FRWA 2EE9A 2DQEH 4PRPD 3O3BB 4Z7VF 3QA3B 2VC2H 1KPUB 1KJVB 3AB0C 3GBNH 4W4NA 1GH7A 3OXRA 5ENWB 4NWTH 3TA3C 3BPNC 1ZT1B 1D9KD 2IFFH 5GRWA 1QTYT 3GSVB 5FK9B 1H9VA 5ERWB 5D2NB 4Z7OE 5DK2B 3I85A 3GMLA 1T7YA 4LARH 4H20L 2FECL 1CGVA 5HGGS 3T0VA 3VXUE 4J3TA 3JWDC 2K1MA 1AKJB 3N9GH 4R26L 4XNZC 1E4XI 4NUJA 5JIHA 3D39B 5I8KL 2Q76B 1RU9H 2O93L 1OSPL 4Q2ZA 2DBLL 4U6XA 1BJ8A 5F1KC 4OCMC 3UEZA 3DGCR 3KNBB 4EOWL 4LLQA 1U3HB 3INUL 3FQXB 1T0MA 3GMNA 1JFQL 3OX8B 1WBYA 2DQJH 2AJUH 1KJ2A 6CGTA 5AWNL 2Z9TA 4NKIH 4WO4B 1H3VA 1KCRH 4OF7A 4LSPL 3V6OC 1JGDA 4PRIB 1UEMA 4QRSA 5HYQA 3PV6B 5T3XD 3MJ8B 3RHWK 5E8DL 2M2DA 1GGIL 3A6BL 3N0PB 4LOUD 3RI5F 3MREB 1MFAL 2X89D 5GGQH 1R3JB 2D0GA 2WIMA 5C6TH 1LE9A 4K3DL 4PY8I 1ORQA 3EYFA 1I7ZB 5EOQH 4NZTL 2RIKA 4JFQB 3G5VA 3L3KB 5I1EL 4HGWB 5ELIA 4PJGB 5FV1L 4HIHB 4JDTL 3P4MB 2AP2A 2FYYB 4LLUB 4NKDB 4OZHF 3KR3H 3QAZB 1H3PL 2RR3A 3CAFA 3KYKH 2VDNL 2DN7A 3L5WA 1I1AD 1SJVA 2OLDA 1GC1H 5DD3L 4LBEB 4RGOL 1IAMA 4MD4A 1BQSA 4U3HA 3QUYB 3V0WH 3KJ4C 1RV6X 5C1MB 1JZ4A 4LHUG 2VOTA 4XCCH 2BSRA 1BVLB 2BC4A 4U6VH 4HWZA 3DLQR 4J8RB 4PB9L 5JMRA 4JZJC 1ZANH 3VXSA 1WC7B 4PRBA 5E6ID 1HYSC 3C8DA 4J3SA 2VLLA 4Q6IB 2N4IA 3KPQA 4DGIH 2D4FA 4LKCA 5BS0E 3MUGB 3FRPG 4LVNC 1MAJA 3HE6A 3F8UB 4WV1A 1CCZA 1A0QL 1ZHNA 4HQQH 4PBVC 1XGQB 2YN3A 1A7QL 1A9EB 1P84J 4P2OC 1A7OL 1G7MB 4X9FA 2ZP0T 3V9FA 2W91A 3OJMB 2IBGA 3NAAL 1VADB 2BDNH 4OB5L 3WDIA 3S7GA 2HFGH 1JP5A 4C57C 4NO0B 5IBUB 3O6KH 2C26A 1F11A 4V1DD 32C2B 4Y8AA 2X4NB 5HHOD 4M6NL 1DBKL 5E6ZA 2OS7A 1FP5A 4JFZL 1T1YA 1DVFC 3ARGA 4LSDA 3V52H 3NIGF 1D6EB 2VYRE 4ZG1A 2VZVA 4OCYL 4PJ9A 3QHTC 4UQ3B 4JO1H 4K7PX 1J1PH 4IOSD 3FT2B 4HAGA 4QNPF 3QUZD 4P2YA 3WFEL 3BXNA 3OMZA 2GSIA 2PYED 3ARFB 3MMEA 5D6CB 4JM4L 1UKTA 4YHKL 3WL9B 4C56A 1Z0NA 3MX0A 3MV8D 4HFUL 4QRRD 1BVKA 1YMME 2A83B 4MAUL 1KXVC 3EJZD 1CFQB 1VKXA 3KJ6H 2JIXD 3LEYL 4OV5B 3H8NA 4XGZA 3MODL 4HLZG 3MLRH 4RGMB 4L3EA 3NCEB 4H88L 4LAQH 1TVHB 3WJJA 2IG2L 5DUMH 3OKMA 4P2RA 3GHEH 1JBJA 2YD7A 5EZLA 3TO4C 4AMKL 3IXAA 3MYJA 5HHVL 5HVFB 4MYWB 2DF3A 5DQDH 2CDFB 3TBYB 3TV3L 5INCA 1P4LA 5CMAB 4WJ5A 5JLZB 2B4CH 2VDRL 3BPLB 5CLWA 3CFBB 4EN3B 1H5BC 2XA8H 4PP1C 3VWJB 3KVQA 3TFKD 4Z6AT 4NPYB 4F37K 1K9TA 1LO0H 3O3EB 5GGTA 4R0LB 1F4WL 5E70A 5J89A 3LPGA 1KPUA 2RAMA 3TPKA 3CLEH 5ADOL 5ENWA 4ODXB 4R2GD 1ZT1A 3L3IB 3BP4B 1FL6B 1VEMA 3CX5J 5KANI 4WRLA 4ONHB 4BUHA 1XH3A 4NGHL 4IMLB 3MCG1 1C5BL 3MJGX 2UWEA 1J0YA 4L8BA 2DI8A 4PJXE 2HT2D 1D5BB 3W82A 1MLCB 3VDAA 2XQBH 3EOTH 4XP1H 2H32H 1MRDL 4XPFH 4MNGE 3WS6C 2Q76A 4PJIB 5FYKE 4Y16C 1IGCL 2IH3A 2YBRB 5DO2C 3KNBA 3FQXA 4POZC 5GZOD 5IJKA 4EI5B 1G7QB 1OAZL 5I1HH 3FB5A 1UG9A 1PSKH 2CR6A 1UCBL 2FSEB 3DARA 2JE8A 1YYLL 2JCCA 4G6FD 4PRIA 3LMJH 3TIEB 4DW2L 2XN9D 1PYWA 5C0BB 1KOAA 4WFEE 2DTSA 5HHNA 3P11H 4WEBH 1FFPA 3WKMH 4JREC 4N1CA 5DVKA 5T5FL 3TA3D 3UJTL 3VFVA 3MREA 3V7MA 3E1F1 1AI1H 4Y5XC 1HYRC 4PJBF 3IJHB 1XAUA 5K9JL 3O6LL 4LU5L 1I7ZA 2BJML 3D18A 3I9GH 1AD9B 5HVWA 5KVDH 4HGWA 3IVKB 5F21B 1CLZL 4HIHA 1AIFA 1FV1B 3P4MA 3MNWB 2WP3T 1HCVA 1NBVH 3JUYA 4KAQL 4NYLB 4LLUA 4KHXL 1QLFB 4PR5B 3T2QA 5DMIH 3QI9C 1T80A 1XR9A 3FL7A 4HIEA 4Q9RH 4DOHE 2W60B 3R4DA 3VFOA 3Q5OA 3C5SA 5LGJA 4TVPE 1L9NA 1OP5K 5KS9F 3ECBB 2LVCA 4J8RA 1WTGT 2ZUQB 3AMLA 4MSWB 2RHEA 1WC7A 5T1DH 5DD1H 3EO9H 4IIQA 1G1YA 4Q6IA 5KVFH 4NO5B 4MA7L 3MUGA 5F7FA 5D5MB 4WTXA 4CU8A 2YC1B 4LLWA 4MNQB 3UO1L 1XGQA 3QUMB 2O5YL 1B2WH 1A9EA 2Z92A 2QSCH 4WGWB 1OCWL 3PWUA 4X4XB 1G7MA 4ISVB 3QG7L 1KTLB 3Q2CA 3F58L 3RVTC 2IC2A 4BZ2L 1M05B 1WFUA 5CFHA 2E7HA 4JPIB 3MLVH 1KULA 2DQTH 1VADA 4WW2C 5EUOE 1EH9A 3G6JB 3KPRB 5TPWH 2AJSL 4JG1H 3RIAF 4APQB 1T7ZA 3MLZH 3NZ8A 1Z6JT 2YK1H 1BFVL 3GBLA 3VD5A 4OCLC 1HYSD 1XF3B 4EI6B 1D6EA 2M1KA 5DURD 3RRQA 1U3JA 4JFDA 1YNLH 4UQ3A 1KB9J 5BO1H 1K4CB 1I85A 4NC2B 2V17L 4XNYL 4MWFA 3FT2A 4EIZC 3FFCD 4LLVB 1WLHA 3VXTB 4YHYC 4M48H 3ARFA 2VH5L 4KWUA 2NY6B 1I9EA 1MCFA 4G3YH 4BFEA 1MCLA 4P2OD 1FCGA 4TTGA 2MQ3A 1DJSA 2A83A 1LK2B 4CU6A 1PZ5B 1S5HB 2OXGA 4Q9QL 4LCIL 4NQSB 1CFQA 4OZGE 2BNUA 4MQ7B 4NZUH 4DGVH 2E7LC 3RTQC 3UTZB 4PLJC 2CIKA 2L0DA 1YC7A 5IW1B 1IKFL 1SEQL 3VXME 4K8RC 3HR6A 1TVHA 4PRAA 2V2WB 1JYWA 4WUKL 4HJJL 1U8LB 4ZAKB 3V0VB 5FGBC 4HC1L 3M45A 1DVFD 3BPOB 4F7TA 2XXCB 1KXTB