5C0AD

1e6 tcr in complex with hla-a02 carrying mvw peptide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
197
structure length
197
Chain Sequence
EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMRGDSSYKLIFGSGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Hotspot autoimmune T cell receptor binding underlies pathogen and insulin peptide cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 197
sequence length 197
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0aD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c0aD02
5INCA 4JDZA 4Y1AE 1D9KA 1FBIH 3SDCA 1DQTA 5KSUA 4FQIL 1D7FA 4XPBH 4TQEL 2YR3A 4JCMA 1F2XK 1WFUA 3GM8A 3FFCD 1YJDC 2DI7A 3IS0X 3P9WB 4I3SH 1KPRB 4XCFH 3RWHB 3MRDA 3HZMA 4U6XA 3QQ3B 5ESAB 4X7FC 1CE1L 5B4MD 2XRAH 5ICYB 4IDJL 1PKQA 4XPGL 4DUWA 3I9GL 3VWJD 2YPLB 1AD0A 1YMME 4DKEL 1F02I 1GHFH 5I8EB 5E70A 1AHWA 4NDMB 3NCFB 1M7XA 2YPVH 1A3LH 4YZFE 1GGYA 4GRLC 5AZEH 1MCPL 4NHUA 4X4YB 3SKMA 1BVKA 1X6LA 1AGDB 3C60A 2C3XA 1CLYL 2XICA 2VDMH 3MXVH 4HAGA 5J57B 4PGDB 5CEXB 5EN2B 2IG2H 4NM4H 1JWSB 5DHYA 1DSFH 2K7QA 4U1KA 5HGAB 1BEYH 1YEIH 1HNGA 4OZFA 4PB0H 4H25B 1KPVB 4IOFC 5F1SA 5D7JC 2V17H 4JM4H 3QUMH 3N85L 3FB8B 3F7VB 3EO1B 1X3DA 3E3QE 5C09E 1K4CB 1QRND 3VGGA 3K1KC 4HUXA 2OL3A 4YHLL 2C3WA 2NY4C 4ZFGL 1LILA 4JFQA 4MJIE 5L7XL 3PHQB 4LSQL 4DKFL 2Y5EA 1YEJH 4F8QA 3S3SA 1F4WL 4HUMB 4MQSB 1PDKA 4Q9RH 4D9LH 3LMJH 5E5RB 1SEQL 3TA3C 3B9KD 1Q9OB 4J3WA 3TWCH 3SE4A 1A7QH 2PF6A 4R3SA 5AYQA 2F5AH 1JVKA 2HFEA 3EHBC 3MRRA 5MP6L 3REVA 4ONGL 2AK4A 2BOBB 4MQ7B 5IF0B 2F54B 3WDHA 4FTVE 3ULUE 3LKNA 2ICES 4ONHB 5I1DB 4QOKA 5DD5H 1MFCL 2IANB 4XNMB 4YUEH 4ALAL 5IG7A 4PLJC 4KC3B 4MD4A 1WF5A 1FDLH 3NIGF 3SKJL 1OT2A 5IVXF 4PR5A 2PW2A 2YUVA 3BEVB 1FFPA 5I74C 2VDNL 4QHUA 4PRDB 1MWAL 4Y4HB 4GW4A 4HKJB 4JB9L 2HFFA 4NPYA 4M61A 3ZYOA 3DX9B 4HWBH 1IZKA 5HVFB 3TCLB 3PQYA 3QCUL 5TF0A 3MRQA 5DEGA 3OB0K 4GOSA 4OLUL 1JP5A 4JJHA 2A9ML 1H9VA 1JRHI 3RJQB 1JGUH 3DV6B 1S7SB 1U8NA 4FMFA 4AEHH 5J11B 1DQMH 1D5ZB 1IKNC 2IWGA 2DQEH 4YPGA 2VLRE 1NAMH 5JIKA 1DL7L 3HNTL 2DYPA 1OAZL 1FNLA 2BVUA 3L3IA 1CCZA 5I17B 4TNWK 1EEZA 4EN3C 1ES0A 5IM7B 5C0BA 2R1YA 4YXKH 3KPSB 1IAIH 1QPXA 4BQCA 1J0IA 4GRLD 5JA9A 35C8L 5FYKU 3O2DL 4QXTA 3VCLA 4HPOL 3HI5H 3ARGA 3C8HA 2WP3T 5T1KB 4HV8A 1D9KC 3SDCC 2Z31B 3WHE1 4K8RL 2HRPH 2XTJB 1NCAL 3ZKMC 5KZCD 3IDMA 2ENYA 1I8MA 3QHTC 5HTSA 4IOFD 3A6BL 1R5WB 5D7JD 3P4OB 3MACL 5D1XA 1BBDH 1PFCA 4Z7QE 1U3JA 3HA0A 1KLFA 3HZYB 3OBAA 4JFYB 5FIEA 1JHTB 4KGLA 4U6YB 1LHZA 2VDOH 2YD6A 3IFNL 4M1GH 2NY5L 4MZ2A 4YDJB 3RPKA 3C60C 4YXLL 1IAMA 4HJJL 4M8QB 2BFVH 1AIFB 1GIGL 2X41A 4PJ5E 3TA3D 5KW9H 4O2EB 1UKQA 3SQOH 4YHKH 2OTWA 5JPMB 1YPZA 1E4WH 4G6FD 5E1AA 3TH2T 4XX1G 3KAAA 3WNKA 5I8OL 1K3IA 1QSFD 1J86A 1MH5B 1FVCB 2ATPB 4QRUA 3NTCL 2DM7A 2FBOJ 3FRUA 3ZKXC 2EEBA 2BRRL 2PCPA 4DVRH 2EXYC 3VU2A 4ZS6C 1L0YA 1A4JA 3GSNH 3UO1L 4Y4KC 5IQ7H 1FO0L 4R4NC 4Z7UA 4OCLC 4PLJD 1GC1H 3R8QA 5C0FB 5K9QI 3PL6B 2JK5A 1G6RH 1I4FB 2P5WE 3OKEA 4MNGA 2XYCA 3WLBA 2XZQL 4N0YL 3T3PE 2R0ZH 1FYHB 4WI4A 2IC2A 1T20B 5ESQA 1A7RL 3DX6B 4DVBB 5GS2D 3BIKA 4BZYA 3SE4C 5GGRY 1N0LA 5KN5B 4DEPC 3DECA 3CK0L 3FO1A 3QH3A 5GGSA 1TVBA 4OGXH 3F62A 5SV3A 43CAB 5DDHA 1QNZH 1EV2E 4UNVA 5E8EA 1IEBB 4PRIA 5DK0A 4K55A 2QQLH 2FSEB 1S7WA 2ZKHH 1FYTE 5E8OA 3T09A 4HT1H 4ZOEA 4OZ4A 4MWFA 1VEMA 1R3JB 2F74B 1CFQB 4H26B 2L7UA 4WGVB 1G7LB 2QL1A 2F53D 4EN3D 1KJ2H 3L5JA 3IDGA 1FPTL 4JM2A 4LSDA 3D85B 4Q9QL 4XP5L 1RZ8B 5D71H 1U8JB 5EIQA 4PRNA 3EYVA 3AMKA 1P69B 1C7SA 1CGUA 3D87B 1RJYA 3OWEA 2MQ0A 4ELME 1J8KA 1CDBA 1OD7A 4PS4H 1D9KD 3SDCD 4IOIA 4JY6A 4LNRA 2O5ZH 1F90H 1CG9A 5E6IC 4C56A 5CBEA 1J1PH 1TZIB 5JMOC 3DHMA 2BVQA 3EO9H 3X14A 3ZKSD 1EJ6A 1KCRH 1K3ZA 1UZ8B 3ZKMD 5EZLB 4LHUA 2DWEA 3BKJL 3WO3B 2X7LA 1QUNA 3D0VA 3MRIA 1NGPL 1T0NA 3U30C 1QLRA 3DWTA 4ZS7H 3NABL 4AEIH 1U3HB 3ES6B 3RWCB 1BOYA 4PGBB 1QBAA 2OQJA 5DTFB 4YNYA 3C60D 4X8JB 5GRJL 2G9HA 4YBHA 1VADA 1NL0H 2UY6A 4FXKB 4S0TD 4LAQL 2M1KA 3BRGC 3HE7B 1BIIB 3T04D 2ZCLL 3NCMA 1S7QA 3QNZA 3S35L 2BVTA 4KUZL 5L8KB 3KPMA 4NT6B 4OQTA 4TSBH 3Q6GL 3K81A 4LHJB 1MY7A 2VLJA 3OSKA 1A9BB 4AJ0A 2CRMA 3NCJL 2EXYD 2ZCKH 3QDGB 4ZS6D 4WNQB 1FCGA 3MRJA 4Y4KD 1EO7A 4G6JL 4RZCA 3CIQA 1UQSB 1TTFA 1DBBH 4LPWA 1NBYA 3DMMB 5DJXB 2KQNA 1U41A 5I2IA 1S9VA 1JN6B 2HKHL 4CJ0A 3LV3B 3FCTB 3OAYK 4YFEA 4MAYA 3MUJA 4E41E 4KVNH 5DJAA 3QXUA 5HGDA 3QXDA 1DANT 2AK4D 4Z0XB 5DD6B 5D2LF 1YNTB 4YZFF 3P0YL 1UG9A 2NY2B 3PWPE 2E6PA 3MV7A 2AQ1A 2W9DL 2P8LB 3L3DB 2ZSVA 3HMXA 5CP7B 1U2CA 3VFSA 4YHNA 2VWEE 2HT2C 4QTIH 4K7FB 2WAHA 4OLXH 4XAKD 5FAAA 5ESVA 2I24N 1LO3L 3MLWH 3OAYH 5EOCH 3QFJA 3BZDA 3V4UL 5CD3A 4X0KA 3PQYD 5ISZE 1X9QA 2R2EA 3NFNB 1IGCH 5IHBA 4UTBH 5J6GB 3S3PA 1HHGA 5DVNA 1I1AA 3Q6FB 1MIEL 4L5FH 3IFOB 1QR1B 2JELL 5D72L 1IAOB 3GI8H 1JNHA 1D3CA 3SOBL 3KNBB 1A14H 1LK3L 3F5WA 3DV4A 3FT3B 3GSRA 2NPLX 4D0BB 4NP4H 4M6AA 4ODTH 4ZFFA 2W0KA 4X7SL 4X9HA 4PJGE 5IW6B 4G3YL 3RY6A 3BP7B 2DYPD 1I8KA 3CDGA 5JORA 3MUZ1 1MHHB 2JJTA 4EDXB 4LIQE 1ZLWK 5FDWB 4NQCB 1MRDH 5MEQB 3ULUF 5C0BD 4JM2C 3G6DH 4Y2DB 3D9AL 3ILQC 2GK0B 5JQ6L 4KRPB 1NKRA 3EFDH 3CD4A 4HIEB 2VOTA 4FFWC 2Z8WC 1H3WM 5CIPB 5CJ5A 2KUTA 3FO0H 2GITB 1ORQA 1RIHH 3LZFH 1OGAA 5FXCH 3UPAA 5FECA 1FN4A 2E27H 2ORBL 1BFVL 1MPAL 4FFVC 4NKIH 4HZAA 4JDTL 2DQHL 5BW7C 3T1WA 1H8OA 4ZYKB 1F8TL 1CLCA 3DHJA 1ZHNB 3GSWA 2QR0A 4OZIE 5D1XD 1PLGL 3I84A 2J8UB 3LKRB 1UYWL 1I7UA 2ESVB 4F57H 2VL4A 5B39G 3CC5B 1TVHB 4HZLA 4NRZB 4G8IA 1MELA 1KN2H 1CFSA 2C3VB 3UTSA 1OTSC 4XBEH 1S5IH 2ITCA 2Z91B 1C12B 1A47A 4XVJL 1I1FA 3VXUB 3EYOB 3BZEA 2DQIL 2R0KL 1LO4H 1VGEL 5E2TH 3BO8B 4OLZL 1JZ4A 4RAUB 4L3EE 3KYMB 4EBQH 1ITBB 1WSST 2WBKA 3ROOB 5C92A 3CFEA 5D7SL 1M71A 5FKPA 5I1JH 1WZMA 2H2SC 2EYSA 2Z0BA 1E27B 2D03L 4M6MH 3SGJA 3MCLH 1NAKL 5IB4A 2HT2D 3TV3H 1EMTL 4HS8H 1MIML 4MYWB 3WKML 4WENB 5DRWA 1TFHA 5AZ2H 4X9IA 1JPSL 5FHAL 4TVPH 4IDLA 1F3JA 4MAYC 3VGAB 5TPWL 4RFNB 1WCQA 3LN4B 3SO5A 2VDKH 5TDOA 4Z7QF 4Z6AT 1IARB 2OR8A 3G5YB 5TDNB 2PYFA 4QHNB 3TT3H 3ULSA 2Z8SA 3ZE2E 5FOBA 4DQOH 5AAWA 2E7CA 3K2UL 4PRID 3DRQA 1M7IA 1TTUA 3C5SB 3QIUA 4FNLH 3ZYZA 4M1DH 1PAMA 3BI9X 4PJ9B 1P5UA 1UM5L 1CICB 4YFDB 3WXWH 2A6DB 1X6NA 1J8HA 4UDTA 2R23A 3OGCB 3V5KB 2UZYB 5E03A 4JHAH 2CJUH 3HNSH 4U0RC 1AXSA 1BQHA 4LOUD 3MLXL 4QXUH 4CVUA 1I75A 3KYKL 4JM2D 4DGYH 1J11A 3ILQD 3P4MA 1W8OA 3LH2L 3TZVA 3VXNB 1X5HA 4NCC1 4QRTB 4PJEA 1I1AC 4FFWD 2OYPA 2XWBA 1BP3B 3O6FB 1ZKAA 3KWWA 4ONFH 4C56D 5FYJL 5DJ0A 3T3PF 1YN7B 1AJ7L 4FFVD 1U8PA 4CU7A 4LHUD 3DSFL 2DQJL 1MRCH 3TBVA 4HFUL 1N6UA 4QRRB 3RGHA 5JW4M 4X6FA 1G7QB 2XIDA 4G8FA 2JJTC 1YJDL 4IS6B 1NGQL 1RY7B 1QR4A 2VLME 4HFWB 1LP9E 1RMFL 1TQBB 3WE6A 3RL1B 5ADPL 2XA8L 1I8IB 3RHWF 4ZUSB 2AKRB 5HY9B 2VTFA 1OTSD 2ICWI 3CVHH 3MRNA 5IFJB 2CQVA 1P9MA 3SHSA 1SYSB 5IESL 2J12B 4R4BA 1QTYT 4FMKA 4XB8A 5EBWA 4ZFOB 1A1MA 5I75B 3IF1B 4LBEB 2VLJD 4P3CL 2PO6A 4X99A 1HHHB 1XF1A 4ELMF 5EZJA 1LO2H 1SM3L 1E0OB 2H2SD 5EB9A 2NNAA 2V7HA 5JOPE 4GS7B 3IKKA 1NEZG 3ZZ1A 3HMWL 5IMOA 2FB4L 5C0AE 3SY0A 3E2HB 3QP3A 4HK3N 4R2GC 2Y07H 4R0LA 5B38B 1IC4H 2VZTA 3U0PA 4IRJB 5FB8B 4H8WC 4MAYD 3M8OH 3CFJA 5FA3B 4OLEA 3ECBB 1JPFB 4JO4L 1XZ0A 2PW1A 2Z9TA 2EZ0D 3CMOH 3GI9H 4LCCA 5I15L 4LVNB 4GJTB 3DX8B 2P5EE 4JZNA 3BW9B 4ODWA 2HYMA 1S7RB 1YECL 3VWKB 3MV7D 1NBQA 3ZLQC 1CF8L 3G6JA 3TT1L 1Q8MA 2H6PA 4FABL 1J0JA 3SGJC 4QXWA 4JREC 2IPKB 5LWYH 3OG4B 4LAJH 1MI5E 5BV7B 5T3XH 2MPAH 3KPTA 1PX3A 5DJ2B 4YFLF 1HKLL 3QFJD 5EC1A 1KYOJ 3S98A 4PV9A 3MRKA 3IB4A 4AIXA 2GAZA 5K9JL 4NO2B 3ZSTA 1NCBL 1I1AD 1UH2A 4RFEA 4QCIA 4HK0A 2NY7L 3FFCE 1KACB 3EJZC 3S35X 3UC0H 4GKNB 4KKNA 4NYLB 1BD2A 3PDOA 2AVGA 1S3KL 3T3MF 2OJEB 3DXAA 4ZXBB 2IAMA 3IDIB 4AIOA 2VH5L 3GFUA 3VXMB 3BPCB 1XH3A 3DX7B 4FXLA 3GUTB 3WUZA 1YN6B 4IRSA 3D18B 4PGCA 3QDJB 3GHEL 1OP5K 3S96B 4P2OB 1QHOA 3THMH 3TZVC 4KI1A 3RGVC 5DJCA 3TLRA 1J5OL 5DLML 1DQLH 1MHPL 2AW2A 3BP4B 1OGAD 1IGIH 2O5XL 1DE4A 4PJDE 4Z95H 4NO3B 2YOCA 4GAYB 1LEKA 2DDQL 1F3DH 3P77B 1Q94B 3QQNA 4PGEB 3N1MC 2Z4QB 1Z6JT 5EZOL 1KEGH 1CZ8L 1G9NC 3SE8H 4X6BA 4UT9H 1QRNE 1WC7A 3GRWA 4OFKA 1FCCA 3QG6B 4M6NL 5CKGA 2NW2B 2EIEA 3AU1B 3KJ4C 3T65A 1H8NA 1OP5H 3OR7B 3EDJA 4KXZH 1MJUH 1RFDH 1EH9A 4ZFZB 5I0DA 3ARPA 4M7JH 1Q0YL 3RX7A 1UB5A 1ZVSB 3MR9B 3UTSD 5BOZG 1MJ7L 1GZPA 4PJGF 1ZHKB 1ZSDA 4HWUA 3H0TB 4JLRA 4R2GD 4G7YL 4P5TB 3VGEA 5ILTH 2N7AA 1P9MC 1R6VA 4PJIE 4UU9B 4ZPVA 5EO9B 1MCHA 3GSQB 3GSNB 1QSVA 2CO6B 5D1QA 1C16A 4HS3B 4J8RB 2EKSB 2HTKC 4AT6A 2JB5L 3IDJB 4Y16B 4EDWH 3MGOA 4L4VE 4KROC 1RUPL 1HILB 3O2VL 3MRHA 2GJZB 1Z9MA 4N5UA 1XCQB 5HBBA 3K0WA 1N0XL 3VGHA 4RX4A 5KTEL 1BBJA 4PP2A 1UH3A 2V7NA 3GMPB 2VXQH 1CYGA 3GSUB 1OGTB 3QRFM 3KLSA 3REWA 3TH4T 4I0PA 1DFBL 4TSCH 1VERA 2HJLA 4Z7NE 2G75A 4R0LC 3MROA 1QFWL 4AZ8A 1U3YA 4DJMA 2VJXA 2XNAA 3CPLA 4OZIF 2R69H 3ALPA 3U9PH 1XR9A 4LCYA 4LLMB 3ZYJA 4LKXA 4P4KB 5IROA 3QEUA 4MSWB 1NBZA 4GKOA 4KY1L 4RIRA 2IALB 1B0WA 1MNUH 4NKOB 5DHVA 2EDHA 1MCWW 3U9UA 4TSAL 4U49A 3WHE0 2MCPL 3TESA 4DTGH 3EJZD 1KJ2B 2CKBA 3QIUD 1EBAA 2VZSA 5GIRA 1QO3B 1A64A 3AUVA 2D7QA 2G2RA 2XTLA 2VITA 1J8HD 1HXMB 1I85C 2XQYK 4BSWA 1Z0MA 1H3PL 2DRUA 2FIKA 2VUYA 4X4XA 5F21B 4LRNL 3PUCA 2YSSA 3SCMA 1RHHA 2CUHA 1CFTB 1NJ9B 1T22B 1PYWA 4X5XA 1TJGH 4MJ6B 3FN0H 3QG7L 3TZVD 3RGVD 1LMKA 5FF6A 3IXAB 5IKCA 2I9TB 4MHHG 3DARA 4K2UL 4RGNC 3MOAH 5F71A 4CVZB 2V2TB 2VDLL 4FQJL 5TDPB 3WFDH 1S7XA 2QHRH 4PGJA 2GCYA 3QRGL 1G0DA 2PN5A 1AR2A 5DMIH 1MJ8H 4G42A 4IRSC 4P23A 3HCVB 3RIFF 3ZE2F 1JNLH 3NH7L 4PG9A 1HHJA 3VD5A 3BWAB 1DQDH 1HXYA 1KELH 3LY6A 1VFBA 1FYTB 5KSBE 2HWZL 4OD3H 2FEEL 2OXHA 4UIMA 3IDXL 4AQ1B 2X1QA 2EO1A 5LAXB 4WW2A 3JTSB 1KB5L 1IGTB 1J05B 5C0CD 1W0VA 4F58L 3LIZH 5F44A 1QSFE 5EUOA 3SDDB 4JFDB 4JN1H 4KMTL 4WFGE 2BVOB 1NCWH 2E3VA 4KROD 5EWIH 1YEGH 3LS5H 4YEFA 4EI5B 3OKNA 1B6DA 4PJAB 1HNFA 5L2JA 5DWUL 1YY8B 4YX2L 4BH7B 4U1HB 3H7LA 1MQ8A 3VFMB 1WGOA 1X5ZA 4KMQA 3NCYP 4KGJA 4JRYA 2YRPA 3C87A 2VISB 3PJSB 1WEJL 4Z7WF 3W9EA 2AK1L 2ZJSH 4O51A 3C9NB 2FBJL 4PJBA 5TE6L 1ZHLB 4WTZA 1C08B 3HC3L 4HH9B 2EDYA 1S8DA 1W72H 2F58H 1K6QH 1GZQA 1E4KA 3KR3L 4LSPH 5ICXA 3T0AA 3C6LA 5C0IB 3PDDA 4JPVL 4N0RA 2Y7QB 2EDWA 4JFEB 5JMRA 3EDFA 3QDMA 5D5MB 1T2QH 1DTUA 5EU5A 3V79C 1KJ3H 4UNUA 3S7GA 5CEZD 3T8XB 3Q2CA 2X6MA 4I0PC 1C1EL 3RWHA 3NOIA 2F53E 3MV9B 5I19H 4X7CC 3QQ3A 1ADQH 2CDGA 5ICYA 4QRSB 3K4DA 2GEEA 3O6ML 2ARJB 3JV5A 1RHFA 1JGLL 2MHAA 5FA4B 3DBXB 4Y0GA 2VC2L 5I8EA 5FM5M 4NDMA 4R8WH 5IROC 5BO1L 1SY6A 3RDTB 4X4YA 2X10A 5A2JH 4P0DA 5T1LB 5JR1L 4RGND 4Y5XB 2FLRT 3QEHB 4PGDA 5CEXA 5EN2A 1WUNT 3SO3B 4N0UA 5M95B 2UZIH 3OAUH 1PKQE 1JWSA 3P0VH 1RUAL 5HGAA 4R96B 4KMLB 1DZBA 2PR4L 4LVOB 5D96C 3BVNB 1T80A 2FATL 4MA7L 1JHLL 5I1KL 3SCMC 4IRSD 1LEIB 2D7NA 4OI9A 2FX7L 3FB8A 4OZGB 3QCTH 1K4CA 3GK8H 4MJ5B 1Y6KR 3VE0B 1V7NH 1ZAGA 4G6KL 3QUXA 4PJ7A 1WZLA 3IJSB 3SDAB 1QA9B 1TPXB 1A7OL 1UM6H 4JPIB 1NDGA 2N4IA 3QEGH 1U3ZA 3IT8D 5TGBA 4N9OB 4MVBC 3FQUB 5K9KB 1W2KT 1B4JH 4Z7VF 5DJDA 4XMLL 4P9ML 3QSKB 5I6XB 1JWUA 5ISZB 1CGSL 3NCCB 1WBYB 4MQ7A 4D0DB 4JVUA 1OAKH 4ONHA 2C26A 4P23C 2ED8A 4PJFB 4QO1A 2BRQA 2HLFD 4JE4B 2IANA 1A6TA 3O3AB 4JQVC 3UP1A 3M1BA 3JBG7 3MRBB 4RAHA 3VG9B 1U8MB 2OJZH 2QQQA 5IW3A 5IEHB 2XQYG 4HDIB 3C08L 4WW2C 1EJOL 2GUOB 3BEVA 4H88L 2FECI 4PRDA 4HWEH 2AK4E 4Y4HA 4HKJA 4FZEH 5H35B 4NQSB 1BGXH 4XAWL 4BZ2L 2K3TA 3TH3T 1QFPA 1RZKC 2RB8A 2Q8AL 3CLEH 3TVMB 4QGTA 1X44A 1FNGB 1OT1A 4NKDA 3DSNA 4RX4D 2DM3A 3OZ9H 1S7SA 1LK2B 4KJYA 1QLEH 4X80H 1OSPH 4L8DA 1RUQH 4PJDF 4XAKE 3OMZA 4I0PD 1CLOH 3O4OC 4I8DA 2YMXH 1OHQA 3B5TA 1HN1A 3PQYE 4J6RH 5I17A 1A5FH 5IMLA 3V6OA 4ERSL 4OZIB 5LGKA 1YNKL 5IM7A 1INDL 2XFXB 3B2VH 1B6UA 2OK0H 1AE6L 1OAUL 1E4KC 5DUML 3WDIA 4K3JH 1CD9B 5IT2L 4NCC2 1UVQA 5BMFL 3TO2A 4XMPL 3KPQB 5J7CC 1P6AB 2Z31A 4MB5A 2A6IA 2EDFA 3VFOB 5IHZB 4PJIF 5TE4H 5GRXG 4Z7OE 1DLFL 4Q6IA 1KB9K 3T4AA 3Q1SH 4GG6A 3EW3B 3GKWH 5C0BE 3HMXL 4NJ9H 1OAXL 1R24B 2R4SH 4K9EH 2HJFB 3L3KA 1I1YB 4CADB 3P4OA 3SCMD 3STBA 3WIFA 4N0FB 4OFVA 3RJDA 5FCSH 4JFYA 1JHTA 4IIQA 1Q9KB 2YBRA 2IH1B 3DGGB 4DAGL 1AH1A 4UQ2B 3RX5A 1BZ9B 5D8JL 3ARVA 1GCFA 4GH7B 4JGJA 1AIFA 4MVBD 4Z7NF 3MLUL 3HI1B 3OKKB 4O2EA 4OJFH 5EO0B 1N2RB 5JPMA 4ODBD 3GBML 4CL7A 3ZE0E 4IM8A 3BKYL 3N1GC 1MH5A 1FVCA 1EGJH 4NKMB 1IBGH 4BUGA 4P23D 4HKBB 2HFGL 3W81A 1B4RA 1JZ5A 4M93B 3M45A 1EUUA 1CS6A 2WQ8A 3GSOA 2IMNA 4OCSL 1TJIL 1BQLH 4ODUB 3RVWC 5C0FA 3PL6A 2R29H 3IJYB 4ENED 1B2WL 2NQCA 1JGVH 1YPZE 1RVFH 2A1WH 4X6DB 3V6ZB 3AXLB 4PTTB 4DVBA 1EHAA 1OD9A 5KN5A 2YK1H 4XC3H 4CRPA 2B1HH 3IAPA 4NUJB 4Z7UE 43CAA 2HFTA 1IEBA 4BSJA 1FGVL 3IFPB 1CT8B 4OLYL 2V5YA 4S1QH 3UDWC 3WFCH 1JGDB 4Y19A 2LVEA 5IFHH 4RNRB 5EG6C 5CBAB 4G6ML 5CP3A 3PNWA 4H1LH 1ZT7B 5IB2B 4JQIL 4KHTL 4MD0B 1YYMH 4H26A 4NQUA 4DN3L 4Y4HC 4RGMB 4GQ9L 5AYUL 4PRIE 3D85A 1RZ8A 1W8NA 1LP9B 4G8GB 4H8WL 4GRWH 4ODHL 4QHKJ 1OWWA 2EXWC 2WANA 3BGFB 4WEUD 1HK6A 1I9IH 5KSBF 4H0IA 5HDQL 2MNUA 3QDMD 3UYPA 3GHBH 5DJ6B 1YEHL 4A2MA 5GHWL 3FOMB 2DWDA 4L1HA 5J11C 1TZIA 4NWUL 5F1KC 5EZLA 3HZVA 3RBGA 5I1CL 5GGUB 2HN7B 4X8XA 2D0GA 3BDBA 5ITFB 3S5LG 1R3IH 2YPLD 5FV2A 4AIZB 2L7JA 3WFHA 4RGOL 3P2TA 4XNUL 3FZUC 1U3HA 3ES6A 4C58B 4F7PA 4PGBA 3OR6A 4N1EA 2GJJA 4C56E 5DTFA 1Q0XL 5B8CB 4X8JA 1KENH 1N7MH 2OZ4A 3NAAH 1IFHL 1T5XB 4H5SB 2Z31C 3GMQB 1ZLSL 5AEAA 3HE7A 5HI5C 3WIIH 4RFOH 1JNNL 1BIIA 3RP1A 1UB6B 2XTJC 3MJ9A 5FDYA 4OFYA 4UT7H 2Q3ZA 3RKDC 4EUPA 4DKDC 4TUKH 5E2UH 1JYNA 4MDIB 1TVDA 1A9BA 1U91B 4M62L 4LGRB 3ISWA 2P5EB 4WNQA 5KSAB 1UGNA 4OCYH 1RIUL 1UQSA 5FEBA 4FQ1L 3RVWD 1LE5B 3TIEB 5C9JA 2VDPH 2P24A 3DMMA 3V5HB 3RPIB 4RBPK 4EVNB 1JN6A 5A2FA 5J6HB 3LV3A 1G84A 1LDSA 3FCTA 3WXVL 1VFMA 3LQMA 3HNVL 4NWTH 4XWGL 2VLJE 1WAAA 2OR9H 4DW2H 3EUUA 3SBWC 3X12B 1Q1JL 3RZCA 3V4PL 4FQIH 4IMKA 2F54D 1PZ5B 1YNTA 4FQQB 3BXNA 5DRXA 5EFIB 4TQEH 5HVGB 2H3NA 3VDBA 4L29A 2JCCA 2IAND 2NTFA 4Q58C 1CE1H 1P4LA 5CP7A 4AYFA 2K7PA 4IDJH 4PD4J 4XPGH 3PL6C 3I9GH 5ID1A 5F9WB 5GGQL 3CFBB 2BVPB 3NBNA 1DEDA 4OZHB 4DKEH 4RBPH 4Q7DA 4ZUVA 2Q7YB 3BQUB 3JUZA 5DRZB 3T0EB 3UYOD 5ADOL 4Y4HD 1MCPH 3FAXA 3I50L 4PRBB 4WUUA 1DUZB 1XCTA 1CLYH 5JTWA 4DK3A 3DTXB 3AAZB 5AUMB 3BGAA 2EXWD 3MV7E 4GMSL 1A8JH 1R3LB 2JIXB 3BP6A 4AENB 1QR1A 2N7BA 4ZDHB 2BC4B 3K4AA 5DZOA 4EXPX 4D0BA 1P5VA 4J3UA 3N85H 3MGTB 5IW6A 3BKML 1V7ML 3QFJE 5K9OA 2ZPKL 3AM8A 1HSAB 2NY6B 4FG6D 4G43B 4YHLH 2R2HB 4ZFGH 5FDWA 4NQCA 2CGRL 3F12B 5L7XH 5MEQA 3TPKA 4DKFH 4LSQH 3FZUD 4Y2DA 2OBGA 1F4WH 4M02A 3QEQB 1CDYA 4HIEA 1SEQH 5DHXB 3SGEI 1WFOA 1OF2B 1AQDB 1OQOA 5MERB 4Z77A 2GITA 4LVEA 5T1KD 3B9KB 5HYSB 5MP6H 4ONGH 2Z31D 5HI5D 1JPGB 4WHDA 4PV8B 3OKOB 5MEOA 1S9YB 3RKDD 1MFCH 3MYJA 4BKLB 2BJML 2OLDA 1IGJA 1KC5L 4ALAH 5CEZL 4HSQA 4L4VB 5CGTA 1BFTA 3VGFA 4AL8L 4PBVC 4YDIL 2ESVA 3K3QA 3SKJH 1E4XI 1U3HC 3FONA 1OGAE 4NCDA 3CC5A 1TVHA 2VDNH 4NRZA 2E7BA 4M7KL 1MWAH 1YY9C 1T03L 3CDFA 3G08B 4LEOB 4JB9H 3OL2A 3ALWA 5J56B 5T3ZE 3EDEA 1TTGA 2Z91A 3QCUH 4UMGA 5IJVB 4OLUH 3HE7C 1CL7L 3VXUA 4LLUB 2A9MH 4I5BA 2IF7A 5EBGA 1O7SA 5FM5O 4RAUA 4ETYA 1TJHL 3CSGA 3ZT7A 3BZFB 2D7TL 3FN9A 3ROOA 1ZLUK 2X1WL 1G9MC 1LO5B 4NN5B 1JYWA 2HKFL 2LE9A 1DL7H 4UB0L 3UTSE 3VFNB 5HGBB 3HNTH 4ZG1A 1OAZH 5CILL 3VFPB 4BH8B 1VEOA 3PL6D 5DQJA 4HIXL 3DMMC 4WV1A 5F6HJ 5E2WL 4XVSL 1F4YL 4WU5B 1ZWIB 35C8H 1VFUA 2MQCA 3O2DH 4HPOH 4HIHB 1GRWA 3BIBX 2KQMA 4QF1A 4IMKC 3TBTB 3G5YA 4QHNA 4K8RH 4P4RB 2DM2A 4I9WD 5ALBL 2Z92B 4LSSL 4M8VA 1ZLUH 4GXVL 1IEAA 1NCAH 4OIAA 5EC2A 1VEPA 2NY2C 3D48R 4WEBL 3G6AB 3C5SA 2P8MA 3GRWL 4HWZB 4JEGB 3A6BH 4PJ9A 1W72B 1CICA 3BGMA 2VE6B 2UYLB 4UOW0 2A6DA 3MACH 4FOMA 4Q2ZB 3FO2B 1BZ7A 3V5KA 3FQXB 1YC7A 2X4QB 3HS0B 4JY5L 1IKFL 3IFNH 2XZCL 3V0AC 2NY5H 2VN4A 4OCRL 5CJQL 4YXLH 4C55A 3LEXA 5ANMB 3D85D 4HJJH 1N64L 4PJCE 5LJYH 5A16B 1GIGH 5E8NA 2EDOA 1S7VA 4YHPB 4X7EC 3O6FA 1IQDB 5IP4A 2G60L 3C8DA 3CFDB 4WIQA 4JN2B 4LL9A 3QZWG 4HC1L 1N4XL 1J8HE 3GDBA 1KCVL 5I8OH 4TOYL 1YPZF 1YN7A 8FABB 1EEYB 3NTCH 1X5KA 1KIQB 2BRRH 2BCKB 4X6CB 3AM8C 4UT6L 3UO1H 1FO0H 4QRRA 3CCHB 1G7QA 3BEWB 2D9CA 3MNWB 3N06B 3QFDA 4PJEE 4Z7UF 4Y2DC 1U3HD 1U58B 2XZQH 4KRPC 4N0YH 1F11B 3RL1A 2XOTA 1YY9D 4Z76A 4YE4L 1A7RH 3VXTA 5F7KC 4NQXB 2AKRA 5HY9A 3JV4B 1QRKA 3QUMA 2AEPL 3CK0H 1NDMB 2H1PL 5IFJA 1UFUA 2E8ZA 3HE7D 3MA7B 1SYSA 3MZGB 3WYRA 2RR3A 1J87A 4OFYD 2BXYA 4POYA 3EGSB 2CKBL 1ETZA 5CZXC 5EPMB 4O9HL 3EJYC 2VZ1A 3IF1A 4LBEA 1JJUA 4WWKA 1XGQA 4XCCL 1HHHA 3QDGD 4OGZA 4I0CC 4JFPB 4PFEA 3QXTA 1BECA 2W0PA 1FNEB 3DMMD 1FPTH 3WKNA 5CSBA 2J88L 3VFRA 4Q9QH 4XP5H 3OPZL 5KSVB 3ILPB 2GIYA 4JM2F 1MQKL 3I3DA 3B9EA 4IRJA 5FB8A 1FZJB 5FA3A 3ECBA 1JPFA 4ODSL 3B6SB 3SGDI 3Q5YA 1ORSA 4XVUC 4EI6B 1T21B 3N0PB 5INCB 3WHXA 2KZ1B 4U31A 2HTLC 4WRLA 5IVOA 5JW4N 1WT5A 5KSUB 3DX8A 3BW9A 3ZKNC 5JOFB 2NY2D 3BKJH 1S7RA 3VWKA 3ABZA 3RI5F 4TYUA 2DMCA 1NGPH 3MRDB 4HWBA 4U6XB 2HVJB 5DC9B 3S5LB 1PKQB 5E1HB 3NABH 1AD0B 2P1YA 1AHWB 4QWWC 3VGAC 5C0RL 4RFNC 1I9JL 1M6OB 5GRJH 4NHUB 1OLZA 3OKMA 3SKMB 4KU1A 4GMTL 2FCBA 4LAQH 2IFGA 4QRQB 1X5IA 1NAMA 2ZCLH 3S35H 1CGXA 1MFEL 1WICA 3G6JE 4NBXB 3CUPB 4F9PA 2GTWA 4KUZH 1ROWA 5GGRA 3BH8B 1RZKL 2MJWA 5DHYB 4U1KB 4HCRL 4GKNA 3Q6GH 4PJ9C 4NYLA 4OZFB 1CICC 4FXGA 3NCJH 2AJZB 1IZJA 4MX7B 2VDRL 1JTPA 5SV4A 1UWEL 2OJEA 1XGUA 3L7FB 3IDIA 4G6JH 4D0CA 3H6JA 1C7TA 4NQCD 3ETBF 3GUTA 1MOEA 2OL3B 1YN6A 2NXYD 3D18A 3QDJA 2Q6WB 1E6OL 4Y2DD 1DR9A 1AXTL 2HKHH 4RGNE 4P2OA 2PYEB 3O6FC 3BP4A 1PX4A 4XNZB 2EDXA 1SBBA 3RY5A 2AJUL 4R3SB 4M5YL 4CUCA 4GAYA 3DRTA 3REVB 1Q94A 3B3IB 3O3BA 1T1WB 3P0YH 4KQ4L 4PGEA 2Z4QA 5GGTL 4F7EB 1DDHB 2V2WB 4GKZA 2W9DH 4QOKB 3EJYD 3BT2L 5E7FA 5AG8A 1NEUA 1BAFL 2NW2A 3E1F1 2AJ3B 5HGHA 2ESVD 3CAFA 4MD4B 4MA8L 1TQBC 3AU1A 3KYNB 2MKWA 3OR7A 4M48L 1LO3H 4ZFZA 4XGZB 3UXFA 2XG5A 1ACYL 3X11A 3MR9A 1ZVSA 3V4UH 4QTHA 4GW4B 1ZHKA 3H0TA 4NPYB 4P5TA 5CKAA 2P8PB 4UV4L 4UU9A 3VXUD 5EO9A 4NQEA 3ARQA 5F1OB 5A43C 5DEGB 3GSQA 3LD8B 1MIEH 1IGML 3GSNA 4J8RA 4LSTL 4L8BA 4XVUD 2JELH 5D72H 1FFNB 3O8XA 4OF7A 3SOBH 2BY0A 1LK3H 5I75C 1HILA 1WWAX 1G6RA 1U8NB 2HTLD 3E6HB 4X7SH 3BJLA 3ZKND 5CJXA 4NNPL 4F33B 4G3YH 3GMPA 3BUTA 4JFZL 3W5MA 4GS7C 1OGTA 1CK0L 4BA8A 2DYPB 5TF1L 3X3FL 4ZQKA 1EEZB 1OCWL 2YKLL 3E2HC 3D9AH 5JQ6H 4JGUA 4PUBL 4S1DC 5C0BB 4KHXL 1LEGA 4IRJC 2EC9U 2A9NL 4HUUB 4I13B 3UBXB 2MMXA 3O11A 2H9GB 3HC4L 4LLMA 5A1AA 3VCLB 3ARGB 2FDBP 4MSWA 2IALA 3BAEL 3LKPA 4NKOA 2ORBH 2CIKB 3KJ6L 1BFVH 1MPAH 4LVNC 1WT5C 4JDTH 4H1LB 2DQHH 2DQGL 2IQ9L 2XN9A 4KJWC 3ZDXE 3VWKC 1ZGLB 1KJ2A 1F8TH 1AC0A 3IDMB 1QO3A 4PJ9D 1I8MB 1CICD 5A3IC 1PLGH 4OQ1A 5B21A 1HXMA 4UINL 1UYWH 5BV7C 5D1XB 3FB5B 5FGCB 1RULL 2APBA 5B39A 1CFTA 1NJ9A 1T22A 1ND0A 4KPHL 4WFFD 3U4BL 3VXPB 4KDWA 4JDVB 3STLA 4XVJH 2XACC 3V0WL 3O6FD 2Y36L 4GKSA 4MLSA 2DQIH 2R0KH 2I9TA 4IMLB 1YUHB 4JG1L 5CINL 1VGEH 4OLZH 4CVZA 2V2TA 5CJ8A 3TP4A 5E1AB 4PRAB 5EOQL 5E2VL 1FL5B 2NXZB 2J4WL 3BD3A 4I0KA 4WHYG 5TDPA 2ILLA 3G5XB 2YUZA 5D7SH 2APXA 1I1RA 1WCBA 3FRUB 5IB1A 1T1YA 2VKXA 4PJXB 4RMRA 4ZXBC 3U2SB 2PCPB 4QRRD 4ORGB 4JO2L 1X5AA 4ZSOB 2D03H 4Z7UB 4R26L 1NAKH 1EMTH 4S10A 1MIMH 5HPOA 2EH8L 5FM8A 3WKMH 4X9GA 4P2OC 3BWAA 1WZKA 2ICWB 3C2AL 4HMEA 4UQ3B 4MNGB 1VESA 1JPSH 1K4DB 5FHAH 3UTTB 5TPWH 2R1WA 2LU4A 2X4TA 1QEWB 3BIKB 5LAXA 3TCXA 1IGTA 1J05A 5DFTA 1J88A 3QH3B 5GGSB 4P9HL 1BPVA 1I9RL 3K2UH 1TVBB 4JFDA 2BVOA 1L7TL 5DDHB 1WJ3A 5E8EB 1PD6A 3TF7C 5F93C 4PJCF 1S7WB 1YMHA 5DK2B 4PJAA 2I5YL 5IBLC 4LLVA 1UM5H 1U8HB 5E8OB 1G7IB 3ZDZF 1OSZB 4BH7A 4BK4A 5J12B 2JJSA 3IRPX 4U1HA 3VFMA 2VNCA 4BZ1L 1ZTXL 3MLXH 1BZQK 1QVOB 2GYSA 4GSDL 3KYKH 1HEZB 4XPHL 1H3UA 4HAFA 5EUOE 1VDGA 3LKSA 4P5TC 3LH2H 4S1DD 3MO1B 4OFPA 5HYIA 4IRJD 5C6PB 1ZHLA 1C08A 2B20A 4HH9A 4HXAL 4PJEF 4Y16C 4GAGL 5DURB 4FHBD 4AG4L 3QULB 5FYJH 5C0IA 1AJ7H 3QZWB 2Y7QA 4U1GB 3L5HA 1CG9B 4JFEA 4Y7MA 5CJXC 5D5MA 4WDIB 3DSFH 1A7NL 2DQJH 4KJWD 3VWKD 4Y8DC 2J6EL 2FGWL 2VXVL 3NPSB 4HFUH 4YDKL 4OF8A 4JFXB 3MRIB 4OD2A 1YJDH 2FHFA 3WNPA 1NGQH 1GPOL 4PJBE 3H3BC 3MV9A 4XCEB 1RMFH 5DFWH 5IVNA 5ADPH 2V9RA 4QRSA 2XA8H 2ARJA 4NC1C 3CFKB 4P2QA 4J4PA 4FQHA 2OQJB 5FA4A 1HE7A 4P4KC 4YNYB 3QDME 4PB9L 5FK9A 2G9HB 4XTRC 1U8OB 1FAIL 5JLZB 2QLVB 4KJPD 5IESH 1KXVC 5T1LA 4EEEA 2X05A 2FJFA 2BP3A 1S7QB 3QNZB 4WCYL 2GI7A 1WLHA 3CXHJ 4Y5XA 4TPRL 4OLWL 4P3CH 4HK3J 1YDPB 3D6GA 4M03A 2EKJA 4R96A 2H26A 1SM3H 4HMCA 4P3DB 2EYTA 4YBQC 4YXHL 3VXMD 1NPUA 3FQRA 1A6AB 3HMWH 3UPRA 3QDJD 2WBJB 2DN7A 2FB4H 2RQ8A 4OZGA 4UOJA 1KIRA 1NEZA 2XPGB 3PXJA 3VH8G 2BERA 4P2OD 3O9WA 2E7HA 3IJSA 3SDAA 5I1IL 1UENA 3PE9A 2Y1VA 3IAQA 4N0UE 3WN5A 4JPIA 4JO4H 5GGVL 5DJAB 3VD7A 5HGDB 1RSFA 3QXDB 5K9KA 5I15H 4LCUA 3MRFA 4FQCL 2P44B 4FS0A 2FWOB 3CZFA 1YECH 1TLKA 5FYKL 3HTLX 1DBML 4IRZL 2K1MA 5IBLD 1CF8H 4LRIA 3TT1H 4PJ7E 4HKZA 4FABH 4PJFA 1ZA3A 2ZSVB 3G6JF 3U4EB 3I6KA 4RAVB 4NQVA 5B3NA 4YHNB 1KTRL 1RV6X 3WUWG 3NIDE 5CEYB 1U8MA 1HKLH 5I71B 4HDIA 4P5TD 2X4RA 4K3GA 5EU4A 5K9JH 3DI3B 1MJJA 2X9YA 3W0WA 5KAQF 2R2EB 1NCBH 1HYSC 2FJGB 4NQSA 3EDDA 2F54E 3SDDC 1HHGB 2OZ4L 2HVKB 3GMMB 3W5NA 1YQVL 3BOVA 2NY7H 1EHLL 3O8XD 5HYEA 2IANE 1P1ZB 5JPNB 4EI5C 3H9ZA 1JNHB 3F5WB 3GSRB 2OR7A 4NHCL 1S3KH 1UXSA 2PNDA 1LK2A 2JJSC 2IPTL 3MSPA 2A74B 2VH5H 3F65A 1HH9B 1I8KB 1IAII 5C2UB 2X9WA 5T5FL 3WEXA 4ODXA 3GHEH 5KVFL 4RMUA 5DMGC 3FHQA 3U82B 3OKLA 4LK4A 5CCKL 4G6AC 3O6LL 1CWVA 1J5OH 5DLMH 3Q48A 1MHPH 2EIZB 4P4KD 5JHDB 2O5XH 2Q76A 1CU4L 2VN7A 2DDQH 4OUUB 2ZUYA 2R0LL 1UADC 2W38A 4MXQC 2XN9D 3KPQA 4NO5B 4OCNC 4PBXA 3D5OF 5L9DL 5EZOH 3MBEA 1CZ8H 4P5KB 1DLHB 2D0HA 3C2SA 2KH2B 4M6NH 4NZUL 3G5ZB 3GSWB 3V6OE 2NY0B 4QHMA 2YRZA 5HVHB 4K3DL 2VR5A 4YBQD 1QG3A 4B7IA 5E8DL 3V6BR 1I7UB 2HJFA 4CADA 3U0TB 1Q0YH 1H8SA 4G9DB 4JR9L 4JO3L 4HZLB 3H9SB 4J4PC 4N0FA 1MJ7H 3UCRA 1CLZL 3F7QA 2EH7L 4OF3A 4G7YH 4TULL 3UTSB 1Q9KA 1N3NA 2IH1A 1CFBA 5K9QG 2DMKA 3RDTC 4N8PA 4UQ2A 2YZ1A 1QQDA 5GS0C 2N1KA 1BZ9A 1FO0B 1I1FB 5CJOL 1KYOK 2JB5H 4K3EL 4Y5XC 3HI1A 3OKKA 4GG6E 3SO3C 1RUPH 3O2VH 4JKKA 4ZNEA 5EO0A 3H8NA 3DUSB 2ICCA 1N0XH 4ETQB 3RWIB 5H94B 1PY9A 3SDXA 5KTEH 4LVOC 2YWYA 4HEME 4NKMA 1IC7L 3CVHA 5D4QA 3ARFA 3D25A 1DFBH 5JQHC 3CMGA 3RVUC 4ODVL 3ZDXF 1FYTD 3SDAC 1IC1A 1QFWH 1TPXC 1Z0NA 4LPUA 3L5XL 5DRWB 3F7RA 3I6LE 3QDAA 3KPNB 3IJYA 2VWEC 1H5BB 4KZDL 4PY7B 4PYGA 5TDOB 4X6DA 3V6ZA 3AXLA 4KY1H 1HYSD 4PTTA 2CDEB 4TSAH 4RISH 3P4NA 3N9GL 1T4KB 2ZNXA 4JFDD 4I2XA 3SDDD 1ZA6B 3HRZA 3ULSB 2MCPH 2RIKA 5I6XC 4OV5A 4M7LL 2IBBA 1U8LB 4WW1A 4NC2B 3QIUB 2WK2A 3GNML 1UACL 4HW6A 4JANB 5ERWB 1QFHA 1X7QA 1H3PH 1UCBL 1JGDA 4MCYB 3JSSA 4LRNH 3RAJL 3VG9C 5CHNA 5CBAA 4TUOB 1JCKA 5IB2A 5DMGD 3QG7H 4MD0A 4LPCA 1R5IB 3P4MB 4G6AD 5FYLL 1PVHA 1AY1L 4UUJA 4YH6A 1WFNA 4I9WE 2FL5A 3VA2C 4K2UH 2XWBB 2UWEA 4G8GA 1URLA 2DLFL 3KWWB 3TVMC 2D9QB 3FOLA 4Y19E 3RVTD 4JFED 2VDLH 4H0HB 3TBYB 2E9BA 4IHOB 4FQJH 1BJ1J 3KLDA 3FOMA 3QRGH 2NZ9C 4HHAB 2X70B 1I7ZA 3BN3B 4JHBA 3LPGA 4O58L 4UTAL 4X6FB 3MV9D 3ESUF 5GGUA 3BD4A 4OM1L 1QFOA 3NH7H 2W60B 2VERN 1Y6NR 5ITFA 2BHZA 1KLUA 4POUB 3NA9L 2HWZH 2RCSL 4J4PD 4JCLA 3IDXH 3HAEH 1PGRB 1KB5H 1MHCB 3MRNB 1KN4L 4WW2F 4F58H 3AS1A 4QGYA 5T1LD 5GS0D 3SKOB 3QPQC 4FQLL 2F9BT 4KMTH 1AFVL 3BUYB 5F9JA 5BZWB 2DLGA 5EUOF 3GMQA 1Y0LA 5T5NF 3EIFA 1UB6A 5DD1L 5GRYA 1A1MB 2IPUK 3SN6N 3PV6A 5DWUH 3MV8A 4YX2H 2PO6B 4X99B 5K93A 3JZ7A 4P48A 4MDIA 2V7HB 3X13A 1JMXA 1HI6A 5D7LB 3FFDB 1WEJH 3RVUD 5IMOB 3UYRL 5KSAA 2AK1H 3SY0B 3O9WD 4LLDB 4O5LL 3SDAD 2FBJH 5JIPA 1LE5A 4HX1B 3TIEA 5TE6H 1UWXK 3RPIA 3U0PB 4EIGB 4EVNA 4ZMAT 3HC3H 2VLKA 4PJBF 1X5FA 4U1IB 3CFJB 5D6DA 2DIBA 5J6HA 3KR3H 3MRGB 1XZ0B 3V7AG 4JPVH 4E42A 4LCCB 5ISZD 1PY4A 3QDGE 5F89A 3UJJL 4ODWB 3HG1A 5LCVL 2VABA 1PZ5A 1MCNA 4FQQA 5EFIA 2YD7A 1C1EH 2VAJA 4U1MA 3DI2B 4M93C 1WBXA 4PJHB 2VDQL 3O6MH 2H32H 4XZUB 1UWXH 2BVPA 1JGLH 5C7XL 5FGRA 1FHGA 2VC2H 1WAAE 5EC1B 3BQUA 4PV9B 5DRZA 3T0EA 3W0WD 1A3RL 5BO1H 2XXCB 3MRKB 5IWLA 5BJTA 5JR1H 2DOCA 5L8JB 1DUZA 3AY4C 4FP8L 3DTXA 1BFOA 4RFEB 1JE6A 2JCCE 5AUMA 1ZOXA 5FCUL 2C5DC 4CJ1A 1R3LA 3NZHL 2JIXA 2HT3C 3BRDA 4AENA 4ZFOL 1RUAH 3ULVC 5FYJU 4ZDHA 1BD2B 4TVPD 3TM6A 2PR4H 3PDOB 3CSPA 1BM3L 5FUOL 3TYGL 2FATH 3DXAB 5I18L 2IAMB 4MA7H 1JHLH 2VSDA 5I1KH 3MGTA 5F7YC 5AG9A 2FX7H 4HUNB 1XH3B 5BCAA 2R1XA 1D5BA 1HSAA 4G6KH 2R2HA 1RI8A 2W91A 6FABL 1U8KB 2QQNL 3VH8B 1A7OH 4RGMC 3F12A 2O61A 4NSKB 1FGNL 1EFXB 5F7HA 4GUPA 1FC1A 3UEZA 5L6YL 3MRMA 3BGFC 4LFHD 3G04B 1OF2A 4M9OA 1YZZA 3QPQD 5MERA 3BYYA 1LEKB 4XMLH 5DUPL 5E5UB 3DPBA 3D39A 4P9MH 5HYSA 3MBED 1S9XA 1CXFA 1CGSH 1JPGA 3KPLA 3Q0HA 5C1MB 1U92B 4PV8A 3OKOA 4U2YA 4X6BB 3TO4A 1A7BA 4NQCE 4LNVA 1S9YA 3H3PL 4BKLA 3BPOB 1BMGA 5BVPL 4I4WB 1Y18B 5IK3B 3I75B 4J7RA 4APQA 3T65B 2QV2A 5KBNC 3GJFK 2MKLC 5I1HL 3TEUA 5BV7L 2ADJB 2EC9T 3C08H 1EJOH 3T0VA 4H88H 1GZPB 3NCYS 3WNNA 5DK3A 1ZSDB 4JLRB 4D8PB 5B8CC 4XAWH 5J1SC 4JY4B 4BZ2H 1O7VA 3P30L 5D1QB 1C16B 3QXVA 4H20L 5HSFA 4AT6B 4U6VL 2A6KB 4LLUA 2Q8AH 4JPKL 3B2UC 1DQQA 1JYVA 3HAEG 2ESVE 2BMKA 5GGSY 4Q74A 1YEDB 3BWUC 2CPCA 3ARFD 3GJFH 3R06B 1JNJA 3O41B 1KULA 3VFNA 2BNQB 5EIVA 5L2KA 1FG2B 5KSAC 4MMXC 4WO4A 2WV3A 1DJSA 4NRYA 3ULUL 2G75B 1CR9L 3VXUE 4ERSH 5FO9B 3H9YA 3MLSL 2HT4C 1YNKH 5IW1A 1XF2A 2DQFB 3KPRA 1INDH 5TJWK 2VIRB 2XNAB 5MENB 2V6HA 1AE6H 5F9AC 2P46B 1OAUH 2J1KA 5DUMH 4LKXB 3DURA 1ED3A 5IT2H 1MCFA 3CSBA 5BMFH 1NBZB 4RIRB 4HIHA 4XMPH 1CGWA 3KS0J 2ENSA 4P4RA 3WIHL 2HT3D 4YLQT 4RA3A 1DLFH 4ESKA 2A6JA 3JWOL 3ULVD 3T4YA 3G6AA 4NZDA 2VITB 3HMXH 2BNRA 4HWZA 1OAXH 4GG6F 1W72A 2B39A 3UX9B 4R97B 2UYLA 1O5DT 2FIKB 5F9WC 4HGKC 1PG7L 1MF2L 1QZ1A 4X4XB 4Z18A 4Q2ZA 4LASL 4K7PL 3FQXA 3BQUC 3HS0A 3T0EC 4DAGH 5D8JH 5ANMA 4UILL 4KTYA 1FSKB 4G8GD 3RWGB 4XB7A 5A16A 3MLUH 4YHPA 1IQDA 5T3XD 1ADQA 3QQ9C 3CFDA 3FRPG 3IKCA 4JN2A 3U48A 1PSKL 3GBMH 2C9AA 4LQFL 3VFTA 4UI2A 3VXRA 3BKYH 4NJAL 8FABA 1EEYA 2GCYB 3PIQB 2M26A 3DJ9A 1KIQA 4GBXA 2HFGH 3RWFA 4X6CA 4G42B 5DD0L 2NY6C 3SE3A 2YD9A 7CGTA 4WFFE 3CCHA 3BEWA 4OCSH 1TJIH 3L3JA 3MNWA 1HXYB 3TNMB 2EECA 1EAJA 2VZUA 1B2WH 1R3KA 1GH7A 1F11A 3RY4A 4FQ2L 3AREB 1CBVL 3HPLA 2IEPA 5F7NC 4NQXA 1IAIM 1TIUA 3B9KC 4G7VL 4XX1E 4JPWL 3V0VB 4X98A 1NDMA 5ACLA 3U46B 3MA7A 3CXDL 1YA5A 4QRRE 3B2UD 4J12A 1FGVH 3LN5B 3EGSA 5L2JB 5EPMA 4OLYH 1WISA 1GGCL 4Z5RA 1OQXA 4G6MH 3INUL 4RQQB 5KSAD 4JRYB 4JFPA 4JQIH 4KHTH 4Y4FB 4DN3H 4L1DA 4LHUG 1BVLB 2HT4D 4GQ9H 2VLKD 5AYUH 1FZMB 2EEDA 4L9DA 4H8WH 4ODHH 1S8DB 1FNAA 1GZQB 1FZJA 1E4JA 3MC0A 1L0QA 3C6LB 5HDQH 1JUFA 1YEHH 3B6SA 5GHWH 1FFOB 3ZHKA 3ARUA 2C1PA 1A6WL 3QDMB 5SX4H 1T21A 4MHHI 1MFAL 5E4EB 5EU5B 2GJ6A 4NWUH 5E08L 4NN5C 5JOFA 5HJ3B 5I1CH 5E94B 2V9TA 4OV6F 2R56L 1IGYB 3FQWA 5JZ7C 4P2RB 5ECJE 2HVJA 1QBML 2CDGB 3S5LA 5IB3A 4RGOH 4XNUH 3BPLB 3I85A 3BQUD 2CLVA 2MHAB 3T0ED 1JZ2A 3T0XA 4HWNA 1Q0XH 1M6OA 3ARBA 1RZ7L 1EXUB 5DC0A 2HRLA 5GXBB 1IFHH 4QRQA 1ZLSH 1JNNH 5C86A 1H3GA 2JIXD 3CUPA 3QQ9D 4N0UB 3BH8A 3OGOE 4GRMB 2EIBA 5ETUA 3U1SL 4ZPTB 3L3OA 5F9DC 4URTB 1ZMYA 5HHVL 4M62H 4MX7A 2AJZA 1MREL 4NO0B 1Q9LB 5FUCC 2NY6D 3L7FA 1HIML 1KFAL 4LLWB 1NMAL 2IGFL 1RIUH 5D2LA 3V2AR 4FQ1H 4BJLA 2F15A 3QUXB 4PJ7B 4O2CA 2Q6WA 4OF6A 4KTDL 1UEYA 2XV6B 4C54A 3QEQD 1NDGB 2PYEA 5TGBB 3WXVH 1N5YL 3ZSSA 3HNVH 2WMPA 4LGSB 4XWGH 3D39D 5DJDB 1Q1JH 1HZHL 1JF6A 3V4PH 2GSGA 1WAAF 4U6HA 1JWUB 2DQUL 3TO4D 3B3IA 3VXME 5GZOC 1T1WA 1KPUB 4KXZI 1ZE3C 3QO0B 4U0QB 3QDJE 4F7EA 1DDHA 3SE3C 1JI2A 2V2WA 4L4VD 3QQ4A 5I73B 1A6TB 4A6YL 3EYSL 5GS1B 1CXEA 3M1BB 5GGQH 2AJ3A 1L7IL 2WUCL 1PJ9A 3FB6B 2MQ3A 5KOVC 2EO9A 3KYNA 15C8L 4OCMC 2WWMC 2COQA 5ADOH 2EIDA 2CUIA 1VCAA 4XGZA 4YHYB 1C5CL 3I50H 3G9VA 1SYVA 1QSEA 5EUKB 5I0ZA 1EGJA 1CXHA 2P8PA 3BN9C 5GS0L 4GMSH 3TJHC 3UZQA 3QI9A 1QOKA 1FFNA 4AQOA 4NKDB 5FKAB 1J12A 4KJYB 2DMBA 4QYOA 3ZL4L 4L8DB 3E6HA 1UZ6E 4MCZA 3BKMH 1V7MH 4F33A 5F7UA 2ZPKH 5HDLA 4WO4D 1IM3B 5J8OA 2NMSA 3AGVA 5JZ7D 2X4OB 4X7TA 2CGRH 4BFBD 4F7MA 4AEFA 5IMLB 1PG7W 2BHUA 3N1QC 5DEFB 1EO5A 4HUUA 3UBXA 1EO8L 2H9GA 1D6EB 1UVQB 3DGCR 4DGVL 1G9EA 3OJVC 3TO2B 1SJEB 3MPCA 4RA0C 1ZS8B 2CIKA 3OAZK 4HUVA 5KVMC 2A6IB 4XHQA 4H1LA 4MD5B 3RX8A 4O02L 5DUBB 2RFXB 3MJ8A 1ZGLA 4LHQB 6CGTA 2B7DT 4Q6IB 2BJMH 3T4AB 1KC5H 3AB0B 5CEZH 4L3AA 4GG6B 4HG4J 5IBUG 5IGXL 4G5ZL 4AL8H 4YDIH 3L3KB 4KI5C 4NC1E 5JA8B 2J8UF 3WIFB 3FB5A 1AHWC 5HI4D 4Z78A 4M7KH 4KK9C 1NGYA 1T03H 3QNXB 4PD4K 4IIQB 2YBRB 3VXPA 2XN9E 3BRFA 3QIBB 1D6VL 4JDVA 1UM4L 1CL7H 1QACA 2AABL 4LIQL 3DROB 3OAZH 1OARL 5HHQB 1YC8A 4PJ8B 3IYLW 4IMLA 1YUHA 5E9DB 1CVSC 1ZT1A 3SPVB 3RTQA 5HHPA 4ACPA 4PRAA 1KBGL 5JW5B 1TJHH 5A2KH 1FL5A 3HAEB 2D7TH 1JK8B 1BREA 5GZOD 1KB5B 3G5XA 1KXQE 4GBXD 2I9LA 1WWBX 1RU9L 1KF9B 2XXMB 2HKFH 5KJRL 4WFGD 4UB0H 4PJXA 4WI7A 3MFFB 3FB7B 3U2SA 5CSZB 4ORGA 5CILH 4ZSOA 4WJ5B 5HD8C 3GSOB 4HIXH 2O93L 5E2WH 3UTZB 1E6JL 4XVSH 3HLAA 1F4YH 3W39A 2WWMD 2ICWA 4UQ3A 3RU8L 1K4DA 1CGYA 3M17B 3UTTA 4XNYL 1QEWA 4XNZC 3MJ7A 3JWDC 3BN9D 3WL9A 1BQHG 4U1LB 3VFGL 3TJHD 1RZFL 1FLTX 5ALBH 4RMSA 4RMWA 4LSSH 4ZO7A 4GXVH 5I1LA 4MXWL 5C07B 4WEBH 3ZTJH 3GRWH 5DK2A 4L3CB 5J0BA 4JHWL 4PRHB 4CMHB 1U8HA 1G7IA 4S0SD 4Y19B 2KL6A 1OSZA 1G7MA 5BRZB 5DQDL 3NZ8A 3MXWL 3K80A 4QT5A 4JY5H 1IKFH 5DJ8A 1FLRL 1PG7X 2XZCH 3PNWB 1AD9A 2WIMA 1QVOA 2X89A 4OCRH 4NUGL 1YNLL 1HEZA 4YHOL 5CJQH 5D2NB 3P9MB 2XI9A 4JFDE 3TGXA 2OX5A 3S37L 1N64H 1OVZA 3MO1A 3TBWA 5C0JB 3LD8C 2Y72A 4PJAE 1KJMB 3KLHC 1IQWL 3VRLE 3VI4E 2G60H 4HC1H 4MS8D 1N4XH 4BFIB 1EAPA 3VD3A 1KCVH 4YJZL 3QULA 4TOYH 4CBPA 3QZWA 4Y5VB 2DWDB 1T7YA 2I27N 4NQTA 4XPTL 4WI3A 4WDIA 5A2IH 5I1GL 3WS3A 3HZVB 4UT6H 4JFOB 2X4UB 4JFXA 1MLBA 2NY1B 2ZUSA 1DBJL 2XY2A 1CFNB 1IC5L 3OJDA 3BDXA 4KI5D 3S4SG 4XCEA 1SJHA 1CN4A 3WFHB 5KVGL 1WFTA 3LVEA 4KK9D 4JRWA 4U3HA 4F7PB 4YE4H 3MODL 4GW1A 2BNUA 3CFKA 3P0GB 3OR6B 2DQDL 3DNKA 4JFEE 5I1AB 1OP3K 5D5ME 3ARGC 2AEPH 1S5HA 2DI9A 2H1PH 5DHVH 1U8OA 5JLZA 5HDBE 2BDNL 2C3HA 3MBXL 1WZ1L 2FO1A 4P57B 3PGDB 2CKBH 5BXFA 3MV9E 3LQAC 5SWQB 1LNUA 4O9HH 2P42B 3JVGA 4XVTL 4EUPB 1YDPA 3ULVL 4MZ3A 4XCCH 2BSRB 3J7HA 5D1XC 5M7QA 4K3HA 4OF5A 4P3DA 3RUGB 1RZIA 1A6AA 1EBPA 1IEHA 5HD8D 1T6WA 4POZC 2WBJA 2CD0A 4XPAL 3K2MC 1RK1B 2C4XA 2J3SA 2XPGA 5C9JB 2J88H 1OP3H 2P24B 3OPZH 1Z9LA 4GXUM 2J2ZA 2PYED 1MQKH 2MFNA 3IJHB 3NVQA 3RIAF 3E8UL 4ODSH 1NCDL 3WBDA 4WU7B 5SWZA 4D94A 5I9QB 4X4ZA 1ZK9A 2ID5A 5F97E 2W65A 4XP1L 1P84K 3RZCB 2NXZC 3OTTA 2FWOA 3BXNB 5D7KD 5DRXB 3TC9A 1MWAA 2H3NB 4OZGE 4L29B 4QOKD 2JCCB 4XRCA 2NTFB 5DSCB 1P4LB 1FL6B 3U4EA 4RAVA 2XG4A 1TCMA 5ID1B 5J1AA 4P5MA 3AFLA 5CEYA 3MOQA 1TETL 4ZUVB 4OSUL 4HULB 5C0RH 5DF0A 1I9JH 4E41A 1INEL 4MB4A 1T1XB 4OIBA 4WUUB 5F7EL 1XCTB 3GJFB 4GMTH 2WP3O 2FJGA 3KLHD 1MFEH 5JUEL 2HVKA 3GMMA 1LDPL 4PJFE 1NC4B 3BP6B 2YD4A 1RZKH 4XBPA 1P1ZA 5JPNA 4HCRH 1T89A 3VW3L 3IRZA 3P11L 2AEIT 2CIIB 2HP4A 1QKZL 2C4FU 2VDRH 5J12C 1FV1B 1UWEH 3O2DA 2WLYA 4FQPA 5ABDE 2A74A 5K9OB 2LTQB 4R7DA 3GMOB 1HH9A 3FKUS 3W0WE 5HPMB 1B88A 1E6OH 4LOUC 2NXYB 4M3JA 3ZTJG 1AXTH 1DCLA 2D31A 3H42L 1T83A 5HHNB 2AQ3A 3UJTL 2BZDA 3MMEB 2EIZA 5JHDA 5IHUL 3ARGD 2AJUH 4Z77B 4PG2A 4M5YH 4TVPE 3JUYA 4OUUA 4NRXB 2JJUA 4U1GC 4NO5A 3QWQB 5IB5A 4KQ4H 2F8OA 3GSVA 4ONOA 5GGTH 5MEOB 4NIKB 1MHEB 1DLHA 4P5KA 3NPSC 1DBAL 3BT2H 3MYJB 1OB1A 1IGJB 3G5ZA 5DQ9A 1BAFH 3LAFA 5L88L 2D4DA 5DMKB 3HB3C 4MA8H 2GW5A 1B9ZA 2D7PA 4LU5L 4M48H 3BKCL 3FONB 5F7LB 4POZD 3U0TA 4G9DA 5FHBL 5KS9B 1ACYH 3H9SA 1HH6A 1UZ6F 3HR5A 4UV4H 1CQKA 4CKVX 1GSMA 4R90L 3EYFB 1IGMH 1JRHL 1F58L 1FO0A 1B0GA 3GIZL 3KGRA 4LSTH 2GK2A 4I5BB 4S11A 4L4TB 2NXZD 4IOSD 3JVGC 3DUSA 1UJTA 1AQKL 2WM0A 3S97C 4ETQA 3S8WA 1KG0B 3RWIA 4NNPH 5H94A 3EOYG 1E28B 5ITBL 4JFZH 4Q9BA 1CK0H 5TF1H 2WBJC 4HH8A 3X3FH 3AROA 3GEWB 1OCWH 1ITCA 2YKLH 5DQJB 2R2BA 4WV1B 4PUBH 4KHXH 5DZLA 4KV5E 2A9NH 3UTTD 5GRWA 4PY8I 4PGZA 4PLKD 4ZNEE 3KPNA 1NGXA 3HC4H 1H5BA 2B4CC 4PY7A 1JGEA 3SDXE 4MAUL 1AGCB 2F19L 3BAEH 4OFDA 2YD8A 3KJ6H 2CDEA 3UBXI 4QF1B 2AS5M 1T4KA 1NCCL 2EZ0C 4X9BA 1ZA6A 2DQGH 2IQ9H 4DFIA 3NFSL 4MLIA 3QB7C 1IEAB 5EC2B 2ZSWB 1T0MA 5GRVL 1U8LA 2P8MB 5T1DL 3CX5K 3BGMB 4UINH 4JANA 1FH5L 2Q3AA 4HGMA 5ERWA 4EQ3A 4JAMB 5FUZL 2D0FA 2YA2A 3I6GA 4MCYA 1RULH 4ZTOL 1MAML 1BZ7B 2X89D 4X6DE 1MCRA 2AEQL 5KVEL 1IE5A 1J10A 5I71C 4RCAA 4TUOA 4I2XE 4KPHH 3U4BH 4CN4A 1R5IA 3LEXB 3KHOA 4P99A 1VGKB 1JFQL 3C09B 3V0WH 4MDJA 5E8NB 2Y36H 3MRCB 4RMQA 1S7VB 4JG1H 5CINH 1XF3A 2JTDA 5C08A 2H8PA 5DURD 3ULVE 2B0SL 5J06A 3PABA 4NKQB 1T89C 1GGBL 5EOQH 5E2VH 2J4WH 3TBYA 4IHOA 1PEZA 4ELKB 3DOSA 3JTTB 1CXIA 2EDQA 3RY6C 4HHAA 3EYQC 2X70A 1ZHBA 4JO2H 5T5NG 1IRAY 1P7QA 4R26H 5DI8A 5E7BA 2NW3B 3HB3D 2W60A 2EH8H 3QFDB 3BMWA 4HBQA 1X5GA 2UWEE 2X1XR 3C2AH 3CH1B 3P3YA 4G8GE 1I8LA 2EEAA 5E5MA 4Q97A 4M43L 1MUJB 4WFHE 5DVMA 3T0BA 2A38A 4Z76B 5T3XE 3RZWA 3VXTB 4N68A 4LDOB 1T1ZB 1MHCA 1NANH 4F15B 4I3RL 3QUMB 3VJ6A 5LKNA 1DN0B 4P9HH 3SKOA 1I9RH 2CMRL 2DBJA 1YYLL 4Z7WA 4E9LA 3BUYA 5BZWA 1L7TH 4C4KT 1I3VA 3TYFA 1G7HB 1ETZB 2I5YH 1T6VN 3E6FB 4CVXA 2OSLB 1JHKL 4PJAF 3VMOA 3VRLF 2NY0C 2PUQT 4NQDA 4WWKB 3VI4F 3ZMRA 2H45A 1XGQB 3PWLA 5HVHC 4M4PA 4BZ1H 1WV7T 4E0RB 1ZTXH 3VXOB 2VQUA 2WBJD 4YC2B 2ZUUA 4GSDH 5D7LA 4XPHH 1P7KA 3FFDA 2BSTB 3TNNB 4DZBB 1MCJA 4Y2OA 1EVTC 4LLDA 2DM4A 3VFRB 4HX1A 1A0QL 3MNZA 2R2CA 1MCSA 3BX7C 4HXAH 4L9LB 4U1IA 5SWZD 3U0WL 4GAGH 3D0LB 4AG4H 3LSOB 3MRGA 5BS0A 2FR4A 2HMIC 1ORSB 2YUXA 1OM3L 3WHXB 5IUSA 2IMMA 1A7NH 2J6EH 4KQ3L 2FGWH 5D5MF 2VXVH 4YDKH 1RJLB 2LAGB 4MNHB 2PKDA 1GPOH 3QWOA 1UH4A 2A2QT 4PIRF 4PJHA 5I8CA 4Z8FL 2VLKE 4PLNC 3V4VL 1NLDL 2VXUL 2WLZA 4XZUA 3RNKB 5HXMA 4OB5L 5E56A 1DP0A 1H5BC 4PB9H 3O81A 3LEVL 2IBGA 5KG9B 3OKMB 1FAIH 2CXGA 5K59E 1VPOL 3HG1E 3ALXA 1NAMB 4YDLB 4YBLB 1OWRM 4WCYH 3MLZL 1HWHB 2GTWB 4TPRH 4OLWH 5GGRB 1P7HL 1EA9C 1WIOA 1A6ZB 4D9QD 3QIUC 5E6ZA 2IADB 3U79A 1G7PA 2GT9A 3VRIB 3K74B 4OZHE 4FXGB 1GOHA 2LU3A 2KZWA 3KG5A 2VZVA 3EYQD 4YXHH 4Z7VA 4YGVB 3T0EE 1XGUB 3GSXA 3MA9L 3T2OA 5CP3H 4XXCA 4D0CB 4K8RD 2WINA 4PYHA 3EZ8A 3DO3A 4OZGF 1U8KA 5I1IH 3IU3A 3VH8A 3H3KA 1NUDA 3MLTB 4BQ9A 4NSKA 1EFXA 5JHDD 5GGVH 2IBZY 3ZTNL 4OGYL 5K33A 3T2QA 4X6EB 1ZT4A 3G04A 4FQCH 1KIPB 2PTVA 1Z5LA 1EZVY 3DRTB 5T3ZD 5C71A 3O3BB 5FYKH 1DBMH 4IRZH 3WO4B 1OOAA 1U92A 4U2ZA 2CSPA 2E9JA 4GKZB 4C57C 3PV7A 4KZEL 1EUTA 2NY0D 4XC1L 3VFVA 4PJFF 3QISA 4I4WA 2DQTL 1Y18A 5HGHB 5IK3A 3I75A 3QEQE 1I8LC 5DJZB 2F8XC 1XF5B 1T3FB 3H9SD 5MEPB 3O45B 3P73B 2ADJA 3X11B 3D39E 4QTHB 4D8PA 4NBZB 1KTKE 4XP4L 1Z3GL 2OZ4H 1FNFA 4FFYL 4JY4A 4NQEB 1YQVH 1EHLH 3DO7B 1T2XA 3X3GL 3BJ91 2X42A 5EU3A 2HMID 2A6KA 4L8BB 5J89A 4YR6A 3O8XB 3BPNB 1G6RB 4NHCH 3KLAA 3SKNB 2DICA 4XNXL 2PO6C 2IPTH 3GMNA 2A0LC 3CXHK 2F8VA 1YEDA 3R06A 3SJVB 5F72S 5T5FH 2DQCL 3O41A 2BNQA 5KVFH 2V5TA 1FG2A 5DFVC 3CSYB 4ZQKB 3VRJA 3CLFL 2OL3L 4HEPG 5CCKH 1MSPA 3OQ3B 1NUGA 3O6LH 3NACL 4N1HB 5FO9A 1KCLA 43C9B 1LEGB 2DQFA 5MENA 2VIRA 2FGZA 3O11B 3AVEA 1CU4H 2ZG2A 3F6LA 4QRPA 3O4LB 4X5WA 3ZO0A 2Z35A 4OCWL 2R0LH 4L8SB 4LCCC 3LKPB 3JWDL 3JWNC 3L3GA 5L9DH 4GAJL 5GGVY 5L2KE 2XN9B 2X1PA 2UVFA 4NZUH 1LGVA 5IVZB 3O2WL 4OM0L 4WI9A 2XWTA 1TENA 3KPRE 4K3DH 4RRPG 3FT4B 5E8DH 4WI5A 3EZJB 2VZOA 4JR9H 5TE7L 4JO3H 2ICWJ 3IETA 1KTLB 5B39B 2ZP0T 1CLZH 4Y8AA 4N90D 2EH7H 4TULH 1ND0B 2I07B 5LVEA 4HIIB 3CZJA 3FT2A 3STLB 5CJOH 3HKFA 4K94C 5C08D 4GKSB 4KK8C 3RWGA 3BZ4A 4K3EH 1I3UA 1MCKA 2BNRE 1V05A 3PDGA 4KV5F 3WFBL 5I8KL 3LRSB 4FZ8L 1GJIA 3C8KA 2AGJL 5FUCE 3QIWB 1QBBA 1WCBB 3SDXF 1A1NA 5IB1B 1FFRA 1T1YB 2IAMC 1IC7H 3PIQA 5F3BB 1P7QD 3PG2A 5B22A 4XXCC 5CGMA 2IFFL 2F5BL 2AJSL 3VXQB 5ANME 1L6XA 4ODVH 5I1EL 1RURL 1FJ1B 3L5XH 4TNVF 3TNMA 2R0WL 2R1WB 4KZDH 2X4TB 4AEEA 3AREA 1KT2A 1X5JA 5CIPH 4XWOC 3N9GH 4X6DF 5D7JA 3V0VA 4M7LH 3U46A 4X6CE 2XKNB 1YMHB 3O6KL 4JKLA 2OI9B 3GNMH 3LN5A 4LLVB 2PO6D 1UACH 4NQDD 1WBZB 3LQAL 1IT9L 2A0LD 3BPOC 3RFZC 1UCBH 5ACZB 1FORL 2HLFC 3SE9L 1T04A 3ULVF 3QPXL 3RAJH 5D7LD 1SJXA 2BXZA 1SBSL 1U8IA 2Z93A 3MCKB 1TCRA 1NMBL 4RQQA 5DFVD 1ONQB 4WFED 3WFZA 4LSRL 3LKSB 4Y4FA 5DVLA 5FYLH 1PQZA 4XCNA 1AY1H 1BVLA 5SX5K 5DMYA 1FZMA 3FO9B 3KYOB 5D1QC 5FO7B 2Q1EA 2UVEA 2DLFH 4M6OL 1LP9F 5F88B 2XWJB 2ADGA 4HJGB 1CDGA 1FFOA 1U6AL 1ERNA 4O58H 4UTAH 2APWA 5HJ3A 3IFLL 4NM8L 4OD2B 4OM1H 5E94A 4DGIL 2QADB 1IGYA 1JWMB 2BSSB 4P2RA 3NA9H 2RCSH 5SX5H 4LF3B 2DS4A 2FO4B 4WTXA 4P2QB 3HI6L 4FQHB 1JI1A 5FK9B 1KN4H 2GJ6E 4FQLH 2B8OT 1IKNA 1EXUA 1AFVH 1D5MB 4KK8D 1CTOA 2YRLA 1QBLL 2FJFB 4M1CD 5DD1H 2CDFB 2IQAB 1Q72L 4J3XA 4GRMA 4EN3A 1BD2D 4RDQF 4ZPTA 4KI5E 1R3HB 1XR8A 3DXAD 3MGAA 2IAMD 2A77L 2H26B 4R97C 2EYTB 4B50A 3FQRB 4NO0A 1Q9LA 3WD5L 3SDYL 5HVWA 1QHPA 3FQTA 3EOTL 1NLBL 3UPRB 3UYRH 4LLWA 1F5WA 1KIRB 3QXAA 1UWGL 1HCFX 4O5LH 3ARXA 1NEZB 5EORL 4DN4L 2NX5B 3FTGB 2ED7A 1CFVL 3O9WB 1T0PB 1EFXD 1FSKC 5F1IB 2OS7A 3WN5B 1CDUA 1ZGLM 3OJ2C 3DIFB 4XWOD 2AXHA 2D7OA 4PP1D 2RJMA 4NFCA 4LCUB 3MRFB 1RJZB 3UJJH 2R4RL 3CZFB 5LCVH 1JV5B 2C4FT 5D2LE 1OPGL 3QYCA 5K59F 1KPUA 3QO0A 1X5YA 4HKZB 1HQRA 1CD1A 1ZA3B 3EYUL 3OX8B 3GKZA 3CJJA 3I6KB 4NQVB 1V5JA 2EC8A 4N8VG 1YEEL 2VDQH 5GS1A 2PYEE 1N6QL 5IFAL 5C7XH 3FB6A 4FFZL 3LHPL 4HS6A 5GISL 3A0OA 4ENEC 4OZHF 1A3RH 3AREC 4ZUWB 4MNQA 2X4RB 4LP4A 5EU4B 1MJJB 3W0WB 3V95A 5EUKA 2FX9L 4FP8H 4O2FA 4F2MA 1B0RA 5D1QD 3RIAK 5D7KE 4BQBA 4WVRA 5FCUH 3MLYL 4QOKE 4Y4KA 1ZXQA 1I3GL 3NZHH 2L0DA 4X4MA 3QUZB 1O0VA 2JB6B 1BJ1H 4ZUTB 5J9PB 1BM3H 4OQTL 5FKAA 1UXSB 5FUOH 2ITDB 3TYGH 5I18H 2RHEA 3L5IA 2FD6L 3JV0A 2M2DA 4JZJB 2BNQD 1EVUA 1QSEE 1EEQA 3S88L 5DT1L 1KSRA 3WEXB 4OUOA 4GT7A 4ODXB 1IM3A 4Y4FC 5MI0B 6FABH 2X4OA 2QQNH 3DVFA 3KYAA 3OKLB 4U1SA 5GS3A 2BY3A 5MEND 3IVKB 1FGNH 4EIZC 1U95B 4QRPD 3QO1B 4KKCC 3CNKA 5DEFA 5L6YH 2Q76B 4UZGA 2VQ1B 3FQNA 32C2B 3C6LC 5T33L 1D6EA 1A3QA 3DLQR 5DUPH 2B4CL 3SKUD 5D7IA 1HHIA 3N50A 4OF0A 1SJEA 3MLRL 1MCDA 1ZS8A 5E4EC 3MBEB 1TITA 2WUBL 4MD5A 5DUBA 2RFXA 3H3PH 5SWSB 4N8CL 2W0FB 1FZKB 4O4YL 2DTML 5BVPH 4QHMB 4LDEB 3WS6A 4NFBA 5I1HH 5FYJD 5BV7H 3BPLC 5HHOB 2NR6C 3K8LA 3QNXA 5E6IA 2NLJB 5CD5C 1JMZA 1P2CA 1N3NB 3OXRB 1QQDB 2XKUA 3P30H 3QIBA 4KRLB 4H20H 3FAWA 3O3DA 4U6VH 3U7YL 3DROA 5HHQA 4PJ8A 4JPKH 1KGCD 3WJLA 5E6YA 4TTGA 3U36B 5E9DA 1KJVA 2ZUTA 3DVGB 1MFDL 3SPVA 4GRWE 3NCBB 1FNHA 4DOHE 5JW5A 3SDXB 3HAEA 5FGCE 4O00A 3OB0H 1JK8A 1KB5A 5AD0B 1A6VL 2P47B 5E24E 4YQXL 3CVHB 3WSQL 3ARFB 3D25B 5EU6B 3UTQB 3MFFA 3FB7A 2A83B 5CSZA 4YWGL 2YN3A 3ULUH 4WJ5A 3QUXC 1CR9H 2UY7A 3MLSH 4Q9CA 1ZV5A 3UTZA 2CK0L 1YEKL 2QTEA 3ARED 2QSTA 3M17A 1UXWA 1QPPA 4XT1C 1NFDB 3D1MC 1MRFL 3P4NB 1GXEA 4I2XB 3HRZB 3EDKA 4PJXE 4U1LA 4L8CA 3WIHH 4OV5B 1ZVYA 2I25N 4ZTPL 1FIGL 2NY4D 4ZSOE 5T3ZL 4HBCL 3JWOH 4HQQL 4LGPB 4WW1B 1DEEA 4V1DA 5C07A 1PW3A 3TJEL 3HZKB 4L3CA 5I73C 3DUUA 5DRNA 1VKXB 4PRHA 5I30L 1X7QB 4KUCD 4MNGE 5GS1C 3AS3A 4F3FB 5DZNA 1PG7H 1MF2H 3UTTE 5BRZA 4LASH 3TIDA 4JRYD 1N5AA 4K7PH 3EHBD 5CHNB 1IL1A 4Y4FD 5IEKB 1P4IL 2XQBL 4YHYC 1F42A 1MCCA 4A2LA 3LKOB 4MXVE 4LKCB 5D2NA 3P9MA 3Q3GB 4UILH 4UUJB 4ZOAA 2MSPA 4KKCD 2FL5B 1K8DA 4ZAKB 4EOWL 1AO7A 3MUGA 2UWEB 1AGEA 3B9VA 1M7DB 2ZOLB 5F7MC 5C0JA 1KJMA 1MAKA 1Q9WB 3C6LD 1TZGL 3FOLB 1PSKH 5DXWA 3AMLA 4BFIA 2C1OB 1RZJC 2H32A 3B9DA 4LQFH 3WNLA 4U3XA 3FRPA 5KANG 3VD4A 4LARL 4NJAH 4Y5VA 1A4KA 1HSBB 3J8F7 2Y5TA 3ZYIA 1I7ZB 2Y06L 2C7UA 5DD0H 4JFOA 1A22B 2X4UA 4X6CF 4P2RD 1RUML 3LKQB 1CFNA 2VR9A 4FG6C 1KLUB 2YEZB 1MAJA 3V6OC 2NR6D 2FHCA 5F7DA 2EE6A 5DJYA 4FQ2H 1EHXA 1CBVH 3D3VB 1BIHA 5CD5D 5F7WC 5I1AA 4G7VH 4JPWH 1LE9B 1FQ9C 5EH1A 5CMAB 5F9JB 3CXDH 1Y0LB 1NCTA 3P40A 4HPYL 4N0CC 1FIEA 3ELAT 3PP4L 2OP4L 3PGDA 4P57A 5GJTL 5B38G 1JPTL 4Q6IC 2GY5A 3PV6B 5SWQA 5BQ7B 3AB0C 3MV8B 4HMDA 1SEBA 1GGCH 4TUJA 2NTSP 3WS6C 2CRZA 1F6AB 4GW5B 4NO0D 2BSRA 3INUH 3X13B 1HI6B 1N8ZA 3RUGA 4FRWA 1LD9A 5EBLB 3QUXD 4D2NA 5JW4R 4IIQC 5EA0L 3RWDA 1RK1A 3RHWK 5BW7A 1J18A 3QIBC 3PGCB 2VLKB 3VA6A 1AKJB 4K7PY 2BY1A 3IJHA 4PJ8C 3WJLC 3LQZB 3V52L 5C6TL 1TDQA 1QLFA 4E42B 3D2UB 4WU7A 3I2CL 3WLWC 1A6WH 3KS0H 1MFAH 4OTXL 1B90A 4OCXL 5F89B 2Q86B 4U33A 3HG1B 2VABB 4F7TA 5E08H 3ARZA 5C3TA 3VXSB 2C3GA 5HYJB 4U1MB 2R56H 4HKXA 1G9NL 4J3OC 1WBXB 1H3TA 2Q20A 5DSCA 1FL6A 1QBMH 3ARTA 5LGJA 1KEML 3OV6A 4CNIA 3IU4L 2FJHB 4KI5F 4MNQD 1T5WA 5SWZE 5TFSL 1VACB 1RZ7H 1NH6A 3HUJA 5BJTB 4K71B 4NFDA 1T1XA 4JQXA 3GJFA 1BFOB 4R4ND 5GQBA 1AGFA 5J13B 3RWEB 5IMKA 1NC4A 3U1SH 2CKNA 3EKCA 4ISVB 2NY3B 4ZO6A 3KXFB 3DVIA 2ATKB 4IBLT 4CMHC 4ZD3L 2CIIA 5E99L 5HHVH 2OCFD 5TQ0L 5F3HA 4GLRH 2WNGA 5FGBA 1MREH 4OD1L 1FV1A 3T3ME 1HIMH 1KFAH 4D9RD 1NMAH 2IGFH 3FJTA 2R1XB 1D5BB 3GMOA 5IHLB 2VMFA 4GXUN 4NN7B 5HPMA 5CGYC 5D2NC 2Q7NA 4XXDB 4KTDH 2O61B 1CVRA 5DD3L 3EFFA 3IDYB 4NNXA 1R0AL 3CDYA 2QJDA 4GUPB 4I1NB 5HHNA 1N5YH 1U93A 3RWJB 1K2DB 3MMEA 3MRMB 4D9QE 1HZHH 4S2SB 5IVXB 3D39B 1IGFL 4I48A 4UDUB 4NRXA 4Y5VC 2DQUH 1S9XB 3KPLB 3MNVB 4N0CD 5FGSA 5D93B 4R9HA 3K46A 2VL5B 3TO4B 2AJXL 1MHEA 2B2XL 4BK5A 1RK0B 2NY1C 3GJEB 4A6YH 5JO5A 3EYSH 4APQB 1BLNB 1L7IH 5DMKA 5IIEB 2WUCH 1FP5A 1JF5A 1RQ5A 4N8VB 15C8H 5JHDE 2ZG3A 2LVCA 4LSUL 2DJUA 5AWNL 2FECL 5E6ID 1C5CH 2EE2A 2LFGA 5KS9A 1RD6A 4WY7L 4GQPH 4K23L 4WUKL 3QIBD 4OI8A 4JKPL 5GS0H 5LXGL 4PJ8D 3EYFA 4K94L 1DVFB 5E9DD 1BWMA 4LCWB 3I6LD 1N6VA 3H7BB 1J1XL 1CTNA 1DQQB 1H3XA 2FIRT 3T77A 3WLWD 5D9SA 4L4TA 1KXTB 3ZL4H 1EPFA 2BMKB