2UY6B

Crystal structure of the p pilus rod subunit papa
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
154
structure length
150
Chain Sequence
b'KVTFNNTVVDAPCSISQKSADQSIDFGQLSKSFLEAGGVSKPMDLDIELVNCDITAFKGGKGTVKLAFTGPIVNGHSDELDTNGGTGLAIVVQGAGKNVVFDGSEGDANTLKDGENVLHYTAVVKKSSAVGAAVTEGAFSAVANFNLTYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERIPLASMID CHAPERONE PAPD PROTEIN
publication title Crystal Structure of the P Pilus Rod Subunit Papa.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 20
structure length 150
sequence length 154
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00419 Fimbrial Fimbrial protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 2uy6B01
5FS5A 3MCYA 3ZPDA 4X5QA 4XODA 4XOEA 4X50A 4J3OG 3BFQG 5FWRA 2JMRA 2UY7B 1N12A 4ATTA 3JWNH 2XG4B 4AVHA 3BFWA 4CA4A 4AVIA 1KLFB 3ZL2A 5F2FA 4AV5A 3BWUF 3ME0B 4AV4A 4XO8A 4X5PA 5AB1A 1N0LB 1UWFA 4AUYA 5CGBA 1PDKB 1KIUB 2JTYA 4J3OH 5ABZA 2WMPB 2W07B 2VCOA 3ZL1A 4AUUA 5IQOA 4XOCA 4AVJA 4XOAA 2XG5B 3JWNE 1ZE3H 4LOVA 5LNGA 5FLUA 4CSTA 3SQBB 5LNEA 5IQNA 4BUQA 5IQMA 4XO9A 5FX3A 1TR7A 4AUJA 4X5RA 3JWNG 1QUNB 5JQIB 4AVKA 4J3OF 4AV0A 4XOBA 5AAPA 3RFZA 5AALA 5F3FA 2J2ZB 4CSSA 2UY6B
chains in the Genus database with same CATH superfamily
4HXAH 5D2LE 1EQWA 2D3VA 1AZUA 2YIHA 1O9VA 4JY5L 3LQZB 5AWNH 2LGNA 4HWBA 4CW1A 1JZ6A 3I74A 4GUPA 4Z3HA 4HWEH 4MXWL 4FQQA 4RRPM 1U8QA 3W2DH 3T2NH 1NJ9A 2EEFA 5ACLA 2IADA 1LEIB 3IDMB 1KIPB 5IB1B 1FPTL 1HZHH 1OGPA 2C1OA 3KPPA 2COQA 2OCJA 5JMOC 1MCPL 1QSFE 3BAYA 3T77B 1FJ1B 3PWPB 1N12A 3ARDB 2D2OA 1DEEB 1OKEA 4EBQH 1G1YA 1NCDL 4R4BA 4DP1X 3ALWA 3UIYA 1NH6A 2E76C 3QIBB 4YSAA 5IJCC 4WGVB 1JPST 3WNLA 1JG9A 1DUYA 2O5NA 2AC0A 3Q13A 4UT7L 2EKSA 3ESMA 4Y2DB 1ORSA 1IBFA 4YQXL 4UTAA 2DDQH 1J5IA 1D5IL 2EDMA 2XQYK 3FK3A 4PJ8A 2RQEA 3TT3H 3ENEA 2MKLC 2VDQB 3BESR 3HUJA 2Q8BH 2OI9B 2NDGA 2TAAA 4GYBA 3DHUA 4NLAA 3T9WA 1KSRA 3N5AA 1NDMA 4MNHA 2AQRA 1KF9B 3QO0B 4L4VD 4TSAH 5KVEL 4DVRL 3KPQB 4IRJC 2AXHA 4WJ5A 3QQXA 3BDYL 3P3TA 4N8CL 4MAYB 4U6YB 1FVCA 5KBDA 1CBVH 4OI8A 3Q7JA 3V5KB 3TCLA 3MJGX 3VWJD 1S9KC 4NKDA 2WWKT 4PG2C 5I71B 3GXUB 2DLTA 4OI7A 3IU3B 5H2BA 4LLVB 2PCYA 5MP6L 3CAFA 1MHPH 4NKIL 4MJ6A 2DYSB 2N56A 2GKIA 5ES4B 2AJUL 2WYZA 4PJAA 5DUML 4JFSA 2R69A 5DMKB 4LSTL 3GSXA 1HQRB 1DE4B 5AKTA 5AB9A 1NMCB 4JAMA 1M2VB 2P52A 4C59B 4Z8FH 4FXGC 3RBSA 5CBAA 1BQSA 4U1JB 1ED3B 1OAZH 4LK4A 4WO4D 4J8RA 1YNTA 5B38G 4M5SA 3D52A 1MH5A 1Z7JA 4GI6A 4OFKA 3BIKA 3OZKA 3SN6N 2CO1A 1HHIB 4U1IB 3GHEL 3K5RA 4J28A 1PYWA 2ESVA 4M5YL 3QDGD 4XMKH 4DESA 3H42H 1DBML 4N8VB 2ARJA 2JQAA 1TVBB 2PPAA 2D0GA 1AGFB 3LKRB 1X5IA 3C6LA 1CIDA 1JRHH 3RL2B 4UOJA 3V79C 1KLUB 1DJIA 3U0WL 3EBHA 3IBEA 4Y88A 4EI0A 5F0MB 2XPGA 4QLRA 1ND0A 4H88H 4JG1L 3WJMA 3QSKB 3ILPB 3JT0A 1YDPA 1JHTA 1QTSA 2DKMA 1OTTC 2IDUA 4Z7QF 2XN9D 4AOFA 3T3ME 4PLOB 2OL3B 4ZS7L 2C3GA 2JKJA 4HZLA 4PMFA 1FO0L 3IKCB 4GO8A 4Q6YA 2XVKA 3CH8A 3CX5J 1F90L 2ZOTA 1U8CA 3RUGA 1A3RH 4OUUB 4ES9A 2APXA 5FUCC 3Q5OA 3MXWL 3PWVA 1KCVH 5I17A 4AQ8C 3Q01A 4F7MA 2R2HA 2DQHH 2GBUA 1S9VA 2R9HD 2CRMA 4WNJA 4GXFA 4PJ7B 4U3SA 1I1YA 2ILLA 5A2AA 4OIIL 1NFKA 5EZOL 1BBJB 4ZMAT 3HAEH 4FP8L 1UXWB 2ZTBA 2W92A 3HPLB 3VWJB 2W65B 3WDHA 4PM1A 1TTRA 1U3HA 4LDCA 2H4EA 3KYKH 4XVUC 3TYGH 4AGMA 4JFEA 3ULUL 5ACZB 5DJAB 4N2KA 1DSYA 3EFOB 3RDTD 4PJGE 3S5YA 2E59A 3KJ6H 1NPUA 4YC2C 1JK9A 4CADB 2MPAL 1U2CA 3T8MA 1NWPA 2E7BA 2G3ZA 3IXAB 5LN8A 1C08A 4FQHA 2D7TL 3BT2H 4L1DA 5TF1H 5HHQA 1I1AC 1CC3A 5CN1A 2J73A 3NIGE 3O6KH 3UTSD 1Z66A 4TTGA 4XPBL 4F7CB 4WO4B 3L4UA 2M26A 4KMTH 3CLEL 5F7DB 2H6PA 2XG5B 4NDMA 1NDTA 3MLZL 4X0NA 2WKOA 3OR7A 5E8OB 3QDGB 4UIMA 3TT1H 3GXFA 3AFLA 3A6CH 5J6GA 3IETB 3C5JB 3PHAA 3DVGA 4I48A 4AQAB 2VL4A 1JMXA 5FGCE 2VL5A 5AB2A 4JFOA 1P7BA 4QRRD 3HKFA 2XWTB 1A3LL 3BDBA 1PG7L 2YGOA 4H5SB 2FR4A 3BFOA 4JZJB 5BVJA 2JQMA 4NQCB 2F1BA 4M1DH 5DSCB 3Q8CA 3VFOB 4YHNB 4PP1D 2WO3B 1TUPA 4GKLA 1SLXA 4W9EC 1KY6A 2ED9A 4D9QD 1A9VA 5F9JA 5GSRB 1VERA 1IGJB 2GK0A 2XTJB 4M7ZB 43CAA 3U4BL 4LZKA 4OFYA 4OUOA 1NZRA 1WV7T 2JKRM 4P49A 1MAJA 1HIMH 2YA2A 5INCA 1XR8A 1S9WA 2V6HA 3RU8H 3AY2A 4MJIB 4GAJL 1EO7A 2LQRA 2A4ZA 5E2TH 4UQ2A 2QR0A 3ZDWA 1MCNA 1AR2A 2CMRL 2EVJA 2C7UB 3ZDYE 2K9FB 5AVYB 5I1EL 1Q0EA 3Q8FA 1UXSB 2Z92B 2P5EA 3GMRB 5AW1B 2XZQH 3IDJA 5DC0A 5T1KB 1LO4H 2ZSWB 1CXIA 3MUY1 3ZQXA 3D9AL 4WO0A 5ITBH 4PRIE 4ANUA 1W6LA 4PJIE 2FLMA 1F02I 2F53D 1KEGL 3CV5A 4DEUA 4YHZH 1CDHA 1ZRUA 4K9EC 5EUKA 1X6NA 5DI8A 3RB5A 1ROWA 4ZMPA 5LQBL 3GF8A 4LCWA 4OJCA 1WBYB 1CQYA 1ETZB 3P0YH 3T8XB 5L0QB 3L6FB 4XBGB 3ZZ1A 4NRYB 4KZDH 1UT9A 4WTWA 3GB7A 2XVGA 1TQBC 3QZWG 4M43H 1AOHA 5ACMA 4PJ5E 3IMBA 4JRXD 5B39A 1S3KH 3FQRA 3KLHC 4JKMA 4KMLB 2X70A 5DQ9A 5H94B 3LKNA 2NY5H 2BOBA 1M71B 2QGDA 1L6PA 3BD3A 1QWUA 5F6IB 4JPKL 4NM4L 2GC7C 5EOQL 1ZTXH 3QNZA 1HL9A 5CEYA 3E3QC 2YSTA 1I7TB 3QC6X 4EE2A 1YSOA 1JNJA 1BZOA 2WYTA 1QO3B 1VPOL 2GITB 5A3ID 4M8VA 1MCWM 4BJLA 3T2PA 5FFGA 3DTUB 4OBSA 1J9TA 1JE6A 3S8FB 4NAMA 4FA6A 1PFCA 5IW6A 4UU9A 3S35H 5KVFL 3NRQA 4G9FA 3GHBL 5EOCJ 3ROOB 1SQMA 2GY5A 4PJ6A 3TA4D 5KVGH 4UOW0 3UG3A 4YZWA 3GS7A 4MMXA 3WSQL 4Y4KC 4ZXBD 1QBML 2BHZA 1UYWL 1WF5A 2CGRH 3BP5B 4HX1A 4OCLC 5F7BA 4PLJD 4EUPB 2NY5C 2Y72A 5D4JA 5E8DH 2VN7A 3CZGA 1MZYA 3IDGA 2VDNH 3Q8AA 1M53A 3V4PL 4AC2A 4Z7OB 3S88L 1N8ZA 4FFYL 3P9MB 4NP4L 3VI3E 2YXMA 1MFBL 2WSKA 4LSQL 2NY0D 4A6YA 3VD5A 3BRGC 3GSNH 3K4DA 2ZP9A 4K9JA 2MQGA 5J3HD 4PGBB 3D09A 4U6XB 3BUTA 1WE5A 4AG4H 1NICA 2CRYA 1UURA 1A02N 1O6TA 2GJPA 3RZWA 1T80A 2FLBT 2K4AA 5E1IA 5MEPB 3BKYL 3GIVB 1CDGA 3QUXA 1HZHL 4O2EB 3HN8A 4P06A 1BD2D 3I50H 1CFTB 2HN7A 5FUOH 2WBJD 5IVZA 4I3RL 2VE6B 4L3CA 3CZKA 4EBQL 4IBSA 3MV8A 3NFPA 4K7PX 3RWDA 5I0WA 4Z1PA 3QB7C 3V5DA 1F6LL 2WHVA 5E2WH 1HHJA 4P46C 2VZOA 3A4AA 4MDIA 1KPVB 1LO3H 3ABZA 2AABH 3T4YA 3B56A 3KVQA 3ULVE 3MX0A 4EN3C 2OMZA 4PJXA 2X05A 3KDMA 3TEZA 3B3IB 3MLXH 1C5CH 3TT3L 1JXKA 3KGSA 43C9B 1P9MC 4FN0A 4CKVX 1X7QB 4Q4IA 3N42F 3CHOA 4H2AA 4I18B 1H5BA 1PD0A 1RVFH 1CXEA 3GI8H 3GI9L 4WUUE 3UBXB 1HXMB 4UNIA 2DEXX 4TSAL 1KGJA 1E28A 2O6FA 3QR0A 3NSCA 1ZS2A 4P2OD 4H0GA 1BFOB 1OCCB 2UZXA 3T3PF 1WFUA 2QGEA 1CBVL 2Q86A 3POHA 2X4SB 3ZTJG 4ZXBB 2A74B 2NNAB 3VMPA 3G7TA 5E1GA 2OYKA 1K3ZA 1P5UA 1F58L 1ZSDB 3U2IA 4KZEL 2BH0A 3H6AA 4IRSD 2RACA 3VX1A 4B27A 4TUJA 4PY7B 4TUOA 1WS8A 1S9XA 1PNDA 1RJZB 2HFGH 2MOQA 3BVTA 5E2JA 3R8BB 3LD8B 1K8DB 3UBFA 1F11A 3DX6B 2X1WL 3DX9A 5BS0E 3DBSA 2CJTA 2Z1PA 4FFVC 1NBZB 5EFIB 3OGCA 1OAZL 3FFCB 3BZ4A 1D7BA 1G7JB 4KO6A 5I76A 3J07A 3LYRA 2OPCA 3UADA 3QEUA 5D7JC 3DXAA 4M3JA 4XMKL 4N2HA 4WDIB 3H42L 5JLZB 3IMUA 3JVGC 4PRPD 5DRZA 3KBFA 4RBPH 1BD2B 5C97A 4HKZB 4OU3A 4LSRL 1WPCA 1DVZA 3BRDA 2W38A 4LNRA 4QCIB 3AC0A 2ENQA 5GGQH 5TH2A 4Y16B 4F8OA 1EFXA 4H88L 5EULV 2BM3A 4HK3N 3V5HB 2FBJL 4G8FB 4AH2B 1FFTB 3ZKMD 3MRDA 4P07A 5DHVB 2X89A 5DC9B 3N6YA 4ZFGL 2D3JA 4XP6L 3BLPX 3VWKC 2C4FT 4DVBB 3MV9E 1E4XI 2XKSA 3KLAB 3LNHA 1IFGA 2WWKO 4XE0A 1OTSC 2MOVA 4X50A 1J0HA 4HHWA 5GISH 4FYTA 2LHAA 1OCZB 3U9PL 1A4BA 3C2AH 5JMRA 4TVUA 5EIIG 4MNGA 2DQHL 1B2WL 2Z93A 3G5YB 3HCVB 3VMNA 5HHNB 1PL3A 3QHTC 4M56A 4P2OB 1QRNE 2BXZA 4WI3A 4BHUI 2WYHA 2ADGA 5DXWA 4G7SB 5K93A 3EOYG 4XH2B 4HFWB 4D9LL 3JV6B 3T0EE 2P48B 3VYOA 4XCEB 4FQIL 3WNOA 1XBRA 3ZKXB 4AIZA 4BKLB 3M1BB 5I1AB 3QIWC 3AQDA 5IVNA 3ECQA 4DO4A 4OZFB 1MCJA 2DD8L 1SF3A 2BOLA 4U6VH 3CFCL 3NJHA 4XPFL 2QQKH 3U0TA 3HZVA 3BT2L 5HI3D 2XOTA 3KLDA 4XPTL 5DRXA 4HPHA 2WTOA 5GS2H 2DTSA 1SJHB 1BGXL 4NZDA 2CJUL 4XBEH 3ARGA 3APDA 5AKRA 3QI9D 4NNYB 3ELAT 4OF3A 2F5AH 5BJTB 1YEKH 2H1LM 2VXQL 5DEFB 3FQWB 3ZE2B 5I8CA 1X5XA 1U4FA 4ZNEA 1A6UL 5FKPA 4YDJA 2DQ6A 1TTCA 2D0FA 4KVCH 5D2LB 2IQAB 4M1GL 3ZY7A 5CS7A 4OSUH 3DJRA 4J4PC 4IRZH 3NEOA 4UOQA 4WGWB 3TBTA 5B21A 2WUBH 3SPIA 1A9EA 4UCFA 3QJFA 3DV6A 3PREA 3SE3A 3OAUL 1AG0A 3SQBB 1UUNA 5C0IB 1HXYA 3RGVD 4XMLL 2I24N 4M1DL 4YL9A 1QSFB 1DDTA 4CRPA 4Y2NA 4NQED 4XPHH 2ZCHH 4LVHB 2WTRB 4RMSA 1DVFC 4K9EL 4L5FE 3SB3A 1GZQA 1JYVA 5K69A 3BP6A 2Z64C 5B22A 1BMZA 3HRPA 4JJOA 2DWTA 3SEPA 5GGSB 4YSPA 1QI3A 1A7RH 4ZMNA 3AM8A 2WXMA 2X42A 3KYNA 3PL6D 5C6PB 4GSDH 5C3TA 1LP9F 3QR1A 1H3GA 1ZSHA 3WDIA 1IAII 1KACB 4M1CC 4POZD 4QNPE 4NFBA 1ZLVK 3BPLC 4FYSA 2OZ4H 4FAAB 4LPCA 4X99B 3RTQA 1UVQB 1J18A 4NO2A 3EO0A 1DVQA 2EIEA 3OKYA 3QA3B 5CO1A 4GAGH 5I16A 3K2MC 5D72H 2AXJA 2XZQL 1W9XA 2DAVA 3GDCA 1KCLA 4Y4FB 2K6ZA 1CR9L 5IY5B 1AP2A 5J06A 1P6FA 2X4NB 3O0RH 2LU3A 3MV7D 4LVOC 1UJ3A 2RH0A 4E9YA 1QLFB 3HKZA 1KTLA 2JWYA 1EHLH 1NAKL 2DQDH 4QF1A 5TPWH 3NQKA 5IBTH 5JW4Q 2VR4A 1SOSA 3STLA 1F4HA 2OSWA 1IL1A 3NG5A 4K2UH 2CRIA 2VOTA 3K71A 4XAKE 4KZDL 5TGBB 2KLSA 1E8XA 4M43L 3RI5F 2JJUA 5CGYC 3ZT7A 1P2CA 4JJ5B 1T21B 2XA8H 3FSZA 1BQHA 1BYOA 1IE4A 2K45A 2YAQA 1LK2B 5JOPE 2NY5L 4H44C 4YK4C 2AQ3A 5EU6A 5AW8B 1LLAA 2CR0A 2VUKA 2WCPA 2DRUA 1V54B 5D93C 1OANA 1FAIH 1MAKA 5LVEA 4LEBA 4IOSA 3DPBB 5JQHC 1QLEH 1AQKH 1WCBA 2JCCF 3UGEA 5IVXB 3HNSH 2NR6D 3GSQA 2O5ZL 4RGMB 5C0CE 4B3VA 4MQ7B 4X4ME 5EO0B 4AIXA 4ONGH 4PAZA 2N7BA 1Z5YD 2BDNH 3L3JB 3EJYC 3DARA 4LARH 3BVVA 1FSKB 2YS4A 5MENB 1QW9A 2H32A 5TDNB 5EBGA 3SPVA 3AS1A 3S35L 1PIGA 3VXRE 4DKAA 3FTGB 4FKEA 4PP2B 1I8AA 2ZWLT 4FNTA 2JIXA 1XGQA 1FE8H 2CGRL 1RL1A 1G7IB 4H8VA 1GC1H 4P59H 5DWPA 3PL6B 3EH5B 4NN6C 2WXRA 4Y9EA 4R7LA 3D85A 2Q2EB 3T3MB 1WTGT 3HC4H 5I1LB 4KRNA 4FS0A 1MVFA 5EMYA 5IHWA 3SDAD 3DV4B 4YIQB 3S36X 2XY1A 4LVEA 5D6DA 2BIHA 1OY3B 1SBBA 5HD8D 3TO4B 2BNUB 1B0RA 4D0CA 1OP3H 4JKWA 5D8JH 2ED6A 2QFRA 3LN4B 3Q1SH 4WFHD 3UERA 5C9KA 3WMQA 3J27A 2R4SL 5JQIB 2QZQA 2WV3A 3D39A 3W39A 2CHDA 1DANT 4CVXB 3ERXA 5AZ2L 5EF2A 1BZ7B 2Q87A 3V7AG 3AT0A 4PV9B 4Z3JA 2KZWA 2VDPH 5B1BB 4AKOA 1T03L 3MZGB 1F0LA 1WWWX 3IJYB 3AACA 2R1YA 1GC1C 1NPNA 1RKRA 4GG6F 1GYVA 1KJMB 5D1QC 4Q6IB 3PWNB 4R2GC 3SYPA 4L1TA 4PJGB 2XWXA 5D1XA 2NW3B 4S1QH 1ZGLP 1LO3L 2AABL 1KENH 4AWJC 3QJHB 4U0RC 4LGSB 3S5LG 2WZ6A 1IKNC 4HG4J 1N64H 1T0MA 3MLXL 4DP7X 5FOBB 3CPLB 5ID1B 1P4BH 1YHPA 5BZDB 2EYRB 4AVIA 4GG8A 4HC1A 1FFPB 1JZEA 3Q0HA 2EYTA 1EHNA 5EC1A 5I1GH 1VFUA 4RIRB 1J1XH 3GI8L 3PGFL 3HI1B 2NRDA 3GBDA 3QP3A 3FTXA 3PAVA 4EOWL 1Z2KA 5FGCB 4RSYA 4O02B 4BKSC 3TA3D 1KXQA 3QZNA 4FXKB 1GGTA 3TXAA 2VXSL 3GK8H 1W8NA 3MBWA 3FZUD 2B5IC 4KY1L 1J05A 3C60B 1EUUA 2TRYA 3T1FA 2BMKB 2JJWA 4GQZA 3QCUL 2NYKA 5B4MD 3UZEA 4ESKA 5JW3L 1I3GH 1TVDA 1FBIL 4KUZH 4M4PA 4J27A 5LHDA 5GSVB 2IALB 3FCSA 3VTTA 3BLBA 3D5OF 1KCSH 2E47A 3ECBA 1P84K 3IFLH 4UDUA 2HFGL 2JLLA 1CXHA 5ICYB 3LB6D 3MREB 1MLCA 4TVPD 5FA3A 1OF0A 5GZNC 4PRHE 4NSKB 4ZAKA 3ZHLA 4N0UE 5DWUL 4XPGH 2Q5BA 5E94A 5FO9B 3ZDXE 2IPKB 1R9FA 1USQA 5DYFA 1UH2A 1R3IH 4ZK8A 2KC0A 5CGMA 4JQVA 5CJBA 1ZPUA 1LHZA 2IXQB 1NFAA 3D50A 1KC5H 5A2JH 2Z31C 1A4KB 3M1OA 5A2FA 1R24A 2GY7B 4XWOC 4TNVK 4O9HL 1OQOA 1ZV9A 2XU9A 4PJIB 3EHBC 2YAPA 1JHKH 5EUOE 1QSZA 4MDJB 4MS8D 3DK0A 4KRPB 1M1SA 4X8GA 1GCFA 5DFAA 4EO5A 2V37A 2XIDA 3D06A 2WZAA 1LDSA 1T3FB 5E5UB 1JPSL 3SBQA 4V2BA 1XIWA 5HJ3B 5C8JB 4F15C 1Y0LB 2X4TB 3HR5B 2I85A 3L13A 3ZE1B 1KUMA 2P8PB 2WLZA 2PWHA 3CC5A 3EO1A 5GISL 5J7CC 1T5XB 5DVKA 4HMEA 4JKNA 5DZOA 3RJDA 3CVBA 4H2CA 3L5HA 5L2KE 2F8OA 5C09E 1BG1A 1FG2B 2ED8A 2LE9A 1R3LB 5HY9B 4JDEA 4CMHB 2R59A 2BHFA 2UYLA 2DYPB 3NGBC 4L48A 1YAIA 5HDBF 1HEJC 1X9RA 3FQUB 3QJQB 2ARJQ 2VJXA 5I26A 2A6IA 5SWQB 1BF5A 8FABB 3L48A 1MHEB 3G08A 3H3BC 3T08A 3TJEL 4G80B 3OV6A 1R3KB 2CM6A 1AS6A 2VH5L 3OKNB 3CH1B 12E8H 1EAPA 2I07B 4HLJA 4NFCA 1UB6B 3IFOA 2AJXH 1QFWH 3LN5A 1EXUA 3U1SH 3MRBB 2AV1B 1CU4H 1E50A 3BJLA 2Y0SA 4X7FC 4GRLA 1IAKA 4XBEL 5GS0C 1QUNA 1SEQH 1JXFA 3W38A 3PF2A 1A6ZB 2F5AL 3VI3B 1M1XB 1ECYA 2DQJH 4JFFD 5IT2H 2DM2A 2R2CA 1G6RL 4KVCL 3PHOA 1NGXB 2APSA 3LIZA 2AXGB 3Q48A 4MNQE 2V3EA 3OB8A 5C0AD 4JRFA 4R3SB 5IG7A 3V9FA 1I9EA 1AE6H 3GKWH 4TPRH 4ZFOL 5ERWB 4ZTPH 4MD5B 4N85A 3T4AC 4GSRA 4BSJA 1SXCA 4PJCF 4OZHF 4WY7L 4W68A 4AT6A 3IMRA 3MUGB 4OJEH 3WN5C 1OF2A 1NFDF 1LMIA 1QHPA 4GFXA 3V0DA 3WTYA 2J1XA 1DQJB 3ARFA 1T0PB 4N9GB 4X9IA 5K1VA 3CFMA 4LPYA 1FFOB 4XPHL 1YQVH 2ZCHL 3DX7B 2XN9E 3O6FA 1LMKA 1IC4H 3LV3A 5JXAL 4X5WA 3U9WA 1R1CA 4RZCB 1WAEA 1QLRA 2CR3A 3OB0H 5C0NC 1C16B 1EK3A 1G0YR 1A7RL 3E7JA 4EDXA 2Z8SA 4OR1A 5DDHB 3LXCA 3FRPA 5IB4A 1BA9A 1NAML 2XWZA 1HHGB 4PJFA 3NFNB 1XFPA 2B59B 1AKJD 1VADA 4MAUL 1HKFA 1CGYA 1OO2A 1BM3H 1UM6L 3VD2A 1HNFA 3PHSA 2A77L 4GAGL 4I77H 4ONFH 5I8EA 5D72L 2AJYH 5T5FA 1ZT4B 4C4UA 2IBBA 2VM4A 3QCTL 3QUYB 2CQVA 2E9WA 2A83B 2AEQL 5ELIA 35C8H 1V8HA 1TIUA 2MMXA 2BSRA 1OM3H 5E03A 5HVWA 3O11B 4IGBB 4MASA 2W07A 1EHLL 2VJ8A 2R39A 1I8LA 2XBTA 4FFWC 4KJYA 4NCDA 4OD1H 4U1SB 5TD4A 3LS5L 1L9QA 3M8OH 3UPRB 4B0MM 4QHMA 1CE6A 4S2SB 4TNGA 4ZUWB 5IBTL 4AYFA 5CN2A 4XHJC 2O72A 4QRTB 4QXGL 2PO6A 3II2A 1AZCA 5I75B 4DK5A 5D7LD 1I1RA 4IKIA 5CP7B 2A73A 4CA4A 2XI9A 3TNMB 4EPSA 2XA8L 3OR6A 4LVNC 3HBPA 1QKZL 2H41A 5D4QA 3U46B 1JOIA 4F93B 1OPGL 1BX2B 4IMKC 5FCUH 2H0EA 3OPUA 2F58H 1BDYA 3FONA 1QLEL 3QDME 4JN1H 5L88H 4F33A 4J6RH 4E0RA 4MRCA 1BAGA 1ZY9A 5HGDA 1VEMA 2CKBA 4AQOA 2HT4D 2E9IA 3H9SE 4MX7B 4ONGL 4KI5D 3UTTD 3OMZA 3T0BA 3LZQA 4MYWB 4K3JL 2BDNL 1BJMA 5E9DA 4ZTEA 3UJIH 2IV9A 4G6JH 4ERSH 4QT5B 4FG6D 2ZYHA 4MVBD 2DI9A 1FFRA 3WLWD 2CHZA 1QQDA 2YPLA 7TAAA 1TFHA 2JB5H 2CIIB 1NBVL 2HG0A 3BUDA 3GHPA 1Q38A 4R0LA 3T0AA 2JB6A 4ODWB 4U0QB 1ROCA 1FE8L 1AQDB 1I3RA 2DB8A 1KJ2A 3KBEA 2YA1A 5IHUH 2XPYA 1T20B 1QSED 1DBAH 3IDYC 4NIKB 3DLQR 1XGTA 1WZ1L 3QG6A 2ADIA 3PHQB 3S37H 1LEKB 2JE8A 4P59L 4PRDA 4ZMQA 5AW5B 5H37A 2OTUB 3HC4L 4UV4H 1KYDA 1JWUA 2J1YA 2YBGA 1S8DB 5K9OA 1U91A 1J86A 2BHUA 4Y9BA 2F7IA 3MV9B 3QNYA 1YMMD 5ANME 1OWRM 2ZIDA 5CHNB 1A1OA 1NCOA 4JRYA 2YSSB 5GS1A 4JB9H 1NDGA 3DDGA 5IV2B 4AJ0A 1TPXB 2BY1A 5CSBA 1XL4A 5C2UB 1QRNB 1QRKA 3P9LB 1J9RA 4TNEA 2OAAA 4AV0A 2NY1B 5K1NA 1YEEH 4LASL 3P30L 3Q44A 5D5MA 3T0EB 4TOYL 4IOFC 4U1LA 3AU1B 3QEHA 1OLLA 2L04A 2ZOLB 1S7WA 1S5IH 2ZD0A 4HIPA 4FQXB 2KL6A 3NIFF 1Q9LA 3B83A 3DX0A 4GBXA 4R4ND 3RWJA 2GAZA 5TE7L 4HHAB 3UCRA 4DUXA 1WEJH 2HLEB 5FYKL 1PZ5A 2Z91A 4JM2D 3S5ZA 2IH9A 1IAMA 3GM8A 3KPRD 3RVWD 4JRXE 2FJGB 1I7RA 4LHUA 1NEPA 4S1QL 4K7FB 3V4VB 5C0EA 4BZ2L 2XWJB 3TIEA 1A1NA 4DHLA 1YY9D 2K3TA 1KB5H 4HGWA 1IM9D 2XKNB 4PB9H 5JHMA 3MLTB 2CNYA 2HVBA 3PQYA 3EKCA 4R83A 2VNCA 2EIZA 1YECL 2I9TA 4U1GB 3GMLB 3US9A 3G6JF 2K78A 1SYVA 3DO7B 1EFQA 3GUFA 4MJ5A 1GYCA 3M07A 5CZVH 4JW3A 4YZFE 4DGUA 4WSGA 4K73A 4E9RA 4KTGA 5I82A 3BO8B 3UYPA 2F19H 3VXMA 1UD4A 4Z7NE 5F96H 3VI4E 4X7DC 4YFLI 5F71A 2DJSA 4OZ4A 5E7FA 3QWRD 4F27A 1LK3H 2AJVH 2RFXB 1D5XB 4XB8A 4HCRA 3BGAA 2YD6A 4PJAE 4BH7A 1Z3GL 3KVDD 4HWZB 5EDSA 4G8GE 4LCCA 4QDGA 3SDDB 1AXTH 1NCNA 1YC8A 3QZMA 4DWHA 2Y7SA 3IFLL 2G0KA 1F6AB 1G9EA 1H9VA 1FCCA 2R8SH 1U8KA 4ELKA 3VB9A 4P4RA 1WZAA 3MRIB 2P26A 1OGAA 3B34A 3RP1A 5D2NB 1LO0H 1M42A 3C5ZA 3DSFH 3FUDA 3QIUC 1DL7H 1E30A 2FQDA 3LZPA 4Q9RL 2ESVE 3KR3H 1GMIA 4KXCA 3VQ1C 4NBZB 3F58L 3ZIMA 4QI3A 5E8NB 2DWDB 3HC0A 4H4NA 1YEDA 5FA4B 2OTPA 3B37A 3J8F7 3ESNA 3K1DA 4QEGA 1ZDQA 2NNRA 1UADC 2VSKB 4GQPH 4GQ9H 4R5VA 3D0VA 1AHKA 1N6UA 1PZBA 1UZ6F 2EDTA 1NUDA 3D07A 3GEWB 4CJ1A 1UG9A 4I5BB 3VG0L 3KPMB 3V7AE 1QYGL 2DQEH 1TMQA 3LPPA 1CFNB 5D1ZD 5ESQA 4OF5A 2XG4A 4IHBA 4N2IA 3B3BA 3FN3A 3S98A 4HLZH 2KBGA 3QDJA 1A7NH 4JFYB 1AO7A 1I85C 3ELQA 4WTZG 4XP4H 4U6TA 1A4CA 4HSQA 4X2UA 2SEBA 4BFKA 5T8IA 1NGWA 2FGWL 3F7VA 3D33A 4EJ1C 1P7QA 4LCYA 4HAGA 3ULSB 2HLAA 3KPLB 3IM1A 3L9YA 4PRNB 2WN2A 1GGCL 2VLRA 1Q90A 4PJ9B 2WLJA 1QA9B 1FNSL 3OJ2C 1I9IL 1U8IA 4CSSA 5K9KB 2OQJB 4OGXL 4GW1B 1THCA 2AJSL 4JFDA 4Y5YB 5D71H 4NC2B 3B1UA 1TQSA 3JV4B 3QHFH 2WB1A 4LSUH 4B9CA 5GS0L 4NJAH 3HG4A 4LEOB 4FQ1H 3UH8A 4DZBB 3NIDF 1FYTD 3KXFA 4F57L 5IESL 1INEL 4PJDA 4ZPVB 2H45A 1T4KA 2XZAL 4A2LA 1O9WA 4JFEE 2EDQA 3QQNA 2BWQA 1GXEA 2C1PA 2ORBH 4EI6A 4WSJA 1JPFB 4JN2B 4CBZA 1EZUA 1U33A 4IDLA 1GZPB 4NT6B 3S3SA 3VXRB 4LPTA 4P3DA 1S9YA 3W0WE 5EH1A 3FOMA 1IT9L 1BQHG 12E8L 4AEIH 5JW5A 4P4KA 2AJXL 2F1AA 1PX4A 3U1SL 4X6BA 1CU4L 1WD9A 2C3VA 3MGAA 4WI7A 4YLBA 3HFMH 3GMNB 2BW4A 3ROLB 3KH4A 5FHAH 5LAPA 2BCKA 3ARDC 4D0BB 1F4YH 4PWEA 1YUHA 3VRJB 2HXAA 4PJBA 3MGTB 5IT2L 1XF5B 5FKAA 1FCGA 4NWTL 4YPGB 5IW3A 3GUTB 3QRBA 3V8CA 4PRPE 3KG5A 5AOIA 2DLIA 4NEHB 3QIBC 3X3FL 1YN7A 3NACH 5DURB 3WAJA 2WYIA 2JLPA 3BPOB 4NX0A 2YAFA 2K3HA 4K3GA 4I0PD 4M48H 4BDVA 3SPGA 4ZDHB 2XBZA 1W72H 3CZLA 2QSQA 1UATA 4XBMA 4HH9B 4YVUA 5AAWA 1YPZB 1H15A 4RX4D 4KMQA 3AQZA 4WWKD 3TBVB 1RZQA 2BSEA 1T04B 4PB0L 1IC4L 5CCKH 4XC1H 5DK0B 4QYOB 1G5AA 4PW3A 5LDUA 4B96A 1USZA 3L5XH 5A40E 3FU8A 3F01A 3HE6A 2OMVB 3BH8A 4YFDB 1Z9SA 4AYSA 4MAYC 3E38A 1NLDL 5KAQF 1KTJA 3GNMH 2E4FA 4YDIL 1IAIL 1T1YA 1IGMH 1TYEB 4M5TA 5CU5A 4KQ4L 4P5MB 4FRWA 3SKOA 5I71C 5GGUB 3ILQD 1BM3L 3EOTL 1EEYA 5I1DB 2F54D 1G84A 3E0GA 3I9PA 1KXTA 2BP0A 4OV5B 1OP5H 4ONFL 2AJYL 1HU8A 4HSAC 1GGIH 2J21A 3AADB 2OBGA 4XNDA 2ICWB 2Q7YB 5ENWB 2F18A 4FTVE 4UT9A 5DK2B 35C8L 1AD9B 3IJEA 5MHSD 2R2EB 5F8RC 3L7EB 1NMCC 4OGAC 1OM3L 5GZOD 1QMUA 5HYJA 5FPIA 2OL3H 5DEZA 4ALAH 4LCWE 3MCYA 1J11A 2Y9RT 5B1AB 1BIHA 1IBDA 3ZT5A 1QSVA 1QFUL 2VR6A 1D5RA 1NC2A 4MCZA 3BKJH 4W9JC 1QPKA 1KTDA 1XH0A 3VCLA 1QEWA 4KDVA 2IPTL 1T22A 6TAAA 2AITA 5AAMA 3U7WH 5TTRA 2GIXA 5FO8A 2D03H 1BFTA 4HIIA 3IDIB 2IPUG 1WAAA 5DYOB 3GT6A 1Q94B 3DRQB 1YEHL 5F1IB 2LV4A 3X1GA 2H3NA 1AGEB 4GFTB 2K0RA 4JN1L 2WANA 2C9VA 1DSWA 4A2EA 3EOAB 1IC1A 3PJSA 4PBWD 3ZDXB 2JKIS 4DP0X 2YJLA 5ID0B 3O8XD 2F7QA 4Y19A 4NO3B 3OXSB 2WZ0A 4HK0B 5I74B 4ALAC 4GUQA 3UJIL 1TJGH 4G6JL 3K6NA 2PR4H 3FYIB 4ERSL 1PJWA 1XH3B 3F6JA 4YXHH 1WWAX 1NC4B 3PUCA 1YEFH 4G9FE 1AD0B 1S7SA 4WWKB 3QNXB 3QWOA 2HVKB 4IIQB 2R4RH 3WUWB 4OM1L 3HN3A 5D9SB 2Y25A 4NFDA 5IREA 2GUYA 1KCKA 5CXPA 3TYFB 2BNQD 4Y1AA 3BAEH 1JV2B 2DS4A 2WQXA 4C83B 2ZUVA 4ZX4A 4NC1E 1Q0XH 1DJSA 3UBHA 3EYOB 2X7LB 3GO1L 5KYXA 3VWJC 2UXFA 4UTBH 3CFDA 1JVOA 3CMOH 1DQQB 4HUVA 2HAZA 4LU5H 1R6VA 5BRZE 2IMNA 1P5VB 3SOTA 1EEUA 4JB9L 5DJ8B 3UABA 2QADD 2VISB 5DVOA 5C0RL 3CDGB 1MVUB 5T3XE 5IJKC 3D51A 1JZFA 3KGUA 5L2KB 5EIQA 5C09B 1S7TA 4HU2A 3Q2VA 5B7EA 1DN0B 5E6IB 1MELA 4WO4C 2HFEA 3KLSA 3HB3B 3U6RB 3AREA 4GH7B 3DMMB 1R5VB 3BZ5A 4GJTB 3MV8E 2AF2A 5HGBA 4PJ7F 1RK0B 2BFVH 1S5HB 3RWFA 3SCMD 4OH2A 5DF0A 3MLPA 4FLRA 4OJDH 2WSPA 4D9RE 4ZUTA 1J5OH 3MKKA 1C8PA 4U2YA 2X2UA 2FO8A 4OGQC 4JZJC 5D7KE 2FJFA 2ZG3A 1T2JA 3OKDA 4Z7UB 3II1A 4ZZFA 3ZTNL 1X5MA 3ZX1A 4BQ9A 1LE5B 2FEDC 1G7LA 2H0FA 2PETA 4K23L 1WBXB 5KSUB 3CFKB 1LO2H 3TBSB 4GRMB 3RWEA 1CDIA 5BZWB 2ZPKH 3HOGA 5CZVL 4MNQB 1RURH 1A7BA 1FRGH 1XR9B 3G5VB 3IGAA 4M7ZC 5AQ0A 4OTXH 2EKJA 4AVHA 5LGJB 2AVFA 1MFCL 1MG2C 3BI9X 1JNLH 2LU4A 3OL2A 3SGJC 4Z78B 4C56D 1B0GA 1XGPB 5E00A 1D7FA 4DEWA 2ERJC 2WOBA 3VYNA 2F68X 3C8KB 1LK3L 4WSKA 1JZJA 5IHBA 1BWWA 2PXYD 2QMJA 3L3GA 3UTQB 1U21A 1W0VB 1AXTL 3FUEA 4OJAA 3BH4A 3QXAB 1IEHA 3MBED 3MRHB 4CC0A 5E51A 3B9KB 4RH4A 2R8SL 3THML 1MJ7L 2JTYA 4L4TE 1X5LA 1UKSA 1F86A 4QO1B 1WFOA 1LO0L 1SF5A 4I3SH 3HZ3A 2Y7MA 4RMTA 3SYOA 3ZUNC 3MFFA 1KB5A 3DXAE 4WFHE 5IM7A 4KRLB 3VFGH 5L0QC 3ARPA 4E9SA 3FBKA 1XCQA 2EVGA 1C12A 2P9RA 4CGUB 4FCHA 1ZWIA 5EIIB 2UV3A 5HHOE 4UQIM 2JCWA 3IN2A 3MRNA 3KNBA 4GQRA 3KH3A 4AK2A 2DQEL 2KPNA 1TU2B 3LKOB 1KWGA 5SV4A 3IFPB 5F6IC 3KMDA 4G82A 4H8QA 3SCMB 4YE4H 2EUXA 3N1QC 1A7NL 3QQ3A 4GOSA 1XZ0A 2BSTB 1LDPH 5EA0L 4FZEL 1ADQA 5IQ9A 1E9PA 5CEXB 3NTCH 4B9IA 4ZQKB 3OKLB 5HYSA 1CFSA 4HS6A 5FM5M 4G8IA 4E9TA 4NENB 1DZ0A 1KTKE 1KYFA 1S7RA 2AI0H 4YHZL 4JGNA 4DP6X 3RFZA 1IE5A 4EI5A 1JF1B 1AQHA 3FQNB 2ZXEB 4PP1C 2OTWA 3UC0H 1K4CA 4MNGE 4V1DA 3GMMB 4QXWA 3UO8B 4XT1C 4LSUL 3Q2CA 1XF1A 3B2VH 2X09A 2Y5TB 3QDMB 4N22A 4KX9A 3OJDB 5HDLA 2PN5A 4QHNB 4ZUUB 3VRLE 2HT3D 4LRIA 2WLIA 3H9SB 4JCWA 5IWLA 4P2AA 1IQDB 2WQRA 2YEZB 3BMWA 1M4KA 5IB2A 2ID5A 3IT8D 4U4IA 1TT6A 5DT1H 2JKNA 3CVHA 1Q0YH 1WFJA 5AYQA 5EZLA 1VKXB 3BEWA 2V2TA 2JMRA 4J12A 4TQIA 1JGVH 4D7PA 2ALAA 2ROYA 1BVOA 4NHUA 3ETSA 1XEDA 4O2CA 3DTDA 4N86A 1P7KA 2WZPA 2FJSA 2V9QA 2B1AH 2VIRB 3MBEB 4LO9A 2VDQL 1ZLVH 3V2AR 1BSIA 3VVWA 5AKSA 4E9LA 5B3SB 2BIQA 3OKOA 5EU5A 2AQPA 3S37X 1B4RA 3N0AA 3WJJC 2Z4TA 1FVEA 3TVMA 2BVUA 2NCEA 1G9MC 4ZSOB 5ICXB 3HFML 3NRPA 4GW5A 4LEEA 1QR4A 5T1MB 3ARUA 5C0FB 3OHXA 2IO5A 4ZNEE 5ANMB 5DRWA 2AEPL 2WKGA 1B90A 4CW1B 3ESUF 2JI2A 4P2RA 1U95A 2N4IA 1E4WH 4ELDA 4FQQB 1XSOA 1U8QB 1J8HE 4X80H 1NJ9B 1I3VA 2JV6A 3O45A 2IADB 3C5XA 4LLUA 2C1OB 1WYJA 3KPPB 4AMXA 3BQUD 5IK3A 3RVXD 1MQKL 5FYLH 3F64A 4R4BB 3MN8A 5EB9A 4TUKH 3R4RA 4DNLA 5ILTL 3IMTA 4HIJA 4Y2DA 1Z3RA 2P24B 4HSCX 1DUYB 4N2GA 2IBZX 1OB0A 5BNXD 4QAMB 5L8KB 2DWEA 2EKSB 2N0MA 3GNML 2HLFC 2ZCZA 1ORSB 4P57A 2OKMA 5IUCA 4PJ8B 1IGML 1F56A 2A74C 4ZXBC 4LLYA 3ZIYA 3WXWH 5EU3A 4B60A 2CKNA 3HUJB 3L17A 1A14L 3UYOD 3K6SA 1OCWH 1WICA 1GOHA 3H53A 4KJWD 5DS1A 3V4PA 1NDMB 3O4LA 3DPDA 3L9BA 4MNHB 4PG9A 4KK8D 2EAEA 3KPSD 4WJ5B 1QR1B 2ZAHA 1FVCB 5DHVH 4GINA 2OL3L 3DOIA 4F7PA 3B2DC 4ALAL 3TCLB 4MA3A 2X4PA 2VZVA 3MRCA 3MO1A 3TOPA 2LOEA 3FH7A 4Z7WE 3DBXA 4P23D 9CGTA 4NKDB 4N5ED 1T2QH 3L2LA 1W72A 3QPXL 4LHUG 3DSNA 4N1HB 3QHZH 3ILEA 5H2BB 1Z5LA 2OLDA 1IB5A 3BH9A 3K2KA 4MJ6B 1F13A 3GLZA 4PJAB 4FJYA 1MIMH 3QEQA 3BE1L 5EU6E 3GSXB 2FYYA 5AVWB 4JAMB 3AXHA 2E5EA 3VGHA 1EAOA 2DLGA 1KB9K 1OV8A 5FUZL 5CBAB 1DO5A 5IW1A 4Y16C 4J8RB 3U36A 1YNTB 4JFFE 3CXHK 4HJIA 1UH3A 1AG6A 1MH5B 5ABAA 3SJVA 3BIKB 1IC0A 3EUDA 5AOKA 5C6TH 1PY9A 2GW5A 3NCXA 3WYRA 1PYWB 2ESVB 2LAGB 2IDFA 4FJ6A 1SEBA 5DMGD 2ARJB 2QQLL 4FADA 3T6WA 2P80A 4OZFH 3LKPA 3SDCD 4F80A 3C6LB 2ZWNA 4YXHL 1X44A 3RIAK 1FNFA 2NCMA 3Q6FA 5K1JA 2ZNXA 4FXGA 2ZXCA 5CD5D 5AOMA 2Q76A 4Z7VA 1ND0B 3STBA 4JFPA 3NJIA 2E9GA 2OK0L 4B9GA 3UTPE 1IC7L 3WJMB 1PDKB 3DX3A 4M5ZH 5KOMC 1YDPB 1JHTB 4P2OC 1M56B 1X5GA 5AG9A 1BQLL 3BAEL 3NA4A 4H20H 3P69A 3ASOB 2VR8A 4HZLB 2AJZB 3VXUD 3F7RA 2X12A 3IAQA 1JGEA 1U8CB 3RUGB 1L9MA 3UG4A 2ADJA 3IJSB 2VWEE 1OD9A 3OAWA 2BIPA 3CMOL 4HDIA 4OFYD 4RDQG 3PWVB 4X6CA 3ZKXC 5I17B 4F7MB 3MUHL 2R2HB 2O6EA 3OKEA 2E7HA 1EGJH 1S9VB 1E3XA 3V6OC 5F1KC 3VYPA 2ENPA 4U3SB 1I1YB 5TFSH 3V0IA 4L29A 3HE7B 5IFAL 2P5ED 5CJXC 3FT9A 3AG2B 3TO2A 4WI8A 3EFOA 5F7AA 1U3HB 1C7TA 4UMGA 2X3BA 2AQTA 4JFEB 3HS0A 4KGJA 5FIEA 5KW9L 3IAGC 4E9XA 4O58L 4AQ8A 2BFVL 2BS9A 3OPZH 4X7CC 5D1XE 5BMFH 3S4SG 3WKYA 1JK9B 4M7LH 4XNZB 4DGYL 3QJXA 1C08B 5KYUA 2Y6SD 2DN7A 4FQHB 4DZ8A 1MCDA 5HHQB 2BNRD 4U1HA 1ZS8A 2G75A 3T6XA 5E08H 2G2PA 3TASA 2IIJA 5CBEA 2H6PB 1NCWH 3S3BB 3BVUA 3LVTA 4NDMB 4NN5B 4PRBA 2VJ0A 1U3ZA 3CNKA 2J8UE 3OR7B 2JJSA 4UIMB 5IB3A 3UTTE 3WXVH 4KI5E 4LVHC 4X9HA 5J6GB 4ZFZA 1L7TH 4X8CA 4AEHH 3DVGB 1MI5E 4I48B 4UTCA 1FRGL 4GLRH 2I27N 2VL5B 2NXZB 3HTLX 3MSPA 4JFOB 5DD3H 2W81C 2VM3A 2CXKA 3TTYA 4LCUA 3ZE2F 2V17L 4ORZC 4TQPA 4YHMH 2FR4B 1O7DE 1I8IA 1FC1A 5BVJB 1MRCL 3CIAA 2VW4A 4GP4B 2GJ6A 3MVSA 4OD3L 2NX5A 4LSVL 4YUEH 1T7XA 2ZKHH 1WGOA 2EEAA 3FCGA 3QORB 2XTLA 4MB4A 4N8UA 1Z9LA 2R0LL 3FCBA 3O2WL 5F9JB 2GK0B 4YDZA 4B9FA 5I1JH 5F88A 4MJIA 43CAB 1KLGA 2CLZA 5HSFA 1B0IA 3MI6A 1YMME 2VRKA 4TRPL 3SPJA 2YLHA 5INCB 1SUHA 1XR8B 1E67A 1S9WB 4PGDA 4Z23A 5F7NC 2HFFA 3UO1H 4LMQE 1OAYH 4J3OH 2HJKA 4UQ2B 2QR0B 3GMRA 3BN9D 1A9BA 1CDUA 1KELH 2R51A 5HI3C 5GRVK 1OT2A 4ZO7A 3K6DA 3GD1C 2WBXA 3KD4A 1RIUH 2P5EB 3EH1A 2KDYA 3IDJB 1Z6JT 1A21A 4XB3A 5AYUH 1HE7A 4ODTL 3FO2A 3MRLA 4PS4H 5HGAA 5T1DH 2EDWA 2VXQA 2WUCH 1PLBA 5ECJE 5F89A 5EUKB 1K8IA 3QUXD 5DI8B 2NXYD 4YE4L 2OJ1A 4LCWB 1KYAA 2QQQA 1ETJA 1CDCA 1S2EA 2CO3A 2FK9A 1OOAA 3FCTA 4A7UA 4RGMC 2DMKA 1CXLA 1FLRH 5KVDE 2HTLD 3L3OA 1LDPL 4GMSL 3UBGA 4NUGH 3GB7B 2DM3A 2VC2B 2YQ3A 3NTCL 2XTSA 2RBLA 4TNVF 5B39B 1MHHA 2XV6B 3FQRB 2EH8H 2X70B 3J7HA 5DQ9B 4L0ZA 2AI0L 3LKNB 4J3UA 2BOBB 1SMOA 4WHYG 4N28A 3UC0L 5I18H 1EMTH 1G9ML 1YYMH 1G1CA 2LLNA 3MJ9H 3QNZB 2OP4H 5CEYB 1WD8A 2WP3T 1M6UA 3G6AA 4N68A 5CKAA 1OGTA 1EX0A 5I0DA 1UEMA 4JNXA 3PL6C 2FT8A 1T66D 2P45B 2X6MA 1ZMYA 3L9EA 1GYUA 2EXYC 4NO0A 5FW6A 3O4OB 7FABH 4V33A 3AXIA 4MLIA 2PP7A 3UCQA 3DUUA 5IVXF 3FU9A 3A6OA 2VQ4A 1AFVH 4UU9B 5IW6B 1EJ6A 5T1JA 4G9FB 4YDKH 3AWGA 1SHSA 3WIHH 1T1XA 4MMXB 3HG1D 4HX1B 3SGKC 1NBCA 2WAHA 2FNBA 4DERA 5CWSA 3TJPA 4IBUA 4LHQB 3AWEA 1AANA 3IDGB 5I1IH 4M6OH 1TNNA 1N8ZB 4A7TA 1HI6A 1AIFA 1GIGH 3QYNA 5F21B 1QEXA 2W91A 3L7FA 2ED7A 4NQSA 4A6YB 4N2MA 4CU8A 4K0OA 3D3VD 4O02H 4Q6IC 2I60H 4R8WH 3V0EA 5CEZE 3T3MF 1XMEB 4XAWH 1KGUA 2FD6H 4X80L 1MHCA 4Q9QL 2YKLL 2CO2A 3QUXB 4QRPD 3B6SA 2NXYB 2VM9A 1MJ8H 5F9WB 4Y5XA 2HN7B 2NR6C 2FIKA 3GSVA 2WVUA 1KPRA 5IVZB 1T1WA 1EHAA 4L3CB 3CSTA 3MV8B 5IOPA 3NFPB 5FYLL 3RWDB 4IBVA 2GTZA 4B97A 1DFBL 3V5DB 2BERA 4LMQI 4K3DL 3VD7A 1HHJB 2X5PA 2HUHA 5LWYL 1ET7A 2A7BA 4UT6L 2X4OA 4MDIB 1LWJA 3B7RL 4JZNA 3CX5K 3FN9A 2EVIA 4UB0H 3CVCA 2DI7A 4PJFE 3T4YB 3MX0B 2OMZB 2QSTA 4Y2LA 3KDMB 1BVNP 1RSYA 1Z0NA 2W9DH 3DYOA 1VACB 3LRKA 3INOA 4WI9A 1H5BB 1OD7A 3WENA 2OSLA 2R0KL 5GJTH 1OTTD 3TTSA 5KOVC 1UZGA 3QUMH 2P49B 3MDJA 1E28B 3F04A 3AS2A 4ZOBA 2J8HA 1BYPA 3WUZA 4XP1H 2UZXB 3AJ7A 3VU1A 4AGNA 4S1DD 2Q86B 4HPOL 4KUCF 3IS0X 3LEYH 5DGRA 3NJKA 3MA7A 5EF1A 5EO9A 5TJWK 1LD9A 4WTXA 1E5UI 2FYVA 1CFMA 1F3JA 1P5UB 2X4QB 2WXGA 3MYZA 4UYQA 4BCZA 4I7ZC 3LS4H 1XB6A 3QHZL 3SE9L 2VLKD 4KTYA 1CVRA 4B0MB 4XCNA 4TUJB 3FSOA 1K8DA 4WI5A 3TZVA 2EC9U 4TUOB 4BWWA 4I87A 5AW6B 3D05A 1NBZA 3FAXA 4DK3A 4BQCA 1K6QH 1D6VH 4XP5H 3FFCA 4PWKA 4Y4HA 4I0KA 1F11B 3ZDZE 3DX9B 5D4HA 4X7SH 3F3HA 3OGCB 2PKDA 4GIPD 4XVUD 3H2PA 5TK4A 2KZBA 3BZ4B 5D6CA 1QUPA 2FAUA 3VDBA 1H8SA 4MB5A 3K4AA 5I76B 5C6TL 3HG5A 2A3TA 3QEUB 3DXAB 4KRPC 4AQ1A 1N6QL 3ARBA 5DS8A 2D7QA 5TQ2L 5K9JH 2P3YA 1J10A 1BF8A 4GB9A 5DRZB 3TFKC 3RB7A 1FGNH 3I6GA 4HYTB 2C3HA 1MRDL 4CL7A 2AEIT 2Z34A 3PDDA 5KVDH 1LGVA 5IF0A 4LNRB 2JJVA 3INUH 1MCEA 4TVPH 5B7MA 1JFQL 1MXDA 5FGBA 5HHMD 5TH2B 1A6VL 1EFXB 5DHVA 4KNUA 5JHLL 4PYHA 3IJ9A 1L9NA 1DVXA 4M5ZL 4C8XA 4LXFA 3MRDB 2XQBH 3QUGA 1PLGL 1UWXK 4CMHC 4PHXA 3TA3C 1CLOL 1IU1A 4PJIF 5DJ0A 3C5SA 1BOGA 1NGPL 2XWBA 5FLVA 1GHFL 3FZUC 4JGMA 5JXEC 2A4CA 4X0KA 3O2DL 2HH0H 3UAFA 1JXJA 1NIAA 5HHNA 1PLAA 5ISZE 5JHDD 4S1RL 4BRVA 5D1ZI 5GGVH 3QDAA 1MFDL 4MNGB 2AHIA 1A0QH 2Z93B 4JGJA 5C9JA 2J1KA 1XGYL 2J71A 3LTVA 1M9SA 5F6HI 2ADGB 3LB6C 4N90D 3ZE1F 1PGRB 2D73A 3DNKA 3O2VL 4I1RA 5D5ME 3O41A 1CGSL 5I1AA 1RIHL 2YA0A 2IAND 2O93L 1OAKH 5CP3A 4AIZB 1QWHA 3MMEA 3ZKSD 4AM0A 2WLKA 2IC2A 5BMFL 3DVIA 2CUHA 4YEEA 3ULVH 4KO9A 3U0TB 3IPBA 4RFOH 3HZVB 3O3EA 5DRXB 1F42A 4J39A 1I3UA 2YD3A 1L6ZA 3RZCA 5E08L 1E3ZA 1E42A 2AK4D 3PQYE 4WAFA 4NKMA 1JPEA 2NNFA 1HCYA 3ARGB 3KWUA 2ICWI 4R7DA 1Z9MA 3GWJA 3QIWA 5I8CB 1KJVA 2DIBA 2XPZA 3ZKNC 1F2XK 5FKPB 2K7QA 4YDJB 1CD1A 1WGVA 1L7TL 4UM9D 2MCAA 4DGIL 1A4JA 4RETB 3N43B 3CWGA 1HWHB 4RAVA 5DD3L 1GTNA 3TBTB 3RIFK 3W82A 1A9EB 3VI3F 3QJFB 3VXME 5B8CA 3DV6B 4YBLB 1H6EA 3O0LA 1HXYB 4OCMC 5LG1A 2XYCA 5D96B 5EDXA 1J0KA 4KZCA 4LOUD 5LNDA 4XCYA 2BNQE 4YUEL 5CSZA 2PLTA 3GXTA 1GZQB 2ZG2A 4GT7A 5D7IF 5DO8A 3BP6B 1SN0A 2J20A 1ZLEA 5JNYA 2Y5EA 1RZFL 3QUYC 4MA7H 2WNXA 5I1JL 3DTXA 1VENA 3U48A 1OGAE 3KYNB 5DFWH 1T6VN 4XP9H 4IGBC 3D85D 4X99A 2ALWA 2YMOA 3HG0A 1ZVSA 2FBOJ 1TJHL 5F9OL 2Q1EA 4YGVA 4AQEB 1OAYL 4JO1H 4P5TB 3RTQB 4PU2A 2OXGA 4Y4KD 4DO5A 4NO2B 4ADIA 1KELL 2PCXA 3EO0B 3MLUL 4FLOA 4Y4FA 3UGUA 5I16B 5I75C 2YMXL 1QZNA 4J23A 4P2QA 1JCKA 1OZTG 3CDZA 1URLA 4X8XA 3ETTA 4I2XA 5AYUL 4BYHA 2DJ4A 2X2IA 4PS4L 2CA4A 3D39D 3L16A 4AUUA 1AP2B 1X7SA 1UJ3B 3PYCA 2WUCL 1G6RA 2YN5A 1KTLB 3PDGA 3QDJE 4XN4A 4QF1B 1AO7E 1PMYA 3STLB 1IL1B 3ZZQA 5I6NA 5EORH 1E8YA 4ZFOA 4R26H 3K71B 1UXMA 3UGXA 2VYRE 2B3IA 4NUGL 4DN3L 1P2CB 3HPJA 4M4RA 7PAZA 1B4TA 2VLRE 2EH8L 4JHUA 1BQHB 4F91B 1H3UA 5I0XA 1N7MH 5EU6B 4A7GA 5DFVD 2OR7A 4JFDE 3IS1X 1NBYA 5I18L 1BVNT 3L5IA 1CICA 1M7XA 4JY4A 3M17A 1YYML 3MJ9L 2OP4L 1B4JH 1WCBB 1GY1A 2JKSA 3GSQB 3T0WA 1N4XL 4HUUA 5I15H 3N0PB 3I84A 3KXFE 4P46D 1WA2X 3MODH 5GHWL 1U0QA 1VEOA 2ITFA 1EHKB 3N2JA 2QDWA 2C3WA 2BZCA 2H32B 3BISA 3BUPA 2VKXA 3D48R 1XGUA 4C56E 2R56H 2DLHA 4NZTL 3SPVB 4U7KA 4X98B 3V4VH 1AFVL 4N2NA 3DC0A 3KPNA 4KXDA 4YDKL 2E7LC 3CFIC 4HS3A 1T83A 2JIXB 1XGQB 3WIHL 1HE8A 3U4AA 3WNJA 1VGEH 3NSJA 1G7MA 1TPXC 3D69A 4QXUL 2UVEA 4FNLH 3ISWA 4NWUL 3D85B 2AV7A 4KAQH 3QZPA 3TONA 4XWGH 2OMYA 2NY1C 3TPKA 3PFQA 5KJ4A 5EC2A 4FI7A 1RZGA 3AAZA 3SY6A 1JK8A 2FECL 1B0RB 2GTWA 4ZAKD 2XC8A 3WKQA 4D0CB 3ECWA 4FQXC 4LPWA 4W9IC 4R8WL 4WQOA 1ESOA 3SGEI 4R7NA 3CVDA 2BVPA 4C57C 1CLCA 3DGCR 3AW5A 3D39B 1T1ZA 3ML9A 4L3ED 3W39B 15C8H 4MJHA 1JDAA 4HALA 4I9WD 4LBEA 4ZX6A 4A2DA 4JG9A 5I1KL 4FFVD 3MOBH 4L5FH 1VLXA 4ENEC 1CO1A 5J0BA 4NCC1 4I13B 2WP3O 1KGIA 4PJGA 2R1YB 1RUKH 1PZSA 4UQCA 4M61A 2DBJA 2DQUL 2OFQA 2ZG1A 4TQHA 3NDYE 2P5WD 3V10A 1NGYA 5D7JD 3R4DA 3GXIA 2VCOA 5D1XB 1GAFH 4FG6C 1C5DA 4F2EA 4NQDD 3NYKA 4BCXA 1NCBH 2W9LA 3BUBA 3QJRB 5FOBA 4UB0L 5T3ZE 2H1PH 1AGDA 3ZRCC 3EBGA 1RH8A 1T0MB 3IMVA 1KFAH 3UP6A 5C07D 4WGKA 1ZVYA 3BZFA 5F70A 4GG8B 3WS6C 4FQLH 4FLSA 5I5RA 4ZW8A 2EYTB 2G2RA 3DETD 5EC1B 4TM9A 5GJTL 1VFOA 4WWOA 3SDDC 4CVZA 3Q8EA 5HYJE 3CSYA 1E9OA 1RZ7L 2NY4D 1NCUA 1B3IA 2C9AA 4XP1L 3FQYA 3UDWC 4F9PA 3LEYL 2Y23A 3FH8A 5D2NC 5CUSL 3PWLB 2Y2YA 3MBWB 4DCQA 1AXSA 3EH3B 3MRPA 4Q9CA 1J05B 4OFVA 1JYNA 2W0FA 3H3PL 3T1FB 1B6DA 2XZCL 3IDXH 4NHCL 3WNIA 4L8SC 4OZIE 3B2UC 2X1XR 4TQEH 4AE1A 2FWOA 2Z65C 3FCSB 2E7MA 2ZCKL 4GT0A 1WAAE 5I73C 3ECBB 2JNZA 2J6EH 2OSYA 4UDUB 1A47A 2BIIA 2UVFA 1MLCB 1S7VA 2A6DA 5FA3B 4X7SL 2ZCLH 4ZAKB 1MCWW 1PJ9A 2GUOB 1UXLA 5E94B 3ABGA 1IFRA 4UZUA 4E41E 1ET8A 1EZSA 5DHMC 3L3HA 2AK1L 1NMAL 4Q56A 3RVWC 2EECA 4PD4J 4F20A 2HKFH 5HVHB 4KHTH 5SWZD 2VXVH 3UIZA 1WTLA 1YZZA 4PRIA 3GMQA 3IPEA 3VGDA 5EZPA 3PJNA 1DEDA 3MJWA 1R24B 3VH8A 4QJ4B 3QUMA 5GZNA 2L7EA 4PJ9C 4TVPL 4FD0A 5KVEE 5GGTL 4U3HA 3MC0A 4GIAA 2YD5A 4Y5YC 2A9MH 2QKIA 3KWTA 3REWA 2CU9A 2JKWA 4Y1AE 3ZU8A 2NYYD 2XQBL 3GSWA 3MRRA 4NNPH 1KTRL 2N7SA 4PJ5A 4J4PD 3IFNH 4PLKC 4WI2A 4JM4H 5IZ7A 4ABVA 2IH3A 2P8PA 4LPVA 4PEEA 3JZYA 2W0PA 5EN3A 5E2UH 1XIWB 4TMPA 4DP9X 1OE3A 2NY7L 3CC5B 3EO1B 2AERT 1UOLA 2KH2B 5A6IA 2GFBA 4ZO6A 5FM8A 5IBUG 3TNNA 4A2GA 1RP8A 2C9RA 2BY3A 2X41A 1DVFD 1UCBL 4N0RA 2I32A 1CTNA 5C0BE 4NRXA 2CCLA 5T1LA 5JHBA 4IW4C 3ZOAA 4JDVA 4JDEB 3PXLA 2UYLB 3CSPA 4G7YH 1D5ZA 1HTYA 2QBWA 3A4FA 3HZYA 3MRKA 4LCIH 3SYQA 1N5YL 4G70B 5IMOA 1OAKL 3QUZD 1CUOA 2A6IB 4AX3A 5FLUA 3G08B 3IXTA 2AXFA 3WFCL 1HKLL 2JKXA 4YJZL 4ODBD 4BXSV 3RX5A 5AL8A 1EAPB 1NKGA 4RFOL 1E5YA 4UM8A 5KJRL 2PO6D 2Z8VC 3IFOB 3LN5B 4KTDL 3U6XS 1EXUB 2MHAA 3BPOC 3ZYJA 3EFDL 4BZ1L 1PD1A 1EO8L 4GRLB 5SX5K 2JELH 3L4CA 1QUNB 1YEIH 2ISDA 4YHLL 1FFQA 4ZD3L 2AXGA 2GQHA 4GRWB 4OCXH 4PJCA 3GLEA 3WMPA 1V3LA 1E40A 3PHOB 4JEGB 4MBOA 3X2QB 1NKRA 1FZKA 1ZA3A 3WKMH 4CC4C 5IG7B 2YAOA 1SOKA 4F7EA 3EDEA 1JD9A 2AEOA 3MYJA 5E9DD 4B7LA 2MFNA 5HJDA 6CGTA 2HMID 4HD5A 4AT6B 1OF2B 1U3YA 2QV4A 1BIIA 4I8DA 5LJYH 3T2LA 5EOTA 3RX9A 1AIZA 1ACYH 2YPLD 3QRLA 4BHUA 2LU7A 3F7KA 1SN2A 3ARFB 5JPMA 1DQVA 4HKXA 4A38A 5FWRA 3O6FB 3RY6A 4XX5A 3VSVA 1ZHNB 2D7PA 3CVIL 4QY8A 4DUVA 4X5WB 5GRWA 2B9AA 1AMYA 1ZLSH 4N0YL 1QLRB 3ULUE 1N67A 5AVRB 4MA7L 3CQFA 2E6QA 2Q0ZX 1HHGA 3D2UA 2RALA 2X9XA 2VXTH 4EDXB 3BUIA 5I6OA 1YPZF 4XP9L 3F5WA 3JWNC 3FRPB 3A4EA 5IB4B 1A8ZA 1R17A 4PJFB 2IPUK 2J7LA 4MMZA 2QHLA 3CFJA 3VD0A 1JDDA 1AC6A 1VADB 4NUQA 4PPTA 1NFIA 4NPKA 1UWFA 4WUUA 2UXVA 1P0SE 5DQDH 2VTFA 1I4FA 1J7VR 1JUFA 2AZAA 2VRQA 4LCVA 4XXWA 1MCBA 3B8YA 3CFUA 3U25A 3NN8A 2PW1A 5DJCA 5CIPA 1TZHA 2WTPA 3RL1A 4Q52A 2W07B 1TETH 4RMRA 2RGSA 4KJYB 2NTFA 4FNPA 4FJZA 4QHMB 1CE6B 2EDYA 3QFJA 4AYFB 4XZUA 4HLEA 5IQOA 3F62A 2YRPA 5EORL 2PO6B 1T7WA 2Z9TA 1PKQA 1NANH 4BELD 2NLJA 1F4WH 4J3WA 2APWA 5I74C 3DJSA 4UZGA 4FL4C 2AQ2A 3FSWA 1DCLA 2A73B 4IU2A 1DCEA 3OR6B 1TZAA 5BS0A 5I6XB 1LNUA 1N7ML 3JWDC 5KANG 4WWKC 3ZDZB 1WUZA 2EXWC 2A2QT 4IIQC 1EZVY 2Y3AA 1F4AA 3FONB 4F33B 3L1GA 5D1QD 4E0RB 5HGDB 4FHKA 1G7HA 4GI9A 3NP4A 1Q72L 4R2GD 5JDJA 2CKBB 5I15L 1MNUH 1KGCD 4PJEF 5E9DB 3X11A 5DR5H 5LCVH 2J56A 1E2VA 1UD8A 2FX9H 4QRBA 2YPLB 1QQDB 4M7JH 5JORA 1R5IA 5BV7H 3MRJA 5C7ZA 3V4VL 4OGYH 2Q9OA 1DYZA 2UWEF 3HVNA 3MJ7A 1OEZW 3O3DA 4C55A 2JB6B 3BSGA 3KS0J 5F93C 1J5CA 5AL0A 2EDXA 5CR1A 1RU9L 3A24A 1I3RB 1KJ2B 2NMSA 5LBSH 1EJOH 4EKXA 5IGXH 1XGTB 2CBMA 3QG6B 2ADIB 2VMCA 4HJJH 2YOCA 4PRDB 5C08E 3BEVA 2H3XC 4HZ1A 2LAAA 4KAQL 1F45A 3BAJA 5E6IC 1JWUB 2EACA 5K9OB 4PBXA 1U91B 3HB3C 3QNYB 4XNMA 4KHXH 5SWSE 3DMMC 4S0HA 5I1HL 1A1OB 1G4MA 2B77A 3ARXA 4JRYB 4WCYH 3EBAA 3E2HB 4OF0A 2KLRA 4XMZA 5GS1B 2FTAA 2VLJA 1NDGB 3HMXH 4KK9C 4LFHD 1RPUA 2WNWA 1P53A 1D5MA 3TN0A 3T0EA 4DSYA 2C34A 5E5MA 5H4YA 3UAJA 2CRZA 5CLXA 5C71A 4QXTA 1YNKH 5D5MB 4XVTL 5D70H 3MNZA 4MA1C 4HKBA 1A6TA 4U1LB 4LL1A 3QEHB 1GJIA 3GC3A 1KCBA 1S7WB 4I1NB 5DZVA 2XVLA 4KVNL 4X4XA 5FYKU 1JAEA 1Q9LB 5FFOA 1G4RA 4GBXB 4ZBJA 3RWJB 2GAZB 3KGRA 4JO3L 3VNZA 5HP5A 2OCFD 1PZ5B 2Z91B 3GFUA 5KVFE 4M7KL 4LHUB 2Z31D 4V11A 1T6BX 5C0EB 1CWVA 3TIEB 1A1NB 1NCCH 5FDWB 1GZHC 3LKQA 4HGWB 3WAKA 3HHRB 2HPTA 1D7CA 4YWGL 3KE0A 1U8HA 3PQYB 5B38A 3NCYP 1NIEA 2EIZB 4FQLL 2I9TB 4YHKH 3JZ7A 3TJHD 3A67H 2QPSA 1SYVB 4GI8A 3GXMA 4MJ5B 5T33H 4MBRA 4LOVA 3WJLC 4M62H 3U1QA 4C4KT 5LNGA 3B9KC 5E1AA 4Z7UF 5M7QA 3A4DA 5J9PA 3B2PA 4KXZH 4ODHL 3UYPB 2TRHA 4DN4H 3QJVB 1KXVA 3VXMB 2QADC 4MKMA 4NNXA 5B3JF 1D5XA 4WJKB 2YD0A 5L4IA 3U30B 3WN6A 4DQOL 4WLCA 3IDXL 3TWCL 2Z4QA 2Y06H 4TQEL 4B5EA 1SRDA 4BH7B 1KCUL 4LCCB 3JTBA 2FRGP 3R06A 2O5XL 2J6EL 3CFBA 3T5WA 4JR9H 2W1NA 1U8KB 4ZPTB 4P4KD 1MCQA 5DZJA 2ICCA 5I6MA 5KSBF 2ZCLL 3X1EA 1QASA 1OGAB 5ADPH 2O61A 1WT5A 3C5ZB 5DQJA 5DZ9A 2HRHA 3SCMC 2DLFH 4DPCX 2HMIC 1K5WA 4QTIH 3ZYIA 4PREA 1INQB 3FUFA 3HC0B 1WFMA 2HKFL 1YEDB 4ISVB 3FO0H 2NNCA 4KHTL 2WXJA 5EBMB 4FE9A 2UXGA 3D0VB 4QRPE 4JRLA 4KV5F 4UV7H 4N0FA 4HIQA 1YYCA 4Z7VE 3SDYH 3IE9A 2EABA 4Z3IA 2V3FA 4NS0A 1LQSR 5ESQB 1O75A 2VR5A 2XG4B 2BVEA 3QDJB 1DFXA 1JTTA 1AO7B 4NNPL 3G5WA 2AMUA 2BSED 4DJMA 3PV7A 4MXQC 3IFNL 4N1CA 2YAMA 2CIKA 3F7VB 1P7QB 1IEAA 3N44B 2BWDA 4HWBH 3QQDA 4UQDA 4XX1G 2HLAB 1JPTH 1SFDA 2VLRB 4HMCA 1WHPA 3QXUA 4RNRA 3O6ML 1U8IB 5DLLA 1UD6A 3HBQA 4JPQA 4HBCH 1IC5H 3SOBH 4JFDB 4KVPA 3P4NA 3HR6A 5C0CA 1OM9A 4GSXA 4O5LH 2VZTA 3C87A 2EE0A 1U30A 1UWGH 5FF6A 3OG6B 2AQSA 4FEMA 1WISA 3MBEC 2BC4A 1AR1D 2IGTA 4ZPVA 4MHHI 2J5LB 1QOKA 3D4ZA 1LM8V 1MREH 3KXFB 3IE4A 4AL8H 4PJDB 1T4KB 5FUCE 4LCIL 4F1SA 4KKCC 4QMEA 4ZQTA 1MSPA 5KJ7E 2C1PB 4NT6A 1TTFA 3CBRA 4EI6B 1I7ZA 2B2XL 3SO5A 3WELA 5HTSA 2BRRH 2ZOOA 2PMZA 2G2NA 4UTAH 5BCAA 4JM0A 2C8NA 4P3DB 1S9YB 3NUKA 8CGTA 2IBGA 3P73A 3FOMB 4YEFA 2P28B 1NC2D 1GA2A 3IPFA 3ZK0A 5JW5B 2BP8A 4P4KB 1NGQH 4AJVA 4K3EH 1MRFH 1NGZA 4X6BB 3ZYZA 2C3VB 5E24E 1DBKH 4NM8H 3MNWA 3MLYH 2JELL 3NH7L 3ZSTA 3NFSH 4KKBD 4FFWD 2BCKB 4JO2H 4OQTA 1JNHA 1YUHB 4OCXL 4PJBB 1FNGA 1X5ZA 3HRZA 4NKQB 4HUXA 1UM4H 4BK5A 4LSSH 5HHVH 4PTTA 2OR9L 4P05A 2F74A 1ZJAA 4NZFA 1YN7B 4TKWA 1A64A 4M93B 4YLCA 3U9UA 2G0LA 2NTSP 2J5WA 4BDVB 2WLHA 3RVVC 4PS3A 2WLLA 2OXHB 3K5SA 1JCVA 4PJ8C 3LDBC 2QEJA 3CBJB 3QJUB 2R69H 4F58H 2EADA 1S4IA 5F7KC 2H6UA 1E6OH 2NX5E 4Y5VA 1FHGA 1H15B 4YSEA 4YLQT 1AGCB 2HT3C 1DJZA 2BSCA 4QLWA 1AY1L 2GCYA 1RZIA 3LH8A 2LTQC 1ZLSL 4LQ1A 5I6LA 2IG2H 1LO5A 2C4FU 3QZWA 2VMJA 1XH1A 3HE6B 4HQQH 3BH8B 1Z9SB 2EIKB 1N70A 3FHEA 2PYEA 5TK2A 2IWGA 1TITA 2RTTA 3R8QA 1T1YB 3MA9L 4I1PA 4NZRL 1PD6A 5EEXA 3SKOB 1U8MA 1AR1B 3OZLA 4NJ9H 3HW7A 1EEYB 3JWDL 1KV7A 2BP0B 2F0CA 4FNUA 4LSPL 4KROB 3RVUD 1OAQH 3VFRA 3CN4A 2FATH 3Q1EA 4WEEA 4YMPA 5CFAA 1SNRA 1KIQA 2P8MA 4ZMZA 3IJEB 4FHJA 4R4FH 3HUJF 4FHBD 5HPMA 2AGJH 5HYJB 2QGCA 3MLWH 4N4YB 1TETL 4PR5A 4P2CG 4YDNA 1H3VA 4RGNB 1NC2B 1JGUH 1FIEA 4MCZB 1OT1A 2VDKB 2XETA 3ZXAC 3VCLB 1KTDB 2X2JA 3QYMA 1F4WL 2KQMA 1QEWB 3CLWA 5GGRA 5LLIC 1T22B 2J4WL 1JGLL 2A1WH 5FO8B 4ZMYA 2DKUA 4HIIB 3DRQA 4OLXL 5L7XL 3C6LC 1HC1A 4AEFA 4PRHA 2WXLA 4JHBA 1RULH 4N0UA 5HVFB 2J72A 3ZMRA 1P1ZA 4IOFD 1F4XH 2H3NB 3H2QA 2OMNA 4R97B 4BKTC 1HH6A 1KIRA 4PJAF 3LY6A 3PJSB 3AGVA 1MNUL 4Y19B 1XH3A 3KLQA 1G1KA 2EINB 5L4JA 3DHPA 1JRHI 4J2XA 1AACA 1E7UA 2Z8RA 5EF3A 1U92A 2AQ1A 1YNTF 3RGHA 4N6RA 1S7SB 3QWOB 2VAAA 1UKQA 1I9JL 5EUOA 3L4XA 2HP4A 2HKHL 1N0XL 2X40A 1L0XA 4O00A 3GDBA 3NZUA 2HJFA 4Y1AB 4BFRA 4HJJL 2Y2WA 4BIKA 5A16A 1ASQA 1X5JA 3R18A 4KO7A 4F7TA 1E2ZA 4GAFB 2GSMB 1EXHA 2EIMB 1MPAL 4FA7B 1P5VA 3GSRA 4MXVE 3CFDB 3WEXA 4N5EC 3ESVF 4PV8A 1IM3D 2MTAA 1TTBA 4OCWH 4HUVB 1SVBA 1HYRC 1IBBA 2MWCA 2OS7A 1CFBA 2CSPA 3VXSD 4X6FA 4L4VA 3HMXL 2C26A 3QCVH 1IZJA 4XNZC 2F2HA 1DN0A 5C0GA 1RZKH 3RUGF 1S7TB 3VH8G 2IWFA 3TBWA 5HXMA 2O30A 1CE1H 1TEGA 3FTZA 3KCPA 5DU7A 3FU3A 1AZNA 5EU7C 4F2FA 2HFEB 2CPUA 3FT3A 3AREB 4K7PH 5D70L 4QOKD 3QIUD 4NN5C 4RVBA 4M9PA 5LCVA 5HGBB 3L5WA 1DTUA 3WO4B 3SO3B 1BZEA 3GIZH 2I7SA 4O51A 4TUUA 5DMGC 3RWFB 2WXKA 2GSGA 5FCSH 5LGHH 1JZGA 1T5WA 1UM5H 4BUHA 1P69B 4ADGA 1H3TA 1EUTA 2EJ1A 2NXZC 4ZUTB 2H9GA 4IQHA 2YFNA 3NABL 5E99L 5CD5C 4GXUM 1M9WA 1NCCL 3ABLB 3PNWA 2GVYA 2J12B 2B39A 3T3PE 1KN2H 3C2SA 3D2TA 3OKDB 3BVWA 1PFOA 1RZKC 4G5ZL 4EI5D 4A63A 1FO0B 1G7LB 2FSEB 1UOVA 3D8MA 3G5VA 4HT1L 5G4OA 1HSBA 3RWEB 5I9QB 2EO7A 4M62L 3UAEA 5IBLD 4BQBA 3IGAB 1CL7H 5L8LB 2EDJA 5J1AA 4J5VA 2O6PA 4AXWA 2EUWA 2ZWYA 4GQQA 4P8QA 4DN4L 2VC2H 4PWHA 1UWXH 1X3DA 1B0GB 3FUNA 3PAUA 5E00B 3RKDC 2XN9A 3W9DA 3L3GB 3L08A 1ZLWK 4M8QA 2P1YA 1DSFH 4M3HA 1KTCA 2YO3A 2NUTA 1VB9A 2WZPD 4X8JA 1HOEA 4AQZA 1BWMA 2PCFA 3X12A 3ZL4L 3R7RA 4FABH 3WHE0 3GJFA 3L54A 4F92B 2VDRL 5ADPL 3TVMD 3AUVA 1IBGL 1NCJA 3RIKA 1V3JA 1E2WA 1V3KA 3QRGL 3BVDB 3EG9B 2KKQA 3MLRH 4HBQA 4P5KA 4XO4A 3MFFB 1KB5B 1I1CA 5IM7B 1NUNB 3OWEA 4F3FA 3DVNA 2Y6SC 1PZ2A 1VIWA 2Z35A 1C12B 4J3TA 1SMAA 3G9AB 3WGVB 1ZGLA 4I9WE 1SXAA 1ZWIB 2FB4L 3DECA 4RFEA 2L7JA 3F7YA 1ETB1 3S7GA 3MRNB 1VZGA 3D25A 3KNBB 2ZX6A 3QT2A 3VSTA 4IBWA 4Q0XL 3RDTA 3PWPD 1JN6A 5HGHA 3ARDD 2CCWA 2A4EA 2HRPL 3MOAH 1R3JA 2P5WE 4G6KH 4HJ0C 5CCJA 4C4KO 3QQ3B 1NL0L 1NOFA 1HDMA 1XZ0B 4GEJA 4L05A 3UTSA 4A6YH 4NQDE 4BSVA 3E1ZA 5I30L 5IQ9B 2R27A 1E9PB 3D87B 3CN2A 1J9QA 2B15A 2ZUYA 5HYSB 1CFSB 4EXPX 4W70A 4HS6B 4G8IB 1BYNA 4HWBL 3O4OC 3EH2A 1JWMA 2R2BB 4HZAA 2DQTL 4Y2DD 4URTB 1ANUA 1JPTL 3BC9A 4ATWA 5DJDA 4KTEH 3RFZB 4EI5B 1XAUA 1Z5HA 2D3LA 4L4JA 2OTWB 1N10A 1K4CB 1IC5L 4HBCL 4V1DB 3SPHA 3EYSH 1HHKA 4ONHA 4X6DA 2WCSA 2VDLB 3L95A 4MMXC 4YXKL 1UWGL 1EO5A 1IAIM 4YSCA 1PCXA 4MYPA 1UTDA 5HDOA 5BO1H 3NCJL 4QRRA 4JKPL 5EOCH 1I8UA 1MREL 2WLIB 3KHQA 4POYA 2NY3B 4FG4A 4F9LA 4MAYD 3OLGA 1RHHA 3MJ8A 4G6ML 3RG1C 5IB2B 1WO2A 3HNTL 2ITDA 1CZ8H 3CVHB 3ZL1A 5EZLB 2XN2A 3BEWB 4N2OA 2V2TB 2VIRA 3GPEA 4NHUB 4UTAL 3HNVL 3GRWH 3NPSC 4O2CB 4U49A 5CJ5A 4E5XA 1P7KB 4X42A 2FLRT 1VAHA 4YX2L 3OKOB 5EU5B 3WGUB 2EC8A 1MRFL 5GRVL 1FVEB 3TVMB 5C0FA 4OGAD 3QUXC 4NM8L 5ANMA 1MCHA 1BZ8A 2NXYC 3MLYL 4JHWH 4LBAA 4P48A 4GW5B 2ZUQB 4QWWD 3QEQD 1ORQA 3SPCA 1HH9A 4Q58C 3OHXB 4Z76A 2R23A 3MNVA 2EUZA 2HTLC 1L7IH 2QTVA 3RPBA 1I9RH 5DRWB 4ZW5A 4XXCA 1UOWA 5AD0A 5IROD 4P2RB 1GSKA 1U95B 2FT7A 3LNDA 5CZRA 2QVIA 5HHVL 3SJVD 2X1PA 4WFEE 4RLDA 1UASA 1VESA 1BMGA 2RD0A 1AYOA 4FG2A 4HVBA 5E6YA 1JV5A 2F53A 3O45B 1QFPA 4LLUB 4LLWA 1DLHA 1J1OL 2P80D 4OLVL 2P4AB 2O26U 2ZX5A 3HHMA 4ELMF 2YXVA 4ETQA 2R69L 5IUSA 5IK3B 1LP9E 4Z95H 3QG7L 1CGVA 3C6SA 3QXDA 1H5BC 2R29L 3IGUA 1O5DT 2P24A 3RIFF 1MW3A 1T66C 2W80C 5IKCA 1PS3A 4JRXA 3NZ8A 4HIJB 3V6BR 3BCDA 3LH2H 4P9MH 2YOAA 2DWEB 2X53A 3B2MA 1EAJA 4EDWH 3UJTL 4N2DA 4EEEA 3BMVA 4P57B 4DEPC 1SOXA 1MWAH 4LLYB 3UTZA 3V9CA 1IBHA 3EGSA 4A04A 5EU3B 3GYRA 4NJ9L 4UIKL 3K6SB 4P2QE 1XH2A 1QR1A 4JLRA 4QRSA 3V4PB 4I2XE 3O4LB 1OAQL 4K8RH 4PG9B 4PJXF 2CUAA 3US1A 1NOAA 4R4FL 4JO5A 5LAXA 2RHEA 5G2NA 3UP1A 3MLWL 4F7PB 2ZJSH 2NW2A 2DH2A 1G7QA 1OB1A 2X4PB 4MA3B 4FNRA 5BRQA 3VI4A 3MRCB 3MO1B 3EOBA 3DBXB 4E42A 3L45A 4HF5L 4JL2A 1JGUL 1W72B 3DUHA 3DSNB 3JWOH 4Q4EA 5CD3B 3GSOA 4NZ8A 1Z5LB 2AAAA 2JCCE 3CBKB 4G8GA 4Y0GA 3BH9B 3PWJA 4Z0XB 1OARH 2A1WL 5KYYA 3BW9A 3EJPA 4NAQA 4LIQL 3QEQB 1JGDA 1I53A 2FYYB 2NT1A 1KBGL 1AVAA 4G6FB 4H1LG 5IW1B 2HWZH 1JHLH 3U36B 1KWKA 4K8RC 3FMGH 4KKAD 3SJVB 4BFIA 2X9WA 4UT6A 3QJOA 4GNKB 2X4UA 3GBEA 4XVOA 1EIBA 1ZE3H 3NP3A 4OLZH 4XCCL 5FAAA 3ZO0A 5J12B 3OSVA 3PGCA 2O5YH 1MIEL 4W9KC 1SEBB 2Y7OA 1MAML 3LKPB 1E6JH 3LIUA 2ZYRA 2XV3A 3Q6FB 2WBJA 3UZQA 4FXGB 5C3IA 3JWOC 1PDKA 5JQ6L 4NQCD 2Q76B 4Z7VB 4YO0A 5FX3A 1CK0L 4JFPB 3OMIB 4D2NA 5KG9A 2FEDD 2PWDA 1RUPH 2AJZA 4B9JA 4UOZA 4RCAA 2GJ6D 3S36H 5IJBC 2XTJD 2LLGA 3IJSA 4S1DC 1O5PA 2C9PA 5KUKA 5KSAA 1SN5A 4W6XB 4B9PA 5BXFA 4XNQA 2B4CH 1JGEB 1XSJA 3S5LA 2ADJB 1CTMA 4MJID 1G0XA 1ZE3C 3C8DA 4HDIB 3AS3A 4X6CB 2YMTA 3WTXA 3LPFA 1J9CT 2XJLA 4NZUL 3OKEB 4L8DA 3QCVL 5F44A 4GG6E 1FH2A 1AYRA 2KDGA 3HE7A 5DTFA 2ZKMX 5T1KD 2WZ5A 1RZKL 5BW7A 1F1DA 5I6KA 1F41A 4HPYL 2CA3A 5IFHH 2XVBA 4L29B 1CE1L 3ARYA 2FEEI 2QVMA 3TO2B 3AITA 1SLVA 2VQUA 1NEZG 2GJZA 2VB5A 4K7PL 3DA0A 3ARGC 3QH3A 3LZLA 3P2TA 1R46A 3KM1A 5KYNA 3HS0B 1HJBC 4L37A 5C86A 4IRSA 2J8OA 4F8LA 3QNFA 4FI8A 5FHBH 3W0WA 1WBZB 2HVJA 4DP8X 3BSZH 4HWUA 3VRLF 5LGHL 2B16A 2E8ZA 4P2YA 3F8UB 5KYUB 4DZ8B 1P84J 1YRKA 4NBXB 4U1HB 5DA4A 3RNKA 4BQ6A 1ZS8B 2CLRA 2G75B 2DMCA 5JHLA 4YBLC 4D8OA 3UEQA 2DY2A 3GZKA 5GRYA 4HMDA 5CBEB 2R0ZH 1DBJL 1KN2L 1WS7A 4I89A 4PRBB 1HL5A 3RWGA 5D96C 1GGUA 2D4FA 5IIEB 3TF4A 1CTOA 5IB3B 3X3GH 4WU7A 5CCGE 1ZJBA 4PRPA 4ZFZB 4N2CA 4Z3TA 3CTTA 5F1NA 3FU6A 4IBTA 4FQJL 4JK0D 2Z0UA 3FFOA 3O2DA 3WFEL 3K6IA 3EDFA 3BWSA 1FORH 3AM8C 3EF7A 4LCUB 1E5ZA 1FWXA 4MFHA 1I8IB 2AJ3A