2UY6B

Crystal structure of the p pilus rod subunit papa
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
154
structure length
150
Chain Sequence
KVTFNNTVVDAPCSISQKSADQSIDFGQLSKSFLEAGGVSKPMDLDIELVNCDITAFKGGKGTVKLAFTGPIVNGHSDELDTNGGTGLAIVVQGAGKNVVFDGSEGDANTLKDGENVLHYTAVVKKSSAVGAAVTEGAFSAVANFNLTYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERIPLASMID CHAPERONE PAPD PROTEIN
publication title Crystal Structure of the P Pilus Rod Subunit Papa.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 20
structure length 150
sequence length 154
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00419 Fimbrial Fimbrial protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 2uy6B01
4J3OG 3ZL2A 4AV0A 4AUJA 2JTYA 2UY7B 4ATTA 4XOAA 4XOEA 5IQNA 1UWFA 4J3OF 1TR7A 4XO9A 2XG4B 3MCYA 5IQOA 2W07B 4XOCA 3JWNG 4AVHA 4AV4A 2J2ZB 5FS5A 1KIUB 5F3FA 4XOBA 2XG5B 4LOVA 5AALA 2JMRA 3SQBB 4AVJA 4XODA 5FLUA 4X5PA 2VCOA 5FWRA 5AAPA 3BFWA 4XO8A 4X5QA 2UY6B 5AB1A 3ZL1A 4CSSA 4AUUA 4BUQA 4J3OH 1QUNB 3BFQG 1PDKB 4AV5A 5F2FA 5LNGA 1KLFB 1N0LB 3ME0B 5CGBA 1ZE3H 4AUYA 4AVKA 3ZPDA 5LNEA 4X50A 4AVIA 5IQMA 3JWNH 3JWNE 3RFZA 5JQIB 1N12A 4CSTA 3BWUF 4CA4A 5ABZA 2WMPB 4X5RA 5FX3A
chains in the Genus database with same CATH superfamily
5JR1L 3K5RA 5FGRA 3WEAA 4MWFA 3ECBA 1GSKA 2D3VA 3NN8A 3KYMA 2B4CC 5CFAA 5GZOA 1E2WA 2EICA 4M8QB 2OMZB 3HAEH 1DQDH 3UZQA 4KPHH 5BS0E 2Y7QA 1HZHH 5D6CB 4LSPH 4AJ0A 1GMIA 5CMAB 5DRZB 4KKQA 1QOKA 1P4LB 2RHEA 2WN2A 3EOTH 5D7HA 2B77A 3FQWA 2HMID 2QEJA 2WBJA 3WN5C 1RUML 1DANU 5HYSG 3VWKA 2XIIA 2C9QA 4HSAC 2D4FA 2HWZH 2J43A 4Y1SA 4F58L 1HYSC 2CNYA 3VA6A 3OJ2C 4Y0GA 1MDAA 1KBGL 2P26A 3F7VA 5I0WA 4IRZL 2JE8A 4O2EA 2VKXA 3QXAA 4FHBD 2UUDH 4FRWA 4LLQB 3A67L 1IKNA 3MJ6A 2DB8A 1RY7B 4GT7A 3DO4A 4Z77B 3CFQA 2WWNA 1LO3L 4WSKA 4WHCA 5I8KH 3MSPA 4LHUG 1NCIA 3BGFB 3EJUA 3GTNA 2Z9TA 3CUPA 4XXDB 5BRQA 2UZYA 4JS7A 1AGBA 1FSKC 5A2AA 4HK3N 4UTAA 4FQ1H 4MDIB 1XF4B 2VM3A 4X4XA 3S2CA 3UGUA 1WZKA 1MNUH 3H6AA 3RBGA 2IEPA 1N3NA 3HRZC 4RFNC 5GSVB 4RMRA 3ZK0A 5HHVH 5HYFA 2RA1A 4ZOEA 5D1QE 1D6EB 2C26A 4NUQA 3I2CH 4KK5D 3L4ZA 4DP0X 2XQ0A 1JI1A 3V7AG 2GITB 1JD7A 5TQ2L 1I7UB 2APSA 1JJUA 2PO6D 3VSTA 2B0SH 3MACH 4LLDB 3RVTC 2W38A 2ADJB 1DDTA 3VNYA 3H9SB 3MKKA 5K33A 2J1YA 4XPBL 1RKRA 3THML 3QYNA 1DQLL 3V0WH 1KCBA 1MWOA 4G9FB 4HV8B 1MIEL 3L9RB 1JZ6A 4E9QA 1AJ7H 3N9GH 4HXAL 1KJMA 2BIQA 5D7JB 1MIML 5F1SA 2HX7A 3ILDA 1SLXA 4Y5XC 4DUVA 3DWTA 4JE4B 1BZ9A 3EFDL 1G6RB 2FEJA 4H1LA 1MHHB 4ZUWB 3GUFA 1ZA6A 3CPUA 2EH8H 5F88B 3JTSB 1MQKH 4MKTA 3FRPG 2H8PA 3RFZA 3GPSA 3FFCA 4YXHH 2UWEA 4HGMA 2QJDA 3L7FA 2QBWA 4XXWC 2A5UA 3NFNA 2VRKA 4OUUB 5ADOH 4YBQD 4WFGD 1MRCH 3PP4L 1K2DB 3DXAD 2AJSL 4ZS6D 3N1PC 1B88A 2R56L 4Z7VF 2CGZA 1Q0YL 3Q8FA 4Q89A 1NSNL 3QJOA 3U4BH 3REWA 4CBPA 2WUBL 3H3PH 3C8HA 4K3DH 1QFWI 4P2OA 3NBNA 2KYIA 2R51A 4ODUB 1NFAA 4J3OG 5HJ3B 2QGBA 5E9DE 5AZUA 1F45A 3DBXA 4NRZB 4OGYH 5AFAA 3ALWA 3H42L 1L9QA 1M42A 2X1QA 4KAQH 4OZGE 4ZAKC 3HC3L 4F37F 1KCKA 1RZIB 1UJ3C 2Y06H 3VI3F 1TPXB 3BLBA 2A1WL 4JFZL 5C0IB 3GHBL 3P77B 5TQ0L 4PLOB 4Q14A 4GP8B 1BVKA 1XBRA 3F05A 2X9YA 2ZSVB 3EJSA 3LCYA 3RY5A 1DQQB 2P5PA 2VXTL 3H53A 5I16A 5KANG 2YS4A 5E6UB 1I31A 1L9NA 2HH0H 1LLAA 4ZSOE 1NMBH 3C9NB 4U0RC 5AW1B 1FNAA 1R5VA 3O2DL 3N85H 3P4MA 3NZUA 5IWLC 4KZEL 3ZHDA 4YSRA 3PUCA 4N2BA 3C6LC 3NSFA 1NMCB 2AMUA 4ZFGH 5DK0A 4HFWA 3VB8A 2HJKA 4I87A 3MZGB 1OTSD 4FXTA 4BA8A 3CSPA 3ULSA 2EXWD 3ZRSA 4JO1H 4ONFH 4UYPA 1FNSH 3TBCA 4Z3GA 1AZRA 1JERA 1UUSA 1OP3H 5KG9B 4ZMAT 3NEOA 4N1HB 1CFQA 5K39A 4D0BA 1C08B 3QRFM 1ZS8B 3ZHFA 5IMLB 4OTXL 3ESPA 1X5MA 2VT0A 2R9HD 4PJFB 3RVXD 4GIAA 1F3RB 5IGXL 3AITA 2WVSA 3QEHA 4NQCD 4F3FB 4BSJA 1AZZC 1AHWC 2NUTB 1CLYH 1S7RB 4LCVA 4YR6B 2VR4A 4OD2B 3VRLF 5EEYA 3IRZA 5AYUL 3WD5L 4POZD 1B0WA 1SRDA 2CKBB 4ERSH 3CBKB 3LN5B 4EZKA 1Q9WB 1UOWA 3NAAL 1JPTH 3ZKMC 2AV1A 5CSBA 2ZG1A 4S10A 1N7MH 4FQXA 3BAYA 4X6CE 2DM3A 1V7ML 3ZYZA 1DR9A 2YBRA 3H9HA 4I0PB 4WSGA 5CCKL 5IV2B 2QQLL 2AEIT 2E7MA 1UWXK 2F2HA 1QWHA 4BHUA 2O5YH 4O00A 4M5YH 5FLVA 2R2BA 3L7EA 4PG9B 4APQA 4EKJA 5DJ6A 3QXTA 5JR1H 3TOPA 1IIKA 1I85C 5JHMA 3HG0A 5HPMA 3RL2A 3IPEA 3PQYA 3WNOA 1BQLL 1JUFB 1U93A 4NO3A 3ZE0E 3V5DA 5B8CA 1I9JL 4UT6H 2GY7B 4F7EB 2DS4A 5T3XH 2QZ5A 1DVXA 4C55A 2HKAA 4AE1A 4ZODA 5LBVA 3G9VA 5DQDH 2MQ0A 4ODBD 4ODWB 4M43H 3IAGC 4FG4A 3VGBA 3ILQC 3EXJA 4F58H 4WV1A 1JXDA 2CLZB 1CD9B 1PZAA 3JV6A 4L1SA 4MDJA 3FQNB 2ZNWA 1NM9A 4IRZH 1RSYA 1S46A 4WVRA 5EFIB 5A3IC 4OI8A 1IKFH 4FXGA 1X7QA 5AB9A 1LHZA 1OF2B 1JDCA 2FATL 3A67H 5DZ9A 3GB7B 1IARB 3V4UL 3W38A 3ZX1A 1A1NB 3J27A 1EFXD 4JN1L 5D1ZA 4ODXA 4J8QA 4PJHB 4F80A 4JFDE 1DCLA 3IWUA 4N25A 4CADA 4Z7WE 3STZA 5I75C 1VESA 3FQYA 3IPFA 1U9KA 1W8OA 2PWGA 1S78D 1KGCE 2DWTA 3NK4A 4B3VA 1U8HB 2G3ZA 3ARBB 3KPOA 2HT3C 3ES6A 3CLEH 4W1TA 3WIAA 3D25B 4MYPA 4XP5L 2RBLA 2P1YA 2N7BA 4NBZB 4LHUA 4LCIL 3NRPA 2OR7A 4B9FA 2DIJA 2RACA 5T1DL 4QHMB 1E8WA 3KDPB 5T5NF 5TQ2H 3DX1A 2XC8A 4JVWA 4V1DB 1E4WL 4ISVB 1XF3B 1WFUA 1H8SA 5D7JC 1T7VA 3THMH 4E41A 5ID1B 1KGJA 1DQLH 3U9PH 3MFGB 4MJIB 3U1PA 5MEPB 1MIEH 4QWWD 3QPXL 4TNWF 4Y5VB 1AIFA 2Q9OA 4HXAH 4ZW7A 1PZ3A 5CEYB 4HSCX 4F7TA 1J8KA 1ZT7B 5J56B 4HHWA 1KY7A 1GTNA 3F7YA 4DQOL 2AJXL 3EFDH 1QEWA 5BJTA 1AGFB 4HH8A 3TCLA 1X5GA 2A74B 1Z9NA 3LQMA 1NC2D 2DM4A 2Q7YB 3GK8L 2L7QA 2FSDA 3SDDA 3PP4H 4N0CC 4XVSH 2AJSH 1MSPA 2R56H 1Q0YH 2WLLB 1YYML 4MXQD 1GHFH 2WN3A 1ZRUA 2YMOA 5BZXA 1NSNH 2P7TA 4KX7A 1ORSB 1PDKA 1JWUA 4NQQA 1NAMA 2DIEA 3G6JE 4NQXB 5HVHB 1WP6A 4V2CB 1A2YA 1BFSA 1PTZA 4L8DA 4QTIH 2OM5A 3DSNA 5J6SA 3BUYB 1IBZA 1TPXC 3O6FD 4MNGA 4YEFA 3S35L 1BWMA 1RD6A 4OIFA 4TQPA 5CCHE 5HI5C 3ULVF 5C07B 4LEXL 1Z0NA 3GMLA 3DX7B 1F3DH 3HC3H 1U4EA 1WEJL 4P2RB 2XZQL 3IU3A 1PAMA 2D3LA 3FHQA 3FUDA 2Z3FA 4JFZH 5DJAA 3DVIA 1ZA3B 3GHBH 2W92A 5DUBB 5TQ0H 2DICA 3MRLB 5HHPB 2H41A 1LP9F 4BE6A 2VXTH 2UXVA 4QO1B 4LCCA 2XQYK 4L5FH 1TT6A 2ADFL 3WY4A 3C5JA 3IFOA 1NMCC 4NRXA 3OJDA 2YUXA 3FUMA 4Y88A 3O2DH 3KPLA 4IK7A 2H6UA 3WUWG 3TEUA 4KVPA 4JFEB 1OY3B 3ARFD 1OE2A 3HZVB 3MGOA 4KZEH 2UYLB 4X6DF 4LP5A 3UTZB 4CC0A 5I6NA 1ZKAA 1T0PB 2CR3A 4N8VG 2WQUA 4KKCD 2XYBA 2G2PA 2G5RA 4G7SB 3WEXA 1ZGLB 5FGBC 4JL1A 2XRAH 3MV7E 4Q9BA 1EXUA 3O3EB 5AL8A 5JLZB 5BUAA 4GUQA 1IT9L 1CGWA 1G7IA 1E4KA 3K2IA 1YMME 3K2UL 2QQQA 4LOUD 5F1IB 3BZEA 5IB3A 1YEHL 5IGXH 2J8UA 4Q74A 3ARDB 4G9DB 1GH7A 3TEWA 2DKSA 1JCVA 4IOIA 3MUUA 3FCGA 5I73B 1NEPA 4M02A 2XHNA 3ZYJA 5EZIL 5SWZD 4WFHE 1YPZA 3GEFA 3D4ZA 1ES0A 5EUOE 1ZV5A 3WD5H 15C8L 3RTQA 4L4TD 4MZ2A 3FN3A 2FYYA 2EVFA 2ZWSA 5DWPA 1NCBL 5FOJA 5JYLA 4TSAL 4XHQA 5I28A 5MI0B 1WUZA 3NAAH 4W6WB 1T1XA 4GG6B 3UTPE 5KYXB 1C9SA 1BHGA 1T5XB 2X0UA 3BO8B 2FNBA 3CC5A 1ZWIB 4X8GA 3MRKB 1HAWA 1UB6B 4N3TA 3F00A 3VH8G 5CCKH 4FQQB 1QW8A 4LCWD 1E5BA 5JA9A 1AS8A 2XIDA 5LQBH 5HP5A 1OM3H 2WXKA 3G08A 4MVBC 2VM4A 3P11L 1HXYA 2CE6A 4X6FA 1IMHC 3L3IA 3GMPB 4BELD 1KULA 4Y7OC 5ERWB 5GGVY 4D7BA 1I9JH 5CINL 5C0AB 1HCZA 4J2QA 3I02B 1U3NA 1CVSC 1R9FA 4BWUA 5KYYB 1EZLA 2XWBB 3EO1B 3LN4A 5JQ6H 1NWOA 2LQRA 3RILA 3DTUB 4TVPE 1OEZW 4UTAH 1Z5LA 4FQCH 4F9LA 3VJ6A 1USZA 1AACA 1DBBH 4MQXC 1U8CA 1EDHA 4N1EA 1E4JA 4KZ0A 4N2IA 2FATH 2K8QA 4A2HA 5GGQH 3R4RA 4NQEA 4WJKB 1ETZB 2CG9X 5F7FA 4NYLA 3Q5TA 3LEYL 2IXQB 4DZBA 4MJ6A 3QUGA 4XN1A 3ARBC 3SJVA 3SZKC 1TJXA 4BQBA 2B1HL 1AD9B 1I9IL 5I23A 2VDRB 5AKTA 2C4FU 1AZVA 1U0QA 2WOYA 5I1CL 1ZXQA 4OVUA 2DN7A 3EJYD 1U92B 1A9EA 1D9KD 1F11B 1P0SE 3GMRA 4FG6C 2OMTA 1JGVL 4JRXE 2EDWA 4Y2OA 4WHTA 4XP5H 5F3BA 5EORL 1KN2H 4WI8A 3DRTA 3FUKA 3NACL 4LCIH 2DH2A 2DZEA 1N6VA 1WCBB 1WSST 1X5KA 4P3DA 1HI6B 2CZNA 4H1LH 1ZDQA 3VFGL 3O2VH 3KPSA 1OT4A 4Y5VC 3PHAA 4YGVA 4LLVB 1S9VA 1AQ8A 4A2FA 1QSFD 1OOWA 4HJUA 4L4VD 2GIXA 4AVJA 1JVLA 2NQDA 3BPLB 3QPXH 5JHDA 5IJBC 4A7QA 4KJPC 4NEHB 3X1GA 5E2JA 5JPNB 1OPGL 2A74C 1M9WA 2QL1A 2Q8AH 3VI4A 3C5ZA 4FFZL 5CN2A 3K4DA 2AJXH 4ZNEE 1EGJA 1NAML 3CXDH 5BUGA 2NUPB 1KGYE 4QF1B 4U31A 5EU5A 4G5ZH 5J11B 4QYOB 3GK8H 5BRZA 2J5LB 3SGEH 2VABA 2OMYB 3GINA 5AL0A 3RPIA 1WT5A 3DGCR 5AB2A 4NN6B 4G83A 4NZDA 2IGLA 5HVHC 4Z7OB 1YYMH 5KS9F 4RISL 4HKZB 3HG1B 1OCZB 2OZ4A 1U3YA 1D3CA 2DYPD 3II1A 3O3AA 3K0WA 1F1AA 3TASA 3L3KA 4HJ0D 4EXKA 2XX0A 5GS1B 3GXFA 3MR9B 2N56A 1I8LC 5K9KB 1I9EA 4LEXH 4XNXL 4D9QD 4ECNA 3GSRB 3N41B 2CHWA 4F2MB 4CVUA 3EBAA 3HZYA 1VEOA 4P2QE 5F9AC 3FSZA 3BP4A 4U1JA 3RVVC 4G8GB 4ZFZB 3D39D 5HHOE 2ADFH 3G5YA 3LQAC 4IDJH 5DZJA 4K5MA 1VFAA 4UT7L 1F1DA 1RJYB 5D5ME 3IMTA 1M57B 5DHVA 3T0XA 5IFJB 4LNRA 3WFEH 3AAZB 4BV1A 4WWKD 4GAFB 4FOMA 1KIQB 1XCQB 1D5BA 3T1FB 3L4YA 4NP4H 2A73B 1GPOL 1KG0B 3A3YB 3U7AA 1ZVHA 1BJ8A 3AT0A 3ARDC 3BAJA 1IEAB 1Z9MA 5G4OA 3ZKND 2D9QB 5I73C 1ZVYA 1IT9H 4PJBB 2FAUA 3I74A 3K2UH 4PRHE 1U91B 1OTTC 2K6ZA 4N8VA 5DFTA 1F8TH 1YEHH 3QB7C 4HOMA 3CSGA 1OGAB 3PAYA 3QRGL 4YGAB 4LBAA 2VXVL 2HTKD 4IRJD 4Q4EA 3RL1B 1INQB 2DWEB 5AALA 2DLEA 1X7TA 3WIHA 2WM0A 3QUZB 4LKXA 5MI0C 3RWDA 2BIHA 4WU7B 1HAUA 4Q8BA 4U1LB 1TUPA 3HN5A 5I8OL 3OG4B 3HE6D 4WUUE 4M03A 1NCBH 2BVOB 2PWEA 1UASA 2NNAB 1CBVL 3T3PF 5IJKA 2HG0A 3CIAA 4UQ3A 4WFFE 4ETQB 3LS4H 4AEHH 4JFFD 4TNVF 4NRYA 4BK5C 5F96H 1NGPL 2X4TA 3NCYP 4NM4L 5E6ZA 1LD9A 1MFVA 3P0GB 4PJIF 3J2PA 3SKUD 1XFPA 2HVJB 2HKHH 5SX5K 1VCAA 3RVWD 3P11H 5CD3A 2I60L 1V5JA 3D85B 3PHOA 1JXGA 2F6AA 2BSCA 4ORGA 2R39A 3B9KA 4N2EA 2TAAA 5D1QA 3NEXA 5IHUH 3S3DB 4M1GL 3N43B 5CINH 1CI5A 4LKCA 3PABB 4DSYA 3VH8A 1H3WM 2BFGA 2V2TB 4BFFA 1QRNE 4KXZH 2A9ML 3S5LB 3PHSA 1RK1B 2UY6A 2LOEA 4HZAA 4XCYB 1NCNA 4HCFA 1DVZA 4KX8A 4U2YA 3VGFA 3X13B 1O7DE 1GR7A 4UMGA 1G7JA 1IC7H 2XN1A 4M00A 2JXMB 3HFML 1EAQA 2ICES 4NAQA 3UIZA 2Q6WA 1KTJA 3O45B 4OZGF 1Q9KA 1HQRB 2VITB 1HXMB 4B9JA 4YLBA 2I9TA 1LJMA 1P69B 3MV8B 4HIEB 1JGUL 4K3EL 5JHLA 1GZQB 3LEYH 5L4IA 3B34A 2DQCL 4UQIM 1NC4A 43C9B 3DARA 5T33H 1KNOA 1I9IH 3ETBJ 1DSFH 4AV0A 2UY7A 1UVQB 3KD4A 4L29A 5I1CH 2AXHA 4WDIB 3TBVB 1FYTE 3L4UA 4IBWA 4IW4C 1P1ZA 4XOAA 5DFWH 5HHNA 1JGVH 2CU9A 1MCBA 4AWJC 1JYWA 1NPNA 1R3JB 5EORH 3U83A 3TFKD 4P5MA 2EE0A 3VXQB 2YA2A 1BGXH 3NACH 2NY3B 3LKSA 3FN0L 4X5WA 2D31A 1L0PA 3BPLC 4YL9A 3FZUD 4XMVA 2YD7A 1QLRB 2LR4A 3HS8A 5GXBB 4GUOA 1ETJA 5JPNC 3IDMB 1X5XA 4WJ5A 3RHWK 3O4LD 1A1MB 5AZEL 1HILA 4P5RA 5HYIA 2XZAL 4ACTA 2B59B 1YC7A 1QFWL 2Y6SD 5I9QB 3SDYL 2IIJA 3CGTA 3AC0A 1ZT4A 3B2VH 5A2LH 2AXGA 1G7HB 2EJ1A 4GBXD 2G75A 3S36X 4FQJL 2O72A 2HZHA 4WAFA 2V5SA 3ETBF 1R5WB 1IGMH 2OZ4L 2DQIL 4GIPD 4ZO6A 2AQQA 4O9HL 3O6MH 4QRRE 2J5LC 1Q9LB 4ZSOA 1NAMH 1MW1A 1R6VA 3OKEA 4JRFA 3AXLB 1N59B 2VDPB 2W07A 3NDZE 4NN6C 4AEEA 2UZPA 3DMMB 3L3GB 3OLDA 1O5DT 1WWAX 2L7EA 3C60A 4NWUH 1MREL 1DQKA 4KRPD 5EU3A 1PL3A 4FLOA 2W0FB 3TO4A 1A4KB 4UM9D 4GW5A 3H9YA 3KW7A 4XHJC 1SDDB 3TF7C 5BO0D 4PGEA 3BE1L 4RISH 5GS1C 4TMPA 3MHZA 4JGUA 4J3OH 1X5ZA 2R1XA 4W6XB 3U30B 1ZHLB 4YO0A 3RIFF 1I1YB 3S96A 2EAEA 2APTA 2UVFA 4IJTA 4N2MA 1DQVA 2HPTA 1N67A 2BRRL 4IBSA 4RWYH 3ROOB 1AZNA 1LTXA 1I75A 5AAWC 5LG6A 3SPHA 4HS8H 2ZKHL 3DI3B 4PJEF 3FCSB 3H0TA 3WU1A 4XNXH 2JJTA 4ZW8A 3GXIA 2CHDA 4MMYB 1BQ5A 5JOPD 3IJSB 2JNZA 3CXFA 5D8JL 4W9ZA 1RUQH 4U6HA 2VERN 3LNFA 3QZWG 1SBSH 1H6UA 4PLJD 4L8CB 4LPTA 1J0JA 5HDBE 4KGJA 5DD6A 5D7KD 4PCKA 1GYWA 1P4UA 2NT0A 5H35B 3BN9D 3QR1A 3HR5B 4YSOA 4BFIA 2BSRA 4I2XB 2Y7NA 5BMFL 1T0NB 1XR8B 5DA0B 4DKDC 5EC2B 3T6VA 4BQ6A 4PD4K 1FZOB 4X42A 3WIHL 2MQCA 1W0WA 4F92B 1GPOH 2GW5A 2X2JA 2VERA 1RU9L 5CEXA 3BVDB 1ET8A 5KVDE 3QUXA 2EDHA 3O81A 1TQVA 1YN6B 3QUZC 1RV6X 3CSYA 2JKSA 3CPLB 3IBEA 5MEND 2VSDA 1D5MB 2ICWI 2VXVH 5GZNA 4LLMB 3PIQB 5DZAA 5FWQA 1OK8A 4DP7X 4HIHA 4B0MM 3FQXA 1YUHA 4FEIA 3RU8L 3K0YA 3P3UA 1QATA 4H8VA 4YIQB 2FRGP 1RLWA 5I8OH 3PU7A 2XVGA 2ZP0T 1KTDB 2ZX8A 2ITCA 8CGTA 3MROA 1QSED 1LO0L 3IK2A 4WUUA 3WE6B 3GXTA 4KO5A 5K9JL 1U3JA 3S4SG 1E43A 1CBVH 1B0RB 1AXTL 3PNWB 1WDAA 4P57A 3CDFA 4OJEH 4NCDA 1SOSA 4TV3A 4M7LL 1MZYA 5CU9A 1PW3A 2QSQA 4JFDA 5GZOD 5FKAB 3DK0A 3GXUB 5K1NA 1FFNA 3DUUB 3JV0A 1NGPH 3BSHA 4NM4H 3T0VA 3ZO9A 3QFGA 4FNQA 4N0YH 2DYRB 1I8MB 3CDYA 1F3JA 4NKOA 2I60H 1JAEA 2WBJD 3GFUA 3VWKD 2X89A 2F8VA 1T0MA 2XPGA 2ZOUA 4M1GH 4DESA 3D18B 1F41A 4AGOA 3DNKA 1VF5C 5F44A 5JHLL 2WGXA 2NXZC 3OLEA 3NMEA 4WNQA 5FW8A 5TDNB 3QHZH 3GPEA 3MRBB 1MCPL 4PRPE 1L7TL 4FKEA 1QABA 2YPKB 3SYCA 2I5YL 3FCBA 3GMOB 4KMQA 2CLRB 4Z7QF 3SDAC 4AM0B 3MREB 4PBDA 1PY4A 3SDXF 1G9ML 2KDGA 4U3SA 4ZX5A 1SYSA 3ROLB 3GIZL 4KKLD 1U8QB 4G82A 4Q97A 3KCWA 1LQBC 5K9QG 2WSDA 1IBDA 3GKZA 2ED7A 3Q2CA 4WQOA 1JGUH 5GIRB 3SGDI 1F4WH 1MCWM 1XD0A 3MLUH 4TVSa 3K72A 1ZLVH 1THCA 2DQCH 1I8UA 5IHBA 4Z76A 1KCWA 3GNMH 1XXFC 4CBZA 4JG9A 4L18A 3TIEB 5SV4A 2NY3C 2Y36L 3RY4A 5ITBH 5D2LA 6TAAA 5ENWB 3M8OH 5GS0H 3LPWA 4PJCF 3IGUA 1L6PA 2FJHA 2QFPA 4I88A 4PRNA 5FX3A 2NY1B 1ACCA 3FN0H 2NY7H 4B41A 2F19L 3G6JA 5I9QC 1IILE 1LEIA 5MERA 1EGJH 2LU4A 1N2RB 4DP8X 3CFBA 5IG7A 2I07B 2AZUA 5AZEH 2XZAH 1EJ8A 2YUVA 5ACZA 4DKFL 3MV11 3FFCD 2NY2D 1JGLH 2EEBA 2YKKA 4PGCA 5FO7A 2X9ZA 4ZMZA 5FO9A 3I75B 3NYKA 3DMMC 3RJQB 3S0PA 4A68A 4P5SA 2RCSL 1EDYA 2UX7A 2OZ4H 3BHBA 4TULH 3FB6A 3PWJB 4G3YL 4O9HH 1A6TA 5EOCJ 3WTVA 3O41B 1B4TA 1HHKA 1SMDA 3LIZA 4ANWA 4J27A 3GUTA 4P2OD 4HUVB 1YDPB 1NBCA 1MREH 5H94B 4G6KL 4DCQA 3MRCA 3TV8A 3U30C 3EF4A 5GRYA 2CM5A 4I89A 1E27A 2ED6A 3H9SE 4U1MB 1EBAA 4MAZA 5DO8A 3BE1H 1E90A 3VO0A 4NXSA 3F6JA 4G9FE 2A99A 1WFIA 1SVBA 4ALAL 3WL9B 3MV7A 4XX1G 4EN3A 1NPUA 2YWYA 4EO5A 1WAAE 2V2XB 4LPYA 3MUZ1 4G7QB 3ZW3A 1J05B 3WTTA 3DETD 2B15A 1XGTB 2CHXA 1YHPA 1MUJB 3EJTA 2P28B 3MNZB 2BS71 3MRGA 4QAMB 3P3YA 4TUJA 3ABZA 5CJ5A 5AYTA 5JO5A 2AF2A 3ZU8A 3IF1B 2CQVA 4KX9A 1FIEA 1TTFA 5EUOA 3WDHA 3ZDYF 5TE7L 1RJZB 4HWZB 2H0EA 1OGSA 4N2OA 1MHCA 1G7MA 3CH8A 2BXZA 2WXGA 2WHVA 3EO0B 4N4YB 1ACYH 2AI0L 2ZUVA 3GSXB 4ZXBD 1RUPL 2DWXA 3DURA 2ISDA 3CFJA 5DMKB 3QJUB 3GKWL 4JPSA 2WZ6A 4NBYB 2YOAA 4PJAA 3NIFF 4S1SL 1IM3A 2AAVA 1QUNA 5FB8A 3IWVA 4NJAH 2CDFA 5BMFH 2XVBA 1MJJA 5EU7C 3AZUA 1ASOA 4O2CB 3BPCA 3WIHH 2WP3O 4KY1H 2ZX5A 3FAXA 1AGEA 3UOAB 1RU9H 3D7PA 2RQEA 2JJVA 3LKPB 1S9KC 1BFVL 2WB7A 4MX7B 3TBTA 4JPQA 5DC0A 1W91A 4M6ML 1BZ7B 2Y5EA 5IBTL 3L95A 3D30A 3V4PA 4XP4L 5HVWA 4F7CB 3AM8C 5K1JA 4FFTA 5JOEA 4K94C 4KC3B 1QHOA 5CN1A 1Q72H 2AZAA 5IF0A 1HJCA 4ZS6C 3MYJA 5FW7A 1IE4A 3RU8H 2I85A 4U2ZA 5E2WL 4DKEL 4FQXD 4OLWL 4RGMB 4D7PA 3BKJL 2DD8H 3D2UD 4LFHG 2PF6A 4QXVA 4AQ1A 1CR9L 1IM9B 2A9AA 4XBMA 2Y1YA 4IBZA 3P4OA 3DSFL 1SN5A 1LO0H 2QVFB 4KKBC 4APQD 3Q8BA 4PWJA 1BG1A 1AXTH 1FV1A 2BSTB 3DIDA 1MFDH 1L4IA 3ESNA 5FFOA 3PQYD 5GGRA 4M7LH 1KPUB 1UXWA 2KZKA 3IMRA 2OL3A 1G4MA 1XF1A 3D4YA 4PJFE 3PV6B 5I26A 5HHQB 4KNTA 2EDTA 3O6FB 4K7PX 4GKZB 3FQ4A 3ERXA 4H25B 1HSBA 4JRXA 5JOFA 4H0GA 2L4OA 2R59A 3P9LB 4H88H 3O11B 4AI7A 4XVUD 1RJCA 3EG9A 2FJGA 3HRPA 3VGHA 2WSKA 4X6BB 1J8SA 3S8WA 3S3CB 5FKPA 4Q9QL 5AKSA 2PETA 1MCPH 2W65B 5E4AA 4G80A 3DYPA 3TYGL 3JVGA 3CHQA 3B2PA 5D1ZD 1A7BA 4W70A 5IVXF 4CL7A 2EXWC 4AEFA 1MH5B 4RX4D 1MFMA 1WK0A 2A3TA 3HW7A 3VFWA 2CBOA 4QT5B 1PZBA 3OLIA 1L9PA 3OWRA 4LF3B 3VW3L 2BOBA 2BP8A 2RTTA 4M6OL 3UADA 1EHAA 3GBEA 4ZNEA 2R9HC 4ZPVB 3AGVA 5DJDB 4BBWA 4GEIA 1VEMA 1A1OA 1MVUA 3SCMA 5ICZB 4JDZB 1GYCA 1U8LB 4JY6A 3VXUA 2IJ0C 2C9AA 5GGUA 4YAQB 4Y16B 4NPJA 2NY1C 2W0PA 2VZVA 1FNGA 5D5MF 2J8HA 1A9BA 1HC1A 1T22A 2GAZA 1EEQA 4E41D 4ZFFB 2IBGA 3ILEA 3EYOA 2DQDL 1BVNP 2ZAGA 2X1WL 5SWZB 3T6QC 4MAYB 2IFFH 4X7EC 3S97C 3RA7L 2F19H 5CWSA 4HS6B 1XV8A 2FIKB 4HJEA 4HF5H 4QCIB 1O9VA 3EAKA 2K1MA 3LIZL 5B39B 5FF6B 1BM7A 1LK3L 2DBJA 1EO5A 3BX7C 4PJHE 4B96A 4DKFH 3ESUF 4WEEA 2WIMA 1REIA 5IB5B 1QPPA 1A65A 1WD8A 4L0ZA 1NICA 1YCSA 5FA4B 1YNKH 3OAZH 4KMLB 4IGBB 4P2QA 3I50L 4OW6A 3SGKC 3SDDD 1BPVA 1U3HA 2RCSH 3RGVB 4P9HC 4EZLA 4FADA 1FDLL 5C3TA 4Y89A 3L3DB 5HHOA 3WIFB 5CN3A 2WANA 1CT8B 1OAYL 2OMUA 2BNUA 1KCRL 1PBYA 3SBWC 5GRVK 4G6KH 4Y2LA 4HPHA 3CHOA 4HT1L 4V1DE 2BWDA 5DJ2A 1O9ZA 1RHFA 3B1TA 1S7XA 3HAEB 3LEXB 1UB5B 3BZDA 3HPLB 4KNUA 4X9HA 1FA4A 1GJUA 5KSAA 4JUTA 1FL3B 3DRQA 3GIVB 3DA0A 2M1KA 3GDCA 3HKZA 3FONA 4AH2A 1WWCA 3MAWA 3Q8EA 4PTTA 1VGKB 1DBAL 3U0WL 2AQTA 4KMTH 4PLKD 5I8CB 2QR0A 2QPEB 4RMUA 2WB1A 1W8EA 4PRHA 4RZCA 5IHHA 2OSYA 4G6ML 3BKYL 1GW0A 5BQDA 5CBAB 4AQ8C 1LM8V 4R7NB 1S78C 1MWAA 2F53A 2MH4A 4B60A 1MG2C 4XMUA 1CVRA 1B9ZA 4YLQT 5DGQA 2EC8A 5TE7H 4J3XA 1KTCA 2QTVA 4UDTA 4YDLC 4YFLI 4XN2A 1NBZB 2CLVB 2H7WA 1YQ2A 1NEZA 3HPJA 3K6OA 1J7VR 2AI0H 2IOIA 3L3HA 3OKNA 1OAQL 2PWHA 3TONA 1RUPH 3QE5A 4LQFL 1AXSA 3FUJA 1JNLL 1GC1L 1Z3RA 4I3RL 4PSRA 3DOHA 1WIPA 5KSBF 1ZLSL 3V4PL 3HG5A 1FCCA 2NNCA 4S1SH 1CU4L 3K8KA 1UZGA 4K3JL 4MNHA 3QG7L 3VCLA 2JB5L 1F58H 3L4WA 5EO1A 1TTUA 3O6KL 4JPVL 1DLHA 4ODTL 4TVPL 2WLHA 4G1EB 1B6DA 5C07E 4CMMB 4NPKA 1XH3B 2P24B 5ISZB 4P2RE 4HCRA 3FB5B 4JM2F 1IEBB 4PJXF 2V3FA 3OWEA 3EKCA 2VN4A 2K9UA 4ANXA 5FR3A 2E5EA 5IBTH 2GTWA 4DPCX 1QRNA 2B9BA 5F8QC 5I76A 4XP4H 5D1XB 1EHNA 1XEDA 3HZKB 4LB8A 1OV8A 5DLLA 4NUGH 5LGHL 1A0QL 3ASNB 1ET7A 5F9JA 2FT7A 4JHAL 5TGBB 2FSEB 1VKXB 4JFEE 2WZPA 2OL3L 5E2WH 1TTBA 2NY4D 4HDIA 1NL0H 4GRWF 5DMGD 1EH9A 3BKJH 4XMLL 1CR9H 3AY4C 2CNZA 4PVNA 1XIWB 5J8OA 1P7QB 1SJHB 3DSFH 1UZ6E 5HDWA 3BGAA 1X6NA 1DEEB 1XGRB 3F8UB 3GRGA 4Z18A 3TWCL 3QNZA 3CBRA 3G04A 3O6FC 2FO4A 3INUL 4Y1AD 3U4EB 1AQKL 2AP2A 3ATFA 1OP5K 1CFSB 1XH2A 3BN3B 1I7RA 3LZOA 1TZIB 4OLEA 2BDNL 2BVQA 1P84J 4GRMA 3CN4A 3ZT6A 1FYTA 4X80L 1QRKA 5DJ0B 1BECA 5TE6L 3U48A 5CSGA 4PB0H 2NW2B 5J3HC 3M45A 4JFHE 3S3SA 5T5NG 4NQVB 2J1KA 4PU2A 5KVFE 2ZYHA 3WN5A 4Q9QH 3CCHA 2F7OA 4J8RA 4NQED 3K6NA 5A2JH 5DJCA 5B38G 4GG6E 4RMVA 3FT0A 5F1KC 1GYAA 2H6PB 3TYGH 1NGZB 1ZIAA 3SJVD 5D70L 4BA0A 1JL8A 2X1PA 1OAUL 1T5WB 4JANB 4ONGL 4NC2B 4WWKB 4R7VA 2YGPA 1M7UA 3E8UL 3EFOB 1ANUA 1Y1UA 4L3AA 4NS0A 2YLKA 4RRPA 1QNZL 3VW3H 1SVCP 3QPQD 4M6OH 4Y16C 4QRRA 4LOUC 2IPTL 1GIGH 4LIQL 3KLSA 5JXAH 3Q0HA 3MRJB 5AOZA 3TH2T 3VD1A 1SFDA 1K4DB 2C34A 3L13A 5C0AE 2OXGB 2XWTA 4ORZC 5JIQA 1QFWM 3QZOA 1LNUA 4QTHA 1T20A 2AXFA 2YPLD 3MRQA 3KPSD 1NUNB 4MAYC 2BVEA 4UIMA 3T4AA 1R34A 4QAWA 3RWIB 3QQ3A 4OJFH 4UU9B 4NT6A 5ITFB 4F8OA 2DQDH 3WNLA 4JVUA 1MAKA 1DVTA 2V2WB 3HUJB 3RA7H 4KITB 2NY5L 3WY1A 1G7QB 3PGCB 4HZLB 2YD8A 3EOAB 5CIPA 5IVZA 2CM6A 2F54B 3DVGB 3C5ZD 2AK4B 3LXUX 3GM0A 3WMSA 4J3SA 3GJEA 3LIZH 3V6BR 1TLKA 4IGBC 2V9RA 1LK3H 5IK3B 1T2QL 4M5TA 3TBSA 4IHOB 4FQLL 4R96B 4QMEA 1FZMA 4Y5XA 1LL1A 4H8WC 1TENA 2J72A 4HH9B 5BRZD 3V6FB 3I50H 5EOTA 5KYUB 2BNRB 4GFTB 3Q7JA 4OZHF 4A7UA 4YHML 1WISA 4OLVL 1MCHA 4RSYA 1FDLH 4HUWB 4CJ0A 3LIUA 4P8QA 4XXWA 2G4EA 5TDPB 4WEBL 4P06A 4YDZA 3CZLA 3NJJA 1KCRH 3QUKB 1R24B 4MTMA 1CMOA 1NCCL 1KEML 2Y9RT 1P5UC 3QZNA 3RVUD 4ENZA 4GLRI 4H26B 5FUOL 3KE0A 4HT1H 9CGTA 3GSOB 5CJQL 2E9IA 3RX7A 2A9NH 2PXYB 4NENB 4E9SA 5DRWB 1RZFL 2VLJA 4M7LT 3CMOH 1A3LL 2PABA 2Y23A 4E42B 4X98A 3V0VA 3I84A 3QDHA 5KUMA 4W93A 3U0TB 1KTLA 2HCZX 2V5RA 2R29A 4BH8A 1IGTB 2AVGA 3QYCA 1HHJA 3ZMRA 1DBAH 3U0WH 4U6YB 3NTCH 2ZWLT 5IHLB 4MCYB 2BHZA 3CXHJ 3QJHB 4PG2C 1UJ3A 3K6SB 1ZHNA 5EO9A 4IM8A 3EJYC 1NGQH 1KFGA 2APBA 5EWIL 5DTFA 2V0AA 2Q3XA 1AHKA 2L04A 4N2GA 1T1WA 1ITCA 2ITDA 1UWGL 3NIDE 4H44C 2BCKB 1OAQH 1TZAA 1KB9J 2R0ZL 4FI7A 4W4NA 4LQFH 4U3HA 5EBWA 1JNLH 4QHUB 4R84A 4N20A 3C6LA 3GLAA 4I3RH 4UTCA 3V4PH 2CDGB 4XMKL 2P46B 5BS0D 2W91A 3MBWB 4MSWB 5EBLA 3QG7H 5LN4A 2JB5H 1M7IB 3TT1L 2R8SH 5F2FA 2YXMA 2KL6A 3O6KH 3SO5A 1E0OB 4JPVH 1KY6A 4BSWB 4ODTH 1EEZA 1P2CB 1Z9SA 3NJVA 3DTXA 3ISRA 2RB8A 1RVFL 4RGNB 5C0DA 3X3FL 4F2ME 1MI5B 4AMKL 3O8XA 1C5BL 2DJMA 2Y07L 3OXSA 5FA3B 2FEDC 4XE5B 1CURA 1WZ1H 3LNIA 4G8GE 1UC6A 2ATKB 4Q6IB 2EDMA 5D6DC 5J9PB 4MXWL 4HPOH 4PRPA 5LGHH 1A0QH 1XIWC 4JHAH 3W81A 4Q52A 5E94B 3TV3L 1KLFA 4H5SB 5IQ7L 3LN9A 1Q38A 3WTUA 1VZHA 2FWLB 3N3EA 4L8BA 1A3ZA 1GS7A 3ARRA 3TWCH 5IZ7A 2GTZA 1V7NL 3B9KD 1AQKH 2XKNA 3U82B 5D1QD 3WGVB 4M8QA 4YE4L 4PJBE 5DXWA 4TL5A 4IEFB 3FYEB 5D6CA 2ODIA 2BDNH 1YY9D 5CMAA 4ZMTA 1I85A 2MQ3A 1JGDA 2Z31B 5AVSB 1P4LA 4HJ1A 4BQ9A 1OGAE 2QPSA 2R2EB 5HGAB 4B27A 4HULB 4HOWA 5AVRB 4R5VA 1YNTF 4UANA 3OKDA 3D3VB 1HK6A 1JD9A 1Y6KR 1KYOK 4N9GB 4LLQA 4RIRB 5JW4Q 1KB3A 2MCMA 1JF6A 4F8PA 2BW5A 2IADB 4WWKC 4UOW1 4Z77A 1AAJA 4N2HA 4UWQB 4JFQB 5JA8B 1CUOA 4B7LA 1EFQA 2XXCB 4J7RA 3RHWF 4NN5C 1NC4D 3BSGA 5D70H 4XXDA 1IGCH 3QDAA 1FPTL 4ZBJA 4JDTL 4PR5A 3IDNB 1TNMA 4MDIA 4F9PC 1XF4A 1YNLL 1QNZH 3OPUA 4FGMA 4K8RH 5B38A 2BVPB 4HWBH 4XP1L 5GSVA 4LIQH 2F0CA 4FFVD 3U9UA 2NLJB 4G2AA 1OSZB 1YG9A 2H0FA 3DV6B 2HTKC 3EGDB 5JW3L 3FU8A 1LO4H 1I7UA 1BBDL 3OB8A 5KYNA 5E9DD 1MG3C 4RAVB 1WG3A 2ADJA 1BD2B 2D3JA 3RKDC 3H9SA 5MENB 2DMGA 4KK6D 4U1HB 4G9FA 1IBGL 4OM0L 3L9RA 2VSMB 2OJZH 1WAAA 3HMXH 4WO4B 2NY5H 5D7JA 2JLPA 1XTMA 1QR4A 3BD5A 1S5HB 2XCMC 3MV8E 1G6RA 5KWYC 2NR6C 4BFEA 1RZGA 1UM4L 3CE1A 6CGTA 5F88A 4C58B 3GS0A 3B3IB 4LK4A 4FQLH 1NCWL 3RUGA 4HD9A 1IIIA 2VJXA 2EVGA 3NCFB 2WXHA 5J57B 1K2DA 4HS3B 3TO4D 3MRFB 1MFUA 3FKUS 4FTVB 5CP7A 1FE8L 1PFCA 2D7TH 3RWFB 2I7OA 2ZKYA 4WWID 4DO4A 3VXMA 2CR0A 4PMFA 2PXYC 3C5SA 5EUKB 5KVDL 3B6SA 2N3JA 3KYKH 1NCCH 1KEMH 4ZTPH 4GI8A 4YXLL 4GI6A 1L3NA 5FUOH 1RFDH 1SPDA 4NRZA 5CJQH 3ZL2A 3QXAB 3N91A 3EOYG 2EZ0D 4NQSB 1MWAH 1RZFH 1B3JA 1Y6NR 1A3LH 1DSYA 2A83A 3T4YA 3SKNB 3MRIB 5EO0B 1CDJA 2AHIA 1RZIA 3CUPB 3OF6D 3WS3B 3P77A 1AGBB 3IFNH 1SQ2N 2ZSVA 4OJDH 5BXFB 4ZDHA 1DQQA 1S6NA 3MCYA 3CFTA 2HKFL 3UAAA 5JW4N 2AQ2A 1N0XH 3C9NA 1ZMYA 3QJRB 3DOIA 3E8VA 1DBMH 5EWIH 2FT8A 1IC1A 5IB1B 1W72B 2XN9B 2UZIH 4QXWA 3ZGHA 4JCMA 1RZ7H 1S3RA 2VZSA 3N40F 5AAMA 2DQUL 4MHHG 1QLEB 4HCRH 3B2UC 5PAZA 5AG9A 1HJBC 4PUBL 3ECWA 4TN9A 3DO7B 2R0ZH 2R23A 3FZUC 2CK0L 1ZK9A 2PTVA 4X4MA 5KG9A 3CZJA 1QFUL 5A43C 4BDVA 5HYEA 5B1JA 1C08A 2W88A 5FYJE 2ID5A 3E7JA 1ZS8A 3NZHL 2MSPA 3QUXD 4XMKH 4RGNC 1OZTG 4TLTA 4MA7L 5LUMA 2G60H 5FGBA 4PJFA 3TT1H 5BW7C 4MD4B 2CKNA 4GBXC 4JEGB 3BQUD 1X9LA 4MJJA 1ZA6B 4Q6IC 3F01A 1RVFH 5B3JE 2EUWA 2EEAA 3MA7B 4AMKH 3FXIC 3RFZB 1C5BH 1S7RA 3CG8A 3L7FB 2Y07H 3Q5YA 4OD2A 4YR6A 4BSVB 2Y72A 4X9FA 3TP4A 3NFNB 1LE9A 1J18A 1JNHB 1JZEA 3VXPA 2BLFA 4HLEA 5MEOA 5IW1A 2CKBA 4HPYL 4MXWH 1E3XA 3LN5A 5DJXB 1Q9WA 4N28A 5F21B 3VFNA 1CGXA 3TV3H 1F90L 4K55A 4JFDD 5IQ7H 2FZ3B 4I0PA 5IV2A 1EV2E 1K8DB 4I2XE 1SJEB 4MA1C 4PG9A 2Y24A 3CZNA 2Z31C 3KZ8A 3BMVA 1V7NH 1DVSA 1JUFA 5FCUH 5EU7E 4JQVC 4F7EA 2Q8BL 1BVKB 4XH2A 1A9VA 1EJFA 1T03H 1K72A 4W6YB 4XNYH 3HBQA 3WLWC 4OF5A 1CXIA 2Z92A 4ODWA 4AYMC 4F8LA 2EE6A 3MNWB 2HT2D 4FXKA 1R5VB 4QIRA 2QLVB 3FN9A 4HIXL 4NDMB 2CLZA 3BD4A 3P4MB 4L4JA 4PLJC 1JWMA 3FQNA 4XOEA 1I9RH 2PP9A 4WFGE 5EFIA 4N3UA 3V5KA 1OF2A 3GB7A 4HFWB 3BN9C 1ROWA 4QXUL 3WELA 3BKCL 3ULSB 4GB9A 2X4SB 4P5TA 2D0GA 1MJUL 2WNXA 4M6AA 4PJHA 3L1OL 3JWNG 3D6GA 3ZDXB 4JO2H 3EJZD 2X4NB 1CFQB 4JDTH 2VLKB 1QZ1A 3ZBMA 3APCA 4R4ND 3II3A 3PWLB 3AG4B 1U8HA 1YNLH 3UBXG 1QMUA 3ZJAA 3ARBA 3Q9PA 4R90L 1T83C 2DQHL 5DJZB 2E7HA 3MV9B 4BWWA 3G9AB 5IJDC 5E2TH 1JYNA 1A14L 5T8IA 3T1WA 4GUPB 4QHMA 1G6RL 5C0GB 4ISVA 1A64A 4WO4C 3JYCA 2DJ4A 4MYWB 4MJIA 1F42A 5MEPA 1IBGH 2NTFB 1DLFL 4OM0H 1QACA 1UM5L 3BVVA 4Y5VA 3JT0A 5C0NC 5E7BA 3CZSA 4WW2B 1GGIL 5HHMB 3PWNA 2HRLA 1S8DA 4QRQA 4Y5YB 1AGFA 1UM4H 2X12A 3PS6A 1II4E 1RI8A 2FJFA 4JHZA 2A74A 4DETA 2Q7YA 3OM3B 4R2GD 2OSWA 2ZOTA 3LHPL 3ARXA 2CAKA 3K6IA 4QI3A 1PD0A 4X8XA 4F33B 3OPZL 1P6WA 3UP1A 1NUFA 2WLLA 4ZMOA 2R29H 3SDCB 1TNNA 3ULUF 4C8XA 5KVDH 2LABA 4HLZG 4EN3D 3MV7D 3MZTA 1RPUA 4Y4HA 3JV6B 5HY9A 4YXLH 1F6FB 4NQXA 4TS6A 4ZO7A 4YE0A 3RRQA 2E27L 4IOFD 4P48A 4XCCH 5EN2B 3BUYA 1X7QB 4PGBB 3NCMA 4W4OA 1UD6A 3ABKB 3I9GL 5C07A 5HYSB 4FHKA 4KKLC 3DX7A 3BAIA 4Y2DB 3BVNB 2ESVA 4PPTA 2UUDK 4QRSA 3M7FB 1TU2A 5E56A 3MODL 4FQIL 2FLBT 1H6TA 1ZA3A 4WFHD 5DUBA 1IFHL 4CADB 1QD0A 1I8LA 4BRJA 5TPWH 3MRLA 3OJMB 5HHPA 4TQIA 4FA7B 4GS7B 1R3KB 2YO3A 1A21A 1OE3A 3DHMA 3KPOB 2HKFH 1N6QL 4C4BA 1DN0B 3VFVA 1Y7VA 5IMMB 4LHUB 5GHWL 5E08L 4JFEA 1WBZA 3HZVA 2UYLA 3FQUB 3UTZA 1TMCB 1CO1A 1IM3D 4LDCA 4PRBA 4J12A 3UMTA 3FTWA 4WF7A 4MBOA 4DN3L 1P6FA 4PUBH 1ZGLA 4XCFH 4GYBA 3T04D 5EIIG 2V37A 1IBHA 2P5EB 3LH9A 4XZUB 1AMXA 2CK0H 5JQHC 2DWSA 4MA8H 2X10A 2KHAA 1CXKA 3NZHH 2CKBL 4RA3A 1KBPA 2YPVA 3PDGA 5F1IA 3RFZC 2NY2C 1BQSA 1WZLA 5E8DL 4GQ9H 4R7DA 3F7YB 1YQVH 3ARDA 2X1XR 5T5FA 5BJTB 3CHSA 5DHEA 4Z7AA 5HHXL 1NCAL 4TVPD 4U1GC 2CXGA 3TJHC 1X5LA 2R27A 1EAPA 1DQMH 2YQGA 4HPYH 5FO8A 2IG2H 4GG6A 4BZ2A 4DQAA 3FRPB 1Y1DA 1PDKB 1JWUB 1T5XA 1F90H 3BO8A 1O75A 1ZWIA 4GXVH 3MRKA 1UB6A 3MRMB 1A2YB 4FQQA 1FAKT 1ZE3H 4LSRL 2XZZA 2FH8A 4DVRL 5BNXD 4MNGB 3UJTL 1RAMA 1G0YR 2XQBL 4JRXD 1YEEL 3GMPA 5FIEA 4O5LL 5ERWA 1O9WA 5DUPL 1OAXH 4N6QA 5C0AA 5DJAB 3IJEB 5E1AA 1F4YL 2Q8BH 3UP6A 2EIJB 2XJKA 2MIZA 4CSTA 5IR1A 4ZMQA 5KYYA 3GMNB 3VTTA 4ZD3H 3F6LA 2DQJL 1WHPA 3IFOB 3LQZA 4NRXB 4X0KA 3UZVA 4RZKA 2YEVB 1TYEB 4HIXH 4R26H 1B4LA 1S5IL 2C5DC 3QXDB 2Z4QB 3MGOB 2ZCLL 4WEMB 2H9GB 1VGEL 1VHPA 1PNCA 4KXAA 1CDUA 1NBYA 3NEEA 1ETZA 2CPCA 4QDGA 3DBSA 4FNPA 4QXUH 3BKCH 3SKJH 4K2UL 5AW8B 1MJUH 1UWEL 3SCMD 1EXUB 3L1OH 5B1KA 3W9EB 2X0WA 4NWTL 4EQ2A 4F1ZA 1JOIA 3UAJA 3NJHA 1AD9A 3WMQA 1G7IB 1S3KL 4XT1C 25C8H 2OYMA 4PEEA 4FA8A 5B3NA 4JRWA 1U92A 4FI6A 1F11A 4UQBA 2XG4B 1EZVY 1OP3K 3DKHA 4NOBA 1ADQA 3OG6B 1WZMA 2QFRA 3L2NA 2R1WA 4LBEA 5JIKA 4U4BA 2QADB 1NDGB 3NIDF 1WCBA 4WUKL 1G6RH 2BIIA 4GW4B 3RTQB 3TEYA 2FYYB 4W81A 2QGEA 5KVEE 4LLVA 4AIZB 4EI5B 1Z9OA 5A2KH 3DOSA 4LSVL 3EXLA 5LGJB 5E1HB 1OKEA 3BWZA 3ISYA 4Y5YC 4APQC 3O4OB 3CC5B 1JP5A 5HI4D 5D7EA 4P2QD 2EIEA 3FDWA 1GGIH 1SHXA 1DJGA 5KAQF 1IC4L 1T4KB 1LWRA 4X2UA 5I15L 2YR3A 2FUTA 5HHOD 1QVOA 4JHVA 1EA9C 2NUPA 4KQ4L 2GK0A 1JGIA 4QF1A 3RPKA 1B4RA 1GRWA 3LHPH 3SDCC 3HR6A 2ZT9C 3KH3A 2E7DA 4QRUA 1O6SB 4A38A 3PG2A 2OYPA 3BXNA 4R97B 3EDJA 1D6VL 3CX5J 4W9IC 1PG7X 2HRGA 4HKZA 1W2KT 5KSAD 3HG1A 4FXGC 3VRIA 2GVYA 3IPBA 3P3RA 2V7HB 5SWZE 4YDIL 3EDEA 3VJ6B 4JQIA 1QX1A 4AG4L 3PWUB 4IBVA 4YBHA 4Y2DC 4AJVA 1S7WB 5GS1A 4J6RH 4PRHD 4OCSL 1UD4A 5AVXB 3I9GH 4PJBF 3FB7A 3HE7B 4NYLB 5AKRA 3K80A 3GSRA 3SJVB 3LQAL 2FL5A 4CA4A 1IUZA 1TDQA 3I85A 4FQIH 4K71B 3Q06A 1IFHH 1ULVA 4XBPB 4LCWE 2HX8A 4TLUA 4UUJB 4G8GA 4XZ4A 4ZFZA 4LSDA 4CKQA 3WFCL 4WUUD 5E4OA 3ZVVA 1A9EB 4K9EH 3APFA 3ZDZB 1RK0A 3BUTA 4WHTB 2GEQA 2VL5B 2YPVL 5IFJA 1NOFA 2Y1VA 3HLKA 1J11A 4MQTB 4YHPB 3UJJL 5IHWA 2TRHA 5T5FL 4X7DC 4RCAA 2KDYA 2ZUYA 3KPSB 4DN3H 2WXLA 1KIQA 1UJTA 4YGVB 3T1FA 5F0LB 1QBML 2A73A 4KH9A 5FM5O 3PUUA 4ZMLA 5JHDB 1IEAA 2ZCHL 3MOBH 4RDBA 4YSDA 4PJ8A 5K93A 1QRND 5F70A 4BZ2L 1JRHI 1E5YA 2I25N 2X4PA 3QIBB 4YSSA 1OXYA 2VR6A 4XO5A 3N43F 3IGAA 2VM9A 3ML9A 1D5RA 5EIIA 3SDDC 3LPFA 3RL1A 3ATBA 4DPRA 3CVHA 2W9EL 4BFRA 1HHGA 2WZPD 5HHXH 1NCAH 2O5XL 5EU5B 5CZVL 4WU7A 5TH2B 1MLBA 2N0MA 1FF5A 3K46A 3RPIB 3VWJB 2BVOA 5EN3A 4TKWA 2NNAA 3VFUB 1FHGA 3IRPX 3CDZA 3DC0A 5F9WB 1OP4A 2QDVA 3KYOB 2J57A 1KC5H 2IDQA 2WW8A 1GYUA 3VU2A 4XO4A 5AAPA 5D7LA 3IGLA 4DK3A 2LGNA 2PYFB 3O3AB 2JV6A 2WTOA 3P02A 1HKLL 3PWPA 1P7HL 1PLBA 1I1CA 3KNBB 4H7VA 3MJ9A 4RRPM 4AZ8A 4DVRH 1FYTD 1XD1A 1LK2A 2VIRA 4J3OC 4PLKC 2NZ1A 2XQBH 2XYCA 4QRFA 1YEEH 5BV7L 5ISZE 5D7IE 5DUPH 2FWOA 4M3HA 4LCCC 3SDXA 1W6LA 3HZYB 2ZXQA 1F4YH 4AEIL 4B9KC 2V2TA 1T4WA 3S5LA 3BP4B 4U1JB 4J28A 5D1XE 3BDXA 3S37L 3KW8A 1QTSA 3DECA 1HYSD 5SX4H 1D2OA 2DQJH 2FH6A 3A0OA 3G5YB 3GHEL 3B8YA 4M7ZB 3BDYL 4P59L 2X6VA 2VDRL 4XRCB 4EJ1C 3X13A 1TVBB 1S5IH 4DP1X 4IHBA 3W39B 1PZDA 2ZCLH 3TT3H 4KRLB 4GKNB 4N26A 3JBG7 3VA2C 1S9YB 3FJTA 4YS4A 3MRRB 5DVPA 1YAZA 1ADQL 3MUHL 1J8HB 2VITA 1HXMA 3Q2VA 5I24A 4HIEA 1D5BB 1CGYA 1GZQA 3F12B 4FEMA 4QRRD 4XNDA 1SMOA 2ZJSL 3AWGA 4K2UH 3D0VB 1UWEH 4HBCL 3WUWB 1BXXA 2ZF8A 1QLFB 4NWTH 5F7WC 1PJWA 2DJUA 43C9A 2WLZA 4KDVA 1JZJA 1S3KH 2QADC 2AEWA 4N8VB 4UINH 2N59A 2YD6A 2W94A 1AMYA 2A9CA 3B5GA 2XQYG 4FQPA 4JY5L 3RTQC 5L88L 2QKIA 3FOMB 4PRIA 1KDJA 3VXQA 2WUCL 2FHCA 4EI5C 5AW4B 5I6XB 3UG4A 4HEMA 1J5HA 4NM8L 3GO1L 3RVTD 1UHVA 3O9WB 5CEZE 2XPZA 2O6PA 1QLRA 3O4OC 1MCLA 2VJ8A 5JHBA 3D8MA 1PCXA 3L2LA 1RPQA 5DMGC 3WTXA 1A1MA 2FQFA 4LSVH 4M9PA 4F57L 4NQDB 2B59A 1JK9A 1G7HA 4GLRH 3VXSB 1KZQA 4ZPTB 4NRYB 5F7YC 4BUGA 3WJMA 3ISWA 2YBGA 7TAAA 2NZ9C 5GS2H 1R5WA 5GRVL 1IC4H 5DYOB 1Q9LA 2BVTA 4J3WA 3H8NA 4DKTA 1MEXL 4JQIL 4G43B 1PZCA 3CZEA 4M1DL 5DK2B 2KLTA 4OIBA 4LKCB 2Q3AA 3VH8B 2W0FA 2W59A 1A4KA 3H9ZA 3ULAB 5IOPA 2UY6B 4OD3L 4FNLH 1A5FH 4F9LC 1N5YL 1SDDA 2VLJD 1D6VH 3KLLA 4HJJH 1IE5A 1NFDA 2FLMA 4PCSA 4JFYA 4E2OA 2YAMA 2ZOWA 1I7ZB 4HAKA 1ZHLA 4QRTB 3GSQB 2ICCA 1I1YA 2XWCA 5AVTB 4AG4H 1EMTL 1AY1L 1AH1A 4XWOC 2JCCF 4ZYKB 2F54E 4G8IB 5C9KA 3QZMA 2AK4E 3QR2A 3L5XH 4K71C 3X2QB 3ZUCA 3FCSA 5IROA 1WF5A 3PFQA 4KO7A 3VNZA 3OX8B 5F6IB 5LNEA 3IJSA 1PX4A 1NC4B 3KGTA 4J4PA 4BFNA 3U6XA 4IU3A 2X1OA 1KNOB 4LL1A 3HNTL 4EDXB 5KZCD 1MFAL 5CF3A 5KSVB 2JCWA 5E8NB 1G5AA 1UKSA 1CFMA 2VXUH 1S9XB 4DGWC 1XH1A 2AXJA 4POYA 3KVQA 3ZTDC 4L8CA 1U21A 1XGUB 1ASQA 3C6LD 2YPVH 5FYKL 4RFEA 3FU3A 1D7FA 3K6FA 3UJJH 1DZ0A 4QHKJ 2KZBA 2ITEA 2YK1H 4PJ7B 3HR5A 4XI5C 5T5FH 3S3JA 3U25A 5GS0C 1A7RL 1OSEA 4HUXA 1T0NA 1XL4A 1XR8A 3E9UA 4TM9A 3JT2A 5EC2A 3WKPA 5T3XE 1DBJL 4NZJA 4K07A 4WJ5B 5D7SH 4WGVB 4PWEA 5I19L 5F89B 3QIBC 3NRFA 3O8XD 2ZCHH 1ZT4B 2J44A 4M7KL 3JSSA 4YUEL 1HZLA 3T65B 3IT8D 3TBYB 1YN6A 3RZCB 4BGLA 1HL5A 1Z5HA 3CPLA 2BIOA 1TR7A 1D5MA 4PRPD 4HWUA 4LLMA 1WT5C 2W07B 4HC1A 4X99A 4DGYH 2O5XH 5F9WC 5CZVH 3M46A 3C60B 1ZDSA 3AM8A 3MJ9L 3F7PC 1NLDL 3HI6H 3FSWA 1KTDA 4G7RB 2F1EA 3WE6A 1SEQL 3HI1B 5K1VA 1B0RA 1SHSA 2IALB 4OB5L 4TYUA 1DJYA 4XNBA 5T3ZH 2YQ3A 3UPRB 1V3MA 5IBLD 1RLBA 2R1XB 4OJAA 5LCVA 5DJ8B 5FKAA 5IMOB 3S96B 3IJHA 2ZNXA 1AXIB 1JZ8A 4YHZH 3DUUA 4G70B 2VR3A 4DGUA 1I8MA 2VJ0A 4PV8A 3BPNB 2OXHB 3O4LE 5T1KA 4JFOB 5BV7H 5MHSD 4RGNE 3COOA 1MI5E 4U3XA 5IVXA 1IAOA 4IKLA 2DIBA 3PAZA 3QCUL 3VFSA 3WY2A 1CJYA 3D18A 4AEIH 4M7ZC 2XY1A 2XJLA 1YUKB 1I1FB 4PS7A 3GJFH 4MBRA 4U6HB 4CN1A 4CUCA 3MRBA 4AV5A 4H0HB 3V4VB 4ICXA 1HNGA 2YPKA 3BVXA 3NSJA 1YEJH 3GMOA 4H40A 3WY3A 5A3ID 1QBLH 1WGOA 1A4JB 3LAFA 4K5OA 5L4JA 5IIEA 3QJXA 4F7KA 4IKNA 3ROLA 1U8QA 2X4UB 1ADQH 3JWOH 5I6MA 4BFIB 3EJCA 2BSRB 2CD0A 2HG5A 1G1OA 3JWNH 1BZQK 5GIRA 4A2LA 1J1PL 1W0WB 2ZJSH 4YVNA 5DWUL 2AK1L 3A4FA 1CTOA 2LU3A 5J6GA 4M62L 2X2UA 3ZYOA 3GZQA 3WMPA 3A6OA 3H2QA 4FFYA 3LV3A 4KY2A 3TIEA 4B9YA 5I6XC 1CN4A 1OQXA 5ENWA 5LXVA 4IDLA 3H9SD 3O9WC 1W6WA 4JY5H 3SBQA 5L88H 3K4ZA 4HIHB 4G9FD 4HWNA 1YAIA 3S5ZA 4AIXA 3SODB 3D3VE 3U6RA 4IRSB 4NM8H 5HYJB 4YSTA 5D7JD 3KPMA 3H4HA 3D9AL 4LP8A 4OSUL 3RWHA 1NCHA 3AWEA 4LCYA 4Z1PA 2VDPL 4MD0B 3MGTA 4NZTL 4XTRC 1KCUL 4KKAC 2I07A 3KWTA 1I8IB 3GD1C 2F1AA 1AR1B 2HVKB 4LSTL 2ORBH 4L5FE 3SBPA 1IX2A 5EZPA 6PAZA 3NCJL 2J8OA 2YGVA 3BAXA 4WU5A 3I75A 2O5ZL 1FFNB 5L9DL 1URIA 1Z7JA 5EOCL 1IGYA 1R46A 1YY9C 3LD8C 4NKOB 2GC4C 4M3KB 4JQIH 4I85A 3LKOB 2J21A 3KXFA 3BWUC 4LEOB 4N0CD 4U6VL 1XXDC 1YDPA 5I5MA 1SOKA 3PDDA 2W60A 3PAVA 2CDEB 4HIQA 2D7PA 1AGDB 4LQ1A 2FE0A 5LBGA 3DX3A 1FH2A 3FL7A 1BD2E 3TEZA 5MENE 5C7XL 4U1MA 3VGEA 2JF1A 3TURA 2BO0A 2JI3A 4WGWB 4XBGB 4OFQA 2NT1A 1MNNA 4WTZG 1AS7A 1EMTH 2DLIA 1AY1H 1J05A 1F18A 4QR7A 5F6IC 2YXWA 3GTTA 5HI5D 1XGTA 4N2KA 2WINB 1BYOA 1MUJA 4OLXL 3FO9A 4E0RB 3DGDA 2M2DA 3MNZA 4W9CC 3RAJL 1MHPL 1UYWL 4X83A 5IUSA 5KSBA 1VA9A 4F7MA 4DGVL 3IF1A 4J3VA 4OCMC 4Z76B 2VN7A 3VD5A 4QUOA 3NQKA 4AQ8A 3HNTH 4CAGA 2XWEA 5F6HI 4ESKA 1RJZA 4FTVE 3EO0A 5D2LB 4EPSA 1A7PL 4MRBA 2WWKO 1LEGB 4TSBH 2FJHB 5DMKA 4PRNB 5FYKH 1LQSR 1F4AA 1OAJA 1HEHC 2F1BA 2GSIA 3MFFB 2ZUQB 3QUMB 2NCEA 1USQA 2PWDA 1A7RH 4KI1A 4OZ4B 1A4AA 3CVHH 4HC1L 4P2AA 5IB2B 3E6FB 5IKCA 2ZF9A 3WXVL 4KH2A 3RZCC 1BF8A 4LDEB 3BH8B 4M7KH 4ZX4A 5C0RL 3FH7A 3Q1SH 4YUEH 1RUAL 2BINA 4GKOA 4C59B 2J20A 4P4KA 4PWIA 5FO9B 3HB3B 3ZT5A 3IJ8A 3NIGF 4XMZA 3C60C 4DZ8A 1ZGLP 1A6TB 2EDXA 3KL3A 5AW9B 1BREA 1HHHB 2XN9E 1P7BA 2COVD 4N5UA 3EH4B 1EHXA 3MJ9H 1E9QA 1J9RA 4I0PD 2JLLA 3AU0A 1IM9A 1XT5A 1AZCA 3VGGA 4I5BA 1PIFA 5IOKA 4OB5H 3W1ZA 5LAPA 1HN1A 3BPNC 3DHPA 4HJIA 2CBPA 4EN3B 1GKOA 4OLUL 1J8RA 2HTLC 3D50A 2OTPA 1E6OL 4PRAB 5EEXA 4YWGL 4MVBD 2JJTC 3PV6A 5HHQA 1QUPA 3KPTA 4EE2A 2HA1A 4JNXA 3P9LA 3FFCE 4CILA 4IBLT 2UWEE 3O11A 4PIBA 5BZDA 3QCUH 4N6RB 2W80C 3E9TA 5DD1L 2NY0B 1YSOA 2AABH 2MOVA 3EJQA 2Q2LA 1QA9B 4X6BA 3QDGB 3VYNA 3ZE1B 3ZR6A 2FQDA 2W9DH 3TX4A 4BQCA 4ZUSB 1MHCB 1G7MB 1XR9B 4EDWH 5IBUG 1R33A 2NPLX 2AQ3A 2X05A 2J88L 3IE9A 3RWEB 3DURB 3S9DB 3VDAA 4MQXD 5AKVA 1GJWA 4FFYL 3W11C 3UYRL 1WZAA 1N26A 2MQGA 5I30H 3OKYA 1GS6X 1QUNB 4C4UA 1MH5A 3Q6FB 1QG3A 2DKMA 3UTSB 4HUMB 3QZWB 4KI5D 4LF3A 2Y3NA 3ARBD 3QUXC 4JKPL 4ZPVA 1MCSA 3Q01A 4I1RA 5DJDA 2YIHA 3BCDA 1TF4A 2AJVL 2DIAA 3AS2A 2AK1H 5ICZA 4JDZA 3B7TA 3T6WA 3H4FA 3NH7L 4M62H 4OCNC 2N0KA 3GI9L 5GZNC 5TDOB 3IAQA 4FG6D 2ED9A 4Y16A 2CUMA 2R4RH 3L95B 4V1DD 4DEWA 1IBBA 3HS0B 3V4PB 2R0WH 4IRSC 5J89A 1LO2L 2V9QA 3SO3B 4ZFFA 3CHRA 3Q44A 2LLNA 3C5XA 2CCLA 4MJID 4MGXA 4GMSL 3J8F7 2CBTA 4H0LC 4MAYA 4Q4IA 4RA0C 1AR1C 3KPPA 3D9AH 4Z7NB 4PP1D 4A6YB 1OL0A 4QCIA 1K5WA 2HRPH 2VDPH 2V5TA 5G55A 4YZFE 5T1MA 5B39A 2AQPA 4KJPD 1DO6A 1Q9OB 1FV1B 2AQ1A 1MDTA 4P9HL 4RQQB 2RGSA 3WCYA 3ZDXE 5I0XA 1IQWL 5IB5A 1OARL 5GGRB 4W9DC 1PCSA 2VLKE 4P4RB 1U4FA 1G9NC 3G6DH 1VERA 5FA4A 1UXWB 4P23B 4JUSA 1NPJA 2O5ZH 5L9DH 3A47A 5HXMA 3RGVA 5EOCH 4FJZA 5ALCL 3L3DA 3WIFA 3ZUNC 4FFWC 3S4SB 5I1AB 1HSBB 4WWNA 1ZTMA 2Q3ZA 3MV9E 3G3LA 5GS2D 2X7LB 4WI2A 1M1XB 4U6VH 2Z7UA 4M5ZH 1OSPL 3EG9B 3HC2A 2D3NA 1Q0XL 3QFDB 3WTWA 3INOA 5FKPB 4XMWA 3CFEA 3GBDA 3GM8A 1UB5A 2G2RA 3HPLA 4M4PA 4OJCA 1RCYA 5C7XH 4HG4J 1ZGLM 1HVXA 1VPOL 4JM4H 4YPGB 5C07D 5AOKA 1FL3A 3GIVA 4GQRA 1CLZL 1CD8A 5CU5A 4ZFOB 1HXKA 2VN5A 5CD5C 3C2AL 4TNFA 2OR8A 2IAMA 4OD1L 5CR1A 1VGKA 5I17B 5CHNB 4BFBD 5HHME 5D7IF 4PRDB 4A7GA 4O02H 4OLXH 2WNKA 3FU7B 5CBAA 2YOCA 4HGKC 3WDJA 1OANA 4PJDF 5IVOA 3RAJH 1MHPH 2BOBB 2BP8B 3D4GA 3MCKB 4FNSA 1ONQB 4R7NA 2CR6A 1R47A 3NUKA 4DGVH 2CBQA 2X6UA 4JPKL 3D12B 4R8WL 4JFED 3RVVD 3UTTA 4FYRA 4WTZA 2X2IA 4NIKB 2A6JB 2ZWKA 4Y8DC 5GGSY 2BSEA 3VXUB 4PG2A 1KWGA 2LTQB 5DMIL 3LPOA 4AGNA 1G7LA 1JRHL 1NBZA 2CLVA 2J71A 1ZLVK 4EUPG 1ZD6A 4I1NB 1A7PH 2ZUQC 2MTAA 3L81A 1G9EA 4IS6B 4OCWH 2TSBA 2GAZB 5DCCA 1IFGA 2YSSB 5GJSL 2PP8A 1SJVA 1ZSHA 2IMNA 4L37B 4JG5A 3UMNA 5CWSB 2XBDA 3HNVL 1JK8B 2YAPA 3NPSC 3APDA 4X8CA 5F7EL 4HC1H 1DCEA 1AKPA 3ARDD 2MOGA 2X44D 3DIFB 1XH3A 3FFDA 5ISZA 3WXVH 1FFOA 4HU2A 3FB5A 2FR4B 1EXGA 1IEBA 3KHOA 1OTTD 4JFHD 3VD7A 5C0RH 1LEKB 2AQNA 3R8QA 1T66D 1KACB 3MLPA 4AX3A 2O4EA 1UT9A 1PLCA 4ODSL 5D1XA 1U3HB 5H8DA 3WHE0 4EN2A 2WXNA 1TZGL 5LCVH 2ZAIA 5TGBA 1VKXA 2FSEA 3VDCA 2OMUB 2BNUB 1DVFA 5E6SB 5AD0B 4DP5X 4UIKH 2B16A 1C7TA 3QC6X 5D6DA 3KEHA 4PWFA 4EN3C 1XIWA 4OLYL 1P7QA 3CHPA 1S7XB 3B3BA 1PEZA 1FUNA 2X28A 3I9IA 2P5EE 1DEEA 1XGRA 3HZ3A 1KN4L 1YNTA 4DWHA 3FUFA 5C92A 3VQ2C 1VDGA 3LXBA 5CO1A 1CFSA 4WHDA 3DX6B 4AH2B 2IQAB 3V7AE 5C0AD 1E6OH 4NZFA 4ENED 4YWGH 1TZIA 5KVEL 5E99L 1ZXKA 4OCXL 3KCPB 1E7VA 2NY0C 1H3PL 3U1QA 1FYHB 2JKRM 2TSAA 3T0BA 3D69B 4FLSA 1MWAB 2NW2A 4XAWL 2F53B 4OQTL 3UTQB 4NQVA 2OQJA 4LPUA 5LNDA 5DD1H 3EGXB 1BM3L 1ADWA 3IMWA 1FFTB 1BMWA 1E8ZA 2OJEB 1JNJA 2BH0A 3U79A 3OKNB 3S48A 1Y18A 2X2HA 3TH4T 3SYOA 2G5BB 5MEQA 3LH2L 3HNSL 3VD0A 2YKLH 2H6PA 1JTTA 1NGZA 3LMJL 5E6IB 1FRGL 3ZHLA 4FFYH 2BFVL 2EYTB 1T5WA 4JANA 4LSQH 4B97A 1X9RA 1ED3A 5DO2D 1ID2A 3EFOA 5FHAH 1IJNA 4MNGE 1KIUA 2NW3B 4XVTL 5EO1B 2YSTA 4S0SD 2PW2A 1DLHB 2B5IB 4JJ5B 4Y2NA 5GS3A 4CSSA 2JI1A 3HS0C 4MMZA 4UV7L 4ODHH 4F9PA 3MRJA 5DURB 3W5MA 1K4DA 2H3KA 2DAVA 2OXGA 3GI9H 3L9YA 2R4SL 2ZZUT 5AUMA 3NZ8A 2CIIB 3NCBB 2AERT 3V52L 2PYEB 2ZCZA 3QDMB 5I76B 2AC0A 3IYLW 2AJUL 2GJPA 5AB0A 3RWIA 4UU9A 4GMSH 3N44F 4UT9A 4Z7UF 5CKAA 3C12A 3HUJA 3L48A 4L8SB 5I74B 3PGCA 1BFTA 2ADGB 4HZLA 3EOAA 3DVGA 2LFGA 5F1OB 3TGXA 1J1XL 4LPCA 5GISL 4P23C 3KM1A 2YZ8A 1CFVL 2WAHA 4BRVA 3B5HA 3ZMNA 4IHOA 1RP9A 4HEPG 2FO4B 3I6LD 3SZ6A 1OARH 4TRPL 4R96A 4CVXA 1TTCA 4OGXH 1DQDL 1RQ5A 2NR6A 1S7SA 2AKRA 1CIUA 2FDBP 3V6FA 2AQSA 2BNRA 2F61A 4OZIF 4N2FA 3EOTL 4D0CA 5ALCH 2Y2WA 3FQTB 4FX5A 5TDPA 3HG1D 1E9OA 3NFPB 1RMFH 1S7UB 1SXAA 2IF7A 4N9OB 5F7BA 3QUKA 1R24A 5L7XL 3T3ME 3HG2A 2XACC 4OFPA 4XHJD 1FFQA 4H26A 3I9AA 3JVGC 1I3GH 1Q0XH 3ZTCC 2BHUA 3GSOA 3QA3A 2XOTA 2PXYA 4PGDB 5DRWA 5JMOC 1JZIA 1RK7A 2N01B 3ECVA 1VPOH 4E42A 3DX8B 4QEGA 5GRUL 1NQBA 4LESA 2OW7A 4OF0A 5I8KL 1CLZH 1DJSA 3QHTC 5IQOA 1IGTA 1OT1A 3C2AH 3K3QA 4R5XA 3VGDA 4OD1H 4NUMA 1NWPA 5JYMA 4FQ1L 1U58A 2Y6TE 1C8PA 4MCYA 4G8GD 5ILTH 3QJHA 3RQ3A 2K4WA 2LTQC 3K6SA 1AD0B 4Z8FL 2K70A 3EFFB 1X5FA 1KGWA 1MJ8L 2GJZA 4R8WH 4JPKH 3UJIL 1UTDA 4WHYG 3I2CL 3P30H 4F5CE 3FO0L 1HEZA 1NDTA 4C54A 5DMIH 1JBJA 2Z7YA 1YJDL 2QQNL 2Y7SA 4K8RC 1JRHH 2AXFB 4YSAA 2B0SL 3MACL 2CSPA 3SOTA 4AXWB 3T4AB 2BCKA 4WSJA 3UC2A 3D33A 5TF1H 3RNKA 1SXNA 3QQ3B 3HC0B 1J12A 3C87A 4XO8A 4OIIL 4OCYH 5ESAA 1ND0A 1TZHB 1WE5A 2P80A 2H4EA 2VDOH 3N9GL 4E9TA 4PJ8D 3FTSA 1EHLL 3HG4A 3MBWA 4MSWA 5FYKD 1M7IA 1QQDA 4Z7VB 3ZT7A 5F7EH 1OGAD 4NQEE 3GJEB 4BSWA 1R1CA 5K59E 2QZQA 1P2CA 2QHLA 3AQXA 4HYTB 2EH8L 4U05A 4CC4A 4QRPB 5KBDA 1MQKL 4JPIB 3TBSB 1F86A 2FBRA 1U3HC 1BX2A 4UV4H 5E9NA 2NY5C 3SJVE 1G4RA 4DERA 4CVWA 5BW7A 2JELH 3QUZD 1DP0A 3E0GA 1FZMB 4P49A 2EXSA 1TCMA 1QSVA 4OM1L 5AOMA 4DIXA 3LKNB 1J9TA 2ATKA 4Q6IA 2P49B 4ODSH 1XVSA 3F85A 4JKMA 5J9PA 1G0XA 3ZDZE 1FBIL 1OO2A 1TZGH 2AEPL 5FECA 2AV7B 3OAZK 3U4BL 1T7ZA 3VI3B 5D7LD 4K3DL 1GCYA 3JTBA 1ZT1A 2BC4A 4PS3A 4WENB 3VD9A 2D4DA 3KPSE 3PWPD 1XO8A 3R8BB 2F68X 2VLJB 4PY8I 1KN4H 3S35X 4X98B 2GHZA 1E65A 5JHDE 4ICWA 1TITA 2V3EA 3NOIA 4BH8B 5CEZL 5E70A 2Y4SA 1QBAA 1PY0A 5LDUA 4UNTA 2WBKA 4XPTL 2P3YA 1UCBH 2WKGA 2YEQA 2R2EA 2JK5B 5DEGA 5HGAA 1IQDB 1H3PH 4NO5B 3BIAX 2HH0L 3QJFB 3WS6A 1NMBL 2E8YA 1WQVT 2IBBA 4JQVA 1ZHNB 5EO9B 4LAQH 1H6FA 3WBDA 3N85L 1TJIH 2WQ8A 2BS9A 2R69H 2W0KA 2WXRA 1BM3H 5E6IC 4UMSA 2BSSB 4RIRA 4ADJA 3BWAB 5EC1A 5L2JA 4TL4A 3MV8D 3LKRB 4JFQA 1B90A 3NA9H 3SD5A 5A16B 5I5RA 3LMJH 2BFVH 2UZXB 1TKWB 1TTGA 2B5IC 1P5VB 4XOBA 4B7IA 5BCAA 2Z91B 4YL4A 1BZEA 1UXLA 5KAQG 5KANI 1E6JH 2F15A 1OHQA 2WLIB 5E24E 2BVPA 1HU8A 2C3WA 4FS0A 4UT9L 1BVOA 5L2KB 2F5AL 5C0DB 5KW9L 1CLYL 2NY3D 2VDKH 1OSZA 1VFUA 3DV6A 5C0BA 2R4SH 1PD1A 1XX9C 5E23A 3ZRCC 1T83A 2ZUWA 4JN2B 4RAVA 4NC1C 4XBEL 2AJUH 4L8SC 5I0ZA 2XICA 4AW7A 1KCSL 1JPTL 3PL6A 4U1HA 5E2VH 3V6ZA 5IREA 1CDCA 2GJ6B 3EJPA 3OHXB 1KLFB 4KROB 1NKRA 1RXLA 1OCOB 2CBMA 1J8HE 2HFFA 1H6EA 2BVYA 1MFEH 2FEEI 2O5YL 2V33A 1J1XH 5GISH 1IBYA 4NBXB 3T2PA 2APFA 1CFVH 1PSKL 1J9CT 3B3IA 1IB5A 3E2HB 2GTZB 4RDQF 4E36A 3R1GH 3DMMD 4TRPH 2XKNB 4D8OA 1KYUA 1AO7A 4JFXA 5CJOH 3MRHB 4UT6L 1SZNA 3KYNA 4HK0A 5T3XL 3KBHE 1FC2D 3KVPA 4HS3A 3SYPA 3MRFA 5IMKB 1JGDB 4FTVA 1NFIA 4XN8A 5DQDL 2CA3A 2DQTL 1BDYA 1MAJA 3RWFA 4M43L 3ZIYA 1BAFL 5EUKA 3S88H 1NTDA 2C1OA 4LGSB 2VW7A 3DJTA 5L7XH 4YHNA 3OKDB 1AANA 1BQHG 5FYJD 1BSIA 1NIBA 4S0TD 1IKFL 3FUNA 4NQSA 4X9BA 4QOKA 4K7PY 4PJ9A 4YHYB 5IROD 4LU5L 2E6JA 3MRIA 3QQXA 5GRUH 3SKNA 2IBZY 4NQDE 3B2XA 5DUMH 5EO0A 1AOZA 3CH1A 3PF2A 3LRGA 1UURA 1NLBL 4J4PD 1MHEA 5GGVL 3VXSE 1CDGA 3WS3A 4PR5B 2C9PA 3VDBA 2H3NB 1KXVA 2CRZA 5BXFA 3CAFA 2E86A 1CYGA 2UWEF 1IC0A 5E9AA 1FAIL 4Z8FH 1FG2B 5EF1A 5B38B 3CLEL 1QWNA 3UO8B 5CLWA 1MJ8H 2GG1A 3T4AC 4JCWA 4MQSB 3U9UB 1SM3L 5IB1A 3UJIH 1XF5A 1W72A 2XN9A 4PFEA 3K5SA 4UNVA 1MRDH 3MX0B 3FO0H 3IKKA 1XWVA 5C97A 2Y1ZA 1YJDH 2QQNH 4EF3A 4GO9A 4TNGA 2M26A 5EIQA 1E40A 1G94A 1TQBC 2D7OA 5IB4A 1OK0A 4PWKA 3BOVA 1CQYA 3FTZA 3DO7A 1OTUC 3U9PL 1MAML 2DQEL 3LS5H 4OIIH 1RZJH 3MCLH 2ZONA 3C09B 3PGDA 4PN6A 4GH7B 4M56A 1HIMH 2V9TA 3L6FB 3RX9A 2X6BA 3W56A 1CLVA 5IP4A 4HVBA 1EHLH 4D9LH 3T0EB 4MD4A 3V0DA 5F7AA 5J13B 1TG8A 1GXEA 1WFNA 2EIKB 1RZGB 4RFOL 3TO2B 4ZMNA 2F58L 2ZUUA 3MA7A 3RUGB 5HJGA 1ZLWH 3PV7A 1FLTX 1QBBA 2YFNA 4DGIL 4BSVA 5GSRB 3FTUA 2YAFA 4OM1H 3F65A 2KKQA 1Z6JT 1JNHA 2P5WB 3HVNA 4XVSL 4RH4A 4HUUA 5CP7B 1FBIH 3H7BB 2DLGA 3LTVA 4TPRL 5DJXA 5EZOH 1GHFL 2AEPH 1J0ZA 1R3LB 3VXMB 4I4WA 3C5SB 2NZIA 2ZWNA 3B6SB 2EO1A 2ZKXA 2FZ3A 2E7BA 2R83A 4PJ7E 1K8DA 2E76C 4KKBD 4Q6YA 4XVOA 5E1GA 1LP9B 4QTIL 1SJEA 3KR3H 1N5AB 3WUZA 3E1ZA 2A83B 3R4DA 3T4YB 4UI2A 4Z3JA 3AQZA 2LVCA 4LSSH 4IKKA 1NCTA 4X6DB 1JCKA 4KWUA 5CEZH 4F93B 4HBQA 1JHKL 1UGKA 1X5HA 3KPNB 2CO1A 2Q87A 4XPTH 3D0LA 5HDRA 3QORB 2EYSB 3NGBB 4ZDHB 1FI8C 3BIKB 1L6ZA 4KVNH 4L5FL 4OFYA 2WLYA 3AB0B 2IMMA 3I9PA 3KGSA 3MNWA 4ONHB 4KNQA 4HD5A 4ELMA 4NDMA 4ZUUB 2MMXA 4M9OA 3B2DC 4NGHH 2E4TA 1Y0LB 2VWEC 3TZVB 3MOQA 2WVVA 4F8TA 4Q7DA 5C1MB 2DV6A 3PREA 3OMZA 1CL7H 2R23B 2X4SA 3L5WB 2ZYIA 3QG6B 2XRAL 3U4AA 4XXCA 1PKQA 2X4NA 4BDVB 4HISA 2VLKA 4D0DB 1EHKB 3PWLA 3O8XC 2WV3A 4ERSL 3IN2A 4NNPL 5AG8A 1J1OL 1A6WL 4UT9H 2A7BA 5DJZA 2BZ7A 5C0CB 4FYSA 4ZJ9A 2F5AH 3MV9A 5KW9H 3WN6A 5C0FA 2NY1D 1XH0A 4PI0A 4GUPA 3T8XA 1LE9B 4Q9CA 2D9CA 5LHDA 4P5KA 1O6VA 5C0GA 3VXPB 4KROC 5C09B 4XBEH 4AENA 1SDAB 5MEOB 1H3XA 5IW1B 2ZUXA 3GSWB 5FWRA 3TBBA 1KCSH 3BVTA 5IEKB 3MTRA 3VFNB 2NTFA 5KJ4A 2ZUTA 3TVMB 1L9OA 1RIUH 4BUHA 5F72S 2YARA 3CSFA 2HSIA 1IZJA 1BQRA 3E2HC 4WW2A 3QHFL 3FOLB 5J1TC 5IBLC 1XAKA 4KK8C 5LQBL 5FCSH 1OM3L 1WA2X 4Y5YA 5AVVB 1H0DA 5H4YA 1PSKH 3EYSL 3LRMA 3V8CA 1G7PB 1IEHA 4KHTL 3A21A 3FAWA 4HIPA 4AQAB 1FZKA 1KLUB 1ZE3C 3V0AC 3VMOA 2JKIS 1A7QL 3TTYA 1QPKA 4XH2B 4WW1A 5C9JB 4DK6A 4F33A 4N24A 2XIBA 5JPMA 2DQTH 4NKQB 4UDUA 2AMGA 1DTUA 2Z92B 4G8AC 3SDCA 1R3HA 5JQ6L 4PMEA 1BAFH 4FXKB 1MCFA 3KLHD 2NX5A 1IGFH 4UTAL 4YHYC 3UACA 4FQCL 5HYJE 2NYYC 2JSFA 1JWMB 1DBBL 1KYAA 3UPAA 2JKLA 5EN2A