2UY6B

Crystal structure of the p pilus rod subunit papa
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
154
structure length
150
Chain Sequence
KVTFNNTVVDAPCSISQKSADQSIDFGQLSKSFLEAGGVSKPMDLDIELVNCDITAFKGGKGTVKLAFTGPIVNGHSDELDTNGGTGLAIVVQGAGKNVVFDGSEGDANTLKDGENVLHYTAVVKKSSAVGAAVTEGAFSAVANFNLTYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords PERIPLASMID CHAPERONE PAPD PROTEIN
publication title Crystal Structure of the P Pilus Rod Subunit Papa.
pubmed doi rcsb
source organism Escherichia coli
total genus 20
structure length 150
sequence length 154
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00419 Fimbrial Fimbrial protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 2uy6B01
2VCOA 4J3OG 4XO8A 4XODA 2JMRA 3ME0B 3JWNH 4AUUA 2XG4B 2JTYA 4X5RA 5AALA 2J2ZB 5IQNA 4AV5A 4AUYA 1UWFA 5JQIB 4X50A 2W07B 4AVIA 5IQMA 5FWRA 3BFWA 5AB1A 3JWNG 4XO9A 3BFQG 4CSSA 4XOBA 4ATTA 1KIUB 2XG5B 5CGBA 4CA4A 5FS5A 2UY6B 3ZL2A 4AVKA 4BUQA 5FLUA 3RFZA 4XOEA 3ZL1A 4XOCA 5LNGA 5IQOA 5F3FA 4AVJA 4CSTA 4AUJA 4X5QA 4LOVA 1QUNB 4X5PA 4AV4A 4AV0A 5FX3A 3MCYA 4J3OF 4XOAA 3JWNE 4J3OH 3BWUF 1TR7A 1KLFB 1N12A 5AAPA 2WMPB 5F2FA 1N0LB 2UY7B 3SQBB 3ZPDA 1PDKB 4AVHA 5LNEA 5ABZA 1ZE3H
chains in the Genus database with same CATH superfamily
2XKNA 3EJZC 3OSVA 2X38A 5CP7A 5LXGL 3VDCA 2EILB 4MA7L 5J0BA 2YMOA 4POUB 4E9XA 4B6ZA 3C60B 2ZUXA 3I6LD 4N2MA 3TCLA 2IGFL 4APQA 4UAHA 3TO4B 1HSBB 3QXAA 3ML8A 2HRPL 3U1SH 2JVUA 5DXWA 1F4YH 4BFBD 5CD5C 1UWGH 4RMUA 1AKJA 3D4ZA 1A6AA 1T20B 1XL6A 4BHUA 2NY1D 3ASNB 3NCCB 5TFSH 2BSTB 1LEKB 3TV3L 1NCTA 1Z0NA 4QRPA 4N68A 5DQDH 2M8XA 4XPFH 3OKLB 5BV7L 2OMWA 1SEBA 5I1GH 3MXVL 4WKZB 4XN5A 1P4UA 3THMH 5IJVA 1RMFL 4MA1C 2ZAIA 5D7SL 4AMKH 3QRFM 4JGMA 5G55A 5EEWA 4GAGL 3EKCA 5HI4D 3FH5A 5FM4A 4JGUA 4JZOB 4MJ5B 5T1KA 5TD4A 3SE8H 1CFMA 3WEMA 4O2CA 3TVMB 3L6FA 4G8GA 4K94H 1Q9LB 4P2QE 3F7QA 2JCWA 3N91A 1GKEA 4JDZA 2JJVA 3BLKA 1PFOA 2Y1YA 2MQ0A 1FG2A 5L2JB 4GKZB 4IRZL 2K0RA 5GRUH 2ZUYA 4BEIA 3D25A 1SHMA 1U8QA 4WU5B 3NEOA 5CU9A 4I3SH 2WQSA 4L29A 4Y4HC 3RILA 1F3JB 1MFCL 3QDMD 3RVTD 3UX9B 4F93B 3RNKA 1PIFA 4BQ8A 2HKHL 4P2QD 1MCFA 3Q7JA 5EEVA 1TO4A 1WCBB 2CO6A 1TQBB 2I24N 2VDKL 1TMQA 1P9MC 3LZNA 4J3OH 1LEGB 5IVZA 3MCLH 1T4KB 5IEHB 2AJSL 3P9MA 4Y1AA 1JZ8A 1GMEA 4HLZG 5I6KA 4KPHL 2OMNA 4FLOA 1MVYA 3L7FA 5DQJA 3TF7C 3MUGB 4AQAA 2WMPB 4ZPTA 4MNQE 1M2VA 3U36A 5FO8B 2CGRL 4H8WC 4PJAE 2X6AA 3FT9A 5MEPB 1VPOL 4TLSA 2R59A 2IALB 3T4AA 1TMCB 2GK2A 4G7YH 4JO2L 1KXHA 1I4FB 1Q94A 3GXNA 1IE4A 5IREA 1NBYA 3UZVA 3ZR5A 2RIKA 2X4TB 2IBGA 3BEVA 2X6CA 1ETJA 3MKKA 4MNQD 1W8EA 4WQOA 1IBDA 4L4VE 4JHVA 2X4RB 3AJ7A 5D2NE 3TBWB 1BQLL 5BO1L 3OKDB 2GC7C 1KN4H 4XCEA 4Y16C 3P4MA 2X87A 2AEQL 2VJXA 1TQTA 1DVFD 4C47A 5BW7C 1RZ8A 3GS0A 4OF0A 1CFBA 1QQDA 3PWJB 4J1UA 4L4VD 1BMGA 2J8UF 2YO3A 1HH6B 3RWGB 3F7YB 2A2QT 1KCUH 2R23A 1Q4NX 1L9OA 3KGUA 1J5HA 1IEBB 3K71B 3GLAA 5D7JD 1BFVH 1I8LA 4HWBA 4U05A 2ZP9A 3FOMB 4Q7DA 1NSNL 1RJLB 1FGVL 1E5ZA 1T21A 4X8XA 5KYWB 4Y19E 2YSSA 1YN7B 2VC2H 2DIBA 2V3FA 1JJUA 3OMIB 4D7BA 5IESH 4JHWH 4XBGB 5BRZE 3IJHB 2QQKL 3FU6A 1XZ0A 2VUYA 3M88A 4JPQA 4XNYL 2NY4D 3LN5B 2H2PC 4KTGA 3LXUX 4LGPB 3RWFA 4GO9A 5DK0B 2H47C 3MV8D 1PG7X 1WRFA 4JG9A 4L0ZA 4FTVA 4JHBA 4Y19D 3HUJA 1DZBA 3CCHA 3MLYH 2W9DH 5FFOA 3U9PL 3GBEA 1ZPUA 1FN4A 1UD2A 2BP8A 4RWHA 2FJHB 4JN2A 5CZVH 5BRZD 3VU1A 5HVGB 2EYRB 1J5OL 3OAZK 2JCCB 1E5CA 3UAJC 4KTEL 1I7UB 3HMWL 2PTVA 1MCSA 1W72H 3B5TA 3Q6GL 3JV4B 4QY8B 4XHQA 3FO1B 1A4AA 2W88A 2ZCLL 4XOAA 5I73C 4JFXA 5I15L 4XXDA 1RHHB 1U93A 1TJIL 3JV5A 3I9AA 3OPZH 1G5AA 5C0AE 5IBLD 3KLQA 1FYTE 4JFTA 3ZE2B 2Q3ZA 4GLRI 2MWCA 3ARFC 5KBMA 4KZEH 3GZPA 5T5FH 4N2FA 4U6YB 4LPYA 1D9KB 5KJ4A 3U0TB 2Z8VC 2HT3C 3TOPA 4NQTA 1N2RA 5GRWA 4BZYA 4C8XA 2FK9A 2D0FA 1JHKH 2XN0A 2GW5A 3ULSA 3RGVA 1EHLL 1BXVA 1U8PA 3LNGA 3TGXA 5BMFH 4LRIC 1RIVH 4UMGA 3C6LC 1NMAH 5C0AD 3OB8A 1XTLA 5F1IB 1KEMH 4NBZB 4YK4B 1MRFH 1XTMA 1NCIA 1Z9MA 4XPBH 1R3IH 4R96A 1FZOA 3ULVC 1GZQA 1I8KB 4N0UA 5ELIA 5FYJL 2QDVA 4NRXB 1R5VA 4XP9H 2WWOA 1U4EA 4NSKA 5HHNA 5SWZB 2P5WB 2BSSB 3GSWB 4L3CB 4RDBA 3L1EA 2E9WA 4PSRA 4UB0L 1E3XA 1ND0B 1LE5B 4NRZB 1PG7W 3KBEA 3KPLA 4PWHA 4BFIA 1A14L 1B3JA 3EYFA 2H6UA 5E6YA 5FYLL 2J57A 1MJ7H 2OMUA 1EDQA 5ACLA 2Z6FA 1AGEA 3D12B 3KVPA 3Q6FA 4AGLA 3D39E 1HHJB 3FQUB 4WDIB 5HHVL 1A1OA 1UADC 3GBMH 5IM7B 3D7PA 1MAKA 4N5UA 1CF8L 2DBLH 1WBXB 2BO0A 1FZJA 1NM4A 2Q76A 4IGBC 5EORH 4QHUB 1H3GA 1F02I 3RTQA 3WY4A 1G84A 1G6VK 1VF5C 3APCA 4AITA 1XH1A 3SO5A 3Q06A 2A9NL 2VLLB 3D39D 3LZLA 5C9JB 2WQRA 4XGZA 1X4YA 4WTZA 1JGIA 1FV1A 4NZ8A 2XWBB 3PQYB 2P8MB 4FFWC 3F7LA 3QWQB 1PBYA 2QMJA 2ZWNA 3GF8A 4QMEA 2UY6B 2OJZL 3TZVB 3RVUC 1UM4L 4LPCA 4MXVE 15C8H 4PRPB 3CH8A 4V1DA 3DNKA 5EIIA 2VLRA 2BNQB 1E42A 3IDIB 4WEBH 5ADOL 1BMZA 1CXLA 2FJSA 4DP5X 4I48A 1X7SA 3DX8A 5FM5O 5E2TH 1P5UB 5AOMA 5D1ZI 2BIIA 4OFYA 4KH2A 4XAWH 1QLEH 2E5EA 4GKOA 4U6VL 1S7QB 5I8EA 4YWGH 1NDGB 2N7SA 2O5ZH 5FHBL 4GW1A 5IF0B 2VIRB 3LS4H 4OGZA 4JBSA 3GNMH 4Y2DA 1KLFB 4P5TA 1MCBA 4AIXA 1YEIH 3GTNA 2GIXA 4PJDB 5FGCB 3KYNB 5FKPB 4NQVB 4YXKH 4N0YH 3KWTA 4NJ9H 2VXQA 2Q8AH 1FO0B 3B9AA 3QJQB 4XMLL 4UI2A 3S0PA 1T0OA 1Q1JH 5HDQH 3FUIA 2VQTA 4OSUL 3VXUB 1TLKA 4FP8L 4G7VH 3BKJL 2V37A 4HV8B 1A6ZA 5E2WH 4LLDA 3ZZQA 1OT1A 3SO3B 1DQLL 1TYEB 2J6EA 4YDIL 4APQC 5J06A 3K8KA 4G6JL 4YX2H 1OP5H 1DZ0A 3KBPA 1R3HB 3FU0A 1MHCA 3CZSA 3VM7A 5SWSD 1B2WH 3GSNH 2D31A 2PXYB 5KVEL 3QHZL 3MRQA 1S5IH 4G2AA 1YMME 2A6IA 2EO7A 4ECNA 4MCZA 4X5XB 3IMBA 3WFEL 3F83A 3LEYH 4YFEA 3MTXA 4ADGA 3B6SA 1SJHB 5G4OA 5C09E 2YOCA 3DROB 4LHUD 5GRVL 4FCAA 5ALBH 3KGSA 1Y18B 2HLAA 2NYKA 1CUOA 1IQWH 4PWGA 4WTZG 1UZGA 3FHQA 4ZTEA 1SJVA 5C08E 5KUKA 4ODUB 1FRGH 4BFNA 1EGJH 3ARBB 5I18L 3WD5H 4F2FA 2Z7ZA 4YHMH 1NCWL 3D87B 4UTBH 2PYED 5EIIG 2Q7AA 5C09D 4HIEB 4HH9B 4HKBB 4G6AD 4RAVA 5LBGA 2DIJA 3UGXA 4ZFZA 1EFXD 2VSCA 5I0WA 3WI9A 2FDBP 2DQHH 3MLSH 5HI3C 5C08D 3V4UH 2YAOA 3DSNA 3RVVC 2CUAA 2GBTA 2GEEA 2IPKB 4OZGF 1PLBA 3HA0A 1CCZA 5ITFB 5TGBA 2ERJC 1AANA 2Y6TE 4WY7L 4ATTA 3IDGB 4KO6A 2FSEA 4NZRL 3DECA 3W2DH 4KI5C 1S9KC 1AZUA 2CHNA 4KNUA 4WHCA 4L37B 4Y1AD 2D03H 1T89C 25C8L 3IETB 4E9SA 3KL5A 3O4OC 2PABA 3H3BC 3AQDA 4MNGE 2E75C 4KZDH 1A9VA 1YEGL 2W0FB 4MX7B 2IDSA 3B9KD 2ZXAA 1G9NL 3N43B 4OT1H 4P4RA 5EUKB 4HHWA 4CVUA 3RI5K 1VKXB 2X88A 5A7BA 2NTFA 2X44D 5TF1L 5IHWA 3EO9H 4M3JA 4PYHA 3OJDB 3IK2A 1ZA6A 4NWTH 5KN5A 4XTRC 4ONFH 1HDMB 2WLMA 5A2BA 2XWEA 5H2BA 1DO5A 3ASOB 2QVKA 4TNWK 2OXGA 3L3IA 5DZNA 1RAMA 3HLKA 5DJDA 1DJIA 4MDIA 1OOWA 2DYPA 4N5ED 4JHUA 3QAZB 3R1GL 1SBSH 4I88A 4P4KC 2UXVA 5T3XE 2E9IA 2XUWA 4Y4KB 2GABA 1AHKA 2ZNXA 5GGVH 2HPTA 3SBWA 4LCCB 1UXSB 1DL7H 5JHDB 4BUHA 2ZXGA 4DZ8B 5J9PA 1X5YA 1RFDL 3OQ3B 3DX7B 2BNRB 2BP0B 4FG6C 2YD3A 3ARYA 5DC0A 5EO1A 1C16B 3LH2L 1CYWA 3V6BR 2R4RH 3LPGA 3L4CA 2BXZA 3VI3B 4DP8X 1G6RL 1BAWA 4G8AC 5F7KC 1MCRA 5D8JH 5T3XD 3QYNA 1OP5K 3ZRCC 4DO4A 1F3DH 4M1CD 3KPOB 4KJQD 2GY7B 4ZUWA 3VXRE 1E4XL 3QS2A 3HI5H 3QUZB 2YC1B 4DP6X 2CXKA 4XO8A 3O2VH 1ZSDB 2NZIA 3ZE1F 3PHQB 1K2DA 3ZKQD 1I8LC 4TRPL 1S7WA 3HZMA 4YIQA 2J8UE 2CKBB 2DTMH 3QDGB 4HJ0C 1PJWA 1FZKB 1KC5H 1R5WB 1QX1A 1ZSHA 2DI7A 3VXRD 2JB5H 1M9SA 2ZTBA 5ITBH 1I9IH 4JR9H 3HB3C 3P2BA 5CSZA 3S35H 3P3RA 4X6FB 1EBAA 3HG1D 4DUXA 2R0KL 4YH6A 2WO2B 1TIUA 4DTGL 1OQXA 4D8OA 2BCMA 4ISVB 3HAEA 2FTAA 3CX5J 1RZKL 3CX5K 2J2ZA 3MCKB 2VKWA 4FNSA 4KWUA 1WP6A 3F85A 4R9HA 3UYOD 4D94A 2ATAA 5ERWB 5DFAA 1L0YA 2B16A 2IFGA 5EU6A 1HYSD 4M1GL 3ABZA 1XB3A 3QUKB 3EJPA 5F1KC 3QORC 4UM9A 5FCUH 3SPJA 5K9OA 4RNRB 1NIAA 2DQDH 1W6LA 3CPLA 4UDTB 3V0HA 1N7ML 5HXMA 3BVWA 1OGSA 4WK2B 4U7KA 4RDQF 5F71A 1B0GB 4LHQB 4LIQL 4E41B 2ZCZA 4GH7B 1NGQL 3KJ6L 7FABH 5LGKA 5JZ7C 2Z4QA 1FPTH 3VI4A 4QT5B 1UA7A 2YN5A 3ELAT 3NFNB 4QRRE 5F0PB 1NJ9B 1T03H 3MROA 2JV6A 3UJTH 1JZ4A 2ZUUA 1YNTF 4KKNA 3RGVD 4LPVA 4ZUVB 5DO8A 4QCIA 5BXFA 1HESA 3ETBF 4AZ8A 3L9BA 4MSWB 5EBWB 4GKNB 2PCPB 4QGYA 4WO4C 5LBSL 4AM0A 1DANU 5AB0A 5DJ8B 3KWWB 3POCA 4QRRD 3NIFB 4TYUA 4PP1D 1ROWA 4RGOL 4PJ9C 2EDJA 3AB0C 1XGYL 1VA9A 2KZBA 2UY7B 2BHZA 4ILDA 2EUVA 1M05A 4H88L 2IMMA 1I7RA 1JP5A 3DPBB 2EDMA 1YEDA 3ZPDA 5KSBF 3ZBMA 1G7IA 2DWTA 1B2YA 1Y0LB 1EO8H 3NFPB 4G70B 2PPEA 2FWOB 4QIRA 4JM2A 1TCRB 3UO1L 3L3DA 3ZDYB 4EI5A 1F3DJ 2QEJA 1RU9H 3O6FB 2Q5BA 5FO7A 5HGBB 5HVWA 4PLOB 4K2UL 1S7RA 2XN2A 2JXMA 2JNZA 1JRHI 3AG2B 3QXVA 5HJ3A 2F54A 3MRRA 5D2LE 4ODVL 3QNXA 5KJRL 3JQOB 1GZHA 3TBTB 3L9YA 5E8EA 2ROYA 3AG3B 4DO5A 2X4QB 3IJYB 4OF6A 5HSFA 4YHLH 5A43C 3ROOA 1FHGA 4FFTA 2BP3A 3RTQC 3VXNA 1NGWA 2IANA 2KLTA 1DBJL 5LQBH 3D30A 1AI1L 4CVZB 3EDDA 1QSFA 5KBPA 1T1WA 2CUHA 4OUUB 3VACA 2X05A 1JF1B 1SJEB 1F8TL 3DETD 1RZJL 1XGTA 5BUAA 1NGZB 1CG9B 2W8CA 2D8KA 1BVLB 2WVSA 1T5WA 2QQNH 4WWID 1QFOA 2VYRE 3BFQG 1AAJA 4IRZA 1EHNA 2WWMC 1NC2A 4IW4C 5JUEH 3MRFA 3TONA 1A3RH 5LAXA 3V4VL 1CFTB 3ZW3A 4AENA 3SBPA 1FC1A 2H1PH 4M62L 5C86A 3UJIL 4UBDC 1IAKB 1CDCA 2CBMA 2P7TB 1ZTXH 4JQIL 3IDMA 3TBSA 5AB9A 5B39B 4Y2DC 2PW2B 2BS9A 4NJAL 4K8RD 1UOWA 2Y06H 3MLRH 4P5TC 4HJSA 3JWDL 3FK3A 4K9EC 5HDRA 4HPOL 1LDPL 1M6UA 2SEBB 4LSDA 1DBMH 1T1ZA 1TTBA 4Z9KB 1WK0A 2WXPA 1H5BC 4OCRL 3RUGF 5FX3A 3MCYA 4JFWA 1OCCB 4QHNA 4LMQE 3MR9A 5EOQH 5F7FA 3KPMB 2GUOB 4F7MB 3H42H 4DGVL 4U1NB 1YQVH 2XWDA 1SPDA 4MA8H 5AOKA 4A7TA 4HS6A 1S6NA 4DGIH 4GG6A 3UTQB 5J1AB 1NAML 4Y9GA 4HUCA 1E4JA 1VADB 4JKLA 4MD0A 2XKSA 1HI6B 3GMPB 3M46A 3MRHB 2QTVA 4YFLF 4YGVA 4XO5A 5DYOA 5EFIB 3Q2LA 3N06B 3BP4A 4LLMB 1YYLH 4PJCE 1E9OB 1XD0A 1BIHA 5E8NB 4PWEA 1KYUA 2Z0UA 1P84K 3IGKA 1F6AA 5F97E 3O8XB 2F8XC 2CIIB 2YWZA 5EUOA 1MF2L 1LO0H 1L9TA 4OF7A 4QRSA 3PV6A 2JB6B 5D1ZA 4MZ3A 5F7NC 1O6SA 3BKMH 4K3JL 1KFAL 4OGAC 2Z91A 2E7CA 5CHNB 3QO0B 3ZTDC 1FNFA 2YSTA 3MLZH 4XMKL 2GIYA 4QO1A 3V8CA 1KEGH 3HEIB 2DI8A 4FFYH 4WHTA 3WHXA 1U95B 5TDNB 2VXUH 1GHFH 2QZQA 1RURL 2YPLD 4NKIL 3LIUA 3VD5A 1OAQL 4K55A 5AYQA 1EXUA 3KXFA 3QO1A 3LQZB 1TQWA 3DOIA 3PWNB 3CK0H 3SDAB 5J7CC 4M43H 1IFRA 1DJHA 4XP4L 5K9QI 2BH0A 2X6UA 1MPAL 4PW3A 4ELKB 4OGYL 5LVEA 3IMVA 5I19L 2NY7H 4M7LT 2ZX8A 4Q74A 2BHFA 2V33A 3BZ4A 3FCGA 4DP9X 2AJZA 5EU4A 4AIZB 4LSTL 4LSRL 3F5WB 5F9JB 2XA8H 2HVJB 1KGWA 3DMMC 3IFNH 1YYCA 4HUMB 4OZGE 1MHHB 5HVHB 2UUDK 1SZNA 1MRCL 5L8LB 4ZD3H 5AZEL 3EGSA 2G2NA 3CC5A 2QGBA 4X5WA 1LO5A 2B9BA 4OFDA 3H3PH 4A68A 3CFBB 3OG6B 2AV7A 3EW3B 1AP2B 5DVOA 5BQ7B 1CMOA 3TCXA 2A77H 5LAPA 4Z78A 4ZMLA 4PTUB 3U9UB 4O02B 4X7FC 5EA0H 1V3JA 1TDQA 3IGAB 4PMEA 4MMXB 4W93A 5T33L 4XC3L 5B7FA 3SGJA 4FQIH 3VH8B 1XIWB 4J3SA 3A67H 3UL4A 1I1FA 4PGEA 4PV9B 5E6RB 5I1JH 2XT1B 1IC5H 3N50A 3D34A 2I5YH 2VH5L 5LXVA 4OFPA 2I9LA 1MSPA 2V17L 2BVTA 3DTXA 1IFHH 1S7SA 2OBGA 3SBWC 5GS0C 4IBUA 4J8RA 3L5WB 1B0RB 2RQ8A 4H40A 4OZIF 3SGEH 3A0OA 3O9WA 4G7QB 2GKIA 1H0DB 5F6IC 4RGNE 1EBPA 4OIIH 2ED8A 3P54A 2E0PA 4ERSH 5FB8A 4PJXA 1OGAA 5CJOL 3FFDB 2OMZA 1CFSA 3V4LA 3AAZA 2O5XL 5E5UB 4FZEH 4U1KB 5DMGD 1T5XB 4AH2B 3GSRB 5CEYA 2AJVH 4PJHF 1BFOB 4GRWB 4DIXA 1Z1WA 3B9EA 1D7DA 4G6MH 1A6TA 4PGCA 4RGND 3H56A 3KYOB 4U31A 4Z0BH 4ZBJA 5K9KA 1D2OA 4MJIA 2VITB 4HJJH 4DEPB 1KCLA 3ZKMD 3MOAL 2XVGA 3AWGA 4K3DH 3IGUA 2JIXB 3GKZA 1VEPA 4TNEA 4OJEH 3EFDH 4JRYB 1K6QL 2AZAA 3ZTNL 4ONGH 5DD1H 5EN2B 2DLTA 3EZ8A 3K91A 1VEMA 2JI2A 1B90A 2CCVA 2MCPH 3ME0B 4KXBA 1XF3B 2Q87A 1FFNB 2X4NA 5F7AA 5K69A 4KNQA 5C6TH 3O3EA 3LPPA 1L7IH 1CFVL 5EIQA 2ESVA 3T0AA 3VFSA 4FXGA 1TUPA 1P0SE 1RJYA 3MRIA 5EU5A 4GUOA 1C5CL 4R5TA 3F62A 1B4JL 1J0YA 1L6PA 4NO2B 2QKIB 4F15B 1VRSA 1G1KA 3SDDB 4ZDHB 3WMPA 1RCYA 4ANXA 2DICA 5CGMA 3KLAA 1CU4H 4MCYA 3TPKA 2BC4B 2A83A 1O7VA 3OZ9L 2IV9A 4JDEA 4HAGA 5K9JL 3GS4A 2ZE0A 2PKDA 3L95B 1WO2A 1GGBH 1FCGA 3HHSA 2AP2A 5AW0B 5E0FA 3RZCA 2BIOA 4MJJA 3WG7B 2ITDA 1E8XA 4PD4J 1ADWA 2K9FB 1YY9C 2R1YA 5L8KB 3RIAF 1S78C 3MV7B 4M6NL 4N2BA 1T4WA 4Q9BA 3I3DA 5DO2D 3V7MA 4LLAA 4MA3B 2DIEA 2X4PB 1D7FA 5DFVC 1BYNA 4I9WE 5ICZB 1XF5A 2HJKA 2VMCA 3ROLA 1DUZA 5KYUA 2WOBA 2FJGB 4RQQA 4U1LA 1CR9L 3DJTA 2H0JA 3K2KA 1KCSH 1N4XL 1F58H 2AABH 3RFZC 1ORQA 1KULA 5FOJA 4FMKA 4JE0A 2AGJL 3NJMA 4A6YH 4XMTA 3UYRH 5J13B 5JO5A 1Z5HA 4JY5L 1MZZA 3P11H 2DKMA 4Z0XB 3IXTA 2HFFA 4I9WD 4LSSH 2E47A 3IS0X 4JRXB 3JYCA 3L1OL 4IBWA 4IOSD 4NS0A 3RWHA 3CHQA 5DMIH 1LLAA 5IJDC 1FGNL 4KKAC 4LFHD 3PWVA 2V2WB 2C5DC 2ICWJ 4PJ5E 1V5JA 4JM2C 4PRIE 2KC0A 5LO7A 4WEEA 1A7RL 1N0LB 4EI5C 4G83A 1RPUA 1WHPA 1JMZA 5KSBE 2F54D 4F7EB 2OYLA 4FQCL 2W81C 1T0MB 4JDVA 4BZ2L 4LCIL 3BPLB 4KTDL 3K74B 4L1DA 2A4CA 3V5KB 3VA2C 1XR8B 4NQDA 3AS0A 4R7NB 4UV4L 3ZVVA 1GZHC 4A37A 1OF2B 4L4TB 1ZAGA 4PJ5D 4W9ZA 1JNHB 3ISWA 1J05B 4RIRA 4HFUH 3U46B 3EO1A 5EEUA 4LOUC 5DD6A 3BIAX 2ATKB 2E7BA 1IVLA 4QTHA 1OEZW 4QRAA 3QUXD 3BAKA 2DTSA 2BVPA 1E2ZA 4WI2A 3MV9B 3LD8B 1JPGA 4JG0L 1BEXA 1FJ1B 2QLVB 4Q6KA 2F58H 3MFGB 4NNXA 4N2AA 3KCWA 2C7FA 2ZX5A 3LKOA 5A3IC 5IQ9B 1AHMA 1Q0XH 2RJMA 3ILEA 4HUNB 5KYYB 2IOIA 2XQYK 3L4ZA 2G5BA 4YSCA 3VXSB 2HKAA 2R2EB 1VHPA 4HK0A 1BEYH 5JIMA 1RZQA 1S9WB 1T0NB 2APWA 5LG6A 2OX5B 4ZOBA 1QRNA 3D4CA 2C1PA 3VXPA 1C5DB 3BP5A 2MPAL 3MRGB 5FYJU 2YK1H 1P5VA 2FYYA 4DJMA 4JNXA 4HS8H 3SPVB 2JH2A 1U8CB 4F7PA 1EXHA 3WE6B 1R47A 4Z6AT 1OD7A 3QW9A 5C92A 2F68X 4JFPB 5CEZL 2HT4D 5IMMA 3WHE0 4YHKL 6CGTA 2IBZX 5EC1B 3FUEA 3RE0A 1CGWA 1PZ5B 2V9TA 1WD8A 3TT3L 1MIMH 3T3MF 5TE6L 2EKSB 3KPSA 4LVNC 4XNUH 4XN7A 6TAAA 3GIVA 2O6FA 4H7VA 2F5BL 4MB5A 1IQDB 3EYQD 3L2LA 3TJHD 2UXFA 1SMAA 4AQOA 3RUGE 3ZTJG 1WT5C 3LTVA 2HJLB 1CXFA 4I8DA 1LVEA 1TZHA 2VE6A 4YSDA 3QIUD 5ALCH 2EXTA 4PJEA 4AL8H 2C3WA 2AXGB 2VQ1A 3D0VB 3AU1B 3BPCB 3I75B 3KPRB 4PJBE 3X12A 4HZLA 5A2JH 4MAZA 2EC9T 4ODWB 3VXME 3QZWB 4JM0A 5D1ZC 3KLDA 5C0CA 3WFHB 1E9QB 4WW2B 5F3BA 2ZSWA 4EIBA 2OZ4L 3FCTA 3FUNA 4OF3A 2CAKA 3BWAB 3QIBB 3CZLA 4R4ND 3D9AH 2L7EA 4NT6A 1W0WB 3KM1A 3JZ7A 5HGAB 5D4QA 3PL6D 1IT9H 1E27A 3D51A 3TEWA 2ZWSA 3O3DB 3P9LA 3VXMD 4PU2A 1G5GA 1QW8A 1DP0A 4OZFA 1SYVB 2Y4SA 4UQ3A 3BI9X 4NO3B 2X41A 4I4WA 4EI6A 4TTDC 4BYHA 3LKPA 3IJSB 3UABA 3KNBB 5L8JB 5AOLA 4JPIA 1WBZB 5F9OH 1WGVA 3ARXA 1A3LL 5A2LH 4MXQD 1R19A 2HG5A 2BY2A 2X0VA 4HX1A 4W9LC 4HIXH 1G0YR 1T1XB 2DQUH 4GEJA 4XN4A 1UUNA 1XR9A 4HUUA 4WI7A 4GMSL 1AO7A 1U41A 3B2UC 4X42A 3MACL 1YNKL 4YXLL 4J12A 1ZA3B 2B2XL 3RVXC 1BG9A 4XNZC 5CILL 5F0JB 5IVXA 4CGTA 3WDJA 2AHIA 1KCRL 4DGUA 2J5WA 2NXZC 2XXCB 5ID1A 3VJ6A 4GAJH 4HBCH 4ZMAT 1XH3B 4TL4A 4OFVA 4Z7VB 1UA6H 7PAZA 2XG5A 3E6FB 1GSKA 3GLEA 2D3VA 2CRMA 2H8PA 4LB8A 4LLMA 3X14A 4ODXB 3NCFB 4XPHL 4DNLA 3RGHA 2HFEA 3SKNA 1KJ2H 5LG1A 4WCYH 4JFZL 1JGDB 2DZEA 3ARGD 5EO9B 3SGJC 3MLUH 2OS7A 3C8HA 2F53B 1BA9A 1JZHA 3VM5A 4TSCL 2EE2A 4PJ7A 4FL4B 3U4AA 4BFGA 3O9WD 3T3PB 4CU6A 3BX7C 4NO0B 3CVDA 1VFBB 2WVUA 3IJEB 1VAHA 3N04A 2XICA 5DS2A 2OYPA 1GGUA 4B0MM 2EYTB 3ZL2A 4CN4A 1OHZA 5D7IA 1IBGH 5MEQA 3IFOA 3GI8H 2G3ZA 5AKRA 3VD9A 3GDBA 3H54A 4JVPA 4KK8C 1MQKL 1GGYA 4OZIE 1OSYA 4IHBA 2JF1A 4HUXB 3SKUD 4ZFFA 2NY0B 5I2IA 1F90L 5BO0D 3GJEA 3IJ8A 5E23A 2C1OB 2EIZB 3PGFH 3FJTA 2BW4A 4ZQTA 3G04A 3B7TA 2VJ8A 3JVGA 1LL1A 4OZFG 1JUFB 3A6BH 3GGWB 3MBWB 4I1NB 4IDJL 1KDIA 1SOXA 3ML9A 1S9XB 4UIKL 1NC4A 1UH4A 2LV4A 1PF3A 3T0EE 1MVUB 4LQFH 4ZXBB 2EXSA 2XVKA 3NABH 1M4KA 4OLXL 2C3HA 4PJHE 1MZYA 3QCTH 2VLKE 4M4RA 1MHPH 2G2PA 2P80D 3I3EA 5JW5A 2AANA 1NANH 4IK6A 4Y5YB 2RB8A 3UTSE 1OXYA 2R0WH 4L3EE 3GFUA 4OCSL 1D5MA 4X0NA 2VC2B 3IGLA 4AQEA 3IU4H 1NGXB 3WNKA 4XN1A 3QZMA 2EJ1A 4PAZA 5T3XH 1Q72L 1WCQA 1U3ZA 3F3HA 3T0ED 2W94A 3C09B 3SYQA 1DJWA 3B1UA 4J4PC 4NYLA 1G7LB 2E7DA 2BZDA 1NUDA 4QTFA 2GSIA 2XZAH 4HWBH 1NOAA 2VLKD 2N1TE 4NGHL 4C56B 5AD0B 3PHOA 2EVHA 1PD0A 5I8KH 1FP5A 2IBZY 5ECGA 3NN8B 4L3ED 3QI9A 3UTSD 2VCOA 4J27A 1C1EH 1E6OH 3AG1B 3IWVA 4AEIH 4ZMYA 2Y6SD 3QULA 2OTWB 1DFBH 3VW3H 4ZAKA 2OXHA 1KXTB 2XSKA 3MU3A 1PPIA 2Y72A 1ACCA 2NUTB 3LKSB 5I24A 4IKIA 1PZDA 3QUHA 1W72B 3M8OL 4BXVA 3RZCD 1IGFH 4Y5VB 4H20H 4Z18A 5K1VA 3D3VE 3IDJB 1GPOL 2QPFA 2G0LA 2ARWA 3QGVA 4Y4FC 5HGHB 5F88A 5K9QG 3ARZA 3C87A 4LKXB 3NACL 4LVOC 3G6DL 5ISZA 4M1DL 4LSUL 3HI6H 4HHAB 4OKVB 2YPVL 4P23C 2YRZA 5DUJA 3BIBX 5KSAD 3WXWL 3VFMB 3E2HC 3OR7B 3DRQB 1HSAA 1NEZA 3D3VD 3L4WA 1E3FA 5HHOB 1NTDA 1CFQA 4JQIA 4JL1A 3OXRB 1RPQA 4ETQA 1UATA 4BSVA 1VGEH 4IBZA 2NQCA 1TKWA 1CXHA 5IIEA 1K8DB 4PRHB 2FB4L 3BIKB 1M56B 4AW7A 2ZF8A 4HKJB 1TQCB 1G4RA 2V6HA 3BGMB 3DIDA 3NH7L 3P69A 4LHJB 3QNYA 4I5BB 4TSBL 2WBJD 1TVHA 4XH2A 4L18A 2WQUA 1AR1D 4WJG3 5A6MA 3QYMA 4AOFA 1A6UH 2VLJB 4Y5XA 1QNIA 1A1NB 4FNTA 3O41A 1PG7L 5DUML 3F7VB 4YMPA 1JZJA 1NAMA 4UIMA 2IMNA 4C55A 1HQRA 1JHLL 3DKHA 1NDMA 5MEOB 1WBYA 4YSQA 1WTGT 2AQRA 2FX9L 2YD1A 1D2PA 1GCFA 2BW5A 2W38A 1A8ZA 4AWJC 4DQOL 4ACPA 4LLVB 4ODHH 3G5YB 3KJ4B 2OR7A 4O9HH 3FUJA 1BD2A 3CZFB 1F11B 1HILB 3SJVD 1K8IB 1KPVB 2KDGA 1KYAA 1SM3H 2WQVA 2JCCF 1RV6X 4Z3TA 4HETA 2XWJA 3ZZSA 1JZ2A 4JB9L 5D93B 3MN8A 3BZEA 3O2DA 1FH5H 1UGNA 1TJMA 1J0JA 1EHAA 3BD5A 2Y7QB 1LMKA 3NZ8B 2VW7A 4IIQA 2NQ3A 2OR8A 4JO5A 4GRLD 1A25A 4OD2A 4Q9QH 2PPAA 2C3XA 3OGCB 3ZE2F 4DN4L 3ORJA 1YZZA 5AL0A 1V54B 2XWCA 4WFGE 3GSQB 3MZGB 1Q0EA 3CVHL 1K3IA 3CMGA 1SEQL 4GSRA 1OWWA 1YAIA 3UPRB 5JHBA 4UOW0 2XQBH 5ICYB 2LFEA 2CRZA 1JCKA 1NEZG 3MBED 1DQDL 2VXSH 2CHDA 4XBPB 3MNVA 5DI8B 4APXB 1EPFA 2DKUA 1SF3A 1X5MA 4X7EC 1ERNA 1PKQE 1QLEB 2P1YA 4HHGA 4O02L 5FFLA 1P4IL 4H25A 4F1ZA 5AW7B 3E38A 2P3YA 4WFGD 3RVTC 4J3TA 3RDTA 2QR0B 4RMVA 1XGQA 1YDPB 4Z7NE 3CQQA 2OKMA 1D5IH 1G9NC 2DN7A 1YN6A 3GWJA 1ULVA 4MGXA 3I6KA 3GHPA 4WI9A 4H8UA 2ZXWB 4F57L 1RP8A 2CDEA 4IRJD 4JKPH 1G9HA 4XAKE 2Z31B 3QZLA 4KX8A 3VE0A 2L0DA 2XXGA 4G5ZL 1KIPB 3NSYA 2WKGA 1KTCA 1J1PH 5TQ2H 2GITA 2AKRA 1WFIA 3DWTA 3GSNB 1I3GH 1VGKA 4NFDA 3C8DA 1QFHA 1HL8A 3GPEA 4JO1L 4K8RH 5DEGA 4LK4A 5G4MA 2VXQH 1TENA 3DX0A 4OD1H 3RIFF 3VGFA 4BQ9A 5C0CD 4XOCA 4XAKD 2P5EB 3IN0A 3E0GA 4OU3A 2AJ3A 3H53A 3OKMB 5GSVA 1U2HA 1XMEB 5EEZA 3V5HA 1NMCB 2NY2B 5ACZB 1ITBB 1U8LA 2DQIL 4NX0A 3TN0A 6FABH 3WIFA 1OT2A 4P5SA 5F3HA 1HE8A 2R29A 2X4SA 4KRMB 5AAMC 4BZ1L 3MOBH 4GBXB 4P3CH 5GGSY 3DO3A 3LRGA 4HDIB 1DVFC 3POHA 3ZR6A 1M7IA 4BDVB 4EJ1C 5I8CA 4FG0A 1ZXKA 2R1WA 1Q9OA 2DQTL 4PR5B 4FNLH 1T66D 4KKZA 2CWRA 3B8YA 3CFKA 5D72H 2ZPKL 3UO8B 3N1MC 2OMVA 1ZT1B 3RURA 4JKNA 3RJDA 1NIFA 1RHFA 3EG9A 4U6XB 3CHPA 1J0HA 2A1WL 3ISYA 3F7RA 1IAIL 3QC6X 4KMTL 5D7JC 3VXTA 1QBML 4LP4A 3Q5TA 3ARUA 3VXOA 4P9MH 1PDKB 2EUWA 1MWAB 1XXFC 4JZNB 3QFJB 3LV3A 4AG4H 1DDTA 4J6IA 5DJ2A 4FQLL 2XRAL 4A2HA 3QUYD 4HIHB 1WF5A 1JN6B 5E8PA 2E59A 4PJDF 1RZKC 2AI0H 4WUKH 4H1LA 5J6GB 2I60H 3SE9L 4KKPA 3QIWA 5HDOA 4NDMA 2C9UA 4QXUH 4UUJB 1XF2A 5BZDA 3OL2A 1DQQA 3RVWD 2VDOL 3ESUF 4FABL 4AYBA 1AS7A 4X80L 2EIMB 2W07A 3P4NB 3QCVL 4HOWA 3EOAB 4M93B 2ZKXA 4DVRL 3CFDA 1I1AC 2HKFL 3OHXA 4PJ8B 2FT8A 3MNDA 4EDXB 3HHMA 2QTEA 3FZUD 2ZJSL 3VWKC 1BZ8A 3ZQXA 1FA4A 1IZJA 5JOFB 2XIBA 2BFGA 3DRTA 1UYWH 2EXWC 3WTYA 5IJCC 4KQ4L 4EIZC 3V9CA 1SFDA 3DGGB 4KVCL 4Y7OC 4HPYH 2J5LB 3W0WB 1NPUA 3T08A 5HHQB 4XNDA 4JZJB 1KCVH 4XMWA 3I2CL 4Z5RA 1QNZH 4D3CH 4ZMVA 1FFRA 5E70A 4ZUUA 4ZX5A 3C60D 2ADIA 4ZFQA 4O4YH 2EDLA 4N1HB 4XOBA 3TO4D 5HJDA 1YUHA 1GVIA 4EIUA 2WVVA 1RZGB 2XVBA 5MENB 1DEEB 1ZT7B 4X6EA 3ES6B 3VB9A 1S46A 2BOBA 4FQ2H 3AREB 1GR7A 3PABB 2XYBA 4JJ5A 4YHOL 1J10A 5KTEL 4K7PL 1NBVH 5HDBB 3BUYA 1L9QA 2A4ZA 1HTYA 3ZMRA 5HI5D 2W92A 3WFBL 5CCKH 2ORBH 3LPFA 4G80B 3T6WA 5I1HH 3EJTA 2E27L 3LNIA 1EZUA 3NA9H 4OIFA 5L6YH 3S37L 5T3ZE 1S2EA 1S7VB 2X70B 2B0SL 5E2UH 1S7UA 4MD5A 5DLLA 1D5BA 3HS0B 1TPXB 5FAAA 1WFMA 5JOEA 4ZS7L 3WY1A 1PTZA 1IBFA 3MNMA 1S3KL 1J8HB 4YHPB 2BVUA 2A0LD 2XWRA 3LEVL 4N2EA 4BZ2A 1HCZA 3JV6A 4H1LG 1KYOJ 2C9SA 1KYOK 3B2VH 3MUUA 1B6DA 3N43F 5CUSH 3T2NL 3TVMD 3VFGL 5T3ZD 2DQFB 2F5AL 4P5KA 3O2WL 3GXPA 3FUHA 2GJRA 2DLHA 1RL1A 3QJHA 2WTRB 3QZOA 2EP6A 1NPNA 1JNLL 5KSUB 1ZD6A 3C5ZA 3FUKA 3MRJA 4XWGL 1PX4A 4ZAKC 1HL5A 1JPTL 2C9RA 5MERA 4KXZH 4YQXH 1QYGL 2V2TA 1FLRL 2WCPA 5DZJA 4M8RA 4ENZA 2OL3H 3HKZA 4B5ZA 3BP6B 2PWEA 2DMBA 3RIKA 3HAEH 3SE4A 3QEQB 3PUCA 1YLBB 3MGOA 5C0GB 1I9JL 5D2LA 2C26A 4JG1L 1WV7T 3MRBB 4P2OA 4DFIA 1A6WH 3SOBH 4PY8I 5GJTH 5K39A 2FO4A 4GXUN 4FKHA 5E08L 1G9EA 4AYSA 4DHLA 2PR4L 4J8QA 5T5NG 3QG7L 5IB4B 4PN6A 1FWXA 5E4IA 5E8OB 4DAGL 1A8JH 5F96H 4M5ZH 5D6CA 5E99H 2EDNA 1LQBC 3VI3F 4FDWA 5HPMA 1CDBA 3MA7A 1LD9A 2OTUB 3CVBA 3NUKA 2XN9B 2MOGA 1J9SA 4H0IA 2XTSA 4AYGA 1ZWIA 2ZYRA 1VENA 4IJ3B 3GQFA 1QLRA 4BIKA 1PYWB 3H9SB 1KACB 4A39A 4XNMA 3ISRA 5INDA 3L45A 3JWDC 2ADJB 2AFNA 2HYMA 1IM9B 3WFCH 4JLRA 1BWWA 1XGRA 5EO0A 2I9TA 1FVCA 4GFTB 2EKJA 4OV5B 5DJ0B 2AVGA 2NY3B 3QZBA 5GS1A 2JI3A 4OD3H 4XCCL 4MQXD 4H2AA 2KL6A 4JM4H 2EZ0C 1FLTX 5DUBB 2O5YL 1U92A 2WLLA 5DJXA 3LZFH 4CSSA 5JIIA 2VR7A 3FCSA 4KZ0A 1KIUB 2ZOLA 1JGVH 1K3ZA 1AGCA 1YHPA 2N59A 4GQ9H 2Y5TA 2GI0A 1H3VA 3EGXB 3SY0B 1SDDA 1O75A 1RPKA 1G7HB 3CDGA 5EDSA 5LXGH 1HJCA 1IE5A 4IMLA 4MA7H 1XEUA 5FGSA 2FUTA 1JFQL 4GKLA 1NOLA 2OZ4A 5JXEA 4WJKB 2IGFH 2LGNA 2WBWB 2DLFL 3RNQB 2Q7YA 3SQBA 3TNNB 3IXAA 4DPRA 1QKZL 2HRPH 5KVFL 3ARPA 4HMCA 1BJ8A 4NNPL 4NQCB 2IH3A 3A47A 1I85C 3HJ0A 4XXWC 4FFZL 5GS2D 5D7KD 4PJCA 5ADPL 1ETB1 5GZNC 1F4WL 2H26A 4P2RB 4IIQC 4OLVL 2WWKO 4HXAL 3WLWD 3WAKA 3FB6B 5JPNA 3AT9A 4L8SA 1BG1A 3ASWA 4YZFE 1W8OA 1JXGA 5BV7H 1ZKAA 3D6GA 3MXVH 4F5CA 4E9YA 4JFOB 1RMFH 5KEZA 5D7SH 2PO6B 1XF4B 1U3YA 4G6AC 4R5VA 1KELL 2A74C 1CICA 5HGDA 1XB6A 3ZE2E 4AVHA 3FOLA 5I5RA 3D09A 4TV3A 3DXAB 3VGHA 1CD1A 1DN0A 1TEFA 4GT0A 2ZAGA 1R9FA 3T0XA 5EB9A 1CURA 2DY2A 4PIRF 4JHZA 3AG4B 2YQ2A 4TQ8A 4AJYV 3OX8A 3EO0A 3FHAA 1L9PA 3RDTC 5GGTL 3V0EA 3M17B 2V7HA 2VABB 4G1MA 3T2LA 4IRZH 1HCVA 4LLQB 3QEHA 2B5IC 5DHYB 2WVTA 4ATWA 2QHLA 4OQTL 1D9KD 1MFCH 5JDJA 4D0DB 5I6XC 1BPVA 5A1AA 1INDL 3D85A 4JFFB 2HKHH 3MLPA 1CK0H 3N41B 3OWRA 3JWOL 5SWZE 2P5WE 2RMNA 2VDKH 3ERXA 4U3XA 5B1BB 5I1CL 5DJYA 3L4VA 3MLVL 3QEUA 1DQKA 3STZA 1J1OL 3MJ8B 4PV8B 1CLVA 4G9FB 1OZUA 1L9NA 3HFFA 2AF2A 3LN9A 1E28A 5EULV 2PTTB 4YDVB 3REVA 2CGRH 4JKMA 1VPOH 2UXTA 4YSTA 2P5WD 5SWZD 3FN0L 4DGYL 3V5DB 5HYQA 1JPFB 4NCDA 4PJFB 3TN0C 1BAFL 2H6PB 2K6ZA 2YEZB 3QJFA 1CN4A 4Q0XL 3D5OF 5EC2B 3L17A 3QNZB 1OAUH 4JPWL 3MJ9L 2VUOA 1GTNA 43C9B 5JYMA 3I85A 5LNGA 1MJUL 4KHTH 4OLWL 1NBZB 4LCWA 4QXVA 3LZPA 5B1CA 2OSYA 4JFYA 3BAXA 2NY1B 3PGDB 3IF1B 3PQYE 4KO5A 4N1EA 5E8DL 3UIZA 1BQLH 3VRJA 3ZRSA 5BO1H 2WINB 3WFZA 4MS8D 5DSCA 4R6UA 1R3KB 2P24B 2VXVL 1PLGL 1D3CA 3D33A 3BVVA 2WLIA 4JFSA 4K3EL 2AEQH 4YZWA 4PRPE 4UZSA 2R0ZL 3QPKA 2BNQE 3LQAC 3PAVA 5DS8A 5PCYA 2KT6A 3RWJA 4EDWH 2V7NA 5JIPA 5D5MB 4BQ6A 1MG3C 4L1SA 4OTXL 4WWKA 3PQYD 1GCYA 2G9HB 1X4ZA 2VZ1A 4HWUA 5IMKB 1CQKA 4UNUA 4PRPD 1RI8A 4HD5A 2BNQD 5FM5M 4F37K 1SDAB 1ZDQA 3RA7L 4HEME 5CBAA 3QIWC 1A4KB 4JO3L 2NY6B 1F4AA 4O2FA 4KY2A 4P46A 2X3CA 1ZS2A 4PJDE 3GBLA 1MCJA 2E3VA 5FGCE 3ZKSD 4Y4HB 1WFJA 1HYSC 3V2AR 1CE6B 2QQKH 3DBSA 4WV1A 3BH8A 5DDHB 1DTUA 3OHXC 4B3EA 4XP6H 4K7FA 3QDMB 3K2UL 1JE6A 3D08A 3S3JA 3VXUE 3H85A 4YDJA 5DUPL 3ECBA 3ENEA 4JANB 1AD0B 4I2XA 4WNJA 3NSJA 2UVEA 4HJGB 2VM3A 2HRGA 3U9PH 4ZUSB 3QRGL 3KS0H 4BGLA 4ENED 1CTOA 1DANT 2W9EL 3BKYH 1UD3A 2BS8A 3GRGA 5H37G 2BS71 4DP7X 2L04A 1FNLA 3V9EA 2YPVA 5KS9A 1J5OH 2OLDA 1ZVHA 4KTEH 3VXUD 4RX4D 2KUTA 3U4KA 1J18A 1JWUA 4P06A 2DF3A 2RHEA 5IW6B 1C5BL 4KJPD 1AGDB 5I15H 1H6UA 4LDOB 1IBYA 3QXUA 1E8ZA 1I31A 4CJ1A 2WQWA 4H26A 5C0NC 1GYAA 3FO2B 2DD8H 5HBBA 2GBAA 2PXYD 3D4GA 2Z8SA 4EXPX 3BAEL 1FL5A 1NCCL 5A2CA 3L4XA 4ZFOB 3FCUB 5FGBC 4NQEA 5FHAH 3DI3B 5JOPE 3D69A 2Z1PA 1IEHA 1MIEL 4Y16B 2EVJA 2NY5H 5BUPA 4ONHA 2JQZA 4PRNA 1T2QH 2ZQKA 1EHLH 4EUPB 2EVIA 4PGBA 4N6RA 4F33B 2NUPB 3GHEL 5D1QA 4RSYA 4PGZA 2R7EA 1I7TA 1EERB 1BPLB 3IFPA 2IQAB 3FQYA 4GQRA 5CN1A 4DPAX 4EN2A 4IK7A 1X5FA 3ARBD 5I9QB 3EYUH 5JOPD 1OE3A 1WA0X 1SMOA 4HKXB 3V0IA 5FYJH 4QNPF 1P2CB 3ABGA 4PY7B 3QCUH 3VFVB 3BSZL 4UB0H 4WI0B 4YLBA 4DFHA 1WIUA 3KPQB 4BFOA 5DTFA 1A14H 3RWDB 2CNYA 4Q9RL 4JAMB 4LGRB 1MDTA 3WO4B 1J86A 2G3XA 1ED3B 4HCFA 4AKOA 3GSOB 2DJMA 1LEIB 1P7KA 3IMSA 4QOKA 1BBDH 4P2OD 1R0AL 4YPGA 4RFOH 3NRPA 2WAQA 3SGKA 1FFQA 1U2CA 3NCJL 2YPKB 1CF8H 1NFAA 1TQUA 1D5ZA 2A9DA 2NY4B 3TH2T 1XCQB 2D4DA 3WSQH 3O11B 5GGRB 2AJYL 3MV8B 3S96A 3X3GL 3ULUF 3ZDZB 4R0LA 4PQXA 3PDGA 3WN5B 4OCWL 3EGDB 3VFNA 1V05A 4MNHB 1O7SA 2A9NH 5IG7A 4TVPL 1NCUA 2CH8A 1UJ3C 3K72A 5JHDE 2MHAB 3L48A 3N9GH 1DLHB 4S0HA 3D0AA 2BNRE 1GTFA 3FT4A 5I73B 2R15A 3NRQA 3HE6B 3I50H 4GP5B 3SKOA 3VI3E 3ECWA 4FXKB 4GRWF 1DUYA 2ZUQC 4ZNEA 4B7IA 3RHWK 4A6YB 3KS0J 5ADOH 5DURD 2H0FA 4O51A 3HZKB 3CFNA 1PY0A 2VDLL 1IL1B 1CYGA 1K4CA 4XN9A 3VGAC 2D3LA 2HN7A 2NT0A 3MCG1 5GS1C 5DJCA 2BNRD 1CJYA 3JUZA 5EBMB 3TBVA 1G7QA 2I32A 3MVSA 5AALA 5KWYC 3L7EB 1RUAL 5HYSA 1S7TA 5FHBH 1BZ7B 4PJGA 4YHIB 1YPZA 2BIQA 3KEHA 2VL4A 3QDGE 1SF5A 3WJMA 3H2PA 4U1HA 1OE1A 3V0WH 5I17A 1B4TA 1D6EB 2YD5A 3CQFA 2ODHA 4CU8A 2EXYC 4JCWA 4UTAA 1I8MB 3QUZD 2A73A 1FL3A 3QQ4B 4XMLH 5IK3A 1M71B 2BVOB 3Q13A 1IEAA 1ES0B 4CADA 2TSAA 2ZWKA 3FKUS 3I6GB 3TTSA 4OSUH 4FP8H 1HINL 4YSPA 2MMXA 3BKJH 3MNZB 5JW3L 3BRGC 1EEZA 5JXEC 1DQLH 5I30L 4YDIH 4DUWA 1Y07A 3VQMA 2BM3A 4G6JH 1UOVA 4D7PA 3WEXB 2K70A 5JA8B 3IPBA 1CGUA 3ZUCA 4BZ1A 3WTTA 1RSFA 4N9GB 5E9DB 4Z3FA 1T22A 3RZWA 3QHZH 5B1KA 3WMQA 5KVEH 5A16B 1ZXQA 4PJBA 3MFFB 3WFEH 4OW6A 5IHUH 2EDYA 1KLGA 3WJLA 2A6KA 4GEIA 4E41E 2AMUA 3DV4A 3L3GA 4FMVA 4CUCA 1TTFA 4LEOA 3QUMB 3DV6A 4DK3A 1QLFB 1A7QL 4WUUA 1CICC 1CGSL 4KY1L 2CBPA 2GJ6A 5C0JB 5CM1A 2XN1A 1VFUA 1T1YA 2NNFA 4HD9A 5I18H 3HZYA 3WY3A 3Q05A 1NCWH 5GRJL 2M26A 3EJQA 4S2SA 1HEZB 4WI6A 4WJ5B 4YSAA 2VMFA 4MTMA 2F2HA 5EBGA 4BV1A 4B9CA 1MLCB 1ZHNB 1JZ7A 3ARTA 2PP7A 2VT0A 2YRLA 4QR7A 1JTPA 3FXIC 4UZUA 3NIFE 2E4TA 3BUPA 1MXGA 4Z7QB 1VLXA 2D7PA 1F2QA 1JOIA 4KJWD 3P30L 4R5XA 2YARA 3WL9B 4WY7H 5L7XL 4NZRH 3KE0A 4PG9A 1ZPLA 4P3DB 5KYNA 1AZRA 5B3NA 4MJ6B 25C8H 2CK0L 4AQ1B 5FO2A 1NDTA 4NIKB 1YEGH 1O6TA 2Z92B 5KYXB 2XPGA 2HG0A 3ZDYE 2R2HB 1PVHA 2XKNB 1I3VA 1JDAA 3GI9H 1H3XA 2K7QA 4H44C 3VUAA 5CP7B 5C0EA 3IAPA 4N0FA 4W1TA 2SODB 4NFBA 4WTWA 1U42A 4B9GA 5F7EL 4A2MA 5CR8A 3G3LA 3TCLB 4JPKL 4APQB 1KZYA 4RRPA 3QXAB 5D6DA 4B50A 4X9BA 4HC1L 1MEXL 3R1GH 4Y1SA 3O6FD 3CSGA 3MBXL 4ELMB 4YC2C 1AKJB 1A6AB 1AGBA 5LUMA 2Q9OA 3IGFA 4NOBA 4QRPB 3LYRA 4FQJH 1RFDH 2JJTA 5DF0A 4UAOB 5J12B 5GGUA 5DVLA 5IFJA 5A2FA 3FB8A 1SHWA 3HZVA 4X0KA 3QQNA 3R7QA 3LH2H 2OMWB 1SEBB 3FCBA 2VDPB 1G6RH 2WKLA 4RGNC 3QQDA 5IJVB 2RTTA 3BLPX 4NBXB 1T5KA 4X6DA 3KLSA 4KO7A 5FLUA 1QWUA 3PGCB 4WWKD 5EZOH 4YBLB 1E4XH 2FIRT 4YO0A 5DRZA 3T1FA 4R97C 2ZZUT 4R90L 1FE8L 3UIYA 4YHZL 2QQQA 3JSSA 1GC1C 5T1LA 5B4MD 5FLVA 5T1KB 1I8AA 2FECL 2N01B 4LBEA 1U9KA 4OZFH 4GJTB 5DGQA 4O2CB 3L6FB 2R69H 3HFML 5E6IA 2LLGA 4TRPH 1U8OA 5EU7C 2CJUL 2PYEB 2V9RA 4JDZB 5EOCL 1N59A 1FG2B 4LSQH 2Y0SA 4M7ZC 4PS4L 5GRVK 3QPQD 2Y3AA 1H6FA 3D25B 4P46C 4MKMA 4R7VA 2WIIA 4L29B 2AQTA 3ZTEA 3BZDA 2PYFA 3KPPA 1SY6L 4YXHL 3RNKB 4XHJD 4DTGH 1KJ2B 1TETL 3EH1A 1ESOA 2CO6B 1Z5LA 2J8OA 2IGLA 3VRLF 1UM5H 3O4OB 1F6LL 4CW1A 3Q0HA 1OPGL 5IVZB 4HIQA 3B2XA 3P9MB 3ABMB 4KMLB 4Y1AB 4M1GH 3ABKB 1ZS8A 1X7TA 5DQJB 1MFMA 1S5HA 2QLYA 2V5RA 1OSEA 3K8MA 4OJCA 3BLBA 3GZOA 1A65A 5FDWA 1QHOA 4AQAB 3I6SA 4ZPTB 2P48B 4WW2F 5ILTL 1M2VB 3U36B 1UKSA 3BE1H 4EE2A 1PSKL 5KVDL 5I76A 3I9GL 2LHAA 1YA5A 4WI3A 1N7MH 1KNOA 4U33A 2GHWB 2LU5A 4RRPG 2NNCA 5BQDA 3T4AB 1T7XA 5EWIL 3K8LA 1G1OA 4LIQH 5EBLA 2LABA 3GO1L 1Q94B 1WFUA 3EDKA 4G8EA 1KF9B 1NBYB 2J20A 4U6HA 2WUCL 4UQ2A 1GJWA 3UZVB 1TYJA 3BEVB 4P99A 4C4KT 1Y7VA 3U25A 3BESR 4LDCA 2DM4A 5AG9A 3NRFA 5DZPA 1CT8A 3C2AH 3O8XD 3WKML 2ZYIA 4L8BA 3FULA 2QJDA 4DZBA 1YNLH 3AACA 1EJOH 4XCEB 1QD0A 2EUZA 3P4MB 1ZANL 3FQXA 3ILQD 1JXJA 5LBSH 2X2UA 1XH2A 1C8PA 1DSWA 3AUWB 4JN1L 2NSXA 1FAIL 1RZ8B 2X4UA 4R8WH 1QQDB 4J1UB 1YUKB 1ML0A 4FQXA 4RGOH 4UT9L 1XGYH 1BAGA 4B9ZA 2R23B 1LP9A 3U48A 2CKNA 2D7NA 2EDWA 5DEFA 3VTAA 2Z9TA 4H88H 2UYLA 3U4BH 4XCNA 4N2OA 5JHMA 3Q3GA 4UANA 4OJDH 5ANMB 5JW4R 1OY3B 4DK5A 2BK8A 5FF6A 1CVRA 5B3JE 5IFAL 5AL8A 1N67A 5F89A 3SDAD 4X83A 4LSPL 4KKCD 4Z7VF 4GS7B 2XFGB 5B21A 5I74C 3QEGL 4BGDA 1HL9A 1T21B 2YSSB 2B39A 3D2TA 3UO1H 4HWNA 5TE7L 4LL4A 4K2UH 4FFZA 1XZ0B 3FU3A 3ETSA 2XV3A 1N19A 3QUXC 3RWFB 3HG1B 1KYDA 4FZ8H 5KJRH 3U7WL 5ENWA 1N3NB 5GHWL 2EEAA 4FTVB 4GAYA 3T3PF 2XETA 2VZTA 2FZ3A 3A5VA 4U49A 3CCHB 4PS8A 4UINH 1BZEA 1MFEH 1FN4B 2BP8B 1GH7A 3QBTB 1WJ3A 4F58L 5F7YC 4JN2B 5T3ZH 3KHQA 4R0LC 2OK0L 3CFJB 1DBJH 3AROA 1QPPA 2ALWA 1AI1H 1AXIB 4LP8A 2ODIA 3OPUA 4LGSB 3VFOA 4AMWA 4U3SA 3OD3A 3ULUE 1IO4C 1ZEAL 2BIMA 4N87A 3W9EA 2IPUK 1QABA 1YJDC 1F8TH 2LVEA 3UACA 1RZJH 3BSHA 1IGML 2J25A 4JFXB 1KG0B 5IV2A 1ZT4A 4UM8A 1CD8A 5GGTA 2GPZA 4JK0D 1J48A 1GY1A 2BERA 3X2QB 3K6SA 3ZOAA 4OM0L 2Z93B 3P40A 4MAYA 3IB4A 5HYIA 5I1AA 1HAWA 3GXDA 3ULUD 3V4VH 1LK2A 2HT4C 5J8OA 3MQIA 2EICA 4GRWE 4OQTA 2KLRA 1N2RB 1GS7A 4M62H 5AZ2L 5DR5L 4OFQA 3K6DA 2Q20A 4QHKI 4NZFA 2MPVA 3ULSB 1BQHA 2DIAA 3RGVB 4XVUD 1A3ZA 1U8PB 3ZKXC 3RJQB 4ZG1A 3FL7A 4PP2A 1MCEA 4N2CA 4NJAH 2FL5A 1KB5L 2EH7H 2DWXA 3AB0B 1JXFA 4HPOH 1IRAY 2WQ8A 3SQOL 4JRYE 2NR6A 5CD3A 1LO4L 1LDPH 4R96B 1IC4H 3SGDI 3WOVA 1FZOB 2AXHA 1GZQB 2P9RA 4N0UB 3T6XA 4OCRH 2A3TA 4PWFA 3QIUC 1R5VB 3MUZ1 4NSKB 2G0KA 2WBKA 5HHNB 1CVSC 3DA0A 3KYKL 3GM0A 5TDPA 4A38A 4DGVH 1U3HA 3HI1A 3GSXA 3BUTA 3F58L 4BFIB 1MVFA 2JIXD 1NAMH 4PWJA 3WNNA 4JX0A 3EYFB 3H4HA 4EN3A 4Z7UF 2OMUB 1AY1L 3MJ9A 1AGEB 3Q6FB 3K3QA 2VM4A 3LMJL 2CHZA 1W15A 4YSOA 3HTLX 5M7QA 1A1OB 1MI5A 3HBQA 2I69A 3SODB 1PY9A 3O3BA 1W0VA 3NGBC 5INCA 1ANUA 4OI7A 4DKEL 1M9WA 5AVTB 4BWUA 1FZJB 1NCNA 2Q76B 4K3JH 3RYMA 3WJLC 3RTQB 4WUUD 1DQJA 4PTTA 2HMID 1AD9A 3FH7A 4XMKH 4XOEA 3ZRFC 1MCNA 3WNJA 2Y9RT 3Q9QA 1H15A 4YAQA 4E5XA 4WWNA 2HPOA 4XGZB 5DLML 1SOKA 3CIAA 1FV1B 1RURH 2FHCA 3MV7E 4NKIH 1CDJA 1RK0A 5IWLC 2WD0A 4NNYA 2I27N 2J4WL 5KBDA 1OAQH 5C3LD 4O5LL 1ITCA 3LRKA 5GS2H 2HTKC 3WFHA 2YD6A 4IU3A 3HG4A 5EIIB 2VLRB 4ZS6D 4KDVA 2IAMD 4Z7UA 1CQYA 3ABLB 3B1TA 1MPAH 4MMZA 3GHBL 4I48B 3GSUA 3DX8B 3BCDA 3MV7D 3BQUC 4PPTA 5JPMA 4LSTH 3QPXL 4LSRH 2WYHA 5F70A 4NC1C 5I8EB 4JRXE 4GW1B 3B37A 1PQZA 4H8WL 4XVSH 1OTSD 4Y2DB 1MDAA 1MRCH 2VXTL 1KLUA 4M02A 2XWTA 4P5TB 4UQDA 5AZEH 4XBEL 1MCPL 3P02A 5E5MA 3KR3L 2XV2A 3FSAA 3ARGC 3WLBA 5FC9A 2KYIA 2CLRA 1JV2A 4MD4B 4CC0A 2IG2L 1NIEA 4G9DA 3KLLA 3ARDA 4QAWA 5T33H 4FULA 1A6ZB 4XC3H 5I71C 4LLDB 3B3BA 5C2BL 3L3HA 4L4TE 5D9SA 4OIBA 5D6DC 4HLJA 3SHSA 3AVEA 1M3JA 1Z9SA 4B9PA 1YC8A 1MHCB 2AJUH 2KLSA 1RP9A 2VH5H 2Y23A 4NPYA 5FYKL 2D31B 4V2BA 4FA7B 3MRQB 4AK2A 2A6IB 3BVDB 2Z0BA 3MV9E 4MCZB 2Q6WA 2YEQA 2YWYA 1A3QA 4OY9A 1JK8B 5BOJA 3BZFA 1EJ6A 2YAEA 5ICUA 1BXXA 4L4TD 1HEHC 3O3AA 3TPUB 3G6JA 3GRWH 4F3FA 4Z7OB 4HH8A 4ZMNA 4TQPA 1TFPA 2HLAB 5CJOH 3VXSE 4CBPA 1I1YA 4HUWA 5T1LD 1AC6A 2O5XH 3MV9D 4WKZA 5EU3A 1QSVA 1NBQA 2VDQL 3NP3A 4MJ4A 4TNWF 2O72A 4I3RL 1QRKA 2XDHA 1RZ7L 4M48L 4OBSA 5E6ID 4KRPC 5ESVA 4OV6F 2PCFA 1ZCRA 5LN8A 3H8NA 1KGXA 1U6AL 2DWDB 4PHZA 4RAVB 2YD2A 5I0XA 5CZXD 4ZFZB 3FO9A 4LZKA 5LGHL 3VG0L 3V9FA 3EOTL 4JREB 1F1AA 3MOAH 3VXSD 2XOTA 3BSZA 3DSNB 1KV3A 3II1A 2OMBA 4RFEA 5IOPA 1BVNP 2JKWA 5EH1A 1XSOA 4RZKA 2V2XA 3AY2A 3ZTNH 1BHGA 5IR1A 4PVNA 4QRQA 5TGBB 4PYGA 5AOIA 5EIVA 1VERA 2FSEB 4GKZA 4JO8A 4QPEA 3PXLA 3U30C 3O45A 3UAAA 1IGJA 4XNXL 1CFVH 2WQXA 3V0VA 3GK8H 5GGQL 1F3JA 2ZF9A 2GY5A 5I0VA 1Y1UA 4H1LH 4JQVA 4ZQKA 1C5CH 3WY2A 4P4RB 1OD9A 4ZX6A 3MX0A 4AT6B 5CEXA 2NTFB 3O3UN 2A38A 2HT2D 1IGCH 3VCLA 3DX1A 3PUUA 1ID2A 1ZA6B 3KPRE 1J5DA 5H2BB 5HJGA 3OZ9H 3ZGIA 3T8XA 2Q2EB 3IMTA 2OXGB 5K9JH 5DJDB 4MDIB 1NLDL 4Q97A 2V5YA 3LS5L 5KSAC 2YD4A 3V8OA 1IAOA 3ZN6A 5FOBA 2P5PA 1I9EA 1J88A 2H1LM 3WNLA 2JQMA 3F84A 3NZHH 1HH9A 5B8CA 1E40A 2GI7A 3KPRD 1E50A 1I4FA 4HQQL 4M6NH 5J9PB 2X7LA 2B4CC 5KOVC 4XB8A 4Y5XC 5F6IB 5EO1B 5LCVL 1AFVL 3LNHA 5E1HB 3ULVL 3A4DA 2DQGL 3T0DA 5AOZA 2ZXEB 1CR9H 2OQJA 2HJFB 2WBJC 4FQXD 5C8JA 1GYWA 2D0HA 1WS7A 4KRNA 1N4XH 5MP6L 3OKDA 4ZUWB 3N40P 2AGJH 1HQ4A 4JY5H 2IXQB 5L88L 1GRWA 3MUHL 3LY6A 2OPCA 1K2DB 2IO5A 2LU3A 1TQSA 3L1OH 1DJYA 1S7WB 3HZMB 3FT2A 2GT9A 3F7YA 3GT6A 4YIQB 4OCMC 2IDFA 4IBSA 2X1OA 3Q2VA 4EPSA 4UCFA 1FGNH 1TZGH 3DOSA 5BZXA 2J1YA 2B9AA 3MREA 5DJZA 5JR1H 4EXKA 1A7RH 2FX7L 4U1SB 2D0GA 3MV11 4U0RC 1JGEB 5CSZB 3TXAA 3WGUB 2VAJA 1P7HL 4ZO8A 5J11B 2DQJL 3RWCA 2OL3B 5FUZH 4F20A 5C3IA 4URKA 4BZ2H 3CH1A 3O6KL 4KTDH 3HAEB 4G3YH 4JQXA 3WHE1 3H9ZA 5FECA 1N70A 3FU8A 3C6SB 3SOTA 3AM8A 4U0QB 3ZE0B 4WK0B 12E8L 1MFAL 3NAAL 5EU6B 1RLBA 4RFNB 1H8SA 3L3OC 2F53E 4PRBA 2K3TA 4GRLC 3S34L 3LEXA 3ZE1B 4EO5A 3GLDA 4JFUA 4UM9B 3T3PE 5K9OB 1GJIA 1JDCA 4JG0H 1YECL 2JE8A 4AEFA 3FSWA 3SCMA 5LLIC 3A21A 3K46A 3CD4A 5KW9L 2WSDA 4FJZA 5I1EL 3MZTA 3B5GA 2J7LA 4BFFA 4PBDA 5HY9A 4UNIA 3PAZA 1WIOA 2W5PA 5L9DL 1UD4A 2Z4QB 3JV4A 5AW3B 3RWEA 1YEFH 5HDBF 1INEL 4NO0D 2Q0ZX 3MROB 1FC2D 1VZGA 3FYIB 1UVQA 2FUQA 4ZSOA 4AKQA 1KPUA 3BAJA 4QCIB 5BXFB 4NPKA 4AZ8B 3OKKA 2TAAA 5C0BA 4HU8A 1YRKA 1NAKH 3MA9L 3WDIA 1OO2A 5F1NA 4AM0B 1X7QA 3FF7A 5I5IA 2FLRT 2NY0D 5CEZH 4NN5C 2P8LA 5EHFA 2H32A 4J2XA 1DEDA 1EUUA 4JY6A 4QD2E 1H3PL 1U8JA 3PHSA 2NR6C 3DDFA 2J8HA 3FRPA 4U6TA 1XDTT 1I7RB 1Z2KA 1RIHL 3TT3H 2IQ9H 4JEGB 4HSCX 4PM1A 1YEDB 5TE6H 3J2PA 2M1KA 2B1HH 4ZXBD 2XCMC 1G7IB 1J9RA 1U3HC 4XCFL 4C56E 1UEMA 4BK5C 2OR9H 4TN9A 3SSGA 4JM2B 4EN3D 1M3IA 8PAZA 4NRXA 3E9TA 1M1SA 3L3DB 3CMOL 1L9RA 4HGWA 4HC1A 5FO7B 1NWOA 4NKDA 1S7RB 3IT8D 2JXMB 3S4SA 4DWHA 4TKWA 2NSMA 1NFDA 5HJ3B 2F54B 3MRRB 2AAVA 3F7PC 1WD9A 5E8EB 4C56D 5BV7B 4KK6D 3ROOB 3VXNB 1NGWB 5IM7A 1P1VA 2ZIDA 5IROD 1KXVA 3FN3A 1CLOH 1U3NA 1Y6MR 4BRJA 1QSFB 1OCRB 3LKQA 2EE6A 4GXUM 5F1OB 3U7YL 3X13A 1T04A 4YDLC 2DDQH 1II4E 1A5FL 1LO2L 2BY0A 3S98A 1XGTB 2RAMA 2DPKA 5HHOE 5MHSD 2VR5A 4OZ4A 4LRNL 4KQ0A 1OHQA 4MMZC 3GMMA 1NC2B 3TZVA 1G7PA 3MRFB 3TASA 4PRHE 5LAXB 3TFKD 1P6FA 1CGTA 4AENB 2OFQA 3QJOA 1LQSR 1TNNA 4E9RA 3QJXA 1SY6A 1A7NH 4I1RA 3RVWC 3CIQA 1M53A 4TLKA 2VAAA 3MACH 1YNKH 4YXLH 4G43A 3IDMB 3TBSB 2YFOA 2IH1A 4Y9CA 5CILH 2VLJE 5CO1A 3U82B 3QXDA 4L9LA 1KCRH 4BFEA 4E42A 2MNJB 2QADC 4KAQL 4R4BB 4MBRA 3FRPG 2XQ0A 1BQ5A 2VMEA 5GSRA 4GW4A 4CN1A 4ALAL 1T1ZB 1BLIA 2J1ZA 3CXFA 1IB5A 2VW4A 4J3WA 4QHNB 5IQLA 2I07A 3MR9B 3RKDD 4N0RA 3SDCA 4ZW5A 5T1DL 1MCWW 4G8FA 1JTOA 4XPHH 1FSKB 4LLUA 2VLJD 4HS6B 4JFZH 2I25N 4BQCA 1TG8A 4UYPA 1R46A 4GG6B 2J43A 4MD0B 3AXIA 1CBVL 4YGVB 3LX9A 1KTDA 3BP4B 2O6DA 3B7YA 4TSCH 1BX2A 2J73A 1PAZA 3NSFA 4R7DB 2X0WA 3TO4C 5EUOB 4YSUA 5IQ7L 3UG5A 4QRSB 3PV6B 2XXMB 2JJSA 1CDYA 1FZMA 1O6SB 5IB2A 2Z91B 5AW2B 4UILH 2AK4A 4P05A 2R2BA 1UGKA 4XE0A 4QO1B 1MQKH 1PZCA 1BFTA 4WHTB 3WHXB 4MZIA 4ZW3A 2XWXA 3W9DA 5K5YA 5HI5C 1F90H 3P0VL 4Q4IA 3FRUB 2JFCA 2R9HC 5EG6C 3SQRA 5D1XD 4UT9A 5F6HI 4R26H 2DH2A 3MRNA 4IDJH 3NSXA 1EXUB 3KXFB 3QO1B 4UIKH 4UOQA 3SDYH 4B9FA 2QT6A 1TJGL 5DEZA 5AW9B 4G71B 3BAWA 5CKGA 5GRYA 5DA0B 3SYCA 2XFXA 4N8CL 2CPUA 3ZT7A 3OR6A 4OCNC 4OCSH 3BZ4B 4ZK8A 1TSRA 1IJ9A 4GG8A 4TULH 2AJZB 5EU4B 4K5NA 3KGTA 1Q72H 5IBTH 2EADA 1KZQA 1MCLA 1IBZA 3QAQA 2H5UA 3H0TA 3UP1A 2DQ6A 4XNZB 4GMTH 3J07A 3QR1A 4G1EA 4NGHH 3EGSB 3CC5B 4KKBD 4JQVC 2CE6A 2EE9A 1LO5B 1WZ1L 3EOBB 2AV7B 4PCKA 5AYUL 3KW7A 4Z78B 4DN3L 4XX1E 5EF1A 2FHFA 4BE5A 3R0NA 4PJFF 2P5EE 1N6QL 2Z31D 2ADFH 3U79A 4C83A 4NM4L 2RR3A 2Y7NA 2OSWA 1GPOH 4JVWA 1I1FB 4PGEB 1HDMA 4F1SA 3AUVA 4DKAA 5C70A 3NACH 2DMCA 3NEXA 2I9LB 3DTXB 3J8F7 1ZHLA 3G6DH 2K3HA 4KKLD 1S7SB 5B8CC 4M1DH 4J8RB 3GEFA 3LHAA 4LSUH 3U1SL 1F4YL 2F19L 2W80C 2YPVH 3O9WB 2P5ED 1DVQA 1UWGL 2H0EA 2X89D 3H9HA 3WXWH 3N0AA 3MJWA 5IB5B 1W0YT 2WO3B 1QFWL 4UNTA 4Y4KA 2ED9A 3UGEA 2EIEA 4LCCA 3DPDA 2WKOF 1GJUA 2NY2D 2BVYA 3AXLA 5FB8B 1WISA 2FO8A 2K78A 3HVDA 4PJXB 5D5MF 2H4EA 1Q9KA 2WZPA 5IUSA 4HJEA 2OMZB 1CFSB 3FO0L 4YDZA 3AAZB 4XRCA 3HRZA 3RX9A 2ADYA 4EQ2A 4GBXD 3B8SA 5KAQF 3C5JA 5TE4H 1M7DA 4AMKL 3UTOA 1A6TB 3INUH 4PGCB 2HFTA 4KUCF 5D4JA 4ZOCA 5JIHA 5K9KB 2WC7A 1BZ9B 3QFJE 4TSBH 1TLMA 4L1TA 4MJIB 4PSPA 3ZKND 5FIEA 4UOW1 1X5AA 1A02N 3L08A 5DYFA 1ID5I 5C71A 1DCLA 1OSZA 3PHQA 5AVWB 5CGTA 3SE8L 1PG7H 4IEFA 2ZKYA 1GW0A 2Y24A 2D9CA 2FD6H 3DVGA 1JHLH 4QWWD 2IIJA 5I66A 2FX9H 2X1QA 3K4AA 1SBBA 2GFBA 2X4NB 4DQOH 4P9HC 5PAZA 4HS3A 3QFJD 3U2IA 3O3EB 1O5DT 3VU2A 2F15A 5L2KA 1KIRA 4JQXC 4NKMB 2R4SL 4ESKA 2ESVB 4KRLB 5IFHL 4X6FA 4JHAL 4MLSA 3AM8C 3OLIA 4FXGB 1RJYB 3MRIB 4WENB 5EU5B 3FBQA 3UTZB 2WXHA 1IV8A 3OF6D 2K8QA 4PCTA 3B3IA 3GMNA 3MCLL 4JB9H 3KLAB 5G5DA 1QR4A 4MCYB 2A83B 3W0WE 4YJZL 2P47B 3K0WA 4JDEB 2HX9A 3IE4A 4JDTL 4NP4L 4PJ8D 3TM6A 4PLKC 3ZHLA 5TDOA 3HHSB 4XMUA 3NESA 5GQBA 3RZCB 4J6RH 3HIZA 3OKNA 2ITDB 4DN4H 4PLNC 4LVOB 3UERA 1TU2A 2BFVL 4G7YL 2R1YB 3CVHH 3M6DA 4NUQA 4E41A 2LAAA 1EEYB 5D7EA 1SEQH 3TO2B 3ZIYA 4FAAB 1OGPA 3S8GB 1CL7H 3W0WD 1XV8A 3E6HB 3PRZA 1QA9A 4AC2A 5D7LA 2EEDA 3MJGX 3NFNA 1XF5B 2HJKB 3QISA 3ROLB 5I1KL 1U58A 1DUZB 5HDBE 5KYUB 4RQQB 4O02H 4U1LB 2JKNA 4HF5H 3K4DA 3LOWA 1NCAL 1D9KC 1WHOA 4ZUVA 4LVEA 5JMOC 4OUOA 1ORQB 1FBIH 3SZ6A 5MEND 4GSDL 5JO5B 4LCYA 4WRLA 4LBAA 3HC3L 5DJ8A 3IXTB 2HFFB 5GRXG 1J8HE 4YK4C 4F57H 3OZKA 3IPEA 3RWHB 1DJGA 2QGEA 2CUIA 2K8MA 3PWVB 5DD5H 3VXQA 1KJVA 3NCXA 4TQIA 4E9VA 4G5ZH 2LVCA 7TAAA 1BFVL 2GUYA 3CFCL 1G0XA 3E8VA 4K71B 4NUGL 3NJXA 4OVUA 5F7HA 2GJZA 1JZIA 4PJIA 4X4KA 4XNQA 1GS6X 4JDVB 5BW7A 4JO1H 1J8HD 1NUGA 4UTAH 3AW5A 4IBQA 1GGIL 5JW4N 5IESL 4NQDB 2R1XB 3V6OE 3S2AA 3CZEA 3RU8L 4PB0L 4JHWL 3QT2A 4Z8FL 4GRWH 3ZDZF 3QH3B 3GMQA 3O0LA 2KPWA 2VISA 4RIRB 3EO1B 3QEQE 5JHAA 3G5ZA 2DQIH 4S1DC 4TSAL 5DD6B 5FPIA 3IWUA 1X5JA 2XTJC 8FABA 4QTHB 4F9PC 3TIDA 1KXVC 2BVPB 3IDNA 1JPGB 3HC0A 5CIPA 4NNXB 1CIUA 1UT2A 1UA3A 1ORSA 3LKOB 4AUYA 3F04A 3INOA 3P73A 5E1AB 5I23A 1FF5A 2DQTH 1WQVT 2ZP0T 3ZDXB 3MYJA 2G5BB 2XN9E 4FC3E 5CF3A 2A1WH 1IAIH 4PVMA 2IGTA 4HIJA 4KMTH 3NQKA 3TZVC 3H9SE 1QRNB 1CPUA 4L5FE 1OAKL 2C1PB 1CE1L 1CD0A 3VXPB 1UQSB 3VD4A 2LTQC 3ARSA 3OHMB 4DP2X 4EKJA 3W39A 3B4NA 1J0ZA 2FYYB 4FFVC 1TJHH 2AAAA 3UDWA 2XN9D 4F7PB 1N64H 2KZKA 1KBWA 7PCYA 3SDXA 4X9GA 5JXAH 1JHKL 3H9SD 3SE9H 3ULVF 1ZLDA 3U0WL 3RPBA 4X6BA 1IM9D 3II2A 2VDOH 1PL3A 3VD2A 4JY4A 2GK0A 3HW7A 4X80H 2DBJA 3ARFA 3KPSB 5GS0L 4ENEC 3GIVB 1O7DE 4YE0A 1XAKA 4DVRH 4KK9D 2HKFH 1L7TL 2ZG2A 4X9IA 2ZJSH 1G1CA 5A2AA 3SBQA 2QL1A 2VDNB 3EDEA 3T0VA 1TZHB 1XL4A 3JXAA 2JKIS 3FTXA 4HULB 3C6LA 4PJEB 1A9BA 1EZVX 5E2VL 3SO3C 3X12B 2VQ1B 3WV0A 1A1MA 3ZK0A 2JSFA 3QG6A 5J1AA 4NQCE 4KVCH 5FM8A 4HZLB 1ZLWH 1XO8A 1AYOA 1D6VL 3I2CH 2K6YA 4ZOAA 3VFPA 3LRMA 2A9MH 2JJSC 5C0CB 5LCVA 1HHIA 2ZSWB 5F3BB 3M1CA 3FCTB 4P2RE 1AIFA 4B53A 5GIRA 3A6CL 4FLSA 4HZAA 4OH2A 3AGVA 1CDUA 4GO6B 3T3MB 3TNMA 4NT6B 1OTTC 4NQCD 1E27B 1S7XA 5F93C 3P9LB 1U95A 5J57B 1YEKL 2F1AA 4OZFB 3DXAE 4UQ3B 1BVNT 2OP4H 2E86A 4I4WB 4EI6B 1P1ZA 1G0DA 3LKPB 4WLCA 3WFBH 1N10A 2DI9A 3FPYA 3CFEA 3MPCA 4JPIB 4Z7QF 1FFOA 2B0SH 1ROCA 1UT9A 1RIUL 15C8L 2PO6D 4IGBA 4R4FL 5CFHA 2HG5B 1F56A 4NO5A 4HX1B 1VCBC 4QKTA 1TYRA 4ZS7H 1A4JA 3IAQA 4H8HA 1S3KH 1XR9B 3EDFA 4HUUB 1IKOP 3LEVH 1AO7B 1N0XH 2F1BA 3WE1A 5E2TL 1L5GA 2QZ5A 4LL9A 1SXSA 4JUSA 5IVXB 1ASOA 2WLKA 2E6JA 4JFFE 3QWRA 3NJJA 3QUYB 3PWPA 4L3FA 1P7QA 2F5AH 5F9JA 3O2WH 4YWGL 5GZOA 3VJ6B 4E2OA 5ID1B 1ZVSA 4ZT1A 3LS4L 2BOCB 3UBXI 2V9QA 3BUIA 2VZSA 4XWGH 2DYSB 2XG5B 1JPTH 2H8PB 3X14B 2J12B 4G9FE 1AP2A 4JUTA 4XN2A 2HFEB 2QMKA 4NJ9L 4UT7H 2Q8AL 2TRHA 4XPAH 3SKNB 4JFFD 4LXFA 4W4NA 1X5XA 2MKWA 2G3NA 5HDQL 2FATH 2GCYA 1I9JH 4QEGA 4NLAA 4JG1H 4OLYL 2LAGB 2WO4A 5T8IA 3VD1A 1ZHKA 4PJFE 4PJ7B 2ZSVA 5E08H 1MN4A 2Z35A 3N6YA 4CMMA 3IRCA 1E3ZA 4R2GC 2PR4H 4M4PA 1SDYA 3QG7H 3EJZD 4G9FD 5D7IB 3DJSA 1XVSA 4DAGH 5F7BA 5MEQB 3IFOB 3QDAA 5BVPL 1I82A 3FT3A 4TNGA 3EJJX 4X8CA 3OG4B 3JYBA 3QA3A 4Y4KC 2XBZA 4LCCC 1KTLA 5C07A 4OIAA 3LEYL 4ZFFB 3FYEB 4OCYL 3OWEA 1FVEA 4QHMA 5I2IB 5CD5D 1WAAA 1OE2A 3HRZC 2PLTA 3KZ8A 1TTCA 1O6VA 2BSCA 3G04B 1EX0A 1MW2A 5ALBL 2IDTA 4M7LL 3FFCA 1I1RA 5D5ME 1IC7H 1A7OH 3MNWA 4F8TA 3P4OA 1NC4B 1ZLWK 1OP3H 5LDUA 2ALAA 2DM7A 1EGJL 5I1IH 1RSYA 2O5YH 4YHML 3QUZC 5DMKA 2ZWYA 4M4RB 2V3DA 3K6OA 4W70A 5JW5B 1PIGA 1R3LA 1D5MB 4IU2A 4AQEB 1SVBA 4KI5F 5L2KD 3KDMA 3V4UL 4F9LC 5ANHA 2CCWA 2Z65C 1OB1A 3TV8A 1JVLA 2X5PA 4JRYA 4NYLB 5AW4B 2GSIB 1BOGA 3CU7A 5MI0B 4ES8A 3PHOB 2C9VA 5IGXL 3ZO9A 4A2FA 3QDME 4KUCD 3W2DL 5KVGL 3QI9B 2D03L 4BQBA 1U8KA 3QULB 5KVFH 1QKZH 2NY6D 4ZAKB 2OXHB 2UZXB 4NQSA 4Y4HD 5KOMC 2DQEL 4FFZH 2XIIA 4OLUH 5JQIB 5D96B 4E0RA 1G87A 5ADPH 4WZ9A 3US0A 3OAZH 3RL2A 1F4WH 1H3TA 4OLVH 4HXAH 1I8UA 4NWTL 1F45A 4ONFL 1OP4A 4NI3A 5DQ9A 5F88B 2BC4A 1EZVY 1UJTA 5LGJA 1G43A 3LKNA 3LXCA 4K23H 2QGDA 5DWUL 5CCHE 2Z8WC 3HE7A 4G42B 1T89A 1U8IA 4LEXL 5AVVB 5ISZB 3NJLA 1KENL 2CM6A 2YA2A 3N44B 1HE7A 3KHOA 3V4VB 2ATPA 5F72S 5JQ6L 3VVVA 1NEZB 3D18A 3KM2A 4GP8B 1USQA 2QQLH 3FPXA 1CFQB 4I0PA 4ETQB 4YDNA 4BSVB 3EYVA 2JELL 4JFDA 2O93L 5GGTH 5IIEB 1EZLA 3PWUA 3DIFA 3MO1A 3P2DA 4WFFD 5D8JL 3ZQ9A 1R1CA 3CVIL 4P4KA 4MRCA 4MAUH 3HC4L 3LN4A 3O6LL 3QNYB 4FQPA 2XACC 4QYAA 1TVHB 4OQTH 4XH2B 1QTSA 5FW7A 3RY4A 3ARWA 3F05A 3HI5L 3Q1SH 4Y16D 1INDH 2K4WA 4Y5XB 4UQ9A 4Z0XA 2YGQA 2O26U 3O41B 5AAPA 2UWEA 1NAMB 3JWOH 4UIMB 1HQRB 5I1CH 1V7ML 1NDMB 5IBUG 3E1F1 3WTWA 1WBYB 3NZUA 2DMKA 3OLDA 4U3CA 4KROC 1CGXA 2J6WA 3A6OA 1J1OH 2JB5L 1X4XA 4ODBD 3SBRA 1CLZH 4O58H 1N0LA 3HUJF 3O6FC 1OP3K 3FQRA 1N5AA 2XY2A 5TTRA 2N0KA 3S35L 1TNMA 1BD2B 4ZX4A 1T0MA 3BPOB 3FN0H 4DGYH 3WU1A 2YXFA 2YA1A 4X4XA 1BAFH 1GMIA 1I75A 4O2EA 4Q0XH 2XWJB 3MV8E 1UUSA 3U7AA 4WTQA 3ZDZE 1NFKA 3BZEB 4JPWH 3JWNH 5CWSA 1A21A 4JJOA 4TTGA 3F2LA 1MJUH