4AVHA

Structure of the fimh lectin domain in the trigonal space group, in complex with a thioalkyl alpha-d-mannoside at 2.1 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4avhA00
1PDKB 5LNEA 5FWRA 5IQMA 3RFZA 2VCOA 4AUJA 4CA4A 5AB1A 1KLFB 3ZL2A 5LNGA 4AUUA 2JMRA 4X5QA 4LOVA 4AVIA 4AV0A 2XG4B 3JWNE 3BWUF 5JQIB 4AVHA 4XOEA 1ZE3H 4AVJA 3BFQG 5F3FA 5FX3A 1KIUB 3MCYA 4J3OH 5FS5A 4J3OG 2UY6B 5AALA 5IQNA 4J3OF 4AV4A 3ME0B 4AVKA 1UWFA 5FLUA 3JWNH 4XO9A 4ATTA 2J2ZB 4X5PA 4BUQA 1TR7A 2JTYA 3ZPDA 4AV5A 2XG5B 3SQBB 5IQOA 4XOAA 1N12A 2W07B 5AAPA 4X5RA 3JWNG 4AUYA 5F2FA 4XO8A 4CSTA 1N0LB 5CGBA 3ZL1A 4CSSA 4X50A 2WMPB 3BFWA 5ABZA 1QUNB 4XOCA 4XOBA 4XODA 2UY7B
chains in the Genus database with same CATH superfamily
1GKOA 1WF5A 2XQYG 4J3TA 2YFNA 5KBPA 3WNPA 4X83A 2MCPH 2NY2C 2F54E 2CKBA 4MCZB 1LE5A 4V2BA 4GG8A 1VADA 3KYMA 4IDLA 5DMIL 1CLOL 4AT6A 5IBTL 4WCYH 4EDXB 2F53E 3A47A 3MREB 4TS6A 4F7CB 5EO1B 4U1JB 2DLTA 3PF2A 1KN2H 5BW7C 2LW3A 2DQUH 1QTYT 2PR9A 2PTUA 5I1HL 4G9FE 2XG5A 1EGJA 2BNQD 4W9CC 2P47B 3DETD 2QKIA 4N0UA 3EGSB 4ERSL 2K4AA 4H25B 2YUVA 5DVNA 4TVPE 3SBWA 3DMMD 4ZMWA 1A4JA 3BZ5A 3BQUD 4FN0A 3BWUF 3OV6A 4QT5A 3RWDA 2P48B 1GGYA 4PV1C 5JPMA 1WCBB 3WAKA 5BJTB 4NBZB 3EJZD 2MOVA 1A65A 2YKLH 3BKML 3PP4L 5ICZA 5D9SA 3IKKA 4WNQA 4U1MB 3UFIA 3C5ZB 3I9GL 1OEZW 5IV2A 4FNRA 2QPFA 4PVLA 2Z4QA 4DVBB 2D7QA 3IFPB 5ELIA 4NRXA 4OUUB 1WG3A 4PJFB 4A7GA 1N4XL 2A0LC 4LLWA 3B8SA 4WUKH 3L3KB 5DMGC 1UWFA 2JV6A 4YSCA 4OZHB 3II3A 4AIZA 3MC0A 3MUGB 4ODUB 2BSRA 4LSTH 5DD1H 1M6UA 1QQDB 1QSVA 1KT2B 5FHAL 2WTOA 3C6LC 1IL1A 3G5VB 5AOMA 2J2ZB 2Z4TA 5IBLC 3AGWA 4ZUVB 1TVBA 2FUTA 5GGQL 1V3MA 4XPAL 2IQAB 5C3LD 4WEBL 3W39B 1EFXB 4H1LH 12E8H 4V33A 1DLHA 3MNZA 3PFUA 3DX0A 4JN1H 1ZJAA 5IP4A 4V1DA 3MLSL 3US1A 5FW6A 1PEZA 3L45A 4GLRH 5F89B 3K8MA 3EUUA 4AY0A 4JQVC 2F18A 3E0GA 5KSBB 2NMSA 2OS7A 2I5YH 3UJTL 4JFQB 1QW8A 1RZ8B 3IU3A 1XF3B 4PYGA 1UB6B 3NGBC 4Q9QH 2WLLB 1A0QL 2WXKA 4O02L 3POCA 3WN5B 3K6SA 1WZ1H 3HUJF 4FL4B 4HS6B 2KKQA 5DJYB 5EOQL 4X8JB 3KLHC 5EBWB 5AWNL 4MQXC 1AZUA 3CFDA 4L4VB 3CHQA 4NZJA 5EWIH 1AZZC 5L7XH 2B08A 2DJ4A 3IDGB 3HA0A 4P2RE 4QRSA 1WIUA 3FUKA 4PJGE 5HGDA 4RFNC 3WFBL 1TTUA 3HNTL 1ORSB 2ED8A 4FZ8L 4PRHA 1TETL 3WFEL 5FV1L 2BOCA 4R7LA 2FYVA 5DHEA 4AKQA 1CD0A 2C9SA 1JI2A 4N1EA 4HC1H 1YNTF 5GS1C 4W9HC 3C5JA 5ALBL 4ES9A 4KQ4H 1EANA 1XIWD 2IAAC 2L0DA 2Q3AA 2XQYA 3QUKA 4G43A 1WFMA 4TSCH 4XAWL 5DVMA 3FOMB 3EJQA 3MA7B 2FJGA 1QEWB 3MKGA 3H9SD 3VSVA 4ATWA 2KL6A 3ET9F 3IKCA 4FQLL 4IGBD 4MAYB 4UTBL 2UUDH 3D2UD 3I6LD 4LMQE 1JJUA 1WLHA 3LEXB 4Y1AD 1Y0LB 4DOHB 3TOPA 1FFQA 2DV6A 43CAB 1UQSA 1QO3A 3N04A 1ZHLB 1BREA 1A7QH 1FCCA 3GTTA 1NUGA 3F8UB 4G6KH 5IHUL 3BYTA 4GAYB 2FQGA 1CYGA 3X12B 4NI3A 4C4UA 1WIPA 1KC5L 3HZMB 2BW4A 5JQHC 3HIZA 1OAQH 3D9AL 5KSBF 1E43A 3Q2CA 3CVDA 2QLYA 4WGKA 1KBKA 3U9UB 1NGWB 5GRJH 5A2BA 3DA0A 1NGZB 3HHMA 2VDRB 4Y5YC 4U1GC 2VLRD 4MCZA 1BFVH 4M6ML 4HEPG 4BE5A 1TO5A 4FP8H 4UNTA 2FWSA 4EDXA 3OQRA 4R6UA 3MREA 3QXDB 4F7CA 4Z3JA 2AJUH 5EO1A 3C09C 1MCHA 2HX9A 3K1KC 4U1JA 5E2VL 1BDYA 4E9RA 5GRVL 3T3MB 4PJBE 2JCCE 3BVDB 4R96B 2UWEB 6FABL 2HT4D 2XWXA 3HR6A 4AJ0A 3T77B 4JUSA 2WW8A 3EGSA 3BPOC 4H25A 5A2CA 4QIRA 4CJ0A 5FUZL 5TQ2L 1U0QA 1NDMB 5BMFL 3OF6D 4NHCL 1NA8A 4NWTL 2X87A 2O6CA 3UTQB 4TSBH 1FHNA 5BV7L 1E30A 1WCBA 4G6JH 4WDIB 1NEZB 5BJTA 1K4DB 2J7LA 3U9PH 2ZF8A 5MENE 2YPLB 5J13B 4S1RH 4RDQG 4U1MA 4ELDA 3C5ZA 4M3HA 4HOZA 1FV1B 1FN4B 4DVBA 5HI5D 2UVEA 3IFPA 4KNTA 4PLKC 4P06A 2IH9A 4OUUA 3KR3L 1YQ2A 4PJFA 3W9EB 4DVRL 1LO2H 4TTGA 1P6FA 1CLZH 3FT2B 3L3KA 3V8OA 3P4NB 5EC2B 4OZHA 5IQMA 3KPSE 5HYSB 3MUGA 2DD8H 4ODUA 5TQ0L 3OXRB 3D18B 5CZXC 2HLAB 1QQDA 1KT2A 4Q8BA 1PMYA 1NEZG 3G5VA 4QMEA 4L3CB 2J2ZA 3BT2L 4ZUVA 1T5WB 2MCG1 3RGHA 5IK3B 4RMQA 2IQAA 1BV8A 4NIKB 3RDTD 3W39A 2JJWA 1EFXA 1IFHL 3ILQC 4TNVK 3V6FB 2CMRL 4X6CF 3K72B 4OUOA 1NKRA 4NC2B 4FA6A 1NAMH 1QLEL 5EUOB 2OAAA 5F89A 4PJ5B 4J4PC 5B8CC 1Z3GH 5HYSG 4XPHH 2HTKC 4JFQA 1RZ8A 1XF3A 3D3VE 2C34A 1UB6A 4XAKE 1LEGB 3AW5A 4UT9A 3H42L 3FOLB 2YBRB 1YEGH 2WLLA 5KS9F 4RDBA 3WN5A 4EZMA 3I84A 2OSXA 2P28B 4HS6A 3VMOA 1DHKA 4X8JA 5B7MA 4FHKA 5EBWA 4CADB 3TEXA 1EDHA 2R39A 4HIHB 4A6YH 3NZSA 1L9NA 4WHTB 2WXRA 3IWUA 4L4VA 4JO3L 2DM4A 4LNVA 3PLYA 3IDGA 2VDLH 3C08H 2AJYL 2Z0BA 3WTVA 4A39A 2XWJB 4AC4A 1ORSA 5JZ7C 1O9ZA 1SQ2N 1VEPA 2W81C 1Q72H 4TPRH 1MAML 1WWAX 4G82A 3PWLB 2R69A 1GA2A 2BRRH 3TJEH 3N50A 4GKOA 4B9YA 3JBG7 4AV5A 1PFCA 3NZ8B 4UTAA 4BA8A 1R75A 1AGFB 1OPGL 1IJ9A 3FOMA 3MA7A 5H35B 4DO5A 1QEWA 1DBBL 1MI5D 4LCYB 1X5KA 2ICEB 4MAYA 2W94A 4HEPA 4J3BA 4PRIE 4X99B 3D1MC 4DQOL 3LEXA 1Y0LA 4YHYC 2OR8A 3A6BL 3IRCA 4FQQB 5B4MC 43CAA 3QJTB 3QO0B 1ZHLA 3MV11 4IRJD 4JREB 4KK9D 1JOIA 4BCYA 6PCYA 4L4TE 4W70A 4GAYA 2WSKA 5GJTL 3HAEH 1AZCA 3IDJB 3X12A 2NDGA 3HZMA 4Y16D 5F7LB 1GGTA 1YJDL 2BY2A 1CFVH 1E5AA 3U9UA 1NGWA 3DI3B 1OTSC 1NGZA 3T2NH 2R59A 4RRPM 3B8YA 3RI5F 4JG0H 4FQ2L 1ZLUK 2C9VA 3BCDA 3MRDB 4UM9D 4GBXB 5A2LH 3OQ3B 3QJSB 4KNSA 4NRYB 3QXDA 2DDQH 4XWOC 1IO4C 3O6FD 4G7SB 1ACYL 1CZ8L 4XN2A 3RY6C 3SE9H 3EOYG 4JVPA 1ROWA 1QYGH 5TE6L 2WJ5A 4R96A 2ISDA 2UWEA 2AGJL 2HRGA 5JPNC 2GIYA 2RFXB 3RY4A 3T77A 3UGXA 2E7LC 4MMZC 5D1XD 2YEZB 3JZ7A 3NCBB 1NDMA 4P05A 4KH9A 1OHQA 2L7EA 1ETB1 3M1OA 1BAFL 3LMJL 1NLDH 3UTQA 3KGRA 4XVTH 2EXTA 4WDIA 1NEZA 2EDWA 3H4HA 2CAKA 1G9EA 1Q1JH 4UOW1 1K4DA 2YPLA 1RMFH 3BFOA 1ADQL 4W6XB 1E5UI 5JHLL 2WXJA 1FV1A 4JX0A 1ASOA 5IQ7H 1FN4A 2H7WA 3BUIA 3ZKXB 2EADA 2J71A 4KKQA 1OXYA 4N0UE 3W9EA 4TUUA 2IGFH 3FT2A 1MHPH 3P4NA 3A24A 4KY1H 5EC2A 3CQQA 5HYSA 1JZIA 2XA8L 5D70H 4UIKL 4OT1H 4XXDB 3OXRA 1CBJA 3D18A 2HLAA 4YEEA 1LO0L 4KFZC 4PWIA 3IFOB 3UBGA 4OD2B 2AQSA 5AZEL 3FTGB 1DUYB 5D2NC 1YSOA 4L3CA 1OAJA 4YLQT 2AEPH 3P2BA 1ZLWK 4I4WB 1T5WA 1F6LL 5IK3A 1RUML 3VO0A 4YPJA 4ZAKD 3GDCA 1A6WL 5ICUA 2CCVA 5A2KH 2H41A 4GQ9L 5FYJL 1E0OB 3V6FA 2VLKD 3IU4L 3K72A 3QNXB 3WV0A 5IQOA 1PG7L 3RVUC 2ZWYA 5EUOA 3DJ9A 3TWYA 3CZNA 4PJ5A 1G6RL 4YXKH 1I7ZB 4I3RL 5L2KB 1QVOB 2VC2B 3RIFK 3MV8B 1LEGA 5BZDB 4G6MH 2FT7A 3BDYH 4EI5D 2FBJH 3FOLA 2YBRA 4OGXL 1EAOA 1MCNA 1OAUL 3MU3A 1RZJL 4CADA 5L8LB 4HIHA 3K8KA 3K71B 3O8XB 2PPDA 2EYSB 1YECL 4V1DE 3CMOH 2MTAA 3ARGB 4A04A 4WHTA 3P4MB 1M3JA 5E6IC 4S0HA 2DMHA 3H2WA 3SDAB 4QLRA 4OLYH 1BM3L 4M48L 2AV1B 4UYPA 1F3DH 2XWJA 5DLML 1UM6L 3LN5B 1TLMA 1M2VB 3PWNB 2QLVB 3QPXH 3PWLA 4G8GB 2J1XA 2IWKA 3AFLA 1T03L 3QIBB 1Q8MA 3QIWC 3QEGL 4XE0A 3NZ8A 1OLLA 2H2SD 5KJ4A 1AGFA 2RQEA 1OE2A 2QQKL 5DD5L 2XRAH 1CJYA 3N06B 1VZIA 2ZTBA 5H35A 2WLMA 4LCYA 5HHQB 3Q06A 2LVCA 2EH7L 2A6DB 2YMXH 2ICEA 3TIDB 5EO0B 1SF5A 3OL2A 1CF8L 4MS6A 2YXFA 2EXYD 4K9EL 4X99A 2QJDA 5AYUH 1MIEL 5C2BL 4FQQA 4P5SA 5I9QC 3QO0A 4JKMA 4PRHE 2D7TH 4QRQB 4Z95L 5ERWB 5GS2H 3IDJA 4N0FB 1ZTMA 2EDDA 5KBMA 2IWEA 3P0GB 3BPCB 1OAYH 1FORL 4MS8D 4PPTA 2CRYA 2JQZA 1FI8C 1FDLL 5JR1L 2DBLL 1IV8A 5TF1H 1NCBL 4GKLA 4MXVF 3C60D 3QZMA 2G0LA 3LZLA 4HIPA 3MRDA 4M7LT 1SLWA 3MDJA 4GBXA 4NRYA 2WHVA 3FPYA 2ILLA 2V5YA 3LRSB 4P4KC 2XX1A 2A6IB 4DK3A 5KYUB 3RHWF 4UT6L 1PYWB 3WE6B 5DT1L 2YAHA 4BELD 2RFXA 1F4YH 1F4WL 2H1PH 4LBAA 3AMLA 3X17A 2YEZA 2G3MA 1D5ZB 1L3NA 2XN2A 3L4ZA 4KI5D 1DP0A 3H2PA 3X13B 1MNUL 2DWXA 1G0XA 4G8IB 1DUZB 3SKJL 5E6SB 3BAKA 1MQKL 3NPSC 4Y5XC 4TNGA 2N7AA 3MCLH 2OYMA 3MLTB 4QJ5B 1PX8A 3BEVB 4LDOB 2HYMA 1MRFL 1ZA3B 2Z8WC 3F6IA 1VAHA 4GEJA 2Y6SC 4BSJA 5LWYH 2WMPB 4Y2NA 4ZZFA 1D6VL 2I60L 1UFGA 2IDSA 4LSDA 4H8WC 4URKA 3B7UX 3N5AA 3VSUA 4FQJH 2MRYA 3TJHC 1QD0A 3BN3B 4XXDA 2GC7C 5MHSE 4ODHH 1S5IH 2BSCA 1IKOP 4JO1L 4NN7C 3W11D 3IFOA 4OD2A 3BYYA 3FTGA 4U3XA 1DUYA 5D1ZB 4I4WA 1QASA 4ICWA 1NIEA 1RIVL 4FFWD 4CSPA 1J8HD 3SDYH 4PJDB 3O9WB 3REWB 4PJFE 4BK5A 2O61B 2HFGH 3PGFL 4QNPE 3QNXA 4XO5A 2XV3A 4J6RL 5LG1A 2JKSA 4WWID 2A4ZA 1HCZA 4OY9A 2F68X 1H6EA 2HSIA 3FBQA 2MKWA 4OZHE 4BH8B 3CFCH 3EH5B 2AFNA 1I7ZA 5L2KA 4NKIL 1QVOA 2Y7QB 3FQWB 4KKAD 2ITEA 1N0XL 3MV8A 5BZDA 3FQYA 1MDAA 2NUPB 4ZW3A 1HQRB 4U49A 4ZTPH 1KIPB 4TN9A 4K3DL 1MFEL 4ADJA 3CWGA 2XV2A 1FPTL 4FOMA 3QUZD 2B5IB 3OAUL 2DKUA 4Z7OB 4MVBD 4I0CC 3GBMH 3K71A 3B9KD 3O8XA 3KPTA 1GKEA 2EYSA 1CIDA 4RIRB 3CC1A 3ARGA 2HMID 1BGXL 3VYNA 5IFJB 1KBWA 1SXCA 3P4MA 3DUUB 3GKWH 5FHBH 1AGDB 3SDAA 3SYQA 2WTPA 2FK9A 4WI2A 4AZ8B 2AV1A 2XQ0A 4NT6B 2LOEA 1F8TH 1XGYH 3ZR5A 3QYCA 4WAFA 4B9CA 5C07B 4HOWA 4FJYA 3LN5A 3PWNA 1M2VA 2J88H 4G8GA 4NUGL 1CIUA 4JGMA 1Q0EA 4EIBA 4HK0B 4M43L 5TPWH 4N2KA 1A25A 2QVMA 1YEFH 3QIBA 3O3UN 2QADB 5AEAA 4W1TA 5F6HI 1YMMB 1YC7A 3CZFB 1G5GA 1T21B 3FPXA 2XY1A 1V8HA 5C0BB 5FUCC 3QXVA 2WZ0A 4L4VE 1RLBA 5HHQA 1X4YA 4AI7A 2A6DA 3TIDA 5EO0A 3NYKA 4HUXB 4UV4H 4FTVD 5DWUL 1J1PL 4Y4HD 4KPHL 1B4LA 3L2NA 1NQBA 2X5PA 4PS4L 4YH6A 4S10A 4QRQA 5ERWA 1SVCP 4N0FA 5F97E 2FHCA 3GXNA 4UM8B 2CO6B 3BPCA 1KF9B 4KKLC 4OGYL 1MVFA 3GSRB 1T1WB 1BZ7B 5DFWH 5M95B 1UJ3C 3R8QA 1B4RA 4N28A 3RKDC 2HCZX 1DO5A 2ADGB 3DX2A 2IAMC 5E2JA 4MA1B 2AJVL 2C8NA 4JKLA 4IBZA 3LRSA 2A6IA 5KYUA 4TSAL 3F58H 1CK0L 3LB6C 2FGZA 1JSYA 1P53A 1PYWA 3DX3A 4KK6D 1AE6L 4PP1C 2C4FU 4M4RB 3MLWH 3WE6A 3LNGA 5DJDB 2FBOJ 4AV0A 3N1QC 1D5ZA 1YEHL 5B3SB 2EDRA 1RZPA 2VZOA 2VSCA 4G7YH 5C7ZA 4DP7X 3X13A 5BRQA 4BWWA 4YHOL 3BQVA 4G8IA 1DUZA 2XACC 5SX5K 1MJ8L 4MMXB 3PS6A 3BD5A 3L81A 4KJPC 5KG9B 1MJUH 3MLTA 3I9AA 3BEVA 3PE9A 2PKDA 1GTNA 1TXKA 2W92A 1CCZA 5JNYB 4KRLB 3MBWB 1YYML 1ZA3A 2ZP8A 1Y1UA 1GL4B 3T3ME 2V8MA 2UWEE 3ULUE 3U0WH 3W37A 2WMPA 5E2TL 3QJFB 2QKSA 2FYYB 1M56B 3SJVD 5PAZA 4O00A 4Q6YA 3QEHB 1I8LA 1RURH 5CEZL 3TL5A 1IC7H 4MA8L 4FMFA 2EUWA 3ZT7A 4JQIA 3IAQA 3S5YA 2ZG3A 3L5HA 5D1ZA 2YPLE 2X3CA 4EQ2A 3RA7H 4R9HA 5ADOH 3JWDL 1RXLA 4LO9A 3R0MA 3HRZC 4L8DB 3UAJD 4PY8J 3FW6A 4F8NA 4PJDA 2AQ3A 4MDRA 3O9WA 3REWA 4KO7A 3QI9D 1WQVT 2O61A 3TFBA 2HTLC 1D9KC 3N1FC 4ICXA 2CUMA 4XP9H 1U8LB 32C2B 3BAEL 3NFNB 1JGVH 4Y2DD 3BKYH 1KBPA 4BH8A 3S88H 2VXUL 3H6JA 4GRWH 4WSGA 3MLYL 2Y7QA 3FQWA 4QRRB 3ZDZB 2AJSL 3ZRFC 4JHAL 2NUPA 4ZOCA 2TSBA 1HQRA 2X53A 2VDMH 1LO4L 2BIOA 1KIPA 1MPAL 4PJEF 2VERA 4R8WH 2ZT9C 5IHLB 1Q0YH 4NWUL 3NACH 4AWJC 4GRWF 5F3BB 2FBRA 2PR4H 1MJ7H 3NH7L 1Q0XH 2VDQH 1CE1H 1P84J 5D6DC 5EUOE 2O5YL 4N8PA 4RIRA 5HYQB 1JZ3A 2E7MA 4BM7A 1ACZA 4PJ5E 5JXED 3ABLB 5IFJA 3DUUA 4G70B 4JM2F 4IRZH 3VA6A 1AGDA 3VM7A 3UROR 2C1OB 4AZ8A 1IGIL 4NT6A 2EDNA 1D6EB 5C07A 4OI7A 1JVKA 4R7XA 2VR7A 4ZO9A 3TU6A 3GBDA 1PGRB 4HK0A 1A1NB 1H3TA 1RIUL 1XSKA 2H4EA 3CQPA 5HBBA 3BLPX 5E5RB 1KTDB 1KB5H 2EEAA 5A43C 1YMMA 4Y5VB 3CZFA 1T21A 5IOKA 2B9BA 4MQTB 2OJZL 3F6JA 3H3PL 3LH2L 5C0BA 1NJ9B 2DLGA 2A6KB 3EOTL 4NB7A 1J5OL 1OTUD 1EZVY 1HS6A 4JFTA 3K3QA 1EJOL 4IBTA 1TJGL 5C08D 1JXGA 4HUXA 4EJ1C 4MHHG 1Z5LB 4PS3A 4NO3B 1MFBL 2NOYA 5C0CE 3CXDH 2FIKB 4UCFA 4W9LC 1C5DB 3MBED 4JY6B 4X4ZA 5AOJA 2V5SA 1V27A 4UM8A 2CO6A 4ONHB 3T4AB 3TURA 1KLUB 3DHMA 2WN2A 4H8WH 3GSRA 1T1WA 4FCAA 1BZ7A 1NGQH 4DP2X 4O9HH 3US9A 3GF8A 1LK3L 3MV7D 4NFCA 5TF0A 5IFAH 2K6ZA 3HG1E 2IH3B 1KEMH 2DM3A 5DD3H 3BVUA 2NY0C 1HILB 4UU9B 2ADGA 1FYHB 3CFTA 1KEGH 1XGTB 2R0WL 2CGRL 4NZTH 5I0XA 5FCUL 1EO8H 3LIZH 2OXGB 3RGVB 5CCKH 5E51A 5ITBL 2CRZA 2Y5QA 3MJGX 1RUQH 4M4RA 4B5EA 3QXWA 2ZCHL 5DJDA 4JAMB 3GNMH 3I74A 4UIMB 5GGTA 5E1QA 4C55A 3OJVC 3W57A 4I9WD 3BKCH 3ZW3A 1CTOA 4F33B 4MMXA 4OF3A 4Z8FL 3IXAB 1COBA 4U31A 5KG9A 4OCXL 4FHBD 1U95B 1BJ1J 4UZSA 2B1OA 3SO3C 5JNYA 1BEXA 1QI4A 3PREA 3MBWA 3DDGA 4JKWA 3QYMA 3INOA 3BUPA 4IOIB 4X5WB 3T2PA 1IIIA 3SYPA 2GHWB 2WWNA 5E2UH 1MCPH 1R4XA 2J5LB 3HN5A 3AQYA 3VD2A 2NY4C 3QJFA 4K3HA 3X1EA 1FFPB 2DWEB 2FYYA 2PP9A 2ZPKH 5HHMB 1ZLSL 2DWDA 4GI6A 1CDCA 4X6DF 1T89A 3IJSB 3QEHA 1SYVB 5HDBB 2HJLB 3EAKA 2ZNWA 4DGVL 4Q6IB 1CVRA 5C0FB 4WENB 1FZJB 4FXKC 1NCWL 4N90D 3SQRA 3BGFB 3OAYH 4AMKH 5IEKB 1QBBA 4L8DA 3CVIH 3QAQA 3PV6B 5F1KC 1OAXL 3K2MC 5AW8B 3LNDA 4O2EB 2C9QA 5KZCD 3APCA 5HHVL 2CJSA 4PJ9D 1AY1L 3WS6A 2WBJC 3DO4A 5TK4A 4Q58C 4UDUB 1V7ML 3EF4A 3GJFK 4G8AC 2PCPB 1U8LA 1XSJA 3B5HA 4JMXA 4EVNB 32C2A 3IMTA 1QMUA 2HLFD 4KZCA 1VFBB 3NFNA 3OSKA 1FSKC 3IFLL 2G75B 2IV8A 4FZEL 2YLHA 3SE6A 4JB9H 4QRRA 4PJIB 4WFFD 2QHRH 3TCXA 3PP3H 2BHUA 4AVJA 1YYLH 2D2OA 1GYCA 4OFPA 3PXHA 4EF3A 4AJVA 4J3OH 1JAEA 1VFMA 5F3BA 1DO6A 1BG9A 2E59A 1AHWC 4LCWD 4W9DC 1NEUA 3OGCB 3WS3B 1OF0A 1T5XB 4HALA 5LGKA 1P9MA 5HYQA 3FQNB 2GY5A 4LRIC 3OJ2C 2Y72A 2B15A 3QFGA 1QBMH 1WWCA 4YDMA 1HXMB 4J3OF 3CFKB 2C1OA 3RX8A 5L2KE 2V7NB 1HL9A 1NMBH 1J7VR 2PMZA 3MV8E 5TDNB 4N24A 1D6EA 4PBWD 1S3KL 4KX9A 3MI6A 5KSAB 1QSFB 3QEQB 4XMVA 3P9LB 3TV3L 1A1NA 2EO9A 4OTXH 5F96H 1KTDA 3ARSA 4JZNB 5AKVA 4Y5VA 1OP4A 3EBHA 4YEFA 2HPTA 1L9QA 1N6UA 1JYXA 1NJ9A 2FHFA 2A6KA 1FUNA 2IH1B 4F1SA 4G6FD 3G5XB 3GB7B 5I23A 4R2GB 4WTWA 1Z5LA 4JANB 2W0LA 1V3LA 2XZAL 4NQUA 1S5HB 4OVVA 4NO3A 3V6OC 2ESVB 3ZT6A 4LHUB 2APFA 2FIKA 4G8GE 5DFVD 3GI9H 1C5DA 1HXYB 4JY6A 4LB8A 3D4GA 2EE6A 5F8RC 3GXMA 4JCMA 4DKFL 5KUKA 3E3QE 1J12A 2O5ZH 1LO5B 4ZJ9A 4ONHA 3T4AA 1KLUA 4AGMA 4CMHC 2JKIS 3NP4A 3HN8A 5F0LB 4N8CL 3I9IA 4J2QA 4YSPA 5GRUH 4ZMTA 3U2JA 2IH3A 5L8KB 1N18A 4HIJB 1HILA 4UU9A 3WY4A 5E6RB 1CLYL 3NSXA 1FNLA 1H5BC 5T5NG 1E50A 2DQCL 3M7FB 3UOAB 4QY8B 1XGTA 4IHBA 4IJTA 2VMJA 2ZXAA 1MXDA 3M45A 1RK1B 3FAWA 4QXUL 5IUCA 4NDMB 4LHUG 1OF2B 1X9LA 1KJVB 2OXGA 3HI5H 4YFLF 1U3YA 3RGVA 4ZUTB 4PWKA 5E70A 1P69B 2A0LD 3UZEA 3MRRB 3PWJB 2C3VB 4JAMA 3E7JA 2PPCA 4XPTH 5DK0B 5DMGD 5SV4A 2XZQH 4UIMA 3I6GB 1LQSR 2PYEE 4YHML 3T0EB 3PJSB 1NGYB 4S11A 4U2ZA 2QDWA 5B7FA 2KYIA 2VZUA 3C6LD 5FDYA 3ZDXF 3MACH 1T1XB 4Y2OB 4BK8A 5IBLD 4F33A 4M6NL 3IXAA 2Q7YB 5I1CH 5LGHH 3RUGB 2WVTA 2ZUYA 1U95A 3HE6C 4HIXL 3CDCA 4OLZL 4TULH 3DVNB 4UF7C 2O30A 1R34A 4XRCB 1MY5A 4LIQL 4KQ0A 3DPBB 4IOIA 4X5WA 1SM3H 4OJYA 3KJ4C 5AKRA 5F9OH 1R6VA 4NUQA 2DLFL 4XC1H 2VDPL 4HU8A 1FFPA 1YNLH 2DWEA 4H1LB 2H3XC 5I2IB 1KCBA 4JL1A 4IBSA 4LSSH 4J3VA 3WI9A 1OGAD 1E4JA 3IJSA 3VAEA 1SYVA 2IPTL 2P26A 2HJLA 2XU9A 5E8DL 5EZLB 3OB0H 4TLUA 3BZEB 4Q6IA 5C0FA 1FZJA 3T8MA 2IOOA 3HUJB 4ZS7L 1C5BH 1QPXA 3LKNB 2LV4A 5IEKA 1UZ8B 4TLTA 3PV6A 1IC5L 2Y5TB 1HFUA 1MFDH 3KLHD 2YK1L 4O2EA 3ECBB 3FSWA 2CNZA 5IQLA 1OWWA 3QA3B 4J3UA 1PVHA 4UDUA 4Y19B 4W68A 1MKFA 2PCPA 4RA0C 4H1LG 2YQ3A 4R4BB 1GHFH 4LVHC 4WW1B 3VNYA 4EVNA 1VFBA 1P5UB 3M7OA 4XNZB 2G75A 3MRFB 5DJCB 4Z7QF 3L16A 1EIBA 4PJIA 4QEGA 4ZI8A 25C8H 1OVZA 5JIHA 4ENEC 1SJHB 4OGQC 5T1MB 3JWNG 2QEJA 4L9LB 4BA0A 1A7OH 3UADA 2XZZA 5HHOB 5FLVA 3GMNB 1DSFH 3REVB 4PJDE 4F9LA 3DURB 4Q9BA 1MUJB 4XN5A 1FL5B 1WWBX 3OGCA 3WS3A 1T5XA 3GTVA 4M7JL 4UAOC 3FQNA 1G9NL 4GRLC 4UQAA 4IJ3C 1HXMA 3CVCA 4HOXA 3CFKA 4MNGB 1SOQA 2V7NA 2A1WH 4O2CB 3FK3A 1CGUA 3GRWH 4N5UA 5TDNA 4Q9RL 2IBGA 1YN6B 4NI6A 5KSAA 1QSFA 2APTA 3DRTB 1CE6B 3QEQA 1OSPL 3P9LA 4U0QB 2V3FA 1I8KB 1IARB 1A14H 1PF3A 3V6BR 2OK0L 3EO1B 4P59L 2NXYB 1IM3D 4JZNA 4QRTB 3VXTB 43C9B 3CCHB 2VRKA 4Z7OE 4WEMB 3FAXA 4H0LC 1J5DA 3PQYB 2IH1A 7FABH 3JSSA 3CU1A 4PREB 1PSKL 3DIVA 3G5XA 3T3PF 1JZHA 2HFEB 1NC2D 3GB7A 3VWJC 2NR6A 3WNIA 4JANA 2OYLA 3TBTB 1ZVNA 1S5HA 5C07E 1QFWH 2ESVA 4LHUA 2WAHA 4HJJH 1HXYA 1WEJL 3QJXA 5J3HC 4C56D 4XP1H 5LKNA 1U6AL 3HMXH 1LO5A 2K70A 3OPUA 4PV9B 1BZOA 5E5MB 3GS0A 1YMME 5KVDE 3C6SB 5D1QB 5D7SH 1IJNA 1UASA 2EDHA 5C0BE 2JB5H 1QHPA 3WKML 4H2CA 4HIJA 2IWGA 3WNKA 2ZOWA 2E27H 3D06A 2PYFB 2G5RA 3B56A 4E41E 4QY8A 4EXPX 5IVNA 1S6NA 4LAQL 4XB7A 3V0HA 4D94A 1B0RB 1RK1A 1UWGH 4OZFH 5B1AB 4NDMA 3SKMB 1DQTA 5EU3B 1OF2A 2Q0ZX 1W72L 1KJVA 5GS2D 1YEIL 3BO8B 2JQMA 4NO0D 4ZUTA 2G60H 5CEZD 4RA3A 3UJIH 3MRRA 3PWJA 2C3VA 5AW3B 5DK0A 1P6AB 3I6GA 4XNUL 4RWHA 3RURA 3T0EA 3PJSA 4LOEA 5C0IB 1NGYA 4M03A 5CZXD 4WY7L 4AQOA 1DN0B 1L6ZA 4KK5C 2P49B 1YEJL 1H9DA 1T1XA 1TKWB 2HN7B 2VL4A 4Y2OA 1W80A 2HRPH 2Q7YA 3RUGA 5JYLA 1BZEA 2DWSA 3DVNA 4XRCA 3ILQD 3GXDA 1UHVA 3DPBA 3V2AR 1HAWA 1YHPA 1UCBH 1BVNP 3B7TA 2LU4A 3LY6A 3SE8L 4H1LA 5IVXB 5I2IA 3B5GA 4JPIB 5BZWB 4J4PD 1MFVA 4KDWA 2WCSA 1UEMA 5EZLA 4AITA 4DETA 3STLB 3BZEA 5I75B 4P23C 1H3VA 1UADC 1HOEA 4KTDL 3HUJA 2W59A 1EXHA 3LKNA 5BOJA 1UZ8A 2A3TA 3H8NA 2Y5TA 1DJHA 3NABH 3IMBA 3ECBA 3AQXA 3L5WB 3QA3A 1T0OA 4Y19A 3E80A 5EORH 2NW3B 4OJEH 4Q52A 4MZRA 4R4BA 4WW1A 4X9BA 3ZLQC 2ZONA 4MJ4A 4YHNB 5E1AB 1P5UA 3VFRB 1EJ8A 5EIQA 3MRFA 2WYZA 5DJCA 3BXNB 5JZ7D 5KANI 4KU1A 4A7VA 4TLKA 1WT5C 1SJHA 4GOSA 5T1MA 2AI0H 5HDRA 4LHQB 5D72H 4L9LA 3INUL 5AYQA 4CBZA 3L13A 3B7SA 3R7QA 4IBVA 3NQKA 5HHOA 5IWLA 3GMNA 4BFGA 1BBDL 3DGCR 3REVA 1CS6A 1WE5A 1GCFA 3CFUA 3DURA 4P5TC 1MUJA 1FL5A 3RGBA 4PRPD 3U9WA 1CL7L 1IAMA 1OV8A 3PWPB 2VH5L 4HCRL 4NNPL 4PVMA 4NZ8A 1RIHL 2DH2A 1A3QA 2NT1A 4CN1A 3UEQA 4BGDA 5CJ5A 1MY7A 1L7TL 4MNGA 5CLXA 4K9JA 5B4MD 3L1GA 3A4FA 4O2CA 2ZX7A 3ZDZE 1CLVA 1TIUA 1YN6A 3LEVL 3U0PB 5C0NC 4LEXH 3DRTA 1CE6A 2BCKB 5KSBA 3MUY1 1I8KA 3S35L 5J8OA 3ARDC 3D34A 2R0KL 3EO1A 1OW0C 4KNQA 4QRTA 1T6VN 3VXTA 43C9A 3CCHA 3HAEB 5EN3A 2Q86B 2DYPD 5EU7E 1OTSD 3DUSB 2JTYA 4C54A 1NSNH 1KXQA 2NQ3A 3P0YL 1G84A 2IAND 3PQYA 1L9OA 2EDYA 4PREA 3SGKA 4AEHL 5C7XH 1G0YR 2HFEA 2N59A 4FQ1H 1E7VA 4XWOD 3TBTA 2VWEE 5AVSB 1FZKB 3ULVH 3QUMH 4ZMXA 4LVOC 5E9DD 5H94B 2F19H 5I28A 4M5YH 3LQMA 2EUVA 3SB3A 1NIBA 3KVQA 3OGOE 4PV9A 2YN5A 2GFBB 5E5MA 4DPBX 3S3BB 4Q14A 1IVTA 3QR0A 3C6SA 5D1QA 1JGUL 3HAEG 4RMBA 3ULVF 4BEIA 3HE7B 3O4LB 3FB8B 2K6YA 5ABZA 1CFNB 5EOCH 4RX4A 4PW3A 4CGUB 1R17A 2UY7B 3H54A 4WI6A 2B59B 5DJZB 4NCC1 2PYFA 4BXVA 4KMTH 1XZWA 1EMTL 4QRAA 4OLUL 3S2CA 1B0RA 4ANWA 3SKMA 3BD3A 2JJTA 4HPHA 5EU3A 1GJUA 3RFZC 2Y36H 3BO8A 3EYUL 5E8OB 5E6UB 3O3DB 1J86A 2Y7MA 1CGTA 2YQBA 1G7QB 3WLWC 1AKJD 3WFHB 1GGIH 2EJ1A 3EF7A 1IBGH 5EDXA 1FA4A 3MA9H 4IK7A 3X3FL 4I77H 4GI9A 5C0IA 1MJJB 2ZX8A 1DN0A 3DI2B 1BECA 2FR4B 2A4CA 1WFTA 4FMKA 1E4KA 1RP8A 1TKWA 2HN7A 3MZTA 5K1JA 4Z3FA 5IB1B 1GGCL 4LHJB 4HD9A 4WU5B 3TZVD 4XPFL 2N1KA 4WSJA 4GW1B 1KV3A 2CA4A 4NN6B 4Q89A 3SD5A 3NSYA 2VXTL 4ZTOL 5GSRB 4I18C 4LCCC 2W60B 3FN0H 3ASNB 2NSMA 4WFHE 1NMCB 3DGDA 5IVXA 2FO4B 1MWAH 4HQQH 4P9HC 4F5CA 3NSJA 2L7JA 4JPIA 4R97C 4PWJA 5BZWA 2C1PB 3AU1B 2DQTH 3KWWB 3QJQB 4PB0L 4DEPC 3MLUL 2OI9C 2GITB 3STLA 1BQSA 5E99L 1SOKA 3VFSB 5IHZB 4H2AA 4KMLB 2XFGB 3I2CH 3U4AA 1BVOA 1S9YB 3NT0A 2O5XH 1DCLA 3CK0H 3CTTA 3NJMA 4EIGB 4RMRA 2NNXA 1II4E 3A3YB 3IDXL 2HX7A 3OM3B 1HU8A 4HWBH 4N0YL 4RESB 4X8GA 3QQDB 3L5WA 1TQUA 1FG2B 5HHME 2Q8BH 2NW3A 2WQVA 3VTAA 4APQB 4YHNA 5E1AA 3VFRA 4EIUA 1OT1A 5HDBE 4X5LA 1BIHA 3LKRB 2ZUXA 3OR6B 3ZYOA 1WGOA 2J8UF 3AUVA 1UA3A 2BM3A 1OM3H 4B41A 3BXNA 4OM1H 1TTFA 2KI6A 2LR4A 4M5TA 3WOVA 5G4MA 1KFAH 4I2XB 2NZ1A 5CJ8A 1UZ6E 4NZRH 4HH8A 5I1EL 2AJXH 3ZMRA 1NBYB 1JHLL 5AW1B 4OLXH 5ECGA 5I26A 5AKTA 2Y1AA 2E9BA 3PWPA 1MSPA 1GZHC 4UBDC 3OMIB 2OL3L 2WANA 3VXMD 1MCKA 4XODA 5DR5H 1FF5A 1N64L 3MBXL 4PJIE 2CO4A 3B7RL 1MF2L 1HYSC 1W15A 4MB3A 5IVZB 3U0PA 4LSUL 4XP5L 4B5ZA 3VE0B 5FOBB 4HHWA 5FYLH 2BCKA 5I5IA 3NSCA 2J5WA 3D85D 1L5GB 2DL2A 1EX0A 3DX9B 2FWLB 1PAZA 3IE9A 2X4SB 3HAEA 2Q86A 1DANU 4YLBA 2F15A 3DUSA 1S2EA 1ROCA 3GLZA 4BWTA 3O2DH 1OARL 3U7WL 1IUZA 3FMGL 4QXGL 4YFEA 3NJVA 2XXFA 5DCCA 4LOVA 5TFSL 2EVJA 1UWEH 1KBGH 3GO1L 2NZIA 3LIUA 1FLRH 4M02A 2R29L 3DSFH 5AL8A 1LMKA 2XWTB 2BHFA 1KGCD 3GSXB 5T5FL 4P4KD 1FZKA 2AC0A 1X5MA 5H94A 3KDPB 3VXOB 3GXUB 3QEQE 3PUUA 4QAWA 2R2BB 2XVKA 4JM4L 5ID1B 1SN0A 1OCCB 1OP3H 4CSZA 5I1GL 1JBJA 1MOEA 4KGLA 3IK2A 2IGTA 3K81A 1O0VA 1YMHB 4OFIA 2EDTA 3HE7A 3O4LA 3FB8A 3NOIA 5F71A 2FIRT 1KDIA 1CFNA 4EBQL 2B77A 4R0LC 1H8NA 3U25A 2UY7A 1E3FA 3ZR6A 2B59A 5DJZA 4KTEH 4U3CA 2FZ3B 3WTXA 2MOQA 2ESVE 3ESVF 4XP4H 2A74C 5C3IA 2YD3A 4D0DB 2CKNA 3FQ1A 1TTRA 5I19L 1NCAH 5AAMC 2Z31B 3PXLA 1RI8A 4NAQA 5E8OA 4LBEB 2Y6SD 3O3DA 4N85A 2PNDA 4F3FB 5F6HJ 1NCCH 2ZWZA 4A66A 1IKNA 1G7QA 2D7MA 2PCYA 4P2OB 5E4EB 5LGYA 3WFHA 3ZBMA 4WO0A 4ZPTB 1NL0H 4AG4L 1MJJA 3ARBB 3D39B 3IS0X 3ZHNA 1RSFA 3MMEB 1EFQA 4P9ML 3ZTJH 2HXAA 4DP1X 4KVCL 4Y1SA 2FR4A 3WNJA 5IB1A 4M7ZC 3SDDC 3HMWH 2FX7H 4WU5A 4L0ZA 4JRYD 4GW1A 1E3XA 3ZT5A 1L0QA 1WV7T 1JPTH 5CKAA 5CNHA 2WXNA 4M5ZH 1NCDL 5GSRA 2YUWA 3QHTC 1MH5B 2W60A 3DV4B 2DF3A 3LPGA 4WWKC 3MYJB 3RWEB 3V9FA 1AZNA 2FO4A 3GXPA 3RLSA 4BXSV 1S7XB 2C1PA 3AU1A 2BVUA 3KWWA 3MLVL 5KSUB 4F57H 3O6LL 3KG5A 3TS8A 2GITA 2WYHA 4XNYH 3RY5A 2DMKA 3WDIA 4A1RA 3VFSA 5IHZA 4HSAC 3SDCC 4IBWA 4WW2B 3RUGE 1D7BA 1S9YA 5DHMC 5T1DL 4PEEA 4ZX6A 3CV5A 1GZPB 4HFUL 3A5VA 3U30C 2EZ0C 2XN1A 3QQDA 4W4OA 4XCCL 3VFGL 1FG2A 2BNUB 3QNZB 2X4TB 4RFEB 5I1JL 3S36L 4APQA 4JVWA 5HHPB 1E9PB 4FKHA 3LKRA 3DJTA 3OR6A 1C16B 3P0VH 2CUAA 2V2WB 5D6CB 3GSNH 1FRGL 3JWNE 3HUJE 3UO1H 4I2XA 2BNRD 2QKIC 4OF7A 4X4KA 2H32H 1XIWB 1EDQA 5L9DL 2PPEA 3SBWC 3KPLB 5LLIC 3HNSL 4PY7B 4ONFH 1P4BL 2A77L 3WFCH 1ZMYA 1NBYA 2C3HA 1I9RH 5JPMC 3D2UB 2G4EA 4Y19E 5I1KH 5I6XB 4I0PB 5F93C 3EH1A 4PV8B 2RCSH 2GTWB 3FCSB 4PS7A 2VDKH 3S8FB 5C9JB 4WEEA 2GK2A 4AKOA 4F24A 5J6HB 3UYOD 5K5YA 1CICB 5IVZA 5FOBA 3VE0A 3FF8A 1NDTA 3TT1H 1YEEL 1KCSH 1TEYA 5HHOE 3UERA 3PP3K 1L5GA 2P1YA 4PM1A 1UEYA 1JMZA 1CR9L 3DX9A 4KKLD 3T08A 3LS5H 2X4SA 4ODWB 1J0IA 3O3EB 1A4CA 1AH1A 1OK0A 3Q2NA 2VDNL 3QIUB 1FP5A 3RKDD 1N8ZB 3Q6GH 3ECWA 3W0WB 2QVKA 4KJWC 2IAMD 3QDJD 4BFJA 2YUZA 4MNGE 5DI8B 3EJJX 3O6MH 3UC0L 1ZJBA 1SHMA 2XWTA 3GSXA 1WD8A 3GZPA 4N2BA 4DEWA 2YGVA 3GC3A 3LB6D 3HVDA 4IDJH 4M62L 5L6YL 3VXOA 2XPYA 1UXMA 4DP8X 5KSBE 1FIGL 4K3JL 1TQTA 1UUNA 2R2BA 1C9SA 5JW4M 4Q56A 5CILH 2Y6TE 5ID1A 3RWIB 4P3WA 4P9HH 3TCLB 1KJ2H 5H37H 1YMHA 1KXQE 3FB6B 2EDBA 3PQYE 4K8RC 5EBMB 5DC9B 5T3ZH 3JYBA 4TUKL 1QP1A 3BFWA 4E9YA 1F1GA 3SIKA 3CFEB 4AEIH 4H20H 4KAQH 4KJPD 4QTIL 1BJ8A 4HF5L 2FZ3A 1FIEA 1RZ7H 5ISZB 3MLXL 2ITDB 3CVHB 1N5YL 4D0DA 1NANI 1KGJA 4YXLH 2BP3A 2Z31A 2QT6A 4PJBF 4LBEA 4HJSA 4F3FA 4XN1A 2AEQL 3APDA 4OM0L 4AIXA 4P2OA 5SWZB 5D1QE 1A64A 4ZPTA 4LVEA 5ADPL 4LSRL 4XX5A 2A73B 3N41F 3ARBA 1BEYL 3D39A 1GOFA 1MEXL 3E8UH 3MMEA 2YD8A 3QWRA 4PCSA 4I5BB 4MJJA 2D31B 2NYKA 4IRSB 3K74B 1JZEA 2XFXB 4JFED 5I1AB 4GAGL 3DPDA 1MZYA 3BZDA 3UTSB 2HTLD 1MH5A 1D9KD 3DV4A 1E42A 1VCAA 2E76C 3MYJA 3RWEA 1TEGA 3QIWB 4L4JA 3A67H 1I3GH 4XPGL 2F7IA 3RWFB 4Y4FD 4YSTA 1S7XA 5F7FA 4DGIH 5KSUA 3EDFA 3VSQA 1XXFC 2E4TA 1F3JB 2IOIA 1ZD6A 2O5NA 5FM8A 3MV01 4JY5H 4ABWA 1UM4L 4PJEB 3WO3B 1M57B 2DWYA 3EDDA 4WW2A 2P43B 1TF4A 2NYZA 4EZJA 4A2DA 3GLEA 3O45B 3BZFB 5FK9B 1Z5HA 1N7MH 1GZPA 4L3FA 2EDJA 1EO5A 1BQLH 1TJIL 4JM2B 4TVPL 2OZ4A 5IVXE 2BNUA 1BQRA 1GY2A 2X4TA 3QNZA 4RFEA 5KTEH 5D7LD 5E2WL 5HHPA 3T2OA 1E9PA 3BKJH 3ENEA 5GISH 1HXKA 1C16A 3G5WA 2B4CC 2V2WA 3QVAA 4XMKH 5D6CA 4A7QA 3VFNB 2CM6A 2VN5A 4DN4L 2V17L 1XIWA 1T04B 3WENA 5GGSB 3NCJH 4PSRA 3FTUA 3KPLA 3SPJA 4PY7A 4AE1A 2F58L 1U4FA 2FWUA 5L4FA 5GQBA 1DJGA 4IGBA 3D2UA 3B2PA 3VDAA 1R3IL 2EVHA 1ZANL 4L2LA 4LP4A 3DC0A 5KBLA 4I0PA 3QWOB 1KB5B 4PV8A 1HWGB 5HGBB 4GXVL 2GTWA 3FTYA 5JXAL 4X4XB 3FCSA 1R9FA 3C5ZC 1F5WA 1MDTA 5DU7A 5C9JA 3B1UA 4O4YL 1E9OB 2B0SL 3BUQA 4R84A 1ML0A 2O4EA 4Y88A 1A21A 5J6HA 3B4NA 1TITA 2GCYB 1CICA 4M61B 5I30H 4R3SB 1GYAA 4PJHF 2NNAB 3L2MA 3DBSA 3P73B 4LDCA 1KELH 4ODWA 5C9KA 3O3EA 3A6CL 3QIUA 4LSPL 3MNWB 3IETB 1N8ZA 2Z1PA 2NY0D 5D2LE 4F2FA 3ZYZA 3CUPB 3W0WA 1DR9A 2D7PA 3TT3H 4A7UA 3V4UL 2CCLA 5HGGS 1TT6A 5DI8A 5JW4N 2ITFA 1CFBA 4HU2A 5I15H 3QCVH 5MERB 5FKAB 1PL3A 4YUEL 3EJRA 1KPVB 4ORGB 3U7YH 3ZHKA 3X14B 3QZOA 1RJCA 3RWIA 3IJ7A 3TCLA 3SYCA 1IGFL 1Q90A 2XKNB 2HWZH 3CZEA 3FB6A 4TOYH 5EBMA 1FNSL 3FB5B 3IJEB 1BD2B 3CFEA 3NA9H 4FYRA 3WN5C 5T3XE 3B9DA 1J05B 4FL4C 1TPXB 1BYOA 4XP6L 5SWSE 3OHXB 5T1KB 2ED7A 4GP8B 4NUJB 5ISZA 2ITDA 2FLMA 3CVHA 4FNSA 1MCCA 1YLBB 1KDJA 2AXWA 1QFPA 2MOGA 4JZOB 1NIDA 2BP8B 3LDBB 2NY4D 4N9OB 3CZJA 1F56A 2R83A 5SWZA 4LSQH 1SXBA 2XWBB 3CSBA 5FKPB 4U6YB 5EO9B 2RACA 2A73A 3KXFB 1HAUA 3AACA 4WWOA 1EGJH 2Y06H 1MFMA 4FD0A 4XMUA 4I5BA 3P11L 1ONQB 2D31A 4IRSA 4JY4B 2E6JA 4GMSH 2PO6B 2XFXA 5EF2A 1HH6B 1OIOA 5I1AA 3AUWB 3MGTB 4G7VL 4NS0A 2ZICA 5EIIB 5HHXL 1A66A 3CFIC 3UTSA 3G9AB 5CSGA 2WBJD 4MAYC 1KJ3L 1OP5H 3QIWA 3VRIB 4B96A 5KN5B 4QTHB 3RWFA 4H26B 1UM5L 3QG7H 3IRZA 1T66C 2EIMB 2MQGA 3ZIMA 1WZAA 1IQWL 1F3JA 1PX4A 3I75B 3M8OH 1U41A 4JZJB 4NENB 1I7RB 2FTAA 2WJ7A 4TV3A 5D93B 4YSEA 3FU7B 4PJEA 5AVVB 2E6QA 5FDWB 2V5TA 2FEJA 1RJZB 3PYCA 4OFKA 2IH8A 3O45A 3BZFA 5FK9A 3QDGE 1TZIB 5EIIG 3RWGB 5SX4I 1YEDB 4JM2A 4HXBH 4TM9A 5J12B 3J8F7 4AK2A 4KXZH 5E23A 1EHLL 1CDBA 4FQPA 4AYFB 5GGVH 1GR7A 4NPKA 4HBCL 2WQ8A 1PBYA 5T33L 1DBML 3O4OB 3VFNA 2VSKB 3BWAB 3ULUC 2DIAA 2O93L 3BVXA 1P7QB 1SN2A 2FWOB 3BUBA 1JERA 4ESKA 1T04A 4NJ9L 5GGSA 1UKQA 3L7FB 4TRPL 1C1EH 1GC1H 3WTWA 4G5ZL 2BX5A 4WK2B 4JDTL 4K8RH 4HUVB 1IAIM 3QWOA 1KCVL 1RZFL 3P30H 1KB5A 4J3OG 5J13C 1TO4A 1DFBL 2UY6B 1ODAA 5HGBA 2FJFB 2ORBL 4X4XA 3H6AA 4AYID 4KO9A 4WWPA 4CILA 3MRCB 5HJGA 1E9OA 1PCSA 1H9VA 3IDMB 3V52H 2IDTA 2LFEA 4I2XE 3OAWA 3QRGL 1FH5H 5B1CA 2GCYA 3TJPA 3ZVVA 1CFTB 2C7UB 3MCKB 4M61A 3UP1A 3NIDE 3FQ2A 4R3SA 1ZVYA 4Y2LA 2NNAA 2XSKA 3P73A 4GUQA 1U30A 3MRNB 4H0IA 1U92B 5TE7H 5BRZE 5DRNB 5CJOH 2JI3A 3IETA 3MNWA 4TNWF 1JPFB 3CUPA 1BOGB 5IB3B 4CBPA 4HIQA 3M88A 4G1MB 3TEUA 1AJ7H 4BZ2H 2D3VA 4OIIH 4IM8A 3K80A 3H9HB 1FHGA 3KL5A 5FCSH 1NOAA 1U3HD 2CD0A 2FHBA 3I6KB 5FKAA 3VRLF 5MERA 5SWQB 1ND0B 2EYTB 2QVFB 4S1QH 2VLLB 5CWSB 3HEIB 5I8OH 1KPVA 3L54A 4ORGA 2F1BA 2IG2H 2RTTA 3X14A 1A6VL 3PUCA 4X6EB 1NMAH 5D8JH 1TYEB 5FOJA 5EV7A 2YO3A 2XKNA 3KBFA 4XCFL 1BXAA 3ZDXB 3KEDA 3VXRD 3EG9B 3FB5A 3IJEA 4OCWL 1BD2A 1DQML 2I7SA 1J05A 4F9PA 4ZX3A 3MZGB 5K9JL 3OHXA 3PHOB 3HE6D 5T1KA 1SZNA 1MCWW 2PCXA 4NUJA 3ZL4H 2WVSA 2X6UA 2WXPA 2WXOA 2GHZA 1IMHC 1WGVA 3EDEA 2VN3A 1LEIB 4JZOA 1NLBL 4K5MA 2BP8A 1NGXB 4QOKD 1LMIA 3H9ZA 5JW5B 2XWBA 2FQDA 5FKPA 1LD9B 5HTSA 1R5VB 3T6VA 4ZD3H 4U6YA 3WNLA 5CN2A 5EO9A 1YUKB 3KXFA 3FO0L 2YA1A 2B4CH 2A9BA 4FAAB 3KWVA 1F4AA 3VQ1C 1ONQA 4AQAB 2WYIA 1WBZB 3N85H 4JY4A 1KPRB 3BISA 3GSOB 1ILSA 2PO6A 4KWUA 3F5WB 5FF6B 1YAZA 2FQFA 2FX8H 1HH6A 1MFAL 4ODXB 3H3BC 1USQA 3MGTA 1JGIA 2YPVL 5L4IA 1CDYA 1FFRA 4R26H 5DQJB 2P5WB 5EIIA 4OFDA 1ZHBB 2ICEC 2AK4B 4UILL 2M8XA 1CI5A 4KZ0A 3VRIA 1OAZL 5KN5A 4QTHA 1QTSA 1KIUB 3DGGB 3HFML 3QCVL 4H26A 4N4YB 1IEAB 4OLWL 2RA1A 3TESA 1VGEH 4Z7QB 4JREC 3I75A 5LCVL 4NENA 4JZJA 1I7RA 4Z3HA 4IHOB 4G72B 3FU7A 4ENED 3NEEA 3A22A 5FDWA 4HKJB 1T2XA 3Q2LA 2OULB 3WTSA 2QMKA 4LQFL 4XNXH 4D0CB 5I1IH 4NFDA 4P5KB 4OW6A 1DQLL 3B9KB 5DURD 4AW4A 1FWXA 1RJZA 1BFSA 1J0KA 1WUNT 1PZSA 2YWYA 3FTVA 4PJCE 2IWFA 3ZE1B 5I17B 1A7RL 1TZIA 3RWGA 1LWHA 4QNPF 3EBAA 2Z8VC 4ZFOB 1YEDA 2Y7OA 2JB6B 5CGMA 4GRLD 4GBXC 3FUHA 3FUEA 2Z64C 4AYFA 2CKBL 2A5UA 3D05A 3KWUA 3S48A 3EH2A 1LDSA 2X1PA 3APNA 3BWAA 4UI2A 1NOLA 2XVLA 1XR9B 5CCGE 3D5OF 4FG4A 1B2WH 1PLBA 1P7QA 2FWOA 3I50H 3G6JF 4LRNL 2IPKB 2BSBA 1N19A 3L7FA 4HUMB 3S5LB 2CG9X 1DBKH 3QS2A 4Z9KB 3S37L 3AREB 3MODH 2YEQA 5DD6B 1DTUA 2NW2B 1VLXA 4I1NB 4UT9H 3VW3L 4HUVA 1O7SA 1BQHB 5GXBB 5HGAB 3KNBB 1CU4L 1WFNA 2MQ0A 2UY6A 1WHOA 2R2CA 2RJMA 2FJFA 3KPRB 1QPPA 3VWJD 3AXHA 4DP4X 2DQEH 3MRCA 4Y9CA 5CJBA 3ZKXC 4H0HB 5JYMA 5KBKA 3VXSD 1HKLH 3IDMA 1T0PB 1U93B 4JFDB 3UX9B 4E9VA 5BV7B 3ZTEA 3EO9H 2CE6A 1CFTA 2C7UA 3AS0A 1KUMA 3MCKA 5J3HD 3C12A 3WKNA 1IAOB 3P40A 4DPRA 3MFGB 3SDXF 1U4EA 1R3LB 3S5LG 2VDOL 1CD9B 5HDWA 4YZFF 3I6LE 1PKQB 3MRNA 1U92A 4WI7A 2VL5B 1RZKC 4PWGA 3AQZA 5CO1A 3RIKA 4Q0XL 5DRNA 3RKPA 3WO4B 1INQB 1JPFA 1BQHG 2R69H 3CXFA 3W9DB 1BOGA 5IB3A 1OSEA 1E5CA 2EABA 2P5PA 1TVHB 4Z5RB 4G1MA 4DHLA 3VFOB 4UTAH 2DEWX 4ZQKB 4J3WA 3CDGB 3HKZA 2WO2B 3NTCH 5JHDD 4BK5C 4JFFD 3H9HA 1I8IB 5SWQA 3I6KA 5K69A 1WCQA 1ND0A 2EYTA 3P02A 5DC2A 2VLLA 3M17B 1LP9B 5CWSA 1KOAA 5DVKA 1JNNL 1AXSB 4YQXH 1DEDA 4X6EA 3D7PA 4AVHA 1SXNA 1AQ8A 5C0DB 1M42A 5IMOB 4D3CL 3GRBA 2G2NA 1IFRA 3EG9A 3W0WE 4KK5D 3E9TA 3WKPA 2R0ZL 2D2CC 1QLEB 2J8HA 4GSRA 4L5FH 4KZDH 2N0KA 5D7JB 5AUMB 1JZ4A 3OC8A 3PHOA 3HC3L 5CEXB 3CN2A 1YEKH 4GQZA 3AY4A 4LAJH 4WI4A 1WZMA 2O72A 2FH8A 3O8XC 2BVEA 1URIA 1XDTT 3ARGC 1LEIA 1NGXA 1MFCH 2F54D 3SDAC 4FXLA 5LDUA 5JW5A 1SGKA 4LLDB 2ZJSL 4EDWL 5D96B 1LD9A 4NYLB 1R5VA 2BJML 3EHBB 1OP3K 2V9QA 4F2EA 1QZ1A 2XNAB 1A6AB 1I85A 4G9FD 4P23D 1L6PA 1JD9A 1ZIAA 3G04B 4AQAA 3E3QC 1FBIH 1WBZA 3U4EB 3QIBC 1KPRA 4RDQF 3GSOA 3T9WA 5FF6A 5ISZE 2FATH 3F5WA 3QI9B 4X9HA 3LNIA 4ODXA 5CJQL 4TVPD 3IJYB 3NDYE 1H3PH 3T3MF 5DQJA 2P5WA 3H55A 4X5RA 2UWEF 1SJXA 1ZHBA 5LO7A 1FVDB 3APFA 1EDYA 2AK4A 5SWZE 4FLHA 5JIIA 3LQAL 5F7NC 4BQ8A 1K6QH 4OLVL 3DGGA 1KIUA 3JV5A 1IEAA 3B2VL 2DQGH 3ATBA 1TG8A 3QCUH 5E0QA 1SBSH 3KVPA 1Z7JA 3MAWA 2BO0A 3EOBB 4B0MB 4JCLA 4IHOA 1GIGH 2W88A 3LVEA 3FU0A 4HKJA 1SFDA 2ERJB 4O5LL 4GKNB 4D0CA 4P5KA 4UTBA 3WELA 5CIPH 2DWTA 3B9KA 5I17A 1BYPA 1SDYA 4M93B 3FQRB 3COOA 5DFTA 4U6HB 4PI2A 3RFRA 3K1DA 4ZFOA 2KC0A 2JB6A 4YGVB 4U1IB 4YC2B 4LARL 1JRHH 1DJSA 3NJXA 4ZXBC 1NC4B 3TBYB 3WIHL 1WWWX 4JGNA 1JNLH 3Q9PA 4WGVB 5DUML 2EH8H 4P07A 4NP4L 1XR9A 3P3SA 2QZ5A 5J89A 5C0ND 4E2OA 2IPKA 2VQ4A 3ARDD 2VERN 3GRWA 2CO7B 3QEUB 4HS3B 1JYVA 3S5LA 2JKRM 4OZ4B 5A2JH 1SEBB 1XF1A 3AREA 5DD6A 2C26A 2NW2A 5C6PB 4R4FL 1BQHA 4GSDH 5HGAA 3KNBA 1SJEB 1FGNL 4XMLH 3PU7A 3KPRA 4PQXA 1DL7H 3FL7A 4XC3L 1IM9B 4N1CA 3IB4A 3HTLX 1U93A 4JFDA 1L7IL 2BY1A 2Z93B 4MA3B 4QHUB 1IAOA 4KY2A 2HVJB 2VN7A 3FCGA 1Z9SB 1R3LA 2NY6B 1P4IL 2ZOTA 2OR7A 1I8LC 3PRZA 4P2RD 3X11B 2F7PA 4K23H 1PKQA 4MJID 1XH3B 2VL5A 5D1ZC 3HMXA 1INQA 1SUJA 2FGWH 4XWGH 3W9DA 1GMEA 1HINH 3KLDA 2X1QA 3QK0A 4GRMB 1TVHA 5CN1A 4Z5RA 1EHXA 2H3KA 3UZVB 3VFOA 5CR1A 4ZQKA 3CDGA 2YAMA 3KLQA 2Y3AA 3T2QA 3O9WC 3QZWB 4KXCA 3CH1B 1I8IA 2MPAL 3WG7B 1MG3C 2BVOB 4DSYA 3M17A 1LP9A 4N2LA 4NPYB 4RAVB 1AXSA 1RVFH 5D55A 3UYPB 1JYWA 3U1SH 3WLWD 2HKHL 2KDYA 5C0DA 1JE6A 1KTBA 5IMOA 3BH9B 3EJPA 3BP5B 2WXMA 2WQAA 1C5CH 3BAWA 3LXUX 2QDVA 4N2CA 1E3ZA 2G9HB 2MMXA 2VXQL 5D7JA 1AFVL 5AUMA 2JTDA 3FUNA 2B5IC 3IBOA 5CEXA 4XOCA 1QWUA 3QZWG 2IQ9H 4HT1L 1T80A 1TZ8A 4HHGA 4PW4A 2ZKMX 1YEWA 4N3UA 4YK4B 2WYTA 5D71H 1UYWL 5BO1H 1JGEB 2H9GB 2QVIA 4LLDA 4K7PX 2HA1A 3NIGF 3FCUB 4NYLA 3W5NA 1T3FB 3JUZA 1UA6H 4K3GA 4ZMNA 3ZMEA 3NK3A 1PNCA 2XNAA 2CBOA 1A6AA 1BD2E 1MWAB 3G04A 4P2YA 4PBXA 1WP6A 3S3JA 3U4EA 4HLJA 4ZMLA 1KYOK 2QADC 4OH2A 3QI9A 2FCBA 3WSQH 3CSPA 3ECQA 4UV7H 3IJYA 4HSQA 2QELA 3FSOA 3C8KB 2QBWA 1FVDA 1D5MB 4KXZI 4FNPA 5MEND 1S78C 4M7LH 3IT8D 5FECB 2DTML 1IGYB 3A4AA 4KV5E 1FGVH 5JHMA 3N44F 2R51A 3EOBA 3ISYA 4PMFA 4H8VA 5F7EL 4PCKA 3MYZA 4X9YA 2QGCA 3VD4A 1Z1WA 4GKNA 1EHNA 2RGSA 1D2OA 4M29A 5K1VA 4OD1L 4UQ3B 1Q9LB 2QPEB 4CKQA 4B9JA 1XF5B 2XTJB 3FQRA 1S7QB 4NSKB 5KW9H 1U8HB 3N1GC 3O41B 3TWCH 4JPWL 4U6HA 4PJ8B 4C47A 1GCYA 1A3LL 2FX9L 1AKPA 4YGVA 4U1IA 5IFHH 2FLBT 4UBDD 3TH3T 3K6FA 1PIFA 2VDRL 1CN4A 4MA1C 2ZOUA 3N91A 1BQUA 3PL6B 5AVYB 3ARZA 2WAQA 3GBNH 1NC4A 1OGSA 3OTTA 3TBYA 4CU8A 1HYSD 3CX5J 5JUEL 5CR8A 3QPQC 4NM4L 4DN3L 3U6XS 1E4XL 3UACA 1J5HA 3MRGB 4HS3A 2CO7A 3QEUA 3ULUL 1QRNB 4OZ4A 1SEBA 2VC2H 3CHSA 5HDLA 3KWTA 3D3VD 1DVUA 3WY3A 2CJUL 4HJEA 4B9PA 1PY4A 4XAKD 1AXTL 3HNVL 4MMXC 1HT6A 3K2KA 3OXSB 1SJEA 4JJ5B 1XFPA 4FS0A 1KCUL 4KRNA 2K3HA 3N43B 4FQCL 1XX9C 1ET5A 1IM9A 5I0ZA 2WLKA 2WKGA 3LEYH 4EN2A 1CFMA 1V05A 1TQCB 2Z93A 1L3WA 4MA3A 4QHUA 3NEOA 3NAAL 4J7RA 4ZFZB 4GS7B 1KY6A 1ESOA 2HVJA 1AHKA 1Z9SA 5FAAA 1I1YB 4JFYB 1T89C 1HL5A 2GW5A 3X11A 3FT1A 5JHLA 1BAGA 4PGEB 1HESA 1XH3A 1FE8L 2WUCH 5EZIH 4PG9B 4DGYH 2BSEA 3WEBA 5IJKA 3ATEA 3IJ8A 2KZWA 3ZDYB 4LSVH 2F53B 5C3TA 4LCIL 5AZ2H 4DJMA 4GRMA 4K4KA 3UZVA 5FGRA 3L2LA 3H2QA 3QR2A 4UINL 3QJZA 3QZWA 2FEEL 2XXMB 3CH1A 5FA4B 4QO1B 3WS6C 5C0JB 4LEEA 3ZTNL 1FZMB 5AB2A 1KBVA 1FVCB 1X5AA 5BRPA 2AAAA 2BVOA 5I0YA 2NSXA 3A23A 4NPYA 4RAVA 4K94C 4W9FC 5MP6H 3UYPA 4YDKL 4PRID 2VJ0A 1OT2A 3UMNA 2R9HC 2HT2C 3RVVC 3MOBL 3QZLA 3C2AL 4E68A 2DMCA 3BH9A 5DYOB 1BWWA 3CDFA 1Q4NX 3BP5A 4L4TD 2W65B 2WIIB 2VT0A 3FH7A 4HDIB 1J1OH 5HXMA 4OD3H 4DW2L 2QR0B 2G9HA 2G2PA 2ZKHL 4X7SL 1S7UB 1HN1A 2CK0H 3AADB 4N0CC 1H3GA 1ZK9A 3MUHL 3ZK0A 4YHLL 1JZFA 1HI6B 5EU7C 4KHXL 1P9MC 2ZYIA 4K2UL 3TPUB 5JIDA 4WWKD 1DDHB 1JGEA 2H9GA 1AI1H 3ULSB 3B37A 2A83B 2B7DT 1TLKA 3C9NB 4Y8AA 3FYIB 1IBYA 1N26A 1T3FA 4P99A 4UT7H 2VWEC 1OAKH 4Q4EA 1TU2B 5EA0H 2RMNA 1MWAA 1UXSB 3RU8L 3SDCD 1NFIB 1A4KB 1GPOL 3ZTJG 4Y5VC 1J87A 3L9EA 5GGUB 1B4JL 3GIZH 3L5IA 1JTTA 3QFJD 4Q4IA 4KKCC 3C8KA 2X9WA 1D5MA 3B2MA 3QUGA 1BZ8A 5J7CC 4G2AA 1RAMA 4IBUA 4ZOAA 5AAWA 5FECA 4S1SL 5CU9A 2QQLL 1IGYA 5C6TH 5F7UA 3AWFA 1ZE3C 5KVEH 3L9BA 4HLEA 5EZOH 1SJVA 4N2AA 2KMWA 5JOFB 4KDVA 2D7OA 3NJLA 2OMWB 5MEQB 1J18A 3T4AC 4BZ1H 2IC2A 2R0LL 1UACL 5F1IB 1N6QL 1DQJB 4UQ3A 1Q9LA 1PIGA 4JR9H 4XBEH 2P5WE 3WFDL 2YD5A 2F8XC 2D7NA 1NBVL 1XF5A 4NSKA 1S7QA 4YHZL 1U8HA 2H32B 3O41A 1K5WA 4PJ8A 2AK4E 3WKQA 1VERA 4F58L 1YUHB 5I8KH 1OSZB 3OHMB 1DBAL 1L9MA 2DQIH 5PCYA 2O6DA 1OP5K 1ZSDB 3BN9D 4Z7QE 5DMKB 5HVHB 3WD5H 3CLWA 2W9EH 3PL6A 4K5LA 4AL8C 5CUSH 3G6AB 3RGVC 3WJMB 1R5IB 4RAHA 1B9ZA 1UA6L 3UZEC 5FR3A 1TQSA 1ZTXL 4G83A 4TYUA 1S46A 3MRGA 3VRJB 3LZFH 3ZE1E 1JV5B 2J6WA 1QRNA 4JO2H 3FQUB 4DP0X 4N2OA 2RBLA 3BDBA 4PJDF 1UWYA 3RIAF 5LGJB 4P46B 2X12A 4UT6A 1D5IH 3GHBL 3OXSA 5DEFB 2Z35B 3CXHJ 4JJ5A 1E65A 1MCIA 4UAHA 3L3IB 1D7DA 4TNEA 4KUZL 1AR1C 1MRDH 1O6SB 4QGYA 2J5LC 4V1DD 1G7PB 1U3ZA 2V9TA 3R4DA 4ZFZA 1UJTA 2A38A 3FTSA 3MLRL 3HC4H 4QCIB 4AJYV 5JW3L 1XEUA 1I1YA 3CIAA 4FYTA 4JFYA 2CSPA 3TVMD 3U6XA 4Z7OF 4OI8A 4PGEA 2EKJA 3O2WH 2V4LA 4PGZA 4LCUB 4Q6IC 4PG9A 3LOWA 3BGFC 3AM8A 3KPRE 2F53A 5DQDL 3GINA 3K2IA 1RZKL 1KJ2B 4RFOL 3V5KB 1NFKA 1LDPH 4KI1A 4NO0B 1XGQB 4JFDE 3HBGA 5FA4A 3PWVB 1KPUB 5C0JA 4QO1A 2BIPA 1FZMA 2HVBA 3BE1H 1FVCA 3MVSA 1R3KB 2C3GA 2CO3A 5JO5B 4GW4B 4YWGL 3LN4B 5C97A 4TNWK 3TXAA 4X8XA 4OF8A 1PKQE 3D52A 3N41B 1DBJH 2F5AL 1E4XI 4PB9L 1MNNA 1OCOB 5KVGL 4PRHD 5DYOA 5A6IA 5DJ2B 4KJQC 1VPOH 4IOSA 3ASWA 3V4VH 2W65A 2WIIA 4X80H 3BJ91 2EXWC 1ES0B 4HDIA 2HRHA 3HR5B 2W9DL 2QR0A 1JVOA 5DO2C 4AYMC 5CINL 1S7UA 1IAIL 1NFDB 2GUYA 3MRHB 3NRQA 4GT0A 4F9LC 3KBEA 3LH8A 3TA3B 1HI6A 2RR3A 1W16A 2XQYK 3OLDA 4N2NA 1LP9E 2HJKB 3BVTA 3TPUA 4RGOL 3CLFH 5AW4B 2QPSA 3LNFA 5GHWH 1DDHA 2VN6A 3GZQA 3ULSA 4JRXB 2A83A 2Y9RT 3WTTA 3C9NA 3J27A 4XVSL 1YVLA 5LXGH 3BUTA 4FXTA 2ODHA 2C7FA 4MSWB 1TU2A 4NP9A 1VF5C 4JL2A 5KSAC 2GC4C 1UXSA 1W9XA 2X42A 4PTUB 4L23A 5FYKL 1NFIA 3V0WH 3ZX1A 4XNAA 1A4KA 3KH4A 2LVEA 4JS7A 2WQXA 3QXTA 4M7KL 1OT4A 1KTKE 2QGDA 4NOBA 4PRBB 5GGUA 2CHWA 4KGJA 4FQIH 1AMXA 4HETA 1KN4H 3DX7B 4Z78B 2Y0SA 3LXCA 1FO0L 4ZMOA 4JFZH 5IJBC 4OB5L 5HD8C 3DVGB 3F6LA 4L1BA 2FEEI 4R2GC 3MXWL 4HWEH 3KS0J 4XOEA 1JTOA 1GH7A 1RUAH 7PCYA 5KVFH 2JI1A 2XVGA 2ZUQB 5GGRB 1S9KC 3GFUA 4LPYA 4RZKA 4QHKI 3AG1B 4Y4KB 3NBNA 1HEJC 4FFZL 4M8UA 4HISA 3JQOB 2FB4L 5IT2H 5JOFA 4AEFA 4Z7WB 1AIFB 1W8NA 4LLMB 2OMWA 5MEQA 3H1ZA 2IPUG 2YPKB 3BWUC 5F1IA 1DQJA 2E75C 1RU9L 3KM2A 2VZVA 3T2LA 5A6MA 5MHSD 1E6OL 3B1TA 2H32A 2QV4A 1GRWA 3O2VL 1HZHL 1EXUB 2ZX5A 3CAFA 4WI0B 1A6PA 1YUHA 4YR6B 1XSOA 4B9FA 1OSZA 1W6WA 2A9NL 1KBBA 3DYOA 3DXAB 1ZSDA 2XBTA 3C5ZD 3GS4A 2DQDH 5DMKA 4ALAH 4PWEA 2ZUWA 1QLRB 4U3SB 3VGGA 2OBGA 3G6AA 3RX9A 3WJMA 1FAIH 2YBGA 1R5IA 4Z7UF 3ELQA 1I9IL 3M86A 2ZE0A 4PJHB 4TQEL 5CU5A 2VR3A 3L48A 4K94H 4G8FB 5E4IA 3VRJA 1JV5A 2VM3A 2Z91B 1NKGA 2NY3B 2W07B 4LASL 3FQUA 3T0EC 3MOAL 5LGJA 4P46A 2AITA 5LQBH 2VISB 1RD6A 2OXHB 2GG1A 5DEFA 2Z35A 3P4LA 1JGLH 1YNKH 4OQTL 3FQ4A 4E9QA 3L3IA 2OJ1A 5E6ZA 1EFXD 5GJSH 1EERB 2FH6A 2KLSA 1IAKB 3RILA 3CLEH 5D7KE 2DBJA 3ZDZF 3ZZLA 1PZBA 4DZ8B 3RB7A 1O6SA 2HH0L 1MRCH 1UZGA 2X1OA 1G7PA 1Y7VA 2ZG2A 3TNNB 4FULA 4QCIA 1UOWA 1KENH 4MA7H 2L3BA 3OR7B 4KHTL 4ABQA 5C08E 2E7CA 4LCUA 4EZKA 3ESNA 2X4QB 3NJGA 3JWNC 4U7SA 3RE0A 2DPKA 2X4RB 1CBVL 1QFUH 1FNEB 4NN5B 4JQIL 1KJ2A 3V5KA 5LNGA 4GO9A 4NO0A 4C57C 1XGQA 4ONGH 2IDFA 3Q2WA 3PWVA 1KPUA 2WLNA 3HZVB 1IBHA 4JO8A 3UL4A 1R3KA 2WUBL 4Z23A 5JO5A 1U3JA 4L4VD 4GW4A 3VYPA 3LN4A 3WNOA 3JTBA 4JFHE 3ULVE 4OF5A 2CDFB 2DY2A 1WFOA 2WLZA 1P5UC 1SY6H 2N7SA 3OZ9L 1G9ML 3QDMB 3ELAT 4XNZC 1RFDH 1JFQL 3IDYB 1ID2A 1ZA6B 1ZE3H 5DJ2A 2DN7A 1A6UH 2ROXA 4LEOB 5F3FA 4L9LC 1ES0A 4YX2L 3TFKC 2CR6A 3HR5A 5IWLC 2WB1A 3DX4A 4HEMA 4EN3B 5KYNA 1I9JH 1TZAA 1NFDA 3MRHA 4BK4A 1MCJA 1TEFA 3X1BA 3F83A 1Z9OA 4ODVH 7PAZA 4JUTA 4FQHB 3Q0HA 3TA3A 3F84A 2B2XH 1JWSB 4YE0A 1PG7X 1I1CA 2HJKA 4N5ED 4MAYD 1MWOA 1KGIA 1ZCRA 4M1GH 2TRHA 4JRXA 1MRDL 1P7BA 1I4FB 4U7KA 3ZKMC 2K3TA 2R56H 4L3AA 3LCYA 5F1NB 1T66D 1X5JA 5FYJE 4GH7B 2MEJB 4LXFA 4Z0BH 4MSWA 3T1FB 4CW1B 5BUPA 1R3JB 4PUBH 4ODSL 3DTXB 2TRYA 1IC4L 1SMDA 4PTUA 3V79C 3VGAB 3UTPD 3IDUA 3T8VA 3KPNB 2J44A 2NXYC 2F74B 3POHA 3DJSA 1HHGB 2X2IA 1BMWA 3QUXB 4JKKA 4PRBA 5E0FA 2VXVH 2PPAA 5J11B 1GSKA 1I53A 3DX7A 4Z78A 1QX1A 4OZGE 1UVQB 1NGPL 4UZUA 4XB3A 4D9QE 5KVDL 4GXFA 3DVGA 3SGKC 2BFVH 1E90A 3PNWB 5F7HA 5AW0B 1T0NB 1HQ4B 2EE0A 4HUCA 4EZLA 4A63A 3MV9B 5ALCL 4NQCB 2G4GA 5GGRA 1KCRH 4Y4KA 2JVUA 1YPZB 4XN9A 5C0RL 1WSST 4PI0A 3KBHE 4R90L 1A5FH 3ULUD 4Z7WA 3KLAB 3ZE0E 1AIFA 4LLMA 3DHUA 2YPKA 3S2AA 4F80A 2WINB 5D1QC 1XBRA 4HUNB 2NNCA 1Y1DA 3WIIL 4F91B 2GJRA 3TEZA 4MTMA 2GKIA 3ZYJA 1E6JH 2JKJA 3ARQA 4J3SA 1EXUA 2AP2A 4D8PB 4WI0A 4YR6A 1GGBH 2YPLD 4XN8A 2JNZA 4XCNB 5J1TC 3QHFL 3DXAA 3TIEB 4YVNA 1OB0A 1QLRA 3NJHA 5JOEA 4U3SA 4GIAA 2ZNXA 3S9DB 1XD0A 3Q5OA 2YN3A 3P9MB 3ASOB 1KIRB 1LXMA 1X7QB 4PJHA 3P69A 1UZ6F 2VZ3A 4G8FA 3D50A 4YHIB 5KJRL 2Z91A 3KYKH 2W07A 2J4WL 2XG4B 3PY9A 3GEWB 3RP1A 3RZCB 4RMWA 3M46A 1LK2B 4YHKL 5BUAA 2EYRB 2BIIA 5GGTL 1IILE 2VISA 1E4KC 2ODIA 2OXHA 2D0GA 5AZUA 3L9RB 4XX1G 3WMPA 2Q3XA 1MLCB 2OTWB 4NGHL 5E8EB 3RVWC 2F5BL 4ZW7A 3D0LB 1IAKA 3PHQB 4PJIF 4OIAA 1G7HB 4DZ8A 2GIMA 4P8QA 3A6OA 3K46A 3K6NA 4PJ5D 3TNNA 5B1JA 1QRNE 4LGSB 5IROA 4UQIM 5IG7B 3OR7A 3T0DA 2EICA 2WXQA 5FYLE 3NSDA 3L4XA 4P3CL 4ZNEA 4P3DB 5ESAB 1MLBB 5I75C 5C92A 1UENA 2X4QA 5BVPL 1I1AB 2X4RA 1HCVA 2Z7YA 3FCBA 5E1GA 1FNEA 3SE4A 3GS7A 2VDPB 1GZQB 3FH8A 4EUPH 2WZAA 3CH8A 3CBRA 2NNFA 2V7HB 1IT9H 3LRHA 3LHPH 3QHZL 4A68A 4J27A 3HZVA 4K3EL 3HI6L 4QD2E 4MKMA 2AQTA 3AY2A 1HWWA 5LG6A 6TAAA 1ZEAH 3NJFA 1RJLB 4WV1B 2Y1ZA 3SQOH 5TDOB 2CDFA 1BM7A 4FKKA 1LLAA 3QDMA 4X7TB 2XQBL 2FQEA 4NM8L 3L4CA 2YD4A 1ZA6A 3FRPB 2AZUA 2C4XA 1Z9LA 1CUOA 4LEOA 3ZDYE 5IMLB 2AEIT 5T5NF 4W9GC 1FC1A 1K5NB 4PLJC 4EN3A 4ZFGL 1AZBA 3IE4A 5J1AB 3MXVL 3KJ6H 2R8SL 1CGSL 2QSCH 4FQHA 2EC9U 5DK3A 3WEAA 2UZIH 1JWSA 2DJSA 4WI5A 1J0ZA 4UYQA 1F13A 4FLOA 2V2TB 1A3RH 1M2OA 1K8IB 2Y1YA 3G6DL 1I4FA 3H0TB 4RRPG 2ADFL 4OCSH 2GSMB 2QGEA 5F1NA 4F37F 2QGBA 3VYOA 1WIOA 4KVNL 3FRPG 4P0DA 3T1FA 4CW1A 4Q2ZB 1R3JA 4NRZB 3TF7C 1E2WA 4QYAA 3FT4B 3DTXA 4QF1B 3AVEA 4AQ1B 2P9RA 3Q9QA 3WXVL 5GS0H 4DAGL 4Y9FA 1A7NH 3KPNA 2F74A 1R5WB 4UNIA 4ELMB 3L4VA 1HHGA 4X5QA 3N9GH 2AMUA 3QUXA 4RGND 1INEH 3HZKB 3BUDA 2DLIA 5EIVA 1PG7W 4JO4H 5D1ZI 4ZYKB 1UVQA 2XYCA 3HG2A 1PX3A 3PNWA 4V2CB 2VMFA 5J4MA 1T0NA 4GBXD 3HJ0A 1HQ4A 4GB9A 2FD6H 3ZKNC 1OCWH 4HXAL 3MV9A 2BW5A 4L48A 4NQCA 1R0AH 4JKNA 2ZQKA 2CBTA 1YPZA 1GAFH 3MCYA 1U8PB 5D4IA 2MNJB 2NPLX 4EMZA 1WFJA 1XH2A 3G6JB 4CVWA 3KLAA 1MIML 1OALA 4WNJA 3LQZB 5M7QA 1INDH 1V55B 3RUGF 2CRIA 2WINA 2WQWA 4DKAA 5DZ9A 3TX4A 4QHLB 2GJ6B 3HE7C 5F72S 4IMLB 3SOBH 4OJFL 1J0JA 3EFDL 3FUJA 1HSAB 1MCOL 2DIJA 1KNOB 4D8PA 4JHVA 3JWNH 1XT5A 1IKFH 1MQ8A 4XCNA 1MREL 3TIEA 2IO5A 1G7MB 4FERA 4O58H 4YHPB 3ALWA 4DKEH 2KPWA 4JKPH 4JHWH 3P9MA 5H4ZA 3SDXB 1F4XH 1KIRA 1X7QA 1ZLEA 4NJAH 1IKNC 3EDKA 3EYSH 4AL8L 1HIML 2NY7L 1PLGH 2XWRA 4YHIA 3EUDA 1ZV2A 3WUZA 4FABL 2DQHL 2XG4A 1HK6A 5EBLB 3RZCA 2A6JB 3L3OB 1LK2A 4AGQA 4F7TB 2YMOA 2EYRA 2J1ZA 3HBZA 4GSQA 2WXFA 3NP3A 3WCYA 2JKNA 1JFHA 3FU8A 1QFOA 5FB8B 3X3GH 3L9RA 1M05B 1RERA 3JVGA 3NFSL 5EBGA 1MLCA 4M1DH 4NN6C 2IBZY 4UOW0 2H6OA 2OTWA 5E8EA 1Z66A 3D0LA 1RLWA 4N8UA 3PHQA 4U0RB 3RTLA 3IF1B 1G7HA 3U36B 4MAUH 2IV9A 4JMNA 3L1OL 1FNFA 2BSSB 1NMCC 4BZ2A 3U83A 3G9VA 3UJJH 2L4OA 3KE0A 4QRBA 4MYWB 2NQCA 5IG7A 5L2KD 3EFFB 3NZHL 4I89A 4OCRL 5I1LB 1HVXA 3MV8D 4P3DA 1MLBA 3ESPA 5ESAA 3WXWL 5CD3B 2AS5M 4LOUC 3ARUA 2E56A 2OCFD 1I1AA 3LSOB 4N20A 3F3HA 1I1FB 1TJHL 2NY1B 1GZQA 2X70B 3LVTA 5C09B 3HCVB 2V7HA 5KBNC 1VFOA 4QTFA 2X05A 2ZUUA 3FZUC 2R4RL 2JF1A 1WA1X 4MB4A 1O9VA 1LO3H 3O8XD 4FFYL 1ZGLB 3VD0A 4W4OC 3ARGD 4OCLC 1RJLA 1J5IA 4WV1A 4APQC 4HLZG 3SDAD 2BIHA 5TDOA 3FU9A 2YARA 4ZW6A 2MKLC 3IFNL 1V3KA 2D4DA 4RRPA 4X7TA 3HB3B 3W38A 3THMH 3UBHA 1CT8B 2P8MB 5FYKD 1EVTC 2NTSP 5DZLA 2CM5A 3FRPA 4G8GD 2YKKA 2PW2B 1SJMA 4JG1L 5T1LB 3TYGL 5IMLA 2ZCKL 2IFFH 2YRBA 3UG3A 1K5NA 5CKGA 5T3ZE 2JH2A 2YLKA 5J1AA 3VX0A 1M71B 4LK4A 4HS8H 3V0FA 1HCYA 3T1WA 5EU4B 1IGCH 5DA4A 2V2TA 4MZ2A 2AF2A 1K8IA 4V11A 1JHKL 2VSDA 1SFHA 5C71A 2H1LM 4AV4A 3ME0B 3H0TA 4M4PA 1A7PL 3U4BH 5A2FA 3UGUA 2VR9A 4Q2ZA 5E9NA 3OPZL 4NRZA 1NCTA 2OSWA 1ZT7B 4TTDC 3FT4A 4QF1A 2H0FA 4AQ1A 4HEME 3FN3A 4NUPA 1TTCA 1NFDE 2G9KA 1R5WA 2JKLA 4ELMA 3B2XA 3BDXA 3BSZH 4HZLB 2VAAB 4QAMB 4RISH 3HZKA 1X5IA 1ZXKA 4ZYKA 4NUMA 1PD0A 5CIPB 3F05A 1ZDSA 4Q97A 2XLLA 4JRXE 2A9ML 3QGVA 4I7ZC 1L9SA 4PWHA 4MJHA 4HPYL 5IJCC 3VG0L 5GRZA 4CSTA 3WKYA 1U8PA 4JQXA 2BVPB 1TJXA 3G6JA 2X6AA 3BQUC 2MCPL