4AVHA

Structure of the fimh lectin domain in the trigonal space group, in complex with a thioalkyl alpha-d-mannoside at 2.1 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4avhA00
2UY7B 1UWFA 3RFZA 3BFQG 4XOAA 4X5RA 1KLFB 4AV5A 4AUJA 5ABZA 4AVIA 5AAPA 4J3OG 5IQNA 2VCOA 4XO9A 4X5PA 1QUNB 2JMRA 4XOCA 1PDKB 2WMPB 5FWRA 5F2FA 4BUQA 4AVHA 2XG5B 4ATTA 4XO8A 1ZE3H 2J2ZB 3JWNH 2W07B 4CSSA 1TR7A 4AVKA 3BWUF 5IQOA 5JQIB 3SQBB 4J3OF 5IQMA 4XODA 5CGBA 3BFWA 4X5QA 5F3FA 5AALA 3ME0B 4AVJA 5AB1A 4J3OH 4AV4A 5LNGA 1N12A 2JTYA 4AUYA 3ZL2A 4X50A 4XOBA 4AV0A 3MCYA 2XG4B 3ZL1A 1N0LB 5FS5A 3ZPDA 4CSTA 5LNEA 4LOVA 4CA4A 1KIUB 3JWNG 5FLUA 4AUUA 4XOEA 2UY6B 3JWNE 5FX3A
chains in the Genus database with same CATH superfamily
3U4AA 5BZXA 1DN0A 4AKPA 1IQDA 3B3BA 4X4XB 3HBZA 5HHVH 4NO2B 2R29L 1IGCL 2EDHA 1UWXH 1YC7A 5IY5B 1QSFA 1SDAB 1YPZA 4YAQB 1JPFA 4IRZH 4JO4L 5IB3A 4R2GD 1X5AA 3B7SA 1FZJB 2DTML 3VGFA 4RMTA 1FE8L 3RZCA 2CLZA 3OQRA 4I87A 4AT6B 3BVDB 1L9QA 2GG1A 1RPUA 2P5WB 3EG9B 3VI4E 2ZCLH 4U1SA 3BD5A 1BEYL 5IW1B 5LGHH 4DN3H 4MXWH 2NY2C 4CNIB 1JSYA 1RUKH 3CFEA 3H9HB 4JJHA 1A6PA 3UAJC 2H2SC 2VOTA 4KKCC 3P77B 4YSAA 3LRGA 3OAZK 4OIFA 2EDXA 1QBAA 1NBZB 3SPVB 4LDCA 1HXKA 4W9CC 1I3RA 2XWJB 3C60B 1G5GA 1F6LL 3QNYB 1MFVA 1QFUH 3C5SA 3OAWA 5C9JA 1ZT1B 2WXMA 4NN7C 1LDPH 2YD7A 3EH1A 4KVNH 4UQIM 5F2FA 3QUHA 3CXHJ 4RDQF 3UXFA 1QABA 4ENEC 1HN1A 1U8JA 2XV0A 4JCMA 3AT9A 5TTRA 5I5JA 5LCVH 3WKML 4BSWA 3EUDA 1O9ZA 2VLRB 1J5OH 1EJOH 1P4BL 2DJSA 2FHFA 3P9LA 3APFA 2BS71 1GYUA 5EH1A 4MDRA 5AW1B 3U6RA 4IRSC 2WLMA 1S9YB 2WXGA 4E42B 5B39A 2O6PA 4MA1B 3CXFA 4WHCA 3G04A 5KVEL 3EYSH 2R2BB 4XCEB 2G75A 1OHZA 4R4FH 1MCOL 4MAYA 3EGXB 2VDRL 4I77L 4PJ5B 4F7CA 4L8DB 1ANUA 4WFHE 5E6IA 1IGIL 3LS5H 1LO3L 3S3CB 4H44C 1OARL 3CFQA 1DEEB 3EJYD 2W9EH 1JD7A 2Y36L 3QUML 2W9LA 4KV5E 1CFSB 4K94L 4IOIA 1A02N 3MRHB 4NHCH 4AIZB 5GS0C 3DETD 3ESVF 3QE5A 4N6RB 4BV1A 1S3KL 1A3LH 3HS0C 3QWOB 4LSUL 5FUOL 5L9DH 2ZKHH 4F57H 3PG2A 3OPUA 4WEBL 3ZRFC 2HTLC 4ANKA 1J9RA 5ITBL 3QI9D 5KS9F 3DX6B 4X6DA 1S7SB 2CLVA 2VDKH 4C8XA 3HR5A 4S0SD 4OI7A 2DKUA 3OWEA 5A6LA 1FNGA 3FQ1A 1KXHA 3MRRA 2ENPA 1WYJA 4GKLA 3WFEH 1EJ8A 3GLAA 4YEFA 4DNLA 4I88A 4FKKA 3WFBL 1N4XH 4P23D 4D7BA 2XWTA 3BCFA 1FAIL 1RQ5A 3QUZB 3EJPA 3LQMA 4H13C 5HVHC 2BIOA 4LP8A 3VXSD 5IQ9B 1EXHA 1EO8L 4Y4HB 3GK8H 3FO1B 3VGHA 4JRYD 4OZGF 1U3ZA 1IEAA 2OS7A 3I3BA 4PRBA 4UIKH 4OLYH 2RCSH 3TBTA 1MXDA 1OCWH 1OHQA 1NOFA 3T2OA 4NO0B 4Z18A 2DMGA 4P04A 3E9UA 4APXA 4LNRB 5C0JA 2EDBA 4HHAA 1BLNB 2YFOA 3QIBA 3VD1A 2BNQE 2YUWA 3BFOA 3IGUA 3QHFH 2EDDA 5KG9B 5F88B 5HYFA 3KCWA 2EE9A 4C4UA 5LVEA 5CINL 2XXGA 3MGTB 1CO1A 4NUGL 4AH2B 3D5OF 1EDQA 2BHFA 3MV7A 4TUJB 2WN3A 2JIXD 4APQA 4ZS7L 4F15B 3O2DA 4AL8C 5KVFH 5DZPA 2JH2A 4L1BA 5IHBA 1VFBB 1NEZA 1MCBA 3ET9F 4JFYA 4PRAA 2GBAA 2Y7LA 4HKBA 1OAYL 1DUYB 1N0XL 3LV3A 5DURB 2EUXA 3JV6A 3V0JA 3KCPB 5CEXB 1KT2A 3L9BA 1N59A 2DQCH 4HX1B 4YHLH 4HC1H 4M00A 3GSRA 4IBWA 4HJ1A 3WEMA 3OKKA 4H88H 4X8XA 4XI5C 5K9OA 3QULA 4LESA 3SPHA 5FAAA 1F11B 1UZ6F 1Q1PA 2BRRH 3WIHL 1G7QA 1DBBL 1IFGA 1JRHH 2J1XA 5DMYA 1URLA 4ELMB 1A0QH 3V6FA 3DI3B 1NTDA 4DVRL 1TFHA 2G30A 3L3JA 4FF9A 4WNJA 5CJOH 3SCMA 3RX5A 3P4MA 3VFVA 4NFCA 2V9UA 5AW0B 4ZFOL 3PXLA 4JN1H 2ENQA 1IVTA 1MXGA 3IBEA 4YGAB 3WBDA 4JFDE 4LCWD 1SBSH 1BXUA 4G43A 2VXSH 3NCCB 4QGYA 2B1HH 5AWNL 4R4BB 4BBWA 5AALA 1CDYA 3FYEB 5DVMA 4HUKB 2KI6A 3C8KA 3MRLB 4PJDB 2ZYSA 3F2LA 4HU8A 5D7LB 3HC4L 1CK0L 1ZLUK 4U6VL 4XCNA 3HIZA 1SOSA 3FT4B 5I71C 2R1XB 1YEFL 3R8BB 5HDBE 5FS5A 3TJHC 3IF1B 3S3BB 1CDCA 1CLZL 1ORQA 4JFOB 4JREC 1L6XA 4RDQG 3IJSA 1GSMA 5D1QD 3H6JA 5F1IB 1NFDE 1BD2B 4TN9A 2FGWL 1IZJA 3QEGL 4FZEL 4F8PA 4GRWF 5HGDB 1E4KA 4FNLH 3DI2B 3VNYA 5E9AA 4Y19B 4ONFL 4RIRB 2BP0B 5DGRA 5IVXE 2JI2A 3GKWL 1CD9B 1MCJA 1RVFL 1QFHA 3TJPA 5ID1A 5I6XB 1I7ZB 2YGOA 3QDHA 4YIQA 5MEPA 1DO6A 1NINA 1YY9C 3EH3B 4Z0BH 1KBKA 4N2DA 2CALA 3LZNA 1KIQA 3P30H 3BZFB 1DFBH 4LSVH 2Z1PA 2UZYB 5F9JA 1W9XA 2WYIA 2WINA 2BC4B 1NAKH 1P7HL 2Z93A 4S1RH 5EU7C 2X44D 3RFRA 3ROLA 5LGJA 1Z9SB 4WTQA 3D7PA 5DO2C 3RILA 32C2B 2XTSA 1SYSA 4JFXA 4YSRA 3NG5A 2BSTA 4R7XA 1FH5L 1IBZA 1XGTB 1ETA1 3MA9H 5HHNA 5MP6H 5AB0A 3R4DA 5I18H 3TO4A 4Y2DD 1FG9C 4MS8D 5AYUH 1RI8A 3LD8C 5FYKH 1G84A 4L3CA 3NZSA 5L4MA 4N24A 4EIZC 2D4DA 5INDB 3X3GL 2JSFA 5DUPL 2VDML 3QARA 3WENA 4PLJC 4OUUB 5IJKC 2FWUA 5D2NB 4G72B 5K9QG 5I1EH 5JHAA 5AW7B 1KC5H 2ZWSA 2BK8A 3GSOA 1PLAA 2VDLL 4NM4L 5L2KB 3NA9H 1WITA 2DYPB 3HNVH 1CU4H 1C7TA 1J0YA 2GJZB 1V7NL 4U1IB 5E24E 3JTBA 3R1GH 5BOJA 2XIIA 4MRBA 1MHEB 2CUMA 4YK4C 5IEKB 4FQCL 3CQPA 1MY7A 1IC4L 4PW3A 2AK1H 2ZUQC 2C9QA 2W1NA 3QDJE 4YHZL 4YMPA 5HVWA 1CT8B 2JTDA 3K6NA 5KBMA 4TOYH 5EF2A 1CE6A 5D4HA 1MZYA 2XKUA 4X8GA 3QNFA 1TJXA 4LSTL 4GFTB 1Y1UA 5DEGA 3LN9A 4NFBA 1ADQL 2IBBA 2B1AH 1BXAA 3MRBB 5KVFE 3S48A 4PG9A 4PRPA 1CG9B 1RCYA 4PR5B 5JIHA 1DVXA 2KUTA 2J72A 3VX0A 3T08A 1C1EL 1LILA 1OAXL 1S78D 3PHOA 4EDWH 3K46A 4UQCA 1J8HE 3FTSA 2YD6A 3IDMA 3PPEA 2JKLA 1H15A 2FX7H 3FMGH 5EU5B 2F1AA 1MREL 1H3XA 2MRYA 2OMYA 3DUUA 1XF2B 4Y2NA 3K6FA 3E2HC 4OFPA 2XKNB 3VXUE 3GDBA 1WAAA 4GQ9L 4WW1A 2HLAB 3TVMD 2OJZL 3P9MA 3RVVC 3JXAA 4HIHA 5DJ6B 1UOVA 3KYOA 4GUPA 1G6RH 4TLSA 2CQVA 5CP7A 4FABH 2JKNA 3QZBA 4AGNA 1QRNB 1G1OA 3V4VB 4JPVH 3ZKMC 1N64H 5JIMA 4Z3HA 4KDWA 2J2ZA 4A2MA 3TA4D 5HD8C 4PAZA 3IPEA 1PG7L 1EBPA 1JZJA 1SGKA 2GJ6D 4OLWL 3WXVH 1A8ZA 1ILSA 1BPLB 1MELA 4RRPM 3HUJE 4YDLC 1PD1A 5C08B 4YGVB 1ZLWH 3HG0A 4UNVA 2BLFA 4MCZB 2OZ4L 2IDQA 3KXFD 3L54A 1OV8A 2OTUA 4ZZKA 1JF6A 1CGVA 1SOQA 2P80A 1XGRA 2F08A 3O4OB 2I69A 4NQCD 1WFUA 5IG7A 2PCPB 2Z4QB 5IVOA 2CHWA 2N1KA 3QXDA 5C0AE 4X4XA 4AGMA 3RGHA 1MF2H 1XD0A 3MFGB 4NO2A 3MYZA 5LQBL 4OCSH 2GBUA 3ARGB 5EV7A 2G4EA 6PCYA 2NLJB 1V05A 3EGDB 1KIRB 3LAFA 4TS6A 3BT2L 4Q2ZB 2QHLA 4YAQA 3O8XB 3DTDA 2OXGB 2Y2TA 4BWUA 1G94A 3U9PH 3OZ9L 1IVLA 1FZJA 2HX7A 3NIDB 3DTUB 4PP1D 5IJCC 1UD3A 4AT6A 4DGWC 3FHEA 4BD4A 4S0HA 1HE8A 3I9AA 3DJRA 2BCMA 1LL1A 1YY8B 3MQIA 4FDWA 4CNIA 2ARWA 2VL5B 2V7NB 3H9HA 5D93C 4PJIB 3P77A 1TTGA 1INEH 1DQVA 3SQBB 1WK0A 5E03A 1IGJB 1IEBB 1KPRB 2LU4A 3FQWA 3AU0A 2GTWB 2H2SD 3QNYA 4G59C 4M3KB 2DI7A 4Y4KB 4IIZA 3TA3B 1ZT1A 3V79C 2E86A 3A4DA 4RLDA 5C3LD 2ILLA 1TVBB 4LPUA 4UQEA 5DTFA 4A7SA 4CVZB 1CXEA 1LVEA 3SN6N 1X5YA 2VLRA 4OCNC 3U2IA 1O5PA 5CLYA 1R4XA 1U2CA 2BZ7A 2OJEB 1S9YA 5JORB 4FJ6A 3O9WD 4E42A 2FZ3A 5I17A 3GSVB 1ASOA 1E6OH 4JO3L 3NVQA 1E5CA 2B4CL 2R2BA 4XCEA 5IV2B 1UXWB 3RI5F 3AROA 1W72L 4PJ5A 4ZPTA 4BJLA 1CGYA 3IRPX 4L8DA 1SN2A 4FA8A 4HQQL 4PLNC 3DXAE 5C7XL 2H3NB 4ZOEA 1K9TA 4KPHH 5E4EB 2C26A 1Q0YL 4P2OC 1DEEA 1I9JH 3GXDA 2DN7A 1WD8A 2J71A 1CFSA 4XNUL 5FO7B 4Q58C 3UTTB 3WSQL 3MRHA 4GYBA 2VR8A 2JKIS 4EIGB 2ERJC 1F6FB 2IPTL 3FO0L 3VSTA 2AEOA 3U7YL 4N6RA 3V8OA 4YNYB 1MFAH 1SZNA 3QWOA 3ELAT 1Y0LA 4X6BA 1UGNA 2FO4B 5C09E 1EZSA 2UV3A 3FCTB 3LNHA 3DX6A 1ZK9A 1S7SA 4NQQA 1WVZA 1O75A 2OI9B 5KSVB 3IAPA 2HTLD 4JY4A 3AXIA 3HFML 4C4KT 1E4WH 1MCCA 2J1YA 2ZUUA 3FO2B 4V1DE 3UZQA 4PJ8C 4Z7WB 1D6EB 1JL8A 4FCHA 4YX2H 1T83C 1D5IL 1Q9KB 3ZQXA 4XNQB 3HVDA 4XO5A 3RKPA 4O4YL 3W11C 2VITB 3QUZA 1LK2B 4Z7VE 4JQXC 3FHQA 3OB8A 2HRHA 3QUYC 5F7HA 4PJCE 2UVFA 5IQ9A 1IIIA 1R17A 4Y4HA 4LQFH 2WVVB 1A1MA 5ESAB 4G1EB 4M6NH 4YDJB 5A40E 2UZPA 3ZTEA 5KBLA 3EJRA 5HDRA 3O6LL 4EI5D 4NO0A 4W9LC 1BLNA 1X9UA 3T6WA 1YYCA 5EUKB 3VFGL 2ZICA 1I53A 2ZIDA 5JLZB 5GJTL 1G0XA 1E4XH 3D2TA 4HOXA 1HEZB 2DQIL 2FX9H 3MGTA 4AH2A 4TUJA 4PD4K 1E9OA 1NM4A 3ATFA 1DANT 4PM1A 4JFZL 3AW5A 1L4IA 2QPFA 3UBHA 3JWDL 1VFBA 2XZQH 3LIZH 1ACZA 4PBVC 4Q9QH 2NNXA 2WVTA 3TT3H 1DUYA 3NACL 4JKKA 4LL9A 3HW7A 4N1CA 2OYPA 4MJHA 3KCPA 4A2EA 1HQ4B 3V5HB 1AGBB 1BAGA 2FIRT 4KQ4L 4NENB 1AZCA 1SEQH 2A9AA 2VN6A 4UQ3A 4ZAKB 5JIIA 1F11A 4AM0B 1E8YA 3ARED 4XI5D 1YEKH 2G5BA 1KJ2H 4J3OC 4OD2B 2DWSA 3T2PA 4ELMA 3NK4A 1FL5B 5FCSH 4J3WA 4N28A 5GGUA 2BNQB 2FEJA 1XVSA 2JJSA 3P0YL 4BGDA 4Z8FL 5T1KB 1DQML 1TZHB 2ORBL 4KMQA 1Z3GL 1WQVT 1VCAA 3TZVB 3QYMA 3IPBA 3WJJC 4EZKA 1OP9A 4GBXB 4UBDD 3VD3A 1QFWH 3JTSA 2YXVA 5C6PB 3CN0A 4OIIH 3ARXA 3QIWC 2Y3NA 1CIDA 2C8NA 5C2UB 3U79A 3MRLA 5I15H 4PJDA 4OQTH 1WRFA 5D7SH 5D7LA 3BSZA 1KGCE 3FT4A 5FA3B 1NDMA 2R1XA 3L5XH 3UYPB 4AVIA 1FUNA 3IF1A 3PQYD 3DVIA 1FI8C 3IGFA 5F9AC 4FG4A 2MNJB 4XAWH 2JMRA 4JFOA 2FE0A 1MPAH 5FCUH 2W5PA 1Q4NX 3TJHD 1ZRUA 1NKRA 4G2AA 5F1IA 5I6PA 1BD2A 2PTUA 2R0LL 3B7TA 2W59A 1HT6A 4MQSB 5HGDA 3FTYA 3BVNB 4ZMXA 1QFWM 3P3YA 4RIRA 4Y19A 4PWEA 2KLRA 2X4QB 2YMXH 3UERA 1I7ZA 3MXWL 3MXVH 4JFDB 1HOCA 4WU5B 4LBEB 1YQVH 1S46A 3RWIB 3EFOB 4ZUTB 3T6QC 4DGYL 3BZFA 5F7EH 2QPEB 1JZFA 1Q9LB 2UZYA 2NNRA 4GMSL 1YY9D 4NCC2 5E6YA 2HRLA 4NOFA 4J8QA 4YXLH 5DMIL 3FH5A 2XUWA 1Z9SA 1D6VH 1IBFA 4KRPB 3ULUF 1JWUA 5TH2A 2V2TB 5HDBB 4TLKA 3KPTA 4FQHB 5CWSB 4WDIB 3MJ9A 2XACC 1EIBA 5DO2D 5GQBA 1PIFA 4LU5L 5ADOL 3TCTA 2AVGA 4EOWL 5DYFA 3GIVB 1DCLA 3GJFH 3MJGX 5BRZE 5KSBE 5H8DA 5INDA 5D71H 4RGNE 3SGKA 3HN8A 2UUDH 4XWOC 5D2NA 2LR4A 2ICWI 3IMRA 2TSAA 3PWPB 3LH8A 3Q5YA 2XLLA 4G7YL 1PX8A 3AC0A 5D7IF 3ULUD 1YDPB 3LNIA 4L9LA 4P5RA 5CEZD 1WT5A 2CKNA 3BP5B 2GJZA 3WD5H 3FQUB 1IZKA 5I1JL 1MHEA 3K2UH 1E4XI 1OTSC 1Q72L 5IEKA 5EU3A 2XZCL 1ODUA 1HE7A 1O6SB 1UB5B 4NZUL 1CT8A 4JGNA 2LE9A 4I0PD 4KXZH 4AYFB 1CF8L 4OR1A 1EGJA 2GBVA 3NCYP 3P73A 4JDTL 2Q9OA 4KMTL 2R69H 1AO7D 2DQGH 1T04B 3BO8B 3FRPG 2GTQA 4RGMC 4B0MM 5F9WB 1XL6A 3RIFF 3FULA 3MRBA 3LSOB 2KPWA 1T1ZA 5IMLB 4MXVE 1CG9A 3NCWA 4NP9A 4KROB 3D3VD 3LKQB 1N7ML 3PABB 3U46B 1P0SE 3G5XB 4M93C 2OV0A 5J9PA 3N41F 3REVB 4ALAH 1NGPH 5EU5A 2EXWD 5EIVA 1XF2A 3QPKA 1XSIA 3IRZA 1P7QB 2DIEA 2XKNA 3SDYL 4A39A 4BZ1H 4XPAL 4HCFA 2Y6TE 5DJ6A 4TSAL 3GLDA 4ZFQA 3W39A 3NJGA 5E5MB 1F3JA 3PLYA 5FYLD 4JO1H 3GJEB 3WO4C 1QRNA 3WN6A 1QFWI 3Q6FB 5JIQA 3HAEG 3HMXL 3LN5B 2H4EA 3QDJB 5HXMA 5HGHB 1I7UB 5E2JA 4AYGA 2AZUA 1RJCA 1XAUA 5T1DH 5GGQL 1JBJA 5HD8D 1UENA 4YGVA 5C08A 3HHSA 2LAGB 4ZMYA 3KJ4B 4MCZA 4PGBB 5DD3L 5JOFA 2M2DA 5CJXC 1EANA 3DVNB 4CADB 4HKJB 1SY6H 1XAKA 1RUPH 3K1DA 1A6VL 5B22A 4XNZB 5DHEA 1KWGA 1PEZA 4G3YH 2PCPA 2Z4QA 2ICEA 3CHOA 4P57B 1E2ZA 4PHZA 1SM3H 4KX9A 1M9SA 3QZNA 3M17A 5FHBL 3WKQA 1W2KT 4KZDL 3ARGA 3VXUB 2NLJA 4EUPH 3EGDA 1JDDA 3FSWA 4O5LH 1R3LB 4KAQH 2BHUA 4KVCL 4Q2ZA 4LP4A 4BCZA 3O6FD 3N0AA 3O8XA 3HN5A 1I8MA 2IADB 1ETZB 4B7IA 2BJMH 4AGPA 1Y6NR 2UVEA 3QQDB 4KXBA 4RX4D 1MFDL 3QFJA 2E9GA 2DWYA 4XOBA 4Q7DA 4HIXL 4XP5H 3AAZB 2A74C 3CSFA 3F3HA 2IG2L 2X6CA 1XF4B 5ADPL 4RFOL 5J7CC 1HH6B 2G2RA 3GSNL 3HUJB 4OZFH 4PJIA 2R0WH 4E36A 3SQBA 1IEBA 1HOEA 4BDVB 3ATDA 4ZDHB 2X6BA 3JZYA 3KR3L 3OAUL 4G6ML 4Y4KA 4XNAA 1EHXA 4UUJB 4X7EC 4M43H 2AJSH 1B88A 1TVBA 1TJGL 3MACH 4CVZA 5C0AB 1QQDB 2QVFB 4G1MB 5I6NA 4ZTOL 1SMOA 2DEYX 3F7PC 1DQTA 5CHNB 4K8RL 4OCWL 3V6ZA 5JORA 3SDCB 1KLUA 3FB6B 2WXQA 3GSVA 4LHUD 5CFHA 3JQOB 4G6JH 3U9UB 2COQA 1UXWA 3PNWB 4HWZB 5IHUH 2BHYA 1JF5A 1PZ5A 2DEWX 3RWCA 3MRQA 2WCSA 4G8IB 3BJ91 3K4AA 3VI4A 2EILB 1M1XB 1OPGL 5CGTA 3A0OA 1E90A 1N10A 5D70L 1JYWA 5FO7A 4QRSA 4HPOL 4P2OD 3BDYH 4JR9L 4G5ZL 2D7NA 5GRJH 4MMZB 4HFUL 4O2FB 2PCYA 3ASOB 4YNYA 2CBTA 4YBLB 5IHHA 1IUZA 2W38A 3WNNA 4LSPH 2FO4A 2R7EB 3QS3A 3FCTA 1L6ZA 4PBDA 2HFFB 2KT6A 4N26A 3IJ9A 4AC2A 3QEQD 4ZO9A 3WG7B 3US1A 3QR1A 1A14L 1D6EA 2EDEA 3QZLA 5EOQH 4H1LB 1OSEA 3BVVA 1J48A 3TO2A 1G9ML 3DK0A 4ZX5A 4XNQA 5A6MA 2MHAA 1IE5A 3MJ6A 2WZ0A 4PJ8D 5CBEB 1M7XA 3BUQA 4K71C 2AAVA 3K8MA 3EBHA 2VITA 1OKEA 3PRZA 3U1SL 1U8OB 3IM1A 3BWSA 1LK2A 4HAKA 3DYOA 4NKOA 3VDAA 2EIKB 2FATL 3DXAB 4MHHG 2YUVA 4WTXA 5D1ZC 3FS9A 2QSCH 3W11D 2KMWA 3HE7C 3H3KA 4DP9X 2CBPA 2VISB 2WVVA 3WEAA 4QRRA 3GDCA 2Q87A 5ESAA 4NBZB 4G1EA 4XODA 5E5UB 5C2BH 2HT2D 3T0EC 3BVXA 4OT1H 4Y4FA 5DQDL 5I0VA 3IS0X 3L2LA 4B7LA 1MLCB 5I66B 5KVGL 2E6PA 3CUPB 3N50A 4JM2B 1F41A 4FFZL 3RX8A 5HDWA 5C09B 2VZ3A 5EUKA 2FYVA 2CO2A 5DA0B 1ZVNA 3T0VA 3QDGE 3LX9A 1HEZA 4IGBB 1RZGB 4FZ8H 5CLTA 2VZSA 4I9WD 2AJVL 3QXTA 5SWSE 5C0DA 1JI2A 1MFEL 3KW8A 1E50A 3E6HA 3LZQA 1BVOA 2IOMA 1SN5A 5I1IL 3F6IA 1P9MA 2CKBH 3WXWH 2DBLH 3UJJL 4Z7VB 2G60H 4QJ5B 4L4VD 3HG1A 4PJCB 5HI4C 1FBIH 4UQDA 1HQ4A 4XXWC 3V5HA 1H0DA 4BUHA 1C16B 2DV6A 2EC9U 5A16B 4NENA 4IKNA 5DK2B 1JGLL 4RSYA 4ZAKA 2X12A 4GI8A 2X2JA 4XH2B 3TONA 3AXHA 3MRMB 4AM0A 3QEUB 4F24A 1U8HA 3BAIA 3FFOA 4OD2A 2A77L 4K7PY 4WU7B 5BV7C 2GJRA 1FL5A 3OHXB 1C12A 1D2PA 2VDOB 3NCJH 4PJ9C 4WUKH 4WGKA 2BNQA 4J3OD 4P3CL 5HJDA 3VWJB 3DOHA 1QVOB 4OLXH 5T1KA 4P4RA 1TZHA 4LSSH 4NP4L 1Z5LB 4Z7OE 5I1KH 5F7NC 3P4OB 3TZVA 1WFTA 1LO5B 1BJ1H 1NPJA 1V55B 2DJMA 2YKKA 4GBXA 2CIKB 5FGBA 4K3GA 1X7TA 4ONGH 3KPMA 3EDKA 4FP8L 1T1WA 1F90L 4GI6A 1CGWA 2BX5A 1P7KB 5FB8B 1MJ7H 2JJTC 4WIQA 3T6ZA 1F02I 3QIWD 4HDIB 2AXJA 4JDEB 4WK0B 1HXYA 1QSED 1IKNA 3N1FC 1ET5A 3AGWA 1FORL 4F1SA 3WELA 1ZE3H 2AJXH 4NKDA 4P46A 2ATKB 3ZR6A 2IBZY 1L0QA 1JNNL 2OK0L 4FXGB 1UVQA 5HYQB 1MAKA 2G9KA 4UNIA 4IRZA 2R2HB 2FUTA 3I6LD 4P5KB 5KUKA 4GAJH 4U6YB 1EQWA 1QW8A 2JJVA 2MFNA 2LQRA 4DKEL 1MFBH 1BQLH 3GXMA 3OKNB 4PCSA 3VSQA 1RSYA 1KBGH 3JVGA 3L3OB 4JFDA 4JHWH 3MN8A 4UM9A 3RWIA 4AMWA 4PV9B 1YEHL 4ZUTA 4BKLB 4Z7UE 4Z3TA 3LIUA 3Q9QA 1F6AB 2RH0A 3RHWK 3RUGF 1IKFL 4K7PX 4YXHH 4ZMOA 3MSPA 4IOSD 4J6RH 1NL0L 3R18A 1FZKA 2EYRB 4YL9A 1JK8B 5HTSA 3MV9B 4CA4A 4R5VA 4X9YA 3DVGB 2CRMA 4L3EE 1H3VA 4NLHA 2D7TL 5FUCC 5CJ8A 2W0PA 4PWIA 3DK2A 4WDIA 1AAJA 2MOQA 2W9DL 4FXKB 5CBAB 3WL9A 3D2UD 4ZFZB 1GAFH 2QDVA 3RJQB 3CX5J 3GLEA 3LZLA 4OU3A 1NFDA 1XGQB 4JQIH 3X1FA 3FSVA 3GIVA 4P8QA 1RXLA 5I19H 1SXZA 4ZXBC 3DBXB 3CK0L 2VAJA 4C56D 4OI8A 3EHBC 4GW4B 1IEHA 5T3ZD 2ZKWA 3MJ7A 5IVXA 1WZKA 1ZANH 4DO5A 4YQXL 3HRPA 4MXQD 3VRLE 1GSKA 1TU2B 3BHBB 4JFFE 6FABH 5HYSB 2IBZX 1NMCB 3PP4L 2EKSB 1YDPA 4ZD3L 3BQUB 1RZJL 3BP5A 3FQUA 5EO9B 3LXAA 3PL6C 5EZPA 5ACZB 3MLYH 3BLKA 5E4OA 1O6SA 1NCHA 1UB5A 3CBKB 2DKMA 4H25B 3DIDA 3E6FB 3WEXB 1AD9A 4ADJA 1HHGB 3ZZQA 1CL7H 1L7TL 1RK1B 3OKMB 3RWEB 3D4CA 3O81A 3EFDL 4I3RH 3BO8A 1T04A 2J21A 4L3AA 4LEXH 5HHXH 4R8WH 3F5WB 3DJ9A 1GZHC 3SDDC 3MUUA 4X7SL 2VAAA 2CXKA 3H3BC 3LSOA 5DEFB 3U36A 5IMMA 5IMLA 1U91B 4UDUB 3LKQA 5DWPA 5EZOL 1BHGA 4EAEA 3U46A 5GRUH 4G70B 4CC0A 2A1WL 3IN2A 1FO0L 4MS6A 1P6AB 1KY7A 4DUVA 3REVA 3FU3A 1U8QB 3RZCD 2GVYA 3T09A 3RTQD 4U0RC 5C07D 5GGRY 1JGEB 1S8DB 3L4UA 3FYIB 1IM9B 2WSPA 5FYJU 3SBWC 4ERSL 1NMAL 3G6JF 4YFLI 5HGBA 2E59A 3EKCA 2Y1YA 3OMNB 5SWZE 3D0VB 3QC5X 2ICWB 1KJMA 2VLKE 2UZIH 5KW9L 1AYRA 3GJEA 1NAMH 1HZHH 1TQBB 4RMBA 5ELIA 1OAQH 3MX0B 3Q6FA 4U31A 5KYNA 3LN5A 3ML8A 1F13A 3QDJA 1PEWA 3H53A 4N90E 5HGHA 1KIPA 1I7UA 4ILDA 3RP1A 3BZEA 2ZP8A 1W15A 5AB1A 5FGRA 2VSDA 3Q3GB 1LXMA 5ILTH 3CU1A 4M7KH 4Q6IC 4QTHB 1MLBB 5GIRB 4M4PA 4PGBA 2X1QA 2X1WL 4MMXC 5BV7H 4CADA 4HKJA 2K70A 2JJUA 1W80A 1K6QL 3M8OL 4NOBA 5JHDD 2J5WA 3BH8B 5GRZA 1BJMA 3O2VH 1J8HA 4FYRA 5HVGB 4P57A 4OFYD 4GKZB 3KWVA 2YD8A 1PLBA 3BKYL 5EG6C 1U8CB 4QXUH 3VXUA 3A6BH 1A9BB 4C4BA 4Q4IA 4W9EC 3IEAA 3EO0B 3WE6B 3VXRE 1KB5L 2IADA 1WISA 1PBYA 5D96C 3VI3F 1NC2B 3BKMH 5DFVC 1KJ2B 1SPDA 1RK0B 3GMLB 5EU6E 2MSPA 4I7ZC 5HI3C 2NMSA 3JTTB 3HTLX 2VR6A 4OM1H 3IFPB 4B27A 3AAZA 3POCA 3ILEA 5LXGH 1XF4A 1HH6A 1JWSB 3HUJA 4IYKA 4G80B 4IU3A 1BQHB 4C58B 1A4AA 4AGOA 1RY7B 4X83A 1IBGH 4BDVA 2YKLL 4OD1L 1I7TB 1KELL 2XZAH 4ZDHA 4U0QB 4LMQE 4EN3A 2XBZA 4OF8A 4UUJA 1GGYA 4WRLA 1M2VB 1QWNA 2ZXQA 4ZMLA 2J25A 3VD5A 1NBVH 1JPTL 1RIVH 1XCWA 3UGXA 1U93A 1QQDA 5C0AA 2XIBA 4G1MA 5JZ7D 1KCUL 5CHNA 1T6BX 2DQDL 5F7MC 1KXVC 2E46A 1QBMH 5TK4A 4ABQA 2WCPA 3SDCA 2I07B 2YD0A 4NZ8A 2Z9TA 4U1KB 4XGZA 3GEFA 3PJNA 4HWZA 2EDRA 2JKJA 4M5YL 5D7HA 1MCNA 1MSPA 2Z92A 4QNPF 3KDPB 2QKIB 1ZJAA 2X0UA 4G8IA 3X3FH 2D2OA 5CCJA 3NZHH 1M1XA 2YRLA 2CMRL 3HZVA 4LAJH 4M4RA 1LE9A 4F5CE 5DWUH 5BVJB 5C92A 3QIBD 5E9NA 2EDYA 1H3TA 3MNWB 4MJ6B 5AD0B 4JE0A 5EC1B 1CL7I 2F8VA 3S37L 5JUEH 1T5WA 4QRBA 2R7EA 4NRXB 5JIKA 3K81A 4JG0L 2HFFA 2DMCA 1KEGL 3W2DL 1R24B 1NDGB 3RKDC 1OAZL 3O6KL 2IDCA 3DMMC 4Z7NF 4H1LA 3VG9B 3ARBC 2N7SA 3LDBC 2P52A 2OMBA 4TM9A 1A6UL 2MKWA 2VQUA 4FQXB 5CBEA 3L6FA 3FH7A 4PJ6A 3I85A 5TE6L 4MBRA 4J3BA 3K71B 1U8OA 3GJFB 4UILL 3DXAA 3QJXA 2QQNH 3DUSB 3C6LD 4B0MB 2VISA 5A7BA 1LJMA 4MA8L 4DEWA 3TWCH 5D1ZD 4K3EL 3V4PL 4P5TB 1I3GL 4X5RA 5BZWA 3P2BA 4GRWH 4QXGL 3TT1L 4LCIL 1MNNA 1MLCA 3LKRB 5I66A 1MCDA 3T0ED 5I5MA 3QUKB 2YBGA 1BZOA 1DJGA 1ROWA 1HNYA 1S9VB 3CUPA 1CI3M 4JM2A 1VGEH 4P9ML 5B39G 4DW2L 5IJBC 2EVFA 5C09A 3VXNB 2R23A 4N2BA 4QAMB 5DJZB 2R8SH 1WFJA 2X1PA 1OSPL 2CGRL 4HJTA 4A04A 3ZHNA 1L9OA 4JANB 1DUZB 2DMKA 5ALCL 4V1DA 4D2NA 3ULVL 1BBJA 2G2NA 1CIUA 1SQ2N 1UZ8B 3BRFA 3VXSE 4QJ3B 4KUCF 1UT1A 3TCLA 4JJ5B 5T33H 5FGCE 4JRYE 1O5DT 1B0RB 2XPZA 4PJ7B 5KS9E 4XP9L 1CBJA 4Z7VA 2V3EA 2Q7NA 3KJ6H 4PJCA 4RRPA 4NS0A 1BIIB 4Y5VB 4IDJL 4TV3A 5EZIH 4M1DL 3CBJB 1C16A 1QACA 4KUZH 1IGML 3OBAA 3DBSA 5GGVY 5A16A 1XH2A 3DOIA 5HI4D 3PGCB 4XH2A 1U3JA 4XVSH 3MRMA 5D4QA 2Z91A 2P43B 3ECVA 4ADGA 2W88A 3L9YA 3P9WB 3QEUA 1C5CL 3ZDXF 4WU7A 3HLAB 7FABH 2EIJB 3SQRA 1E3XA 1REIA 3QNXB 3SKNB 3T65B 3IWUA 2DQJH 3CTTA 3I2CL 4KUCD 5K9JH 1QTPA 2NY4C 4QRQA 2I5YL 5CKGA 1Z5LA 4LAQH 4OZGE 1T2QL 2J55A 3P4OA 4PJ9D 4TVSa 5DVLA 3MFFB 3QDGB 4AG4H 1LO5A 1NBCA 2EH7H 3U0WL 1CTOA 1TO5A 2CIKA 1F4XH 3SB3A 1A5FH 5SWSB 3NN8B 3MGOB 2E27L 4XCFL 1XIWB 2YPVL 3WS6C 2ZPKL 4FE9A 2FJHA 2TAAA 4BH7A 5A1AA 4HDIA 4JDEA 3NA4A 3RTLA 5I8KL 4JN2B 2IAMA 2JCCF 3IB4A 4NRYB 1J9CT 1BF2A 4FQ1L 3SD5A 3F00A 5IFJA 2YSTA 5F9OL 2ATKA 4F7KA 3LN4B 2VDQL 1X44A 1EMTL 2ZOWA 2X4TB 2IMNA 3T2NH 2YC1B 4EUPB 1WWCA 3IGAB 4LCWE 3PGFH 4LSRH 2R2HA 3DX1A 4P5KA 2UXFA 4NJ9L 4RVBA 3DROA 4U6YA 4UV4L 4XAKD 1F1DA 1FNSL 5TPWH 1NEZG 3CSYB 1JV2B 5BRQA 3BPLB 3S3JA 1VPOH 3L3OA 4Z7OB 2OTWB 1MDAA 1NC4B 3OZKA 4E9LA 1FHGA 1HCYA 4PV9A 1UZ6E 3Q43A 4BKLA 2YUZA 4KC3B 2CLRA 4Y5YB 3FOMB 3EDDA 1MCKA 5JO5B 1UOLA 5CD3B 4YR6B 4K3DH 4WO4B 1FG2B 2MTPA 2NY5H 2QFPA 3GSNA 4LIQH 2B5IB 4MAUL 5D1QE 1BVLB 5E4AA 2EYRA 1JK8A 2CDFB 2WBJC 4KTDL 2GK2A 2VW4A 3DVGA 4ESKA 1J1OH 3VWKA 1LTXA 4GIPD 5CBAA 4FXKA 4R0LB 5H37G 3KWTA 4ZFZA 3TM6A 1NUFA 5HP5A 3D06A 3ME0A 3IMVA 1XGQA 3VA6A 2APXA 4LT7A 5HYJD 4OJEH 1R34A 3DBXA 3SGJA 1AGDB 3CHQA 1M71B 3BXNA 1NCWL 4GW4A 5I1CL 1UXLA 1XMEB 4K23H 4NZRL 5AVTB 3BCDA 3B83A 3JWOL 4ZXBD 2X3BA 1P4IL 1Q38A 2D7PA 2EDOA 3OL2A 3EHBD 2OMUA 3CU7A 3QCTH 4FXTA 1GYWA 2DM3A 4U1JB 1QHQA 1TU2A 2A5UA 4IHBA 3FU7B 3NK3A 4XO8A 3QG7H 5HYSA 2YSSB 3SE8H 4ACTA 3AGVA 2FX8H 2EKSA 3R06B 3BQUA 1CTMA 4JZJA 4Z7UB 1S7UA 4RMWA 4GRWE 1MDTA 4OIBA 4CAGA 3LZRA 5EO9A 2IOIA 3ZHKA 1OF2B 1GC1C 1KEMH 3IDYB 5ACZA 5EUOF 3BRDA 2WZPA 1QPKA 2YGNA 3E6FA 3KYNB 3WEXA 5JQIB 4E68A 1KF9B 1HHGA 3PL6D 1RK1A 1QOKA 2ICWJ 3DX7B 3RWEA 4ODVH 1YNTB 4L3EB 1TJIH 4U2YA 4H26B 3FU8A 3F5WA 3LB6C 5FHAL 3UG4A 4WV1C 4IMKA 4KI5C 3X12B 5DEFA 4QT5A 3ZUCA 4GMTL 3PV7A 2PNDA 1U91A 2B08A 4UDUA 5FC9A 2YZ8A 4N2IA 5BRZA 5KSBA 2XN0A 5HVFB 3WEOA 4DK5A 3BESR 1LP9F 2GYSA 1WH0A 2WBKA 4AQ1A 1U8QA 3OKDA 5F7LB 1FZMB 1PSKL 1NCDH 3HPJB 3HZKA 4RFNC 4JFFB 4X80L 5GRVL 4AYEC 5L8JB 3PWNB 1JGEA 1DHKA 1Q0XL 1S8DA 3I3DA 1U58B 2O6DA 4K7PH 4QXVA 3QA3B 2X4OA 4JZOB 4YSUA 3PNRB 1ZVYA 3D0VA 5D72L 2NY7H 3ZMEA 4NQDD 1G9NL 1A7NH 3CSTA 4YSDA 2XC8A 2WLZA 4BH8B 3PP3H 3MX0A 2F7QA 2I26N 5JHLL 4ZMNA 1PCXA 3PXJA 5FA4B 2KERA 1KN4L 4HWBL 3ZW3A 4JQVC 1X5XA 1BQ5A 4MASA 3Q3GA 4LRNL 4YDNA 4IBLT 4TVPL 3TYGL 5A2LH 1EV2E 1DZBA 1BZ8A 4BXVA 1S6NA 4NFDA 3B2DC 3FBKA 2YK1L 1WCQA 4YFEA 5CF3A 1OSYA 1VIWA 5B7FA 1PZUB 1ZSDA 1BCIA 3L4WA 1B2WH 1Y18B 1U8IB 4CKQA 2B16A 4I3SL 2IV8A 1PDKB 2HKFH 3VNZA 4RH4A 4PB0L 3NUKA 1KV7A 3FQXA 4OBRA 3CVCA 3ECWA 4GKZA 2VR3A 4YHNA 5B1AB 4I8DA 2GQHA 2YR3A 1IC7L 1SMAA 2BNUA 2W95A 4NNXA 4Q9RL 2NZ9C 2VDNH 3SZ6A 1OCOB 3DHUA 3HZMB 1A9BA 1JNLL 4N2KA 3VJ6B 3WE6A 3EO0A 1EAPB 1JXKA 2GJ6E 4ZPVB 5SWZB 1NC2A 3GMLA 1RK0A 5AZ2L 2WVSA 5IBLC 2VLKB 2DJUA 2CM5A 5DQJB 3JTTA 2AABH 4MJ5B 3KXFE 4X9IA 3IFPA 1OK8A 1WFMA 1JGUL 3C08L 3T8XB 3VVVA 5D8JH 1JWMB 5F7KC 3WNPA 3HNSH 3K6IA 1JWSA 4XMLH 2EYTB 2Z31C 2FDBP 3QWRA 4NQCE 2PWEA 2OCCB 1BQHA 3ZN6A 5SX5H 2VE6B 2GC7C 2A73B 4W6YB 2ZQKA 4HALA 4NQVB 1BFVL 5DUML 4PS7A 4C83B 2Y72A 3W82A 2YXFA 1YECL 3GS4A 4LVEA 4XN8A 1KLGB 5I2IB 4I85A 3OG4B 4UV7H 4UTAL 3RNKA 3V6OC 1TETH 2X89A 5JW3L 2VSMB 1MI5B 1SN0A 3BISA 3H54A 3ZMRA 2I9TB 4ZBJA 2I07A 4GO6B 1R5VB 1N12A 1NLDL 1H3UA 3VXRB 5DI8B 1KENL 3P4LA 3VUAA 3QDMD 3MRGB 3ZZ1A 1MJUL 2O5YH 1RZPA 3RDTC 3U30C 1JYNA 1RH8A 2E6QA 1HEHC 1KIUB 1SJVA 3V7MA 2ZUXA 2R4RH 1AIFB 5BVJA 2BXYA 1VENA 4HG4J 2ZCLL 1J0IA 1I9IL 3HAEH 5AD0A 2AKRB 2FGZA 5EC1A 3MLVL 5LGHL 4MXWL 1F4WL 2XU9A 3TOPA 3IMTA 1RUKL 3NQIA 3T0WA 4Z3EA 1YN7B 3IAGC 4PRDB 2ISDA 1NDGA 4R2GB 4K0OA 3H9SD 1JDAA 1U8NB 3RKDD 1BVZA 5BXFB 5E1AB 1UEMA 4BQ6A 3VSUA 1P5UB 3ARBD 5LCVL 1CGXA 3X1GA 1U8PB 1EJOL 4U1GC 1CYGA 4KO7A 1A3ZA 4LPTA 1ZD6A 1MHPL 3KM1A 2ZWKA 3AXLA 3ARWA 4IBZA 2B0SH 4EBQH 2QSQA 3LJ3A 4ODTL 2YO3A 2C34A 3EYSL 1S9WA 5AKRA 4A6YL 4M7LH 4G6FD 1RIHH 4R4FL 1FLRH 2XFXB 4FJZA 3QJSB 3LS5L 1S5IL 2X4UB 2PWDA 4MB5A 5GZNA 3SO3C 2F58H 3IJHB 4P06A 2W9EL 4KQ3L 3LKRA 2YOAA 3QUKA 4B6ZA 5HSFA 3QZOA 3VMOA 4NHCL 1L9NA 2RQ8A 3WNLA 2LTQC 1CXLA 3VXNA 2ZUWA 1JHTB 2A9ML 2WYZA 2QV4A 3B5TA 4O9HH 4JANA 1RP9A 1URIA 5DU7A 5I1HL 3US0A 2ZKHL 1DQDL 3LS4L 4JLRB 1YJDH 4HXBH 3U0PB 2VDKL 4OCYH 1ASPA 2VR4A 4JJ5A 5FM5M 1B0RA 5AW8B 4HUNB 2R56H 4CC4A 2P8PB 3ULUH 3KDMB 4JG1H 4N2GA 4A1RA 5AZEL 2AXFB 1IAKA 4Y5VA 5EFIA 2OW6A 4YBQD 4JS7A 1GOGA 2QVMA 3VMPA 1AZVA 3ETBF 1HAUA 1AGCB 1ZPUA 4PQXA 2Q86A 3PGCA 4DP0X 3CFDB 4WSKA 1HVXA 2VQ1B 4BHUI 1DBML 2KDYA 4N2HA 3RBSA 1CFQA 3VCLB 4W9KC 3GK8L 2EO9A 2MNUA 4H2AA 3RVUD 3HLAA 3LVTA 2PO6C 3FU6A 3QNXA 4Y1AB 3SKNA 1WD9A 3ZE2F 4OLYL 4Z9KB 1OCWL 3VFPB 1NAMB 4UAOB 5FOJA 3EOAB 4P23B 3QDGA 3CC1A 5DK0B 4ZX3A 1ID5I 4FERA 3WJMB 1KCVH 3MRJA 5SWSA 3NN8A 4S1QH 5FX3A 1IGFL 2P8MB 1H6EA 2H0JA 3MGOA 5AENA 2N0KA 4S2SB 1ODAA 1XIWA 4B9IA 4N0RA 3J7HA 1M7IB 5FGCB 4L18A 4EXPX 2F2HA 1F4YL 2WC7A 1R3KB 3L5HA 5LUMA 4NRYA 3UYRH 2IWKA 2BFVH 3NEOA 4D0DB 2L04A 2UX6A 5AQ0A 2WM0A 3UH8A 3L7FA 4WW2F 2OPCA 1PZBA 2VZOA 3ECUA 3LN4A 1FNEB 3TF7C 3GO1H 4GINA 5KVDE 3WAKA 3V4LA 2X4TA 4U6XA 5LG6A 2YC1A 2DQCL 3B9KC 4YHLL 2L7UA 4HC1L 4MQXC 5C6WH 2V8LA 2ZE0A 3HG3A 4H88L 3LQZB 3WCYA 1ZLUH 5F0MB 2X05A 1T1YA 2JIXB 2L7JA 4YSPA 4GUQA 4GIAA 2JNZA 3CSYA 1JV2A 5KSAD 2IMMA 2BRRL 2GITB 2Z7YA 4HOZA 2X2HA 3RPIB 3RFZC 1KB5A 4FNPA 4OZGB 1G7MB 2OTWA 4N4YB 1UKTA 2W0LA 4P05A 1XF1A 5CJOL 1LNUB 4UMSA 3E8UH 4HF5L 5FKAB 3WO3B 5JHBA 1IAOB 3PQYE 4X8JA 3W57A 5JO5A 3UZVA 5IMKA 2C9VA 1A6WH 2H6OA 6TAAA 4YR6A 3G5VB 4O00A 2VXSL 1QSVA 2I24N 4WO4A 1FG2A 5KVMC 2B1HL 3MBEC 5T1MB 4K9EH 2NXZC 4PI0A 3MV8D 3BPNC 3GD1C 3UTZB 2CDFA 2K4AA 1GMIA 1GW0A 1PYWB 1KV3A 4MD4A 1NCUA 3QZPA 4XMTA 2WBJD 4R0LA 5DT1L 3CPLB 3RWJB 2XVKA 1KCWA 4C4KO 4F2EA 4GQZA 1RERA 4PJFF 4FX5A 1DO5A 3ARPA 4F91B 4N2OA 4NPJA 2MMXA 3DDFA 1MCEA 2TRHA 4LCWB 1HS6A 3AG2B 1EZUA 2VNCA 5I5RA 3FUJA 4YXKH 3U2SA 1SUHA 5DRXA 5DD5H 2YEQA 4NGHL 5FM4A 1I1AA 3UTPD 2F5BL 5T1JA 4B41A 2KZBA 4FNLL 2GEEA 3FU7A 2CJUL 2ZCKH 3KPLA 3UCQA 3D0AA 2YSSA 5DXWA 3R06A 2A9NH 3HB3D 1XFPA 3HNTL 4Q9BA 3W37A 3V9CA 3KE0A 4N1HB 2ITDA 5DVNA 2QMJA 1OF2A 3ILPB 4YE4L 1ERNA 3MUHL 4Z0BL 5E1QA 3U7AA 2K6WA 1KGIA 2WXPA 5D1QB 1DFBL 1G0YR 3JWNG 4P2AA 5FLUA 1QX1A 2BSBA 3DX7A 5LGKA 1WTLA 1EEUA 1YNTA 4L3EA 2OFQA 1NAKL 4S1RL 1UWFA 2OP4H 3FQNB 2H0FA 1UFGA 4NKMB 4ONHB 3X12A 5ES4B 5GS0L 1P6WA 2ZCHH 3SKJH 4CC1A 3ULUE 1CD1B 3LEYH 3MA9L 1RUAH 3H9ZA 4UM8B 2WWOA 5CEZE 4IIQC 1G7PA 2BH0A 5EU4B 4L1DA 2V2WA 1XCXA 5FYKL 4FQ2H 2X10A 5IB1B 3QRGH 4YDKL 1KTCA 3WY1A 2X6VA 3PWNA 5D7JD 4JFED 1U58A 3QFJD 2J7LA 3KPPA 3NFSH 4JZOA 1INQB 1U3HC 3G9AB 4GRWB 1PY9A 5I1EL 1AO7E 3MCLH 1UCTA 5EEXA 2BRQA 4QXTB 1KXQE 3V4PA 2VJ0A 1HWGB 3NA9L 5D55A 5E1IA 2QVIA 5I75B 4J3SA 2JV6A 5GJSH 4NRZA 1J10A 1A4JB 3U1PA 4UDTB 5FA4A 3VI4F 4Y2DB 1YNKH 4QHPA 3R1GL 3D3VE 3FCGA 1GYAA 2D2CC 5DJXB 3TBSB 5D7IE 1U4FA 4H0GA 3VVWA 1GW6A 2AK1L 1NANH 5F89B 3D18A 1KYOJ 4TYUA 2VO8A 4TOYL 2OCFD 2V9RA 2H5UA 5MEQB 3FT3B 3A22A 2ETWA 1Y18A 3F6LA 4KRMB 2VKXA 4HS8H 1PDKA 3QJOA 3RVWD 5MI0C 4X99B 5JIDA 1QRKA 1LDSA 2DIBA 4X5XB 5I73B 1GL4B 5FYLE 4E0RA 4RMUA 1YMMB 1CDBA 1OF0A 3V4UH 1UFUA 3MRNB 3PV6B 2WQWA 3HZMA 5C0BD 3VJ6A 3D39D 3DECA 5CIPH 3CHXA 3AY4A 3CCHB 3L17A 4ZPVA 5SWZA 4FTVD 2NZ9D 5DD1L 4M8QB 4AL8L 4K2UL 3PE9A 2VLKA 2NOYA 3L8QA 2B8OT 4AE0A 2CZNA 4MJ5A 4EZLA 3GBNH 4KY1H 1G6RL 2FR4B 3OJ2C 3RURA 5C0FB 1JWMA 3VGBA 4FABL 5I74C 5I0ZA 4V2CB 4JZNA 2EYTA 4JPVL 3QQ9D 1FL3B 4LZKA 1N64L 2H41A 2Y9RT 1E4HA 4RZCA 2VE6A 3TPUB 1OIOA 4BK5A 2Z31D 2A73A 3WXVL 4DO4A 5ISZD 2KLTA 3NZUA 4PTTB 3TVMB 2DLTA 2YGQA 4DTGH 2YWZA 2YPVA 3LQAC 2X4RB 4XVJH 1KLGA 1E28B 3G5ZB 4OF5A 1K8DB 3Q2VA 3QJQB 3D1MC 2I9TA 1L6PA 1XH1A 5E8EB 4BKTC 5EF1A 3MBWA 4IBVA 1MRFL 5JPMA 5I8EB 4QRRD 2PXYB 3VXRA 1DQLH 1MF2L 1CFVH 2XOTA 5DI8A 2I27N 4GAYB 5EU6A 4P2QA 3MRGA 4LL4A 3ARFA 4Y4FD 3VE0B 2PN5A 3CVIH 3U2JA 1G4MA 4Y1SA 2CXGA 4P3DA 5BPPA 1TYJA 3KXFB 5I82A 2WUCL 3IJEB 3U9PL 3HE6C 1KIUA 2EABA 3RDTD 1AIFA 2K0RA 3JUYA 2P1YA 2DQTH 1PKOA 2E9WA 1QI5A 4NQCB 1Q9OB 4HLJA 1HI6B 3GRWL 3B8SA 1DQJB 4Z5RB 2BSSA 3S35X 4IEFB 3OKYA 2Y2WA 3OSKA 5BS0A 3QO0B 3UAAA 3LXBA 4PRDA 5IESL 5J12B 1CE1L 3GI8L 1U8NA 2Y24A 2BWQA 1TJMA 5BXFA 2WKGA 1E27A 5E1AA 2WW8A 1OAUL 3HG1D 3SODB 4FEMA 3QNZB 2HYMA 5T3XL 2A38A 1FGVL 3WFZA 3M88A 4H8PA 1FFNB 4MBOA 5E7BA 4I0CC 1EX0A 1KPUB 1E6OL 1ES0B 4M56A 4KU1A 2GKIA 3X1BA 4F5CA 3BH9B 2R0ZH 2XFXA 5E99H 1A4KB 1U8KB 4Y9CA 3N85L 2X4UA 5HHOD 3IJHA 1IT9H 1UHVA 3QEQE 3N1PC 1KBWA 2B20A 1I9JL 4NAQA 2IAND 2PLTA 3H85A 2PKDA 4IS6B 3TEYA 1I8LC 5CN2A 1ZMYA 3IMUA 5E8DH 1X5KA 1SVZA 2GHWB 1N6VA 3O9WB 1NANI 4QTIH 3QIUC 4GIOA 4X6FB 2X4PB 3AZUA 2CHDA 3PXHA 1ULVA 1XGYH 3MODL 1X9QA 3EH2A 4JLRA 4LF3A 1DJZA 3EADA 4MQTB 5T3ZH 3GXTA 3VX1A 3ZR5A 2H2PC 4APQC 5GZOC 1RMFL 3VM7A 3U0PA 3HZYB 1GZQA 2Z7ZA 4F37K 1T0MB 2VLME 1GHFH 2PR9A 1E4WL 4P9HH 1H6TA 1GMEA 2EH8L 4XN2A 5A7EA 3KDMA 4ZUUB 4YX2L 3RJDA 1R0AH 1Z9MA 3UAEA 4BZ2H 2YBRB 3TN0B 4J7RA 4BFIB 1A2YB 1S7RA 3MLZH 1KLFB 4LCCC 5G55A 1AGCA 4DAGH 1FSKC 4NIYE 3LKOB 2OSXA 3FO9B 4G9DB 2VQ1A 3QI9A 4KFZC 3P69A 3HS0B 1GGCL 1LWRA 4XNXL 3QWQB 1B9ZA 1QHPA 1RJYB 2W07A 3FK3A 1CDIA 1NFDF 3DURB 4HZLA 4F7MB 2EEXA 5FFLA 1E43A 4I9WE 5DMGC 3PWJB 3CZSA 4M6NL 1N5YH 5F96H 2W91A 3MKKA 4PJGF 5DFAA 3AADB 3WNJA 2O5XL 1DJWA 1NAMA 4XMXA 3VFPA 3AVEA 3A6OA 2MH4A 3EOAA 4P23A 5T1LD 4WWID 1W0WB 2ZXEB 3A6CH 3N55A 1GGBH 5DK0A 1ZHBA 2A6IA 3KEDA 4IOFC 1I85C 4O2CA 2VM9A 1PVHA 1SVBA 2P8MA 4FMFA 4L4VE 4PWGA 3VXSA 1HK6A 2VLLA 4YDIH 1M7IA 1E4XL 1TPXB 2KLSA 2I60H 1UZGA 2FX9L 4JRYA 3DGCR 3L4ZA 5KS9A 5FYJH 3IMBA 2FNBA 1BZ7B 5DDHB 1R3KA 2NXYC 2VZTA 3N3EA 4WTWA 2XZQL 4D0DA 1DQKA 4EI5B 2FO1A 4K8RC 3SYPA 5B8CB 1MCQA 3VQ1C 2HXAA 3OQ3B 3TT3L 2EKJA 2FJGB 1FNEA 4R9HA 1IKOP 4FI7A 1H8SA 4NQXB 3G6AB 1D7FA 2A3TA 3HI5H 4ZO7A 2VDNB 3A4EA 5GGTA 2N7AA 1AS6A 1R75A 3LQZA 4O58H 3WKNA 2NSMA 1NFIB 2JIXA 1AHWC 2EADA 2IJ0C 4XRCA 3RJOA 1SXBA 4MQXD 3VSVA 2WXRA 2GITA 1TZIB 1YEKL 1KJ2L 3RPIA 1CDHA 3UZEC 4OZGA 4H8UA 3IU3A 4XPBH 1L9PA 3MPCA 5IKCB 1LNUA 4YHIB 1QSEE 5FKAA 3EGSB 2GY5A 3FBQA 3IJ8A 1IAOA 2CHZA 4DHLA 3N43B 4TSCL 1DCEA 1A7OH 5CEYA 5L4JA 4DKFH 3G5VA 5I9QC 4DKDC 5ANME 1RURL 4OCRH 2YD2A 43C9B 5T1MA 1JFQL 4OIIL 3B37A 2A4CA 1XF3B 3UTZA 3AREB 4KK9C 3FRPB 4RQQB 5I15L 2FO8A 1N6UA 1PYWA 3STZA 3X11B 3I6LE 3AG1B 5F1OB 5JW4R 2OL3L 3RWJA 4QRTA 1FH2A 1MCRA 1Q9WA 3L5XL 4G9FA 2X42A 4JW3A 3NSXA 1VFMA 5EORH 3E3QE 3MVSA 4XAWL 1GTFA 1GJUA 2BIQA 4A55A 1G7IA 3WIFA 4L8BA 4UB0L 2DRUA 3MOBH 1TMCB 2H7WA 3SGDH 4TQHA 2UUDK 2E75C 1L9RA 4GRLC 4V33A 1SYVB 2WP3T 5E8OB 1NMBH 3M86A 1RZFH 2Q3AA 2JELH 3PGDB 4FFVC 1WZ1L 4XBPA 3SPGA 2QADD 3D0LB 4EVNB 4NUPA 2OX5B 3PQYB 2WKLA 3HAEB 3GSQA 1K2DB 2C7FA 2JCWA 3ILPA 4LPVA 3SKOA 1ZT4A 5I71B 4GKNB 2Q8BL 4RA3A 1PZCA 4NERA 4JVWA 1TEYA 3LEVL 5F7EL 4NJAH 3VH8B 3WFHB 4ELKB 5DRNB 4LL1A 2ZOUA 1RUQH 1T5KA 3SYCA 2AI0L 4C56E 5GGSA 3SSGA 3FQNA 3WKPA 5T3ZE 4OY9A 3TC9A 1D6VL 4NKMA 2YPLD 3GM8A 4ONHA 4OCMC 3IDIB 3RUGE 4N5UA 4RNRA 3FAXA 4YO0B 4CW1A 1HHIB 3HHRB 2J5LC 2HTKC 5I6LA 3M1BB 3WTSA 1XD1A 2IWEA 2ZJSH 4UM8A 4GRMB 1OQXA 5GSVB 2Y25A 2K8MA 3VD4A 3GHPA 2V2XB 2NNAB 2NYZA 3O2DH 5CP3H 5IB1A 5GGRB 3V0HA 3SJVB 5D71L 3KS0H 4OJFL 2X41A 1KZQA 1UYWH 2W0FA 2OMTB 3CH1B 3K8KA 4GNKB 4HBCL 5DJ8B 4WJKB 5E0QA 4R97C 3I84A 3MNZB 4DQOH 4M7LT 5F7WC 1X4ZA 2OMVA 3VFMB 4QXTA 3HCVB 4G8GB 4LP5A 4TL4A 5EEYA 4JB9L 1U3HD 3SO5A 2NNFA 2Q7YB 5L8KB 1A4JA 4UDTA 3WD5L 4Y2DA 2XV3A 1BWMA 1MCPL 1DE4B 3AUVA 3K2UL 3R19A 3TBSA 3FDWA 5F89A 2H1LM 2KYIA 3SOBH 2HJLB 1II4E 2H45A 1RHFA 5KJ7E 2JTYA 4XNBA 1MOEA 5MEQA 3FT3A 1JPSH 3ARQA 2WD0A 2YRPA 3OZLA 5C07E 1IBDA 5I0WA 4RESB 4GSDL 2J88L 3ALWA 3GMPB 1HIMH 3L48A 4OLZH 1N6QH 2JB5H 1A7RL 4HA1A 4X99A 2JQZA 4X5XA 4JGUA 4X4ME 4PRNA 2ADFH 4LVOB 1LK3H 4EMZA 2XQYG 4LCYB 1OGAD 3MRNA 3J27A 2C9PA 3PV6A 4P49A 3NRQA 4AQEB 5D7KE 4QKTA 4M48H 4I0PB 2DKSA 1NGPL 1UXMA 3C5ZD 3CZFA 4OB5L 4M8QA 1R3HB 2Y7NA 1XV8A 2FSEB 4IKLA 1UA6H 3D6GA 3TL5A 1IGTA 4LOUC 3IDXL 1WZAA 2C9AA 3LCYA 3T2QA 1K4DB 4JKMA 2FR4A 5CZXD 3D3VB 3TX4A 3OLIA 2XJKA 4PS8A 4JO1L 5JHDE 2FBRA 5D7IB 3TV8A 1KULA 1EVUA 3G6JE 1FL3A 1EXUB 4NXSA 4S0TD 4IK7A 3TPUA 3B2MA 5FUZH 1QW9A 2VMDA 4K3JH 5T1DL 3DJSA 4Q52A 1GS8A 2DICA 3C60C 4QHUB 2H8PB 5C8JB 3AS2A 3E2HB 2X4RA 3CQQA 1SY6L 3G5ZA 3MNMA 1RUPL 1FWXA 5E8EA 3MUZ1 1KYFA 4U1LB 2NY3D 3UMNA 4G3YL 4A63A 4E5XB 4KHTL 3SGDI 1X9LA 4F7EB 2XPGA 1SM3L 2GJ6A 3LOWA 4JKWA 4UINL 3BGAA 1SLXA 3MRPA 4UQ9A 1DP0A 3VE0A 3JYBA 4MJJA 4LASH 1AQ8A 4OV5B 1CDUA 3N41B 3KXFA 2PCFB 1BAFH 2UXVA 5AVWB 5L88H 2XXFA 3IJEA 4YDLB 1FCCA 4YWGL 1URZA 3EJZC 1QNZH 2H6PB 1SJEB 3UTSD 4S1SH 3X14B 3HE6D 1N19A 4NQCA 5HHPB 1Q9OA 3VRJA 1HI6A 1WAPA 3O0RH 5DVKA 3T77B 3AG4B 4XP5L 3VI3E 1UACH 5IUCA 1LO4H 4Z5RA 5D5MF 2EEDA 4JFQB 1TQCB 3FQ2A 4IEFA 3ZL4L 1L7IH 5FF6A 3ZGIA 1AXIB 2ADGB 3O6FB 5F6IC 4BFJA 1BZDA 3M45A 4KRLB 5CM1A 3GMRA 3KG5A 3NDZE 4R83A 2QT6A 3ABKB 2JF1A 4Y16C 4RAHA 4H40A 3MYJB 3MACL 3QNZA 1BYPA 2LOEA 4I2XB 4OGZA 1D2OA 1GIGL 4HWEH 3APDA 3QUZC 2EUWA 1VLXA 1FFNA 1U21A 1KPUA 2M8XA 3CZLA 1YO4A 4PRHD 3RB5A 2VC2L 5MEOB 5FV1L 4L2LA 3T0BA 3FOLB 1Q0EA 4KTYA 3UAJA 5D93B 1S7VB 1L9MA 1A4KA 1U8KA 2FUQA 1QBLL 4DQAA 5E2UL 2PPCA 3K6SB 1RZ8B 4IS6A 1RHHB 4AV5A 2AJYL 4QNPE 1TYEB 3ZTCC 1OAJA 3V7AG 1NSNH 1HH9A 3O9WA 5BQ7B 3NMEA 4XN9A 4LHUB 2X4PA 5L2JB 2ZT9C 4TUOB 1X5JA 4LSPL 4Z76B 1X9RA 1X5IA 2W65B 3EOTH 4F15C 2XYCA 3HZYA 4LDLB 4X6CF 3BJLA 1DSFH 2HH0H 1T0MA 1UXSA 2AV1B 2CO7B 1TLMA 5JW5B 1A1NB 2LU5A 5AOMA 2H2PD 5GZOD 2PTTB 5JR1H 3GIZH 5FWQA 1Z5HA 4ZUUA 3T0DA 1CQKA 1TMQA 3OJVC 3FQRB 1MFUA 1F86A 3JV4B 4OLUH 1QG3A 2ZF9A 1XF5B 1H8LA 2IGTA 3KEHA 4TQ8A 3T0EE 2WXLA 4PREB 5F6HI 1A2YA 2ERJB 5DJYB 3VQMA 4BFIA 1KLFA 4Z7NE 2R0KH 4KXCA 3CBRA 4RA0C 3LKOA 5C0RH 3FO9A 4G9DA 3HS0A 3QB7C 3HMWH 2QSCL 1BLIA 2EUZA 1RJYA 2YOCA 3QEQB 1MN4A 4F7MA 5JQ6L 2M83A 3QR0A 3PWJA 1TCMA 4BRJA 1V54B 1ZGLM 2Y5TB 1ZGLP 2EIDA 3CVHB 3L3DA 5DMGD 3N9GH 1U8LB 1W0WA 1NCGA 2V33A 3PFQA 2BVPB 2QGDA 2BINA 2EIMB 5IQOA 4LKXB 1AFVH 2KKQA 5BQDA 3WJLC 1D7CA 4IOFD 1T4KB 5TGBB 4AQZA 4FZ8L 2EDMA 5LG1A 3O2WH 3K0WA 5DO8A 2HP4A 1BZ7A 3VGAB 4TSBL 2RGSA 7PCYA 3MMEA 1TVDA 4EI5A 3SQOH 1AIZA 4HJJH 4WI5A 2NXYD 4P5SA 5B8CA 1F58L 1A9VA 2AERT 4KH2A 2CKBL 3QFDB 3V0DA 1ZLVH 1X5LA 2G60L 4K8RD 2O4EA 4NQXA 2IGFH 1XBRA 4PJEF 3G6AA 1FBIL 2HFEA 1BXVA 2V5TA 2YEZB 3CDGA 4D3CH 2FBJL 3MRDA 2JVUA 1TLKA 4NN5C 4G6KH 2CO4A 5BZDB 1UM4H 1MJ8H 1NFIA 1OANA 3D30A 4NDMB 3D69A 3GS7A 3PUCA 1E6JL 1FL6B 4OF0A 5KSBF 1TZIA 4TULH 2K8QA 1B4JL 1ZXKA 2PW1B 5I6XC 2CA4A 5F7AA 3G08B 2X5PA 3NIGF 4NPYB 4WUKL 3NCJL 5IKCA 4YHIA 1SVCP 2CSPA 1Q1JL 3ZDXE 3EGSA 3TBCA 2B2XL 1ZTXH 4L4VB 1OT2A 1M7DB 4LSSL 1UCBH 5I1KL 2JI1A 2EE0A 5HGGS 3EZJB 3EJTA 2DD8H 4UT7H 1TTBA 2D3LA 3IMSA 4ONGL 1XF3A 3F62A 3AREA 2EC9T 4RQQA 4PS4L 3X11A 2F8IA 1MJ7L 3AU1A 3DC0A 4XAKE 3BE1H 5EPMA 2J57A 5I6KA 5IQ7H 4ZX6A 2YN5A 1U4EA 2BMKB 2E4TA 2KZWA 4YHYC 3L5WB 2X0WA 5DJ2B 3UP1A 2AJXL 3ATAA 2XTJC 4ZMWA 2JCCE 3C2SA 3O3DB 4AY0A 4JRXB 1CB4A 2IEPA 1IM3A 4ZTPL 4LVHB 3SGKC 3NFNA 3P0VL 1HYRC 4WI7A 4A38A 4XXDB 5IBTL 3D50A 3O6MH 2JXMA 3QIWB 4GAJL 4OGXL 5E8OA 1HDMB 1KJ3H 3DYMA 4HS6A 4Z95L 1QSEB 5J06A 4GRLD 4EVNA 1VJSA 3D0LA 1Y1DA 4LFHG 3OJMB 3PQYA 1NCAH 4TL5A 4UOQA 4FFVD 5H94B 2DTSA 1PG7X 4GKNA 3O4LD 4I48B 5ANMB 1M9WA 2VIRB 4XN4A 1HXMB 2P5PA 5FUCE 5LXVA 4FYTA 3VH8A 4ELKA 3WFHA 3ULVC 1ZS2A 2VR9A 3PY9A 5DRNA 4PVBA 4YSCA 1AI1H 5HYJE 4UT9L 4QHMB 5ICXB 3TFKD 4XVUC 1N18A 4YXHL 1MKFA 2VXQA 4PH8A 1VRSA 4BSJA 3TIDB 4POYA 1WUZA 4NBYB 5TK2A 3IDIA 4TRPL 4FFTA 1HHIA 4QO1A 4LLMB 3M1BA 4G7VH 2ZCZA 4IMLA 5FK9A 3IMWA 3H7LA 1DVYA 2QGBA 4GRMA 4JQIL 1Q90A 2PABA 1JHKL 5BO0D 1D5RA 3NH7H 2Y2YA 4GAFB 3Q5OA 2NNAA 2ZF8A 3OGCA 4DO6A 2DLGA 4GH7B 2RBLA 4PWJA 4QKXB 1ZANL 2OMTA 3CH1A 4WY7H 3I75A 4XB7A 5DJ8A 3MNZA 1X5MA 1M42A 1KDIA 5AVRB 3S7GA 3T71A 3P1VA 1WCBB 3HC0A 3VFMA 4JFHD 6FABL 1DZ0A 3MBXH 3D2UB 2FH8A 2AVFA 4WENB 3NIFF 4BKSC 2Q7YA 3KBHE 3ZDWA 4YHMH 4ZS6C 4GS7C 1CFBA 1GGIH 1J0JA 3Q8FA 4ZFFB 4WI4A 1A6TB 4GXUM 1T5XB 4PJAF 4XHQA 1QLFA 4KKPA 3MLYL 5JNYA 4R7VA 1PQZB 2ZKXA 3VO0A 2RD0A 3ZTJG 5ABZA 2HJLA 3TBVA 1CL7L 3RUGB 4QR7A 4I3RL 5EUOE 3CIQA 3O4OC 1KG0B 3US9A 4LEXL 5HHXL 4JFWA 3GMPA 1OTUD 2CO3A 2WV3A 2DQUL 4PGEB 4A7TA 4XTRC 1OZTG 4NQDE 4L0ZA 5KZCB 4KITB 1T22B 4LARL 3KPRD 5GRUL 3AITA 2WB1A 4PYGA 4YZFF 4AQEA 3ARGC 4ZSOE 4JY5H 4I0PA 4KJQC 3BSZH 5IGXH 5E94B 5E7FA 1E3FA 3BGMB 3MHZA 3UP6A 1R3HA 1AO7A 1CYXA 3RGVC 2P46B 1KXQA 4N68A 4ZNEE 4L37A 1LP9E 1PX3A 1ZA6B 1K4DA 25C8H 5DEZA 4RMRA 4RGMB 1DN0B 3QRLA 4LOUD 2DLIA 3W5MA 4ACPA 1U3YA 2P5WD 3D3VA 3RB7A 2NY1B 4J23A 3FFCD 2Q2EB 4X5WB 5D7IA 4Z3FA 1OAQL 4ZG1A 2WZ5A 5E2TL 4LEEA 3JWNH 2CNYA 2HFTA 1J88A 3RZCB 2DLFL 4QHUA 4Y89A 4GO8A 1T03H 2WTOA 4XXCA 3RTQB 5C07B 4FHKA 3TA3C 5BV7L 1FGNL 4XNYL 4N8CH 3C60D 2FAUA 4X0NA 4U1SB 2EXTA 1UURA 4JDVB 3FCBA 3BAKA 2DDQH 5HPMA 4MWFB 2ITEA 2O1AA 4U3SA 4TNFA 4U1LA 5B4MC 1BEYH 4E5XA 3O2VL 3U6XS 4F7EA 2JKSA 2EDNA 1SJMA 1I3RB 1GGUA 3EOBA 3FONA 1TTRA 4QXUL 5C0GA 3ML9A 4FCAA 1SDDA 3GM0A 4LVNB 5E4EC 3MOAL 2PCFA 2NY0D 1U8JB 3HBGA 4BSWB 3BKML 1H6UA 3MJ9H 3ARSA 5LHDA 1YEWA 3P9LB 5JHDB 2H6PA 2R27A 4LDOB 3G6JB 4DUWA 4OM1L 3GFUA 1BXXA 3WKMH 5HHPA 3EJZD 3T77A 1P4BH 4A2DA 3AY2A 5ESQB 5LXGL 4HCRA 3WN5B 4MAYB 4BQ8A 1VKXB 2LU7A 3NCXA 4AQOA 5E6IB 1BA9A 2OI9C 2ADGA 4IM8A 2WQAA 4W70A 1MCOH 4KRNA 4URTB 1IGIH 4IOIB 1LO3H 3QDME 4PJHF 1RD6A 4RX4A 1OARH 4N20A 3A4FA 4PIRF 3KLHC 4Y88A 3QUMH 1NBVL 2LHAA 2H1PL 2V9TA 2F7RA 4Y16D 1QWHA 1BQHG 2ESVD 3UROR 1QBML 2XWCA 1J1PH 1S3KH 4GB9A 1EGJH 3HR5B 1LGVA 5FUOH 5MEOA 5HDOA 1FNGB 3FOLA 4OI9A 4WEBH 4BFBD 5ITBH 4HK0B 1S7VA 3II2A 1YSOA 1IAMA 2EUVA 1G9NC 3P11H 1ACCA 1X5FA 3VI3B 3K6SA 2VYRE 1WA1X 5DWUL 2RMNA 3H9SE 1RHHA 1HZKA 1GYVA 1YLBB 4N8VA 1U2YA 1BX2A 5A2BA 2AGJL 2JKXA 3MLWL 4LHUA 3CSPA 3NCMA 2OSLB 1X5HA 3N06B 1S5HA 2AK4A 3V0AC 3PDDA 4Z76A 5CNHA 3QJRB 2W65A 3ZQWA 3GTTA 1EO8H 1PJ9A 2PUQT 2G5RA 4LK4A 2F53D 1NDTA 4Q56A 2D7MA 4BUGA 4N0CC 4OSUL 2AV1A 2CO7A 1TQTA 1A1NA 4IBUA 4CSSA 5EMYA 4HHAB 3U0TB 4G6AC 1YEJL 3QIBB 4P2OA 1NIDA 1BSIA 3FQRA 4CU6A 1F3RB 3JV4A 1BQSA 3R7RA 4LDEB 4AOFA 4PREA 2JQMA 5DJYA 1KY6A 2V5SA 3EYQD 4TPRH 3UYOD 4J6IA 2I7OA 1I1CA 1F18A 2YD1A 4HMDA 3GMNB 2QQNL 2ALWA 3FTZA 1WO2A 1JERA 1JZ8A 5E08H 2NUPB 3QEQA 2APSA 2HAZA 4J28A 3ABMB 4ZS7H 3TWCL 1CXFA 3RY6C 3S5LA 5I76B 5IZ7A 3D12B 1VF5C 4PRID 2Y5TA 3ZQ9A 3CVHA 4I5BA 5CSBA 3LV3B 4L1TA 4PJ8A 3JV6B 3O3UN 3QQXA 3S3SA 5F93C 3T1WA 1U8LA 4GSRA 2WMPA 4NZTH 3L81A 4WGVB 4WWOA 1YEGH 4GBXC 4ODWB 3QISA 3HI6H 4LKXA 1U9KA 4K71B 2R8SL 1LQBC 3C6LB 3O45B 3O41B 3KNBB 4JQXA 3GF8A 1AQDB 1M56B 3JWNE 2DMHA 3QUYA 5TGBA 3V6FB 3IWVA 4P0DA 1ND0B 3WIHH 3P4MB 2AQSA 1IKNC 2CJSA 2X4SA 2D7QA 5T33L 3T0EB 4KK8D 3W9DB 4FKEA 2OW7A 4Z7NB 4Y5XB 1JN6A 3WUWA 5F70A 1B0WA 4QOKA 5DD6B 5K93A 3L45A 1J9SA 2YEZA 5AWNH 3IGLA 3AWGA 5BZDA 3TBYA 3PWVB 4XVSL 2EDWA 1FL6A 3M7FB 2ZWLT 1UM5L 3HC4H 4GOSA 4U6VH 2PW1A 3C6SB 4PGJA 3JVGC 4GO9A 4UOW1 4Y8DC 1QZ1A 7FABL 3X13B 4RMSA 1FDLH 1UH3A 3QORD 4ZZFA 2WSKA 5K9JL 4L4VA 2NUTA 1KGUA 1CWVA 1M7DA 5KANG 1ICTA 1CLZH 4AG4L 1PS3A 4XT1C 2X88A 2WOYA 3ZE2E 4PCYA 5IW3A 3L9EA 2DS4A 1HWHB 12E8L 1A5FL 1SLVA 4KTGA 5J6HA 2CBQA 2FGWH 1OSZA 3KPSD 1W6LA 3QEGH 1KBBA 5KVEE 3FPXA 3ASWA 4LLVB 5C0CD 4ONFH 3WU1A 1HQRB 2BMKA 5I24A 1TZGH 4M5TA 5L4FA 3AACA 2Y07L 5C3IA 3FC8A 5GS1B 4PJ9B 2ATAA 2LFGA 2QL1A 1MHCA 3ZT7A 3MZGB 2K6ZA 4AQ8C 1HU8A 3O3DA 4ZW3A 3ULVF 1DVQA 1QPXA 2XTJD 2F18A 3OB0H 3C09C 3WJJA 4Z1PA 1VHPA 3LZOA 4N85A 4X42A 4D9LH 3SYOA 1HWWA 3PGFL 2ARJQ 4XXDA 1SYSB 2X4NA 3QIWA 1H5BB 5DFTA 5TPWL 5LBSL 3MV8E 2HPTA 1QSEA 2BSTB 4KNSA 3PAVA 3B6SB 3ZDXB 3INOA 4V11A 3CSGA 3GZQA 5L2KD 3QQ3B 4XPGH 1FH5H 2XG4B 2DYPD 5AL8A 3W0WD 5ANMA 2VIRA 5T5FA 3SE4C 2C3XA 4AK2A 4TLTA 2WZAA 5J6GB 3BKJH 4WHDA 1OWRM 4GSUA 4FNRA 4K3DL 4JGJA 3SBQA 3ULVD 2NY5L 2ENJA 1E7VA 4ZX4A 3ZYIA 5DUPH 1MQ8A 2VDMH 2WO4A 3OPZH 5F9WC 3QAQA 4XVUD 4JFUA 1UD8A 2FLRT 3UTPE 3E0GA 1DDTA 1U42A 3AFLA 3CZGA 4NM4H 3P4NB 4M5ZL 4AQAA 3ZTDC 4KROC 2Z34A 5I0DA 1KACB 2JCCB 1PZAA 1OWWA 5E6SB 1V7NH 4GQRA 1T89A 2VZUA 3CPUA 3UTQB 1CE6B 1PIGA 5JYLA 4CMHC 4MSWB 4PJFE 5DEGB 2DQEH 2QLYA 4IOSA 1OE2A 2J8OA 4NWUL 4YLBA 3ZIMA 3RI5K 4PJBE 4NKIL 4M1GL 3VFUA 1MFNA 1RZKC 2F1BA 4DKTA 4QHKJ 2DBJA 2FLBT 1WCBA 3QG7L 4YL4A 2C9XA 3PP3K 4PD4J 3D2UA 2FX8L 3PHOB 2AF2A 3IDMB 5KUMA 2E7BA 4UNUA 4ZFFA 2PWGA 2ZUSA 4P5MB 4AYDC 1A6TA 1KEML 1T5XA 2NY6B 2OMYB 5HYJB 1AG6A 1C1EH 3H2PA 4HETA 2EXYC 4C56A 1WLHA 1IIKA 4X9FA 3GSWA 3F05A 1T2JA 3S6CA 1HFUA 4ZXBB 4HIHB 3EXLA 3LRSB 1OGPA 4GUPB 4ODVL 3AQXA 1UWYA 3EHBB 1RIUH 2AITA 4KHXL 3RUGA 1TJIL 3T3PF 3LHPH 4AVHA 5BOPA 4DWHA 4GQ9H 1KG0A 2OJZH 4R96B 4JFEE 3KW7A 3QFJE 3TGXA 4FRWA 1QTSA 2J2ZB 2GAZB 4PGEA 4A7VA 2WOBA 3Q8BA 3OTTA 3ZTNH 1HEJC 3KGTA 3JBG7 4Z7IA 4FLHA 4MMYB 4WZ9A 4MB4A 1T22A 5ALBL 2ZOTA 2UY7A 4P2QD 1E5AA 3PL6B 5E94A 2NR6D 3BGMA 5DMKA 4JFSA 1XGRB 1NCDL 1NZRA 2GC4C 1ZEAL 4KJQD 1U6AH 4PB9L 2WQVA 4A37A 1AXSB 3VXOA 3L2NA 4M9PA 1X4YA 3ORJA 5IG7B 3RGVD 3QXDB 4CKVX 4H0HB 2NY7L 4FNTA 2FVNA 4MDJB 1B6DA 4XZ4A 4DH2A 4X5WA 1JXFA 3S36L 1JXDA 4AUYA 4G7SB 3RWDA 5BS0D 5JDJA 5SX5K 3BPOB 4HUUA 5KEZA 5LQBH 1RFDH 1T7XA 1VEPA 5EDXA 3L4XA 5EUOB 1YYMH 2CPUA 4ETQB 5LNEA 1IQWL 3RTQA 5C07A 3BT2H 4Z77B 1FNLA 3U25A 3Q0HA 5C0BE 1DYZA 5LLIC 3D39E 5HJ3A 3BAJA 3OZ9H 3PHAA 4U0RB 4FTVE 1ID2A 4ISVB 4JDVA 4X4MA 2GJPA 4U1NB 1FFTB 1B2WL 1KB3A 4MWFA 2EICA 4DEPC 1L0YA 4ZSOB 2HKFL 3SDCC 3TH3T 2ZUYA 3SKMA 4W81A 3FQWB 2VJ8A 2F68X 1QA9A 2NTFB 2NNCA 2QVTA 1LP9B 4G42B 3ZDYF 5DTFB 4JY6A 4UANA 4Y2OB 5L0QB 3P02A 2R9HC 2EEBA 4QPEA 4Q6IB 3ROOB 3TV3H 1SHMA 4MMXB 3FPYA 5ISZE 1T7WA 3QZMA 5JHDA 2DM7A 1LM8V 3ULAB 3G6JA 4GXVH 2WLHA 4MMZC 5I17B 1LHZA 2FZ3B 3FZUD 4TNWF 3GXUB 3II1A 3QJZA 3RG1C 3SZKC 3UTTD 2XN2A 4OFYA 4YBLC 1MH5B 5ESQA 3WN5A 3HNSL 4XMLL 2J8UE 4ZPTB 1VKXA 5CU9A 3FCUB 2B4CH 3BYYA 4QRRE 3V6OE 3ZYJA 5F3HB 1JZGA 4PIBA 5IFAL 4I1NB 3F7VB 4HQQH 2B59B 4JG9A 3PYCA 1C5BL 1Q0YH 1N0LA 4PLKC 4FMVA 3VGEA 2CUAA 3MOQA 2VERN 2IDFA 2WXIA 2AJ3A 4F9PA 1XCQB 4UV7L 1NEUA 1Y0LB 2OMXB 3KD4A 4X6BB 2Z35B 3FO0H 3U7YH 2XRAH 1VGKB 2A74A 3L95B 3LY6A 1L5GB 4JY4B 1A7PL 4HK0A 5I0XA 3UZQB 1NCBL 5TQ0H 1THAA 4H2CA 2XXMB 3KPOB 3HFMH 1DDHB 1ZDSA 4N22A 3VI3A 2GK0B 1GTNA 4OH2A 5AVSB 2F8XC 3DO3A 2R4RL 2FECL 4JM2C 4JMNA 1FVCA 1U30A 3KS0J 3HG1E 4O4YH 2OSLA 1JS4A 4J12A 2QPSA 3D4GA 2Q8AH 2C9SA 1A1MB 3NSDA 4LEBA 3ARDC 4IGBC 1F97A 2Y7QB 4FA6A 4ICXA 4W4OC 4TVPD 4F7TB 1RZKH 1HHJB 2QSTA 4JHBA 1SHXA 2R2EB 3O3AB 2BVQB 2BP3A 3B2UC 3G6DH 4N0CD 2EO7A 3U0TA 4JVPA 3QGVA 5EB9A 4A2HA 5HHOE 1YNLH 5TQ2H 3BEVB 3BLPX 4JKLA 1GC1L 5CR8A 5E6ZA 4G6AD 1E5YA 2IANE 3UPAA 1B4TA 2XBTA 5T8IA 3VFGH 3WIAA 1E9OB 2AHIA 1AHKA 2B0SL 5CP3A 5GJTH 4XMZA 3GMNA 2ZOKA 2NUPA 4N2FA 5LBVA 2BIPA 4QYAA 4M7LL 5J1SC 4I13B 1FLRL 3H9SB 4A7QA 3OHXC 1AE6L 5E9DA 2A6DA 3DYPA 5I76A 3JWDH 4Y1TA 2YQ2A 1EAOA 3VWJC 3CE1A 2F58L 1PG7W 1D5ZB 3MA7A 1CICD 1A7QH 4J3TA 5IQNA 3ARBB 4ODWA 1ML0A 1Z9OA 1TZOA 4UQ3B 5F1KC 3FNKA 4GW5B 5EBLB 3C6LA 3QJTB 3O45A 4O9HL 3O41A 2G5BB 1LEGA 2X6AA 3KNBA 3MJWA 5D9SA 2OMWB 3APMA 1AQDA 2A9DA 4G6FB 2Q0ZX 5D1ZA 1KYAA 1YJDL 4I89A 4HXBL 4MB1A 3HE7A 3RPKA 3NSCA 5GGUB 1ND0A 4OCYL 1JXJA 4PU2A 5B1CA 1TDQA 4G9FD 3SDXF 4DFIA 5H37A 5IB5B 3T0EA 1UD4A 4PBXA 3W9DA 3RIFK 4B5EA 4Y5XA 3IVKB 1JTPA 3JTSB 1JFHA 2ADJB 2MOVA 4GQQA 5EOCH 2ORBH 3UX9B 5C6TH 4D0CA 4FXGC 5DD6A 5DC4B 4KTEH 3BAEH 4Y9GA 3ZSTA 2C3VA 2JKRM 5AAMC 4XC1H 1BM7A 2KHAA 3PWVA 2SODB 4NSKB 5GRYA 4Q4EA 1NDMB 4PPTA 2EECA 2A83B 1WIOA 2R1WB 3C6SA 1K5NB 2WLKA 2JJWA 4NQED 5LAXB 3X13A 3FT0A 2BVTA 3EO9H 3BN9C 1B6UA 4P2RA 5K39A 4MFHA 3BVWA 2XETA 4KKAC 2J20A 1TJHH 4DGVH 5K1NA 4AMXA 1JV5B 1U95B 4A2LA 4PJGE 3S3DB 2PP8A 4KWUA 3QG6A 3RVTD 5BNXD 4GUCA 1GR7A 5E8NA 1BVNP 3H3PL 4FFYL 4LLVA 1HOCB 2AFNA 3KMDA 3Q1SH