4AVHA

Structure of the fimh lectin domain in the trigonal space group, in complex with a thioalkyl alpha-d-mannoside at 2.1 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords FIMH
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4avhA00
3JWNH 4AV0A 3RFZA 3BFQG 5IQOA 5IQNA 4ATTA 4AV5A 4J3OG 5IQMA 5AALA 4AVKA 5FX3A 3JWNG 1KLFB 1PDKB 5F3FA 4AVIA 2WMPB 4XOBA 4AUJA 4AVHA 3SQBB 3JWNE 4X5RA 2XG4B 3ZPDA 4AV4A 4XO9A 1TR7A 3MCYA 3ME0B 2VCOA 2UY6B 1UWFA 4XODA 4AUUA 4X5PA 3ZL2A 4AVJA 4BUQA 3BWUF 4CA4A 1ZE3H 1QUNB 4XOCA 5AB1A 4J3OH 4LOVA 5FWRA 4XOEA 2JTYA 5CGBA 2XG5B 5LNEA 5ABZA 5JQIB 3BFWA 1N0LB 2W07B 4J3OF 4XOAA 4AUYA 5LNGA 4XO8A 3ZL1A 4X5QA 5FS5A 5AAPA 1KIUB 4CSTA 5F2FA 4X50A 2J2ZB 1N12A 2JMRA 2UY7B 4CSSA 5FLUA
chains in the Genus database with same CATH superfamily
2F08A 2GBVA 2VTFA 1X5MA 3KBPA 3V95A 3MRKB 3U7WH 3U0TB 1CFQB 1HWWA 4Z7OB 5JW4M 4FZ8L 1SVZA 5CLTA 5KBPA 5I5MA 4M4PA 3CFDB 3RURA 5F88A 1BJ1H 3BQVA 5IT2H 4XCNA 2H32H 4JPWH 4YHPA 3D39D 3VTTA 5I74C 3JSSA 1ZWIB 3OB8A 5T1KA 3DRTA 4FQHB 1BZ9A 4XNXH 3HBQA 3IPBA 1HOCB 2BHFA 2NT1A 2J8UE 4K3JH 3WIHL 3TV3H 1WZAA 4TLTA 4Y16C 4DGWC 2OAAA 1IIKA 3GHPA 1RQ5A 4WUKH 3TA4D 3P2BA 4QRFA 3GEWB 4WF7A 1QRKA 1AP2A 2BPBA 1J0YA 4WKZA 4BEIA 1UVQA 3FXIC 5TF1H 5F9JB 1UFUA 2WIMA 3EYQC 4FXLA 4JPWL 2P5EA 3MLPA 3M88A 2GFBA 3VFNA 1WWWX 1UZ8A 3P9WB 2Y5QA 4G8AC 2Y25A 2WXQA 3DTXB 5ID1B 1T0PB 1OW0C 1N64H 4HXBL 4XAKD 2QV4A 2A4CA 4LAQL 3LPPA 4Y1AA 4AV0A 1U92A 2ZYSA 1RK1A 1QO3A 3ISYA 4ANVA 2A4ZA 2KH2B 2C9PA 2XHNA 4GRMB 2H6OA 3QJSB 4GNKB 4LIQH 2V2WA 4PWIA 4KJQC 5T33H 2FWSA 3TP4A 3QW9A 1UENA 3VQMA 1PFCA 5ISZB 5LCVA 4W9FC 3FJTA 4JZOA 5IEKB 5J1SC 3K7UA 3TEWA 1DQVA 1WD9A 2PPCA 4EN3D 3MBWB 3KLLA 2JQAA 1QR1B 3AT8A 5CCKL 5AAWC 1I31A 3HZMB 1DBAL 1L3NA 1EHLH 3ARZA 3ARGB 1KXTA 2OYLA 4J5VA 2EDQA 1MFAH 2XVBA 2YKKA 3BP5A 4WK4B 2PWFA 2AK4A 5F1OB 2EUVA 3EGSB 5C0IB 2ZKHL 1GIGH 2VDLB 4J3OD 4JDTH 3O9WB 1THAA 3SDAA 4YHPB 4H13C 3JZYA 4JDZA 4GKSB 3V4LA 3U6XS 3BCDA 4P23C 3VXOA 1CLCA 1LEKA 1DJXA 1NCCL 5G4NA 1KCSH 3ULUC 4MD5B 4XNZB 2HX8A 3WE6A 4B9PA 5BVPH 1DEEB 3MYJB 5BS0B 5B3JE 1YMMD 4K23H 3QQDB 5IHZB 3PQYB 1IGCH 2ENSA 2PO6D 3O6KH 4N8CL 4KH9A 1MHEB 4JQXA 2X10A 4EIZC 1KXVA 4PGCA 4OZFH 3LS5H 2PW1B 2I24N 3SD5A 4EZLA 1FO0L 4JVWA 3T1WA 2VMJA 1IGJA 3MA9L 1C7TA 4G7QB 4CVXA 1MJUH 2GSIB 4GKZB 5AG9A 4JR9L 1JYWA 3FHEA 2WGXA 2CK2A 4G3YH 4AVJA 4D0CB 3HG1A 3OB0H 4JO2L 3IVKA 3V4VB 3AAZB 4O5LH 1DUZA 2FLBT 1T1ZA 4C59B 5LHDA 4LDEB 2L7JA 4EE2A 1KTRL 2MQ0A 2FO4A 2BERA 5EZPA 1YVLA 5AL0A 1OGSA 1SFDA 2F18A 2VQ1A 5IOPA 1MHPL 2X28A 1SDAB 2XPZA 4PRBA 2V37A 2ZUXA 3E2HB 2CJUL 1V3JA 4ZUUB 5FYJE 4K7PL 3NJGA 5E2WH 3OGCA 1J1XH 4OGXL 5EZIL 3SY0A 4J3BA 3WNPA 3KLHD 3BFOA 4I3RH 4IJTA 5GIRB 3BZDA 2X4SB 4QPEA 3KPMA 3DURB 3VSQA 3H55A 1G94A 1JNHA 5TDNB 4Z3FA 1UXMA 4XGZA 3MUJA 2Y1ZA 2XVLA 3CVHA 5MENB 2XTJE 3EZ8A 5BZDA 2EDXA 3RL1A 4NRYB 4DQAA 5KAQG 3F7KA 5FHAH 2OTWB 2YGNA 3FONA 4MXVE 2KKQA 3ZT5A 2PR4H 2FJFA 5F6IB 4OZIF 5AZEL 2EUWA 2WWKO 1BG1A 3FYIB 4NHUA 5IW6B 3UIZA 3TO4B 1AGEB 2OQJA 2QPDB 4EIUA 1R24A 1TYEB 2ITCA 4O4YH 4JFZL 3TO4A 3FH7A 3PP3H 1NLDL 2CO6A 1KXQE 3HJEA 4ATWA 1E9OB 2BVPB 3BUQA 3JTSB 3SPVB 3SKMB 2G0LA 1BQHG 2VJXA 3UACA 5JDJA 3T65B 4HJIA 4X6BA 1L6XA 4XB7A 1R5IA 1PZ2A 2DQMA 3E80A 4ZX6A 5DS8B 4N1EA 4WFHD 5ANME 4KKBD 1F4AA 2CAKA 4MQSB 1J48A 4NZUL 3MXWH 1WRFA 1FL3B 5JHAA 5IVOA 1LP9E 3HAEB 1D5MB 4RZCA 2H5UA 2HRHA 1GTFA 2CHNA 3H0TB 3MRCA 5EUOE 4U7SA 1BF5A 2EXSA 3TT1L 4HK0A 4NAJA 3HNVL 5LBSH 3HLKA 3VE0B 2X1OA 2OV0A 5E5MA 2X44D 4ELKA 2BNUA 5C0IA 1KTLA 4RZKA 2NTSP 3VO0A 5LBGA 4F93B 1LQSR 2J57A 4OJCA 4PGJA 2AEIT 1RD6A 2W59A 2Y7NA 1J87A 1FG9C 1EFQA 4PY8J 4KO6A 3T2PA 4BQ9A 5H2BB 3UADA 3P69A 1IRAY 3QH3B 3ZOAA 5GGUB 4AYSA 4KTGA 4P3CH 1L6ZA 3CVHH 4MDJA 5IFHL 3H4HA 4R6UA 1ZS2A 2R0WL 3CDFA 1CI3M 3GSQB 4GP8B 4S2SB 2F5BL 3ULVL 4DN4H 5KTEL 1IVTA 1GGYA 1TUPA 4A2MA 1C8QA 4ODVL 1BGXH 5F0MB 1JZGA 3SDAD 1EA9C 4UNTA 3Q6FB 5HDQH 3SDDD 2WXNA 1ZA3A 1W0WA 3Q5TA 5CJBA 1YEJL 3PFUA 4MQTB 5ABZA 5A6IA 4F2EA 1NZRA 3BEVB 1NC2D 1HSBA 5DFTA 4WJ5B 4QRRE 5LN4A 2DIEA 3HZYB 1KB9J 2GJ6B 2DPKA 4OLEA 5D7IB 5HHNA 5FDWB 4DP0X 1R46A 4Y1TA 5BMFH 4G1MA 3MRPA 4POUB 3C5ZA 2DRUA 4WTZG 1ZLSH 2YRZA 5JOEA 5GISH 5ESAA 2ENJA 1MFDH 3V6OC 1W8NA 4DKEL 4P2YA 4POZD 3RWCB 4ZW3A 3BYTA 4JLRA 3LKQA 2Y2YA 4OFQA 1KJ2A 2WZ0A 1OT4A 1WGOA 1INDL 2C3VA 1MNUL 1OT2A 1TZGH 2XFGB 2IADA 1SFHA 4IBLT 4MJ6B 1LWHA 4OGAD 3K6SB 2FO8A 1GPOH 2O61B 1RY7B 4BXVA 1HEZB 1NGZA 2KQMA 5CEZD 2JELH 2OJZH 3MRJB 4O4YL 1RIUL 4LPCA 3KYNB 4PEEA 4IBWA 1KTDB 3NFPB 2L7UA 4WRLA 3QVAA 3D51A 4YDNA 4U4IA 3W5NA 4KMLB 4M03A 3N6YA 4XC3H 3WFDH 1MCKA 2WUBH 3QDGA 3ZT6A 5FYLE 3FF7A 3VI4B 2IIJA 4XHJD 4YVNA 3IFPA 5CF3A 3GXUB 1UA3A 4YK4B 3PPEA 4R26L 2OSLA 2XWTB 3MV7E 4NKIH 1GCYA 4JS7A 3R1GL 3J07A 4LRIA 4LHJB 4Y4HA 5DC0A 3HLAB 3O6FA 4E9QA 3FQNB 5L0QB 1BOYA 4QNPE 3ELQA 2XA3A 3OLGA 5AL8A 5HYJB 4GLRI 1X9LA 4M48H 4KXDA 5J0BA 1BWMA 3B3IB 1BJ1J 3SKMA 3F6JA 3MGAA 3QUXC 3BQUB 5KVMC 5C71A 4S0TD 3U1QA 4HOMA 1E4XI 4QKTA 4D0DA 4IBVA 4JFPB 5FDYA 4GUOA 4H8WH 2WYIA 2ODHA 4EDXA 1BOGB 4MZ3A 1X5FA 4H8PA 3EFDH 4PJXB 5IMMB 4QRTA 1TVDA 3LQZA 1IBYA 3VUAA 2UX6A 2X0UA 4H88L 2XQYG 2R69H 1GXEA 5T5NG 2YAFA 2YAHA 5SX5H 3PUUA 4Y8DC 1TLMA 1DSYA 3TJHD 2J4WH 1BYNA 2CM5A 3BMWA 4KI5D 4LCCA 4P9HH 3RWIA 4XWGL 3EJJX 4HZ1A 2M26A 3RB5A 2BP0B 3AU1B 4YSCA 4UZUA 1PEZA 3QJUB 2NY0C 5SWZB 4H2AA 3HS9A 3RDTA 1E4KA 5DT1L 2W9LA 3TT1H 5FS5A 3ZQWA 4HIEB 5D9SB 2AC0A 1KPVA 1ZTXE 2EYRA 1FLRL 2ZKXA 3FN3A 1B88A 4RETB 3KBEA 1AVAA 3DMMA 2WLIA 3UTOA 2R2EA 3MLVH 4HV8A 3LEYL 3DUHA 3V6OA 3O3BB 4MD4B 2FEDC 5CMAB 2CK0L 3ROOB 4IOIA 1KNOB 4RWYH 1G5GA 2Y72A 3G5WA 1MJ8L 4P2OA 4BBWA 2VXSH 5LNEA 3ARFD 1QAWA 1TITA 2ORBH 5CN1A 1T5WA 3LIZL 1NLDH 3IE9A 2E47A 1U8IB 4NZRL 4K5MA 4X4YA 3VI4F 4UIKH 3QXAA 2QSTA 5D96C 1YPZF 4OGYH 5E00B 5DD0H 3VXRA 2D9QB 3HMWH 3QUKA 3MV7A 4KITB 1AIFB 4HKZA 2Q87A 2YSSA 4XCCH 3BRDA 1N5YH 2NYYD 5A6MA 3T0EE 1SVCP 3BWAA 2JJUA 2XV6B 3CDGA 1OAQH 1YC7A 4TVSa 3U1PA 2R0ZH 2VDRB 2VGLM 3ZGHA 1S9YA 2HA1A 2JNZA 1LL1A 4WEBL 3D0LA 2BHZA 4IRSB 4WJG3 4EAEA 2HJKA 5IIEB 4UQ3A 1F4XH 3VXNB 1M05B 1P1ZA 2ED9A 3AFLA 1TEYA 3ARFA 1XD0A 4K73A 2BVTA 2H2PC 1AJ7L 3V0WH 3ZTDC 4I18C 2QL1A 3C09B 1KTDA 3NFPA 4QO1A 3T8XB 1N2RB 3VWJA 3ULAB 2DWEA 3MN8A 1OPGL 3S5ZA 5DD6A 4O02H 3QT2A 4P2QA 4NAMA 4K7PH 2Q8AH 1AKJD 1JNLH 4MCYB 4HKBB 3DX8B 2EIMB 3AROA 1XH2A 1EEQA 1SQ2N 2P8LA 3DX9A 3BDYL 5EB9A 32C2A 2J6EH 4KRPC 4FFTA 4QRQA 4AH2A 3V79C 5DJCA 5FECA 1I1FB 4TUUA 5FUCC 4ELDA 2IWGA 5I23A 3FO0L 3MBED 5ICUA 2QSVA 4HSQA 3W1ZA 2FJHB 4LGRB 3SKNB 4F37F 2KZKA 4FDWA 3MI6A 1DO6A 1JZFA 3GLDA 1N59B 4GRMA 4YFLF 2A74B 5HGDB 5AAMC 1E9QA 2IH3B 5BQ7B 1JCKA 1R3IL 4Q58C 3O9WD 3QIBA 4WEEA 5FO8B 3E1F1 4JE4B 2QKIC 3HE7C 3BPOC 1H9DA 3QIBB 1VENA 5IBLC 4AL8L 4Y0GA 4NDMA 4BCZA 1ZT7B 1RIHL 2N7AA 5AOKA 1I9IL 4P2CG 5AVYB 2GFBB 3QWRA 3VTMA 5MENE 1JK9B 1DDHA 3WS6C 2NYZA 4BSVB 1XHHA 1XZWA 3FTZA 5FKPA 3KXFB 3DROA 4U1NA 2K9UA 1KCSL 3RPIA 4F2FA 5KW9H 3GD1C 1FSKB 5M95B 4XXCA 4G7YL 5IY5B 4LU5L 4YC2C 3EHBB 3L3HA 2C34A 1BFVH 4RAUB 1AGFA 4P4KD 1KGCD 4PJBB 1ZLUK 2VSCA 1UD4A 4G9DB 4RAUA 2B0SH 1PCXA 2JIXA 4TUOB 1ET8A 5GRJH 5IUCA 2QGBA 3MTRA 3OPZL 3NGBB 2J2ZB 4KNSA 1MFAL 2GC7C 4XVUC 3NDYE 4FKHA 4FN0A 1EJ6A 1SMAA 1C1EL 1QWNA 1EHLL 1TZAA 3EADA 2NW2B 1A7OL 4F8TA 1Q4NX 5DD6B 1SHMA 1DP0A 1TTBA 4W4OC 4UV4L 2GI0A 5FA4B 1VPOH 1FC1A 1U8KA 2E4TA 3LXUX 5HY9A 1NC4B 2OX5A 2WXKA 3LPGA 1OE2A 1KFAH 2BJML 4D9LH 4ZYKB 1W72L 1MCNA 1YUKB 5E6ID 1GKEA 1RSYA 3S4SB 3VRIA 4EUPB 4MMXC 1EFXB 4GP4B 2LU3A 4QYAA 3C5XA 3O3EB 4L3EB 3RWFA 5F3BA 4AGMA 5E94B 1JHKL 5CZVL 1JTPA 3RA7L 1J18A 1NCDL 4W68A 3AXHA 4N0FA 2XDHA 4F7CA 3FFCA 3VH8G 5CLWA 2DWDA 4JGJA 2VERN 5GS1A 1R3KB 2YPLE 4NXKA 4WUKL 2DKSA 3B7UX 4N2CA 5K69A 2NY1B 2XXGA 2QQKL 4G5ZH 3QNXA 5CZXC 1XF4B 3BX7C 4FFYH 5I8OL 2ZJSH 4PJHE 4G6FD 4EBQL 2EABA 1FV1A 2MMXA 4I2XA 4IOSD 2XYBA 2NXZB 4X9FA 1TF4A 4KRMB 2FH6A 2RQEA 5EF2A 2VDKH 3RGBA 1GS7A 4DFHA 2WXLA 3O3BA 4MD4A 3VI4A 2AJYL 3N41F 1GGIH 4X7SH 1KG0B 1A9BA 3BAXA 1J05B 1NCWH 2D7PA 2DYPB 4W9ZA 5JQ6L 2RQ8A 4XNQB 2L3BA 5I15H 3NJFA 3L3OB 2DY2A 4QOKB 3M86A 4EN3C 5HDBB 2DWYA 1KCVL 2VZSA 4FS0A 1M7XA 2Q9OA 1YEFL 2VLRE 3KPQB 4AMKH 3G04B 4OI8A 2B1AL 1A8ZA 3IJ8A 4N2BA 2GY5A 2HT2D 2JKNA 3PGCB 4LE8A 4YIQA 3ESPA 3B2VL 3LRSB 3GSNA 2YJQA 2JKJA 3DTUB 4ZMLA 2FD6L 3OBAA 2FUTA 2BP3A 3BESR 3DXAB 3QDJE 4HFUL 2Q6WB 4P57A 1OK8A 2BCMA 5KVEE 3KDMB 3DIFB 1MREL 3DVGB 4ZMWA 3AXLA 1FDLL 5BO0D 1TQVA 4YGVB 5T8IA 4A38A 5KVGL 3RU8H 3QWNA 3DVGA 2WJ7A 5ALCL 4DIXA 1EO5A 3KW8A 1LGVA 4CVXB 1ETA1 3L9RB 4HKXA 4XVTH 3L3OC 3V52L 3BISA 3ML8A 3D3VA 4YPGB 2C4XA 2XG4A 4WTQA 3RE0A 4B3VA 4ZMNA 5KSVB 4FHBD 1XGTB 2PO6A 4HH8A 4J3OH 1CXHA 3S37H 2FIKA 5EBWB 3Q13A 4NC1C 3REWB 5INDB 1BHGA 4FQQB 4OZFB 1CFSA 4F33A 3SYPA 3L7FB 1UH3A 4BSJA 1NMAH 2B9BA 3K1KC 1HQRB 3SDCA 5DHEA 1IT9H 4Z7UB 3LKOA 4IMLA 3E6FA 3N0AA 5IMKB 3WLWC 2OYPA 2YUWA 2B20A 4XHJC 3ARUA 4O2CB 2XX0A 3IDGA 4HJEA 1QATA 3X17A 3FRUA 3V9CA 3ZZQA 3AS1A 2BZ7A 2GHZA 2AEPH 4ZNEA 5A1AA 2QHRL 1KIPB 3C6LB 1KSRA 5MEQA 4OGZA 5DUMH 2CPUA 3W9EB 1QI4A 2DLGA 1AD9A 1NGQH 2KPNA 1LE9B 3IDMA 5A40E 1SRDA 5HYIA 3NFSH 4HFUH 2F8VA 2OSYA 3MV9E 1A3QA 4C56B 1IUZA 4OFDA 1B0GA 2AW2A 1U2CA 2J43A 3OXSA 5HGAA 5HHME 4IYKA 5LCVL 3VXTB 1BPVA 3MLWL 1JWUA 2PR9A 1S7WB 2PP8A 4GRWB 4WSKA 1YEGL 2WXFA 4O2FB 4R84A 1CG9B 1GA2A 5DHXB 4PI2A 1O7VA 4PJXA 5IMMA 3PAZA 1X3DA 4IHBA 4WV1B 3RWFB 5F3BB 1JGUH 5DZJA 2QHRH 2VQUA 2NY2C 1U30A 2JLLA 4G1MB 3KPPB 2WNWA 2GY7B 4D0DB 4CL7A 3MV8B 2FE0A 3OKLA 4OSUL 4R5XA 3IDIB 5MEPB 3QZWA 3MRQB 5EOCL 4BD4A 1MUJB 4N1HB 1B4RA 5BO1H 2J88L 1ADWA 4OZGB 4BKTC 4E5XA 1RVFL 3RB7A 1OSYA 3S4SG 1ZA3B 3EG9B 3ZQXA 1S5HA 2ZF8A 3QRGH 4YPJA 5I1DA 1IBGH 2XIBA 4GRLA 5F3FA 5KSBB 4R97C 1KB3A 3QJFB 5T1LB 3U2SA 3SGJC 3WL9A 5IFAH 1A5FL 2PWEA 3OTTA 1CF8H 1H6UA 4PS7A 4R7NB 3RY6C 1PBYA 1VACB 3HEIB 4PTUB 3GSUB 4XR8C 5LLIC 1AHWC 4F57L 1KC5H 2AK4B 1MCSA 4MVBC 3G9AB 3JV0A 3SODB 4ODUA 2C1PB 1U8LA 2LVEA 5ADPL 5ITBH 2AP2A 4KI1A 4ZS7L 1A7PH 2WOYA 3CQQA 5AW1B 1DVSA 1OTUC 2Z64C 4YDVB 3L3IA 4H2CA 3F2LA 4MJ6A 3UIYA 2W60B 4L5FH 3O8XA 3GM8A 1CVSC 3WDJA 1LNUB 4OZFG 4ZD3L 4ES8A 5EORL 4DP8X 3QIWA 2Q0ZX 5IR1B 4UILL 3EJZD 3PE9A 1WUZA 3SGKC 2BFVL 5BVPL 1XR9B 2OS7A 4NO2A 1CE6A 2WLYA 3DC0A 1XR9A 2KS0A 2YK1H 2VLMD 2EDYA 3F7VA 3L81A 2R59A 3DGDA 3C60B 1NFAA 5FPIA 1Q9OA 3DDFA 4HAGA 1FFQA 5AD0A 2WLLA 4ISVA 3O3DB 5B1BB 3NIDE 2N56A 3VW3H 1JRHI 3MOQA 3HPJB 3TBVA 3HFML 3PP4L 2N7SA 2IGFL 4CMMA 2XTJD 3ETTA 4LL4A 1ZCRA 2ZSWB 2F68X 4NP4H 2ZG3A 5JHLH 2JB5L 3F7YA 1SN0A 3VSUA 5AUMB 2B1AH 2XWJB 3E6FB 4MAYA 4OZIE 4XMTA 4IJ3B 3RIFF 4OLUL 1U8QA 2EYRB 3ZKMD 3CFDA 3L48A 4M43H 1G6RA 4GI6A 4PAZA 4WEMB 4Z7OF 5K9KB 5FYJD 4LSRL 2R1WA 1EPFA 3LKNA 4I77L 4FL4C 3U36A 5D2LE 3PGDB 1U58A 1D5ZA 5ERWB 4J7RA 3SSGA 5D1QE 3FH5A 1KJVB 2QSCH 4FG6D 1D9KB 3GK8L 3WIHA 2Z35A 3N04A 4X5WA 5SWSA 1EJ8A 3U25A 3O9WA 1J5IA 4PUBH 1PY9A 1I82A 3SHSA 5AALA 4HISA 4TTDC 4FMKA 5KN5A 4FNQA 3UZEA 2HJLB 1XGQA 1NM9A 4A1RA 2BSED 1R9FA 5FK9A 4ES9A 4FNLH 2HXAA 3OKYA 1P5VB 4Z95H 4X4YB 3L5XL 3IF1A 1MZZA 4MB4A 2VKWA 3UYRH 2ED6A 3EOYG 4GG6B 4JFFA 3MKKA 3CLFL 2RAMA 1BMZA 4PRHD 2OMVA 4NQSB 2YXFA 2MFNA 2FHFA 3OZLA 4XPTL 4B7IA 2AEOA 5CZVH 1FNGB 3GIZL 3F7QA 5JW5A 4BE6A 5D4QA 2YR3A 1FA4A 4AG4L 3CSFA 2YD8A 3K3QA 4XX1E 5JIKA 4WHTA 1BFVL 2NQCA 3HC3H 4FZ8H 3ARPA 4PJIF 5IESH 5L6YL 5AB2A 1UWGH 1G7JB 3BP4A 2GSMB 1FNEB 4NJ9L 2Q7YB 1S9KC 2WZPD 3FT0A 3AACA 3HIZA 5ENWA 3VQ2C 5DJXB 4P05A 1Z9SB 3SGDH 3FO9A 2OL3H 4UINL 4X8JA 5EOQL 1G7MA 1OVZA 1VPOL 4QNPF 1KBVA 3P0VH 3QPQC 4M5TA 3TXAA 5EU3A 1TMCB 5J3HD 1GAFH 4EOWL 5AVZB 4FG4A 5DZOA 1JGEB 2IAMC 5DD5H 1PW3A 2P7TA 4LKXB 3B9VA 1E6OH 4JY4A 3BEWA 3ZE0B 5T5NF 4HC1L 3VXRD 1T2XA 3ZTEA 1KLGB 4PGBB 2L8AA 5DURB 4TOYL 4JPKH 1CR9L 3BN9D 2Q2LA 3FKUS 4HLZG 1O6SA 3AGVA 1KY6A 2ID5A 2DM2A 1CIDA 2YD6A 2CK0H 3UAJD 3WIIH 1BOGA 2PWDA 4E9RA 2DH2A 5E2UL 2Y9RT 4UQ2A 2GAZB 4APXA 5AOIA 1TYRA 1YYMH 5CBAA 2EDTA 3DOIA 5AD0B 3JV5A 3G5YB 5AW2B 2MPVA 3BEVA 4N0CC 3ARGC 4HHGA 4ZXBD 1XF3B 3QCTL 1DEDA 3RX7A 2VAAB 4UNIA 3HUJF 4S0HA 4GXVL 2VDPL 2PYED 3NG5A 3SDYH 5J6HB 4KC3B 4U1MA 3WFZA 2VSDA 4ZPVA 5IJVA 1D3CA 1PTZA 3ETSA 1QPKA 2A74A 3LYRA 4NUPA 1EHAA 2AJXH 4BQBA 5G5DA 4YLQT 3N40P 2G0KA 3TIEA 3BO8A 3U1SH 3UJIL 4CGTA 2DQHL 4HKJA 3PDDA 1UATA 3HKZA 2WXPA 2B15A 3HZMA 5ILTH 3RFRA 5A16B 3LH9A 2O61A 1P4BL 3UJJL 5AOZA 3GIZH 1ZGLB 4N85A 5C9KA 1HOCA 4FQ1L 2UY7B 1QSFA 2OLDA 3MUZ1 3BFQG 2FT8A 3P0GB 4R8WL 2NNFA 1NPUA 2ZKYA 1T0MB 2FWOA 4JZJA 1V55B 1B9ZA 1XEDA 3C08L 4EQ3A 4L9DA 3MNWB 2DMCA 5LO7A 1JWMA 2JIXB 3GTVA 1M7UA 3OMIB 5C0AE 2DQDH 1A6TA 1CLZL 3MCG1 4LPXA 5D93C 1E27B 1V54B 4WEBH 1CZ8H 4R26H 2YPKB 4U1GB 4CADA 3AITA 1JYVA 3LEYH 2VXVH 2D03L 1V7NH 1CLYH 2ZKWA 1J1PH 2ZP9A 2R4SL 5HJBA 1YECL 3D3VB 4YPGA 5K93A 4U31A 3IDIA 3HI5H 5C3TA 5HXMA 4HZAA 4OCSL 2ATKA 3GK8H 5CUSH 2VLJE 2BSDA 4YHML 2A9ML 1J10A 4NN5B 4O02B 2H0JA 4I0PD 4K7PY 2E8YA 3HRPA 5BXFA 4ZW8A 3V0GA 4MZIA 4CSSA 4E0RB 3LMJL 1W0WB 4GIAA 5BZWA 3WDIA 3SGDI 3HZ3A 3EO9H 1DN0B 4XMPH 3LN4B 3SYAA 1JF1B 1E28A 4PRID 1Z3RA 3F7LA 5FF6B 5LAPA 5BVJA 5K59F 4UIMB 1DVQA 4ESKA 5EOTA 1HS6A 1YUHA 2CUMA 3HUJB 3BIBX 1UACL 2WC7A 4HEPA 1R0AH 1UM6H 5AVWB 5IQ7L 3U46A 3D4GA 4ONFL 4PJDA 2NX5D 4WI6A 5I19L 1T2JA 3TFBA 5I76B 3PWPB 1AD9B 1LE9A 2JXMA 2QVKA 1GOGA 3QUZC 4JFSA 1P4UA 1J5CA 4J3OC 4PG9B 2J25A 4NO0A 3OJ2C 3EW3B 4LKCA 1OT1A 1JPTH 4ELKB 5GIRA 3S3BB 3SDXF 5GRVL 4B9CA 3KPMB 4L4TD 1P5UC 1JERA 3CE1A 3MOBL 4FQLL 2M8XA 4MKTA 1E2VA 2DM4A 1WLHA 2XRAH 4PV8B 2EXYD 2FX8H 1I8KA 2X9YA 3PABB 5E00A 5MEOB 3D34A 3SJVE 5E1GA 3N1MC 1X4ZA 4U1SB 5KVFL 1XXDC 1OIOA 2ZTBA 3QZWB 5AVQB 4B0MB 1N5AA 1TZIB 2Q76A 1IFGA 3P77A 3BIAX 3GSVA 3T71A 4K71C 3LB6D 4DVBA 4HSCX 4MA8H 3CN2A 4MYWB 1NUNB 3P30H 4KJYA 4N87A 4TYUA 2R7EB 4NO0D 3V6ZB 1Q0EA 5EO1B 3CZKA 4XX5A 3SZKC 4FX5A 2EECA 4LEOA 4TPRL 4Z3JA 3IVKB 2ZKMX 2H6UA 4M8QB 4AUYA 3KH4A 1QBAA 3VI3B 2WLZA 3L4UA 5L4MA 1KV7A 5EDXA 5C6PB 3JWDC 2K3HA 3VYNA 5F96L 1IGFH 3LRGA 2CO7B 4LSQH 4HZLB 1J9TA 5C0EA 2XWZA 5IVZB 2IOIA 2X1QA 3U7YH 1QEWA 4P2RE 2XV3A 4J12A 4P5KA 1S7UA 4XI5C 3MCYA 4C56D 5EU4A 3KVPA 4FFZA 2XN2A 3QJXA 5FXCH 2ZSVA 1DO5A 3AY4A 3X3GL 3QDAA 3H85A 4I18B 5DJ8A 4EUPH 2HVJB 5A2BA 2WXIA 4N9OB 3ZDZF 2X1PA 1WAEA 3CMGA 4OJDH 2VDQL 1E5CA 4GKSA 4XHQA 4YDLB 5ETUA 2CD0A 2J88H 3PXJA 5DR5H 1DQJB 3NA4A 5I5RA 1T1WB 3VFSB 2P43B 3QEQE 5KVFE 5E5UB 4LKCB 4W9EC 1JDAA 4HCFA 3TBBA 1CFSB 3TWCH 3ZE2E 3MRLA 4DP9X 2D2CC 5IB4B 5SWZA 2CLVA 4D8PA 4WO4B 4UTCA 5T5FL 5J3HC 4AQEB 1F6AB 3K2UH 2HH0L 3A22A 4V1DB 3EO1A 3SE3C 2XACC 4BFJA 1J5OL 3K6IA 1MNUH 2HKHL 1E65A 3SJVD 7FABH 2CBOA 2VZOA 4BSVA 2J1XA 3FYEB 4IBYA 2EVFA 3CV5A 1O6VA 4JY5H 1BAWA 1YEHL 4K9EL 1FZKA 4H8QA 4NUMA 1U8OB 1UWEL 1FL6B 5GISL 2N3JA 4OLXL 4IOIB 3WKPA 1AKJB 3HE7D 2VAJA 1SUJA 1XX9C 3N91A 3V4PL 4GKZA 1MF2L 5DZ9A 3DYPA 4JKNA 5M94B 2HFGH 3HNSL 1YN6A 4D0BA 2VERA 4IHOB 2H8PB 2E74C 3VXUA 1R5IB 5AAWA 4LIQE 3VXRE 2DJMA 3GJEA 1AE6L 4A2EA 2EO1A 1UGNA 4HF5H 3DV4A 3WTYA 4BELD 2A9NL 3TYFB 1L5GB 3FU7B 1JPTL 2XWDA 2N0KA 2YD2A 3NJNA 1BGXL 3OKKB 4WVRA 3US1A 3D0VB 3CFMA 4PJAA 2PXYB 2OULB 3ECVA 5C0CE 4H44C 4ZD3H 3H6JA 3INUL 4F7PB 4MJIB 2DF3A 5JDSA 4NQEB 2GI7A 5HYQB 5L8LB 4NBZB 4AIOA 3KEDA 4JM2B 5KSAA 1ORQA 4W4OA 1KJ2H 3HHSB 5I75B 5GHWH 1JZ5A 1E90A 2FGWH 1NSNH 3KPRB 2Z7ZA 5T1KB 1TTRA 4PRIA 3HHSA 3WSQH 2VDNL 2G3MA 3W3BA 4LF3B 2YD1A 2RHEA 3QPQD 1KGWA 3S35L 1WAAA 4MB5A 1MJUL 1QI5A 2JLPA 1MLBA 1ZVSB 1U93B 2ZCHL 3S9DB 1KLFB 1BZEA 1KN4H 1T04A 3SE4A 1H3TA 4DO5A 4G1EB 3BE1H 5L4JA 4LCWB 4NC2B 3PREA 3CZFA 2PR4L 1NINA 4I89A 4WFFD 4X9GA 3S5YA 1TZOA 2WLJA 2P80D 1QNIA 5IBTL 1OAZL 5F7DB 1ED3A 3TBYA 4FJ6A 3MXWL 3NA9L 3QEQA 2F61A 2XWRA 3OF6A 3QEUA 3WAKA 43C9B 1UA6L 3O9WC 3QORC 2LV4A 5JA9A 4QRAA 4PJHF 2J6EA 2KL6A 1H8OA 5E2VL 4FQXC 2AJUH 2COQA 3FT2B 5HHNB 3EDFA 3F6LA 2VRKA 2ZX5A 3ALWA 1Z5YD 2YZ1A 4ERSL 4MXVF 2J12B 3QFGA 3VXME 5DQ9B 2DH3A 1AZRA 1DJSA 1KB5H 1T66C 2Z0UA 4QRSB 2C5DC 1KCBA 4WO4D 5FW6A 3GZOA 3BT0A 1YEIL 4OZGF 1BZ7B 2CJUH 3UO8B 3AREB 3OXRB 4JG1H 4ONHA 3QNYB 1PQZB 1N0XL 2OW6A 2FRGP 3T3MB 3AQZA 5JO5B 3U4BH 2Y7QB 2B59B 3FTYA 1FNFA 5TE7H 1TO4A 2R69A 1SXCA 3GUTA 4QAWA 3BLKA 4P59L 4HS3A 5I5IA 4FI7A 5DRZB 1GCFA 2CG9X 5HGBB 4NZ8A 5H2BA 1CDHA 1IBHA 3ROLB 4QO1B 3T8XA 4YJZL 1TPXB 3Q8EA 4JHUA 4HS8L 3MRIA 4N6QA 4PJ6A 5T3ZL 3SOBL 2BCKA 4WI0A 5C6TH 1HDMB 1HILA 4KUZH 1XCTA 2Y36H 3IS0X 3VXQA 2B7DT 1QBLH 3ULVD 4NO3B 3WKNA 7PCYA 1W9XA 3A6BL 2O6CA 3U48A 3CQFA 3CH1B 1L7IL 4G8GE 3ZHFA 1SJMA 3O45B 3KWUA 3H9YA 3CX5K 4NT6B 5C0BB 1W8OA 3LD8B 1RK0B 1N9PA 3CN1A 3SE8H 1I7RB 1YNTA 1XR8B 3AG3B 1YO4A 3LHPH 1N4XH 4W9GC 1MN4A 3APNA 2CXKA 1M71A 5EZOL 2MQCA 4Z78A 4AT6A 2Q1EA 1IGYB 1RZJL 1WFJA 2YQ2A 3N43F 5JW5B 1R17A 4ONGL 3BZ4A 4GUQA 4YNYA 3US9A 4JZOB 4GQ9H 1GL4B 4AEHH 4EI5B 4ZI8A 5ISZA 2P4AB 2UWEE 3MUGB 5JXEC 1EAPA 4RFEB 4DGVL 1GZHC 4MSWA 4NP9A 2GJJA 5E6IC 2FO4B 2IOOA 4FQIL 4EI5A 3EJUA 3HC0B 3EFOA 2VH5L 1RPUA 3B2UD 3UFIA 3DNKA 2CNYA 3IF1B 3MFFA 4PBVC 1KIPA 2DD8H 2A6DB 3JWNC 3QUML 4B95C 2K4AA 1KT2A 4G8IA 5ECJE 1R34A 2X70A 4HDIA 2VZTA 2CLRB 3ME0B 4FI8A 1IAOB 2BY3A 2OMZB 4I1RA 4Z7QE 1E6JL 2ADIB 2DQEH 3RKDD 5BV7L 1AXTH 4KX8A 1PAZA 3SDCB 5GS0D 4PGEB 5I24A 1HHGB 2ZAGA 1AXTL 2ICWI 1MFEL 3G3LA 5CD3A 2WNKA 2A9DA 4HIEA 3EZJB 2HFEB 4WWKD 1XXFC 4G9FE 3RFZA 2YKLH 3STZA 4TULL 5BS0A 1JI2A 3MRJA 4UTBL 1RUQL 2NCMA 4X9HA 4TSAH 4XOBA 3F84A 3JYBA 5EIIB 4YFLI 3TBTB 5L7XL 4GS7C 5I6LA 2X4UB 4CMHB 1U36A 3FB5B 4ECNA 4PB9H 2K7PA 3QQ3B 5JZ7C 1GYVA 3ARDB 5DJ6B 1DBAH 1E50A 3CFBA 2BIOA 2ZJSL 5CP7B 5CCKH 2UYLA 2WUCH 4JUSA 3SEPA 4CSZA 3BSZA 4ZQKB 3QZBA 2QQKH 4G5ZL 3UTSD 1E7VA 3TBVB 1NMBL 2WKOF 4UOW0 5GSRA 4PN6A 3WL9B 4DESA 3HC2A 3OPUA 4YIQB 3VD7A 2XA8H 2ZUQB 1PDKB 4FQPA 1IBBA 2BRRL 3EJRA 3PS6A 3RZCA 4TUKL 5AW3B 2AQNA 2CZNA 2NQ3A 3RDTD 2ZUWA 4JHWH 2HVKB 2VL5B 5D4JA 3WS3B 1BPLB 1OF2B 4ZPTB 2TSAA 5IB5A 3MRQA 2JCWA 1WAAF 1SHWA 1IMHC 4QHNA 5L9DH 2BM3A 2ARJA 4MNHA 3O6FC 1OP3H 4UZGA 1VIWA 3ILPA 4UTAA 1H3PL 4PJ7A 2DEWX 1LK3H 4M5ZH 3OGOE 4JRXB 1IARB 4BZ2A 3SN6N 3KZ8A 1UOVA 1HCFX 3WU1A 3TURA 1X9UA 3FH8A 3HPLB 2WVVA 5DRNA 2NW3A 3T0VA 4FG6C 4LB8A 1EMTH 1HAWA 3GS7A 4AYFB 1NOAA 2BNQD 4NN7B 5C8JB 5JMOC 5B4MC 3QQ9D 2VZUA 1CL7I 3KYNA 4K3JL 4L4VB 2YUZA 5C08B 4OZHF 4X4XB 3CFTA 3NTCH 4F7KA 3WNIA 1ZS8B 1O9ZA 3DPBA 4QYOA 3RILA 1F6AA 1IGMH 2VUYA 1AAJA 1HK6A 1JK8A 2KQNA 3OJDA 2W65B 1WYJA 4QWWC 1CD8A 4LCIL 1LEIA 4ZMAT 3J2PA 1IM3A 1KDIA 1OGPA 2BMKA 1A1OA 1QD0A 3FN0H 3NUKA 4ELMF 8FABB 3AUVA 3GJFK 4P9ML 1FFPA 4U6XA 4JY4B 1ZLVH 5JYLA 3JTBA 1BXUA 1X5IA 4MJJA 4DUVA 4ZX4A 5JW4Q 3ZXAC 5DZNA 2OMUA 1I3GL 2QDWA 1S9XB 4F3FA 3QYCA 4WHYG 5C07D 5JQIB 1P4LA 3U0TA 4N2MA 3NQKA 4P5TC 4X6BB 5IEKA 5JYMA 3DVNB 2IPKA 1BSIA 1QHQA 2SEBA 4YGAB 3DVNA 1PPIA 1KYOJ 3ZO0A 3FU7A 3S3DB 1PDKA 5E8OA 3WTUA 1E27A 4X99B 4HULB 1BQHA 3KD4A 4I5BA 3QZWG 3NMEA 4JKPH 4LOUC 1TNNA 3QORD 4X7EC 1E4WH 3QEHB 5F21B 4AV4A 1CT8B 3GFUA 3VD0A 1NBZB 1RZKC 5ESVA 4ELME 4P9HL 4OLVL 4F57H 4DO4A 1WBYA 3L3GB 3IKCB 1A6WH 2YMXL 3EOBB 5C09D 4M3KB 4XCNB 4A7VA 1KLGA 3GDCA 3FRPA 4LCWD 2B3RA 3TWYA 2X3BA 5EDSA 4UT6A 3EJYC 5IFAL 3ARBC 5EZOH 1NGZB 3M6DA 3H9ZA 1KYAA 1UWYA 3NRQA 2X4TB 4UM9A 3NCJL 4U0RC 5GJSH 3TONA 4JG9A 4G8GB 5GS2D 3STZB 2NY6B 1VJSA 1DQDL 5C8JA 3U9WA 4ZXBA 2ROXA 2XSKA 4LHUA 5FYKH 1SDDA 1OPGH 2XXMB 2K0RA 1MLCB 3VMOA 2W8CA 4FXKC 4A63A 1A6AB 3SE9L 1GYUA 3VWKA 4W9HC 4FMFA 1MLCA 3FB5A 5KYUA 4U3SB 4KUZL 4XE5B 1MCOL 3FS9A 2Y5TB 2X6AA 4AE1A 4KAQL 2ICEA 3SQOH 1KB9K 1U8PB 1IVLA 3MLTB 2NTFA 2YLHA 3TBWA 5TGBA 4A66A 1F2XK 3OMNB 2NY0B 5C08E 5BS0D 5LGJA 1HL5A 1XIWD 4XP9H 5B21A 4MSWB 3RWDA 4DF9A 2DQUL 4YLBA 4N3UA 4F8LA 3W37A 2FGZA 2CO7A 5C08D 5KBNC 4XCCL 4AEEA 4PS8A 1KBBA 4WUUB 4ZTPL 5AWNL 3VM5A 5DD0L 2HKHH 5C0AB 1D5BB 3ATDA 2WWKT 3D69A 1TJHH 5EA0L 1R3KA 1EZVY 1J0HA 2BSRB 5C0AA 1UM4L 4P06A 4X7DC 2IPTL 3QDGE 5J89A 5D7SL 1IC4L 4K8RD 2OXGA 3QSKB 4E42A 3MV8E 3UTSA 2P24A 5DO8A 3EUUA 1TZHA 3C8KA 2DDQL 2LABA 4KJPD 3O3DA 4Y4FC 1KJ2L 3CVDA 3T8VA 1QSFE 4E9XA 3EYQD 1ZV9A 4NRYA 4ZFFA 1COBA 3ARSA 3GINA 4F27A 2I7SA 4L4VA 4KVCL 3MLYH 4OFYD 1XCXA 2VISB 2BCKB 3PHQA 3MROA 3MUHL 5K5YA 3S5LB 1UASA 4J8QA 5ESQB 2V9TA 5TQ2L 3X3GH 1EUTA 4ORZC 1ACXA 4PBWD 4NI3A 4KK9C 4Q6KA 3NEOA 2YXVA 2XPYA 3ABGA 4IOFC 2HMID 3CK0H 5I8CA 1I8MA 4OD3H 3T4AC 3QFDB 4FA7B 2P45B 5F7KC 1G9EA 4HP5A 3VU2A 2V5SA 5KYWA 2JCCB 3MJ8A 3HC4L 2DJ4A 4POZC 1OGTA 1MDTA 3RU8L 1S7RB 2LOEA 4Y4FB 2H2PD 4S10A 2JV6A 4IU3B 2FQDA 4AJWA 2WWMD 1Q1JL 4KPHL 4APQB 3LXBA 1E28B 5B1KA 1ZT1A 3FFCB 4F2MB 1B4LA 3CN0A 3BMVA 1FNAA 1A6VH 3LKQB 3TBSB 5E8EB 5E9AA 5B1CA 2B14A 1MFCH 3ZYZA 3JWDH 2PYEA 1JRHH 1X44A 3COOA 4WUUA 2C7FA 4JHVA 3QEHA 4KKPA 2VL4A 3DETD 4BRJA 3RKPA 3O2VH 4BUHA 2VR4A 1YMHB 3BAYA 4HF5L 5SWZD 1OARL 2EYSA 3K0YA 2ZOTA 3IMSA 5CSZA 5HI4D 1JDCA 1SM3L 3KLKA 3S36X 5D7JD 1FPTH 5CR8A 2BS9A 4HPYL 3UERA 4L4VE 3UABA 1PNDA 1FFNB 2DEYX 4CDHA 2FYVA 4EBQH 1I8KB 1QFUL 1B4TA 3PABA 3S36L 3WHXA 1VKXA 5DRZA 3P73B 4M4RB 4PU2A 5EF0A 5HPMB 4WHYH 3GSQA 4U3XA 1V5JA 4YHYC 1SDDB 2IFFL 3KPOB 2NW2A 4JQIA 7FABL 3VDBA 5EEYA 1IM3B 2FECL 4WV1C 4Z7VF 2C4FT 5C0BE 3WY3A 3WEMA 4NOBA 2BZCA 2BWQA 3GTTA 1QSFB 3STLA 2Y6SD 4LSQL 3QPXH 3T2NL 4RAHA 4Y2OA 4A6YB 1T89A 3FTGB 2AQPA 2RR3A 4IBSA 1F0LA 4DH2A 4BKSC 4Z7VA 1GPOL 1L9QA 2VC2L 2WXMA 4XNMA 3CFCL 4F7EA 1V7MH 1LE5A 1IEHA 3ZVVA 1EGJA 4DCQA 3PXHA 4DN3H 1TKWB 2J7LA 5D71L 3AC0A 1MRFH 4Y9FA 3W82A 2H32B 2CIKB 2KI6A 3P30L 5DMIH 1J8HB 5F70A 4WY7L 3PP3K 5GS1C 4FNTA 4L9LC 2E7LC 1Q9KB 5CILL 3QGVA 4AIZA 4FYRA 3UTSE 4YSEA 1HI6B 2X2YA 5BMFL 5C0JB 5AAPA 1BQ5A 3K91A 4B27A 5FO8A 1AG6A 1B9KA 4QHPA 1JZEA 4NPKA 4R2GD 3B5HA 4ZFGL 1AO7D 4GKNB 3IJ7A 3PRZA 4P0DA 3LS4L 5K9OB 4UQ2B 2ATPB 3UZVB 4P5TB 1MDAA 4PS4H 1WTGT 1E9PB 1IGTA 2QLVB 3DV6B 4WENB 5CS7A 2GIYA 3A0OA 1RCYA 1UM4H 1KELH 1E5UI 1NDGB 3L1GA 5C08A 3VCLB 1GMIA 4WW2F 3ZLQC 4BK5A 1VA9A 2PCFA 4M7ZB 2LVCA 4J4PC 3LHAA 3RVWC 1WBXA 2P49B 5ILTL 3TBCA 1A6UL 5J56B 2NY7L 3PWVB 2WXHA 1MAKA 3MLUL 3QQ3A 4HKBA 5JZ7D 1R0AL 3ZK0A 4KPHH 4MCYA 3PWVA 3S98A 2W65A 1UM5H 5KSUA 4FCAA 5FUCE 4JO2H 4NO3A 3TNNA 5J9PB 5DC2A 4WGKA 2ITEA 4KROC 3TBTA 3E8UL 4AL8H 3ZQ9A 5MI0C 3BEWB 4BZYA 2V9RA 4P4KC 1YY9C 3MRDA 4ODXA 1EEZA 4UWQB 2LT9A 2X12A 5TDNA 1A64A 2Z92A 4NRXB 4G59C 5EBLB 3WEXA 5FB8A 2I85A 3CK0L 4WNJA 1LK2B 1ZRUA 1Z9OA 1EUUA 4TSCL 5AYQA 1S7UB 2FL5A 4LSPH 4Y5YC 4JHAH 5HI5C 1YEDB 2NY4B 2VDLH 3KPRE 4Y5VA 3HR6A 3HHRB 1A9VA 1PF3A 1HZHH 1NCAL 4KFMA 1S3KL 4MNHB 5DMGD 3MLYL 3FT3A 1BD2D 3MRRB 1FAIL 4QTHA 4L4TE 4G83A 5CEXA 4MMYA 2CWRA 5HSFA 1F56A 3GSNL 1MY5A 3VQ1C 4IJ3C 1RURL 3UTTD 3KCWA 2FBRA 1VESA 2XZQH 1JNLL 2JSFA 1T80A 3VGEA 1ZKAA 3DO7A 3IDNB 5C9JB 1T0NA 1QLEL 3BOVA 4Z78B 1BECA 5DUPL 4ATTA 1U8NB 5EA0H 3CU1A 5DD5L 1P84K 1D5XA 2XN9A 1AKPA 3NIGE 3QS3A 4LF3A 5DK3A 4GAFB 4IIQA 2ADJA 3PWUA 4HEPG 1SBBA 2AK4D 3R06B 2R2EB 4IU2A 5DU7A 1EIBA 2PWGA 1F4XL 3DPDA 1WK0A 4IRZL 2OW7A 4N86A 4O2CA 4OFVA 5EH1A 3D1MC 4MNGE 3GTNA 3WE1A 1BFOB 1OALA 4NO5B 1K9TA 5I30H 1V7NL 4YXKL 3D25B 1FGNL 3QDMA 5E5RB 1WICA 2QBWA 4N2IA 1LK3L 1AZZC 1I3GH 3SDYL 5I28A 2E6PA 1F1GA 1KB5B 2Z35B 4X5WB 5J12C 5IESL 5HY9B 2Y1AA 3PYCA 1E4JA 4D7BA 3QUZD 3X1BA 3FN0L 5AOMA 3C8HA 4UM8A 2WCSA 3ZKMC 5EU6B 4NZRH 2O5XH 3CVBA 3JUZA 4PRPD 5E1AB 1LWJA 2CJ3A 5C0DB 4PD4K 1DBJL 3KGRA 1I7ZA 1DQDH 2FJGA 5KVDE 4HBCL 3IN2A 1NFDF 2QDVA 1HHJB 4WO0A 4Y89A 5FHBL 2KDYA 5CCJA 5IZ7A 2F58H 2NRDA 4M1CC 1VSCA 3L5XH 2FNWA 1PZDA 3C75A 4FHKA 4JGMA 1NFDA 3OR7B 5BNXD 1HNYA 3QJTB 2A0LD 3H2WA 4C56E 4OQTA 2X7LB 3EDEA 4A04A 3GWJA 4PV1C 1ZHKB 3LZRA 3T6QC 2ATPA 2X5PA 1EXUA 1MEXL 5B1AB 3UDWC 4LVHC 5DI8B 1ZA6B 4Z3TA 5AB1A 5MENA 3L3DA 4MB3A 4Q4EA 4M3HA 3FT4B 3QCTH 5DJDA 2Q3AA 1TFPA 1UADC 3UG3A 3FSAA 2QTEA 4M43L 2DI8A 3B6SA 3FSWA 3GXFA 3OSKA 3BUYB 4HUUA 1YG9A 1G43A 3H8NA 1EO7A 4HU2A 2FR4A 4OLUH 2WD0A 2NMSA 3P02A 3EF4A 4FG2A 4G9FB 4MQXC 4YHIA 4JVUA 5IMLB 5F7DA 5BV7H 4Y16B 1U3HA 3CC5A 4XMXA 4N2LA 3PLYA 3DDGA 2FWLB 3EO0B 1CGSL 2UY6B 2XPGA 4NO0B 2HVJA 1P2CB 1AQHA 3VFTA 5AENA 2WUCL 2Z8VC 4HMDA 5I1EL 1ETZA 3F01A 4JDTL 1JFQL 1OK0A 3I02B 3NCBB 3R0MA 3LKRA 4AQ1B 3QE5A 4KRLB 5EN2B 3ZE0E 1XQ4A 4AQ8A 4KXAA 4NN5C 5ID0A 5MERA 2BNRD 4LPYA 1IAKB 1ZTMA 3ZHDA 5DQJB 3QG7L 1TU2A 4G6AD 3HN3A 2NCEA 2NUPA 4L3CB 5IVXE 2YN5A 5A2IH 3B83A 1OD7A 2IGLA 5E0FA 3WFHA 5IHUH 2W0FA 3IBOA 3LIUA 4KY2A 4MAYD 2UWEB 4MXWH 5L4IA 3WXWH 4I48A 3KCPA 1QHOA 1XMWA 1NGYB 2C9UA 1S7TA 4I87A 4HWZB 1N8ZB 2WPGA 4OF7A 4IKIA 4ORGB 5D1QA 1K8DA 1NAKL 3PWLA 5SWSE 1U8MA 1EJFA 3LN5B 2WLMA 4X99A 5E99L 5B39G 3H7BA 4RA0C 3SBPA 1Y07A 3QI9D 3H3BC 3BUPA 1UCTA 3OWRA 1VRSA 3QUXD 4J3XA 3WFDL 1HXKA 4AGPA 1MCCA 3R8QA 1A7BA 5JHDA 3L2LA 4UT9A 1B4JH 4XP5L 2XG5A 5IJVB 1B3IA 3QAQA 2R23A 3D85B 3PY9A 4KU1A 1JGLH 1UWFA 3TCTA 4KHXL 2HX9A 2HLAB 2E8ZA 3QFJD 2EIDA 2HFFB 1J8SA 3HS0A 4PJ8B 3IJ9A 3H6AA 3V7AE 4A68A 3AJ7A 1MCWW 1URLA 3QISA 3C5SB 1XIWB 5IGXH 5C0RH 1LLAA 3BUDA 3PWJB 2IWEA 3IFLH 2R1YA 1XT5A 2YN3A 4M00A 2AI0L 3IMBA 4ZUSA 3CLEH 2EVHA 4K5NA 4YDJB 3VD3A 3QNFA 1MFDL 2D4DA 1U8LB 3GSXA 1Q9LB 5CP3H 5C86A 5FYLL 1TJXA 4XCFL 4AYFA 5EMYA 4Y2DA 5EO9A 1XH1A 1G0YR 1M9SA 1QACA 2VO8A 3BT2H 1B0RA 4BFRA 1SPDA 1FC2D 4NDMB 3F04A 3RWGA 1WD8A 5C6TL 4PJ8C 3FCSA 2B77A 1IKFL 3JV6B 3OKEA 2X6CA 3AMLA 3VFNB 1L9TA 4HWNA 3O4OB 3ARGD 1HWHB 3LXCA 4M9OA 5EWIH 4L0ZA 2Z4QB 4XTRC 1A3ZA 2DM7A 3CHQA 3PHSA 2E27H 1DVYA 5FUOL 5HHVH 2HN7B 4HLZH 4OKVA 3N06B 2GAZA 4APXB 4EUPG 3BZ4B 3EYSH 1N0XH 4NFDA 1FVEB 1CE1L 4HWBA 3UP6A 1T1XB 1FP5A 5EUKB 1X5YA 5B39A 1VFBA 2ZUYA 3GLZA 1U91B 4OLZH 3L4XA 4N2DA 2CHWA 5ADPH 5ITBL 3GSWB 3LKSA 1NGWB 1THCA 1UKTA 4G42B 4WTZA 2LLGA 3PHOA 4PJ9D 1QA9A 4YSPA 1OPOA 5DA4A 4AGLA 4RGNB 1CK0H 4BH8B 4GAYB 4RLDA 2Z7WA 1DVTA 2PW2B 4PJ5D 1BAFH 4PREB 1VKXB 3II2A 1H3GA 4GJTB 3THMH 3DJZA 4PHXA 1CDJA 3BSZL 3BLBA 4FFZH 2P5WD 1MCBA 4Z76B 1S9WA 4MZRA 3CFEB 5JA8B 5GRVK 1DQMH 4W1TA 4NQEE 3ZRSA 5C07B 2AQTA 3FFDA 3RL2B 2FQFA 1JWMB 1BIHA 1T1WA 3VFSA 4XB8A 4L0PB 4J6RH 1E8WA 1MVFA 3WEAA 4F37K 4YFEA 1YEKH 5CCGE 1MFVA 4MQXD 1KN4L 3O4LA 1DQTA 4JFYA 4XVSL 3WG7B 1SY6H 2ZICA 4ACTA 2GG1A 1FJ1B 1EZSA 3Q48A 4RNRB 3A3YB 3OZKA 3UEZA 4E9LA 4B6ZA 1UJ3B 3WJJA 3TVMB 2IF7A 3CCHB 5IROA 3ARED 2O5ZH 1UM5L 4J2XA 3EOAB 4CU6A 4Y9CA 5KSBE 2V3FA 4E2OA 2FO1A 3V4VA 1S7RA 5IK3A 5FHAL 5DTFA 1MQ8A 3T0AA 3GT6A 5J13B 1DQIA 5I75C 1KELL 1FFRA 2ESVE 3ARDD 1RVFH 1UH2A 4MXQC 2XKUA 1A21A 5IJKC 1AGCB 3TTSA 4K5PA 3N44F 4X6EB 4HWBH 3QA3A 4U6VL 5FAAA 1S7VA 3G6AB 2H3KA 2P3YA 4NGHH 3MLZH 1NCOA 3LS4H 5C70A 4NQCB 2VM9A 2MQ3A 2R0LH 3TVMC 6PAZA 1W6LA 3G04A 4FZEH 3HB3B 3IPFA 2E9IA 4UB0H 2GCYA 3U36B 5E56A 4GG6E 5EU3B 1D7FA 2OMUB 4XCFH 2Y5TA 3VD9A 4ZUWB 4UU9B 4QD2E 3MREA 2Y2WA 4YHKH 3QAZC 1T03H 3K1DA 1YSOA 4PV8A 4TVPH 1NWPA 1TEGA 2A99A 2ZG1A 4KX9A 4AKOA 4BK4A 4CW1B 4XMUA 1OP4A 2ZUVA 3KPRA 2BVYA 3F5WA 5CIPH 5F8RC 3IAQA 3BE1L 5IWLC 1OQOA 4W70A 2ESVD 3P4LA 4HETA 5K9JL 1I4FA 3EDDA 5D71H 1CDIA 2V5MA 1HQ4A 3VXSD 4OBSA 3LQMA 1M53A 2V8MA 4M62H 4LOEA 1BVNP 2ZUUA 4JN2B 4GO8A 2Z31A 1NCDH 4JFDB 3TV8A 4CILA 1U4FA 3K2IA 4TQPA 3WSQL 4OLWH 1WEJL 4DQOH 4NQSA 1KMGA 1C08B 3HB3C 4JAMB 2GEEA 3CZGA 2R1XB 3UAEA 1ACZA 2EYTA 2HJKB 2X0WA 2CM6A 4DZBA 4OUOA 4FQXD 2V2WB 4N8CH 4YLCA 4ANUA 5FUZH 2IQ9L 4R7LA 3GYRA 3GMMA 4HT1L 3W11C 2VDQH 5DA0B 3IRPX 3EYUL 3OX8B 2Z0BA 5D2NC 5DURD 2DWXA 4Z7QB 1JPSH 4GLRH 5C0BD 1HE7A 3X14A 1NAKH 4L3EA 4FFVD 3FB6A 4F15C 4XVTL 1JHLL 5CLXA 1JD9A 3L4ZA 1ND0B 3D8MA 2OZ4H 3BAWA 4NUGH 1HXYB 2G5BA 2XOTA 2B9AA 1ITBB 4S1RH 4YSSA 3RRQA 5IROC 4FLRA 5EU7E 3UAJC 1Q9LA 4UM9D 3QDJB 4JJOA 1R3LB 2B0SL 2Y69B 4OM0L 4YBQC 4YAQA 4OY9A 2PF6A 1L4IA 5MEQB 2WJ5A 3DOSA 2FD6H 3L3KB 1XGQB 3FQYA 3H1ZA 3CDCA 3NZ8B 1CLOH 1PLBA 3BLPX 4IDJL 4MBRA 4XCEB 4GSDL 2E27L 1RZQA 3ES6A 1YYLH 3OKOB 5KSBF 1Z9PA 4FEIA 4CW1A 1DUYB 3HUJE 4MWFA 1P7KA 2WM0A 3QDJD 4U33A 4NC0B 4CJ1A 1MZYA 4UM8B 4X4XA 1TJGL 5IMOB 1AH1A 1VEMA 1T5XB 4RAVA 3LMJH 2JF1A 4Z7AA 3OAUL 5D7JA 3K72B 2FAUA 2GTZB 1XCQA 1URZA 3DSNB 4OD3L 4X4ME 1PY0A 2H1PH 1NICA 5J1TC 1OLZA 3KXFA 3BT2L 2CHXA 4WUUE 2H8PA 1YMHA 4Z0BL 3VXUB 3ZO9A 3EXLA 1WC7B 1KCUH 3GJEB 5C0FB 4UT7H 2XTSA 1U8OA 4LP8A 3VVVA 5KVDH 3GRWA 4FQ2H 2VR3A 5BRZD 1BZ8A 1CLZH 3R7RA 1FGVL 2Y1VA 3AU0A 5IWLA 1IQDB 2DL9A 2CIIB 4A6YH 1CGVA 4FMVA 1UQSB 3DX6A 4JQXC 2F53D 4PJDF 2N01B 3VMNA 4JFPA 1W6WA 3QI9C 1I9RL 4S1SL 3JQOB 2PO6C 5EC2A 3VXMB 2YWYA 3UG4A 1ZGLM 3UAAA 3FSOA 3PJSB 5GQBA 3S88H 3TPKA 3NVQA 5C97A 1QQDA 4NNYA 1TEFA 2F19H 5GS0L 1X6LA 4HQQH 4EI6A 3LD8C 3T77B 1WT5C 1DBML 3CDZB 3DGCR 5TE6L 1O6TA 3O4LB 2AJXL 4BM7A 4KZDH 2MNWA 4BKLB 2BJMH 2X1WL 5HHMD 4D9LL 2IAMD 1AZBA 4KTEH 3IJHA 4QXTA 1E4HA 4IMLB 1KXVC 4Q9RL 4L8DB 4JQIL 4I8DA 2X41A 7PAZA 1BQSA 1RJLA 1N18A 4XH2B 3CHRA 4HCRH 1H0DB 5B3NA 4Z5RA 3TL5A 1CO1A 3PWPD 4QRRA 1HT6A 2VDKB 2ADYA 3FB8B 2WQAA 5DJZB 3EJTA 3R4DA 5HHOD 1DLHB 5LAXA 1YPZB 4HIIA 5I1IL 3OAWA 4LOUD 4V11A 3T0EC 4E0RA 4FXTA 5I19H 1FRGL 1FIEA 2NY3C 5C0CB 1T4KA 4GRLB 1SNRA 3FQRA 5CGTA 1EJOH 2PCFB 4DZ8B 3QUYB 4DP7X 1FSKC 3APFA 5FKAA 1I7UA 1TOXA 1PG7W 2NXYC 4ILDA 2CA3A 1ND0A 1K5NA 3CH8A 4N0YL 4PR5A 5DEZA 2DQTL 3PWNA 1UC6A 2PKDA 4JDVA 4DP6X 2CBMA 4KXZH 4NQVA 3E6HA 3X11A 3MV8A 4L05A 1Q9WB 3JWOC 4JG0L 2FQGA 5F9WC 4POYA 1RSFA 1W80A 3UXFA 4PJEB 1RZ7H 2YIHA 1P7QA 3KLDA 3BUTA 3ARWA 4YHMH 3AS2A 3IK2A 3LZPA 3ZHNA 5F7HA 3B9KA 4K3HA 3RY6A 4Q9RH 1JV2A 1PD6A 5CJXC 1DANU 2GBTA 2DQIL 2EKSB 2ZUSA 5D1XE 3K46A 2OI9B 3FBKA 1D9KA 1AOHA 1QBML 3MRMB 2A9AA 3NJMA 3MCLL 5D6CB 5A2AA 4ZFFB 5C7XH 1LD9A 4Q6YA 5DQJA 3WIIL 5F7EH 2APWA 1NIEA 4XVUD 5JLZA 1F3JA 2VABB 3BDBA 3MLUH 1KPUA 4OZGE 2I32A 4PRHE 2F58L 2OTPA 3SPJA 1ZV5A 2VR6A 1KPUB 1RK7A 1T5XA 2QADC 4I9XA 3C5ZD 4J2QA 1Q9OB 2YA2A 5FO2A 2IADB 4KK8C 4PJXF 4HC1H 5FLUA 2CNZA 2O5XL 4JM2C 1BEXA 2X42A 1GSMA 1JXGA 4NQDB 5H37A 2NNRA 4YEFA 3B8SA 1PSKL 4N22A 3MLSL 3LN4A 2UZIL 3FOMB 3JTTB 4LBEA 1UURA 4PV9A 3FQ1A 1RK1B 3SPGA 4ZFGH 3VGDA 1JPFA 2PNDA 4PP1D 2ICWJ 3C5ZB 2HKFL 1K2DB 2A6KA 5EEUA 4LCYB 1M6OA 3EUDA 1CXIA 1E9QB 2IH3A 3MLVL 2DQCH 3W2DH 2SEBB 4BZ2L 3C87A 2E6QA 5JXED 1TCRA 4JN1H 3WMQA 1L0PA 1L6PA 5FKAB 1VADA 3V0VB 1CYWA 1R3HA 2TSBA 4ELMA 2CR0A 2IGTA 4NKDA 4WSGA 3HI1B 4JPQA 4NZFA 2ICWA 5KZCB 1JV5A 4YK4C 3L7EB 2IH1B 5D2LB 3S37X 1IJ9A 2QLYA 4N4YB 3RVVC 4OZHB 4BFIB 2GPZA 1NCNA 2Q6WA 3BZFA 1P7HL 4R4FH 2HMIC 5DFWH 1AR1D 3QH3A 4MJ4A 1OZUA 2VITB 1CXKA 1V8HA 1TENA 1FG2B 1T83C 2XN9E 3C5ZC 1I85A 3FB7A 3MR9A 5LB1A 2IEPA 4V1DA 3Q44A 4C4BA 1YY8A 4N24A 4LMQI 2EIZB 5FYKU 4JFDA 4FQ2L 1BM7A 4UBDC 3TOPA 1U3HB 3CC5B 3HG4A 3S2AA 5I1IH 4V2BA 3EO0A 4HG4K 3B34A 2AITA 1UB5A 5ALBL 5L2KB 1KCRH 4GW4B 2NNAB 2GITA 2Z93A 4YE4H 1DCLA 4NKMB 4LO9A 4M48L 3CFUA 4U1MB 4N5UA 5DT1H 3WFEL 4EPSA 3FCGA 4R7DA 2CHZA 5F7BA 3QK0A 3OX8A 3KLAA 4P48A 2YK1L 5BV7B 1LQBC 3R1GH 4RFNB 5EOQH 1BMGA 1N59A 1TPXC 3HTLX 3PWUB 3H3KA 4KXCA 1XVSA 5JPMC 3G5VB 1MFEH 5EUOF 4PJBE 3TA3B 4HCIA 3TYFA 2E7DA 3DV4B 1G87A 1G9ML 2D2OA 3PQYE 2MNUA 4JFDD 2WUBL 3RZCB 1AC6A 4NZTH 4ZW5A 2ZCKH 2BP8A 4FXGC 4G8EA 1K5NB 4PR5B 4JJ5B 1A6PA 4BWWA 4PBXA 4N2FA 4F7CB 1UYWH 3JVFC 2X4RB 4WK0B 4Y19D 3OKNA 3ILQC 4OLWL 1OO2A 2FWOB 2UZPA 4JZJB 4W9JC 1OY3B 4M1CD 2WHVA 4HVBA 1GYCA 1PYWA 3L16A 1TTFA 2W9EL 4PCTA 2X1XR 4CC1A 1DE4B 2I69A 1CICB 5IB3B 4E5XG 3DPBB 3OKDA 1ZGLA 1UD6A 3QIUD 1IM9A 2ZPKL 4UYPA 5JPMB 1PLCA 4I4WB 3IE4A 4KROD 3L5IA 4I9WE 1RJLB 5JLZB 3WUWA 1Z9SA 1CPUA 2EDOA 4KFZC 4BDVA 3SE8L 1J0IA 1ZHBA 2AV1A 4ZOBA 2YC1A 1U8CA 2EKJA 2CRMA 3GMNB 3RI5K 1Y1DA 2MKLC 5HPOA 5JHLA 1MCIA 2H1PL 5D4HA 4OQ1A 3ASNB 4Y5XC 1SXSA 5AW6B 5JHDE 2C26A 2GHWB 4IQHA 1JPGA 1X4YA 1KIRB 2F15A 1MW1A 4WFEE 5CU9A 1SXNA 1XMEB 1HXYA 3ECQA 3QUHA 3RHWF 4J8RA 5D55A 4L1SA 3MUGA 4XPGL 3SDDC 1B2WL 3FT1A 4M6NH 5CU5A 1KBGH 3BUBA 3EOBA 5FGBA 4E9YA 1JVOA 3RNQA 4Q9QL 3BXNA 4GKNA 5HD8C 2HX7A 3T0EB 3K80A 2TRYA 3DWTA 5IEHA 3KNBB 4BCXA 1FNHA 1PZUB 1CU4L 1S7XB 2FECI 3SQOL 2VWEE 1T1XA 3AUWB 1EXHA 4IRJA 9PCYA 2Z1KA 4TTGA 1QG3A 4DO6A 3MLZL 4YQXL 1FYTE 2MPAH 3PQYA 4B7LA 2NY6D 5KYYB 3D48R 1OB0A 2MTPA 3WNKA 3GGWB 3V0IA 2EXWD 5FGBC 1J88A 5FM4A 4DPAX 3UTTE 5F9JA 4WI0B 2R56L 1V27A 2HRLA 3MRIB 2VQ4A 4ODVH 1YY9D 2GQHA 5F6HI 5F9WB 1KG0A 4XCEA 4PREA 32C2B 2E7MA 4PP2B 1OTSC 1CJYA 4ZMTA 1F90H 1TQCC 2CKBA 1XDTT 5LCVH 3FQUB 2ITDB 2WYHA 4LLQA 2VW7A 3MRGA 3V52H 2EEBA 3SGKA 1S7SB 3P2DA 5JPNC 1YDPB 3B9DA 1YA5A 2P28B 3BI9X 4CVZA 2IAND 2G9HA 2WBJB 2MJWA 2R23B 2XVGA 4Y2LA 2QJDA 3VXRB 1Q38A 1S8DA 3BP6A 3ESOA 3HR5B 4RMTA 5I8EA 3S96B 1DQKA 2CO4A 3FMGH 2RD0A 4GYBA 2PPAA 4KQ3L 2QADB 2MCAA 4AE0A 2IVFC 4N8UA 4LVNC 5EC2B 5ELIA 2LTQB 4MA3B 4RFOL 2GJ6A 3L1FA 3QS2A 5D7IA 4MQ7B 4Z7WF 3DX0A 5EV7A 1KIRA 3NGBC 4YXHL 3T0XA 4K8RC 3SCMA 1WQVT 4KNTA 3OJMB 3SKJH 1ZHNB 3D85D 4D9RE 4XP4H 1F1AA 3QRGL 2APBA 4PI0A 2ZT9C 3L7EA 4LHQB 5E7BA 1KCVH 1ZHNA 3HS0C 2K6YA 3L5WB 3ERXA 4OUUB 3PPSA 1S7QB 1T21B 2NY4D 2Y3AA 3O6LH 1A0QL 2FB4L 5JQ6H 3R0NA 1T4WA 1F6FB 3CZJA 4QOKE 3NK3A 3THML 3UMTA 3L6FA 1ZHKA 4YQXH 2WO3B 3ZE2B 1XIWC 4U6VH 3ZUCA 1JDDA 4EXPX 3LB6C 1SEQL 2DM3A 3CX5J 4P4KB 5IHZA 3QRLA 4HHWA 1MAML 1QSEE 1NGPL 1YAIA 4XWOC 1WWCA 4EZJA 5KVGH 2X4TA 1GGCL 1HSAB 1HHHB 3IFNH 4DTGH 2B16A 3L1OH 4OLZL 1TJHL 1DUYA 3SCMD 4YUEL 2D3JA 4PJGE 2E7BA 1IAII 3E3QE 1J9CT 4WW1A 2J5WA 4F24A 1WFTA 3BVNA 3U9PL 4KK9D 2KZWA 3CNKA 4WW1B 4AX3A 5KSUB 2O30A 1EMTL 5HGGS 2WAHA 4ZS6C 1GVIA 3A67H 3VI4E 3MREB 2G9KA 4D9QE 1X6NA 4QJ4B 4N8VB 3FUKA 5FX3A 2IMMA 1ECZA 1XWVA 3CLWA 1TDQA 3RNKB 2UX7A 4WU5B 3VFRA 2I9LA 3ZKXC 2J8OA 5AAMA 5I1JH 5IJBC 4NIYE 5D7IF 4M5ZL 1RLBA 1FE8H 1QR1A 1OL0A 3HZYA 4LVOC 3WAJA 4WJ5A 2IAAC 3BZEB 3AB0B 2IDCA 4LCYA 3M1BA 4U0RB 3BQUA 1EANA 4IKLA 5DGQA 1MPAL 1TXKA 3GO1L 3V0AC 3NAAH 2J56A 4HGWB 4BSWA 4GAYA 4DP5X 2P26A 3KPTA 3KPPA 1J1XL 4JO1H 4OGXH 3LEVL 1U2YA 1XB6A 5D2NA 4KQ4H 5CIPB 4I48B 3CVIL 2HFTA 2XA8L 1PIFA 1YQ2A 3ZTNH 3BH8A 1LYQA 7CGTA 1OLLA 2PYEB 3V4VL 1J5HA 4HHAA 5EOCJ 2C8NA 5B39B 4UV4H 4NQVB 3GMMB 3SJVB 4IEFA 3WGUB 1FO0A 3QHTC 5AYUH 2Z31D 1KGIA 4P5TD 2GJ6E 5D7IE 4ENEC 2VLRA 2P5WB 3L5JA 5DHVA 2EDFA 1F3JB 1NEZA 1N2RA 5SWZE 3KS0J 1XL6A 1HEHC 4LPVA 3FPYA 4H0GA 4KHXH 5AQ0A 3CZSA 1OP5K 4QYOB 5BOPA 2HRGA 1ZS8A 1AACA 1KFGA 5GRJL 4CN4A 1WFUA 3SBWC 5DSCB 3N2JA 4XMKL 3R19A 4PRPA 4D8PB 1BF8A 3MOAL 4OM1L 3QIWD 4B50A 5T3XD 5I1GL 1CC3A 1R24B 2K7QA 1PS3A 1IC5L 1SXZA 4Q0XH 4PP2A 2F9BT 4NO5A 4OIFA 2JKWA 4NWUH 2AXHA 2CKBB 3P0YH 4H20H 3QP3A 4PMFA 3CSBA 4ZUTA 1YC8A 4P9HC 4DT2A 1EK3A 3ORJA 5INDA 4GG8B 3WEXB 3V4UH 2EXWC 2ZYRA 4QHMB 4LLAA 2R2HA 2C1OB 1XEUA 1TQSA 4LLDA 4R4BB 4X98A 1E4KC 3IGAB 5E8DH 5CP3A 2CO2A 1YN6B 4QRPB 1JNJA 3HE6D 43CAB 1XD1A 5D1XD 2ICEC 3EGXA 4X8XA 2YAEA 2VDKL 3FQRB 1E8XA 5GRUH 3QUYA 1D5RA 1JPFB 5LXVA 2VLJB 4YWGL 1D7BA 4QRTB 3RNQB 4KK5C 4F7MB 3MV7B 3PAYA 1IBFA 2EC9U 3GXNA 1G0DA 4ODBD 3ZL4L 5ESVB 2ENYA 4ONFH 1NKRA 3X13A 3P4MB 2F7IA 1UACH 4N0CD 5CKAA 3O0LA 3OZ9H 4L1HA 2F1EA 4X4MA 5FHBH 4XCYB 4XMWA 3FONB 4RMUA 5SX4I 4HBCH 5EEWA 2WWMC 2ED7A 3UBHA 3LRHA 2CDFB 4D8OA 3L8QA 2JK5B 2Z7YA 2QQLL 2F8IA 3WE6B 3R18A 1BVKA 1QZ1A 2AV7A 2AXGA 1FVDA 3QDGD 2O6FA 4JL2A 1I1CA 5D6CA 5CEZE 4EDWH 2WV3A 3L1EA 3AT0A 3RG1C 3ZW3A 1UB5B 1E42A 3DK0A 1Z9MA 1A6AA 5EN3A 1OM3H 4W81A 25C8L 2NY2B 4HD5A 4XAKE 4ODWA 1G7LA 1KFAL 1QQDB 2BIQA 3MZGB 4C4UA 5JIDA 2XZCH 3PGDA 5ERWA 3C12A 4Y5VC 3IFOA 1LK2A 3LNEA 4P59H 3U9UA 4HOZA 1NMBH 1S9WB 2XY1A 4PJDE 5E9NA 1AANA 1DR9A 3GMPB 4P4RA 1M57B 1SEBA 4NQCD 5DS8A 3VSTA 3WHE0 5K59E 5FFOA 2UZIH 1MJJB 4U4BA 5C0EB 1QRNE 2ZD0A 1QTPA 1F58H 2ENQA 3RVTD 2CIIA 1VACA 1CD1A 1DBJH 5I18L 5T3XH 2YEZB 5GRUL 3SYOA 3NCYS 1NIAA 4HK0B 2ORBL 2XICA 2XYCA 3TLRA 5KSAD 2DIAA 2WBWB 4GI9A 2VXSL 5I0WA 2DWSA 1YEWA 4Q97A 3ZYIA 1DSFH 3MNMA 2NR6A 4DPCX 5L8KB 3GIVA 3KEHA 1Z5HA 4LESA 5DJZA 1BZQK 3KHQA 2IBGA 2BP8B 3PAVA 1IJNA 4LGPB 2X4NA 2CE6A 1A1MA 3QR0A 1OTTC 3D5OF 4EQ2A 1N26A 1L0QA 3F12B 4I9WD 3NA9H 3C5JB 4EN3A 2L7EA 1DEEA 3MYJA 2DKMA 3B1TA 4TSCH 1I9EA 5J8OA 3C5JA 4NCC1 4R0LC 4HMCA 1P7KB 5IKCB 1CFNA 3VNYA 4KI5E 4QF1B 3LOWA 4BWUA 4GRLD 4YO0B 2XKNA 1CL7L 1NGXB 3AREC 3KPLB 1NEPA 1WBZB 4JG0H 3GB7B 3VFVB 2I9TB 3U30C 2Z8SA 5I6PA 1PGRB 1WGVA 1OGAB 2YGQA 1U8JA 1XB3A 5GGUA 3SBQA 5EUOB 3A23A 4YDVA 2XZQL 3RUGF 2QADD 3L3KA 2Q7AA 4UDUA 3T4YB 4L37B 3T04D 3LKRB 1NANI 4AQ1A 1R4XA 2E75C 1JTOA 3H3PL 5ANMB 5EFIB 1MCEA 2D8KA 1ICTA 1M3JA 1RZGA 3RTQD 4PCYA 4AENA 3T6ZA 1FAIH 4FCHA 3H7LA 1D2OA 3MGTA 3GSRA 4TNFA 5F7MC 1LD9B 5CAYB 4XI5D 4N6RB 5F7YC 4LSPL 4C8XA 3KJ4C 3QDME 1KJ2B 1L7IH 4L8SA 4ZO7A 3QXWA 2HT4C 2PTTA 3WIFA 2V2TB 2Q3ZA 4JHBA 1ZT7A 3T3PF 4A39A 4UT9L 5FYLD 5CEXB 1HI6A 1J8RA 3EG9A 4LEEA 5AVXB 4S1DD 1WC7A 2XQ0A 4JM2F 1K6QH 4GT0A 4XWGH 2ZIDA 5I9QB 4KOCA 5I71C 2HVBA 4H26A 2BNQE 2OXHB 2AK1H 2B2XL 2YD0A 3DX1A 3OQ3B 1E3XA 5D2LF 1AHKA 5E6IB 1QW8A 5ISZE 1KDJA 1IEAB 3TX4A 4K9EC 4GAJL 1BZDA 2EP6A 1KTJA 1NFDE 3EFDL 3MJ6A 1IV8A 4ZDHA 3QO0B 4JREC 4WI2A 5CINH 3FTVA 2ZF9A 3O2WH 4UIKL 4GMSH 4OIIL 4QRQB 4HUCA 4XPTH 1KYUA 2ITCB 4JG5A 4W9CC 3FNKA 4MHHG 5I73B 3B9EA 4IM8A 4I85A 2AJVL 4MMZC 3TN0C 1G6VK 3K8KA 1QFWI 2JWYA 3IEAA 3S3SA 3VG0L 2V7HB 4A2LA 4JKKA 1MJ8H 3VB9A 4KH2A 3ZDYB 4ERSH 5BUAA 3KH3A 3QXUA 4XBMA 5I71B 2EH8L 4L23A 3GQFA 4WGWB 4KKCD 3IJHB 4LOVA 1IFHL 3FZUC 4MAUL 4QXTB 4X80H 5L2KE 1UA6H 3N44B 3TN0D 4DVRH 5CD3B 5I16B 1EVUA 3QIUC 4PUBL 3AVEA 1I8IA 1QLRA 5CXPA 5BPPA 4TKWA 3KGSA 1RP9A 1ZTXL 3EH5B 3KLQA 4M7LL 3V5DA 2YSSB 4YHZL 4P07A 4RISL 1JZDC 4XBEH 5DJ2B 3RKDC 3BDXA 3LNGA 4N1CA 2ZCHH 3RHWK 2Y22A 4QRBA 3B7RL 3ZDYE 4OIAA 1RIUH 5J1AA 2ZCZA 4QHNB 2W9EH 5F96H 3UAJA 1MI5A 35C8L 3KR3L 5DC9B 5A2JH 3UTTA 3IRCA 1MFCL 3U6RB 4KDWA 3Q8AA 1JZ2A 5J4MA 1A6VL 2R0WH 4X6DB 1OKEA 5GHWL 5C0GA 1AI1L 4XAWL 4DZ8A 3V0FA 3TJEL 1KJ3L 4JRXD 2WZ5A 4AM0B 3II1A 4G42A 3UYPA 4MGXA 4YDLC 1OE3A 5INCA 1QFHA 5KANI 5GRZA 5D1QC 5CEZH 5T1KD 1SGKA 2XTLA 3QFJE 2ALAA 2GYSA 4WDIA 3DX8A 4NHCL 1IL1A 1EEYB 3VFOA 4UOW1 5I6NA 3EH4B 1Y7VA 1CDBA 2GB2A 1WIPA 5D9SA 1A4JB 1QASA 1PEWA 3MBXH 4KVNH 4PS4L 3K71B 2AK4E 4DSYA 3DMMB 4LBAA 1QNZH 1RUPH 3KPSD 1NMCB 2I60L 2MH4A 4LHUB 4PTTB 4QUOA 3V8OA 3WXVH 2F6AA 1PD0A 4IS6B 4PTTA 4AEIL 5LGJB 1SZNA 2R1WB 3FUDA 2WYTA 3FU9A 3T3PE 1G1CA 3BZEA 5HHXH 1EEZB 4YDJA 2BFVH 3KWWA 4WLCA 1LP9B 2YOAA 4K8RL 2RA1A 5DGRA 2UXGA 3OKOA 3S6CA 3NIDF 6PCYA 2P48B 3FW6A 4EDXB 5TH2B 4HJ0C 1A7PL 3RVWD 4F15B 4X9IA 3VFMA 2AZUA 4LNRB 3FBQA 3OKNB 5DXWA 5DD1L 4QLRA 5LWYL 4AL8C 3EXJA 1OTTD 1F8TH 1CQYA 4ZODA 5LBSL 4JRLA 5E9DA 1CDCA 2V0AA 4P46D 3GMRB 4HIXH 3MNZA 3TIDA 4XOCA 4JFVA 2YPVH 1NCUA 1Y18B 1BQKA 1RL1A 3RX8A 3X14B 3MGOA 1DANT 2BSSA 4JFXB 3VWKD 2DYPA 1E5BA 2WQXA 3ZYOA 1TJIH 1IFHH 4X80L 1BA9A 4IKNA 1FPTL 4N2AA 2CH8A 5IG7A 2DQDL 2QVIA 3UCRA 2EH8H 3NT0A 1U3JA 4U1HA 5EOCH 3V7MA 3QWRD 4X0NA 2OYKA 3H2QA 1E2WA 4H4NA 2LW3A 4NGHL 3I6GA 1QNZL 3ZU8A 3U7YL 3X2QB 3ARGA 2CGYA 1O0VA 2V33A 3GBLA 4I3RL 4WWKA 4E41E 4KV5E 5HYEA 1VFOA 4R8WH 2A2QT 2Z92B 4NRXA 5E2JA 4F7EB 5FB8B 5ICZA 1IEBB 3ARTA 1BYPA 3HE6A 4RMQA 5FECB 4N8VA 2XXFA 3ULVH 5GJSL 3WO3B 2K8QA 4OGAC 3B2PA 3IGKA 5CCHE 1OCCB 2WMPA 3O6ML 2OMTA 4PWJA 4QXUH 1V3LA 1UFGA 4YVUA 1JF5A 2OR7A 3IDJB 1VB9A 4N0FB 1LO3H 4PJ9A 1HHHA 4X6CA 1NGQL 5DC4B 2D3VA 4LLMA 4C83A 2QPUA 1MY7A 1BVLB 1H3WM 2AJZB 2HUHA 3U4KA 1A65A 2XY2A 3I84A 3TPUA 5ID1A 5DEGA 1NOLA 5CO1A 4AYGA 2FX8L 4X6CF 2LU7A 5IQ9A 2VDPH 4PCKA 4CDGC 1LEGA 1OP9A 5CJOL 1RZ7L 1DYZA 4UQEA 3GHBH 2C7UA 2VMDA 3D0LB 5GGVL 4XBEL 4OFYA 5E6IA 1NDMA 1T22A 2WVVB 4OJYA 2OJEB 3ALPA 4J6RL 4JUTA 4AZ8A 2WY3B 2JI3A 5KBDA 4JFEB 3T6VA 5E4OA 4Z8FH 4DKAA 4BCYA 3VA6A 4BQ8A 1OSZA 2ICCA 3T09A 3DHPA 3HA0A 2GJZA 3RJDA 1NDTA 5IVXF 1PU0A 4WNQA 5AW7B 4U3HA 2GABA 2ZONA 4L1LA 3WV0A 2FBOJ 3OVUB 4N68A 3I75A 2C9XA 4C56A 4PSRA 1P2CA 4L37A 2BO0A 2ZWNA 2DI9A 4UDTB 1N68A 1XGPB 2BNQB 4NENA 1ETZB 1WFNA 3BQUD 5HYJE 4ZNEE 2JCCA 2H45A 1MJJA 1E4WL 3UZQB 4BH7A 1ZHLB 2WNXA 3GBML 4HFWA 1A4KA 2A73B 3IT8D 4LCUA 5E1QA 3ZKSD 4PRIE 5DUBA 4PRAB 1DLFH 3U9UB 2YSTA 5EEXA 3MRMA 2WW8A 3GNMH 3S5LG 1JZ8A 4DNLA 4YS4A 1CVRA 2OMXB 4YR6A 2D0GA 2IG2H 4LASL 3EJQA 4NNXB 3AS0A 4KGJA 3HKFA 4P04A 3QC6X 2VXVL 5F93C 5EU5B 3UTZB 1WWAX 2YPLB 4Z3IA 4A7TA 2AQSA 3Q05A 5B1JC 5TFSH 5TE6H 4LXFA 4DKDC 3ZUNC 2ZWKA 1AGDB 2CDGA 2JKXA 3X12A 4UQ3B 1XGTA 2PO6B 4KZEL 2AQ2A 4TF4A 4B9JA 3RWIB 3OLEA 3C6SB 2H2SC 5T1MA 3SE9H 5IV2B 4FD0A 3IU4L 1FN4B 1T1ZB 1YHPA 4HZLA 3SDDB 3S48A 5FM5M 1KYFA 2YD7A 5IVZA 1UXSA 3MACH 4FNUA 1CFBA 1A25A 3BPOB 4TRPH 5DTFB 1OQXA 1T83A 2ZOKA 3KLSA 5C0CA 3D50A 1P4BH 3UJJH 2VQTA 3RUGA 3QO0A 4RDBA 4A6YL 1Q94A 3W39A 3TBSA 1XF5A 4WJKB 4TVPD 2FYYA 4KK5D 4LEXH 5C7XL 2IDSA 2TAAA 2HSIA 2Q10A 2BIMA 3MPCA 4P99A 3BH9A 3QRBA 2E59A 4JY6B 1KB5A 4AITA 5AZUA 1R75A 5HYJA 2DLFL 2VCOA 1WO2A 1H3VA 4HUVB 1CBJA 1QWHA 3ILDA 1H6EA 2J6WA 4IRSD 2E4FA 4JRYA 1N64L 3MBEC 1OAXL 1LTXA 4QOKA 2BNUB 4TSAL 4EDWL 4I1NB 3RGHA 4DW2L 5BZDB 5IB4A 4LSRH 2YQ3A 4OCYH 3APDA 2GBAA 3RBGA 4CAGA 1WS8A 5L88H