4AVHA

Structure of the fimh lectin domain in the trigonal space group, in complex with a thioalkyl alpha-d-mannoside at 2.1 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4avhA00
5FS5A 4XODA 4J3OH 3JWNH 2UY6B 4ATTA 4BUQA 3BWUF 5CGBA 1PDKB 3ME0B 4J3OF 4AVKA 4J3OG 5IQMA 1QUNB 4CSSA 4XO8A 3JWNE 5ABZA 2XG4B 4X50A 3RFZA 3ZL1A 5IQOA 3BFWA 2XG5B 4X5PA 4AVHA 4AVIA 1N0LB 1N12A 4AUYA 4AUJA 1ZE3H 2J2ZB 4XOEA 5FLUA 4AV4A 3BFQG 4AUUA 5JQIB 4AVJA 3ZPDA 3SQBB 2JMRA 4XOAA 4X5RA 1KLFB 3MCYA 5FWRA 4XOCA 2WMPB 1TR7A 4AV0A 5LNEA 4X5QA 4LOVA 2UY7B 5F2FA 5IQNA 5F3FA 4AV5A 2W07B 4CA4A 5AAPA 1UWFA 5AB1A 3JWNG 5LNGA 4XO9A 2VCOA 5AALA 1KIUB 4XOBA 3ZL2A 5FX3A 4CSTA 2JTYA
chains in the Genus database with same CATH superfamily
4EZJA 1S9YA 1BGXH 4JFFE 1RU9H 5EU4A 1ES0B 3OHXC 1CURA 3B9DA 3WTWA 1WFIA 1TVBA 1EO7A 4Z3TA 4PGDA 4IRJC 5H2BB 2IXQB 2RACA 5EPMA 3B3BA 2QFRA 2E8YA 1J86A 3JVFC 3NESA 3WL9A 4K3JH 5DK0A 4XPFH 3GXFA 1ZGLA 1I3UA 2HKHL 1EIBA 2YFOA 3B7UX 3KM2A 4MHHI 2O6FA 3IXTB 4GSXA 2YC1B 2ZOLB 4FZ8L 1S46A 1H9VA 5EHFA 5GGQH 3EO9L 3JWNE 4FCAA 2WIIB 5AVWB 4EI5B 4HPOL 3INUL 4K2UL 1BZQK 3GEFA 3K6DA 4AM0B 2HYMA 5F1NB 3TWCH 4AVHA 5IM7B 4PJGF 4FXKA 4FFYH 4NFDA 3DXAB 3ZK0A 4LCVA 1ZV2A 3NPSB 3HB3B 4MNHA 4RX4A 2ZXAA 1FL6A 4Q9CA 5D7LB 1GGBL 1N8ZA 4MMZC 4PGCB 2FE0A 5FA3A 5GGRA 2EYRA 4R8WH 4C83A 4DEUA 4R7DB 4UTAA 1XVSA 1IAIM 1GKOA 4BHUI 5C0FA 5ERWA 1UURA 4IGBB 5D2NB 2GUOB 1LMKA 5CFHA 1RLWA 5DHYB 4XAKE 2J12B 4LP5A 5F6HI 4X6FA 3BAEH 3LRHA 1LMIA 2EUWA 3D0VB 3FN0H 1WBYA 2W38A 2K7PA 3ILQD 2P9RA 3LYRA 3OMZA 4XMPH 3MCYA 3BPCA 1AH1A 5CINH 4BFRA 1T2JA 3BIKA 1XGTA 3ILPA 4G1EA 4WK4B 4Y19D 4Y1AA 1AO7E 2EO1A 5F3BB 4N8VB 1UM4L 2W80C 2VLLB 4J12A 5DJAB 2PWGA 2C4FT 4BE6A 1U8JB 2N3JA 3N43F 4CU8A 2P8LB 3K46A 3QIWA 4XI5C 5BXFB 4AYEC 2VLKA 3RTQA 1XF4A 4I2XA 2FT8A 4M5YH 5KYXA 4ZO7A 3VFWB 3CDYA 2E59A 3L4WA 1N70A 4LCCA 2Z7YA 2R0KH 3O6FB 2ZSWA 1GSKA 5KYUA 3W39B 2C4XA 5FO7A 4L4VD 2H8PB 4U1NB 2A0LD 1PPIA 2Z8WC 4MXQC 4Z7VF 1BFOA 1P7QB 3T0BA 2GAZB 1WYJA 4G7VL 3WLWC 2NXZB 2MOQA 4ZX5A 2ADFH 3ZZQA 4AMWA 1AE6H 2RBLA 3BJLA 4PWIA 3REWA 1AGFB 1IL1A 3L54A 4JFEB 4J3OH 4X4XA 1DN2A 4O5LL 1O0VA 2MKLC 3MOBH 5KSAA 3A6CH 3BUQA 1KPVA 4GP5B 2LLLA 2CBOA 4L4TE 1UVQB 1ID2A 2FT6A 1CK0L 2NX5B 3C8KB 1B0GB 2H4EA 4QXWA 4E9TA 1VLXA 4JFWA 1S78D 3ATEA 4PR5B 2AK4A 2F54E 1USQA 2YRLA 5EF0A 3HPLA 3BFOA 3D39E 4FNLH 1QSFE 4MNGA 1UB6A 2FB4L 1SVBA 2NY1D 3KBPA 4KXZI 3SDDD 4OZGE 2APWA 5E6SB 5BRZD 3RPBA 3CK0H 4OZFH 5TTRA 2OMNA 3N41F 1MF2L 3LQAH 4FX5A 1YEHL 4LNRB 2ZOKB 3H6JA 3O9WD 5I1KL 2PTVA 1J9TA 4OR1A 5IMKA 1KTDA 1OSZA 3FCGA 1PLAA 3TT1H 5EIQA 3U30B 3F3HA 2X4QA 3L13A 4OSUL 4WK2B 3FMGH 3PXJA 1AKPA 3ARFB 5C08E 1BAFL 1DCLA 2NXYD 1I9IH 1IE4A 1LWJA 3R1GH 4L3CA 4XX1E 3ZRSA 1LO5B 1CBVL 2A6IB 2VE6A 3NA9L 5LN4A 3QUZA 1D2OA 1XF5B 4NS0A 1BXXA 43CAA 4F7CB 1GOHA 3ZTCC 5IB2B 3BP4A 3CX2A 4JGNA 1JNLL 1IM9A 1P4IH 3QDGA 5IY5B 2AJUL 2XPGB 2F53E 3K0WA 4BGDA 4PJAE 3FHAA 3FOLA 2ADGA 1AD9B 2PMZA 3MLRL 3TH2T 3J7HA 3T2OA 5JZ7C 4KV5E 5E7FA 5ESAB 2NR6A 3CFJB 1MFMA 1BQSA 4NPYA 1AQHA 2OTWB 5ECJE 4HHWA 3T8XA 5D72H 1C16A 3D2TA 3I3BA 4PB9H 4U1HA 4NO0B 3JWDH 5CILL 2VKWA 1KIRA 1U92B 1WH0A 2G5BB 5GSRA 2CBPA 3U0PB 5DYOB 1WP6A 1T83A 5IBUB 5DRWA 4OF5A 1HHGB 5CO1A 3DV6B 1YPZE 5C0IB 1GIGH 1MJJB 4O02L 4ZUUB 4AYMC 4YHOH 1L0XA 4HIJA 5DGRA 4M6OL 3KDPB 3VM5A 4JS7A 12E8L 4KX8A 5LN8A 2EC9T 3F7YA 4PJ8B 3VRLE 4AGLA 1FE8H 3MUGB 5PCYA 2YN3A 3X17A 3PDGA 2ZKHH 3FTXA 2R1WB 5CBAB 2C3VB 2E7MA 3L9EA 2PYFA 4DEPC 3FS9A 5IB1A 3ABZA 1TLKA 3P0YH 4G2AA 3U0WH 4AKPA 2LW3A 4QT5B 4YN3A 4AGMA 1AGDB 2IOMA 2J1YA 3KPPB 1BJ1J 2EECA 1CYWA 1WA1X 4I89A 5AVRB 4X6DF 3C09B 5J11B 4PVNA 2IBBA 1EHNA 2MHAB 2ICES 3WTUA 2VMEA 5C9JA 3K72A 4XNYL 2EDDA 4KXZH 3P3TA 4ZS6C 5TE7L 1QEXA 3WBDA 4TNFA 3ZDZB 4GQQA 5EF3A 4APQD 3B37A 3P77B 1RZ7L 3ARRA 3C9NA 4HKZB 1S5IH 4Z9KB 4JAMB 1JYXA 3W5MA 4N2LA 4F7MA 2ZG2A 5T1LB 2AQNA 2JKSA 1OWWA 5DUPH 3NSXA 4A7GF 1U3HC 1MCOL 3A4EA 2IMMA 3CCHA 5CEZH 3TYFB 1F6AB 3LSOB 1FFNB 5B3JF 2OYKA 4G8GD 4WKZB 3FTUA 5DJXB 2NY2C 3O3EB 3EYOB 1KV3A 5I28A 4ELKB 3NFSL 2G30A 3L3DA 3QDJA 3BKCL 4AI7A 5ITBH 1QZ1A 2X1OA 2K8MA 1FFOB 1HWHB 1CDYA 1PZDA 1XEUA 1DJYA 3VM7A 1DBKL 1ZGLM 1A9BB 2NNAA 2YEZB 3W81A 4IU2A 4X4ZA 2QPDB 1JZ6A 1IC5L 3QDAA 4HJ0C 5IB3A 1MI5D 2ZTBA 2QPFA 3GSNB 1RKRA 1CLYH 1QA9A 3G08A 4IMKC 2ADJA 1ZHKA 3PUCA 1NCIA 4KK8D 5E0QA 5LCVA 2GSMB 3D69B 3GTVA 4IOSA 4G6ML 4IEFB 1BVLB 3GBLA 4NKIH 2E27H 2GI0A 2YKLH 3GSXB 3QC5X 1XH3A 4M29A 4M7KH 4NQCA 2JQAA 5B39A 4FTVD 3B2VL 3T0WA 4QOKE 4V1DE 5J9PB 2M83A 4L9LC 1SOXA 4FHBD 3BW9A 4QRFA 4PJIB 4E5XA 5AOZA 5HVGB 1EPFA 1MY7A 3QRLA 3VXMD 4X5QA 2YHGA 4NRYA 4BEIA 1CN4A 4JQIH 3CUPB 3DX7A 2XFXA 4FQXA 1CD1B 4LK4A 3N1PC 3ZY7A 3AXLA 1FH5H 1RSFA 4GAJH 4PBDA 3V0AC 3QISA 5SWQB 2QV2A 4NJAL 1NWPA 1YQ2A 4X6CA 5DJ2A 1RZGB 3QQ9C 1RZJH 5DA4A 3FT4A 3RNQB 3FO1A 1ED3B 5HDBE 3KPQA 3MLVL 4WGVB 3VG0H 4XWGH 4FC3E 3BN3B 4PG9B 2F1EA 3MV9E 1IBZA 2OW6A 3ARSA 3VUAA 1W0WB 3IKCB 1X6LA 4M3KB 3GXTA 1A9VA 2KT6A 3DK0A 1AGBB 1H8LA 3NJLA 5I17A 3N9GL 3RWCB 3GO1H 3VQ1C 1AC6A 1FCCA 4NO2A 3EOBB 3QEHA 2X4OA 3GHBH 4BSVB 4WFFD 4ZMYA 4ZOBA 5T1DH 3O45B 3J27A 4TSCL 3DO3A 3QWOA 1BEYL 3C87A 2JVUA 5I1AB 5M94B 3T2NH 1UD6A 2Y6TE 4DCQB 2ORBH 3K8KA 3QJHB 4G6KH 3O3BA 3RIFK 2WXHA 4PSRA 2ZUXA 1M05A 1I9RL 1QHPA 3RWDA 4CMMB 3UPCA 1J0JA 2Y69B 2BNQA 1ND0A 3DX6B 4Y16A 2QGCA 3PWPD 4KJYA 3OX8B 4KJWC 1P4UA 3VXSD 4JFUA 1K4CA 1B2WH 2VOTA 4XPHH 4Z0BL 3G3LA 3V5KA 4YSSA 4XVTH 5FO8A 43C9A 4NZTL 4WEBL 3OQRA 5EOQL 3MRMB 4KKBC 5GRVK 4HMDA 1N8OE 1QLFB 1YEIL 1RUKH 1D9KC 1LNUB 3B9KC 3GSQA 5INCA 3T8VA 4R90H 3BDXA 1ZJBA 1N19A 4XX5A 5I1JL 3QIBA 3DHJA 1NTDA 4PY8I 3HS9A 1FRGH 3WXWL 3ZMRA 1IIIA 1G1OA 4MLIA 5FLUA 3FFDB 3ZTJG 5KUKA 2AJYH 1SF3A 3NIFE 2HJLB 4PRID 3D3VA 2WQ8A 4CMHB 1H3XA 1AOZA 1KBVA 1S9VB 2HT2C 4JZOA 4NM8H 2H2SC 4YHZL 1IIKA 5IEHB 5GSVB 4XCYB 1ZS8A 4HCFA 4MCZB 5KVGL 1YRKA 1OP3H 4HD9A 3FUEA 4RQQB 3VGGA 1FGNL 1GAFH 3DPDA 4ODXA 4BGLA 3HE7A 3EYVA 3X1FA 2UZXA 5DUBB 4BWTA 2V37A 4MJ5B 2VC2L 1S3KL 4LKCB 4ICXA 4OFPA 3LRKA 5C09E 2VXSH 4ABQA 5IIEA 1XZWA 2EDNA 1TTFA 1I75A 4IRZA 2HWZH 3BT2H 1X5YA 3D08A 1WC7B 4JRFA 4PGBB 4JRXD 4Z7VA 1LL1A 4CAGA 4HUCA 4DVRL 4Z3HA 1CL7I 4WI3A 3BXNA 3MBEA 1K8IA 2L8AA 1JNHB 1L7IH 2GHWB 2LVCA 1RK7A 2WO3B 4JPIB 4X0NA 1IC7L 3SODB 3KPNA 3MRBA 4J3VA 4IKLA 1TU2B 5EN2B 2FUQA 3MUJA 4F9PA 3HCVA 1PX3A 1TVDA 2CNZA 4W9IC 3PHAA 4K71B 2RMNA 4LGPB 3ME0A 5EDXA 5BQ7B 3N40F 4HJ1A 3U36B 4RA0C 3QXVA 3TYGH 3ZT5A 2ED9A 3SPGA 2YSSA 2VLJA 3TVMC 3NSFA 2X2JA 1JMXA 2Z93A 1F97A 5E9DA 3WSQH 2HPTA 3V79C 5GS3A 4YH6A 3W9DB 3L3OA 3KS0H 3HZKA 4ATTA 2Y7SA 5JHDA 4UT9L 2PYEE 1KLUB 3T5WA 3OTTA 4XNUL 2N0MA 3C5ZD 4HLZH 1LTXA 1J1XL 5HDQH 4DVBB 1S7RB 4ZD3H 2OXGB 4I5BB 3MNVB 4WK0B 5KVEL 4NP4L 5BO1H 4MMXC 4HJEA 1PZBA 3Q2NA 1TCRA 1XR9B 5F7FA 2Q7YA 4JO2L 1PLGH 1NIFA 4HSAC 4WEEA 1P84J 1E65A 2HT3C 4XBMA 3O8XD 4RSYA 1I53A 2WOYA 2N1KA 5IVXE 5HHPA 4I9WE 3OLIA 4BIKA 1BF5A 5D2LB 5F0LB 2VXUH 3ULUC 4M61A 5MEOA 1LQBC 4S2SB 5JR1H 5CZXC 1OE3A 2JKIS 1UTDA 2JKWA 1GTNA 2X87A 3HRPA 3H0TA 2JCCB 1XGYH 1TNNA 2CJUL 2F6AA 4F37K 2H6UA 5DU7A 1FIEA 4NQSB 4M1CC 1MCLA 3R7QA 5BMFH 1PAZA 1H19A 3IKKA 2E7BA 3N85L 1NEZA 3RZCC 1WFOA 4XHQA 3VRIB 3P9LB 1NUGA 1QQDA 4M7LH 3V0VB 3DK2A 4KAQH 2YLHA 1E4KC 2HPOA 3B2PA 1OAYL 4OF8A 5T5NG 3B34A 1DVTA 1MHPL 2VAAA 3GSVA 1NKGA 2NY0C 1VJSA 3V6FB 5JIKA 5CCJA 4NQEE 2CBTA 4XNQB 2ZWSA 2K45A 3K0YA 1ORQB 2GIMA 4MWFB 4YE4L 3B2XA 2WMPB 2WXJA 1WZKA 1NCHA 2OL3L 1JGDB 2ICWB 2NSMA 1PKOA 3RILA 2CLZB 2VGLM 4UDTB 2CO6A 2VDPB 3UTSD 4GT7A 1DJXA 4GI8A 1YG9A 3CHRA 1XSKA 4K23L 2DQGL 4CSPA 3IU4L 1JHTA 4NDMA 4P5TC 1MH5B 1OT2A 3ZL4L 2P42B 1NQBA 5JA8B 3NFNA 2ZG1A 5I1DA 2LU5A 3G5ZA 1YMHB 1NGXA 1G87A 1JCVA 1KIQB 2DDQH 2XQBL 4NM4H 2VXTH 1JDDA 3IFPA 5EA0L 1KULA 3V0DA 4KZCA 4KTYA 4NQUA 3FU5A 3GRWH 1N0LA 3HRZB 5E1HB 4PIBA 2UWEF 5JHLL 4DKFL 4GFTB 4GI6A 1ZLDA 4WO4B 4X6DA 1IB5A 4H8PA 4O51A 4X9IA 2NNXA 1NMCC 2FATL 3IN0A 4KO7A 4LEXH 4LHUG 4N2GA 4CADA 3Q1SL 4IK6A 4N5UA 5FM5O 1Z5LB 4Y4HD 4KQ3H 2B4CL 4OLWH 1RURL 5IREA 1X4ZA 1UACH 3BO8A 1D5IH 3M1OA 3VFUA 3VSQA 2H9GA 2VQ4A 3WKQA 1YEDB 3GXPA 3QDMA 3EZ8A 2N7BA 1K8DA 2FIKA 4IJ3C 2IO5A 2F5BH 4GUOA 5LGHL 4PJFB 4NUQA 3KR3H 4NB7A 2Y5TA 4MS8D 5KEZA 4J27A 4WJG3 4J23A 1EXGA 4RNRB 1VKXA 5HYSG 1KGXA 1UJ3B 2V7NB 5CD5C 4PJDB 2OSLA 1X9RA 4LSSH 1F3DH 3GRBA 1WT5A 2XXCB 3TN0B 4DP4X 1MUJB 1ADQA 2DWEA 1IGJB 4HCGA 2EUVA 3RWFB 3LJ3A 2R1XB 4GS7C 4PRBB 1DDTA 2ZPKL 4KK5C 1OIOA 3SBRA 3MLTA 5D93C 1DANT 3L3JB 2VDNB 1OZUA 1C5BH 2CO7B 1Y6NR 3V4UL 3QXTA 3IE4A 3TNMA 4JN2A 4Z95H 4RX4D 4QUOA 4LT7A 3VD1A 3RFRA 3T0XA 3EDFA 4Y1TA 2HA1A 3JUZA 4P2AA 1M71B 1XF2A 5DEZA 3V7AG 1MFVA 5GHWL 3VJ6B 4TVPL 3INOA 5HHOE 3EGSA 3KCWA 2LE9A 4IRSB 4P59L 4YDVA 4L8BB 1CFTB 1KGJA 3K4AA 5E8DH 3JQOB 3DX3A 1TZHB 2Y7LA 4F2EA 3FSAA 5IHZB 1AG0A 1DQJA 2IANE 3ARWA 3DOSB 5TDPB 3TGXA 2ZAIA 3GYRA 2BZDA 2OS7A 2XKUA 3ATFA 4JKNA 4QNPF 5DUJA 1JPTH 1YNKH 1PVHA 1U3ZA 3AG3B 3DHPA 2HTKC 3FB5B 2CO4A 2J73A 3NN8A 4NC2B 3B1UA 5DWUL 5I15L 4Y1AD 4RSVA 4M3HA 5KVDL 3S4SG 5DJCB 5HHNA 3HPJA 3RVUC 1SQ2N 4E9XA 1ZSHA 1UEYA 3QEQA 4QIRA 3IDGB 5D9SA 3UYPA 5CP7A 4DFIA 3W11D 3I74A 3S98A 3PDOB 3GWJA 5F2FA 4M4PA 3QIWD 2QR0A 4QDGA 3P30L 4AY0A 3EXJA 2VLKD 4UOW1 1J8HA 4G3YL 4X5XA 1EH9A 4HPHA 4UQ2A 2CDGA 4LOUD 3FB8A 4ELMA 3EJSA 3MBWB 4H26A 3MMEB 1TMQA 1CE1L 5LB1A 1CB4A 3PFQA 1OSYA 1PZ5A 4BKLB 2ATAA 4DTGL 1JYWA 3LS5H 3S7GA 2P1YA 5B3NA 3B3IB 5LLIC 4TS6A 3U9PL 1XZ0B 1XD0A 3I3EA 5FXCH 1DJHA 3NIGB 4CSTA 3FUMA 2FEDD 1MNNA 4JVWA 2J72A 1LQSR 2ZCLL 3FHEA 2X10A 4L8SB 3L1GA 4JFOA 4M8QB 3D50A 1CICA 1TJGL 1JPSL 1T21B 1NH6A 4TNWF 4HULB 1T03L 2DH3A 5KSAD 1NGPL 3UTPD 3F62A 4C59B 1FL3A 3FONA 5D1ZA 1NBVL 3VFTA 2EDTA 4M6MH 3WIHA 1UQSB 1E28A 3V5HA 1T03H 3HMWL 5C0EB 1AHKA 5IHBA 3Q1EA 1UXWA 2I69A 3TFBA 4X4YB 2AK4D 2QKSA 5DFWH 3BVNB 4MQXD 4WNJA 3KYKH 1NFKA 4MKMA 1CFMA 3LEXB 1OEZW 1FG9C 3HBZA 2SEBA 3FQNA 4AEFA 2OMYB 1I8KB 1KCRH 2OMVB 1U58A 4HUUB 1R5VA 3N5AA 3RI5K 2MOGA 5FYKD 1D6EB 1OD7A 2BSEA 2R4RL 4FD0A 2AXGB 5D1QE 3BHBA 4MJIA 5CMAB 5GS1B 1MFCL 1JRHI 5FFLA 7FABL 4JCMA 5A6LA 5IJVA 1SM3H 1U93A 4JPQA 4DN3H 4B0MM 1LO4L 4WFED 2AVFA 2CZNA 1BW8A 2QKIA 1PG7H 2HG5A 3O0LA 3HHSB 4Y2DB 4FQHA 1TZ8A 3FC8A 3AU1B 3ATBA 3QUZD 2YZ1A 5AW1B 5SX5K 3ARQA 1KJVA 2J1WA 3GMQB 3LNGA 4KKLD 3QDGD 5BZWB 3C12A 4S1RL 1NC2B 4PAZA 2OR7A 3LKQB 1PY4A 2OXHB 3E6HB 2BNRE 3VRJA 3MNZB 4MAYB 1PNCA 2GEQA 3SQOL 2YN5A 3CLEH 4JN1L 2NR6D 4YLQT 3MRGA 2GT9B 1FO0H 3ALXA 2XN9E 1HOCA 3DUUA 4FG6D 3WNKA 2BOCB 3RAJH 1PTZA 3H55A 3OPZH 1QBBA 1MRCH 2P5ED 3CFTA 1TYJA 1OL0A 3S36H 3X1NA 3QIUC 4WTXA 5C2BH 1SHSA 4FFWD 3RPKA 2I25N 4Z3JA 4DKEL 4DP5X 1NDGB 1U8MB 5EBWB 1J9CT 1OGAB 2XA8L 2BIPA 3BSZH 2GI7A 2X1PA 3MTRA 2VDML 2F8OA 2PO6A 5HI5C 1A6TB 2K8QA 1BQ5A 3EO0B 2EKSA 4KZDH 3EFDL 3OZLA 3RUGB 4ONHA 5I8OL 1TENA 4EIUA 1MZYA 3CGTA 3FU3A 4NT6B 4PS3A 4CC1A 2NY5L 3DETC 4W9KC 2PABA 1MG2C 1TJMA 3LRGA 4XNDA 3LDBB 1CI3M 3HG1B 3IGAA 3L7EA 2FNWA 4BE5A 4HK3J 2G2PA 5AW7B 5KZCD 1KXVC 3DX9A 3WTVA 1A3RL 1MXDA 3UZQA 1G7JA 1DQLH 3S3DB 4BH8B 2Y07L 4N68A 1KPUB 4G9FE 4K3EH 4PJEB 4ZFZA 5CBEA 4OCWL 2DQUH 3IDIB 1RJZB 3D09A 2DBLL 2MQ0A 2OX5B 2O61B 1EFXA 1QYGH 3UG3A 1NGQH 4PBWD 3QORC 1T6WA 1TZIA 2CLRB 1CG9B 2P5WA 4U6YB 3WV0A 4L3EA 3VB9A 5AWNH 1N2RA 2JELH 3Q2WA 1KJ2A 3ARDB 5ABZA 2XG4B 4I48A 2QEJA 2J2ZA 1JRHH 3P9MB 2BIMA 3S88L 2I9TA 4RFNB 2FECL 3BD3A 5IKCA 4Y5XC 3UPAA 1OP9A 5GIRB 4HK0B 1KN2H 4KC3B 5DJZB 5D4QA 1BM7A 3EOYG 3UBXB 1TNMA 3QDJD 4OBRA 1HQ4B 2AI0L 2BCKA 5EOTB 1OD9A 3VFGL 5A7BA 1AIFB 2ZNWA 2XTSA 4UANA 5GGRY 3TEUA 1AHWC 1JUFA 4LP4A 1Y0LA 4P4RA 3F65A 5DQDL 4LGRB 4WI8A 2HP4A 1OV8A 4NAQA 4KOCA 1KG0A 2O93L 2CU9A 4R7XA 1WTGT 2QT6A 3RWEA 4UB0L 3PHSA 3ULUH 2VR6A 2VM4A 1WK0A 1HI6A 4IOSD 4KMTL 4XNZB 1HHIB 4JFDB 1QABA 1CJYA 2F1BA 2CBMA 3Q44A 4NQCD 1T89C 2B2XH 4JE4B 2AQRA 1DBAH 5HI3D 2NRDA 1EAQA 5B38B 4V2CB 2JJWA 5C07E 4HPYH 5FV2A 4ZW5A 3QQDB 3VX1A 3O3AB 2XTJB 3M8OH 4RIRB 5H35B 3QZWB 7PAZA 3P4NA 3K71B 2FDBP 1FGVL 3BVWA 3L4ZA 4FQXD 4AQOA 1ZVSA 4LCWD 3CC5B 1KGIA 1LK3L 1SEBB 2MPAL 5E6IA 4E41E 1NIBA 2XN1A 3ABLB 1JGEB 2X05A 3EYFA 3QQNA 3FCSB 4L37B 1TTUA 5L2JB 1CFNB 2XVBA 3GF8A 3SDXB 3BMWA 1AGCB 2HKHH 2JI2A 3OWRA 5IQ9B 4FERA 4HEPA 3UACA 1IM3B 2KS0A 1EAPB 5HHQB 2V2XA 4IIZA 4W4NA 1BIIA 3EO9H 4HPOH 3QQ3B 3A21A 3KYOB 4K2UH 4KGLA 1TTRA 4AIEA 2VABA 4P2OA 5DHVA 4JFQA 5HD8C 2GSIA 4E36A 2H41A 1JZ7A 4EI6A 1S3RA 4FFZL 3CXFA 3HA0A 4JFFB 5EWIL 3CFEB 1MCQA 5SWZE 2R0WL 1F1DA 1FVDB 4RBPK 5IQ7L 1GGBH 2WWMD 3ZDZF 4DWHA 1F86A 3VG9C 1WCBA 3AW5A 4YFLF 1YN6A 4NQQA 3V9EA 2NZ9D 5F7KC 3N40P 3DVGA 2KZ1B 3FU7B 4EUPB 1KZYA 1JWSB 1ZLEA 2BP8A 4ZODA 5BOPA 4XMTA 2Y36L 3RHWF 1XGPA 5DD5H 3VGAB 1QZNA 4PMFA 1ICTA 2P52A 3BDYL 2WNGA 1KV7A 5EEZA 1FWXA 1AY1L 3FBKA 5J5EA 2BNQD 3BZ5A 8FABA 4Y16D 3I6LD 1NGYA 1BOGB 4JREC 1KJ3L 3RX7A 3KXFE 3RY4A 2R2HA 1D6VL 5L2KE 1IGML 4H1LG 1JPEA 4WU7A 4WV1B 3EJUA 1IGFL 1QEWB 3T09A 1KUMA 1WGOA 4OJEH 3LNIA 2B3IA 4X8XA 1I8UA 3QIBD 3JSSA 1WA0X 1HILB 4LVHB 5LAPA 3S9DB 1ZMYA 5EEUA 3MRLA 1G6RB 5F9DC 3D3VD 4QWWD 1K5NB 1SUJA 5AAWC 4Q14A 5EBMB 4D9QD 1QP1A 5JW5B 5I18L 3SDYL 4D7PA 1L5GA 3DGDA 4GW1B 5D71L 5F7LB 4PJIF 3TBSB 4GW5A 5CCGE 3QUXA 2YD8A 1MEXL 2BSBA 2QFPA 3HE7D 3P3RA 1RIUL 1FZOA 3NZUA 1Z9LA 2LVEA 1JZGA 1ZDQA 1AO7B 4G7VH 4X0KB 4X9FA 1SHMA 1K4DA 3OR7B 3VI4E 3GKZA 2FLMA 2ZXWB 1MG3C 4NNYA 4Q6KA 1D5ZB 4QPEA 4PD4K 4O5LH 1CGXA 4YXKL 5LG6A 3FRUA 5JO5A 5DRZA 3JV5A 4XBGA 3HHMA 1REIA 3QUMA 1I1YA 4HH8A 3MBED 3TH3T 3QA3A 2CJSA 4KRPC 1HL8A 2DJSA 1CK0H 1ES0A 3TPUB 2Y06L 4X4MA 4BCZA 2XX1A 5E4EB 1P5VB 3U0TB 3UTQB 1G9EA 1JV5B 3FYIB 2DJUA 2FB4H 3UEZA 2GTZA 5C0AE 3DHMA 2OMXB 1L7TL 2EVIA 3ABKB 1IJNA 3IXTA 4N2CA 2YC1A 2ZOLA 1UKTA 1URZA 4MQTB 1VRSA 1MF2H 4NZ8A 1YEHH 4EI5A 1SDYA 5IROC 5I1KH 3E8UL 2W91A 5E9DD 4MD4B 1GW6A 4AM0A 5DVOA 1F4WL 3CVBA 1U3YA 5F1NA 5F89A 5IM7A 4OSUH 3DVNB 1BAFH 4JFHD 5HHME 3FUDA 1M56B 1M1XB 3GSUA 2ETWA 5D7LA 1YSOA 1YYML 2F54B 4XO8A 1R3LB 1FVCB 4GRLA 4IS6B 4N20A 4LCUB 2UY7A 3D39B 1QSFB 4R7DA 3ZHFA 3NOIA 1IBGH 2AJUH 2FWOB 4PVMA 4IGBA 4OZGB 3PV6A 3KLAB 4RMVA 5DHYA 2RALA 2N56A 4G80B 1BWWA 3IRCA 3R4RA 3LHAA 2V9QA 3H7BB 4KNSA 5IW6A 4JY6B 2WP3T 2C5DC 3X13B 3K1KC 5DTFA 5CILH 5C08B 5IB4A 5DYFA 4F5CA 2ODHA 2B4CC 4XT1C 2N1TE 1SLVA 4K15A 1V5JA 4HWBA 3BP7A 4ZFGH 4JDZB 4D0DB 3GMMA 4NI3A 5JDSB 3J2PA 2P8LA 1RJYA 1Z5HA 4O02H 3S96B 1M3IA 3BH9B 4LESA 4M6OH 2NNCA 12E8H 3PWVB 1GMIA 3LPWA 2F53B 3VFWA 4PJAB 2YAQA 2OFQA 2GBTA 5D70L 1DQML 3D07A 3RG1C 4WVRA 1NUNB 3O6FA 2FJSA 1DVFB 4NXSA 1C7SA 3W39A 4A6YB 4I3SH 1EJOL 4B95C 2X6VA 4DUWA 2H8PA 1MJ8L 3SGKA 2OM5A 4H0HB 1YEEL 4KXCA 4I1NB 1T3FA 4NKMB 2MPVA 3WNMA 5L7XL 1XCTB 2GAZA 5DJ0A 3O4LA 5F7WC 4OU3A 5CD3B 3ASWA 5SWSE 1NCDL 4LSRL 4XNYH 1AGFA 5TE7H 1YPZB 3WS6A 4JFEA 4TF4A 1RZ7H 5HGAA 2BVTA 1MW0A 3NCBB 4JPWL 4R4ND 5E2UL 1HC1A 3FQUB 1ASPA 3ARGC 5D6DA 1T4WA 3WY1A 3EJRA 5AOMA 2X4SB 4HOWA 3LH2L 5HI4C 2J1XA 4LMQI 4BZ1L 2I07B 2DAVA 1A6UH 2XZQL 3NFSH 2ITCB 3WN5A 3BKCH 2K6WA 1DFXA 1ZT7B 2JIXD 1JFQL 1HESA 4XB3A 5EU6E 3QDMD 4ZSOA 1SJEB 4M1GL 2FJFB 2VNCA 3MODL 1DBKH 1AYOA 4CDHA 2G3XA 2ZOKA 3KH4A 1IC5H 1NCWL 1JF6A 2K6YA 2XXFA 4P4KA 4LDEB 3WNIA 4TQIA 1E3ZA 1LEGB 4MHHG 4J3OG 1U95B 3BGMB 4EDWH 2I9LB 4G6MH 1EHKB 2E8ZA 1QR1B 1HXYB 3TBBA 4XCNA 5D2LF 3CFBA 4CN4A 1X5ZA 2XWTB 3RKPA 3SGEI 2A6IA 3B2VH 2Z8VC 1XWVA 1XF5A 3ZR5A 4NOBA 4F7CA 2JCCF 3P54A 4AQAB 2N7AA 5IB2A 4ZMZA 3I02B 2CLVB 4L8DB 4HLEA 1HTYA 2XPGA 4HSQA 2E7LA 1N9PA 1AD9A 5IVZB 2MTPA 3ATAA 4ZUTA 2HLFC 3QAZB 1NDTA 4IYKA 4OZFG 1AQ8A 1E9QB 4NJAH 3VXPA 4HOMA 3G5VB 4AUUA 2WPGA 4NO0A 2SODB 4LLMB 3WO4C 3MLVH 4I0PA 4XB7A 1CDCA 5KSBE 2Y2WA 2G5BA 5DYOA 1HWGB 2B20A 4PMEA 4QOKB 4V1DB 2NQDA 1NOAA 1KENL 1SYSB 4G5ZH 4JR9L 1G43A 2KZBA 4ZUUA 3VFNA 5C0IA 2V8MA 5DSCA 5BPPA 3C60A 3DBXA 2NTFA 1UXMA 2XV6B 3MKKA 5CJQL 4JFYB 3N9GH 4O2CA 5HPMA 1ASOA 1IJ9A 2R1WA 1QI3A 2C3VA 5D8JL 2EZ0C 3WXVL 3V0IA 3GLZA 3F85A 4NHUA 1MWOA 5E1AA 4HIHA 1EFQA 3M88A 1J8HD 4JJOA 4L1LA 1RP9A 1DCEA 4GUPB 4TSCH 1BEYH 2XN2A 1H6TA 4U4IA 1F4XH 5HDBB 2H3XC 3AWFA 3WMPA 4NUPA 3FH7A 1ZA6B 3BVDB 4QAWA 3EOTL 2R69L 5F8RC 5C0CE 1ZLVH 4G9DB 2MHAA 3H3BC 2DYPA 2C3GA 2PTTA 3SCMC 1NGWA 1I9RH 4R84A 4D7BA 1M7DB 1OTUC 2Q10A 4IIQB 4C4BA 4JAMA 4Z0BH 2X2YA 1OZTG 2Z6FA 4FYSA 2YGVA 1DJWA 4NZTH 4WEBH 5T3XD 5EOQH 2FQEA 2D3VA 1EZVY 1GC1C 3CFQA 1YEIH 3TYFA 4UT6A 1CICD 3LSOA 4NOFA 4XN7A 3SQBA 4CBPA 5B4MC 5C2UB 2AXJA 1TJHH 2AXWA 5IOKA 2MNUA 5I1JH 4ELKA 5IFJB 5D1ZD 4PJDF 2FGZA 5EULV 3WXWH 4JQVC 4GT0A 3Q5YA 3GMLB 3VD2A 1QD0A 1FFOA 3QULB 3EGDB 2EVHA 1CF1A 2ARJB 1YMME 4QHMA 3F6JA 3T3MB 5IQMA 3FYEB 3IFOB 5HJDA 4YHZH 2YEZA 3DJSA 3HR5A 1HE8A 3ARYA 2CDFB 2V5TA 4ODBD 5KVGH 1J8KA 3GMNB 2FQGA 3SYOA 1FGNH 3TIEB 1UATA 5AW9B 1SJXA 2AQ2A 5ICYB 2DM4A 4FG4A 4HJUA 4A2HA 1MJ7L 2ZXBA 3AG2B 4WW2C 3NGBC 3N2JA 2BSED 3GSXA 2HFFB 3VWJA 2VC2H 1N12A 1S3KH 3F2LA 4MJID 1O5PA 5TH2A 2NY3C 2ITDA 4XVJL 3MLPA 5J9PA 2BCMA 1AKJB 4P46B 5E8NB 4U1GB 4UQ9A 3HW7A 4PJXE 1I85A 5IW1B 3FB6B 2G9HB 3NIFB 4L1TA 3WJJC 2NY5C 4DVRH 4ZW3A 3L1EA 4XVUC 1KIUA 1PQZB 3CUPA 1TETL 3WTXA 1UD3A 5HVFB 1CD1A 4YQXL 1IC7H 2FO8A 4L1DA 1Q4NX 3U6XS 3BPNC 2Q2LA 3BVTA 1RZGA 1GMEA 4ODWB 3PUUA 3L9RB 1R6VA 4Y9BA 3RNQA 1R3JB 5IGXL 1ED3A 4Y2NA 5F7DA 4LPVA 2VL4A 1HH9B 1T5KA 3T6QC 2V7HB 4OBSA 5C09B 1A14H 4ZO9A 4NN7B 2WBJC 5L6YL 2WB7A 5GRXG 1W0WA 3HAEG 3QUYB 5C0ND 5EO1A 3IKCA 4L48A 1R0AL 2J57A 4UV7L 3IPEA 1OCWL 5KYWB 4U3HA 1AGBA 2PWFA 4UT9H 3G6AB 3WTSA 4XNUH 2XRAL 3RWCA 3ZTEA 1J1XH 4M93C 5I6PA 3EOBA 4ZAKD 5D1XC 3CVIL 5KVEH 5AB1A 4DP0X 2J55A 4NP4H 4YNYA 5DZAA 2PO6D 1IGIL 2XIBA 1PFOA 4JO2H 4OLEA 1R17A 1Q0EA 4YHNB 3H42L 1VCBC 4E9LA 2Z34A 1P9MC 3IPBA 2LV4A 5KG9A 1CQYA 1TQBC 3LV3B 3NIGF 1DSFL 2F1AA 1JOIA 1FVEB 2PCYA 4PLOB 3E3QC 1EANA 5JOFB 5I30L 2ZYRA 4LPYA 1BLNA 5MHSE 4CMMA 4O9HL 1KFAL 3TEZA 3DO4A 1MHCB 2CJUH 3ZOAA 1I1AA 3ZGIA 4AG4L 1NDMA 1WD8A 4Y8AA 2CKBA 3OX8A 1FNGA 2ZONA 2BSSB 2PYEB 1E6JL 1II4E 3N85H 2IAMB 5DUML 1RV6X 1JP5A 4XCEA 1EFXD 4GEJA 4NBXB 4I4WB 1LNUA 4WCYL 1PD1A 3HUJF 3DRQB 5T1MA 4IRJB 1OAYH 2QADD 4GB9A 4POZC 4L3ED 2APBA 4BFIA 1CS6A 3L3HA 3S34L 5C0DB 1MHPH 2XV0A 4RFOL 3FFDA 5CLTA 4K94L 5IVXB 2HJLA 1OOAA 3MV7E 4CU7A 4FXTA 1PMYA 3MCG1 4NBZB 5CXPA 5J57B 2CHXA 5IT2L 2B14A 4M7ZC 5IEHA 1J0IA 1P7HL 4JFVA 1IV8A 2ATKA 2OL3H 3GXIA 1JWUB 1QNIA 3E9TA 1GZHC 3PQYE 5FGBA 1WG3A 1JFHA 1TO4A 1XT5A 3NQIA 3UTOA 5DUBA 4CKVX 4H40A 4K23H 2DQGH 4DGVL 4Q4EA 2V3FA 5HGHB 5FA4A 4HCIA 2F19L 3DARA 3ZL4H 4B9PA 1LK2B 2GIXA 4OKDA 3QQ4B 2XQBH 3GI8L 1IQDA 2VN6A 3K80A 3LVTA 4XMKL 5EA0H 4IU3A 5DURB 3EXLA 3ASOB 3HI5L 1HL4A 4ILDA 5JHLH 1JBJA 2D73A 3QPKA 4DKFH 2OMZA 4NQEB 1MLBB 4JDVA 3GSNL 4XXCC 3H2PA 2FATH 2X3CA 4YVUA 1MFEL 5LDUA 1WAEA 2B4CH 2OMBA 1RURH 4P2YA 2FYYB 1TU2A 5JXEC 5EN2A 4I18C 4LCIH 2C7UB 2HRHA 4H88L 2LFGA 4MBOA 3DPBB 3NTCL 5I9QB 1MHHA 5KVEE 1D5MB 2X89D 3HBPA 1WVZA 3AY4C 3L95A 2QJDA 2W0KA 5E6ID 5LGHH 3KWUA 3RY6C 1MCWW 1TVHB 2Z65C 2HKFL 3P0VL 1O5DT 4YEEA 2WZ5A 1DLFL 5H4YA 4WI0B 4G1MB 3RUGF 3I50L 5I5IA 1KLUA 3KAAA 5DGQA 1W8EA 2OTUA 4Z78B 5I0YA 2APTA 4DVBA 4NKQB 5KANI 1S7RA 4OAWB 1UFGA 4LVOC 4WHYH 1BZ8A 2ZPKH 1OTSD 1TMCB 4I5BA 3VNZA 2HH0L 2WSPA 3ABGA 3CN2A 1BQHB 1JXJA 2DMBA 1E8YA 2RQEA 1I8LC 1BV8A 2DV6A 4HV8A 4P2OD 3CBRA 3CHXA 5FECB 3CDZB 4PWEA 5CLWA 2B5IB 1UOVA 2BFVL 4MCYA 4MD5A 4PJEF 5AVZB 3WJMB 3BSHA 5EORL 5EU7E 5F70A 3QPQC 2EAEA 3R18A 5D2LA 2D0HA 1TYRA 4S2SA 2B15A 1EZVX 2NT0A 3PNWA 3GI9L 3DIFB 4U1LB 2JCCA 5GHWH 5E08L 4N0FB 3QNFA 4LBAA 3WEOA 2Y7QB 3VD9A 4TVPH 3GM0A 3FUKA 3IU3B 3DTXA 2C4FU 4P59H 4N6QA 1D7DA 2NY4D 5ISZE 4AEHL 1AXSB 3P9LA 3AREB 3O41A 3MHZA 3V0VA 4YIQA 5B8CC 4JB9L 2YAEA 5HYEA 5EC1B 2A9NL 5HVHB 5DWUH 1SLXA 2CHWA 3U4KA 5I15H 4TUJB 3SGJA 5KVDH 5HGGS 5FYJL 4NN6C 1WRFA 5A2BA 3UBGA 3PYCA 3VFOA 4OGAD 2OPCA 1ORQA 3PJNA 3ULSB 2CRMA 3PWLB 4KJPD 4CKQA 1B6UA 2WMPA 3P30H 2VKXA 3NCFB 4DPRA 2CDEB 4LSQL 1YAZA 1J88A 4G3YH 5D7HA 3KG5A 2BX5A 4XXDB 3O0RL 4WZ9A 2WAHA 4UDTA 5HHOB 2K3TA 1SVCP 4LHUA 5AKRA 2ZX8A 3OXSB 1A4KB 4MZRA 4HJJL 4R5TA 2IANB 1CE1H 3UPRB 4RAVB 1MH5A 5DMGD 1MOEA 2WWOA 3ELQA 4Y88A 3WFBL 4BZ2L 4FLRA 2FSEA 1FORH 1YMHA 3QUXD 4N3UA 2IQ9L 3HRZA 3U9PH 5E4OA 2W94A 2R9HD 3T0DA 4PM1A 3BUIA 4QXTB 1FAKT 3HI1B 2NW3B 2PCPB 2ZCLH 4OKVA 2YBRB 5DC4B 1Z5LA 5CJ8A 1TJGH 1JPSH 5HJ3B 4TQEL 4U1JB 1Q0YL 3SDXF 1NGPH 3OB0H 3X1BA 1F42A 3H8NA 5LG1A 4GIAA 1HAUA 3LHPL 1NBVH 3PG2A 5I8EB 1MWAL 1RAMA 2MCAA 2E75C 1WWAX 5I1HH 3HMWH 2Y6SC 2WXQA 4BXSV 3CHPA 2R56H 2W8CA 2VZOA 3Q9PA 3EBGA 1TQCC 2WJ5A 5EC2B 4RNRA 1JCKA 2BWDA 4XO9A 1CU4L 3CFNA 3Q8CA 1F0LA 2WUBL 2V7NA 2XJLA 2UXFA 4PJDA 3ZL2A 2X0UA 1KSRA 3TN0A 4TSAH 3NJVA 1UYWL 2R4RH 4EI5D 2R1XA 1NLBL 5G2NA 2F8XC 4PRBA 5DQ9B 1H5BA 1XH0A 4ZK8A 1OGSA 4QRSB 1WIUA 3X11A 2IWFA 3OWEA 1CQKA 1MFCH 1H15B 4DEPB 4JG9A 3L3JA 5K5YA 4WUUA 2F58L 3WNLA 3MU3A 4BWUA 4TVPE 2FR4B 2FECI 3ZKND 2X3AA 4AH2A 4L8CA 3C6LA 1EHXA 3DXAD 3AGVA 4TL4A 1IU1A 4XN4A 4JO1L 3HB3D 3MCLH 2ZYHA 3EJYC 1BAGA 4LSTL 2A83A 5K59E 5D7LD 2ZUVA 4JM2C 4K9EL 4M7LT 4GRLD 2DLIA 1ZVYA 5HYJA 1EAJA 4ENZA 3P4LA 4IOFC 2PETA 1NJ9B 2BSTB 1OQOA 1X5AA 3K81A 3SE3C 3VJ6A 4S1RH 5I0VA 5AQ0A 4IGBD 2VMFA 4L8BA 1CFTA 1RULL 3SPCA 1TZHA 1DHKA 3EH2A 5FGSA 2WKLA 5D1QB 2C9VA 5TDPA 1DEDA 4CVZB 1EZLA 2QSTA 4JN1H 1U3HB 3FNKA 3VWKC 1KYOK 5MEQA 1PW3A 3ARBB 4JCWA 2NY2B 2D2OA 2HN7B 4TMPA 2DIJA 1EK3A 1MREL 3PGDB 3O4OC 2WSDA 4QXUL 4ZMPA 2HJKA 1SLWA 3I9IA 4DKEH 2XA8H 3GSOB 3LKRB 1EEYB 1N68A 1OANA 1TZAA 1NINA 4JM0A 4L1SA 5F1OB 4N1CA 1KWKA 1Z2KA 1PS3A 3LS4L 3MJWA 1SEQL 5K9KB 3EFDH 2X1XR 1D7BA 5CIPB 5I8OH 1EGJA 3QNZB 3MMEA 1RZ8B 7CGTA 3O6FD 2XZCL 3H56A 3SE9L 3BN9D 2NY5H 2BVOB 4BKLA 1T7WA 3VH8G 5I82A 2XN9B 4Q89A 1BVOA 4MKTA 3RGVC 1HH6B 1NLDH 3OKLB 4L9LB 4PWHA 4U7MA 2YGPA 5CKGA 3JUYA 3RJQB 1A3RH 5C0GB 3M45A 5I1GL 4NWUL 1P7QD 3F58H 1AZBA 2WCPA 3O4LD 3NH7L 2Y07H 3TNNA 5I0XA 5F3FA 2EIZB 4QJ4B 2ZXDA 4K5LA 2BOBB 2YGNA 4OCWH 4OVVA 1AMXA 4RGMC 3SKNB 2DBLH 3PL6A 4L8SA 4C54A 3EH1A 4M8QA 4KPHL 2VDPL 4JFED 4LEEA 1BVKB 2JCWA 4MVBD 5HYQB 4U0RB 1YUKB 4NCC1 2IVFC 5TQ2L 2NZIA 2PR9A 1AP2B 1IGTA 1NSNL 3VXRE 4UTBA 1UQSA 4E0RA 1FNAA 3CSTA 5J3HC 4LPTA 5EEXA 3V0FA 4X4YA 2GCYA 4Q8BA 2VZVA 2HMID 1XF3A 4PJ9B 3HUJA 1YN7A 1CDUA 2AI0H 1ZCRA 4OI8A 1I8KA 3GIZL 2OMVA 4AK1A 4G9FB 4I7ZC 4HXBL 5IOPB 3QWNA 4N85A 1OAQL 1HXMA 1D6EA 3M1CA 5DQDH 5KSUB 4S1QL 4X80L 4EQ2A 4P4KD 4XMLL 3TL5A 2XYCA 5GS1A 4UB0H 3VYPA 1IKOP 1QSEE 1GYWA 1RIHL 2EXSA 2H45A 4TSBL 2WZPD 3VMPA 3QEGL 3KLQA 3MLYH 3APDA 4KMTH 5ETUB 3CFCL 1E0OB 4OZGF 1WAAE 2FZ3A 4I87A 2X4RB 4JDEA 2E6JA 3HHSA 3QRGL 4Y2DA 3IJYB 4OJYA 1EUTA 4D0BB 5JW4Q 4HVBA 1JE6A 2D2CC 3AU1A 1A3LL 4KO5A 3B56A 2J5WA 4RDBA 3GMQA 5TFSL 1V7NL 4GBXA 4N0CD 2VZSA 5BZWA 3FBQA 4H25B 1NC2A 3CDFA 5DVKA 5C86A 4GMSL 5GZOA 2I27N 2P26A 1FGVH 4FFVC 1HFUA 6FABL 4M8VA 3MNZA 2QLYA 1V3KA 2PLTA 4MAYA 2ZWLT 1JZDC 3NJMA 3M17B 4N1EA 4ODSL 4C56E 3IS0X 2MPAH 1LK3H 5FHBL 5HYSB 2VSCA 3CPLB 1OP3K 3SDAA 2GT9A 1UWGL 3LMJL 3VTTA 3VA2C 4LSDA 1SFDA 2BOCA 3ILDA 3TONA 4WFGD 1GGCL 1ROCA 4WWKB 3ZT6A 1X5LA 3GGWB 4NO0D 3L6FB 5CAYB 4I0PD 2AAAA 2BO0A 4PJAF 2XKSA 1BECA 1QBLL 1KCVL 1YEKL 4EO5A 1VHPA 3UJJL 2NXZC 3I2CL 1U8MA 4KV5F 1FO0B 1HHHB 5JW4N 1OGAA 5E2TL 1A7RH 4DH2A 1SN2A 4EN3C 3BZEB 4MFHA 2BNUB 3C60D 5I8CA 3VVVA 4UQIM 2EDOA 3EO0A 2WJ7A 3RUGA 3EHBB 5AL8A 3AY2A 5EWIH 1H6UA 1T1XB 2E4TA 3SDCC 4E41B 2R0WH 3A5VA 2WANA 1DBJL 1ZS2A 1YPZF 3CFIC 4XE5B 5IQ7H 4JM4L 3HG1A 3RX8A 5E5RB 2XG5A 3UYOD 2VN3A 1UFUA 3VFRB 3VRLF 5IR1B 1WD9A 2A5UA 3KPSE 2WQXA 1NFDA 3H3KA 2Z4TA 1KPUA 4PJEA 2FX9L 2A4CA 2KPNA 1T04B 1RJZA 2Y36H 2DYPD 3IDIA 1W6LA 3MV11 4LQFL 1G9ML 2O61A 1GZQB 1KGWA 4YC2C 4PRHE 5CN1A 3BDYH 1GS7A 1AY1H 1AZZC 4HGWB 1QFPA 4U6YA 2IADB 3ECBB 3GMPB 2R2BA 1BZ9B 4WU5B 2VXQA 2IPUG 1KJ3H 3U30C 2OQJB 2XG4A 3NP3A 1J9RA 1CT8A 5FGRA 4ZXBA 3ARFC 1IGMH 5AZEL 1IGFH 2J1KA 4QXGH 2C1OB 3HE6C 3TVMB 2YMTA 4Y19E 3E3QE 1X9QA 4GRMB 2JKXA 2A6JA 3UBXA 5A6IA 1HQ4A 2I26N 4KK9C 5EOTA 4ALAC 1J5OL 2AC0A 2XWEA 4P49A 4FXGB 2EDBA 2ZX5A 1ZIAA 3MRHB 3NCYS 2KUTA 3X14A 3ISWA 5J56B 1RZQA 3EOAB 2GK2A 2OK0L 4MZ3A 1XAKA 1UT2A 1KNOB 2P8PA 3SDYH 4AGNA 5I18H 2EP6A 4RFEB 5C0CD 5LGJB 1M7UA 4MMXB 5D71H 1OW0C 2K4AA 1J9SA 3KXFB 1RIUH 4NUJA 1HJCA 2PWHA 1OAJA 1W8OA 1EQWA 4LLAA 5L2KB 1XXDC 4G83A 3OZKA 4FI7A 4UZSA 3W38A 4GRWE 4YXKH 1KB9K 5B38A 1DJZA 2PP9A 2WYTA 4AV4A 1IQWL 1OP4A 1BZ7A 2E76C 2G4EA 3CX5J 3QQDA 3ZW3A 2K6ZA 4RIRA 3QZWA 1KTCA 4LEOB 4NO5B 4HJSA 4PJ8C 4ZDHB 2UYLB 1TSRA 3TA3C 3CC5A 3ECVA 4MJ4A 2EACA 2KERA 2Y06H 1GS8A 1ZANL 4HG4J 1JGEA 3JTSB 1BD2E 5GRWA 1FP5A 3SDXA 2H32B 2WBXA 2XVKA 4OIIL 3FO9B 3G7TA 3BAXA 5JNYB 1AGCA 1KLGB 1L7TH 1VADB 4JG0L 2NY0B 1IM3A 1OAZL 1EAPA 3VI4B 3MRPA 4ZW6A 1XCQA 4FQ1L 4R96B 1AGEB 5JOEA 4JFTA 3RFZB 2G60L 3O2DA 3LNFA 3E8UH 1A2YB 3CFMA 4UYPA 3F7PC 2KDGA 2K3HA 3OD3A 2VN5A 3NJKA 4K94C 5BRZE 3EYQD 2ZNXA 3P2BA 1F4WH 2CNYA 1XIWA 1KBBA 5HDBF 2HVKA 5A3ID 2YJQA 3E80A 4S1DC 3UCQA 4XP9L 3R4DA 4R5XA 4JFFA 2C9AA 3CFEA 4G72B 2Y3NA 1YYMH 4P5TB 1OOWA 1ZTXL 4OF7A 3BH4A 5EIIB 1S7WB 1P0SE 5LNGA 4B3VA 4H1LA 1IUZA 1E42A 1JAEA 2PR4L 4PLJC 4S0TD 3VD0A 3FTSA 5GRUL 3FU7A 1R24A 5PAZA 1JWSA 4G59C 3GDBA 4YDZA 3X1EA 3FSWA 3ML8A 1NMCB 3MGTB 1RUMH 2VR5A 3CQPA 5GJTL 5DQJB 1FG2A 4F2MA 5CSBA 3W9EA 3C8DA 3ORJA 5ENWA 3RTQC 3T65B 3S3BB 1DR9A 5JIHA 2QPSA 4K8RL 4QTFA 1Q94B 4QRUB 5HHMB 5EBGA 3HOGA 3T3MF 3QE5A 2H26B 2WXOA 4IKJA 2QELA 2BP0B 1QEWA 4Q58C 4EJ1C 4YXHL 2X70B 4XH2B 1I7ZA 3QZLA 3QBTB 2O30A 4Q4IA 1HILA 4U7KA 2V5SA 3BFWA 3IAQA 1PIGA 4AWJC 1KACB 1CLCA 1T4KA 5JPMC 4PGJA 1DQMH 3KJ4C 3RVXC 1U4FA 3NZ8A 3BLBA 3MI6A 4FQ2L 1IBFA 4XZ4A 1MW3A 1EJOH 5C0BA 1Q9KB 4N2AA 4N24A 4DW2H 1JK8B 1YEEH 3NIFF 1ZDSA 1EBAA 1SDDB 3VMNA 5L7XH 4BKSC 4PJBA 4GNKB 2BIOA 1NCOA 3D06A 1EXUB 1NCDH 4LSRH 1D5ZA 3GHPA 4HFWB 4WAFA 4R7VA 5C1MB 1OB0A 1I9JL 3BH8A 3CE1A 1H6EA 2HRLA 4L29B 2X4UA 2DW5A 2H2PD 4JPWH 3L4TA 1R3HB 3FW6A 2YLKA 5E2UH 1VESA 1ETB1 3EUDA 4JHBA 1KCWA 4G8FB 5LXVA 4AT6B 3TPUA 4F27A 3LH2H 4BZ1H 1P5VA 1BSIA 3U0TA 2ZYIA 2RTTA 1ZHLB 2XZQH 3NK3A 3UTQA 1CGWA 3ZYJA 1JV5A 1RK1B 2APFA 3OJ2C 1QPKA 3LXUX 1T66C 5B7MA 5C3IA 2D0GA 1JFQH 2NZ1A 4QTHA 2YXMA 3RWHB 2IWEA 4G8GE 1PJWA 4M1GH 2XICA 1EAOA 4YBHA 1XMWA 2H47C 3WFZA 1NCWH 4FQQB 2AEQL 3QJXA 1O7VA 4KK6D 4F1ZA 2IFGA 3GZOA 3ELAT 2EDXA 5DEGB 5LAXA 3W0WA 3DVNA 2YQ2A 4YHYC 2X7LB 4GP4B 1EMTL 1TFHA 3H9YA 3WKPA 1RERA 1I8MB 4OF6A 4PY7B 1W0VB 3B5TA 1E4XL 2I5YL 3HLAA 3ECQA 3QVAA 2YSTA 1DTUA 1P4LA 4IS6A 4LCUA 3V4LA 4FFYA 4LOEA 4FTVE 3P3SA 3CZKA 5EU6B 4FRWA 5JHBA 3FH8A 2Z1KA 4LLWB 4P06A 2JXMA 2Z92B 5JIPA 3PJSA 4A2GA 4G80A 4FFWC 3VXME 1J12A 4LARH 1IEBB 2GJZA 5MI0C 2OSXA 1HCZA 5BUAA 2Y22A 1HE7A 2E86A 5IVXF 3EH4B 3VD5A 4MQ7B 3X3FL 5AKVA 2IALB 4LF3B 4HBCL 4WJ5B 5JDSA 1KENH 1CO1A 3ULVD 4JR9H 3S96A 2GJ6B 5B1BB 1F3JB 3CVHL 5AW4B 4DPAX 1FI8C 1F11A 5HSFA 2C9QA 4MJ6A 3G5YA 2F53A 5CJQH 1A25A 5HDWA 3P2DA 1FHNA 3MYZA 3IJ7A 3NPZB 5JW4M 5D8JH 5ID0B 3WXVH 1XB8A 4O02B 1DVFA 2AQ3A 4XMXA 4EIBA 1HK6A 4Z3EA 4MZ2A 2H3NA 1IKNC 4DIXA 4GG6A 3E9UA 4DKDC 5IUSA 1A6WL 1AMYA 4LHUD 2VSDA 5K1JA 4WFFE 4BFKA 1KXQE 1OT1A 1V55B 5KSBB 4OFVA 5EBLB 3EOTH 2R69H 5TDNB 1XB6A 2EIEA 1LE9B 5FYLD 5E5UB 1G6RL 3ZQ9A 5IHUL 5IWLC 5IEKA 3UGUA 3IMVA 1X5FA 2P7TB 4K9EC 2HX7A 3RWGB 1QACA 2VB5A 4H13C 3PWPE 4DJMA 1GPOL 3ZKXC 3WI9A 3AT0A 1ETJA 4KKAD 4XXWC 2OR9L 3EZJB 2I07A 4M5ZL 5HY9B 1XL6A 3P3YA 4UT7H 1G7MB 4S1SL 3GXUB 3RA7L 4X9YA 4C57C 2YS4A 3D87B 1TLMA 1IEHA 1BXVA 1SYVA 2EYTA 2EUXA 5C0CB 4D9RE 4ZOCA 4RGND 3BKML 4AQ8A 3PDDA 5CF3A 2EDLA 5IBLC 1U8IB 2VIRB 3JTTA 2GSGB 5GGSB 3ZUNC 1LEGA 1Z5YD 2ICEC 5J4MA 2DI7A 1HHKB 1U95A 3BGMA 4CVUA 1MJ7H 4FLSA 1S2EA 4OZFA 4YBLB 3TN0D 3TEYA 1QR1A 1HXYA 5E00B 3DROB 1W15A 2AJSL 4BHUA 4DETA 5DS8B 6PCYA 3ZIYA 3QK0A 4XVJH 3ZE2E 1KJ2L 1T20B 2W92A 4NNPL 4WUUD 1BMGA 4AQAA 3SO5A 3C6LD 1BFSA 2GQHA 4FYQA 5H94B 4L8DA 1Y18A 2WTRB 3O6LL 1YMMB 4J3WA 4CBZA 1TETH 1TTAA 3KPRE 3QRBA 4X98B 4E9WA 5IVZA 3NUKA 2K0RA 2HZHA 4YQXH 4OFKA 4P9HL 1FDLL 4WDIB 4UBDC 5HYJD 3UJIL 2CKNA 4HETA 3G5VA 2CR6A 5LBGA 3FUNA 4G8EB 1U8KA 1L4IA 3HVDA 2HVJB 5IGXH 3JV6A 3NRFA 4LLMA 3NJXA 3NQKA 4BFFA 5KVFE 3GBNL 1DLHB 1DUZB 4W68A 2IDTA 3D85B 3KPLB 5H37H 5DK2B 1OF2A 2K1MA 3UGEA 2CG9X 4QOKA 1DQKA 3OMNB 2FD6H 3U6RA 5L6YH 2BMKB 5MEPA 3SKMB 2MKWA 3KWXA 1UOLA 2HT4D 4NZRH 2CIIA 1R0AH 3D18A 4PJXB 4UV7H 3TLRA 1OCWH 4HOZA 2EEAA 4KI5D 2XRAH 4KROD 5G4MA 3EJPA 4MXVE 4WO4C 2Q6WB 5FOBA 1AHWB 3CVIH 3BWAB 1MCSA 3TIDB 3ZKMC 1IGIH 1U8PA 4RMQA 2VLMD 3BAJA 5K9QI 3BUPA 4NQDE 4WI4A 3S5YA 3H42H 4GUPA 3V0WL 1OKEA 2X4TA 1UB5B 1N6UA 1DSFH 1MVFA 3V8CA 4P57A 1OM3L 3QQXA 4K9JA 4B96A 5ICXB 3NJNA 3EFFA 3L4YA 5I30H 3UAJA 1RI8A 4W9FC 3LX9A 1KFAH 4N0UA 2DM7A 3EO1A 4IIQA 1S9WB 4B41A 3H53A 4AG4H 3I6KB 4P5RA 2WWKO 3B43A 1UJ3C 2ERJC 3FSVA 1E6JH 3HMXL 4A6YL 2W1NA 5DUMH 3SOBL 2F08A 3PL6D 3VDAA 4G6JL 4QWWC 4LPCA 4WCYH 1WV7T 5I19L 2BVPA 3DURB 5GZNA 1CDBA 1GS6X 3TV8A 3FUJA 2R0ZL 2XLLA 4CW1A 1JYNA 4IBQA 1SBBA 2DTML 3EYSL 4UUJB 4CGUB 4CN6A 3POHA 5IFJA 2BY3A 4G7QB 4D9LH 3S34H 4PW9A 4RFOH 2W9EL 1KZQA 5E5LA 3QULA 3EGDA 4K94H 4NQXA 2ARJA 5A16A 3BQUB 3HVNA 2C9RA 5CWSA 5IT2H 4LOFA 1J0KA 3II3A 4Y4KA 5D7JC 1UUNA 1TYEB 2JJUA 3CD4A 3STBA 3TIEA 4ODVL 2ED7A 1E5AA 1TQTA 2WLKA 3F5WA 4RCAA 4YK4B 4IRSC 5T1KA 1OAUL 2XOTA 3KNBA 4R2GD 4XP4L 4DGVH 5I6OA 4M00A 2IGTA 1G7HA 2AEIT 2DWSA 2F19H 2PW1B 5ANMB 4AE1A 4FULA 5E95B 5ID1A 3QHZL 4JX0A 5ABDE 4P46A 5E8NA 4DSYA 4XMKH 2FEEL 3HI5H 5GISH 2GG1A 5GGUB 5IW1A 3FB6A 4JANB 2VDRB 4AC4A 5BW7A 2VC2B 3JTBA 3MV7B 2ZUTA 2V4LA 3WMSA 1PQZA 4Y2DD 2P43B 3GSNH 3QI9A 3TTSA 2AJZB 5C6WH 5C6TL 2NY6C 5EEVA 1MFEH 2PXYA 2O1AA 5E4IA 4LL9A 1M7IA 1EO8L 3PGCB 2A2QT 4AL8L 4ODWA 4GBXD 5GZOD 1NC2D 5IMLB 4H88H 4OZIF 4JQIA 4EVNB 1G9MC 1AJ7L 2BW5A 3L3KB 4QRTB 2AFNA 5CN2A 3L3OC 4MAYD 3NTCH 4JREB 1JGLL 4HJIA 1HH9A 4NGHL 5DLLA 2V7HA 5C09A 1R19A 4CGTA 2FVNA 1X4XA 3SDAD 4NKOA 3GEWB 2XY2A 3FU6A 3P0VH 1W0YT 3QUYA 4Y5YC 3A4FA 1XO8A 3FOMA 4A7QA 3FO2B 1DLFH 1RJLA 4EMZA 3LZFL 5KYWA 3I50H 3G6AA 4OLYL 3H2WA 4AYID 1TITA 2DQFB 2J25A 5B1KA 5DDHB 4APXA 3RPIB 1OGAD 2BY1A 2YPLA 3PPEA 2WLYA 2GITB 2HH0H 4LSUL 3IJSB 3CFKB 4YHNA 3MROA 1UZ8A 1S7QA 1QW8A 3AUVA 4EE2A 5FB8B 1EEUA 2ZX7A 3LV3A 2BFVH 1J5IA 1CIUA 5DJYB 3FKUS 5B39G 3OF6A 2FO4B 5T5NF 1FVEA 3GBDA 4G43B 2E56A 3K91A 4A2MA 1GVIA 2NW2B 1XMEB 3HG1D 1NCGA 4WWOA 3GI9H 2JV6A 2DY2A 3DTDA 1MHCA 1V3MA 4GIOA 4UU9B 4Y5VC 1PL3A 1VFMA 1S7XA 2VR4A 2PYEA 4J3UA 3CSFA 4AEHH 4IBSA 4FZEL 4KKQA 5AALA 4Z8FL 4JFPB 1Z6JT 3MV8A 3ZMEA 3OHXA 3DWTA 5EG6C 1A6AA 3DRQA 2IOOA 4IRJA 2A9NH 3X12B 5K9OA 3QG7L 4E9YA 5K69A 2BK8A 5FPIA 2XBZA 5HVWA 4ZXBD 5IVXA 5FYJH 4HS3A 4X99B 3T0AA 1DBBL 5FO9B 3T08A 3BJ91 5FF6A 2RR3A 2ZXGA 4XP1L 3UOAB 2WINB 3PP4L 3B2MA 4Y1AE 1R3IL 1JWUA 5FV1L 2CO2A 2OV0A 4LSQH 3K2KA 4PP2B 3O0RH 1HU8A 5FO2A 4MDIB 4J3BA 1CDHA 2B3RA 4PPTA 5ISZB 2R29L 3D4CA 4R0LC 4HJJH 5CCKL 5DA0B 3P11L 4JFXB 3U4AA 3HNVL 4BZ2H 2KLSA 1L9MA 4MMZA 2WWNA 1J9QA 1A9EA 1ZVHA 1OT4A 2IQ9H 2DBJA 4OCXL 4P23C 4Z18A 2O6PA 1M1SA 1LM8V 3D2UB 4JFDD 3MOQA 1DSWA 5E5MB 2GY7B 2EILB 4LBEB 2DN7A 32C2B 4FNUA 1FJ1B 1XR8B 2DM3A 2P8MB 1Q0YH 3FJTA 3KGTA 4MB4A 2Q8BL 2WP3O 3LHPH 3CC1A 1TQSA 1MWAH 1Z3RA 1WFTA 1CXEA 1B4LA 3LB6C 1BBJA 2JMRA 3MUHL 2VR3A 1XAUA 1BOYA 1D5MA 4QCIB 5D6CB 2B0SL 2BXYA 4X42A 5F88B 1WTLA 4P2RA 4K8RC 5FWRA 1IAMA 1CU4H 2ICWI 1B0IA 3LDBC 4BA8A 3WOVA 1M42A 3TJHD 4Y2OB 2WUBH 5IV2A 3VNYA 2AK4E 3FZUC 2UVEA 2F5AL 5J89A 1IM3D 4DGYL 4Z78A 4MNGE 4H2AA 4R6UA 1UYWH 2JJVA 1NLBH 4OAWA 3EDEA 4IBUA 1PZSA 1HCFX 1QWHA 2J4WH 3PREA 1BQHA 1C12A 2TRHA 5DT1L 5I0DA 2F58H 5FYKE 1U8QB 2WK2A 1XIWD 3SE8L 1MAKA 3I3DA 3P73A 4TQPA 1FNFA 4NCC2 5EDSA 1ACYH 2R27A 5EOCL 3WJMA 1UXLA 3ARDC 4JO1H 4JFFD 5TF0A 4RFNC 3UZVA 2EXYD 2Z1PA 2WO2B 4WFEE 4K9EH 4QY8B 4L0ZA 4DAGL 3ROLB 3ARUA 4WI9A 5I26A 3LRLA 4NSKB 1S4IA 4U1LA 2E0PA 1WDAA 2OP4L 4N0FA 3OGCB 3ZRFC 2RGSA 3RVWD 3WHE0 2VDLB 3D8MA 5I1EH 5A43C 4GO6B 1RULH 1CTMA 1M2OA 4AQZA 1BFVL 3ARGB 1AXSA 3HAEB 3QDGE 4GINA 2Q1EA 5J7CC 1ASQA 2D31B 3IDNB 3QO1A 1G84A 4NQVB 4CRPA 3B2UD 5I2IA 2OJEB 4C4KO 4PJHE 4LGSB 2P28B 3EG9B 2A77H 4LZKA 3TBVB 3ABMB 3VSUA 1F45A 1ECYA 1MREH 4W93A 5DRNB 1EEZB 4UOQA 5HGDA 1AR1C 3U9WA 2ZCKL 4Z0XB 2ZUYA 4UAOC 2X2IA 3KCPA 3ULSA 1FA4A 3PWLA 3NIDB 3HIZA 4QHNA 2CDEA 2J3SA 2DKMA 3P3UA 4YDKL 5HHOA 2VQ1B 4PBVC 5D7EA 1SEQH 2AEPL 1THCA 3KPMA 4OM0L 4BH7B 1YEJL 2XTJC 4XAKD 1CDIA 1XD1A 2A7BA 3TO2B 4B9ZA 2IANA 1VDGA 3N44B 1KYUA 3SE9H 4AYBA 4XBPB 4N2HA 5C0BD 1QLRA 4QLRA 4XCFL 3LNEA 4X8JB 1T0MB 4XMVA 1ZE3H 4NWUH 5I1GH 3MBXL 2A9AA 3NH7H 5D1ZC 4Z5RB 1FLTX 3RY5A 1MRDL 2PCPA 2NW3A 1FFRA 1SJHB 2FEJA 4KPHH 2VDPH 5L88L 3KLHC 2CUIA 1NAMB 5HJ3A 5TQ2H 4BELD 1AS6A 3GRWA 4NYLB 4PWGA 3HFML 3SBWC 3P02A 3I9PA 1NEZG 5I8EA 4ENED 4I1RA 4L4VA 2XC8A 2IDSA 3VI4F 3G5XB 3A47A 1XGUB 1LEKB 5I71C 3P69A 2FIRT 4WI5A 3VD3A 2IJ0C 3CSYB 2CHZA 5L4FA 5EC2A 2LOEA 2A73B 4DGWC 5JQ6L 3S3JA 1Z66A 1ZLVK 4YS4A 1I3GL 3GIZH 1GZPB 4HXBH 2HKAA 1ZLUH 1OAQH 2EIJB 4MRCA 3QDJE 3WU1A 1C08B 2ZWNA 2C1PA 4OB5L 5C0JA 3OC5A 4S1QH 4FLQA 3JWNC 4XMLH 4QRSA 4BM7A 1QVOB 4X6BA 1VGEL 3VGAC 2WKOA 4H0GA 4UDUA 1Q9OB 1RIHH 1TFPA 1T7ZA 2X4PA 4PRAB 5AZ2L 4NI6A 4P2QA 3X1GA 1SXCA 2FO1A 3QEGH 4F24A 1VEOA 3CFCH 4UQCA 3W0WD 4QRPE 4PGEB 3RWJA 1KEGH 1QASA 3QRGH 5HJBA 2XTLA 5E24E 2ZD0A 2B1HL 1A3LH 4WV1C 4ACPA 3ZQXA 3U9UB 2F18A 1EHAA 2W81C 1MKFA 3S97C 5TFSH 4NQCE 4L1BA 1E9OB 1V7NH 4B5EA 4LVHC 4GMSH 6FABH 2DICA 3KVPA 2BINA 4U2ZA 2VYRE 3S8WA 2LU7A 1N4XL 5CSGA 1F18A 4ODSH 5FHBH 3L5JA 4B9CA 4GY4A 2J8UA 1PIFA 4GKSB 1QSEB 1UWGH 3BKYL 3LMJH 4NKDA 4MZIA 2AS5M 3BGFC 4DO4A 3HZVB 1Q9WA 3KEHA 4NENB 1VFOA 5C08D 3CJJA 3GJFB 2HN7A 3MRNB 5DD3L 4X6CE 4OZIA 2BVYA 4XWOC 3VH8A 1KCVH 1YEKH 4UYQA 3UJJH 1EZUA 3I2CH 3PAUA 5GGVY 4E9RA 4ZNEA 2KDYA 4FLOA 3A3YB 5EUOE 1L0PA 3GSOA 1CC3A 2GW5A 1SNRA 3CZJA 5EZJB 1CBJA 4XE0A 3SE4C 2F53D 5K9KA 4WGWB 4IMKA 2IOIA 1U6AL 3E38A 1N0XL 4HAKA 1IBBA 1TQWA 3TFKC 1RZ8A 4C56B 4WW2B 3NGBB 1DBJH 1DVFD 2VDMB 4K0OA 1ZV5A 4JM4H 4MD0A 2NY3B 1MFUA 4OI9A 1HH6A 1TPXB 3OKLA 4L9LA 3JZYA 5C0GA 4ZJ9A 2Y1YA 4PLKC 1A1NA 1A6ZA 4OZHE 2FX9H 4AJYV 2BSCA 4LQFH 1G9NL 3ZVVA 1G9MH 4IBYA 1UT1A 5HYQA 2R0LL 1A4BA 1BVKA 3B7SA 3GS7A 2ESVA 1A6PA 1AP2A 1CL7L 4GW4A 1OK0A 1WFJA 2EE3A 2YAFA 4P9HC 1FN4B 4MDJA 1VACA 5AOLA 5ESQB 5AZEH 4J3OD 5LGYA 4A04A 5BOJA 1U2HA 4JUSA 5E0FA 3OXRB 4DZ8A 1G5AA 3EH3B 4PCTA 5AW5B 3NABL 2WBJB 3E6FA 3PHOB 1O6VA 4ZPTB 1J5OH 3KPSB 1I1CA 4NLHA 4DT2A 2XWCA 4LNVA 4QO1B 4YEFA 3B6SB 1LP9B 5IOPA 4PI0A 3U2JA 4EZMA 2AQQA 4J3XA 2L7EA 5KSUA 3AQXA 4PRHB 2OK0H 4P3DA 4Z7UE 3OKKA 3D3VE 2EVJA 2EE6A 5CGYD 4DGUA 1FZJB 4ORGB 1IBYA 4N8CL 3EDJA 1O6SB 2WLIB 4AYFA 4D9QE 2VMCA 5ETUA 4RAUB 1ZT1A 3LN5A 2X4RA 1TQBB 1UZGA 4KWUA 3P4MA 5CGTA 1NBQA 3IJYA 4D0BA 1GGTA 3IB4A 2JH2A 1BF8A 3STLA 2H6PB 3NEOA 4TTDC 4Y19B 3O6MH 1MVUA 4POYA 4XVOA 4ZMTA 1IQWH 1KPRA 4X9BA 4DZBB 3H4FA 1WFUA 1MI5A 4Q9RL 3BPLB 4N90E 2BP3A 4LPWA 4N5ED 1KF9B 4QRRE 4JG1L 4AQEB 1ZANH 4PP1C 3MRRA 4XGZB 1D9KA 3B9KA 4LIQL 4B6ZA 4DUVA 1P7BA 2X44D 1QR4A 1N59B 1XTLA 3BZFB 3QO0A 2IPTL 2VMDA 4OIIH 2OYLA 3GGWA 3WCYA 2KYIA 3JVGC 1INEL 2ZKYA 3LNHA 1RZIB 3BCDA 4JG0H 1UKSA 4BSWB 1AZCA 1FO0A 1HHHA 2EE0A 4QOKD 4YDMA 2G60H 4GRWB 3RDTC 4LLQA 4M7ZB 4H5SA 2LU3A 1YUHA 2VLJE 5F7EL 2BNUA 4D3CL 1DUYA 4YSPA 4KO6A 1TZGL 4H8QA 3MRIA 5IMMA 5KSBF 4HKXB 2P3YA 1BVZA 3C75A 4XP9H 3D4GA 3DUSB 5E9DE 1RP8A 3HC0A 4GUQA 3VQ2C 1PEWA 3BQVA 3BSZA 5DRXB 4RLDA 1ACZA 1P53A 3QXDA 3WS3B 3MACH 1E2WA 5JHDE 4FLHA 4X5RA 4MLSA 2ZX6A 1BD2B 1ZTXH 5EZIL 1XGRB 4JFHE 2PW2B 4IBWA 3VFRA 4XRCB 4X6EB 5IR1A 4XPTL 2YAOA 3T0VA 3WJLA 2PR4H 5HYIA 5GRUH 4FMFA 5AFAA 3LKPA 1S7TB 1T2QL 1T04A 3S3SA 1IAKB 2NY1B 5F7HA 1EVUA 1A4AA 4M7JL 3SDDB 5FM8A 3RVTC 1IILE 3V4VB 3BRGC 4ZRGA 5GJTH 2R7EA 3S0PA 1LYQA 2IADA 3ZU8A 3GMPA 1BZ9A 4WSGA 4I18B 5D1ZI 4G70B 2OQJA 3DGGB 1WHPA 3VXUA 1E4XI 1H3PL 3GKWL 1WZ1L 3Q6FA 3CDGB 1K72A 4UQDA 1CFQB 3IF1A 5T5FL 1FSKC 4AL8C 2WN2A 1ET8A 4MYWB 5GZND 4YXHH 3TVMA 1IKFL 2PN5A 4OD2B 2R39A 4GRMA 4UQBA 3H9HB 3AG4B 2B1OA 1EEQA 3VI3B 1KEML 1TF4A 1QBML 3FUHA 5CEZD 2YARA 2MCPL 1COBA 3V7MA 1M6OB 1E2ZA 2E9IA 1F8TL 4FQ2H 3WDHA 1C5DB 4M4RA 4Y4KD 1OAKL 1JVKA 5FEBA 4KFZC 2FJGA 1OPGH 5GRJL 4FJZA 1L9SA 5T1KD 2MFNA 5L2KA 4K3GA 3OJDA 1MIEL 2MNJB 4G82A 3AB0C 5IJBC 1PY0A 4YFEA 4PRIA 4DGIL 1P2CB 3M86A 3NG5A 5ABAA 1I9JH 4P46D 3OG6B 4YXLL 4X7SL 2ZXCA 4YLCA 3D12B 4H20H 1U33A 4XCCL 3QJVB 5AOKA 2BIHA 3QR0A 1GGIL 4ZDHA 3QYMA 4GAFB 1V05A 3VGEA 4JHAL 3RZCA 3QI9D 1FZMB 1R1CA 1FQ9C 5J6SA 3STZB 2PXYD 2BLFA 2O5XL 3FT9A 1BG9A 4UQEA 1XDTT 5AVTB 2WLLA 4AUYA 4D0CA 5B8CB 4XMWA 1J87A 4KUZL 2Q9OA 4PJXF 3V5DB 4QF1B 4BDVB 1E4KA 3S8GB 5BV7L 4FAAB 3JBG7 3L7FB 1VADA 2C9PA 5C09D 2ZUUA 4NN6B 1ZTXE 3ROOA 3VSTA 1AGEA 3KW8A 4PWKA 1XSOA 3LPGA 3DX8B 4F2FA 3AS2A 3ISYA 3QDME 3IDJB 3ZPDA 4HCRL 1U8NA 1QO3B 3QUYD 5GRZA 4WW1A 1DN0A 2AEQH 1FLRL 1UA6L 5KS9F 2DQMA 2QPUA 3WGVB 5JIMA 5CP3H 4HZLA 5KBNC 4NRXA 2AJXL 3U7WL 4F58L 4APQB 3S5LA 2YPLD 1EMTH 4AW7A 2CIKA 3OB0K 3BD4A 4P5TA 1E4XH 1E9PA 2I5YH 3QHTC 3VB8A 3K6NA 4LU5L 5I1LB 5LVEA 5EIIA 4PD4J 3QZOA 2Z7UA 1D5BB 1Z9SA 5CEXA 3HS0B 4J1UB 4JO3L 1C9SA 4G8GB 3QEUB 4GAAA 1NBYB 4FJYA 1U8HB 5IQNA 1IGCL 1IEAB 3OF6D 1D7CA 3J8F7 3S6CA 4PJ7E 1QUPA 3R0NA 1ODUA 3FHQA 3IN2A 1FYTB 4HJGA 3JV0A 3VTMA 2JKTM 3D25A 5DO2C 1FV1A 1OF0A 1E27B 3T65A 2P45B 1NICA 2PYED 5CJXC 4ZS7L 2VDKB 3U83A 4I1PA 3X3FH 1OVZA 4LASL 1GTFA 3O11B 1AYRA 2H6OA 2YAMA 4OCRL 4TNGA 3FT2A 4HBCH 3SPJA 3MV8D 1UA3A 2GJPA 1KJMB 5DMIL 4EUPH 1HZHL 4IRJD 1INQB 5DEFA 3CVHH 4PN6A 5FOJA 1LJMA 3JWNH 1NANH 4FTVB 5E8OA 3ZUCA 4U1GC 5FKPB 3ZYZA 4I9WD 4HUXA 1HYSC 3B7YA 4UOZA 5IB5A 4QTIL 3B7RL 3DYPA 3MNMA 2A74B 4ZFOB 3VXMB 2MH4A 3LZOA 1P5UB 2H0JA 1UENA 4ZMVA 4M02A 3VTAA 2ZKWA 3QH3B 3QEQE 1A6WH 1WLHA 1JK8A 4KTDL 2XU9A 3RL1A 3WUWB 2HX9A 3OQ3B 1OB1B 1J8HE 2W65A 2L0DA 4KJQC 1DEEB 1EXUA 4ELME 3SY0B 2HAZA 2ZUQC 5T3ZL 4HFWA 1G6RH 3MYJA 3C6SB 4DP7X 1ET7A 1ITCA 4JM2B 5IHUH 3K2MC 4HG4K 3EJCA 4L29A 1E30A 4J7RA 5DURD 4Z7OE 2YPVL 2HMIC 1NWOA 1IAOB 5F7AA 1MCRA 4UILL 3BZDA 4L2YA 3WN5C 4NQED 5C0RL 2AZUA 3SYAA 1FL5B 3MJ8A 2VDOL 4QHKI 3UTSA 3N0PB 1GJWA 1CGSL 1GPOH 3OAUL 1OLLA 2ZWYA 4W9CC 1R3KB 5CSZB 1AQMA 1GOGA 2OR9H 5T3XE 3BSGA 4S1SH 1RK1A 1E3XA 3QFGA 3RA7H 5HTSA 4DEWA 4XB8A 1W91A 1M2VA 1F5WA 3BKMH 3O4OB 3GMRB 2DLFH 4MJ2A 2UY6A 5CHNB 2XIDA 3VFVA 5J1AB 4P2RD 3DUHA 4G6FD 2GEEA 3FFCA 4DNLA 4TQHA 4XI5D 3SKOA 4DKTA 3GPEA 5AD0A 4CSZA 5JPNC 1BPVA 5D4JA 3QYCA 4GFXA 1NMBL 7PCYA 2AJSH 2IAMC 4L5FL 3PWPB 2E7LC 1I8MA 5G4NA 3TBWB 4F33A 4PY7A 1CD9B 2BRRL 4GG8A 4UTBL 1ML0A 4NNPH 3EYUL 2J88H 2GTQA 3RGVB 3W57A 4OY9A 4MXQD 5DF0A 1YCSA 4IDJL 3O6LH 1G7QB 1A5FL 4JNXA 1RHFA 4V2BA 2YUWA 3WLWD 4RWYL 1LO2L 4RGMB 1DVUA 4P9HH 3VFMA 4PG2A 3UJIH 4JHZA 4UIMB 5DR5L 4XMUA 4OW6A 2BSRB 2WQUA 4MQ7A 1ACXA 1S7VB 3SJVA 2IALA 3GBNH 4LF3A 2HRPL 4J3SA 3TBTA 2Z91B 2FEEI 4JGMA 4WJ5A 1CFVL 3UZEC 4I3RL 3GMOA 4PV9B 2GJ6A 1T0OA 1Z1WA 1Z9OA 4U6XB 4NERA 5E8PB 5J06A 4U3SB 1ZTMA 5DCCA 3UABA 4TUOA 3F05A 4QHLB 2VDQL 3KPRB 2KZKA 1IZJA 4HHAA 1HDMB 2YXFA 5ID0A 3TP4A 4O02A 4XNBA 3LPFA 2XI9A 4QRQA 2H0FA 4ADJA 4F7EA 2IIJA 3WEXB 4X5PA 4YHML 1YECL 4P2CG 5HHOD 3V0WH 4KZ0A 3MVSA 4NC1E 3KYNA 4N9GB 1OM3H 1SVZA 2XDHA 2IAND 3ZX1A 1P7KA 2H3KA 1YJDC 5I9QC 1LE9A 4HKBB 3H6AA 1G1CA 5L8JB 2EYSB 3QS2A 1S7SB 4AJVA 5EZLB 4ZQKB 3CN0A 2P7TA 4A6YH 3HMXH 3IDUA 4HC1L 4I88A 2X28A 3SOBH 1HXKA 3O2WL 3RWGA 2KBGA 3K6OA 4G6JH 3ZZSA 5TD4A 4JW3A 2HLAB 4JHUA 5I19H 1HSBB 3GSWB 3C5ZB 2R23A 1X7QB 2W9DL 5JZ7D 1B4TA 1I3RB 2R0ZH 4NQDB 4S11A 2DTMH 2P46B 3EYSH 5FUCE 5I76B 1G7MA 2WYZA 2W9EH 4N8VG 3QJFB 1UZ6E 3SGDI 3VQMA 5FDWA 5IHWA 3VE0B 5C0CA 2B5IC 3L08A 2P5WE 3QIUA 3VGHA 1C7TA 4L3EE 1KGYE 4MJHA 3WTTA 3VWJC 1MDTA 5EU5B 1YNLL 2VIRA 4TXVB 4DK3A 3HZMA 1WBXB 3ZO0A 2DB8A 3WFHB 4LSVL 4PRPB 4EN3B 4M43L 4B7IA 1T1ZB 3MN8A 1E8ZA 5BZXA 4GAYB 2E5EA 1M4KA 1OAUH 1KBKA 1GR7A 4XP4H 4DOHE 3FTWA 5DS8A 1LWRA 1MZZA 2WLMA 1FNHA 3MFFB 4WNQB 3SDCB 1BX2B 5BS0E 3AREC 3OZ9L 3QHZH 3D48R 5KJ7E 1S8DA 5DZJA 4PFEA 4P2QD 5FM4A 4Y9EA 1HNGA 2IBZY 2IGFL 1ZHNA 3LY6A 4ZMOA 5HVHC 2F74A 1JVOA 1KXVA 3BP6A 2KQMA 2WTRA 4MQSB 1K6QL 3FQTB 1QKZL 4X98A 2WVVA 2JJSA 5DD6A 1CGVA 1CVRA 1NFIB 3WELA 2YQGA 5C6TH 4ZZFA 3BDBA 4I77L 4WDIA 4Z7WE 4ZS6D 5TE6L 4YC2B 1EO8H 3QORA 4DFHA 1CVSC 2FBRA 2E4FA 4AL8H 4G8EA 3IXAB 1G9NC 2HVJA 1AJ7H 3PIQB 3L2LA 2XWBB 1OGPA 3TOPA 2HTLC 4GQPH 3K74B 1SZNA 4NGHH 2IH1B 5K59F 3D85A 2QQNH 3O6KL 1U3HD 1WIPA 1E2VA 5FHAL 2DLGA 2XNAB 1QAWA 3NIDF 3OHMB 1HSAB 3KPOA 4Y5XA 4L23A 3HE6B 4B5ZA 1LXMA 5FW8A 4PJXA 3LZFH 1ORSA 4PB0H 1G4RA 4JJ5A 1EDQA 5F6IC 3W1ZA 2EDJA 4OLYH 1QTPA 3DSNA 2C3HA 4NO3B 5DZOA 3IETA 2EXWD 3N44F 4P5KA 3QJQB 2Q6WA 1AHWA 3MRJB 4J8RA 4WTZG 2PP7A 3BWAA 4LSUH 5EB9A