4AVHA

Structure of the fimh lectin domain in the trigonal space group, in complex with a thioalkyl alpha-d-mannoside at 2.1 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
molecule tags Cell adhesion
source organism Escherichia coli
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4avhA00
1UWFA 4XODA 5LNGA 4XOEA 4XO8A 1KLFB 5FS5A 4XO9A 4AVKA 5IQOA 5CGBA 5FLUA 5LNEA 1TR7A 2WMPB 3BFQG 1QUNB 2W07B 3SQBB 2XG5B 1N12A 5AAPA 5JQIB 5IQNA 1PDKB 3ZL2A 4CSTA 5F3FA 4AUUA 4AUYA 2XG4B 4BUQA 2J2ZB 4AV4A 4AV5A 3BFWA 4XOBA 4J3OG 4XOAA 5AALA 4AVJA 5FX3A 1KIUB 5F2FA 5IQMA 2VCOA 5ABZA 4J3OF 3JWNE 3ZL1A 4XOCA 4J3OH 3RFZA 3JWNH 4LOVA 2UY6B 3BWUF 3ME0B 2JTYA 1N0LB 3ZPDA 4AV0A 2JMRA 3MCYA 4X5PA 5FWRA 4AUJA 2UY7B 4X5QA 4AVIA 4CSSA 4X5RA 1ZE3H 3JWNG 5AB1A 4CA4A 4AVHA 4ATTA 4X50A
chains in the Genus database with same CATH superfamily
4GLRI 2BSCA 3N43B 4X9HA 2DMHA 2EE6A 2K6WA 3WNPA 3QZPA 4ZS6D 2KL6A 2PTTA 4XZUB 4AZUA 4I18B 4LLQA 1VADB 4XMZA 3BKYH 3LH9A 1J8HD 3KH4A 2OSLB 3A4AA 3N42B 3CWGA 4YBLC 2FLRT 3HMXH 5B3JF 3MX0B 5I17B 5I6KA 3QEQB 1E5YA 3ILEA 2H3NA 2I7OA 3U7WH 3KYOB 4WKXA 2Z0BA 2GB2A 3L3IB 4XGZB 5HTSA 3PJLA 4FLHA 3FULA 1OCZB 3U79A 1WRFA 3WLWD 2OMTB 2J7LA 3SGJA 5ISZD 2VN7A 4WWID 1DZBA 2VISB 3E6HB 3GXIA 3DJTA 3LEYL 4FG0A 5LBGA 2Z35A 2WIIB 5E7BA 5HJGA 3U1SL 4ZNEA 3U0PA 4JANB 1ASOA 3AQZA 1L9OA 2X4PB 3IJ8A 2MWCA 4OGAC 5KYNA 1AQDA 2F74B 1NGYA 4XT1C 5ALBH 2GTQA 4ICXA 5F1SA 9CGTA 3MJ7A 1KTCA 2NDGA 4N8CH 3RDTB 3T2LA 3HFML 1I31A 3PWPD 2EINB 4UNUA 4NAMA 4YHIB 3FW6A 4QJ3B 4WFFD 3RURA 3IFNL 5E9DA 3QDMA 2X4RB 4RMRA 5DRWA 5J6HA 2ADJA 5F1IA 3IE9A 4NJAL 4Q89A 1NGWA 3U0WH 2ZXQA 2VZOA 4NAJA 1NAMB 3DWTA 5GS1B 4R83A 2D9CA 1DFBH 1RK1A 5CILL 2VSKB 4G5ZL 2P1YA 1OHQA 2B2XH 2G75B 5LN4A 3QCTH 3C9NB 3M1BA 2CO7A 1ED3A 1NCGA 4Z0BL 1IQWH 2DBLL 1CLYL 3BD3A 2VMDA 3TJPA 1GAFL 1YN6B 3UBXI 1JXJA 4PJXB 3P9LB 5F44A 1UB6A 2ITFA 2IDFA 1AGEB 1B4JL 3RBSA 3ULVD 1G6RH 5T3XE 1MHHA 3TO4B 5C09E 4H8WL 1M4KA 4N0YL 4O02B 2BVOB 3KL3A 4BWUA 5AW9B 5GGSA 4A2GA 4ZUUA 4JFOB 3OAZH 3QSKB 4HS6A 4P23D 1ECYA 1Z9SB 4L5FH 4PJEA 2B59B 2BMKA 2PWFA 3UTSD 5L8JB 1XCXA 4YQXH 4WO4C 3ZXAC 2BP0B 3CSTA 3W1ZA 4LE8A 1YMME 1RZJC 1OWWA 1EAOA 4ZFFB 4PJEE 4PM1A 3IDGA 1NEZA 2J4WH 5HDQH 2A3TA 3CCHB 3ZZ1A 5EO9B 4ZAKB 2J5LC 4PJXA 4DOHB 2IGFH 1D7FA 1WHPA 4I0PA 3WTSA 3F85A 4YBHA 3F7RA 4NO0B 3SKNB 1E8ZA 3DSNB 1CLCA 5IQ9A 4J4PD 3ESVF 2FX8L 1U8CB 4EUPG 3GSWA 1LDPL 2YRBA 4FXLA 4B9ZA 1XSIA 3Q01A 5H94B 4FJYA 4C55A 5L7XL 4NP4L 2CA4A 3SKUD 5EPMA 1JRHH 1E4JA 4ODWA 5B21A 2ZX6A 1BXVA 1FYTB 3FF7A 2YAFA 5BCAA 2GABA 2R69H 3JUZA 4XMUA 4PAZA 5C0EA 1A6TA 4LAQL 4J8QA 3AU0A 4OR1A 2H0EA 2Y6SD 3MUZ1 1RHHA 3HG3A 1AI1H 5ETUA 4E9RA 3RPBA 4HWUA 3BIBX 4GJTB 1G6RL 2BVYA 2FLBT 1U58A 2RH0A 1NDMA 2A6JA 4D9QE 3RGHA 2PWGA 5HGAB 2UWEE 2XWDA 1WFNA 2NY5C 4G6FD 2R29A 1JF1B 1TPXB 1YEEH 2N4IA 2VLKB 1FFQA 2X6UA 3ATDA 4ALAL 4GH7B 4NT6B 4A2MA 2IANB 3UGUA 2J44A 4OCSL 5A7BA 1YLBB 1S7RA 2V33A 1ICTA 1RZQA 3CXHK 4LNRB 4PRPD 5DGRA 5I6MA 1ZS8A 1RIHH 3GMMA 3KGSA 2NR6C 4R7XA 3GEWB 2EYSB 1AIFA 1N10A 2KQMA 5FYLD 2ED7A 3ROOB 4FTVD 4XOAA 3AMKA 4JHVA 3UJIL 5E0QA 5BXFB 2F2HA 2BNUA 2EIZB 1W16A 1C7SA 3N1FC 2KPWA 4GRLD 1DN0A 2X9ZA 5F3BA 4G3YL 2WBXA 2IQ9L 5CFHA 4IBSA 3V52H 1OE2A 5I1CL 4MCYA 4DHLA 3LJ3A 3GEFA 3D3VB 1EV2E 2A77H 1BMWA 3TA3B 2DQCH 2FSEB 3INOA 3LZPA 4HJSA 3S8WA 4QOKE 5LNEA 1CC3A 2IOIA 3U9UA 5E5MB 5IB1B 3VXQA 5KYXA 1OTUD 5JHLL 1WT5A 4YDZA 3MNDA 4XVTH 4JM2F 3VG9B 3PDGA 3D51A 4N8VB 3DETD 4D8OA 4YPGA 5IQMA 2DLFL 3QCTL 5BS0D 1M05B 2EIZA 2QMJA 4PRHA 1LK3H 4AK1A 3L9EA 4R6UA 2IALB 2GJPA 4W4OA 5IOPA 2ARJB 4HAFA 3D39A 5IW6B 2CMRL 4BFJA 5FAAA 4UT6H 2BOCB 1JGDA 2WC7A 5EZJB 4UIMB 1QKZH 5C0DB 3Q06A 2D03L 2E7MA 2AJXH 1S7WA 3IMTA 5JW3H 4XMVA 3NMEA 4JFYA 5DVOA 5E4OA 3I6GB 2YXWA 1KBBA 3CMOH 3B56A 2Y22A 5A2CA 4X6BA 4EZJA 5A2FA 1L9MA 3RWJB 3ZN6A 4J3OH 3US1A 5CU5A 3MRHB 3P3RA 4H0IA 4GO9A 4PIBA 5MP6L 2ERJC 4WFED 4OQ1A 1MW0A 1R3KB 5CCJA 3E38A 2WLLA 5GJTL 3RGVC 3V5KB 4ZFZA 4OZIA 1PY0A 3IDIB 1G7PA 1C16B 1MVYA 2V7NB 3IEAA 2HRLA 4OZ4B 1JFQL 1N12A 3FFDB 4HK3J 5I1GH 2DKMA 3LXAA 4RAVB 2CK2A 4KK6D 35C8L 1JK9B 3MJ8B 4AYFA 3W5NA 5ENWA 4OJYA 3EHBB 3ZYJA 1MCJA 2Q86A 2HT3C 1S7WB 4I48A 3CNKA 3CPLB 4MNQD 2AEPL 4TQEL 4U0QB 2NW3B 1P0SE 2BC4B 4ZTOL 1YAZA 4U6XB 4FYQA 2CBQA 1BOGB 4HIJB 3P11L 3FNKA 4ZD3L 3MJ9H 5DD1L 4B7LA 3W2DH 3M17B 2AEIT 4JRXA 4JMXA 5D1QC 3OLGA 4M7JH 4BHUI 5T1JA 1EK3A 1R17A 2X3BA 3CZFA 3MO1A 5CEYB 3CFCH 4H4NA 3SDXE 4QPEA 5EEYA 3RVWD 1A1MB 4BUHA 1KNOB 1XR9B 3IMSA 4PLJC 4EIUA 4UB0L 5FWQA 1AG6A 3V95A 1LO5A 1I3GH 5DJ6A 5IKCB 3NAAH 1KTLB 1OGTA 1H3TA 4ZD3H 4HIXH 3ZE0F 1NQBA 4G6FB 1NL0H 4QLWA 2YEQA 3OWEA 4I3RH 4YXLH 3VVVA 1MRFL 1UCTA 3CTTA 3WFCH 4E5XB 4NKIH 1TQWA 4L8CB 5HJBA 3CXDL 1C8PA 4L1BA 2FECL 4MKMA 5FLVA 1T0MB 2R4RL 5KBKA 1GTNA 2K1MA 3D0LB 5FW8A 3TEUA 3BP6A 3VFSA 1PMYA 1JRHL 4CVUA 5C6PB 3N50A 4DH2A 3T77A 1S78C 4NJ9L 5D7EA 5MEOB 5SWQB 4QF1B 1DVFA 3BIKB 4LASL 5L8LB 5KVGL 3I9AA 3MN8A 3P3TA 3U83A 4FD0A 3D8MA 4PGCB 3QIBD 3S0PA 5JW4N 5CCKL 2Y4SA 1Z2KA 2RB8A 2V17H 4PJDF 3WN5B 3FU3A 3OKYA 4L2LA 1MJ8H 1BD2E 4PJ9A 2LV4A 3BHBB 3DA0A 4L9DA 5LLIC 3E1F1 4RMUA 2JELL 4LRNH 2AKRB 3DVGA 1BOGA 1F90L 1T83C 2R83A 4U6HB 3B8SA 3P0YH 1J0IA 3POCA 4OCLC 3IDXH 3MUY1 3EFFB 3HG1B 4FERA 4GKLA 2FQDA 2OZ4L 4J3WA 1IAIL 2YRPA 3KLSA 3OJMB 4XPHH 4AEEA 3N40P 3CJJA 3LD8C 1MQKH 2ZWSA 3ZGHA 1KSRA 1EFXA 3BIAX 4RFEA 2VDNB 3NVQA 1F8TL 5JW4Q 3SE3A 4NPYA 2FGWH 5GRYA 1MHPL 4OT1H 1LO2L 3W57A 3SO5A 3D39E 2ICEA 3EYOA 4YBLB 3UAFA 3KNBA 1QWUA 4TOYL 5FO8A 5BZDA 1E9PA 3F7VA 2KS0A 3MCLL 3IPBA 5BV7C 3NYKA 2CDGA 5GGRB 1TJIH 4LEXL 3D7PA 4Z7UB 3KPPA 4LCYB 4UIKL 1HESA 1ORQB 4F33A 4WI9A 2JKLA 1B9ZA 2GQHA 1P4UA 1QRND 5TQ0H 1RURL 3RY6C 4AQ1A 1WSST 2GIXA 1XMEB 4OFYA 2BOCA 2Q7AA 5EZJA 4QNPF 2G5BB 2HKFH 1DBMH 4X9FA 1BZ7B 3UZQB 1L7IL 1KT2A 4BFRA 5J06A 4QXVA 2OQJB 1QLFA 1JZ8A 2KLRA 3TS8A 5JQHC 3CFKA 3VDBA 1RY7B 4L37B 4M3KB 5DQ9B 2ZCLL 5FO9B 2WXJA 2A5UA 1S46A 2E9BA 2GUOB 4GQQA 4JO4L 4EOWL 3UC0L 5KBDA 1T5WB 3NSFA 4MGXA 4J3XA 5L2KD 4MLIA 4F9PA 4AY0A 5C0AE 2R2CA 4POZC 1F6FB 2X7LA 1ZHBA 5I24A 5I1DB 4JRYE 4FTVE 4JDTL 4AH2B 1VZHA 4F24A 2X2IA 3PPSA 3LXCA 2IV8A 5DTFA 4L4TB 1RFDH 4WI5A 3TO2A 3MV01 2QLYA 4WDIB 3ARUA 3SDDA 3R19A 1N18A 1LMIA 2IH1B 3DX3A 4ZPTA 2H32H 2QQNL 3Q5TA 3NFPB 5J11C 1MREH 1BQRA 2OMWB 1J1OL 2PXYA 5KJRL 4TTDC 5MENA 5BRQA 2UXTA 3GSRB 3QQ9C 1YN7B 3GM8A 3MGTA 5C0CD 1JZ5A 4DWHA 5D7LB 5L6YL 1DVXA 1M2OA 1BAFL 1U8QA 2GI7A 2R23B 1EAQA 3O6LH 5MERB 4PLOB 4H8HA 1MRFH 3WAKA 2WWNA 2OXGA 3VTTA 2LHAA 2YQ3A 4AEHH 3DK2A 5B7MA 2F54A 3UYPB 1WEJL 5AZEH 3SKMA 4OD2A 1N6QL 3AMLA 4MAUL 1FYHB 4HJJH 3OX8A 3D48R 3SPVB 1ZA6B 2GSIB 3TH2T 4HK0A 1EJOH 5JIIA 1V7ML 4GBXA 5FV1L 2MNUA 3IRCA 1I1RA 3ARBD 4GMTH 1TQUA 3BUPA 1ANUA 2HB0A 3MBXH 1Y18A 3O2DH 3NH7L 2GI0A 2R8SH 3QE5A 1WC7B 5B39G 1UWGL 3L3GB 3A6CL 5FPIA 3O4OB 3AY4C 2PR4H 2P8PA 2OULB 3MV9E 3RPIA 3MTRA 5E00A 4PR5A 3K46A 2HFGL 4DGYH 1FC2D 3ARZA 5TF0A 4JZNA 43C9A 1Z3GL 3LPOA 4Y16D 3S3BB 4D0CB 5IB4B 1CICB 3WMQA 3HIZA 1SOKA 1A2YB 3VI4E 5F1NA 5LXGL 1D5MA 2YZ1A 1I8MA 4I77H 5KOVC 3LIZL 1OSEA 5B8CA 4JFEB 3MGOA 3BH4A 4Y5XB 2O5YL 2J43A 5D71H 1CYGA 4B9JA 5CP3A 4G8IB 1IBZA 1LILA 1OSZB 1QSEE 1R75A 1U8NA 4KXCA 4E9LA 3PIQB 1Z3RA 5CZXC 1UGNA 1TQVA 1QFOA 3QPXL 2A9NH 3ABLB 4L1TA 4DTGH 2W9EH 1MRCL 4HUWA 5EA0L 5T5NF 4LIQH 1V3MA 5T5NG 2A7BA 4FHKA 1XGYL 1NEZB 2DN7A 3O3DB 4OGXL 4YGVB 5FW6A 2XN9B 3WHXB 1JK8B 1DVFC 5HHXL 1IE5A 2DBJA 4YC2B 1P5UA 3PCYA 3V6OE 1FSKC 4JRXD 3CFKB 4YWGH 5HHNA 1OM3H 4WCYH 1DO6A 4F7TB 1N59B 4X9BA 1FL6B 3ZMNA 1LWJA 3NA9H 2V5MA 1AVAA 3NCMA 3HZMB 5HHVH 1JPST 1MRCH 5EA0H 2Z7WA 3OG6B 1A7QH 4NBXB 2VLRB 2X4SB 4N87A 4AT6B 4KKBD 1E7VA 3PIQA 1BREA 2GT9B 1BVKB 5I2IB 3BQUD 5DD3L 4GPVA 4HOMA 1RZGB 1ORQA 4F33B 1JS4A 2CJTA 5KYUA 3CXHJ 4WWKC 4N6RB 4AIXA 2XN9E 3TPUA 4Z7UF 3UAEA 2VO5A 2CCWA 2ZCHH 2PLTA 5AVXB 2VDLB 4DKFL 4I8DA 5GSVB 4AQ8C 4ZMXA 4ZO8A 2JI1A 5AAWC 4ILDA 4KRNA 3LZFH 1OZTG 4NXKA 1H5BA 1U8MB 5E6RB 1KB9K 3GSOA 3K4ZA 4WJ5B 4TM9A 5CP7A 2BSEA 2QVTA 3A3YB 2JJTC 4S0TD 1UD8A 2FGZA 4AITA 3MOBL 4FI8A 3W81A 4LIQE 4KKRA 3I2CL 2ENYA 2HH0L 3BDBA 2ICWB 2VN4A 5CLWA 4M43H 4XMKL 5FKAA 1U95A 1MF2L 1GJWA 1JZDC 3VWJB 1QVOB 4X7TA 2Z64C 2CGYA 4P8QA 3RYMA 4OGXH 3TT1L 3ZKXB 4F8PA 1F3DH 2NQCA 1U8IA 1U58B 2JFCA 4FEIA 5JYMA 2FR4B 2CIKB 5I6XB 3DECA 4NXSA 3EOTL 2MIZA 5B4MD 4DGVL 3ABGA 3JV5A 4PRBA 4JLRB 2JB5H 2NNXA 4KZDL 5MEPA 5ILTL 1G6VK 1CFBA 4NQQA 1E43A 1ETB1 3HE7B 3EBGA 3AABA 4NIKB 4KJQC 2MCMA 4PB0L 1N3NA 1JXKA 1NUNB 5LGYA 5FXCH 1DQKA 5EO1A 3RIFK 2FCBA 2DI7A 3ZDZF 5HHMB 4QJ4B 3GBMH 1FLTX 2OP4L 1PAZA 3O8XD 5ABAA 2AJUL 1AC0A 4F8OA 3QFDA 4UAOC 4LLQB 4OV5B 4LPCA 2HWZH 5I74C 2JMRA 4IRJD 4F2ME 2EUZA 3NOIA 3QCUH 1J87A 1RERA 3KPSA 1SRDA 4U33A 4ZFGL 4ZX3A 3C08L 4GSUA 4M8RA 1QEWB 3ROLB 4MA7H 4HUNB 2Y1VA 4AQ1C 3QJUB 4ZFQA 3M6DA 5E5LA 1NFKA 3DJSA 3T0EA 2JQMA 4JAMA 2H3XC 3TA4D 2EYTB 1RSYA 3H0TB 2BZDA 5DD3H 2VL4A 2C3VA 4NWTL 2XWTB 1YPZB 3IDGB 1ZE3C 4X0KA 4CGTA 3VCLA 3MNVA 4K3DL 4ZFFA 2VABA 4X4ZA 5C0BB 5A7EA 4M8QB 3L3HA 1J48A 5IJCC 2FHBA 3MRNB 5B7FA 3C6LD 5JMRA 3CLFH 4HJUA 2VLMD 2PPDA 5CINL 1ZT4A 3BP4A 1OGAD 4X9YA 1EA9C 1QFWI 3ROLA 4XH2A 5D72H 4B97A 1GGCH 4ZXBA 2UZIL 3I50L 1RUML 4JUSA 1CLOH 5F9OL 1QLEL 4FNUA 1WFUA 2DLIA 5BUAA 3OLDA 5D1QB 3VD9A 5H8DA 5ICUA 1BBJA 3W0WE 3V6FA 1ZGLB 3HMWL 1ZAGA 2W94A 4I2XE 4OB5H 1LWRA 4BUGA 4V2BA 4ES9A 4WJG3 1RAMA 2P45B 1ZK9A 4R4FH 1FNSH 5DK2B 4HPYL 3NDZE 2C7UB 4AQZA 3L6FB 2O5YH 1FFPA 2NYZA 2P44B 2F5AH 3QA3A 1UWFA 3TH4T 5L88H 3D6GA 3QCVL 3D0VB 2C9AA 1W72H 4WAFA 3AGWA 4WY7H 5I1KH 1J18A 1WA0X 4JY6B 4XNXL 3ZTJG 3PWPB 6FABH 3AQYA 1YNLL 2B0SH 3BAYA 3QUXA 4NN5C 1SJHA 4PJHB 1S9VA 1UWEH 2LVCA 5C86A 1UURA 4X83A 2WLIB 3IJEB 4BZ1A 3ARGD 3AG2B 3S4SG 2BNRD 3PHSA 3W82A 2G2NA 4DEPB 1MFVA 4EN3A 1U42A 1MCNA 2QPSA 1KXHA 3LS4L 4JQVA 5DS8A 2E4FA 3IPEA 1KIPB 4FN0A 5DYOA 5GS0D 5F9JA 1XL6A 4WTWA 2ZWLT 1A4CA 4IU2A 1TMCB 1TDQA 3GK8L 4IOFC 1SVCP 5EC2A 4L8SB 3WELA 1MFBL 1R3IL 4MZ2A 2NY1B 3AAZB 1HXKA 1J8RA 5D1XD 1RUAH 4OJDH 3U25A 3BIKA 1AQMA 3S37H 4Z7OE 4NQVA 1X9LA 3SDXF 1OGSA 1ECZA 3WO4B 1T1YB 5MEOA 1UB5A 3EYUL 1NDTA 4M6OL 2E59A 2BY3A 2FO4A 4PRAB 4X5RA 1WS7A 1G7LB 2A9AA 2ATPB 2QJDA 2XPGA 1G0XA 3OHMB 3EGXA 4Y19D 5I66A 4P4KA 1BW8A 1TZHB 3QYMA 2AAAA 2Q8BL 3LN4A 4K3GA 4B9FA 5C3LD 5FUCC 1IGJB 2IJ0C 4OLXL 1JZFA 1E2ZA 5KJRH 4Z7WB 4N4YB 3OF6D 4P2OA 3VQLA 2A74C 3TJHC 4WHTB 2VDRL 4E41D 4OVVA 2V2TB 4AGQA 5FHBH 3B2UD 3ZPDA 2ARJQ 1C1EH 5I1EL 3DROA 4LDEB 1E6OH 5JLZA 1Z32X 1BF2A 3ZGIA 2DYPB 3SODB 4PJIF 1PD0A 1MIMH 3TEYA 3E2HC 4KTYA 4JVWA 2EYTA 3DIFB 3GSVB 4UOQA 4OI8A 1CTNA 2FATL 2A9ML 2AJ3A 1M6UA 2W0PA 4PVMA 4CADA 3HC4H 1IGIH 1JNHB 3HAEG 4RMSA 3QUZD 4RGMB 1DTUA 2DQTL 5GGQH 2FL5B 1MI5E 2YA2A 3LHAA 4YL9A 3ABZA 5J11B 3FUIA 3KXFA 3P69A 3BEWB 4QRSA 5E5UB 2WQWA 3RPKA 4IDJL 1WTGT 3U4EB 3ZLQC 3TPKA 2AEPH 1A14L 3VXUB 4OLYL 2GIYA 2EIMB 1ZTMA 3DXAB 2ZXGA 3UBXG 5HVWA 3FH8A 2JIXA 1KCVH 1TVHB 4NQUA 3ZIMA 4KKQA 2XWJA 2CKBL 1IE4A 1YMMA 1VDGA 2CAKA 3B6SB 1UVQA 2OZNA 4JFXB 5F7LB 3RWGA 5ADOH 4Y8AA 5H4YA 1S4IA 3BN3B 4G8GA 4PGEA 1SMDA 2AXHA 2R4SH 2V3DA 5JIDA 3ZDZB 3GSQA 4O51A 2XN9D 1SDYA 2ZOUA 4XAKE 3VI3A 5SWZD 1AGDB 5AKSA 3HNSL 3NFNB 1AG0A 1EANA 1H6TA 4BH8A 1AIZA 4Z6AT 1MQKL 3RNQB 3LEXB 5HPMA 1C1EL 2VKWA 4HKJA 5F3HB 3SGDI 3H7BA 5CCHE 4JDVB 1KY7A 3EYQC 3V4PA 5CN3A 4JVPA 1ZXQA 4HBCL 4LLVB 3UYPA 1HIMH 2R27A 3RWDB 1NMCC 2VSMB 5EULV 3EBHA 3G5VA 1BX2B 3DUSB 1FZMA 1AZCA 4G9DA 4J3BA 4W9HC 3FO1A 3VNYA 4R5VA 3NIDE 2DQIL 1V8HA 4RAUB 2OTWA 3LN5A 4XN5A 5JHBA 2IH3B 1U3HA 3DJ9A 1HI6A 1A1MA 3SDDB 2B4CC 4X5WB 4XVOA 3C60D 3JV4B 1X44A 4NQTA 1PZ3A 3G3LA 2DKSA 1D6EB 4UBDD 3VX0A 3H7BB 3WJMA 2GG1A 1OAZL 3OVUB 3UZEA 1P84K 1SJVA 2NY3D 4HH9A 3FQNB 3PQYE 1T5WA 1GGUA 4U6YA 3PHQB 3IDXL 4WHYG 4D3CL 3G6JA 1HQ4B 1H3XA 2Z9TA 4HD5A 1GL4B 3CIAA 5ESQB 3IAPA 4PRDB 3LKRB 3INUH 1UENA 2JXMB 4PLJD 1AGCA 2WP3O 2GSMB 1J86A 1RP9A 3SDCA 3PLYA 5T1LA 3V4VB 5LWYH 1D7BA 2JCWA 4MB1A 1N0XH 3KGTA 3P0VH 5CUSH 5DS2A 1GGBH 4MJ6A 3BI9X 3RZWA 3H3PH 1BAGA 2H1LM 3SB3A 3DX1A 4GO6B 3QDJD 4NQSB 1MPAL 3STZB 2WLLB 4OZIB 4C56B 1E3XA 3CFDB 4G1EB 1PYWA 4M9OA 2CDGB 5GGRA 3VFVB 1DJZA 2KERA 1HAWA 2PW1B 4P9HL 1BGXL 4R0LB 2HRGA 2G30A 25C8L 1LL1A 3NEOA 2RD0A 1A9EB 4OIIL 4TSBL 2L7QA 4DNLA 2MOQA 5KYWA 1KMGA 5ESVB 2JJTA 4MB4A 4XP9L 2GTWA 2Z1PA 4CDHA 4I18A 2IDTA 5I8OL 2J73A 5BO1H 1NUDA 3GJFK 4JB9H 5I74B 4WNSA 5SWSE 4TUJB 1DBJH 2QELA 4Z7AA 1UYWH 1DSWA 2A6DA 1G7IB 3SZKC 3QDHA 4XVUC 3OV6A 4GW4A 1KFAL 5E4EB 3ZR5A 5C0JA 4JPVL 4MMZA 1GC1H 4HCRA 3WEMA 1M3IA 2EC8A 2VMEA 1DVSA 3SDAA 5A2BA 4TXVB 5C3IA 3T65B 1PL3A 3KXFB 4LSRH 5HDLA 3RIFF 5T3ZL 2ZQKA 3BUQA 4D8PB 4I2XA 1NUGA 4J3OG 1B3JA 5E6IA 1ZLEA 4NO2A 3L7EB 2ERJB 2DTML 1EHAA 5GRJH 2Q7NA 1WAEA 1A7NL 1BM3H 2F53E 1AXIB 1KFAH 1ETJA 1P6AB 3T2NL 3J07A 4LASH 8FABA 1T1WB 4LP5A 1FCGA 3AJ7A 5GSRA 3FTVA 3GF8A 2VC2B 4UMGA 3DJZA 5D7IF 3ZMEA 3D85B 3FUKA 3GIVA 3T3PB 1KGCD 1OB1A 4QLRA 4AYBA 3L17A 4JJHA 5EIIG 4F7EB 3HE6C 3ETTA 4POZD 5L2JA 1GJIA 5JYLA 4B95C 3K6SA 3B7SA 4N9GB 3JT0A 1IGMH 2I32A 5D9SB 1UM5L 5TDPB 4LL1A 3RWFB 3FUHA 1YPZF 2DQHL 3ATBA 3HTLX 1CD0A 4LCUA 4YIQA 4N2NA 1M7IA 4UOW0 2OMVA 4L8DA 1KXVA 2NNAA 5AW2B 1I3GL 2X1WL 4NSKB 1JXFA 4JY5H 4HVBA 4LSVL 4JVUA 3OXRB 4LSTL 1OPGH 5I73C 1DP0A 5ALCL 3IF1B 1A21A 2DLTA 4Y19A 5DEZA 3T2PA 2X1QA 4KXZH 3QIBA 4X6EA 5CLYA 4K5MA 1U3HC 2I24N 3ULUL 1QVOA 4X7TB 4PJ9D 4RA3A 2WO4A 1KULA 2E56A 4KUZL 4QR7A 5CM1A 3GRBA 4JBSA 4NUJB 5DVLA 4H8WC 5CIPH 3HN3A 2XKSA 2W60B 3UO1H 3MDJA 4LLMA 1IZKA 3LOWA 4M5ZH 5BOZG 5E24E 5D1XB 4NNPH 2AV1B 4WFFE 5L8KB 3WKMH 3CX5J 4Q7DA 5HDBB 3N91A 1H19A 4JANA 1KTKE 4MS8C 2MMXA 3T71A 2NY2C 4BINA 2Y1AA 4GRWE 1CTMA 1IGYA 4AE1A 4HGWB 4LP4A 5DSCA 5F70A 4QYAA 1QO3A 1X5GA 3QC5X 5DCCA 3EJRA 4YHOH 4Y4FD 5TF1H 1V3LA 3S5YA 5FW7A 1GS6X 2X89A 3JWDL 5F89A 1F4YH 1SY6H 4LEOA 5IEKB 3VWJD 5GSVA 1ET5A 4ETYA 3SPJA 1ZLWK 3WS3B 4CSSA 2JH2A 4NQCB 3KNBB 4P2OC 4NM4L 5D2NE 2FBRA 4PBWD 2X6MA 5FYJU 4EIZC 5JW5B 4G5ZH 4BRJA 4CC4A 1T3FA 4ELME 1Q72H 5EMYA 1VKXA 4AOFA 4PWHA 2VIRA 4BFNA 1DN2A 1KZQA 2WOBA 2WN3A 5DRZA 3ZRCC 5A2JH 1PKQA 4O02H 2DIEA 2AJZB 3L3HB 1EGJH 2ZSWB 1I8LA 2BVOA 4NNXA 2YD8A 2XZQL 1HS6A 2XN9A 3WHXA 3TO4A 4PY7A 3ARGC 1R34A 3BGAA 1CE6A 3LPGA 1T20A 4FAAB 4FQLL 2VT0A 3A47A 5CJOH 3MV8B 4ZO9A 4F57L 2O5NA 3C5SA 2E0PA 4QAMB 5FDWA 2N0MA 4FFZH 4RAHA 4Y2OA 4PH8A 1BXUA 4AK2A 1QYGL 3IPFA 2K70A 5I30L 2IWFA 1GZHA 4TULL 4LPVA 4PUBH 3WFDH 4APXA 1S5IL 4X7DC 5GGTH 4XP1H 4LQ1A 2BJMH 3IN0A 3DGGB 3QNZA 4A37A 4PV1C 3LIZH 3Q6GL 1TEYA 1UHVA 3LXBA 1M7DA 4AKOA 5GGRY 1MCLA 3JUYA 5F3BB 3IMRA 2Y3NA 4N0UB 2F1AA 2ZAHA 4YX2H 4MA8H 2PCFB 5DHYA 2OCFD 1NGXB 2LE9A 4QOKD 4ZMNA 5JXED 3KWVA 4BSWB 1TJXA 4GT0A 2XZCL 5AKVA 3EGSA 3NJMA 5JORA 5AW7B 3NQIA 2EIBA 1XZ0B 2D2OA 2EEDA 3TT3H 3OGOE 4AGLA 5ECJE 4X6DB 3VGAB 2QSCH 3FHAA 3BPCA 3WJJC 4WUUA 1UXLA 4AL8C 2CO4A 2R1XB 1JNLL 4BFFA 3PP3K 3HE7D 4GP4B 1QD0A 3IJ7A 4ADJA 3SE3C 4PGDA 5FHBL 1JZEA 3ILDA 4Y16B 3EHBD 3U6RB 2A83B 2DQFB 4JPIB 3TTSA 4BKTC 3SDCC 3HOGA 3TOPA 2QPDB 3GDBA 4P2YA 2OAAA 2OP4H 3PHAA 1YAIA 3BPNB 3LV3A 3QUZC 5FA3B 2XY1A 3UAJA 4KMLB 2NX5A 1PD6A 5HYQA 3MMEB 1A7PH 4ZUVB 1IM9A 1NGZA 2EDDA 3F2LA 3GBNL 2V2WA 2J56A 3E7JA 3BRDA 3MA9H 2VDLH 2IBBA 1EZVY 3QULB 1FCCA 4A66A 1A5FL 5D7JD 3VMNA 4ZFZB 3SOBH 3TNMA 4X7EC 3C87A 2GTZA 2AF2A 1RSFA 4KWUA 3BO8B 4LOVA 5CD5C 3QJTB 5ES4B 3II2A 3TV3H 2NUPA 4MAYC 4MQXC 5H37G 3WD5H 5EBLB 4LOUD 4YSSA 2ITEA 5HHNB 4XWGL 4XNMA 3C6LC 1YEFL 5HI4C 5D93C 2EIEA 2VDPB 3DI2B 3MRGB 3US0A 2EDQA 3BSZA 5I2IA 2WBJA 2ZCKL 2Q8BH 1I1AB 3BSGA 1IEHA 4BJLA 4YDNA 2NYYC 4FFVD 4JZJC 1HILB 4KNSA 5MI0C 1R4XA 4BFEA 3VFOB 5BJTB 3BPLC 5AFAA 5KUKA 1TTGA 2ARWA 2QVFB 5DJ0A 3X1FA 2HRHA 4QHUA 3QI9A 4F8TA 4PTUB 4RWYH 3FB8B 1X9UA 4N5EC 2AQQA 3A24A 3G5ZB 2Z92A 3S37L 4G1MB 5HXMA 4AE0A 5JOFA 5GXBB 1NGQL 4B3EA 1CFSA 5FLUA 5I1HH 4UTBA 3CDZA 3P3SA 4D9LL 2GK2A 3BQUA 3DUUA 4C57C 3KD4A 1K3IA 1ED3B 2DRUA 3U0TA 3MMEA 2HJFA 3KPNA 4TKWA 1Q4NX 3P2TA 1U8OB 4ZSOA 1CDBA 4KQ4H 3KLHD 2J72A 5TD4A 3L4WA 1J5HA 2EACA 3CAFA 5HHVL 3BXNA 2DJ4A 4GSXA 4QT5A 4HUXB 5JHDD 1JZ7A 4P06A 4GXVH 4XB7A 5EH1A 1ZT7B 1BOYA 1CGSH 3OZKA 5C07E 4DERA 3I3BA 5L0QB 1IEAB 1DVTA 2CJ3A 1QR1B 3H6AA 3MNZB 3MV8E 3KCPB 1A9BA 1KJ2B 1UD4A 3CLFL 2ADIB 3KYMB 4YFLF 1UEYA 1LO4H 1IKNA 2IANA 2WLIA 3EW3B 3IJEA 4U1NB 5DVKA 1UTDA 2R7EB 4OTXL 2ROYA 5KVEL 1ILSA 1LJMA 2R4SL 1TYJA 1X5IA 2AEOA 2O5XL 2M26A 3DVGB 2EE9A 1TEFA 4Z3HA 3JV6A 3LXUX 5ISZB 1PDKA 3BHBA 1A6WL 3V9EA 2XYBA 4LCCA 1LK2A 4UT9A 5I8CB 2A99A 1PG7L 2ZUQB 4KNTA 4YO0B 4ZZFA 5J13B 5D5MB 4FFWD 3E0GA 1RHHB 1QHOA 4GQZA 2ICWA 4DUXA 1OALA 3JSSA 4ZFGH 2X2UA 4JPQA 2HAZA 4HX1B 5CWSA 3FCGA 4TLSA 3V0VA 4H2AA 3C2AL 3HLAB 4GAJL 4YBQD 4HSCX 1V3JA 3GYRA 5FO7A 5CEXA 4IDJH 3BKYL 5DXWA 3MJ6A 2JTDA 4L3AA 3RGVD 2VUOA 1GOGA 1HHKB 2XA8L 4Y4FC 4XB8A 2IAMC 3M7FB 1YEHL 4L3CB 3H2WA 3RVWC 1E9OA 1TENA 1AP2B 4HC1L 1FAIL 2FATH 3CH8A 1MHCA 1NL0L 3BP7B 4I0PB 5JHDE 1DJSA 5L4IA 4XX5A 2I26N 1T66C 1HWWA 4OFYD 3QXAB 1H5BC 3N44F 5AKTA 3SBQA 1U8HB 2HT4C 2H5UA 4BK5C 1OCRB 3QIWB 1GYVA 1J9TA 4K73A 2OPCA 2BS9A 3WLBB 2C26A 3SOBL 2BP0A 3V0GA 2XXGA 4AJWA 3VGBA 1CXLA 2CE6A 1CIDA 3QIWD 3BAJA 2XX0A 4N28A 5DUPL 4HFUH 2ZD0A 3O9WD 1K4CB 3SE9H 4JFVA 4U6XA 4X7SL 3UGXA 1IGCL 2UZXA 3AY4A 5IBTL 2ZKHL 4PJ7E 2P5ED 5INCB 3REVA 4YHYB 4ZDHA 4WKZB 4GW5A 3ZTNH 2VDNL 2F7IA 2VMFA 3ZOAA 3CVHB 3BT2H 3TYGL 3D0AA 4UV7H 3VU1A 5J1TC 3SDXA 4L4VA 2Q5BA 4JHUA 4Z7VE 3WKQA 3BO8A 4P3DA 4XMLL 3P4MA 3S35X 2EO7A 1EAPA 3QJHA 2LAAA 2ZG1A 4PW9A 3O8XB 4R8WL 2IOMA 2ALAA 3AG3B 3RWGB 3SKOA 4TRPL 3COOA 2VRKA 2BSRB 5B39B 2Y0SA 3RFRA 3OC8A 1N8ZB 3JVFC 4P99A 3V0AC 3O6FB 1AZBA 3IKKA 3ZHNA 2D2CC 4MVBD 3CVHL 3EO9H 2F54D 5T3ZD 4WW2C 3VSQA 3UTOA 1IAOB 4JO4H 1NCWL 1RPUA 1NCNA 3P0GB 3HE6B 1TIUA 2NZ9C 4GW5B 2ATKB 3LKRA 5B38G 1XFPA 4G6KL 2PW2B 4LSDA 5KVFE 1NBQA 1FVEA 4MAZA 3BSZL 5AUMA 2AJ3B 3T4AA 4DESA 4F9LC 1CTOA 4ZO7A 5F7DB 4JE0A 1VGEL 1O6VA 1QUPA 5TQ0L 4H1LB 4HZAA 1ZGLM 4WHCA 2YS4A 3WJJA 4OZHF 4B7IA 5IMLB 4UT9L 3Q8EA 2XIBA 5I82A 1TOXA 5I9QB 1G5AA 4EI5B 3DOIA 4TQHA 4R96A 4TLTA 5T33H 3RX5A 4A1RA 5KZCD 1NUFA 2DQUH 4OFKA 4BQCA 4Y19B 3LN5B 5IB1A 1JG9A 3RA7L 4BELD 1DHKA 3ECBA 3FZUC 2D7TH 3SPVA 3DMMC 4AIZB 1IGJA 2KZBA 2YK1H 3OR7B 1G9MH 3LD8B 1R0AL 3BZEB 4MD4B 2Z8RA 3B5GA 1CDHA 1SDAB 2YEVB 2RCSL 1ETA1 2GC7C 2XPGB 3EZJB 3NJVA 2L8AA 2H45A 5IR1A 4DVRH 4K0OA 4JQXA 2D9QB 5F88A 5FOBA 4DUVA 2DQDL 2OZ4H 2EYSA 3NABL 5ISZE 3BDYH 3OHXC 2BNQB 4P04A 4Y4HA 1LXMA 3L7EA 1P4BL 2IDUA 2C3HA 3EJQA 4FDWA 5DWPA 1JGEA 1NCBH 3H55A 2OR9H 3AT0A 1CBVL 2N7AA 3ZKND 3SBRA 1OO2A 4WEEA 3M17A 1EIBA 1B0RB 1JV2B 1QFWM 5DUBB 1AQKH 3OSVA 4PJCA 5D1QE 5D4JA 4WEBH 3WNMA 3C09B 4DGIH 3PV7A 3MV7E 2Y69B 4JG0L 3R06A 4JFXA 2TRHA 4YDKL 4Y5XA 1EO7A 1H6FA 2Q2LA 2HJKB 3BVXA 4M61A 4F93B 1A9EA 3DIVA 3W9DB 4ATTA 3I6LD 3OGCB 2PW1A 3UCRA 5I30H 3MZTA 4LLYB 4L9LC 1DBAH 4DP6X 2V7NA 2VJ0A 3CQFA 3D4GA 2E7DA 4I3RL 3SE8H 3U4EA 2NY4D 2UX7A 4U49A 2JIXD 1JBJA 3QQ9D 2EDMA 1JPTH 2YARA 3QWOA 2EDKA 3HHRB 2XTSA 1NPNA 1SMOA 3R0MA 4FQJH 3QDGA 1BEYH 1E9PB 3F7VB 2ZX8A 3M1CA 3TNNB 3ASNB 1DANU 1OCWH 2GITB 1VA9A 3BAIA 3VFNB 4L3EA 4CJ0A 3BZ4B 2A6IA 3ULVF 5JDSA 4WKZA 1WICA 3ES6B 5DVMA 2FTAA 4JM0A 4CRPA 4UM9B 3ZE0B 1R3KA 1CIUA 1SYVA 5C6TH 3MRBA 3VO0A 4K9EH 2QGDA 3LNIA 4U6YB 2IQAA 4AENA 4AGPA 3CQQA 1C5BH 2Y7LA 1Q0EA 5JIHA 5MI0B 3FQTB 2OJ1A 1IGML 2GSIA 4G11A 4LDCA 4TQPA 4MA1B 1TTFA 3L4ZA 3JWNE 3N44B 1WGOA 5DDHB 3FMGH 2HKFL 1CDCA 1YY8A 2V9RA 2XV3A 5JPNA 2H0PA 3DO7A 3TN0D 1HI6B 3SPGA 3OR7A 1RZKL 3M07A 1XCTB 1JFQH 2APFA 1BAWA 2WVVB 3PP4L 4CMHC 2EJ1A 5FB8B 3L08A 4JDTH 1GVIA 4DVBB 4YHOL 25C8H 1NANH 1A7NH 5F3FA 4UTAA 1E4XI 4PREB 3W0WB 4UTAH 1BYOA 1A7QL 5B1KA 1CR9L 3LMJH 1IMHC 5G4OA 2WLYA 1CDIA 3I6KB 3Q1EA 1P2CA 1T04B 4YMPA 2BNQA 5SWQA 2J8UF 2J1XA 3BUBA 1U3HD 4KTEH 4QKXB 3JZ7A 3ZO0A 1W15A 3WIFB 5D7JB 5D93B 2ADJB 5F1IB 3T3MF 1J05A 4LSSH 1TCRA 2OL3B 3BFQG 4PJGB 3KJ6H 4AM0A 4YDIH 5FA3A 1SGKA 2CLZB 3PFQA 4G72B 3TBWA 4JFQB 1PQZB 2X40A 3ZL2A 3BVWA 6PCYA 1WIPA 2F9BT 4KROC 4RGNC 1BQLL 2AK1H 4PY8J 3H56A 4PIRF 3QHFH 1T66D 3H3KA 1JDDA 1EZSA 1SXBA 4AL8L 3PXLA 4H0GA 4XCEB 3ORJA 4NZRH 5GZOA 4N24A 1OT4A 4HWZB 4D8PA 2DQGL 1KLFA 4M62H 1GOHA 3GZOA 5I6LA 2ZKWA 1V54B 2MJWA 5FDYA 5I6OA 4Y9GA 2IADA 1BFTA 2ZP0T 3B4NA 2ZJSH 2ZUSA 4FQLH 4NUQA 4PJ7B 1INDH 4LKCA 4MHHI 1IAKB 2W65A 1QSVA 1UZ8B 4X7CC 5D1QA 2SODB 3BPLB 3C8KB 1JRHI 1YEKL 2HFGH 2VTFA 1G7QA 3MRLB 1J5CA 4OCXH 5ESVA 1SLWA 3WIHA 4LIQL 4JCLA 3WEAA 5JHAA 1I9JL 3VXMA 1NAKH 5D4IA 5D7LE 3RUGF 3D52A 4XNBA 1WBXA 3CZJA 4K07A 5BMFH 3PXJA 5KYYB 3GI9H 4U6VH 2H8PA 2BZ7A 4RMWA 5KYUB 2WQAA 3IAQA 4NM4H 1O7DC 2APWA 1RIVH 3GSUB 5C9KA 4IOSA 1KPRA 3GHBH 4PTUA 2AITA 3GMNB 4XVJH 1I4FA 2AXFB 3QI9C 4LVOB 1U36A 3BJ91 1J8HB 1A3ZA 3PWVA 2QZQA 5TH2A 5CGMA 2VLLA 1E27B 2NT0A 3EJZC 5EIIA 2BS8A 3QJSB 3E8UH 3Q48A 2NXZB 5EZLB 5DJ8B 4YAQA 2V7HA 1AGBA 2NNFA 3QJQB 4IRJC 1SUHA 3CFBB 1GGIL 1MAKA 4ONHA 3DURA 3IVKB 3NACH 5DD5H 4N2CA 2CHWA 4LHUA 3NIDF 2VDMB 2X0VA 5KSAA 3MV9B 3O6KL 2VXQA 4NKOB 4QWWD 4R7VA 4PRNB 4Y8DC 5TPWH 3E8VA 4ODTL 2XZZA 2QADC 1M05A 3I02B 3PY9A 1AANA 1I8IB 4UV4L 5DZOA 4H0LC 1AKJD 5EEWA 1NWOA 4CW1B 2CO1A 1EO8H 4HAGA 3DMMA 3GMRA 1UA7A 4PRAA 3A4EA 4ZPVA 3ULSB 2A6KA 2K3HA 4FI6A 5B8CB 4MWFB 1NC4A 5D7SH 1UB5B 3KPQB 1CGYA 3X12A 1VGKB 3MRDB 3OPUA 1GKOA 3HE7C 1KIPA 2V5YA 4FLQA 4HT1L 2W92A 4B9YA 4WW2B 3HZVB 2P5WB 1UKQA 4KI1A 4JFZL 3IGKA 1DUYA 1A25A 1EO8L 4K3EH 3MJ7B 3FQWA 4G43A 1RUKH 2YQBA 4AC4A 2YQ2A 1F4XL 4BSJA 4P46B 3H6JA 1WBZB 3NZ8B 4IMKA 1MCKA 4JFDE 3WDIA 4OZFA 2EZ0C 2DIAA 2SEBA 4F5CE 5F97E 2OTUA 1TR7A 4HEPG 1TKWB 5AWNH 3L3GA 4ZMTA 5I18H 1KYDA 4KKNA 5G5DA 4E9VA 2FBJL 2R2BA 4DP8X 2DM2A 3KPOB 3WNLA 4K71C 1SBBA 1JZGA 2OMTA 3CVDA 4KJWD 1VACA 4WW2A 3QRGL 4PGZA 4G7RB 1QRNB 3SD2A 4OGYH 4MJ4A 3S3JA 3FO2A 5I0YA 3I3DA 3R7QA 3WUWB 1TNMA 2DJMA 2R1WB 4A6YA 3WOVA 2XZQH 3L3IA 1OQOA 3U0WL 3MNZA 1TZIB 4C56D 5I1LA 1I85A 2H3KA 4P2RE 5DR5L 1WE5A 1OPOA 4N90D 1YMMD 3WIHL 3MI6A 5HYFA 4NRXB 3VSUA 3QQ4A 1ACXA 3CN2A 4GLRH 4P5KB 1LGVA 1IAII 4QRUB 3MBWB 1RZFL 1E5ZA 4LHUB 4OZHB 4ONFH 1I9JH 5BRZB 1QPKA 2YN5A 2WB7A 3IVKA 4YUEH 4ENEC 5B7EA 3NSDA 4W9GC 4IM8A 2XQBL 2V0AA 3DBXB 5CSGA 4NO0A 4BBWA 1WFTA 3L5XL 3KJ4C 4AG4H 1XEDA 5G4NA 1VFBB 5DVNA 4DT2A 1P7HL 1IBHA 5D7HA 2X09A 2UY6A 1CVSC 1FNAA 2O5ZH 3IU4L 1AS8A 1BIIA 4JUTA 3TO4D 3MLRL 2XTLA 3OKDA 2PO6B 4YE4L 2Z92B 3TNMB 4L2YA 4ZFOA 1ODUA 3QCVH 1IKOP 3FT9A 4NNXB 3F65A 3IGAB 3C6SB 2KLSA 4KMQA 5C7XL 1JMZA 2BP8A 2ZYRA 5CN1A 1EEYA 3U9UB 3E9UA 1NTDA 4KUCD 1N64H 5EUKA 2FJGA 2JNZA 1MWAA 5GHWH 3UDWA 4XNUL 2H32B 2JJSA 1IZJA 5E2UH 1L3NA 3U30B 4DOHE 1RV6X 5IBTH 3BPOC 1QUNB 2G2RB 1KPVA 4L3CA 3UYOD 3CN4A 3QUHA 3DI3B 1B4TA 3VI4A 3VSVA 1U0QA 2H6PB 1AGEA 3TGXA 3PWPE 4KTGA 4G7VL 4KK8C 3D3VD 3OKOB 3LTVA 5CJQL 3S35L 1HT6A 2MTAA 1BYPA 2FR4A 3MLSH 4CVXB 4M7LT 1I8KA 5AAWA 1AMXA 3F6JA 1SUJA 1GYCA 1S7RB 1M7XA 1T2XA 3KLHC 2JCCA 3VTMA 1U95B 4PRBB 1CT8A 3H1ZA 3AWFA 4TQ8A 5CD3A 1W72L 3NG5A 1T21B 4NDMA 3WL9B 1XF2B 3NEEA 2EUWA 4FZ8H 3HEIB 1TKWA 5I8EB 2ZYSA 3UBGA 3HHMA 3CX2A 1LEKB 1IM9B 1OCOB 4LAQH 2Z91A 2B4CH 2FX7L 4H25B 3TFKC 3UPAA 3UTTA 5DO2C 5K39B 1VACB 1P4IL 1OVZA 3BAXA 1CBJA 3MJ9A 4Z7OB 3WMPA 5ACMA 3VH8A 3RDTA 2NTFA 4J3VA 2J6EA 1JP5A 2MEJB 1UJTA 2ZUTA 3QIUD 6PAZA 4M1GH 3O41A 1EX0A 5TDNB 3O3AA 5A3ID 1M1XA 3AROA 5JW4M 1FYTA 4PGDB 4NHCH 2JCCE 5KEZA 1M7UA 2FYVA 3EO1A 3NZHL 5EPMB 4RDQG 1N0LA 1N8ZA 5JIQA 3TYFB 3BKML 4NDMB 4LMQE 3HA0A 4JPWH 3PXHA 3TONA 4TNVK 3ARXA 3GK8H 4GMSL 4WFGD 4PP2A 5C0FB 2IVFC 1BZ8A 1BJ8A 1J0YA 4UQ2A 1MWAL 4LLWA 4W9LC 1FZKB 1JUFA 1Z0MA 1YUKB 3FCSB 4OTXH 4OQTL 5HVHB 2C9UA 1MCIA 3CN3A 4TQEH 3DOSB 3QQXA 4FQCH 4KU1A 4LPXA 4WHDA 5KVGE 4NI6A 2IPKB 1MAMH 3LRKA 2WXGA 4UOJA 2VO8A 3HW7A 3QUKA 1AO7D 1BHGA 1QRKA 4HP5A 4XNQA 3RGBA 1LO5B 4PV9A 4Z7NE 4LPWA 3DPBB 2HCZX 5E6ID 1A6VL 2HG5A 1SMAA 2FNWA 2DEWX 4LL9A 2WBJC 4HUKB 4E2OA 1BF5A 4I0PD 4F8NA 4K94C 4MDJA 2MNJB 4K8RL 4AZ8A 4XP4H 1INEH 2C1PB 1PG7W 4PJXF 3R8BB 3VI3B 3DKHA 4P57A 3QQNA 1I1YA 3U36A 1A64A 1YNKH 3FRUB 3NA4A 1QNIA 1RUAL 4YXHL 1H0DA 2AABL 2AJXL 2N7SA 4DO4A 4JEGB 2ZUUA 4ANXA 4AIOA 1R5WB 3Q2WA 2BC4A 4XN9A 5EU6D 4HZLB 3QISA 5F7FA 1T03H 2LU3A 3WTUA 1UVQB 1LDSA 2Q86B 3BWUF 3V10A 1TJHH 1UCBH 1KIUA 2OMZB 3N6YA 4HIHA 1HZLA 4HIEA 4XNZB 4YHNA 1B90A 3NABH 2FWUA 4WU7A 4EZLA 3DVFA 4L1LA 1S9XA 3TZVA 4UNVA 4Z3EA 2Y23A 4TVPH 3K8LA 1UH2A 4OCYH 1NCTA 1ZANH 2XC8A 4L0YA 1OGPA 4AEIH 3MFGB 3FFCB 2WXMA 4FQCL 2FO8A 4E0RB 4NQDB 3SDDC 1H6EA 2GSGB 1JV2A 4XN2A 1VPOH 4YEFA 2X1XR 3UJTL 1RXLA 1AO7E 2X4NA 5J9PB 3MV7A 3TN0A 4KY1H 2UYLB 1JWMB 2R7EA 4G3YH 3G08A 4PRPE 4XP6L 5I75B 3D30A 5FK9A 4ZQKB 3V4UH 2X6VA 1Y1DA 4V33A 3LQMA 1P5VB 1E65A 4URKA 4WW1A 1F45A 4O58L 3SJVA 3VFSB 2BNQD 5C0BE 4WSJA 3ZJAA 4HFWB 5KAQG 1MRDL 4OD2B 4HK3N 1AZVA 2YMTA 3TBWB 2HP4A 2V4LA 1U4EA 3X14B 3MXVH 3S8GB 1P1ZB 4Z7UE 2RFXB 2IMMA 1FA4A 1NCJA 3GSXB 5LGKA 5J6SA 1TCRB 2OL3A 3IK2A 4K2UL 4PJGA 3ZE1F 2VM4A 3CBKB 2WGNB 2VJ8A 4K7FB 1BLIA 2YIHA 3F6IA 5M95B 2XG5A 1CBVH 3IFPB 4N90E 4JGMA 3CBJB 5BV7H 4Y0GA 5BVPH 1MCRA 4H20L 3PL6A 1MQ8A 1WCQA 1PIGA 4R96B 4N1HB 2OMVB 3S97C 3DUSA 4PV8B 2GUOA 4KMTL 2R2EA 4W93A 2CQVA 4XVSH 3P9MA 1G0DA 1MCHA 1F4WL 1R3JA 2YJLA 1BJ1H 3OAWA 4FQXD 5GZOD 3HNTH 2ZG2A 4AUJA 1LP9E 3SJVB 4FC3E 1MXGA 2CIIA 5E4AA 3PAVA 8CGTA 3AB0C 3UEZA 1FO0L 1CQYA 4JG0H 4IIZA 4PP1D 2R2HB 4UV7L 1J8KA 2HTLD 4FTVB 3BKCL 1I7RA 1U8LA 4PJIB 4KHXL 1K4DA 3ZKNC 1KLGB 4HISA 2WWOA 4R90L 5I8KL 3WIIL 3B9KD 1HJBC 4IRZH 1MXDA 4JN2B 4FS0A 1FVDB 3QW9A 4KJYB 4N3TA 3E1ZA 1S7XA 1V7NH 3FZUD 5K93A 4IRZA 4FEMA 1Q1JL 2KC0A 1RK0A 5E2VL 3D07A 4BKLB 5L6YH 3RJOA 4BXVA 4LVOC 5FO8B 4U3CA 4AQ1B 4POYA 4UQDA 2FJHB 3GSUA 4X99A 4NZUH 3D33A 5DU7A 1E5CA 1UM6L 3OKLB 3U46A 2H8PB 3GXPA 1JXDA 3WTWA 3NGBC 5C0ND 3V6OC 1FPTH 3MYZA 1RH8A 1ZHLA 2ORBH 2FNBA 3BC9A 4ZZKA 4ZW6A 3RVUD 1M6OB 4BFKA 2D3VA 4K2UH 2OSYA 4U7KA 4G42A 4NHUB 3CC5B 1KBPA 2NY3B 4BZ2A 2QADB 3BGMA 2PYEB 5GISH 1NIFA 5ABDE 3GJFH 3OGCA 3F7LA 4NFCA 4ONOA 1QBML 4WTZG 3SQRA 4H5SA 4JFFE 1TVDA 4M1DH 1I1YB 4N1EA 5E9DD 3HBZA 2R1XA 3ULVC 2IMNA 4Q6KA 1QFUH 3V4PL 4WVRA 4HEMA 1U3HB 5ANHA 2MQ0A 1EUTA 1GY1A 1EBAA 3TT1H 3KPQA 4GOSA 1MI5A 4M1DL 2BX5A 3NPZB 5E4IA 3MJWA 3ZHLA 3JYCA 1AAJA 2EDRA 3WEXB 3ZDYF 2VGLM 1UXWA 1PLAA 4HCGA 3VFGH 4OLWH 3SBWA 3KYNB 3IMBA 3VWKD 1BFOB 1JF5A 2CRIA 1KZYA 1UUNA 4LDLB 3QJZA 1JN6B 1XSJA 3QHTC 2D31A 2AI0L 2UXFA 4NYLB 3RRQA 1IEBA 3S8FB 4DK6A 3RNKA 3BVTA 5LCVL 3CSYB 4DEPC 3ARDA 4OQTA 4PHZA 4ABUA 1IJNA 2WPGA 3US9A 1QSED 4R7NA 3LZFL 1X3DA 4HA1A 5J3HD 3BZEA 1Q9OA 3ARYA 1HINH 3MLVH 1TUPA 3DTUB 3WTVA 3KJ4B 3QORB 1F11B 3SQBB 2AEQH 3MROA 3VB8A 4BRVA 1SN5A 1KXTB 4L1HA 4JR9H 3KEHA 4F15B 1PY9A 1KCUL 1X4ZA 5FYKU 5AZEL 4N8UA 5EBMB 4BFIA 2VW7A 3L48A 1AO7A 3ZTCC 4AMWA 1LMKA 5HJ3A 1IU1A 4CMMA 3CVCA 5TDOA 5CCKH 1AXTH 2AJZA 5IROA 1ZIBA 3NA9L 1Y6KR 3TCLB 2EIJB 2CNYA 3NCEB 5KS9E 4WCYL 1Z9OA 2WMPA 3GMOB 4JPSA 1AD0B 3V0EA 3FQTA 4LSUL 2ED6A 3G6AB 2FJFA 3PDDA 2PWEA 2YPKB 4KJQD 4TUJA 2Y1ZA 2HMIC 3ELQA 3ZX1A 4WO0A 1IM3B 1TITA 4UAHA 3N1PC 4NHUA 3CHPA 3WTTA 3GSNL 4N2AA 5BOJA 5E8NB 2GITA 2ZSVB 3RIAK 1OLZA 1KN4H 1ZKAA 2C4FU 3ALPA 4FFYH 1FLRL 4NUPA 3QWOB 5I17A 1OAQH 4EOWH 3MUHL 5FKPA 1A7RL 1DDHB 4E41B 4LSRL 5K5YA 2C3GA 5IFHH 2J8OA 2VXTL 3WEOA 2K0RA 3DGCR 4Y9BA 3KWXA 4YBQC 4OSUH 5E2WL 4ADGA 1MFAL 1UWXH 4NNYA 4Y1SA 3IJHB 2R2HA 2D0FA 2HWZL 4PJIE 4NOBA 3FQ1A 3HZMA 3X3FH 3G5YB 1HSAB 4WHYH 1LQBC 2J8HA 2J1KA 1R6VA 2WKOA 3OAYK 2E8ZA 1P6WA 1EEYB 1UZ6E 3ZRSA 4D0BA 3V0IA 4WO4B 4JFQA 4ZQTA 3ZYOA 1E6JL 5TE4H 4KO5A 1S3RA 2UY7B 5KSBE 3D9AL 5EBMA 3VMOA 1HL8A 2Y7QA 3DLQR 4GRLA 5ICXB 4L9LB 4NFDA 3FTGB 1XGQB 2BVQA 2A0LC 2WY3B 3H7LA 4W9IC 3V7AE 5SWSD 4FL4B 1A22B 1KCBA 3QJFB 3ATEA 1JNNH 3GRGA 3P73B 3MXWH 5JOPE 4NWUH 3D3VA 4XNDA 4L8DB 4FYTA 2Y5TB 3GMQB 4N0FB 4NZ8A 4KXAA 4GMTL 1OARH 1S9WA 4M43L 4XMKH 1C5CH 4DVBA 3N41B 3ME0B 1EJOL 1SYSB 3PREA 5GS1A 2E76C 2KQNA 2R29H 4UUJA 4WV1B 3N3EA 3UYRL 1X6NA 1MEXL 3BUYB 1QASA 2R15A 1BFOA 1RMFL 4IEFB 4PRHD 4Z5RA 3LS5L 4J27A 4N1CA 4MA8L 2K9FB 2RJMA 2HUHA 5EB9A 5EOTA 1Z7JA 5JR1L 4AJYV 1OEZW 1KBWA 4IU3B 1NMCB 4XXDA 1KEGH 3SSGA 2VKXA 1ADQL 3CU1A 3KLAA 4WEMB 2QKIB 1NCCH 4LLUB 1A5FH 4WGVB 4PJAB 1JTTA 4JFFA 4U1HB 4G7YL 1E2VA 1PX8A 2ITDA 3EOBB 5TF1L 2O5ZL 3Q43A 3OKKB 5I75C 2ADIA 2QDWA 4YFDB 1QYGH 5K1JA 3ETBF 3F12A 3KYOA 4AQAA 4XX1E 3SO3B 1K8DA 3GB7A 1XAKA 3VDAA 3GJEB 1LEGA 1T4KA 4KHTH 5IQ7L 1H3PL 3MX0A 1RPKA 1ZEAL 4RGOH 4ZUWA 2WM0A 2OMZA 4HIHB 2F58L 3W3BA 3FT2A 3AS2A 3T6WA 4UTCA 5AWNL 4XPTH 1CXKA 1EZLA 4WUKL 3PFUA 4BWWA 3HKFA 3QK0A 5JXAL 4FNLL 1S7UB 4JHAH 4EO5A 2AV7B 2NY2D 3OJ2C 3RTQC 1MJ7L 3VYNA 4XPFH 3SKJH 1NDGB 4CSPA 2GJRA 3DIDA 1N5AA 5HHOB 3O2VH 4I1RA 1UEMA 2AHIA 2AP2A 4UT6A 4OZIE 4ANWA 2NSQA 2OCCB 1SYSA 5EFIB 4NC1E 2C3XA 4ZPVB 3V6ZA 2JCCF 3NQKA 3VXMD 1RULL 2E86A 3NFSL 4TSCH 3VXRB 2OX5B 2QQLL 2VDLL 4GMSH 3ZYZA 4DCQA 2CG9X 3ASOB 1H8LA 1JGLH 3U0TB 3RVUC 3H0TA 3FRUA 2VDQH 3EYVB 4IOIA 5DJYA 3OAZK 1U8PA 5T5FH 3V0HA 2XWCA 3WDHA 1VFBA 1GS8A 1NCDL 1RIUH 4JFOA 4NKOA 5EF2A 2QPFA 4HU8A 4HMEA 5E8OA 4Z76B 3L3OB 5D2LE 3AACA 4NJ9H 3Q6FB 4PRHE 1WPCA 4JY4A 3K6NA 2B59A 2NY0C 4QRUA 3EOYG 2NUPB 1CWVA 1DEEB 1A1NB 1GHFH 3B9AA 2W0LA 1U91A 2R69L 3ARFC 2WQVA 3BAEH 3JV4A 4KI5C 5C0BA 3JVGA 1DQML 4P4KB 3FONA 4ENZA 3EGXB 4DCQB 1LO3L 1GYUA 3LZLA 4X0KB 3MCKB 2ZUQC 3LVTA 1SJXA 3AWGA 3QARA 5HDBE 4MMYA 3V55A 3CDGA 2LVEA 2NNCA 3P9LA 2VXUH 4XXWA 4MJHA 1MG3C 4WTZA 5CLTA 1F4HA 2M1KA 3BUIA 4BH7A 3VAEA 3P30H 4Z7OF 1LNUB 3WTYA 3MKKA 2ZAGA 4JHZA 4K94H 4JFHE 4U1IB 2HKAA 2YD9A 3GS4A 4X8CA 3SYAA 3ZT7A 5CCGE 3MV7D 3GLDA 1J11A 3DETC 1UOWA 1NGWB 2VSDA 4D3CH 5JIMA 4WIQA 3U6RA 2CALA 3ENEA 4LGRB 5TK2A 1K8DB 2IBGA 1N4XH 3GB7B 4C4KT 1BFVL 1ZV5A 3L1EA 3DHPA 3EJZD 3ETBJ 1YYMH 3F12B 1Z5YD 3C5JB 1EFXD 4DQOL 4A38A 4PCYA 4IIQC 2DQFA 3ESOA 3FRPG 3FFOA 1YEIL 3ILPA 4JPIA 1KTJA 3GPEA 3QIWC 1I8KB 5TQ2L 1EHLL 2FX8H 4BH7B 3TFKD 4NQXB 3S3DB 4BA0A 3RJQB 5JOEA 3UP1A 2B16A 3I84A 3SYOA 1XVSA 5EUOE 1QPXA 4NEHB 1T21A 4RMBA 1LVEA 3A5VA 5CJQH 1UD3A 3S35H 3IGLA 1YYLH 5C07A 5I73B 1Q90A 4ELDA 1YCSA 4M6NH 1TXKA 3QFJA 1HYRC 3EJCA 1NSNL 3HBPA 3PL6D 1NCBL 4N26A 5IMKA 4Y1AE 1BLNA 4GRWB 2Z31D 3AUVA 4TNGA 4F7MB 1HDMA 1PJWA 4LRIA 5E6SB 4UDUA 5EORL 4U2ZA 1UCBL 4IRJA 5HHPB 1RIHL 1NCAH 3PJNA 3V6FB 1ZGLA 1QSEB 3RAJH 1Z9MA 2NY3C 3MRCB 5IQLA 3Q6FA 5HYEA 4Y7MA 4JHAL 1BZQK 4Z77B 1T0NA 2EE0A 2FT7A 3QUGA 2HT3D 4J2XA 4MA3A 5DEGA 4ZTEA 1KIQB 2QSQA 4FLRA 5DUJA 3T1FB 4CADB 3G6DL 3IBEA 4PJEF 5EUKB 2E47A 5DJ6B 4ZMAT 5C6WH 3CDZB 2EO9A 2ENQA 3F7YB 1ZA3A 2BWDA 3I85A 5HYJE 1O75A 3RA7H 4B41A 3EADA 2HT2D 1VHPA 3H9SE 2VQTA 3FONB 5FC9A 2XBTA 3GBEA 2PO6A 1MPAH 1OGAA 4TLKA 1PD1A 3VXOB 4NRZA 5DJDB 2ZUVA 2UY6B 1JPGB 3LAFA 4F3FA 1PZUB 1AXSB 1ZLDA 5DFTA 1HWGB 3L1OL 2OJZL 4UM8B 4NKDB 1G7IA 5DEGB 1GTFA 3EYFB 5IVXF 3O2WL 3I9IA 3BGMB 1KG0A 4PN6A 2VDNH 1NGPL 1A65A 1D5IH 3RU8H 2CBTA 2ZKHH 1TTCA 4AYFB 1KY6A 1UKSA 3PAZA 1U8PB 3TL5A 4IHOB 1ODAA 3H9HB 4EI5C 5DHDA 5ID0B 5I9QC 4LEEA 2XRAH 2CHZA 4XI5D 1B2WH 1L6ZA 2ZXBA 4QOKA 2VR5A 3UTTE 1KGXA 3FU8A 4HJGB 1ITBB 3V5KA 2GJ6A 3KR3H 1TNNA 3C12A 2ID5A 3QZLA 5IHZB 1PDKB 3NJNA 4M1GL 1RZIA 2BRRH 1DZ0A 3ARGA 2DM3A 3MBED 4PJCF 4QXTB 5DRNB 2J5WA 1SOQA 2WWMC 4GBXB 1KN2L 5D96C 3T9WA 3ZL4H 3O0LA 2XKNA 3EFDL 5DJCA 1HFUA 1K5NA 3CFJA 1DE4A 1CGWA 3FF8A 4I5BB 4XCYB 1BP3B 3EJYD 4XN7A 3BZ5A 3EUUA 1U8LB 3ECQA 4PJIA 5HGGS 4GKNB 3IDYC 5DUML 4Z3FA 2XY2A 1PNCA 3M86A 3FYEB 4OLZH 3MFFB 3PU7A 4B27A 3JWNG 5E00B 3UTTB 4IBUA 3DVNA 2NW2B 1NFIA 4P5RA 3UBXA 1WAAA 1PZCA 2CM6A 1JWSB 1XGPB 4MSWA 3R8QA 5L7XH 3FL7A 1CG9B 3JTTA 4CC1A 3WEBA 1AYOA 1SXNA 2HLAB 2NX5D 2R0WH 1CZ8H 1XBDA 1Q9OB 1MW3A 1OCWL 3RL1B 4LSPL 1MNUH 3O11A 2H1XA 3L8QA 1TCMA 5HJDA 3FT4B 3O2DA 4B9PA 2AGJL 3QIBB 3W37A 2X6BA 5I0ZA 2EXYD 5J6GB 5L4FA 2H2SD 4R7DA 3OKNA 4RIRB 4X5QA 2OR9L 1USZA 5F0PB 2DMGA 2XNAB 3LPFA 5D7IE 3TXAA 1IBDA 5GZOC 2PP8A 1FZMB 1KN4L 1UOKA 2I60H 3QQ3A 4ZTOH 3OF6A 5TE7H 4Y2LA 2WYZA 4RISH 5CHNA 1RJLB 1JSYA 3VXRE 2A73B 3VFGL 4DVRL 2YC1A 3MR9A 2J21A 3GHPA 5IEHA 3G5XB 2R9HC 3LH2L 2LOEA 3QUZB 1Q9KA 1SHXA 1BQUA 4YSRA 2WBKA 4BZ1H 1WV7T 2KUTA 1KNOA 4A68A 2QKIC 3VFTA 4NC0B 2BIOA 3FXIC 2DYSB 4G6MH 2QHRL 2ZXWB 4JN1L 4IRSB 3UTPD 3QIUC 3K2KA 2YKKA 1Z6JT 2X4NB 1MY7A 1TQCB 4NUGL 4WSGA 3FB7A 1E6JH 3MNWB 4G8GB 3INUL 5TE4L 3C75A 2LTQC 4KUCF 3R7RA 3MRPA 3D09A 1G7JA 3PGCA 4GS7C 1MIML 3RI5F 4CVZB 1KB9J 3I3EA 5IB5A 1BXAA 3MJ8A 1E3FA 1TVHA 4XNZC 3HS0A 2O93L 2YA1A 2FWOB 1O0VA 4K5OA 3S34H 1BZOA 4UI2A 5LCVH 4PCTA 1ZHLB 5AOIA 4JREC 2AI0H 3ZHDA 5JHDA 2Z7YA 4Y9CA 3WHE0 3SE4C 2WZPD 1BD2B 3UPRA 4KTEL 4PS4H 2ZJSL 4W6WB 2NYKA 3UIYA 4I3SH 1ZWIA 1NBYB 4HZLA 4V1DD 1NLBL 3P4OA 2BIPA 1FGVL 2EDWA 4XCCL 3PJSB 2IPUG 1T22B 3EOAA 4R4BB 3Q8FA 1WFOA 3MGAA 1XIWB 4M62L 2DQIH 1PZAA 2AXGB 2B5IB 4ODUA 2AKRA 5F2FA 3PUUA 4GUCA 3FB7B 3OMZA 4JRXE 3GBDA 4HGKC 3GM0A 5BW7A 1ILUA 1Y1UA 4C83A 2PCPA 1BIHA 4YSUA 4JR9L 3BJLA 4R3SB 2J2ZA 1IKNC 3LKOA 5DSCB 2JXMA 1IGYB 1IILE 4FTVA 4XWOD 3GTVA 3T0DA 4AM0B 3BP5A 3IDJB 3UG5A 4J1UA 4KHXH 1KEGL 1EERB 3PAUA 2ZX9A 3JTBA 3BT2L 3TYGH 3T77B 4DN3H 1KEMH 1GMIA 2ZNXA 3IFNH 3BMVA 5DZLA 4NOFA 4GAGH 3RBGA 4BGDA 1Z3GH 1E40A 1JIBA 2GK0B 2X89D 1RJLA 1GPOH 3OB0H 4N2DA 3V9FA 3VG0L 5IBLD 4HT1H 4A7GF 5C0AA 2F53B 4A7GA 5DLMH 2OI9B 4C58B 1PSKL 5DZNA 1JAEA 4PI0A 1WT5C 4JFPB 3OPZL 4L1DA 3GXNA 4GI9A 2ENPA 3HZYA 4XPAL 4Y2DD 5C0GB 4QRTA 3OXRA 2PKDA 2QPUA 2DEYX 4NKMB 4A39A 4NZDA 4FABL 3RIKA 5BQDA 1GYAA 4PJ5B 2WCGA 1ZVSB 2O61B 5HSFA 5E99H 2Y5TA 3GMQA 1JNNL 3P54A 1NANI 3EJTA 5KBLA 3ILQC 4S2SA 2F15A 5I1DA 2WJ7A 3IXAA 5F0JB 3BH9A 1W80A 5LAPA 3HUJA 1IVTA 1YJDH 4MSWB 1AE6H 4HJJL 1FE8H 1QW9A 5EUOB 4HOZA 4BIKA 2AZAA 5D2NA 2HZHA 3BVDB 2P9RA 3DYPA 4AENB 1LLAA 2IANE 1RK7A 1S7QB 2F53A 5C0AB 3VGFA 5D4QA 1FZOB 2COQA 2NZIA 1UFGA 2DQ6A 4Y1TA 4TUKL 2NY0B 2J12B 3B7UX 1XT5A 1IBGL 3FC8A 3QUXC 5D6DA 1M6OA 5EU4B 3ZVVA 3V4PH 4Z7WF 3B9EA 4QO1B 4XP1L 2WO2B 2VXTH 3HRPA 4NN6B 3PJSA 4R4BA 5C1MB 1SLVA 3SYCA 1JDAA 3TVMA 4Z9KB 3EYSL 2N3JA 2V5RA 4X50A 4PUBL 3WFDL 2QV4A 4PJFF 1F41A 2UZPA 1YRKA 3KPPB 4NLAA 4GQ9L 4C83B 4LLYA 3HBQA 3FOMA 1BFSA 5FUCE 5A2LH 5JZ7C 2BNRB 2WUCL 3FQ4A 2QR0B 3DRTA 1M71B 4AV5A 4O2CB 1T22A 2WXIA 3EFOB 43C9B 3B2VH 4BSVA 2DDQH 1MWOA 1QP1A 5DWUL 5HI4D 3QEQD 4L4VE 4F9LA 3ZZSA 3MSPA 3GJFA 2AQPA 2UZYB 4DK5A 1KBGH 3KWWB 2X28A 2W65B 2AJUH 1AZUA 3L9BA 4H7VA 1EJFA 2LAGB 1DCEA 2P8LA 2RA1A 4IS6B 3SIKA 2QV2A 3WS6C 4LPTA 4LLMB 2H2PC 2W9EL 2VR9A 3X13B 3BLBA 3ARBB 5J8OA 2PPAA 3KVDD 3TC9A 3PRZA 5GIRA 1Y0LB 3OR6A 3WXWL 3FCTB 4PS7A 5IHWA 4FXGC 1CFQB 5BV7B 4LARH 3VWKB 2FQGA 2WWMD 2Y3AA 1ZTXL 5EOQH 1RU9H 2EDHA 1U41A 2QHRH 3QRLA 3QG6A 3V4LA 2HX7A 1WO2A 4Z7QF 5SX4H 2K3TA 3E9TA 4TOYH 4Z3JA 2LW3A 4N0CD 1BPLB 2YLKA 3B2UC 3MYJA 5FUZL 5B1JA 1HEHC 4OJCA 4BDVA 4CILA 1JCKA 2CPCA 4DKDC 5TGBA 4JG5A 2E7BA 5C9JA 4FQIH 3D39B 2X9WA 2B0SL 3ARSA 3HB3D 5BNXD 4HWBL 4ZYKA 2HKHH 1G7LA 4YVNA 1ASPA 5I1KL 5ALBL 4O2FA 5LBSH 1IIKA 1XGTB 3IGUA 1B4LA 4BFGA 4P5TC 2WSPA 3EKCA 1NJ9A 4MXWL 3KYNA 5AD0A 4JFED 4P23A 1HNFA 1RU9L 4DFIA 3C9NA 5FF6A 4BE5A 4HHWA 1XB8A 5MEPB 4K8RC 4PYGA 1NM9A 4JK0D 4D0DA 3GMLB 2VH5L 4GXFA 4U2YA 1Q1JH 3QULA 4CKVX 1CE1H 3L45A 2FHCA 1OTTC 2VAAA 3O6FC 3VM5A 3HRZA 5E1HB 4RSYA 2X9XA 4JDZA 4DKFH 4TL4A 4NHCL 4WUUE 5D96B 2F8XC 5E9DB 3TIDB 3O3EB 2ED9A 1X4YA 4OGQC 5IOKA 2BVUA 3MA9L 1Q0YH 2W9DL 3AC0A 3X13A 1AHWB 4TYUA 4U1LA 2BCKB 1A7PL 4P2QD 1NKRA 2VDKB 3CZLA 2A0LD 2ICCA 1WFJA 3WE6A 4XO4A 1AGFB 3JWDC 2WXHA 2HA1A 3S7GA 1KELL 2XVKA 3NJXA 3AG4B 4ODWB 3FQUB 2JJSC 4EEEA 2B4CL 1D6VH 1GOFA 3B9DA 4HUMB 1I7ZB 2AJYL 3AFLA 3R4DA 1ROWA 4WI8A 1DQQA 8PAZA 2YD0A 1MAML 4F7CB 4YDLB 4U1GB 3OZLA 2ZUYA 4GRMA 3WENA 5JO5B 3MRFB 3QVAA 5LO7A 3L5JA 1I1AD 1NDMB 2A6JB 3D87B 2CRYA 4UDTB 5EU6A 1R1CA 1OWRM 4Q74A 1YEGH 3KVPA 4XMLH 3BX7C 3OMIB 4S1DD 3T08A 5E8NA 1EZVX 5FCSH 4NLHA 1WHOA 3PQYA 4AVHA 4MQ7B 4BQ8A 1GS7A 3T8MA 1OB0A 1I9EA 1KV3A 4M48L 3UC0H 4ZW3A 1KELH 4HKZB 2I85A 1XMWA 3BSHA 4MBOA 1A6TB 4GUPB 5LAXB 4OZIF 4TPRH 3MRHA 3IU3B 4JQVC 3OG4B 1MFCL 4K55A 4P2CG 3RWEB 5EU4A 1AOZA 1HN1A 3QNZB 1PFOA 2IEPA 5E2UL 2P52A 4HFUL 2HVJB 4KKLD 1FP5A 4QRBA 2DWSA 5DQDL 1C5DB 2J88H 3B34A 5H94A 1N19A 5GGSB 3FT1A 3WY3A 2GBUA 3O9WC 1BSIA 4HAKA 1MREL 5I6NA 1QZNA 1FNHA 1KN2H 1QWHA 4A67A 5GGTL 4FYRA 3CFIC 4NKDA 1H6UA 2P8MA 3F62A 5EBLA 3V6OA 3KDMB 3ZQ9A 5TE6H 4UNTA 2WXFA 3F7YA 1F58L 3OBAA 2FH6A 2GHWB 4Q9QL 3G04B 4H40A 1T0OA 3CSPA 1T2QH 2X12A 2LTQB 3FT3A 5CGYD 4HG4K 4QYOB 5IM7A 4WW2F 1XCQB 3NCWA 4K9EC 4XOCA 3RTQD 1C5DA 1ROCA 1BZ9A 2Y5QA 4PEEA 4HJ0C 5IB2A 1V05A 3PABB 1B2YA 3ATFA 3BKMH 3QS2A 4JZOB 4A7SA 2PMZA 4R5XA 4ZUUB 5JPNC 2NY5H 2BWIA 1KJ3L 2B3RA 3HLAA 4GG8B 4X7FC 3KPSB 1ZDSA 2F7PA 1WZMA 1MJ7H 2F0CA 1L3WA 3LV3B 4HUCA 1DJWA 3X14A 5AB2A 1MHHB 5HDOA 5C70A 3T3ME 3C60C 3HB3B 1MKFA 1GW6A 3D34A 1R9FA 2VE6B 1FNLA 1YN6A 1X5MA 5EIVA 3QDJB 5F7EL 5FYLL 5E03A 3MTXA 4HHAA 2BK8A 3KPRB 5A3IC 5LDSA 3HE7A 4YR6B 1QSFA 2QFRA 5GZND 4AQAB 4D9LH 1EUUA 1YYLL 4JPWL 3F64A 1VZIA 3C6LA 1OQXA 4P9HH 5DD0L 5FWRA 3V8CA 4Y5YA 3M1OA 5FGSA 5ANMB 1X5ZA 1R46A 3FSVA 2IO5A 3C5JA 2HLAA 3IS0X 4FFTA 4JFFB 3BVNB 1K8IA 3UOAB 1TQCC 2F19L 2UUDK 4MMXB 3KLAB 5I5IA 1BYNA 3V79C 3KYAA 1WCBB 1M1XB 3RY4A 4IK6A 3N41F 3FFCA 3MODH 1F8TH 3OKOA 5DS8B 5DYOB 2AVGA 5I1CH 2WKGA 2VDML 3MRMA 2YAMA 3OB8A 3QUMB 1WBYB 3BFOA 4W9ZA 1KGJA 4MA1C 1ZOXA 4PLKD 1E5BA 1IFRA 1P4IH 3ELAT 5F71A 2C9SA 4ODXB 1QBBA 1EXHA 5A6LA 1EAJA 1QUNA 2G2RA 2NY7H 3L7FA 5EU7E 1SJHB 5D5ME 2FAUA 3RKDC 2C7FA 4OJEH 5D1QD 3Q9PA 5BZZA 1G4MA 5IFJB 5AQ0A 4OU3A 1XR8B 1F1AA 2D4DA 3ZE1E 3HVDA 2BVEA 2EH7H 2Y7OA 1WWWX 1F02I 3SGKA 3D85D 1H0DB 3FHQA 5F6IC 4MXVF 4RNRB 3LRLA 1J7VR 4X6BB 3IU4H 3ZE2F 4IRSA 4DQOH 3QZWA 4HH8A 4HS8H 2MCPH 5C2BL 5ECGA 1DQMH 4NS0A 4JHWL 1U92A 4NRYB 2R0ZH 4X42A 5C0DA 3SE9L 3KBHE 3D06A 3ESPA 1BFVH 1CGUA 2GAZA 1M9WA 2K9UA 4XH2B 2CHNA 1KV7A 5FYKD 5CJXA 5I18L 2CIIB 1F0LA 4U4BA 5IEHB 4OFVA 5B4MC 2DMBA 3EFDH 4IOIB 5DJYB 4JFSA 1U93A 1PAMA 2R39A 3GO1L 1T1ZA 1DR9A 1TVBA 3LYRA 2VNCA 4AYMC 2P7TB 3F3HA 4LU5L 3P30L 5DO8A 3EH1A 5IT2L 3T0BA 2YPVH 5E5MA 2JLLA 4M7JL 3CE1A 4ELKA 3BP7A 3OSKA 5ICYB 2XRAL 1MVUA 4O2EA 2VQ1B 3WFHB 3DBXA 2BSSB 3W2DL 2XPZA 1L9QA 2A9MH 2XI9A 3DX7A 2YPVL 2DWDB 1LE9B 4AEHL 3CMOL 4MD0B 4P3CL 2WANA 1FRGL 3VXPB 3JWOL 2WLZA 3SHSA 3KG5A 1NGPH 4IBVA 4F37K 1E6OL 4HFWA 4P46C 2QEJA 4QRPB 1CXHA 1Z0NA 2BCMA 1MFUA 1E3ZA 4X6DE 5FO7B 3K81A 3VM7A 1EFXB 2XDHA 3LRMA 1IM3D 2Z6FA 5A43C 2YGQA 3BD5A 4WSKA 2FECI 1E28B 4E9WA 1JZ2A 4KKAC 3GZKA 1HXMB 3BAKA 4RDQF 2WLKA 3A6BL 2L7UA 2VXQH 1J1PL 1IX2A 3ABKB 4CNIB 3DX8B 3U9PH 4MJIB 4KKBC 5I8CA 3RWCB 4KTDL 2WLHA 3FTSA 4F1ZA 3JV6B 3JVGC 3HC4L 3Q3GB 2DYRB 4FZEH 1AQHA 1R3HA 4X5PA 1B0GA 2LU7A 4H26B 3EYUH 3WO3B 2FT6A 2P80D 2QQLH 4X2UA 3STLB 5B8CC 5IVXA 4GG6E 4PRDA 5I1IL 2XOTA 1LO0H 4A63A 5CUSL 4LOUC 4FG6D 4NC2B 3SOTA 1TU2B 1J05B 1PFCA 1VB9A 3I6LE 4HXAH 1XHHA 4AC2A 3UJIH 3EGDA 3R0NA 2CUIA 1G4RA 1PX3A 1KB5L 1WUZA 5EZOH 1TLMA 5CMAB 2EDTA 1KGUA 3MV8D 1J0JA 1IBYA 3FN0L 2VITB 1WDAA 4OCXL 5EO0B 4FXKC 1UXWB 4WEUD 5DGQA 4FKEA 5I71C 5EZLA 1CR9H 3LMJL 3L4XA 3T8VA 4EI6A 3GFUA 4AIZA 4AX3A 4NQED 3BGFB 1K3ZA 1MCBA 1C9SA 4OBSA 2QL1A 5JHLH 5DHVA 1FGVH 3VI3F 4HPHA 3LSOB 1JF6A 3WTXA 4XNYH 4PS4L 4TNEA 3AG1B 4AZ8B 2ZG3A 4KO9A 2EQDA 1KYOK 3U7WL 3CZFB 3ESNA 1CFTB 5GRZA 3QQDA 4TV3A 3I02A 4RZCA 3C5SB 1HE8A 1ZA3B 4HALA 1R24B 2VXSH 5FM8A 1I1CA 3DPDA 4OFPA 4C4UA 3ZZQA 4CN6A 2NMSA 3RHWK 5MEND 2IQAB 1OAYH 4HKBA 4CDGC 3P0YL 2R1YA 4KH2A 2Z7ZA 3MREB 3VFPA 3DOSA 5AENA 4LF3B 3AVEA 4BSVB 3KWTA 1VJSA 5HY9B 2P5EE 3ARBC 4XMXA 5C97A 5A2KH 4GINA 3ARED 3QDGB 1AR1B 2DQEL 2E27H 2A4EA 5IEKA 4OSUL 5E2WH 3K72A 4Y4KB 2DQJH 4LU5H 1KPRB 4G80B 5J56B 3VFWB 4LSVH 3JWDH 4YHKH 1OF2A 2PYFB 3QPQC 3UPRB 3PNWB 4M5TA 4XVTL 2WKOF 4LCCC 1D5XB 3FBKA 1OIOA 1OY3B 2J55A 1RK0B 1Z5LB 3JT2A 2P5WD 4FQHA 4XWOC 3W9DA 5DUMH 3GKWL 1BQ5A 2B3IA 3BFWA 1KJ2L 5KSBF 2GJ6D 2R69A 2J25A 1AGCB 1JYNA 4JZNB 4I4WB 4KK5C 1FZOA 4XC3H 1NFDB 5IIEB 1HKLL 1BQLH 2JTYA 1UZ6F 5C0RH 4UWQB 1FWXA 4RFEB 2B8OT 1UZGA 1A3RL 4PJCB 3ULUH 1RP8A 2YXVA 5D1XA 5LJYH 1WFIA 5FYJL 3OZ9L 3G6JE 1NA8A 1MNUL 5LXVA 1J0ZA 1R24A 2A9CA 4WRLA 1UM4H 1F11A 3X1NA 1OAKH 3P9MB 2ZXEB 5AW5B 1P2CB 1T04A 3GMLA 4U1KB 4JHBA 5MP6H 2PO6C 4OCMC 4XHJC 4PV8A 4F15C 1M7IB 5A1AA 3FSAA 4U6HA 4YSQA 1M57B 4P23B 5AYTA 3WFEH 2CJUL 3QWQB 5JIKA 2L7JA 2MQCA 4RA0C 1JI1A 3FU6A 2MOGA 4GQRA 1KGWA 4HDIB 2XHNA 4OZHE 5CLZA 1OAJA 2DYPD 3GSNA 4BFOA 3TPUB 4NYLA 1AHWC 1HINL 3BAWA 4BWTA 5BV7L 4OLZL 3T6ZA 1KGYE 3GSNH 1HQRB 1D7CA 5HVGB 1GY2A 4O00A 5JPNB 4AXWB 2BSTA 2F54B 4PWKA 5TGBB 3UTSA 4P2OD 1YY8B 1MF2H 2DMCA 3VX1A 1XZWA 1E5UI 3QAQA 2A4CA 2IGLA 5KN5A 2BP3A 2DQMA 3KPTA 3WNJA 3CZGA 3E80A 2XNAA 2BM3A 1OP3H 1PX4A 4F7TA 4N86A 3MGTB 4YSAA 2DIBA 3KGRA 1XXFC 4KRLB 3ME0A 5E1AB 1DJHA